Issuu on Google+

Harga Eceran: Rp2.500

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Legi, 9 November 2011/13 Zulhijjah 1432 H


No: 23678 Tahun Ke-65

Terbit 24 Halaman


LEMPAR JUMROH: Para jamaah haji melempar Jumrah di Mina, Makkah, Arab Saudi, Selasa (8/11). Jamaah haji sudah kembali ke Makkah.

RAJA Abdullah dari Arab Saudi menyampaikan ucapan selamat kepada umat muslim di seluruh dunia bertepatan dengan Idul Adha, dalam sebuah pidato, Senin (7/11).

Kloter I Tiba Lusa Malam

Raja Saudi Ucapkan Selamat

MEDAN (Waspada) : Plt Gubsu Gatot Pudjo Nugroho rencananya menyambut jamaah haji Kloter pertama yang tiba di Medan pada 11 November pukul 23:15 dan Kloter terakhir pada 11 Desember, kata Ketua Panitia Pelaksana Ibadah Haji (PPIH) debarkasi Medan, Drs Abd Rahim M.Hum, Selasa (8/11). Sementara Sekretaris Drs Abd Rahman Harahap MA, didampingi Humas Drs HM Sazli Nasution di Asrama Haji Pangkalan Mansyur Medan mengatakan, persiapan penyambutan jamaah haji mulai rampung dibahas dan berbagai keperluan yang melengkapi penerimaan jamaah telah disediakan. Misalnya, becak pengangkut barang bawaan jamaah untuk keluar dari aula yang jumlahnya ditambah tahun ini. “Sangat disadari becak barang untuk pengangkut bawaan

MINA (Waspada): Pemelihara dua Masjid suci Raja Abdullah memberi ucapan selamat kepada seluruh umat muslim yang telah melaksanakan ibadah haji, Senin (7/11). “Dari dasar pesan suci dan wahyu, saya mengucapkan selamat kepada anda dan kaum muslim di manapun bertepatan dengan Idul Adha,” ujar raja Arab Saudi itu dalam pidatonya. Raja Abdullah juga mendoakan umat muslim dan para pemimpin negara muslim untuk terus mengupayakan keamanan dan stabilitas bagi warganya, Saudi Press Agency melaporkan. “Ketika keamanan dan stabilitas tercipta, masyarakat berkembang, ekonomi makmur dan umat terus melangkah maju. Masyarakat Muslim hendaknya menggunakan haji sebagai sebuah sarana pembelajaran. Di antara beberapa tujuan besar (ibadah) haji adalah

Lanjut ke hal A2 kol. 5

Waspada/Surya Efendi

LANGIT GELAP DAN TURUN HUJAN SORE HARI: Langit Kota Medan di foto dari gedung DPRDSU tampak sebagian gelap beberapa saat sebelum turun hujan deras, Selasa (8/11). Sejak 3 hari terakhir, hujan deras menguyur di sore hari. Namun, bila siang cuaca panas terik.

Lanjut ke hal A2 kol. 6

CUACA SUMUT KACAU Jadwal Pilkada Aceh Molor Lagi BANDA ACEH (Waspada): Jadwal tahapan Pilkada Aceh untuk pemilihan suara sesuai draft KIP Aceh bergeser sebulan setengah menjadi 24 Januari 2012. “Kami tidak bisa menghadirkan kepala daerah terpilih sebelum masa jabatan gubernur dan wakil gubernur berakhir pada 8 Februari 2012,”kata Yarwin Adi Dharma komisioner KIP Aceh didampingi komisioner KIP lainnya dan Ketua KIP Aceh kepada wartawan, Selasa (8/11) malam. Keputusan tersebut diambil setelah melakukan rapat koordinasi dengan KIP kab/kota se Aceh di ruang pertemuan KIP Aceh, perte-

MEDAN (Waspada) : Kondisi cuaca di kawasan Sumatera Utara, khususnya Medan hingga awal pekan ini masih kacau atau berpluktuasi , ditandai adanya gangguan cuaca di Laut China Selatan (LCS) dalam beberapa hari ke depan.

muan berlangsung alot dan dilakukan secara tertutup dari pagi hingga menjelang maghrib. Menurut Yarwin, pergeseran hari H pemilihan tidak bisa dielak lagi, karena ada penambahan waktu pendaftaran selama tujuh hari sesuai keputusan Mahkamah Konstitusi (MK) dari 3-10 November 2011. Akibat penambahan itu, KIP membutuhkan waktu selama 21 hari untuk verivikasi faktual bakal calon dari pasangan perseorangan maupun dari jalur partai. sehingga masa pemilihan bergeser sebulan setengah.

Cuaca cepat sekali berubah-ubah, dari suasana panas pada siang hari dan terjadi hujan pada malam hingga pagi. Kondisi demikian akan berlangsung hingga akhir pekan. Sementara hujan diselingi angin kencang dan petir masih terjadi dan mengkhawatirkan warga masyarakat, baik di kawasan pesisir timur maupun pesisir barat Sumatera Utara. Hartanto, Kepala data dan informasi (Datin) BMKG wilayah I stasiun Bandara Polonia Medan membenarkan hal itu saat dikonfirmasi di bandara itu, Selasa (8/11).

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 3

Rusia Dan Iran Peringatkan Barat MOSKOW, Rusia (Waspada): Rusia dan Iran memperingatkan Barat agar tidak melakukan satu serangan militer atas Republik Islam itu, yang katanya satu serangan yang ditujukan pada program nuklir akan mengakibatkan korban sipil dan menciptakan beberapa ancaman baru terhadap keamanan global. Pernyataan terpisah oleh Menteri Luar Negeri Rusia Sergei Lavrov dan Ali Akbar Salehi dari Iran sehubungan dengan spekulasi tentang satu serangan udara potensial yang bakal dilakukan Israel terhadap lokasi nuklir Iran sebelum penyiaran oleh satu pemantau PBB yang diperkirakan akan menyiarkan lagi tentang

aspek militer terhadap kegiatan nuklir Iran. “Ini akan menjadi kesalahan paling serius dengan konsekuensi yang tak dapat diramalkan,” kata Lavrov di depan temu pers di Moskow Senin (7/11) ketika dia ditanya mengenai kesiapan Israel untuk melancarkan serangan militer tanpa pemberitahuan. Di St. Petersburg, Rusia, Salehi mengatakan Iran “mengutuk setiap ancaman serangan militer atas negara indepeden.’ Salehi berbicara di samping PM Rusia Vladimir Putin serta sejumlah menteri dari berbagai negara di

Lanjut ke hal A2 kol. 8

“Hamka Sejak Awal Pahlawan Bagi Kami” JAKARTA (Waspada): Haji Abdul Malik Karim Amrullah - terkenal dengan panggilan Buya Hamka- dianugerahi gelar Pahlawan Nasional bersama tujuh tokoh lainnya, Selasa (8/11). Anugerah itu diberikan melalui ahli warisnya di Istana Negara Jakarta. “Kami, keluarga mengucapkan terimakasih kepada pemerintah dan beliau itu sejak awal sudah jadi pahlawan bagi kami,” kata anak ke sepuluh Buya Hamka, Afif Hamka. “Kemudian dari daerah sejak lama menghubungi kami, sudah berusaha menjadikan Buya Hamka menjadi Pahlawan Nasional.” Menurutnya, pemberian gelar pahlawan itu membanggakan keluarga. Keluarga, kata dia, bersyukur setelah melalui prosedur panjang sebelum bisa lulus kriteria. Buya Hamka adalah seorang ulama, aktivis politik dan penulis yang karyanya telah memperkaya khasanah pemikiran Indonesia. Karya sastra pria kelahiran Kampung Molek, Maninjau, Sumatera Barat, 17 Februari 1908 itu telah diangkat ke layar lebar. Yakni, novel Di Bawah Lindungan Ka’bah yang ditulisnya pada 1936. Buya Hamka wafat di Jakarta pada 24 Juli 1981, meninggalkan 11 anak.(vvn)

Soeharto Dan Gus Dur Belum Diusulkan Pahlawan JAKARTA (Waspada): Dua mantan Presiden RI, Soeharto dan Abdurrahman Wahid atau Gus Dur, hingga saat ini belum mendapat gelar pahlawan. Bagi pemerintah, tokoh-tokoh yang akan disematkan menjadi pahlawan tergantung adanya usulan dari bawah. “Karena tidak ada yang mengusulkan keduanya untuk jadi pahlawan. Kalau masuk di Kementerian Sosial itu pasti sudah dibahas di situ,” kata Ketua Dewan Gelar Tanda Jasa, Tanda Gelar, dan Tanda Kehormatan, Djoko Suyanto di Istana Negara, Jakarta, Selasa (8/11). Menurut Djoko, penyematan gelar pahlawan dilakukan dua kali dalam setahun, yakni, saat Hari Ulang Tahun Lanjut ke hal A2 kol. 3

Prof. Dr. H. Abdul Malik Karim Amrullah (Buya Hamka)

Dr. K. H Idham Chalid

Mr. Syafruddin Prawiranegara

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono atas nama pemerintah Indonesia di Istana Negara Jakarta, Selasa(8/11) menganugerahi gelar Pahlawan Nasional kepada tujuh tokoh nasional atas jasa-jasa mereka kepada negara. Tokoh-tokoh nasional menerima gelar Pahlawan Nasional diterima masing-masing ahli waris yaitu KH Adham Chalid, Syafruddin Prawiranegara, Prof.Dr. Abdul Malik Karim Amrullah (Buya Hamka), Ki Sarmidi Mangunsarkoro, Mr. I Gusti Ketut Puja, Sri Susuhunan Pakubuwono X dan Ignatius Joseph Kasimo. Selain gelar pahlawan nasional, pemerintah menganugerahkan Bintang Mahaputera Adi Pradana kepada Raja Serdang Sultan Sulaiman Sjariful Alamsjah dari Sumatera Utara. Semasa kepemimpinannya, beliau dikenal dekat dengan

rakyat dan jiwa membangunnya selalu mendapat pujian.

Sri Susuhunan Paku Buwono X

Terbukti untuk kesejahteraan rakyatnya, Sultan memba-

ngun irigasi di Perbaungan yang disebut Dam Sultan dan


PRESIDEN Susilo Bambang Yudhoyono dan Ibu Negara Ny. Ani Yudhoyono memberikan ucapan selamat kepada ahli waris Syafruddin Prawiranegara (alm), Aisyah Prawiranegara (kiri) seusai menganugerahkan gelar Pahlawan Nasional di Istana Negara, Jakarta, Selasa (8/11).

Mr. I Gusti Ketut Pudja

mampu mengairi ribuan hektare sawah di Perbaungan dan Pantaicermin. Dalam rangka peringatan hari Pahlawan 2011, pemerintah juga menganugerahkan penghargaan bagi para budayawan dan seniman. Mereka yang menerima penghargaan itu adalah Benyamin Sueb, Hasbullah Parindurie, Harijadi Soemadidjaja, Gondo Durasim, Huriah Adam, Idrus Tintin, Kwee Tek Hoay, Sigit Sukasman, Gi Tik Swan atau KRT Hardjonagoro dan Gedong Bagus Oka. Seluruh penghargaan itu diberikan berdasarkan Keputusan Presiden, diterima oleh masing-masing ahli waris penerima gelar. Dalam acara tersebut hadir Wakil Presiden Boediono, Ketua DPD Irman Gusman, ketua lembaga negara lainnya, seluruh menteri Kabinet Indonesia Bersatu II.

Polisi Gerebek Panti Pijat Pengunjung Lompat Dari Lt. 2

Perlu Keikhlasan Oleh Tgk. H. Ameer Hamzah

Lanjut ke hal A2 kol. 3

Ignatius Joseph Kasimo Hendrowahyono

Tujuh Tokoh Dapat Gelar Pahlawan Nasional

Al Bayan

SEJARAH kurban sudah diperintahkan sejak anak Nabi Adam, Habil dan Qabil. Qurban Habil berupa seekor kambing yang gemuk yang dipersembahkan secara ikhlas diterima oleh Allah SWT dan kurban Qabil yang tidak ikhlas berupa sayur-sayuran yang busuk ditolak Allah SWT. Di sini menunjukkan niat ikhlas sangat diharapkan dalam berkurban Memang segala amal itu harus disertai niat. Allah akan membalas apa yang diniatkan. Puncak keikhlasan itu ada pada moyang kita Nabi Ibrahim Khalilullah yang menjadi “Bapak” kurban. Baginda mendapat perintah dari Allah supaya berkurban

Ki Sarmidi Mangunsarkoro

Waspada/Andi Aria Tirtayasa

Aiptu Daud Pasaribu.

Waspada/Andi Aria Tirtayasa

Tersangka AL.

Mahasiswa Tinju Wajah Polisi MEDAN (Waspada): Anggota Satlantas Polresta Medan, Aiptu Daud Pasaribu,56, menderita luka-luka akibat ditinju seorang pemuda berinisial AL warga Jalan Terendam Medan Area, Selasa(8/11) siang. Menurut informasi, kasus itu terjadi ketika Pasaribu memberikan penjelasan kepada AL yang mengendarai sepedamotor agar menghidupkan lampu pada siang hari, namun AL, pemuda 19 tahun itu tidak terima dan meninju wajah Pasaribu. Lanjut ke hal A2 kol. 6

MEDAN (Waspada): Petugas Subdit IV Renakta Poldasu menggerebek panti pijat tradisional “Rela” di Jln. Padang, Kelurahan Bandar Selamat, Kecamatan Medan Tembung, Selasa (8/11) sore. Dari lokasi itu, polisi mengamankan tujuh wanita yang diduga sebagai Pekerja Seks Komersial (PSK), seorang mucikari dan lima pria hidung belang. Seorang PSK diketahui berstatus sebagai pelajar SMA dan masih berusia 16 tahun. Dia menangis saat diboyong ke Polda Sumut. Penggerebekan dilakukan pihak kepolisian membuat masyarakat sekitar terkejut karena tidak menyangka di lantai 2 gedung dijadikan

Lanjut ke hal A2 kol. 3

Sultan Sulaiman

Sultan Sulaiman Anti Belanda Dekat Rakyat SALAH satu tokoh yang mendapat penghargaan dari pemerintah adalah Sultan Sulaiman Sjariful Alamsjah (Marhom Perbaungan). Sultan Sulaiman Sjariful Alamsjah mendapat anugrah bintang Mahaputera Adi Pradana yang diserahkan Presiden Susilo Bambang Yudhoyono di Istana Negara Jakarta diterima ahli waris, Selasa(8/11). Sultan Sulaiman Sjariful Alamsjah yang berkuasa pada tahun 1879-1946 merupakan raja ke-5 di Kesultanan Serdang menggantikan ayahnya Sultan Basjaruddin yang berkuasa

Lanjut ke hal A2 kol. 6

Ada-ada Saja Gay Dan Waria Jadi Anggota Dewan

Waspada/Rahmad F Siregar

KEJARI Tanjungbalai membakar 240 bal pakaian bekas asal Malaysia di komplek TPA Kec. Datukbandar.

Kejari T. Balai Musnahkan 240 Bal Pakaian Bekas TANJUNGBALAI (Waspada): Kejaksaan Negeri Kota Tanjungbalai memusnahkan 240 ball pres pakaian bekas asal Malaysia, di Tempat Pembuangan Akhir (TPA) Jalan HM. Nur, Kec. Datukbandar, Selasa (8/11). Pemusnahan barang bukti yang telah disita untuk negara atas perkara terdakwa HA alias Ucok Limper itu, berdasarkan putusan Pengadilan Negeri Kota Tanjungbalai No. 472/PID.B/2011/PN-TB tanggal 20 Oktober 2011.

Lanjut ke hal A2 kol. 1

DI banyak negara, kaum waria kerap mendapat kesulitan memperjuangkan hakhaknya dan tak jarang mereka mendapatkan kekerasan. Namun, nasib berbeda dialami para waria di Polandia. Di negeri Eropa Timur itu, para waria nampaknya sudah memiliki hak setara dengan Lanjut ke hal A2 kol. 2

Serampang - Paklek kok nggak jadi ya...? - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) RABU, Legi, 9 November 2011/13 Zulhijjah 1432 H  z No: 23678 Tahun Ke-65

Terbit 24 Halaman

Raja Abdullah Belajar Banyak Menyaksikan Ibadah Haji


Presiden Susilo Bambang Yudhoyono (kedua kanan) dan Ibu Negara Ny. Ani Yudhoyono (kanan) memberikan ucapan selamat kepada ahli waris Syafruddin Prawiranegara (Almarhum), Aisyah Prawiranegara (kiri) seusai menganugerahkan gelar Pahlawan Nasional di Istana Negara, Jakarta, Selasa (8/11). Kepala Negara menganugerahkan gelar Pahlawan Nasional kepada tujuh putra terbaik bangsa Indonesia dalam rangka rangkaian acara Peringatan Hari Pahlawan 10 November 2011.

Sejumlah Tokoh Dianugerahi Gelar Pahlawan Nasional JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono atas nama pemerintah Indonesia menganugerahi gelar Pahlawan Nasional kepada sejumlah tokoh nasional. Tokoh nasional yang menerima gelar Pahlawan Nasional masing-masing KH. Idham Chalid, Syafrudin Prawiranegara, Prof.Dr. Abdul Malik Karim Amrullah (Buya Hamka), Ki Sarmidi Mangunsarkoro, Mr. I Gusti Ketut Puja, Sri Susuhunan Pakubuwono X dan Ignatius Joseph Kasimo. Gelar pahlawan nasional diterima oleh ahli waris masing-masing dalam acara yang berlangsung di Istana Negara Jakarta. Selain gelar pahlawan nasional, pemerintah juga menganugerahkan bintang Mahaputera Adi Pradana kepada Sultan Sulaiman Syaiful Alamsyah dari Sumatera Utara. Pemerintah juga menganugerahkan penghargaan bagi para budayawan dan seniman. Mereka yang menerima penghargaan itu adalah Benyamin Sueb, Hasbullah Parindurie, Harijadi Soemadidjaja, Gondo Durasim, Huriah Adam, Idrus Tintin, Kwee Tek Hoay, Sigit Sukasman, Gi Tik Swan atau KRT Hardjonagoro dan Gedong Bagus Oka. Seluruh penghargaan itu diputuskan oleh Keputusan Presiden dan diterima oleh masing-masing ahli waris penerima gelar.


Dr. K.H. IDHAM CHALID (Almarhum)







Foto Repro tujuh Pahlawan Nasional (dari kiri atas searah jarum jam) Syafruddin Prawiranegara (almarhum), K.H. Idham Chalid (almarhum), H. Abdul Malik Karim Amrullah (Buya Hamka) (almarhum), Ki Sarmidi Mangunsarkoro (almarhum), I Gusti Ketut Pudja (almarhum), Sri Susuhunan Paku Buwono X (almarhum) dan Ignatius Joseph Kasimo Hendrowahyono (almarhum) dari buku Profil Penerima Gelar Pahlawan Nasional Kementerian Sosial yang diterbitkan November 2011 di Jakarta, Selasa (8/11). Kepala Negara menganugerahkan gelar Pahlawan Nasional kepada tujuh orang putra terbaik bangsa Indonesia dalam rangka rangkaian acara Peringatan Hari Pahlawan 10 November 2011.

MINA (Waspada): Pemelihara Dua Masjid Suci Raja Abdullah memberi ucapan selamat kepada seluruh Umat Muslim yang telah melaksanakan ibadah Haji, Senin (7/11). “Dari dasar pesan suci dan wahyu, Saya mengucapkan selamat kepada anda dan kaum Muslim di manapun bertepatan dengan Idul Adha,” ujar raja Arab Saudi tersebut dalam pidatonya. Raja Abdullah (foto) juga berdoa bagi keamanan dan stabilitas Umat Muslim dan para pemimpin negara-negara Muslim untuk terus mengupayakan keamanan dan stabilitas bagi warganya, Saudi Press Agency melaporkan. “Ketika keamanan dan stabilitas tercipta, masyarakat berkembang, ekonomi makmur dan Umat terus melangkah maju. Masyarakat Muslim hendaknya menggunakan Haji sebagai sebuah sarana pembelajaran. Diantara beberapa tujuan besar (ibadah) Haji adalah persatuan, solidaritas dan menyingkirkan kebencian dan perselisihan,” ujarnya. Jamaah haji yang datang dalam jumlah besar dari segala penjuru dunia untuk melakukan Rukun Islam kelima, adalah sebagai bentuk keyakinan semua orang akan pentingnya keragaman, toleransi dan musyawarah. “Gambaran sejati dari Umat yang bersatu nampak saat pelaksanaan ibada Haji. Semua jamaah telah mengerjakan satu tujuan dengan niat hanya memenuhi panggilan Allah Yang Maha Kuasa. Ke manapun kita pergi kita hanya mendengar seruan Talbiya (arti: ‘Kami di sini memenuhi panggilan Allah, Yang Maha Esa’).” Sang Raja juga menambahkan bahwa pelajaran penting dari seluruh rangkaian ibadah Haji adalah bahwa seluruh jamaah telah siap berkorban saat mereka memenuhi panggilan Tauhid. Raja Abdullah mengaku dirinya banyak belajar saat menyaksikan pelaksanaan ibadah Haji setiap tahunnya. Lanjut ke hal A2 kol 5

Kloter I Tiba 11/11/11 Profesor Darni Positif Daftar BANDAACEH (Waspada): Rektor Unsyiah, Prof Dr Darni M Daud, MA menyatakan positif akan mendaftarkan diri ke KIP sebagai calon Gubernur Aceh melalui jalur independen atau perseorangan. “Benar, saya akan mendaftar pada hari terakhir, Kamis lusa,” kata Darni M Daud yang dihubungi Waspada, Selasa (8/11) malam. Hingga kini, ujar dia, dukungan KIP yang dibutuhkan sebagai syarat bisa mendaftar sudah lebih dar i cukup. “Dukungan terus mengalir dari kantong-kantong atau Lanjut ke hal A2 kol 1

MEDAN (Waspada): Plt Gubsu Gatot Pudjo Nugroho rencananya menyambut jamaah haji Kloter pertama yang tiba di Medan pada 11 November 2011 pukul 23.15 dan Kloter terakhir pada 11 Desember, kata Ketua Panitia Pelaksana Ibadah Haji (PPIH) debarkasi Medan, Drs Abd Rahim M.Hum, Selasa (8/11).

Sementara Sekretaris Drs Abd Rahman Harahap MA, didampingi Humas Drs HM Sazli Nasution di Asrama Haji Pangkalan Mansyur Medan mengatakan, persiapan penyambutan jamaah haji mulai rampung dibahas dan berbagai keperluan yang melengkapi penerimaan jamaah telah disediakan. Misalnya, becak pengangkut barang bawaan jamaah untuk keluar dari aula yang jumlahnya ditambah tahun ini. “Sangat disadari becak

barang untuk pengangkut bawaan jamaah ini sangat diperlukan, karena dikondisikan mobil penjemput jamaah itu ada di luar asrama, agar tidak terjadi kemacatan jalur keluara asrama. Apalagi situasi kedatangan akan berlangsung malam hari, secara otomatis diperlukan ketelitian husus untuk memastikan bawaan jamaah tidak tertukar,”kata Abd Rahman. Rahman menambahkan, tahun ini para penjemput yang boleh masuk asrama hanya

kota se Aceh di ruang pertemuan KIP Aceh, pertemuan berlangsung alot dan dilakukan secara tertutup dari pagi hingga menjelang magrib. Menurut Yarwin, pergeseran hari H pemilihan tidak bisa di elak lagi, karena ada penambahan waktu pendaftaran selama tujuh hari sesuai keputusan Mahkamah Konstitusi (MK) dari tanggal 3-10 November 2011. Akibat penambahan itu, KIP membutuhkan waktu selama 21 hari untuk verivikasi faktual bakal calon dar i Lanjut ke hal A2 kol 5

Lanjut ke hal A2 kol 6

Cuaca Medan Dan Sumut Kacau Berpotensi Hujan Lebat Di Sibolga, Nias, Tapteng Dan Madina MEDAN (Waspada): Kondisi cuaca di kawasan Medan dan Sumatera Utara pada umumnya hingga awal pekan ini masih kacau atau berpluk-

tuasi , ditandai adanya gangguan cuaca di Laut China Selatan (LCS) beberapa hari ke depan. Cuaca cepat sekali ber-

ubah-ubah, dari suasana panas pada siang hari dan terjadi hujan pada malam hingga pagi. Kondisi demikian akan berlangsung hingga akhir

Jadwal Pilkada Aceh Molor Lagi BANDA ACEH (Waspada): Jadwal tahapan Pilkada Aceh untuk pemilihan suara sesuai draft KIP Aceh bergeser sebulan setengah yaitu jatuh pada tanggal 24 Januari 2012. “Kami tidak bisa menghadirkan kepala daerah terpilih sebelum masa jabatan gubernur dan wakil gubernur berakhir pada 8 Februari 2012,” kata Yarwin Adi Dharma komisioner KIP Aceh didampingi komisioner KIP lainnya dan ketua KIP Aceh kepada wartawan, Selasa (8/11) malam. Keputusan tersebut diambil setelah melakukan rapat koordinasi dengan KIP kab/

dua orang saja. Hal ini juga sebagai bentuk antisipasi jumlah penjemput agar tidak terlalu banyak yang memasuki asrama. “Kami sudah berkordinasi dengan kepala kantor agama kabupaten/kota untuk memberikan surat kepada setiap keluarga jamaah haji yang akan menjemput sebagai syarat boleh masuk asrama. Hal ini sebagai antisipasi agar jumlah keluarga yang

Waspada/Surya Efendi

LANGIT GELAP DAN TURUN HUJAN SORE HARI: Langit Kota Medan di foto dari gedung DPRDSU tampak sebagian gelap beberapa saat sebelum turun hujan deras, Selasa (8/11). Sejak 3 hari terakhir, hujan deras menguyur di sore hari. Namun, bila siang cuaca panas terik. Masyarakat diimbau waspada atas perubahan cuaca ekstrim ini.

pekan. Sementara hujan diselingi angin kencang dan petir juga masih terjadi dan mengkhawatirkan warga masyarakat, baik di kawasan pesisir timur maupun pesisir barat Sumatera Utara. Hartanto, Kepala data dan informasi (Datin) BMKG wilayah I stasiun Bandara Polonia Medan membenarkan hal itu saat dikonfirmasi di bandara itu, Selasa (8/11). Kata dia, gangguan cuaca di Laut China Selatan berpengaruh kepada pumpunan awan bergerak ke wilayah Sumut dan Medan pada umumnya. “Yang perlu diwaspadai meningkat curah hujan di kawasan lereng perbukitan dan pergunungan, berimbas kepada banjir kiriman dari hulu sungai terutama pada malam hari,” ujar Hartanto. Kondisi cuaca saat ini dan beberapa hari ke depan pada siang dan sore hari hujanLanjut ke hal A2 kol 4

Rusia Dan Iran Peringatkan Barat MOSKOW, Rusia (Waspada): Rusia dan Iran memperingatkan Barat agar tidak melakukan satu serangan militer atas Republik Islam itu, yang katanya satu serangan yang ditujukan pada program nuklir akan mengakibatkan korban sipil dan menciptakan beberapa ancaman baru terhadap keamanan global. Pernyataan terpisah oleh Menteri Luar Negeri Rusia Sergei Lavrov dan Ali Akbar Salehi dari Iran sehubungan dengan spekulasi tentang satu serangan udara potensial yang bakal di lakukan Israel terhadap lokasi nuklir Iran sebelum penyiaran oleh satu pemantau

MEDAN (Waspada): Otoritas moneter di Indonesia menegaskan hingga saat ini belum ada izin untuk membiarkan bank penerbit kartu kredit dengan foto yang diminta (request) dari nasabah, kata pejabatnya.”Kalau yang lazim itu hanya pasfoto.” “Penerbitan kartu kredit bergambar pada bagian depan yang dikeluarkan bank-bank nasional di Indonesia belum ada. Di Indonesia hal tersebut belum lazim digunakan, bahkan untuk pemasangan foto dalam kartu kredit di bankbank nasional pun belum ada. Itu cuma bank skala internasional,” kata Kepala Bidang

Oleh: H. Ameer Hamzah SEJARAH kurban sudah diperintahkan sejak anak Nabi Adam, Habil dan Qabil. Qurban Habil berupa seekor kambing yang gemuk yang dipersembahkan secara ikhlas diterima oleh Allah SWT, dan kurban Qabil yang tidak ikhlas berupa sayur-sayuran yang busuk ditolak Allah SWT. Di sini menunjukkan niat ikhlas sangat diharapkan dalam berkurban Memang segala amal itu harus disertai niat. Allah akan membalas apa yang diniatkan. Puncak keikhlasan itu ada pada moyang kita Nabi Ibrahim Khalilullah yang menjadi “Bapak” kurban. Baginda mendapat perintah dari Allah supaya berkurban dengan cara menyembelih putra kesayangannya Ismail As yang masih belia. Keikhlasan Ismail juga tiada taranya. Dia anak yang sangat patuh kepada perintah Allah.

Lanjut ke hal A2 kol 2

Waspada/Nazelian Tanjung

SUASANA siswa kesurupan di SMP N 8 Binjai.

Puluhan Siswa SMPN 8 Binjai Kesurupan BINJAI (Waspada): Puluhan siswa SMP Negeri 8 Jalan Samanhudi, Kel. Binjai Estate, Kec. Binjai Selatan, Selasa (8/11) pagi kesurupan, sehingga para guru kewalahan dan akhirnya sekolah diliburkan. Keterangan yang dikumpulkan Waspada di lapangan, peristiwa itu terjadi tiba-tiba, ketika siswa masuk ke kelas untuk menyimpan buku. Saat itu terdengar teriakan dari kelas I. Ketika didatangi oleh staf pengajar, terlihat para Lanjut ke hal A2 kol 2

DI banyak negara, kaum waria kerap mendapat kesulitan memperjuangkan hakhaknya dan tak jarang mereka mendapatkan kekerasan. Namun, nasib berbeda dialami para waria di Polandia. Di negeri Eropa Timur itu, para waria nampaknya sudah memiliki hak setara dengan warga negara lain. Bahkan mereka berkesempatan berkarir di dunia politik. Dan negeri yang dulunya sangat konservatif itu dalam waktu dekat akan memiliki waria pertama yang menjadi wakil rakyat. Lanjut ke hal A2 kol 6

Moneter dan Ekonomi BI kantor regional Sumut dan Aceh Mikael Budisatrio kepada Waspada di ruang kerjanya, Selasa (8/11). Dia ditanya tentang itu terkait bank swasta di AS CapitalOne yang memberikan kartu kredit MasterCard kepada warga Medan H. Prabudi Said dengan foto yang berlatar dia sedang menyerahkan buku 60 Tahun Waspada kepada Presiden Susilo Bambang Yudhoyono yang berlaku sampai Januari 2015. “Penerbitan kartu kredit yang menampilkan gambar Lanjut ke hal A2 kol 1

Ani Yudhoyono Capres Demokrat

Gay Dan Waria Jadi Anggota Dewan

Perlu Keikhlasan

Lanjut ke hal A2 kol 7

BI Belum Izinkan Request Foto Di Kartu Kredit

Ada-ada Saja

Al Bayan

PBB yang diperkirakan akan menyiarkan lagi tentang aspek militer terhadap kegiatan nuklir Iran. “Ini akan menjadi kesalahan paling serius dengan konsekuensi yang tak dapat diramalkan,” kata Lavrov di depan temu pers di Moskow Senin (7/11) ketika dia ditanya mengenai kesiapan Israel untuk melancarkan serangan militer tanpa pemberitahuan. Di St. Petersburg, Rusia, Saleh i m e n g a t a k a n I ran “mengutuk setiap ancaman serangan militer atas negara indepeden.’ Salehi berbicara

KBRI Swiss: Yayasan N7W Perusahaan Bangkrut JAKARTA (Waspada): Kontroversi yayasan New 7 Wonders (N7W) yang mengusung Taman Nasional Komodo sebagai kandidat tujuh keajaiban dunia masih terus berlanjut. Kendati pihak yayasan membantah mentahmentah sebagai yayasan palsu, Kedutaan Besar RI di Bern, Swiss, bersikukuh yayasan ini tidak kredibel, karena riwayat pendiriannya yang tidak berjalan mulus. Pernyataan KBRI Bern, Selasa (8/11), diceritakan kronologi berdirinya N7W yang awalnya adalah sebuah Perseroan Terbatas (PT). Dalam kronologi tersebut, dikatakan perusahaan itu bangkrut dan berganti fungsi menjadi yayasan. “KBRI tidak ingin berpolemik lebih lanjut, tetapi Lanjut ke hal A2 kol 3

JAKARTA (Antara): Kabar Partai Demokrat akan mengusung nama Kristiani Edhie Prabowo —lebih akrab dikenal sebagai Ani Yudhoyono— sebagai calon presiden mendatang sudah santer. Ani Yudhoyono bisa menjadi lawan tangguh bagi Aburizal Bakrie, Prabowo Subianto, Hatta Radjasa, juga Sri Mulyani. “Ani Yudhoyono akan menjadi lawan tanding bagi capres lain dan berpotensi untuk menang,” kata petinggi Partai Gerindra, Martin Hutabarat, di Gedung DPR, Jakarta, Lanjut ke hal A2 kol 1

Serampang - Angka keramat - He.... he....he....

Berita Utama

A2 BI Belum Izinkan ....

pilihan nasabah pada bagian depan di Amerika mungkin sudah biasa, tetapi di Indonesia hal itu belum lazim digunakan,” katanya. Me n g e n a i k e t e n t u a n penggunaan kartu kredit bergambar pilihan nasabah di perbankan Indonesia, Mikael mengatakan semua ketentuan penggunaan kartu kredit sudah diatur dalam Peraturan Bank Indonesia (PBI) No.11/ 11/2009 tentang penyelenggaraan kegiatan alat pembayaran dengan menggunakan kartu. “Boleh atau tidaknya kartu kredit bergambar tersebut, bisa dilihat dalam ketentuan PBI No.11/11/2009. Secara spesifik saya tidak bisa mengatakan, apakah hal itu boleh atau tidak. Karena hal itu bukan saja hanya berdasarkan ketentuan perbankan atau BI, tetapi juga ada ketentuan dari negara. Jadi bank yang menerbitkan pun harus melihat ketentuan tersebut,” kata Mikael Budisatrio. Sedangkan mengenai kartu kredit yang memakai foto dari pemilik atau pemegang kartu, kata Mikael Budisatrio, memang BI tidak mengatur lebih spesifik apakah bisa pakai foto atau tidak. “Dalam hal itu, BI hanya mengatur keamanan maupun mencegah agar kartu kredit berdampak negatif (artinya banyak kartu kredit yang macet),” ujarnya. Sebagai contoh, katanya, CitiBank yang merupakan bank internasional, menggunakan kartu kredit memakai foto dan bisa juga tidak menggunakan foto, tergantung keinginan masing-masing pemilik kartu. “Dar i segi k ea m a n a n dengan foto jauh lebih aman, karena petugas merchant tidak hanya melihat tandatangannya asli apa tidak, tetapi bisa melihat pemilik sesuai fotonya. Hal itu tidak diwajibkan di BI dan itu diserahkan kepada masing-masing bank,”

ujarnya. Sementara Ahmad Yunas, pejabat di Bank Mandiri wilayah Medan, mengatakan memang hingga saat ini belum ada izin resmi kalau penerbit bisa menggunakan foto seremoni atau foto yang dminta pemiliknya untuk dicetak di kartu. “Saya punya kartu kredit tapi semua tidak menggunakan foto keluarga. Baik itu platinum maupun titanium tidak ada foto yang direquest. Memang kalau diizinkan request saya fikir itu akan menjadi daya tarik kepada nasabah,” jelasnya. Request menggunakan foto pribadi di kartu kredit memang belum memungkinkan karena hingga saat ini proses penerbitannya masih diseleksi bank, kecuali untuk nasabah tertentu, jelasnya. “Saya melihat ada beberapa komunitas yang bisa mengajukan untuk foto khusus. Andai pun itu bisa request hanya untuk nasabah platinum atau yang dipilih bank berhak mendapatkannya.” Sementara Rudy Ispri, manager kartu kredit BNI wilayah Medan, mengatakan sampai saat ini memang untuk penerbitan foto di kartu kredit dengan permintaan nasabah belum diizinkan. “Apalagi teknologi di sini tidak memungkinkan. Kita mencetak kartu itu bekerjasama dengan Visa dan Master. Kita mencetak blank card itu di luar negeri.” “Di sini selain aturannya belum dizinkan, juga secara teknologi tidak bisa. Kalau di sana kan seperti CapitalOne mereka sudah menjadi principal sekaligus penerbit kartu. Jadi bisa saja memakai foto yang diinginkan nasabah,” jelasnya. BNI, menurutnya, hanya bisa disain kartu dengan memasukkan beberapa logo perusahaan atau asosiasi yang bekerjasama. Misalnya REI (real estate Indonesia) atau institusi lain, jelas Rudy. (m06/m41)

JK: Perdamaian Aceh Perlu Perawatan Terus Menerus

Waspada/Rahmad F Siregar

KEJAKSAAN Negeri Kota Tanjungbalai memusnahkan 240 bal pres pakaian bekas asal Malaysia di komplek TPA Kec. Datukbandar, dengan cara dibakar.

KBRI Swiss: ....

sebagai bagian tugas yang diemban dari negara, kami harus menginformasikan kepada publik kronologi kebangkrutan New 7 Wonders of the World AG,” tulis pernyataan KBRI Bern. Riwayat N7W, tulis KBRI, bermula pada 26 Juni 2000. Kala itu Bernard Weber dan kawan-kawan mendaftarkan PT atau di dalam bahasa Swiss dikenal dengan sebutan Allgemeine Gessellschaft (AG) dengan nama New 7 Wonders of the World di kanton (negara bagian) Schwyz. Modal perusahaan kala itu sebesar 103.000 chf atau sekitar Rp1 miliar. “Tujuan perusahaan, sebagaimana tercatat di kantor register kanton ialah mempromosikan keajaiban dunia melalui dunia maya/internet. Alamat perusahaan di Bahnhofstrasse no 19, CH 8832 Wollerau (kanton Schwyz),” tulis pernyataan KBRI. Lalu, lanjut KBRI, pada 7 Oktober 2003, pengadilan setempat menyatakan PT New 7 Wonders of the World bang-

krut dan pemerintah kanton Schwyz secara resmi membatalkan pendaftaran organisasi itu sebagai PT (AG) pada 5 Januari 2006. KBRI tidak menjelaskan alasan kebangkrutan perusahaan tersebut. “Ketika dalam proses kebangkrutan ini, Bernard Weber d k k m e m b u a t Ya y a s a n (stiftung) dengan tujuan sama dan nama yang sama yakni New 7 Wonders of the World,” ujar KBRI. Yayasan New 7 wonders of the world kemudian didaftarkan di kantor register kanton Zurich pada tanggal 7 april 2004. Alamat yayasan ini adalah Heidi Weber, privat museum Heidi weber haus von le Corbusier Hochgasse 8, CH 8008 Zurich. Yayasan inilah yang kemudian melakukan

berbagai kegiatan yang terkait dengan New 7 Wonders of the World. “Berkaitan dengan faktafakta tersebut, KBRI Bern tetap pada keyakinan awal bahwa organisasi ini tidak kredibel dan tidak layak dipercaya memberikan gelar ajang kompetisi internasional,” tulis pernyataan KBRI. Sebelumnya KBRI telah menyatakan bahwa yayasan ini adalah yayasan palsu. Hal ini terbukti dari tidak jelasnya alamat basis yayasan yang terbukti merupakan sebuah museum. Dalam telekonferensi pekan lalu, pihak N7W membantah yayasannya palsu. Dia mengatakan bahwa mereka tidak selalu berada di kantor karena bekerja menggunakan internet. (vn)

Cuaca Medan ....

wasan Sibolga, Nias, Tapanuli Tengah ( Tapteng) bahkan Mandailing Natal (Madina), mengkhawatirkan warga masyarakat di sana. Misalnya H. Syukran Y. Tanjung, Wakil Bupati Tapteng menyatakan, potensi banjir dan longsor selalu menghantui masyarakat disana. Namun aparat Pemkab sudah melakukan antisipasi saat musim penghujan. Pihaknya sudah melakukan antisipasi dengan mengorek parit dan membersihkan selokan-selokan baik perorangan maupun gotong royong, dengan harapan masyarakat berada dalam suasana aman dan tenang saat musim penghujan. (m32)

hujan lokal, sementara pada malam terjadi hujan merata terutama di pesisir timur Sumut, antara lain kawasan Medan, Deliserdang, Langkat bahkan Asahan. Suasana panas pada siang hari berpengaruh kepada kondisi curah hujan pada malam hari. Warga yang bertempat tinggal kawasan sepanjang aliran sungai baik Sungai Deli, Babura, Denai, Wampu di Langkat bahkan Sungai Ular di kawasan Deliserdang, diingatkan bakal meluap lagi air sungai. Kondisi cuaca saat ini juga berpotensi hujan lebat di ka-

Ani Yudhoyono ....

militer dimana ayahnya adalah pahlawan nasional, Sarwo Edhie Prabowo yang berhasil menumpas G30S/PKI pada 1965. “Juga, Ani Yudhoyono adalah istri seorang presiden yang dua kali dipercaya rakyat Indonesia memimpin negeri ini, Susilo Yudhoyono. Ani banyak makan asam garam selama mendampingi SBY

sebagai presiden dan juga sebagai menteri,” kata Hutabarat. Ada lagi alasannya, mayoritas perempuan Indonesia akan memilih Ani sebagai presiden. Hal yang lain yang bisa menjadikan Ani Yudhoyono sebagai presiden adalah peran besarnya melahirkan partai Demokrat.

Profesor Darni ....

Saya kira rakyat mendukung saya karena menginginkan perubahan,” ucapnya. Dukungan Darni M Daud, dilaporkan, selain dari alumni Unsyiah yang tersebar di seluruh aceh, para kepala sekolah, guru, dunia pesantren dan para santri di Aceh. “Tim kita sudah lama bekerja, jadi kalau untuk mengumpulkan 1 juta KTP dukungan kita sudah siap,” sebut Darni. Belum Satu Pun Mendaftar Dipihak lain, Waspada melaporkan, hingga menjelang batas akhir pendaftaran, belum satu pun pasangan calon Gubernur dan Cawagub Aceh yang mendaftar ke KIP. Par tai politik dan gabungan partai politik mestinya bisa mencalonkan tiga pasangan, seperti Golkar yang berkoalisi dengan PAN atau dengan PKS satu calon, Partai Aceh, satu calon dan 25 partai politik yang bergabung dalam forum lintas partai. Tapi, partai-partai ini tidak memanfaatkan keputusan sela MK yang membuka kembali pendaftaran pasangan calon

Gubernur/Wakil Gubernur, Bupati/Wakil Bupati dan calon walikota dan/Calon Wakil Walikota di 17 Kab/kota. PA yang pertama ambil sikap tidak akan mendaftar ke KIP, sebelum konflik regulasi diselesaikan. PA tetap berargumen bahwa Pilkada yang dilaksanakan oleh KIP melanggar UUPA dan MoU Helsinki. Partai yang menguasai mayoritas kursi di DPRA ini minta pelaksanaan Pilkada harus mengacu kepada Qanun Pilkada. Sedangkan keputusan MK yang mengakomodir calon perseorangan, dipandang sebagai “biang” permasalahan. Mestinya, sebelum memutuskan, harus lebih dahulu konsultasi dengan DPRA, demikian suara PA yang selalu dilansir media. Partai politik nasional, seperti Golkar dan PAN, mengungkapkan ar gumentasi senada, Kedua parnas seperti yang disebutkan S.Abda (Ketua Golkar Aceh) dan Tarmidinsyah (Sekretaris PAN Aceh), tetap tidak mencalonkan pasangan Cagub dan Cawagub

sebelum kisruh Pilkada di Aceh dicarikan solusi yang bisa diterima semua pihak. PAN, kata Edo, sebutan akrab Tarmidinsyah, bukan “membebek” dengan PA, yang ikut-ikutan tolak Pilkada. Dalam perspektif PAN, kata dia, pelaksanaan Pilkada tidak mengukuti aturan UUPA. “ Kita tidak rela UUPA bisa dipreteli dan dimana letak kekhususan kontsitusi UUPA ini,” katanya kepada Waspada, Selasa kemarin. Juru Bicara Forum Lintas Partai Provinsi Aceh (FLP2A), Erly Hasyim menyatakan, 25 partai yang bergabung dalam FLP2A tidak mendaftarkan calon Gub dan calon Wagub, selain waktunya yang sangat singkat, mereka menunggu persoalan regulasi diselesaikan dahulu. Ketua KIP Aceh, Drs Abdul Salam Poroh kepada waspada usai rakor dengan KIP se Kab/ kota menyatakan, sampai Selasa kemarin petang belum ada pasangan calon Gubernur dan Wakil Gubernur Aceh yang melapor untuk mendaftar ke KIP Aceh. (b01/cb01)

Puluhan Siswa ....

pulang ke rumahnya masingmasing. Para guru juga sibuk mengantar anak didiknya pulang dengan menaikkannya ke becak mesin. Tapi setelah para siswa yang kesurupan diantar pulang, beberapa siswi yang masih berada di sekolah malah gentian kesurupan. Mereka mengaung dan kejang-kejang, membuat para guru ketakutan. Melihat situasi yang tidak memungkinkan itu, Kepala SMP Negeri 8 Binjai akhirnya

meliburkan sekolah. Kepala SMP Negeri 8 Binjai, Gumasang Sianipar, S.Pd ketika ditemui, mengatakan kesurupan itu sudah terjadi sejak Senin (7/11), yaitu lima siswi kelas I. Mereka baru tersadar setelah pihak sekolah mendatangkan orang pintar. Namun Selasa pagi, dia terkejut sebab puluhan siswa dan siswinya kembali kesurupan, membuat pihaknya memutuskan meliburkan sekolah. (a05)

Al Bayan ....

As-Saffat: 102) Selanjutnya Allah berfirman: Maka tatkala keduanya telah berserah diri, dan Ibrahim membaringkan anaknya atas pelipisnya (nyatalah kesabaran keduanya). Dan Kami panggillah ia hai Ibrahim! Sesungguhnya kamu telah membenarkan mimpi itu. Sesungguhnya demikianlah Kami memberi balasan kepada orang-orang yang berbuat baik. Sesungguhnya ini benar-benar suatu ujian yang nyata. (Qs. As-Saffat: 103106) Dan ayat berikutnya: Dan Kami tebus anak itu dengan seekor sembelihan yang besar. Kami abadikan untuk Ibrahim itu dengan pujian yang baik di kalangan orang-orang yang datang kemudian. Yaitu

kesejahteraan dilimpahkan kepada Ibrahim. Demikianlah Kami memberi balasan kepada orang-orang yang berbuat baik. Sesungguhnya Kami telah memberikan nikmat yang banyak kepadamu. Maka dirikan lah shalat dan berqurbanlah. Sesungguhnya orang yang membenci engkau, dialah yang terputus (dari nikmat Allah).(QS. Al-Kautsar:1-3) Dari ayat-ayat itu jelas kita diperintah oleh Allah SWT, untuk mensyukuri nikmat yang sangat banyak, memotong kurban ba’da shalat Idul Adha dan juga menginformasikan kepada kita, bahwa orang-orang yang tidak mensyukuri nikmat, akan diputuskan nikmat itu.

Selasa (8/11). Oleh karena itu, semua capres harus mewaspadai pencalonan Ani Yudhoyono. “Semua capres yang ada, termasuk Prabowo Subianto harus mewaspadai Ani Yudhoyono,” tambah Martin. Alasan lain sederhana saja, Ani Yudhoyono putri keluarga

basis pendukung kita yang tersebar di seluruh daerah se Aceh,” ungkapnya. Syarat untuk pencalonan jalur independen atau perseorangan minimal harus mendapat dukungan KTP sebanyak 148.598. Atau 3 persen dari jumlah penduduk Aceh yang saat ini berjumlah 4,9 juta. “Tim kita sudah berhasil merekap sebanyak 200.000 KTP dan sekarang sudah berada di Sekretariat Darni Canter di Batoh, Banda Aceh. Insyah Allah, kamis lusa kita daftar ke KIP,” jelas Darni M Daud. Darni mengaku bahagia karena dukungan yang dia dapatkan murni aspirasi masyarakat yang simpatik kepada dirinya. “ Tidak ada yang bayar.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kh5+, Rg6. 2. Bf3xf6+, BxB.

siswi kesurupan dan kejangkejang. Beberapa saat kemudian, kesurupan menular ke semua kelas, baik itu kelas I, II dan III Jawaban TTS: membuat para guru dan bebeTTS Topik Kesehatan rapa mahasiswa yang praktek lapangan di sekolah itu, kewaA S P I R I N H I V lahan. Karena bingung menghaS I R A I S P B S O B E S I T A S dapi para murid yang kesurupan, akhirnya para staf pengA A V D D G ajar minta temannya mengR N O R I T O D R G antar mereka yang kesurupan,

3. Bf2xBf6+mat.





Jawaban Sudoku:

1 7 6 8 2 4 5 3 9

4 3 2 5 9 7 1 6 8

5 8 9 6 1 3 2 7 4

9 6 4 3 8 2 7 5 1

7 5 1 4 6 9 3 8 2

3 2 8 7 5 1 9 4 6

6 1 5 2 3 8 4 9 7

2 4 3 9 7 6 8 1 5

8 9 7 1 4 5 6 2 3

Nabi Ibrahim bermimpi disuruh Allah menyembelih putra kesayangannya. Baginda ragu-ragu dengan mimpinya itu. Tetapi mimpi itu berulang-ulang, dan mimpi para nabi adalah wahyu: maka Ibrahim berkata kepada putranya yang kala itu masih berusia 14 tahun: Maka tatkala anak itu baligh dan sanggup berusaha bersama Ibrahim, Ibrahim berkata: hai anakku! Sesungguhnya aku melihat dalam mimpi bahwa aku menyembelihmu. Maka fikirkanlah apa pendapatmu? Ismail menjawab: hai Bapakku kerjakanlah apa yang diperintahkan Allah kepadamu, Insyaallah engkau akan mendapatiku termasuk orang-orang yang sabar! (Qs.

WASPADA Rabu 9 November 2011

Jadwal Pilkada ....

pasangan perseorangan maupun dari jalur partai. Sehingga berakibat bergeser masa pemilihan sebulan setengah. Setelah melakukan rakor, KIP Aceh melakukan rapat pleno antara komisioner KIP Aceh dan pleno tersebut akan dikonsultasikan kepada KPU pusat dan Mendagri untuk dijadikan SK KIP KIP Aceh yang baru. Yarwin menambahkan, akibat bergesernya hari pemilihan, KIP juga mengalami permasalahan anggaran, karena penyelenggaraan pilkada masuk pada tahun anggaran baru 2012. “Kami perlu payung hukum untuk penggunaan anggaran 2012,”ujarnya. KIP Aceh enggan berkomentar tentang Penjabat (PJ) sementara, “Tentang hal itu biarkan Mendagri yang memikirkan, karena itu bukan ranah kami,”terangnya. (cb01)

Raja Abdullah ....

“Saya menyaksikan seluruh jamaah dalam perjalanan mereka. Saya mendapat banyak (pelajaran) dengan menyaksikan seluruh jamaah dan saya menyerap energi unik dari kerumunan yang besar itu. Saya kagum menyaksikan kepuasan dan ketenangan pada wajah-wajah mereka. Mereka juga menikmati keberkahan dari keamanan dan ketentraman yang disediakan di negara ini. Yang tua mengasihi yang muda, yang kaya membantu yang miskin,” ujarnya, sambil menambahkan bahwa pemandangan seperti ini hanya dapat dilihat di Tanah Suci. “Tanah yang baik ini di mana tempat para jamaah dan pengunjung berkumpul, dengan ridha Allah, menikmati keamanan dan stabilitas berkat doa Nabi Ibrahim AS. Dan (ingatlah), ketika Ibrahim berkata: “Ya Tuhanku, jadikanlah negeri ini (Mekah), negeri yang aman, dan jauhkanlah aku beserta anak cucuku daripada menyembah berhala-berhala,” (Qur’an Surah: Ibrahim, Ayat: 35). Raja Abdullah mengatakan bahwa melayani para jamaah merupakan satu kehormatan besar bagi kerajaan Saudi. “Kami hanya mencari balasan dari Allah Yang Maha Kuasa untuk menjalankan kewajiban dalam melayani para jamaah,” ujarnya. (an/rzl)

JAKARTA (Antara): Mantan Wakil Presiden M Jusuf Kalla (JK) menegaskan perlu usaha untuk merawat perdamaian di Aceh secara terus menerus agar tidak muncul kembali benih-benih konflik seperti sebelumnya. “Untuk mencapai perdamaian butuh kepercayaan. Sementara membina kepercayaan itu butuh pembuktian. Sedangkan kepercayaan butuh pembuktian untuk menjaganya,” kata Jusuf Kalla saat peluncuran buku karya Farid Husain di Jakarta, Selasa (8/11). Buku karya Farid Husain berjudul “‘Keeping the Trust for Peace; Kisah dan Kiat Menumbuhkan Damai di Aceh” berisikan usaha menjaga perdamaian selama enam tahun sejak perjanjian Helshinki ditandatangani. Lebih lanjut JK mengatakan bahwa menjaga perdamaian tidak hanya selesai ketika kesepakatan ditandatangani. Perdamaian, tambah JK, dibutuhkan usaha untuk merawat perdamaian itu secara terus menerus. Sementara pengamat politik Dr Salim Said yang bertindak sebagai pembedah menegaskan bahwa memelihara perdamaian justru lebih penting daripada mendamaikan itu sendiri. “Dalam sepanjang sejarah,

Ada-ada Saja ....

Sang waria politisi itu adalah Anna Grodzka, 57, yang terlahir sebagai seorang lakilaki ber nama Kr zysztof, sebelum menjalani operasi kelamin di Thailand. “Saat saya bertemu masyarakat di jalanan, sebagian besar dari mereka bereaksi positif,” ujar Anna seputar reaksi masyarakat atas terpilihnya dia sebagai anggota parlemen. “Tapi tentu saja ada yang menentang dan bersikap agresif,” ujarnya, seperti dilansir BBC, Selasa (8/11). “Yang menyedihkan adalah politisi dan media menggunakan fakta bahwa saya pernah menjadi laki-laki sebagai sarana untuk menyerang saya,” ujar Anna. Selain sang waria, seorang gay, Robert Biedron juga akan dilantik menjadi wakil rakyat hasil pemilu bulan Oktober lalu. (bbc/rzl)

Kloter 1 Tiba ....

menjemput kedalam asrama terbatas, cukup 2 orang saja,” katanya. Hal lain yang disampaikannya, kedatangan jamaah haji dari Jeddah ke Medan bisa saja berubah-ubah, artinya jadwal yang ditetapkan semula mungkin saja tidak sesuai lagi dengan penerbangan yang akan berlangsung pada tanggal kepulangan. Karena itu, kata Abd Rahman, keluarga jamaah bisa langsung menggunakan nomor kontak 061-4532290. Dengan bertanya ke informasi itu, keluarga yang akan menjemput bisa memastikan apakah jadwal kepulangan sesuai dengan pemberitahuan awal ataukah ada perubahan lagi. “Kepastian jadwal itu bisa saja berubah, meskipun saat ini informasi yang didapatkan telah ada penambahan gate di bandara, namun ketepatan

baru penyelesaian Aceh ini ada pemeliharaan perdamaian. Sebelumnya berulang kali Aceh didamaikan tetapi terjadi lagi karena tidak dirawat,” kata Salim Said. Menurut Salim buku ini penting untuk menjaga perdamaian di masa-masa mendatang. Salim mengharapkan mudah-mudahan dari buku ini menjadi pola bagi perunding-perunding selanjutkan karena Indonesia memiliki potensi konflik sangat banyak. Namun Salim Said mengkritik karena judul buku itu menggunakan bahasa Inggris, padahal kita punya bahasa Indonesia yang baik.

“Anda telah berbuat baik bagi bangsa dengan menjaga perdamian, maka anda berbuatlah kebaikan lagi dengan menggunakan bahasa Indonesia dengan baik dan benar,” kata Salim yang disambut tawa ratusan hadirin. Sebelumnya Farid juga telah menuliskan pengalamannya dalam proses perundingan damai Helshinki dengan judul “To See the Unseen, Di Balik Damai Aceh” Farid Husain merupakan dokter spesialis bedah dan subspesialis bedah digestif. Ia pernah menjadi Direktur Jenderal Pelayanan Medis Depkes.

Rusia Dan Iran ....

di samping PM Rusia Vladimir Putin serta sejumlah menteri dari berbagai negara di Shanghai Cooperation Organization (SCO), satu kelompok regional yang didominasi Rusia dan China di mana Iran bertindak sebagai peninjau. Kementerian Luar Negeri Jerman juga menolak aksi militer terhadap Iran, yang katanya bahwa pertikaian itu harus diselesaikan melalui tekanan diplomatik. Satu laporan oleh Badan Tenaga Atom Internasional (IAEA), yang seyogyanya dikeluarkan pekan ini, kemungkinan memperkuat dugaan yang mencurigakan bahwa Teheran berusaha untuk mengembangkan kemampuan nuklirnya untuk membuat bom atom dan mendorong Barat agar menyerukan sanksi lebih jauh terhadap Iran. Rusia dan China sebelumnya mendukung empat rangkaian sanksi terhadap Iran sehubungan dengan program nuklirnya. Namun kedua anggota Dewan Keamanan PBB yang memegang hak veto itu telah menjelaskan setiap sanksi baru akan berdampak sangat buruk. Rusia, yang membangun stasiun pembangkit listrik nuklir pertama Iran, dengan keras menentang aksi militer. Tak ada penyelesaian militer “Tidak ada penyelesaian militer terhadap problem nuklir Iran sebagaimana juga terhadap problem lainnya di dunia modern,” kata Lavrov. “Ini merupakan penega-

san pada kami setiap harinya ketika kami melihat bagaimana banyak problem dan konflik di sekeliling Iran yang diselesaikan — apakah masalah Irak atau Afghanistan atau apa yang terjadi di negaranegara lainnya di kawasan itu. Intervensi militer hanya menyebabkan banyak lagi manusia yang mati atau menderita.” Iran sejauh ini tetap menolak mehentikan aktivitas pengayaan uraniumnya kendatipun dikenakan beberapa babak sanksi PBB. Iran, Selasa (8/11) mengatakan Barat tidak memiliki bukti kuat bahwa Teheran sedang mengembangkan senjata-senjata nuklir, menjelang satu laporan IAEA. “Tidak ada bukti serius bahwa Iran sedang berusaha membuat satu hulu ledak nuklir,” kata Menlu Ali Akbar Salehi, menjawab satu pertanyaan telepon dalam satu kunjungan ke Armenia. “Barat dan Amerika Serikat terus menekan Iran tanpa argumen-argumen dan buktibukti serius,” katanya. Laporan IAEA yang diperkrikan akan disampaikan pekan ini sebagai kemungkinan pemicu serangan Israel terhadap fasilitas-fasilitas nuklir Iran. Penilaian IAEA sebelumnya dipusatkan pada usahausaha Iran untuk memproduksi bahan nuklir— uranium dan plutonium — yang bisa digunakan untuk tujuantujuan damai seperti pembangkit listrik atau digunakan untuk membuat bom atom. (ap/ok/bbc/m10)

waktu tidak bisa diprediksi secara tepat,” ujarnya. Air Zam-zam Di Ambil Langsung Penerbangan Garuda, kata Rahman Harahap yang telah menyiapkan air zamzam untuk jamaah haji, akan membagikan langsung air tersebut di aula sebelum jamaah meninggalkan asrama. Hal ini lebih memastikan air zam-zam itu diterima oleh jamaah daripada harus dibagikan di kabupaten/kota. “Sudah ada koordinasi dengan pihak penerbangan bahwa air zam-zam itu akan diterima langsung oleh jamaah dengan memperlihatkan paspor mereka kepada petugas yang langsung membagikannya. Hal ini untuk memastikan bahwa mereka mendapatkan haknya secara langsung,” kata Rahman. Humas PPIH Drs HM Sazli Nasution menambahkan, se-

luruh jamaah yang akan pulang ke kediaman masingmasing, akan diperiksa kesehatannnya, utamanya suhu tubuh mereka. Jika suhunya lebih dari 38 derajat maka akan dilakukan observasi oleh petugas kesehatan. Sudah Ke Makkah Sementara itu, kabar dari jamaah haji di Arab Saudi, seperti disampaikan Fahmi dari Kloter 7, kemarin, mereka telah kembali ke Makkah karena rombongan ini mengambil nafar awal. Setibanya di Makkah, mereka langsung tawaf dan sa’i. “Alhamdulillah prosesi ibadah haji dilalui dengan lancar, bahkan saat melontar jumrah tidak terlalu sulit terasa sangat lapang,”kata Fahmi yang menyebutkan cuaca di sana semakin dingin, utamanya pada malam hari saat angin berembus sangat kencang. (m37)

Berita Utama


Reses Anggota DPRD DS Temukan Proyek Bermasalah

Model Kartu Kredit

Di Indonesia Beda MEDAN (Waspada): Otoritas moneter di Indonesia menegaskan hingga saat ini belum ada izin untuk membiarkan bank penerbit kartu kredit dengan foto yang diminta (request) dari nasabah, kata pejabatnya.”Kalau yang lazim itu hanya pasfoto.” “Penerbitan kartu kredit bergambar pada bagian depan yang dikeluarkan bank-bank nasional di Indonesia belum ada. Di Indonesia hal tersebut belum lazim digunakan, bahkan untuk pemasangan foto dalam kartu kredit di bank-bank nasional pun belum ada. Itu cuma bank skala internasional,” kata Kepala Bidang Moneter dan Ekonomi BI kantor regional Sumut dan Aceh Mikael Budisatrio kepada Waspada di ruang kerjanya, Selasa (8/11). Dia ditanya tentang itu terkait bank swasta di AS CapitalOne yang memberikan kartu kredit MasterCard kepada warga Medan H. Prabudi Said dengan foto yang berlatar dia sedang menyerahkan buku 60 Tahun Waspada kepada Presiden Susilo Bambang Yudhoyono yang berlaku sampai Januari 2015. “Penerbitan kartu kredit yang menampilkan gambar pilihan nasabah pada bagian depan di Amerika mungkin sudah biasa, tetapi di Indonesia hal itu belum lazim digunakan,” katanya. Mengenai ketentuan penggunaan kartu kredit bergambar pilihan nasabah di perbankan Indonesia, Mikael mengatakan semua ketentuan penggunaan kartu kredit sudah diatur dalam Peraturan Bank Indonesia (PBI) No.11/11/2009 tentang penyelenggaraan kegiatan alat pembayaran dengan menggunakan kartu. “Boleh atau tidaknya kartu kredit bergambar tersebut, bisa dilihat dalam ketentuan PBI No.11/11/2009. Secara spesifik saya tidak bisa mengatakan, apakah hal itu boleh atau tidak. Karena hal itu bukan saja hanya berdasarkan ketentuan perbankan atau BI, tetapi juga ada ketentuan dari negara. Jadi bank yang menerbitkan pun harus melihat ketentuan tersebut,” kata Mikael Budisatrio. Sedangkan mengenai kartu kredit yang memakai foto dari pemilik atau pemegang kartu, kata Mikael Budisatrio, memang BI tidak mengatur lebih spesifik apakah bisa pa-

kai foto atau tidak. “Dalam hal itu, BI hanya mengatur keamanan maupun mencegah agar kartu kredit berdampak negatif (artinya banyak kartu kredit yang macet),” ujarnya. Sebagai contoh, katanya, CitiBank yang merupakan bank internasional, menggunakan kartu kredit memakai foto dan bisa juga tidak menggunakan foto, tergantung keinginan masing-masing pemilik kartu. “Dari segi keamanan dengan foto jauh lebih aman, karena petugas merchant tidak hanya melihat tandatangannya asli apa tidak, tetapi bisa melihat pemilik sesuai fotonya. Hal itu tidak diwajibkan di BI dan itu diserahkan kepada masingmasing bank,” ujarnya. Sementara Ahmad Yunas, pejabat di Bank Mandiri wilayah Medan, mengatakan memang hingga saat ini belum ada izin resmi kalau penerbit bisa menggunakan foto seremoni atau foto yang dminta pemiliknya untuk dicetak di kartu. Request menggunakan foto pribadi di kartu kredit memang belum memungkinkan karena hingga saat ini proses penerbitannya masih diseleksi bank, kecuali untuk nasabah tertentu, jelasnya. “Saya melihat ada beberapa komunitas yang bisa mengajukan untuk foto khusus. Andai pun itu bisa request hanya untuk nasabah platinum atau yang dipilih bank berhak mendapatkannya.” Sementara Rudy Ispri, manager kartu kredit BNI wilayah Medan, mengatakan sampai saat ini memang untuk penerbitan foto di kartu kredit dengan permintaan nasabah belum diizinkan. “Apalagi teknologi di sini tidak memungkinkan. Kita mencetak kartu itu bekerjasama dengan Visa dan Master. Kita mencetak blank card itu di luar negeri.” “Di sini selain aturannya belum diizinkan, juga secara teknologi tidak bisa. Kalau di sana kan seperti CapitalOne mereka sudah menjadi principal sekaligus penerbit kartu. Jadi bisa saja memakai foto yang diinginkan nasabah,” jelasnya. BNI, menurutnya, hanya bisa disain kartu dengan memasukkan beberapa logo perusahaan atau asosiasi yang bekerjasama. Misalnya REI (real estate Indonesia) atau institusi lain, jelas Rudy. (m06/m41)

Kejari T. Balai ...

Ditambahkan, dalam rangka penegakan hukum, pemusnahan ini menunjukkan kepada publik bahwa barang bukti yang selama ini disimpan tidak disalahgunakan. “Mudahmudahan acara seperti ini dapat dilaksanakan secara konsekuen sehingga maksud dan tujuan kita menegakkan hukum yang berkeadilan, mengamankan kebijakan pemerintah serta keuangan negara dalam rangka mewujudkan kesejahteraan masyarakat, dapat tercapai dengan baik,” kata Edi Winarto. Sementara, Wali Kota Tanjungbalai, Thamrin Munthe menjelaskan, pemusnahan barang bukti itu memilik makna, antara lain Tanjungbalai punya kepedulian terhadap penegakan hukum. Dan, kata Wali Kota, unsur Muspida telah membuktikan secara terus menerus memberikan pengajaran agar masyarakat tidak mengulangi prilaku ilegal. Kemudian, lanjut Wali Kota, menunjukkan konsistensi penegakan hukum, karena pemusnahan barang bukti merupakan salah satu sistem pengawasan bersama dalam proses penegakan hukum. “ Kita akan terus bangun kebersamaan Muspida dan semoga Tanjungbalai maju serta sejahtera,” tegas Wali Kota. (a14)

Barang bukti dimusnahkan dengan cara dibakar sampai habis disaksikan Wali Kota Tanjungbalai Thamrin Munthe, Kajari Tanjungbalai Edi Winarto, Kepala BCTeluknibung Rahmady Effendi Hutahaean, Kasi Pidsus PDE Pasaribu, dan Wakapolres Tanjungbalai serta perwakilan Pengadilan Negeri Kota Tanjungbalai. Kajari Tanjungbalai Edi Winarto mengatakan, dengan pemusnahan barang bukti ini, diharap penyelesaian penanganan perkara tindak pidana kepabeanan dapat dilakukan secara cepat dan tepat sehingga terhindar dari hal yang merugikan kepentingan masyarakat. “Penanganan perkara secara cepat dan sangat diperlukan,” jelas Edi Winarto.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kh5+, Rg6. 2. Bf3xf6+, BxB. 3. Bf2xBf6+mat.

Ada-ada Saja ...

Jawaban TTS: TTS Topik





Jawaban Sudoku:

1 7 6 8 2 4 5 3 9

4 3 2 5 9 7 1 6 8

5 8 9 6 1 3 2 7 4

9 6 4 3 8 2 7 5 1

7 5 1 4 6 9 3 8 2

3 2 8 7 5 1 9 4 6

6 1 5 2 3 8 4 9 7

2 4 3 9 7 6 8 1 5

8 9 7 1 4 5 6 2 3

warga negara lain. Bahkan mereka berkesempatan berkarir di dunia politik. Dan negeri yang dulunya sangat konservatif itu dalam waktu dekat akan memiliki waria pertama yang menjadi wakil rakyat. Sang waria politisi itu adalah Anna Grodzka, 57, yang terlahir sebagai seorang laki-laki bernama Krzysztof, sebelum menjalani operasi kelamin di Thailand. “Saat saya bertemu masyarakat di jalanan, sebagian besar dari mereka bereaksi positif,” ujar Anna seputar reaksi masyarakat atas terpilihnya dia sebagai anggota parlemen. “Tapi tentu saja ada yang menentang dan bersikap agresif,” ujarnya, seperti dilansir BBC, Selasa (8/11). “Yang menyedihkan adalah politisi dan media menggunakan fakta bahwa saya pernah menjadi laki-laki sebagai sarana untuk menyerang saya,” ujar Anna. Selain sang waria, seorang gay, Robert Biedron juga akan dilantik menjadi wakil rakyat hasil pemilu bulan Oktober lalu. (bbc/rzl)

WASPADA Rabu 9 November 2011

Waspada/Nazelian Tanjung

SUASANA siswa kesurupan di SMP N 8 Binjai.

Puluhan Siswa SMPN 8 Binjai Kesurupan BINJAI (Waspada): Puluhan siswa SMP Negeri 8 Jalan Samanhudi, Kel. Binjai Estate, Kec. Binjai Selatan, Selasa (8/11) pagi kesurupan, sehingga para guru kewalahan dan akhirnya sekolah diliburkan. Keterangan yang dikumpulkan Waspada di lapangan, peristiwa itu terjadi tiba-tiba, ketika siswa masuk ke kelas untuk menyimpan buku. Saat itu terdengar teriakan dari kelas I. Ketika didatangi staf pengajar, terlihat para siswi kesurupan dan kejang-kejang. Beberapa saat kemudian, kesurupan menular ke semua kelas, baik itu kelas I, II dan III membuat para guru dan beberapa mahasiswa yang praktek lapangan di sekolah itu, kewalahan. Karena bingung menghadapi para murid yang kesurupan, akhirnya para staf pengajar minta temannya mengantar mereka yang kesurupan, pulang ke rumahnya masing-masing. Para guru juga sibuk mengantar anak didiknya pulang dengan menaikkannya ke becak mesin. Tapi setelah para siswa yang kesurupan diantar pulang, beberapa siswi yang masih berada di sekolah malah gentian kesurupan. Mereka mengaung dan kejang-kejang, membuat para guru ketakutan. Melihat situasi yang tidak memungkinkan itu, Kepala SMP Negeri 8 Binjai akhirnya meliburkan sekolah. Kepala SMP Negeri 8 Binjai, Gumasang Sianipar, S.Pd ketika ditemui, mengatakan kesurupan itu sudah terjadi sejak Senin (7/11), yaitu lima siswi kelas I. Mereka baru tersadar setelah pihak sekolah mendatangkan orang pintar. (a05)

Polisi Gerebek ... tempat pijat sekaligus prostitusi. Bahkan saat dilakukan penggerebekan, seorang pria hidung belang sempat melompat dari lantai II menghindari tangkapan polisi. Dia berhasil ditangkap setelah dilakukan pengejaran. “Kami tak menyangka di gedung itu ada transaksi seks. Selama ini yang kami tahu gedung itu panti pijat tradisional,” sebut warga. Mereka mengatakan, jika warga mengetahui pijat tradisional tersebut dijadikan ajang prostitusi, masyarakat tidak akan

Jadwal Pilkada Aceh ... Setelah melakukan rakor, KIP Aceh melakukan rapat pleno antara komisioner KIP Aceh dan pleno tersebut akan dikonsultasikan kepada KPU pusat dan Mendagri untuk dijadikan SK KIP Aceh yang baru. Yarwin menambahkan, akibat bergesernya hari pemilihan, KIP mengalami perma-

Soeharto Dan Gus Dur ... Kemerdekaan RI, dan pada saat Hari Pahlawan 10 November. “Tidak semua dalam satu event,” kata Djoko, Menteri Koordinator Bidang Politik Hukum dan Keamanan ini. Djoko menekankan Pahlawan Nasional itu diseleksi di Kementerian Sosial berdasarkan usulan dari daerah dan kelompok masyarakat. “Diseleksi oleh tim dari Kemensos, Mabes TNI umumnya hampir seluruhnya, sejarawan

CUACA SUMUT ... Kata dia, gangguan cuaca di Laut China Selatan berpengaruh kepada pumpunan awan bergerak ke wilayah Sumut dan Medan pada umumnya. “Yang perlu diwaspadai meningkat curah hujan di kawasan lereng perbukitan dan pergunungan, berimbas kepada banjir kiriman dari hulu sungai terutama pada malam hari,” ujar Hartanto. Kondisi cuaca saat ini dan beberapa hari ke depan pada siang dan sore hari terjadi hujan lokal, sementara pada malam terjadi hujan merata terutama di Pesisir Timur Sumut, antara lain kawasan Medan, Deliserdang, Langkat, bahkan Asahan. Suasana panas pada siang hari berpengaruh kepada kondisi curah hujan pada malam hari. Warga yang bertempat tinggal kawasan sepanjang aliran sungai baik Sungai Deli, Babura, Denai, Wampu di Langkat bah-

DELISERDANG (Waspada): Reses anggota DPRD Deliserdang Dapil VI menemukan sejumlah bangunan diduga pengerjaannya menyimpang yakni pembangunan drainase di Desa Mekarsari Kec.Delitua dan pembangunan kantor Cabang Dinas Pendidikan, Pemuda dan Olah Raga di Kel.Delitua Timur. Dana pembangunan kedua proyek tersebut bersumber dari APBD Deliserdang 2010. Tim reses diketuai H Sabar Ginting bersama anggota Timur Sitepu, Reki Nelson J Barus, Maya Shinta Sianturi, Berngap Sembiring dan Setiawan Sembiring yang turun meninjau bangunan yang sedang dikerjakan tersebut, beberapa hari lalu, berang karena dua proyek yang ditangani Dinas Cipta Karya dan Dinas Pendidikan, Pemuda dan Olah raga Deliserdang, itu pengerjaannya diduga menyimpang dari bestek.

Kloter I Tiba ...

atau tokoh masyakarat, ada 1213 orang. Setelah itu masuk ke Dewan Gelar,” kata Djoko. Dia menambahkan, syaratsyarat umum bagi seseorang menyandang gelar pahlawan sudah diatur dalam undang-undang. Syarat umumnya yakni, bukan hanya warga negara Indonesia, tapi memiliki integritas moral yang tinggi. Mereka harus memiliki keteladanan dan berjasa kepada nusa dan bangsa sesuai bidangnya, berkelakuan baik dan setia, tak pernah mengkhianati bangsa. (vvn)

jamaah ini sangat diperlukan, karena dikondisikan mobil penjemput jamaah itu ada di luar asrama, agar tidak terjadi kemacatan jalur keluar asrama. Apalagi situasi kedatangan akan berlangsung malam hari, secara otomatis diperlukan ketelitian khusus untuk memastikan bawaan jamaah tidak tertukar,” kata Abd Rahman. Rahman menambahkan, tahun ini para penjemput yang boleh masuk asrama hanya dua orang saja. Hal ini juga sebagai bentuk antisipasi jumlah penjemput agar tidak terlalu banyak yang memasuki asrama. Hal lain yang disampaikannya, kedatangan jamaah haji dari Jeddah ke Medan bisa saja berubah-ubah, artinya jad-wal yangditetapkansemulamungkin saja tidak sesuai lagi dengan penerbangan yang akan berlangsung pada tanggal kepulangan. Karena itu, kata Abd Rahman, keluarga jamaah bisa langsung menggunakan nomor kontak 061-4532290. Dengan bertanya ke informasi itu, keluarga yang akan menjemput bisa memastikan apakah jadwal kepulangan sesuai dengan pemberitahuan awal ataukah ada perubahan lagi. “Kepastian jadwal itu bisa saja berubah, meskipun saat ini informasi yang didapatkan telah ada penambahan gate di bandara, namun ketepatan waktu tidak bisa diprediksi secara tepat,” ujarnya. Penerbangan Garuda, kata Rahman Harahap yang telah menyiapkan air zam-zam untuk jamaah haji, akan membagikan langsung air tersebut di aula sebelum jamaah meninggalkan asrama. Hal ini lebih memastikan air zam-zam itu diterima oleh jamaah daripada harus dibagikan di kabupaten/kota. Sudah Ke Makkah Sementara itu, kabar dari jamaah haji di Arab Saudi, seperti disampaikan Fahmi dari Kloter 7, kemarin, mereka telah kembali ke Makkah karena rombongan ini mengambil nafar awal. Setibanya di Makkah, mereka langsung tawaf dan sa’i. “Alhamdulillah prosesi ibadah haji dilalui dengan lancar, bahkan saat melontar jumrah tidak terlalu sulit terasa sangat lapang,”kata Fahmi yang menyebutkan cuaca di sana semakin dingin, utamanya pada malam hari saat angin berembus sangat kencang. (m37)

kan Sungai Ular di kawasan Deliserdang, diingatkan bakal meluap lagi air sungai. Kondisi cuaca saat ini berpotensi hujan lebat di kawasan Sibolga, Nias, Tapanuli Tengah (Tapteng) bahkan Mandailing Natal (Madina), mengkhawatirkan warga masyarakat di sana. Misalnya H. Syukran Y. Tanjung, Wakil Bupati Tapteng menyatakan, potensi banjir dan longsor selalu menghantui masyarakat disana. Namun aparat Pemkab sudah melakukan antisipasi saat musim penghujan. Pihaknya sudah melakukan antisipasi dengan mengorek parit dan membersihkan selokan-selokan baik perorangan maupun gotong royong, dengan harapan masyarakat berada dalam suasana aman dan tenang saat musim penghujan. Pumpunan Awan CB Bahkan GDP,Kapten Pilot Garuda yang sudah berpengalaman 23 tahun di jajaran penerbangan itu menyatakan

pengalamannya saat mendarat di Bandara Polonia Medan dari Jakarta dua hari lalu. Kalau saat ini kondisi udara di kawasan Sumut dan Medan pada umumnya sudah muncul awan-awan menjulang tinggi seperti awan Cumulo Nimbus (CB). Begitupun kondisi cuaca saat ini masih aman jajaran penerbangan saat mendarat dan terbang melalui Bandara Polonia Medan. “Awan selalu ada namun masih dapat dielakkan pesawat,” ujarnya. Berdasarkan pengalaman bertahun-tahun memasuki bulan November dan Desember pumpunan awan akan meningkat ke kawasan Medan, namun kondisi ini tidak perlu dikhawatirkan. Kalau penerbangan terganggu mendarat pada runway 023, pesawat masih bisa mengalihkan pendaratan melalui landasan pacu (runway) 05 Bandara Polonia Medan, kata DGP penduduk Bogor, Jabar. (m32)

menerimanya dan bertindak melakukan penutupan. Kanit II Subbid IV Renakta Direskrim Polda Sumut AKP Amakaoy Tahia kepada wartawan mengatakan, penggerebekan dilakukan setelah mereka menerima informasi menyatakan panti pijat “Rela” menjadi lokasi prostitusi. Untuk membuktikan itu, polisi menyamar sebagai pelanggan dan memesan pekerja seks kepada mucikari, dan tercapai kata sepakat Rp300 ribu sekali pakai (short time). Setelah mendapat bukti, polisi kemudian melakukan penggerebekan.(m27) salahan anggaran, karena penyelenggaraan Pilkada masuk pada tahun anggaran baru 2012. “Kami perlu payung hukum untuk penggunaan anggaran 2012,”ujarnya. KIP Aceh enggan berkomentar tentang Penjabat (PJ) sementara, “Tentang hal itu biarkan Mendagri yang memikirkan, karena itu bukan ranah kami,”terangnya. (cb01)

Al Bayan ... dengan cara menyembelih putra kesayangannya Ismail As yang masih belia. Keikhlasan Ismail juga tiada taranya. Dia anak yang sangat patuh kepada perintah Allah. Nabi Ibrahim bermimpi disuruh Allah menyembelih putra kesayangannya. Baginda raguragu dengan mimpinya itu. Tetapi mimpi itu berulang-ulang, dan mimpi para nabi adalah wahyu: maka Ibrahim berkata kepada putranya yang kala itu masih berusia 14 tahun: Maka tatkala anak itu baligh dan sanggup berusaha bersama Ibrahim, Ibrahim berkata: hai anakku! Sesungguhnya aku melihat dalam mimpi bahwa aku menyembelihmu. Maka fikirkanlah apa pendapatmu? Ismail menjawab: hai Bapakku kerjakanlah apa yang diperintahkan Allah kepadamu, Insyaallah engkau akan mendapatiku termasuk orang-orang yang sabar! (Qs. As-Saffat: 102) Selanjutnya Allah berfirman: Maka tatkala keduanya telah berserah diri, dan Ibrahim membaringkan anaknya atas pelipisnya (nyatalah kesa-

baran keduanya). Dan Kami panggillah ia hai Ibrahim! Sesungguhnya kamu telah membenarkan mimpi itu. Sesungguhnya demikianlah Kami memberi balasan kepada orang-orang yang berbuat baik. Sesungguhnya ini benar-benar suatu ujian yang nyata. (Qs. As-Saffat: 103-106) Dan ayat berikutnya: Dan Kami tebus anak itu dengan seekor sembelihan yang besar. Kami abadikan untuk Ibrahim itu dengan pujian yang baik di kalangan orang-orang yang datang kemudian. Yaitu kesejahteraan dilimpahkan kepada Ibrahim. Demikianlah Kami memberi balasan kepada orang-orang yang berbuat baik. Sesungguhnya Kami telah memberikan nikmat yang banyak kepadamu. Maka dirikan lah shalat dan berqurbanlah. Sesungguhnya orang yang membenci engkau, dialah yang terputus (dari nikmat Allah).(QS. Al-Kautsar:1-3) Dari ayat-ayat itu jelas kita diperintah oleh Allah SWT, untuk mensyukuri nikmat yang sangat banyak, memotong kurban ba’da shalat Idul Adha dan juga menginformasikan kepada kita, bahwa orang-orang yang tidak mensyukuri nikmat, akan diputuskan nikmat itu.

Rusia Dan Iran ...

Seperti proyek drainase yang menelan anggaran Rp 471.920 juta di Desa Mekar Sari dikerjakan CV Rizki Putra Jaya, ketahanannya diragukan. Sedangkan plang proyek tidak ada, sehingga masyarakat tidak mengetahui berapa panjang dan lebar drainase yang dikerjakan. Demikian pula dengan pembangunan kantor Cabang Dinas Pendidikan, Pemuda dan Olah Raga di Kel.Delitua Timur,

dikerjakan CV Abdi Nusantara dengan nilai Rp 147.419.00, fondasi yang seharusnya dinaikkan 30 Cm tidak dilakukan. Dalam hal ini, tim menilai pengawas kedua instansi Pemerintah Kab. Deliserdang itu tidak bekerja. Untuk itu, Tim minta pihak berwenang, seperti Kejaksaan Negeri Lubukpakam dan Polres Deliserdang segera mengusut kasus tersebut agar negara dan rakyat tidak dirugikan. (m11)

Mahasiswa Tinju ...

Prof HM Yamin simpang Jalan Gaharu, Pasaribu menghentikan sepeda motor AL. Pasaribu menasehati agar AL menghidupkan lampu depan sepedamotornya pada siang hari sesuai peraturan berlalulintas. Namun, AL mahasiswa salah satu perguruan tinggi swasta itu berang dan meninju wajah Pasaribu. Pasaribu telah melakukan visum di RSU Dr Pirngadi Medan. Kanit Reskrim Polsek Medan AKP Nimrot Aprwin Simanjuntak menjelaskan, kasus pemukulan diduga dilakukan AL tetap diproses sesuai jalur hukum. Tersangka AL ditahan. (h04)

Shanghai Cooperation Organization (SCO), satu kelompok regional yang didominasi Rusia dand China di mana Iran bertindak sebagai peninjau. Kementerian Luar Negeri Jerman juga menolak aksi militer terhadap Iran, yang katanya bahwa pertikaian itu harus diselesaikan melalui tekanan diplomatik. Satu laporan oleh Badan Tenaga Atom Internasional (IAEA), yang seyogyanya dikeluarkan pekan ini, kemungkinan memperkuat dugaan yang mencurigakanbahwaTeheranberusaha untuk mengembangkan kemampuan nuklirnya untuk membuat bom atom dan mendorong Barat agar menyerukan sanksi lebih jauh terhadap Iran. Rusia dan China sebelumnya mendukung empat rangkaian sanksi terhadap Iran sehubungan dengan program nuklirnya. Namun kedua anggota Dewan Keamanan PBB yang memegang hak veto itu telah menjelaskan setiap sanksi baru akan berdampak sangat buruk. Rusia, yang membangun stasiun pembangkit listrik nuklir pertama Iran, dengan keras menentang aksi militer. (ap/ok/bbc/m10)

memenuhi panggilan Allah,Yang Maha Esa’).” Sang Raja juga menambahkan bahwa pelajaran penting dari seluruh rangkaian ibadah Haji adalah bahwa seluruh jamaah telah siap berkorban saat mereka memenuhi panggilan Tauhid. Raja Abdullah mengaku dirinya banyak belajar saat menyaksikan pelaksanaan ibadah haji setiap tahunnya. “Saya menyaksikan seluruh jamaah dalam perjalanan mereka. Saya mendapat banyak (pelajaran) dengan menyaksikan seluruh jamaah dan saya menyerap energi unik dari kerumunan yang besar itu. Saya kagum menyaksikan kepuasan dan ketenangan pada wajahwajah mereka. Mereka juga me-

nikmati keberkahan dari keamanan dan ketentraman yang disediakan di negara ini. Yang tua mengasihi yang muda, yang kaya membantu yang miskin,” ujarnya, sambil menambahkan bahwa pemandangan seperti ini hanya dapat dilihat diTanah Suci. “Tanah yang baik ini di mana tempat para jamaah dan pengunjung berkumpul, dengan ridha Allah, menikmati keamanan dan stabilitas berkat doa Nabi Ibrahim AS. Raja Abdullah mengatakan bahwa melayani para jamaah merupakansatukehormatanbesar bagi kerajaan Saudi. “Kami hanya mencari balasan dari AllahYang Maha Kuasa untuk menjalankan kewajiban dalam melayani para jamaah,” ujarnya. (an/rzl)

mangkat, tahta kesultanan digantikan Sultan Sulaiman, beliau mencari tempat untuk memindahkan istana. Ketika itu, ada beberapa lokasi yang akan dijadikan pertapakan istana. Salah satunya adalah di Lubukpakam. Tetapi di Lubukpakam terdapat kantor pemerintahan Belanda sehingga karena Sultan Sulaiman merasa tidak nyaman jika berkantor (istana) berdekatan dengan Belanda. Sehingga dia memilih mendirikan istana di Kuta galuh Perbaungan. Dalam laman Kesultananserdang.Com ditulis, Kesultanan Serdang berdiri lebih dari dua abad, dari 1723 hingga 1946. Selama periode itu, telah berkuasa 5 orang Sultan. Sultan Serdang pertama adalah Tuanku Umar, kemudian ia digantikan oleh Tuanku Sultan Ainan Johan Almashah (1767-1817). Tuanku Sultan Ainan Johan Almashah beristerikan Tuangku Sri Alam, puteri Raja Perbaungan. Di masa Sultan Ainan Johan ini, terjadi penyatuan Kerajaan Serdang dan Perbaungan. Ceritanya, sewaktu Raja Perbaungan meninggal dunia, tidak ada orang yang berhak menggantikannya, sebab ia tidak memiliki anak laki-laki. Oleh karena anak perempuan Raja Perbaungan menikah dengan Sultan Serdang, maka Kerajaan Perbaungan digabung dengan Serdang. Jadi, penggabungan ini berlangsung semata-mata karena adanya hubungan kekerabatan, bukan karena peperangan. Pada 1946, di masa pemerintahan Sultan Sulaiman Sjariful Alamsjah, Kesultanan Serdang bergabung dengan Negara Kesatuan Republik Indone-

sia (NKRI). Sultan Sulaiman dalam menjalankan kekuasaannya secara turun temurun,selain sebagai Kepala Pemerintahan, juga sebagai Kepala Agama Islam (Khalifatullah fi’l ardh) dan Kepala Adat (Melayu,red). Bahkan, selama menjalankan kekuasannya, Sultan Sulaiman membangun dua masjid yaitu Masjid Raya Sulaimaniyah di Perbaungan dan Masjid Raya Sulaimaniyah di Pantaicermin. Sultan Sulaiman juga membangun dua sumur bor masingmasing di Perbaungan dan Pantaicermin, yang hingga kini masih berfungsi baik dan digunakan masyarakat. Setelah bergabung dengan NKRI, aktivitas Kesultanan Serdang vakum. Baru kemudian pada tahun 1980-an, musyawarah masyarakat Melayu melalui Datuk Empat Suku, aktivitas Kesultanan Serdang kembali dihidupkan untuk melestarikan adat istiadat, Ketika itu hasil musyawarah memutuskan Tuanku Abu Nawar Sinar Sjariful Alamsjah Al-Haj diangkat sebagai ketua adat Negeri Serdang. Ketika Tuanku Abu Nawar Sinar Sjariful Alamsjah Al-Haj mangkat (2001), kepala adat digantikan oleh adiknya Tuanku Luckman Sinar Sjariful Alam Shah Al- Haj. Setelah Tuanku Luckman Sinar Sjariful Alamsjah Al –Haj mangkat, jabatan ketua adat digantikan oleh Tuanku Ahmad Thala’a Sjariful Alamsjah. Beliau adalah tokoh muda di Deliserdang yang kini mengemban amanat sebagai Ketua DPD Partai Golkar Deliserdang. (Rudhy Faliskan /dari berbagai sumber).

Dalam kasus itu, Pasaribu membuat laporan pengaduan ke Polsek Medan Timur. Sedangkan AL diciduk petugas Reskrim Polsek Medan Timur. Informasi diperoleh di kepolisian, sekira pukul 12:00, Aiptu Daud Pasaribu dan beberapa temannya sedang melaksanakan tugas rutin di Pos Polisi Jalan Prof HM Yamin simpang Jalan Gaharu Medan Timur. Saat itu, Aiptu Daud Pasaribu melihat seorang pengendara sepeda motor jenis Mio BK 3838 XV tidak menyalakan lampu. Persis di perempatan lampu merah Jalan

Raja Saudi ... persatuan, solidaritas dan menyingkirkan kebencian dan perselisihan,” ujarnya. Jamaah haji yang datang dalam jumlah besar dari segala penjuru dunia untuk melakukan Rukun Islam kelima, adalah sebagai bentuk keyakinan semua orang akan pentingnya keragaman, toleransi dan musyawarah. “Gambaran sejati dari umat yang bersatu nampak saat pelaksanaan ibadah haji. Semua jamaah telah mengerjakan satu tujuan dengan niat hanya memenuhi panggilan Allah Yang Maha Kuasa. Ke manapun kita pergi kita hanya mendengar seruan Talbiyah (arti: ‘Kami di sini

Sultan Sulaiman ... pada 1851-1879. Kejayaan Kesultanan Serdang di bawah kepemimpinan Sultan Sulaiman tak hanya sikapnya yang tegar dalam menentang penjajahan Belanda. Tetapi, beliau mampu membangun kesejahteraan bagi rakyatnya dengan membangun pertanian serta menghidupkan perdagangan rakyat terutama hasil bumi. Bahkan Sultan Sulaiman rela mengeluarkan uang membiayai pembangunan irigasi dengan mengambil tenaga kerja dari Kalimantan. Irigasi yang kemudian disebut Dam Sultan dibangun dari Sungai Ular itu mampu mengairi ribuan hektare persawahan yang membentang dari Kec. Perbaungan hingga Kec. Pantaicermin ( kini masuk wilayah Kab.Serdang Bedagai). Dalam sejarahnya, Kesultanan Serdang berdiri tahun 1723, dan bergabung dengan Republik Indonesia tahun 1946. Kesultanan ini berpisah dari Deli setelah sengketa tahta kerajaan pada tahun 1720. Seperti kerajaan-kerajaan lain di Sumatera Timur, Serdang menjadi makmur karena dibukanya perkebunan tembakau, karet, dan kelapa sawit serta pertanian pangan (padi). Sebelum pindah ke Kuta Galuh Perbaungan, istana Sultan Serdang berada di Kampong Besar Serdang (Kini,Desa Serdang Kec.Beringin). Tetapi keberadaan istana tidak nyaman lagi karena terus-terusan dilanda banjir sehingga istana dipindahkan arah ke timur hilir atau 7 km dari istana Kampung Besar. Namun, banjir terus terjadi. Dan, ketika Sultan Basjaruddin

Info Sumut

A3 Ketundukan, Pengorbanan, Kesyukuran....

WASPADA Rabu 9 November 2011

Kolom Amir Syarifuddin

Kurban BILA ada Pejabat Gubernur, menyembelih sendiri hewan kurbannya, itu adalah Plt Gubernur Sumatera Utara, Gatot Pujo Nugroho. Pada Idul Adha 1432 H, Minggu, 6 November 2011, Plt Gubsu menyembelih sendiri hewan kurbannya di Kelurahan Bagan Deli, Medan Belawan.Di kelurahan itu, Gatot menyerahkan tiga ekor lembu.Sedangkan di Kelurahan Belawan Bahagia, masih di Medan Belawan, Plt Gubsu memberikan hewan kurban berupa dua ekor lembu serta 12 ekor kambing. Gatot sendiri melaksanakan salat Idul Adha bersama ribuan ummat Islam di Lapangan Merdeka, Medan. Selain Gatot, terlihat pula sejumlah pejabat di lingkungan Pemprov Sumut, unsur pimpinan DPRD Sumut Walikota Medan dan Ketua DPRD Medan. Bertindak sebagai imam dan khatib di Lapangan Merdeka adalah Dr H Saidurahman MA, Pembantu Dekan I Fakultas Syariah, Institut Agama Islam Negeri (IAIN) Sumut. Dalam khutbahnya Saidurrahman mengatakan, bahwa bulan Zulhijjah dalam Islam dianggap istimewa, karena memiliki dua keistimewaan. Di bulan itu, umat Islam yang sanggup secara jasmani, rohani , kesempatan dan keuangan, diwajibkan melaksanakan ibadah haji. Selain itu, kepada umat Islam disyariatkan menyembelih hewan kurban, sebagai jalan mendekatkan diri kepada Allah. Usai salat Idul Adha, Plt Gubsu menyaksikan penyembelihan 11 ekor lembu dan 10 ekor kambing di Kantor Gubsu. Hewan tersebut merupakan kurban dari sejumlah Kepala Biro dan PNS di secretariat daerah, termasuk BKD dan Satpol PP. Setelah menyaksikan kurban di Kantor Gubsu itulah, Plt Gubsu dengan rombongan, antara lain, Ketua Umum DPW PKS, Sumut, H Muhammad Hafez, Lc MA, Kabiro Binsos Provsu, H Shakira Zandi MA mengunjungi beberapa titik pelaksanaan kurban di Komplek Perumahan Nelayan di Medan Belawan. Menurut Gatot,dipilihnya Bagan Deli dan Belawan Bahagia, karena jumlah penduduk di sana cukup padat dengan tingkat kesejahteraan rendah. “Atas pertimbangan itulah, kami berkurban di

wilayah Bagan Deli, Medan Belawan,” kata Gatot. Selain proses berkurban merupakan ibadah, daging kurban dibagikan kepada masyarakat sebagai bentuk kepedulian sosial dan kesetiakawanan. Kepedulian itulah yang ditunjukkan Plt Gubsu dengan memberikan hewan kurban ke sejumlah daerah.Secara keseluruhan Gatot menyumbangkan35 ekor lembu untuk kurban kepada 33 kabupaten/kota di Sumut. Idul Adha menurut Plt Gubsu, adalah sebuah pelajaran tentang keteladanan dari keluarga Nabi Ibrahim AS. “Hari ini keteladanan itu menjadi nilai yang bisa dipedomani pemimpin, para ulama dan pengusaha. Ketika kita memberikan keteladanan, mudahmudahan membawa kebaikan,” kata Gatot, usai menyembelih hewan kurbannya. Plt Gubsu berharap, apa yang dicontohkan Nabi Ibrahim AS akan menjadi nilai yang berkembang di Provinsi Sumut. “ Keteladanan yang perlu dicontoh adalah kesetiaan, ketulusan dan kejujuran. Karakter seperti inilah yang dirindukan bangsa ini,” kata Gatot.Sebagai Plt Gubsu, Gatot berupaya memberikan keteladanan kepada masyarakat. Kita boleh bangga, karena kepedulian dan kesetiakawanan masyarakat Sumut cukup tinggi.Pada Idul Adha tahun ini di Sumut disembelih 23.900 ekor hewan kurban, yang terdiri dari lembu, kambing dan kerbau. “Jumlah ini meningkat dibanding tahun lalu,” kata Plt Gubsu. Peningkatan jumlah masyarakat dalam berkurban ini, diharapkan juga meningkatkan kesetiakawanan sosial di tengah masyarakat.Alangkah naifnya, jika setiap tahun ibadah kurban dilaksanakan, tapi dalam kehidupan nyata, jiwa pengorbanan tidak berbekas di tengah masyarakat. Kita berharap masyarakat Sumut, tak terkecuali aparatur pemerintahan, menjadikan momentum Idul Adha untuk membuktikan keteladanan dan kesetiakawanan sosial.Seorang yang pantas diteladani, tentu tidak akan melakukan perbuatan tidak terpuji, seperti korupsi, fitnah dan menyalahgunakan wewenang dalam menjalankan kewajibannya. ***

BANYAK hikmah yang dapat diambil dari kisah Nabi Ibrahim AS, selaku hamba Allah yang pertama kali memulai pelaksanaan kurban di muka bumi. Karena mampu memberikan pengorbanan kepada Pencipta, berupa sesuatu yang paling ia cintai di dalam keluarga: Putra tersayang, Ismail. Bermuasal dari kisah tersebut, kurban kemudian disyariatkan kepada ummat Islam, sebagai bagian dari bentuk ketundukan, pengorbanan dan kesyukuran seorang hamba kepada Rabb-Nya. Banyak lagi sebenarnya ketauladanan yang terkandung di balik runutan kisah tersebut. Di Sumatera Utara, sebanyak 35 ekor sapi dikurbankan Plt Gubernur Sumatera Utara, H Gatot Pujo Nugroho ST pada perayaan Iedul Qurban, Minggu (6/11) kemarin. Sapi-sapi tersebut disebar di seluruh kabupaten dan kota di provinsi ini. Sementara Pj Gubsu sendiri, ikut menyembelih sapi kurban di lingkungan masyarakat nelayan di Kelurahan Bagan Deli, Kecamatan Medan Belawan. Penyembelihan bersama masyarakat nelayan tersebut dilakukan Pj Gubsu, setelah sebelumnya melaksanakan sholat Ied di Lapangan Merdeka Medan dan memantau secara langsung proses kurban di halaman kantor Gubernur Sumatera Utara Jalan Diponegoro Medan. Usai penyembelihan, masyarakat kemudian mengajak Mantan Ketua Umum PKS Sumut tersebut menyambangi Musholla Al Ikhlas yang masih belum rampung di kawasan tersebut. Kegiatan kemudian berlanjut dengan silaturahim ke sejumlah titik pemotongan hewan kurban bersama masyarakat nelayan, dan ke beberapa tempat di kawasan pemukinan nelayan bersama sejumlah tokoh. Semoga saja, aktivitas kurban tersebut tidak saja berhasil merangsang kalangan pe-

Malinda Dee Didakwa Gelapkan Uang Rp40 Miliar JAKARTA (Antara): Terdakwa Inong Malinda Dee didakwa melakukan penggelapan uang dan terlibat pencucian uang senilai Rp27 miliar dan 2 juta dolar AS atau total Rp40 miliar. “Kami mendakwa Malinda dengan dakwaan UU Perbankan dan UU Pencucian uang dengan nilai transaksi sekitar Rp27 miliar dan 2 juta dolar AS, artinya sekitar Rp40 miliar,” kata ketua Jaksa Penuntut Umum Tatang Sutarna seusai sidang pembacaan dakwaan di Pengadilan Negeri Jakarta Selatan, Selasa (8/11). Tatang yang didampingi JPU Arya Wicaksana, Helmi, Dede Herdiana, Jul Indra Dhana, dan Rustam membacakan secara bergantian dakwaan kepada Malinda selama 2,5 jam sejak sidang dimulai pukul 11.00. Mantan Senior Relationship Manager di Citibank itu mendapat tiga dakwaan dari JPU, pertama soal perbankan, pencucian uang, dan pemberantasan tindak pidana pencucian uang. JPU menganggap Malinda pada periode 27 Januari 20077 Februari 2011 melakukan transfer tidak sah atau palsu dengan tidak diketahui atau

diizinkan oleh nasabah yang bersangkutan dengan cara memberikan formulir transfer palsu atas nama sekitar 30 nasabah yang ia kuasai untuk kemudian diberikan kepada teller bank Citibank dan selanjutnya dikirim ke rekening individu atau perusahaanyangsudahdiatunjuk sebanyak 117 kali transaksi. Di antara nasabah-nasabah yang dirugikan oleh tindakan Malinda misalnya Rohimin bin Pateni sebanyak 24 kali transaksi, N. Susetyo Sutaji sebanyak sembilan kali transaksi dan Suryati T. Budiman sebanyak enam kali transaksi. Untuk tindakan itu Malinda didakwa dengan UU Perbankan pasal 49 ayat (1) huruf a UU No 7/1992 sebagaimana diubah dengan UU No 10/1998 tentang Perbankan jo pasal 55 ayat (1) ke1 jo pasal 65 ayat (1) KUHP, subsider pasal 49 ayat (2) huruf b. Dakwaan kedua berhubungan dengan tindak pencucian uang yaitu Malinda dianggap melakukan transfer harta kekayaan yang patut diduga sebagai hasil kejahatan dari dan ke perusahaan jasa keuangan demi menyembunyikan asalusul tindak pidana.

Oleh JPU, perempuan kelahiran Pangkal Pinang 5 Juli 1952 itu dianggap melanggar pasal 3 ayat (1) huruf b UU No 15/2002 sebagaimana diubah dengan UU No 25/2003 sebagaimana diubah dengan UU No 8/2010 tentang Tindak Pidana Pencucian Uang jo pasal 65 ayat (1) KUHP. Sedangkan pada dakwaan ketiga, istri Andhika Gumilang itu didakwakan pasal 3 UU No 15/2002 sebagaimana diubah dengan UU No 25/2003 sebagaimana diubah dengan UU No 8/2010 tentang Tindak Pidana Pencucian Uang jo pasal 65 ayat (1) KUHP. Dalam persidangan yang dipimpin hakim Gusrizal yang merupakan wakil ketua PN Selatan, dibantu Yonisman dan Kusno tersebut, pengacara terdakwa, Batara Simbolon merespons gugatan dengan meminta agar JPU mengajukan saksi pada sidang selanjutnya dan tidak memilih mengajukan eksepsi. “Kami tidak mengajukan eksepsi karena ingin status ibu Malinda segera jelas, kami tidak ingin membuang waktu karena eksepsi hanya berisi mempertanyakan kompetensi untuk

mengadili atau dakwaan jaksa yang kabur yang hanya bisa dibuktikan dalam pokok perkara, “ kata Batara seusai sidang. Dia yakin dapat membuktikan bahwa kliennya tidak melakukan kejahatan seperti yang dituduhkan jaksa. Pada sidang selanjutnya yang akan berlangsung pada Senin (14/11), JPU Tatang Sutarna mengatakan berencana untuk menghadirkan lima saksi dari total sekitar 30 saksi yang disiapkan. “Pada sidang kali ini kami baru membacakan dakwaan, belum sampai pada tuntutan jadi belum ada jumlah ancaman hukuman penjara yang diajukan, tapi sesuai UU ancaman hukuman penjara maksimal 15 tahun,” ungkap Tatang. Malinda Dee yang hadir dalam sidang perdananya tersebut dengan mengenakan setelah kemeja, celana, dan kerudung hitam sempat menitikkan air mata saat JPU membacakan dakwaan kepadanya. Kasus tersebut juga melibatkan suami Malinda, Andhika Gumilang,Visca Lovitasari yang merupakan adik kandung Malinda Dee dan Ismail, adik ipar dari Malinda Dee.


KUNJUNGI NELAYAN: Plt Gubsu, H Gatot Pujo Nugroho ST, bersama Ketua Umum DPW PKS Sumut, H M Hafez Lc MA beserta rombongan, Minggu (6/11) mengunjungi pemukiman masyarakat nelayan di Lingk XV Kelurahan Bagan Deli Kec Medan Belawan, Medan, usai menyembelih kurban di lingkungan tersebut. mimpin dan masyarakat untuk tetap tunduk, rela berkorban

serta bersyukur kepada yang Maha Kuasa, tetapi juga senan-


MUSHOLLA: Masyarakat Kel. Bagan Deli menjelaskan sejumlah kebutuhan pembangunan Musholla Al Ikhlas yg sedang di bangun di kelurahan itu, kepada Gatot Pujo Nugroho. Usai menyembelih kurban masyarakat mengajak Pj Gubsu bersama Kepala Biro Binsos Provsu, H Shakira Zandi MA, meninjau mushola tersebut.

tiasa mampu mempererat hubungan antara pemimpin de-

ngan masyarakat yang di pimpin di hari-hari sesudahnya.(m28)


BERCENGKRAMA: H Gatot Pujo Nugroho ST, bercengkrama dengan para ibu rumah tangga, masyarakat Lingk XV Kel. Bagan Deli Kec. Medan Belawan, Medan, dalam kunjungannya saat menyalurkan sapi kurban dan merayakan Idul Adha bersama masyarakat di kelurahan tersebut, Minggu (6/11) kemarin.

Medan Metropolitan


WASPADA Rabu 9 November 2011

Importir Ikan Belum Bayar Retribusi Pemko Medan Rugi Ratusan Juta Rupiah BELAWAN (Waspada): Sepuluh perusahaan importir ikan yang beroperasi di Pelabuhan Perikanan Samudera Belawan (PPSB), belum ada yang membayar restribusi ke Pemko Medan sebagaimana diamanatkan dalam Perda Kota Medan No 14 tahun 2002 tentang retribusi izin usaha perikanan. Akibatnya, Pemko Medan dirugikan hingga ratusan juta rupiah karena retribusi tidak masuk ke kas daerah. Sepuluh importir dimaksud yakni PT. ASSA, PT. TSI, PT. ASP, CV. SH, CV. SMF, CV. RK, PT. MTC&FI, PT. AA, PT. KALJ, PT. GCS dan PT. SAWS. Hal itu terungkap ketika anggota DPD RI asal Sumut Parlindungan Purba, SH, MM didampingi Ketua HNSI Kota Medan Zulfahri Siagian dan Kadistanla Kota Medan Ir Wahid diwakili M Rahman Daulay mengunjungi PPSB, Selasa (7/11). Kadistanla Kota Medan Ir Wahid diwakili M Rahman Daulay mengatakan, dalam Perda Kota Medan No. 14 tahun 2002 tentang restribusi izin usaha perikanan, disebutkan bahwa importir ikan dikenakan restribusi sebesar Rp 100/kg. Menurut Rahman, pihaknya sudah berulangkali mengadakan sosialisasi kepada pengusaha. Namun, meski sudah berjalan hampir sembilan tahun, para importir tersebut tetap belum memenuhi kewajibannya membayar restribusi dimaksud. Selama ini, para importir ikan Belawan hanya tunduk

kepada aturan pemerintah pusat tentang impor ikan. Sedangkan aturan pemerintah daerah dikesampingkan mereka karena tidak memiliki sanksi yang kuat. “Jadi, yang kita harapkan hanya kesadaran. Kalau mereka tidak mau, kita

tidak bisa berbuat apa- apa,” ujarnya. Menyikapi hal itu, anggota DPD RI Parlindungan Purba, SH, MM mendesak importir ikan tersebut segera menyelesaikan kewajibannya. Sebab, uang yang terkumpul dari retribusi itu menambah pemasukan kas Pemko Medan. “Dalam hal ini, kita butuh kesadaran mereka untuk melaksanakan kewajibannya. Masalah ini akan saya sampikan pada rapat kabinet pada 10 November mendatang,” tegas Parlindungan.

Resahkan Nelayan Sementara itu, Ketua HNSI Kota Medan Zulfahri Siagian mengatakan sejak dibukanya kembali kran ikan impor pada Agustus 2011, nelayan Belawan resah. Sebab, ikan ikan impor yang seharusnya tidak mudah beredar, kini banyak ditemukan di pasar dan merusak harga ikan lokal hasil tangkapan nelayan. “Ikan impor itu seharusnya untuk diolah kembali atau kebutuhan perhotelan. Tapi sekarang sudah banyak yang langsung dijual ke pedagang,” kata Zulfahri. (h03)

Waspada/Rustam Effendi

ANGGOTA DPD RI Parlindungan Purba, SH, MM mengamati satu kotak ikan impor di gudang CV Bahagia, saat mengadakan kunjungan di PPSB, Selasa (7/11).


PENGURUS SPS Cabang Sumut periode 2011-2015 beraudiensi ke Harian Mimbar Umum, Senin (7/11). Tampak dalam gambar Pemimpin Umum/Pemimpin Redaksi Harian Mimbar Umum HM Fauzi Lubis (enam kanan) dengan pengurus SPS Cabang Sumut, Ketua H Teruna Jasa Said (lima kiri), Sekretaris Farianda Putra Sinik (empat kiri) dan lainnya.

SPS Harus Kompak Hadapi Persaingan MEDAN (Waspada): Pemimpin Umum/Pemimpin Redaksi Harian Mimbar Umum HM Fauzi Lubis mengatakan, Serikat Perusahaan Pers (SPS) Cabang Sumut harus menggalang kebersamaan dalam menghadapi persaingan media yang sangat ketat. Kebersamaan itu diperlukan agar eksistensi penerbitan media oleh perusahaan pers khususnya media cetak lokal dapat terus berlangsung. “Saya melihat persaingan media saat ini sangat ketat. Karenanya, saya berharap temanteman di SPS menggalang kebersamaan, kompak dan tetap saling menjaga”, ujar HM Fauzi Lubis saat menerima audiensi pengurus SPS Cabang Sumut periode 2011-2015 di kantor Harian Mimbar Umum, Senin (7/11). Fauzi mengharapkan pengurus SPS Cabang Sumut yang baru bisa memainkan perannya

Perpustakaan Kota Medan Kembangkan Kelompok Pemustaka

Pemko Medan Bangun TV Billboard

MEDAN (Waspada): Guna mengembangkan peran perpustakaan dan minat baca, Perpustakaan Kota Medan melakukan pembinaan dan pengembangan kelompok pemustaka tahun 2011 di Restoran Kenanga, Jln. Jamin Ginting, Medan, baru-baru ini. Kepala Kantor Perpustakaan Umum Kota Medan Zulkarnain mengatakan, pengembangan dan pemberdayaan pustakawan ini merupakan kegiatan rutin yang dilaksanakan Perpustakaan Kota Medan. Menurut Zulkarnain, perpustakaan sangat berperan terhadap tumbuh kembangnya kebiasaan dan kegemaran membaca di Masyarakat. “Dengan kegiatan ini, kita ingin lebih dekat kepada para pustakawan maupun kelompok pemustaka. Karena kelompok pemustaka merupakan bagian dari perpustakaan dalam mengembangkan dan mencerdaskan masyarakat,” ucapnya. Dalam acara tersebut, hadir seratus pustakawan berasal dari semua elemen masyarakat. Kegiatan tersebut menghadirkan pemateri yakni Kepala Seksi Pemberdayaan Perpustakaan Kota Medan Arriani Yusra dan Huller. Arriani menjelaskan selain pembinaan, upaya-upaya yang dilakukan Perpustakaan Kota Medan dalam mengembangkan kecerdasan masyarakat adalah melakukan lomba minat baca bagi siswa/siswi SD dan SMP setiap tahunnya. (m50)

MEDAN (Waspada): Kepala Dinas Komunikasi dan Informasi (Kominfo) Kota Medan Zulkifli Sitepu mengungkapkan, dalam waktu dekat pihaknya akan membangun tv billboard. Salah satu di antaranya akan dibangun di depan kantor wali kota Medan sebagai sarana penyampaian dan penyebaran informasi atas kebijakan wali kota secara online. Selain itu, tv billboard juga dibangun di kawasan Medan bagian Utara. “Insya Allah, tv billboard juga akan dibangun di sejumlah lokasi pada 2012, dengan pusatnya di kantor wali kota. Tv billboard dibangun sebagai upaya Pemko Medan menuju smart city. Dimana, Medan yang merupakan kota berbasis bisnis di sumut harus memiliki IT lebih maju,” kata Zulkifli didampingi Kabag Media Elek-

Pemilik Ke ATM, Mobil Terbakar MEDAN (Waspada): Satu mobil Kijang Kapsul BK 248 N yang sedang parkir di Jln. H. Adam Malik, Kecamatan Medan Barat, Selasa (8/11) siang, tiba-tiba terbakar. Tidak ada korban jiwa dalam peristiwa itu. Namun arus lalulintas di kawasan bundaran Glugur Bypass mengalami kemacetan. Informasi yang diperoleh Waspada di kepolisian, siang itu pemilik mobil bersama sopirnya Marto bermaksud mengambil uang di mesin ATM di areal kampus LP3I Simpang Glugur. Setelah mobil terparkir, pemilik mobil bergegas ke ruang ATM, sementara sopir menunggu di mobil dan mesin dalam kondisi tidak menyala. Setahu bagaimana, tiba-tiba asap mengepul dari bagian depan mobil. Melihat hal itu, Marto yang masih berada di dalam mobil langsung menyelamatkan diri.“Begitu ku lihat ada asap, aku langsung keluar lah,” kata Marto kepada petugas Polsek Medan Barat. Api dengan cepat menyambar seluruh mobil. Melihat itu, pengguna jalan dan warga yang melihat kejadian tidak dapat berbuat banyak. Beruntung, petugas pemadam kebakaran yang menerima informasi segera datang ke lokasi. Api yang sempat marak, berhasil dipadamkan. Kanit Reskrim Polsek Medan Barat AKP Anthoni Simamora menjelaskan, sopir mobil tersebut sudah dimintai keterangannya. Penyebab kebakaran karena terjadinya korsleting di bagian depan mobil. (h04)

Dekan FD IAIN SU Dilantik MEDAN (Waspada) Rektor Institut Agama Islam Negeri (IAIN) Sumut Prof Dr H. Nur Ahmad Fadhil Lubis melantik Dekan Fakultas Dakwah (FD) Dr. H. Abdullah Msi, Senin (7/11) di gedung rektorat kampus itu. Prof Dr H. Nur Ahmad Fadhil Lubis mengatakan, pelantikan ini dilakukan sesuai Surat Keputusan Menteri Agama. “Atas nama Menteri Agama, saya melantik saudara menjadi Dekan FD periode 2011-2015, “ tegasnya. Fadhil Lubis berharap FD bisa menjadi pelopor dan tidak menjadi pelengkap dari empat fakultas di IAIN. Terbukti, sudah banyak alumni FD menduduki jabatan strategis di berbagai instansi pemerintah maupun swasta. Hadir dalam acara itu, para pembantu rektor, dekanat dan pejabat teras IAIN SU serta undangan lainnya. Usai pelantikan, digelar acara pisah sambut antara dekan baru dengan lama di Aula FD. Sejumlah alumni FD terlihat hadir seperti Prof Dr M Hatta, para guru besar FD dan Kepala Binsos Pemprovsu Drs Sakhira Zandi, Msi. Sementara itu, Dekan Fakultas Dakwah IAIN SU Dr. H. Abdullah Msi Dr H Abdullah berjanji akan melaksanakan amanat dan kepercayaan yang diberikan kepadanya. “Saya mengharapkan dukungan dari seluruh civitas akademika IAIN SU,” ujarnya. Sedangkan Guru Besar IAIN SU Prof Dr M Hatta, MA berharap Dr Abdullah bisa membawa FD menjadi lebih baik lagi. Peningkatan kualitas merupakan skala prioritas dari program kerja bagi dekan baru. Sementara mantan Dekan FD Prof Dr Ilhamuddin MA mengucapkan terima kasih atas dukungan yang diberikan civitas akademika IAIN SU. “Kalau ada kekurangan yang saya lakukan selama memimpin FD mohon dimaafkan,“ katanya. (m49)

tronik Bahrain dan Kabag Data Harunsyah, Selasa (8/11). Dalam waktu dekat, lanjut Zulkifli, Dinas Infokom Medan juga membuat 10 video conference di 10 lokasi untuk Satuan Ke r j a Per a n g k a t D aer ah (SKPD) dan lintas forum. Sepuluhan lokasi dimaksud yakni Dinas Kependudukan dan Catatan Sipil, Dinas Bina Marga, Dinas Kesehatan, Dinas Perrtamanan, Dinas Kebudayaan dan Pariwisata, Disperindag, Kominfo, Polresta serta ruang wali kota. Menurut Zukifli, kebijakan itu dilakukan sebagai upaya percepatan pembangunan dan diharapkan rampung dalam jangka waktu dua bulan. Program Dinas Infokom lainnya seperti SMS Center, untuk menampung aspirasi masyarakat yang setiap minggu disampaikan kepada wali kota, kemudian ditindaklanjuti

SKPD terkait. “Pada 9 November, digelar ceramah terbuka 27 sekolah setingkat SMA dan berlangsung selama sebulan dengan materi pembangunan generasi muda, tertib lalulintas sesuai Undang-undang No. 22 tahun 2009, pencegahan HIV/ AIDS dan penanggulangan narkoba. Wali kota dan kapolresta akan membuka acara tersebut,” ungkapnya. Dalam acara itu, pihaknya juga melibatkan Dirlantas terkait lalulintas, HIV/AIDS oleh Dinas Kesehtan, narkoba oleh Badan Narkotika Nasional (BNN) yang dilanjutkan pembagian brosur informasi untuk empat materi tersebut. Kemudian diadakan dialog tatap muka untuk semua kecamatan menyangkut Perwal 28/2011 tentang izin usaha warnet, e-KTP dan gizi buruk,yangberlangsungpada1020 Desember. (m50)

PrimeOne School Berkibar Di Ajang Kompetisi Sempoa Internasional MEDAN (Waspada): Nama PrimeOne School berkibar di ajang kompetisi Sempoa Internasional yang berlangsung di Kuala Lumpur, Malaysia, belum lama ini. Kompetisi yang digelar di Corus Hotel itu diikuti 13 negara yakni Indonesia, Malaysia, New Zealand, Filipina, Singapura, Sri Lanka, Tanzania, Turki, Uni Emirat Arab, Pakistan, Kamboja, India dan Thailand. “Ini pertama kali saya me-

ngikuti kompetisi Sempoa tingkat internasional. Saya senang menjadi juara dan membanggakan nama negara dan sekolah saya,” kata Vanneshia Swiegl Lee, siswa POS. Para pemenang Kompetisi Sempoa Internasional yakniVanneshia Swiegl Lee (E3 Pacific) Champion (Foundation 3); Yani Chandra (E4 Arabian) 2nd runner up (Advance 4); Freddy Chandra (E5 Fuji) 2nd runner up (Advance

4); Richard B. Cuthbert (E1 Amazon) 3rd runner up (Foundation 2); Felicia (E4 Syrian) 3rd runner up (Advance 1); Jevinca Djunawi (E4 Syrian) 2nd runner up (Advance 1); Rivania Carolin (E5 Everest) 3rd runner up (Advance 4); Novalia Carolin (JH2 MG) 3rd runner up (Grand Module B); George Rusmin Fong (E3 Medi) Consolation (Foundation 2); Evelyn (E5 Himalaya) Consolation (Advance 2).(rel)

dan mengupayakan modal bersama untuk pembelian bahan baku kertas koran dengan harga murah tanpa harus melihat oplah dari masing-masing perusahaan penerbitan pers. “Untuk menghadapi perusahaan pers bermodal besar dengan oplah ratusan ribu eksemplar per hari, berskala nasional dan disebut-sebut memiliki pabrik kertas sendiri, SPS Cabang Sumut perlu mengadakan modal bersamauntukpembelianbahan baku kertas dengan harga murah namun kualitas baik,” ujarnya. Selain itu, sudah waktunya SPS berorientasi ke bisnis (menghasilkan) demi kepentingan anggota dan kemajuan organisasi ke depan. “Kan masing-masing media sudah punya segmen pasar.Yangterpenting,marisamasama kita menghitung berapa biaya penerbitan koran,” ujar Fauzi seraya menambahkan, koran daerah masih bisa eksis ter-

bit asalkan anggota SPS bersatu. Sementara itu Ketua SPS Cabang Sumut H Teruna Jasa Said di dampingi sejumlah pengurus antara lain Wakil Ketua H. Baharuddin, H. Bahtiar Tanjung, Sekretaris H. Farianda Putra Sinik,Wakil Sekretaris Drs. Jumian Situmorang, Bendahara Dessy Fifi Septiani, Komisaris M Erwin, Drs. Arifin Butarbutar dan Direktur Eksekutif HM Zaki Abdullah menyampaikan tentang terbentuknya kepengurusan SPS Cabang Sumut periode 2011-2015 hasil Musyawarah Cabang pada 19 Oktober 2011. Sekretaris Farianda Putra Sinik mengatakan, setelah kepengurusan terbentuk, SPS Cabang Sumut telah beraudiensi ke Harian Sumut Pos dan sekarang ke Harian Mimbar Umum. “Harapan sebagai pengurus, SPS ke depannya lebih baik lagi dan keanggotaannya bisa berkembang dari 16 peru-

sahaan penerbitan pers saat ini”, ujarnya. Sementara itu Direktur Eksekutif SPS Cabang Sumut HM Zaki Abdullah menyebutkan, dalamkepengurusanSPSCabang Sumut periode 2011-2015, tercantum lima tokoh pers daerah ini yang duduk dalam jajaran Dewan Penasehat yakni HM Fauzi Lubis (Mimbar Umum), dr Hj Rayati Syafrin (Waspada), Ibrahim Sinik (Medan Pos), Supandi Kusuma (Analisa) dan Ramlah Hutagalung (SIB). Zaki Abdullah juga mengatakan, pelantikan pengurus SPS Cabang Sumut periode 20112015 akan dilaksanakan pada 23 November 2011 oleh Ketua Umum DPP SPS Dahlan Iskan. “Bersamaan dengan pelantikan itu, kita minta ada salah satu program SPS Pusat yang dilaksanakan di Medan, seperti lokakarya atau seminar sehari,” tandasnya. (m28)

Waspada/Ismanto Ismail

KANIT Binmas Polsek Medan Baru Iptu Raswan Effendi,S.Psi member pengarahan terhadap pelajar SMA yang kedapatan berada di warnet Jln. Jamin Ginting/Padang Bulan Medan pada jam sekolah, Selasa (8/11).

Binmas Polsek Medan Baru Pergoki 10 Pelajar Bolos MEDAN (Waspada): Binmas Polsek Medan Baru memergoki 10 pelajar SMA yang bolos sekolah dan nongkrong di warnet kawasan Jln. Jamin Ginting, Padang Bulan, Selasa (8/11) pagi sekira pukul 10:00. Informasi yang diperoleh Waspada di lapangan, para pelajar yang masih mengenakan seragam SMA itu dipergoki Kanit Binmas Polsek Medan Baru Iptu Raswan Effendi,S.Psi bersama Panit I Aiptu Ganefo Sembiring,SH, dan personelnya ketika melakukan sosialisasi dengan memasang stiker di salah satu warnet. Stiker yang disebar ke sejumlah warnet tersebut bertuliskan larangan bermain internet bagi pelajar yang mengenakan seragam sekolah

terutama pada saat jam belajar, membawa/menggunakan narkoba dan sajam, membuka situs-situs porno, bermain judi dan berbuat mesum. Ketika memasang stiker di salah satu warnet kawasan Jln. Jamin Ginting, Padang Bulan, polisi memergoki pelajar berseragam SMA dan sebagian diantaranya sedang merokok. Melihat hal tersebut, Kanit Binmas Polsek Medan Baru Iptu Raswan Effendi,S.Psi langsung mengumpulkanparapelajartersebut dan memberi pengarahan. “Jika dipergoki lagi berada di warnet pada jam belajar, mereka langsung diamankan untuk dimintai keterangan. Dalam kasus pelajar bolos sekolah itu, kita akan memanggil kepala

sekolah dan orangtua murid agar dilakukan pembinaan lebih lanjut,” tegas Raswan. Sementara itu, Kapolsek Medan Baru AKP Dony Alexander, SH,SIK mengatakan, pihaknya melakukan sosialisasi melalui pemasangan stiker di warnet agar terjalin koordinasi kerja dengan pemilik/pengusaha warnet dalam mengantisipasi adanya pelajar bolos sekolah dan kenakalan remaja lainnya. “Polsek Medan Baru telah menyebar stiker di 80 warnet dan belasan hotel melati. Diharapkan pihak pemilik/pengelola warnet bisa bekerjasama dengan polisi dalam upaya menekan kasus kenakalan remaja terutama para pelajar,” demikian Dony. (m36)

Pemahaman Masyarakat Tentang HAM Masih Minim


PARA pemenang Kompetisi Sempoa Internasional foto bersama usai menerima hadiah dan penghargaan.

MEDAN (Waspada): Pemahaman masyarakat terhadap persoalan Hak Azasi Manusia (HAM) di Indonesia masih sangat minim. Ini terbukti dari data yang pernah dilaporkan Komnas HAM, bahwa dari ribuan laporan pengaduan yang masuk, hanya 15 yang benarbenar terkait dengan pelanggaran HAM. Hal tersebut dikatakan BPPC Pusat Studi Hak Asasi Manusia (Pusham) Universitas Negeri Medan (Unimed) M Fahmi Siregar di sela-sela Workshop Pengembangan Payung Penelitian HAM Pusham Unimed di ruang pertemuan lantai III, Gedung Lemlit Unimed, Rabu (2/11). “Dari ribuan kasus laporan pengaduan yang diterima Komnas HAM tersebut, hanya 15

laporan yang benar-benar pelanggaran HAM dan itupun hanya tujuh yang diproses sedangkan selebihnya laporan dicabut. Ini menunjukkan bahwa pemahaman masyarakat terhadap HAM masih sangat minim,” ujarnya. Sementara itu, Workshop Pengembangan Payung Penelitian HAM tersebut menghadirkan narasumber Azizul Kholis (Sekretaris Dewan Riset Daerah Provinsi Sumatera Utara) dan Majda El Muhtaj (Kepala Pusham Unimed). Kegiatan tersebut merupakan tindak lanjut dari upaya merekonstruksi bentuk danragampenelitianHAMdalam bentuk payung penelitian di lingkungan Lemlit Unimed. Kepala Pusham Unimed Majda El Muhtaj mengatakan, sekalipun wacana HAM telah

menggelinding deras di Indonesia, namun kenyataannya masih ditemukan kendala akademis dalam memposisikan kajian HAM ke dalam penelitian ilmiah. Untuk itulah, katanya, melalui workshop ini akan membuka cakrawala pendekatan studi HAM secara multidisipliner. “Workshop ini diharapkan mampu menghasilkan pemahaman yang utuh dalam melihat kajian HAM secara akademis dan membekali calon-calon peneliti dalam melakukan penelitian HAM,” katanya. Payung penelitian HAM merupakan pedoman yang dijadikan acuan praktis dalam melakukan penelitian HAM di Indonesia, khususnya di Sumatera Utara. (m41)

Medan Metropolitan

WASPADA Rabu 9 November 2011

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 08.40 12.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Bandung Surabaya

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7986 QZ-7610

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 05.45 08.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Bandung QZ-7487 12 Surabaya QZ-7611 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00



MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.45

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 15.00

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Jadwal Perjalanan Kereta Api No KA

Nama KA




U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang 08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.


Tidak Tertib, Angkutan Ditindak MEDAN (Waspada): Kapolresta Medan Kombes Tagam Sinaga, SH menegaskan, jajaran Sat Lantas akan menindak tegas seluruh jenis angkutan seperti angkutan kota (angkot) dan beca bermotor (betor) yang tidak mematuhi peraturan lalu lintas. Selain itu, polisi juga merazia seluruh terminal liar. “Semua angkutan dan terminal liar ditertibkan dalam minggu ini,” tegas Tagam didampingi Kasat Lantas Kompol I Made Ary Pradana pada acara temu ramah dengan pengemudi angkot dan betor dalam rangka menciptakan Keamanan, Keselamatan, Ketertiban dan Kelancaran Berlalulintas (Kamseltibcar Lantas) di kota Medan yang digelar di Wisma Kartini, Selasa (8/11). Sebelum dilakukan penindakan, lanjut Tagam, pihaknya melakukan sosialisasi selama sepekan. “Dalam minggu ini dilakukan sosialisasi terlebih dahulu. Setelah itu dilakukan penindakan berupa tilang,” kata Tagam yang merupakan calon jenderal setelah dinyatakan lulus pada sekolah perwira tinggi. Menurut Tagam, kesadaran pengendara harus ditingkatkan agar mematuhi peraturan lalulintas. “Kenapa para sopir di Jakarta bisa tertib berlalulintas. Padahal mereka umumnya perantau dari Sumut. Karena itu, Medan harus bisa lebih baik dan lebih tertib. Dalam hal ini, para sopir harus disiplin berlalulintas mulai sekarang,” jelas Tagam. Selain itu, Polresta Medan melalui Sat Lantas terus melakukan penertiban terhadap terminal liar yang masih beroperasi sehingga menimbulkan kemacetan lalulintas. “Polisi akan memberikan tindakan tegas terhadap pengelola terminal liar dan pengemudi angku-

tan umum sesuai peraturan yang ada,” tegas Tagam. Penertiban terminal liar di sejumlah tempat sudah dilakukan sejak 29 September hingga 5 November 2011. Bahkan, polisi sudah mengeluarkan 65 surat tilang ditempat serta menyita angkutan roda empat sebanyak 55 unit dan STNK 10 lembar. “Razia yang dilakukan ini merupakan lanjutan dari razia sebelumnya,” jelas Tagam. Sebelum dilakukan razia, Polresta Medan mengundang para pengusaha angkutan umum yang beroperasi di terminal liar, Jumat (11/11). “Kita akan mengundang semua pengusaha angkutan umum yang beroperasi di terminal liar. Kemudian mereka diberi pemahaman dan sosialisasi tentang peraturan lalulintas sehingga menimbulkan kesadaran berlalulintas,” jelasnya. Polresta Medan juga melakukan penertiban terhadap truk pengangkut pasir di sejumlah lokasi. Tercatat ada 386 jumlah pelanggaran dan menyita 25 unit truk,72 lembar SIM dan 290 lembar STNK. Mengenai kemacetan yang terus terjadi di Kota Medan, Tagam menjelaskan, daerah ini merupakan kota besar dan jumlah kendaraan terus bertambah setiap tahun. Untuk menghindari kemacetan yang terus terjadi, diperlukan kesadaran masyarakat saat mengendarai kendaraan bermotor dan tertib


Ditilang Dalam upaya menciptakan tertib lalulintas di Kota Medan, Sat Lantas Polresta Medan telah melakukan berbagai penindakan terhadap pengendara sepedamotor tanpa helm dan tidak menyalakan lampu pada siang hari. Sampai saat ini, Sat Lantas Polresta Medan telah mengeluarkan 1.568 tilang terhadap pengendara sepedamotor tanpa helm. Sedangkan 2.101 surat tilang diberikan kepada pengendara sepedamotor yang tidak menyalakan lampu pada siang hari. Di samping itu, Sat Lantas Polresta Medan menyita 142 unit sepedamotor, 23 unit betor dan 1.746 lembar SIM serta STNK 1.758 lembar. Sementara itu, Kasat Lantas Polresta Medan Kompol I Made Ary Pradana mengatakan, pihaknya terus melakukan sosialisasi Undang-undang 22 tahun 2009 tentang Lalu Lintas. Misalnya, sepedamotor wajib menyalakan lampu besar pada siang hari. Sosialisasi ini dilakukan ke sekolah-sekolah sejak 1 Mei hingga 7 Okteber 2011 dengan sasaran 2.085 siswa. ”Sosialisasi UU 22 Tahun 2009 sudah dilakukan ke sekolah-sekolah di Kota Medan. Selain itu dilakukan sosialisasi tentang prosedur pengurusan SIM dan Safety Riding,” jelas Made Ary Pradana. Berdasarkan data sejak Januari hingga November 2011, jumlah kecelakaan lalulintas mencapai 878 kasus dengan korban meninggal dunia 230 orang, luka berat 601, luka ringan 415 orang dengan kerugian materi sebesar Rp.1.743.650.000. (m39)

Pencuri Sepedamotor Dihajar Korbannya MEDAN (Waspada): Pencuri sepedamotor berinisial DSC babak belur dihajar korbannya pemilik sepedamotor Syafrizal Harahap, 37, warga Jalan Tanggukbongkar, Kecamatan Medan Denai, Senin (7/11) sekira pukul 09:00. Tersangka DSC kemudian diboyong ke Mapolsek Percut Seituan untuk menjalani pemeriksaan. Informasi yang diperoleh di kepolisian, Senin (7/11), kejadian pencurian sepedamotor itu berawal saat korban Syafrizal Harahap yang bekerja sebagai buruh bangunan di Jalan Baru Gang Mekar Desa Tembung, Kecamatan Percut Seituan, memarkirkan sepedamotor Supra BK 5076 CG di depan lokasi bangunan. Karena datangnya terlambat dan buru-buru, korban lupa mencabut kunci kontak dan tetap tergantung di sepedamotornya. Tersangka DSC, 29, warga Jalan Letda Su-jono Gang Surya, Kelurahan Bantan, Kecamatan Medan Tembung, yang melintas di depan lokasi bangunan tersebut melihat sepedamotor yang kunci kontaknya masih tergantung. Padahal, niat semula tersangka yakni untuk mencari pekerjaan di lokasi bangunan tersebut. Berpura-pura duduk di atas sepedamotor korban, tersangka kemudian melarikannya. Dia mendorong sepedamotor korban hingga ke luar pagar. Namun, aksinya diketahui oleh kenek bangunan yang mengenali sepedamotor korban dan me-

nanyakan tersangka mau dibawa kemana Honda Supra itu. DSC berdalih telah meminjam Honda Supra itu kepada korban Syafrizal. Tidak percaya jawaban tersangka, kenek bangunan itu memanggil korban. Syafrizal melihat sepedamotornya ditangan tersangka langsung menghajarnya DSC hingga babak belur di wajahnya. Selanjutnya tersangka DSC di-

amankan oleh petugas Polsek Percut Seituan. Kanit Reskrim Polsek Percut Sei Tuan AKP Faidir Chan membenarkan penangkapan tersangka DSC. “Saat ini tersangka masih menjalani pemeriksaan di ruang juper, akibat perbuatannya tersangka akan dijerat pasal 363 KUHP dengan ancaman hukuman 5 tahun penjara” sebutnya. (h04)

Waspada/Rudi Arman

KAPOLRESTA Medan Kombes Tagam Sinaga didampingi Kabag Ops Kompol Yushfi Nasution dan Kasat Lantas Kompol I Made Ary Pradana foto bersama sopir Angkot usai acara temu ramah di Wisma Kartini, Selasa (8/11).

Polisi Amankan 13 Pelajar SMA Berkendara Ugal-ugalan MEDAN (Waspada): Petugas Polsekta Medan Kota mengamankan 13 pelajar SMA yang mengendarai sepedamotor secara ugalugalan dari kawasan Jalan Juanda Medan, Minggu (6/11) dinihari. Dari mereka, polisi mengamankan delapan sepedamotor tanpa dilengkapi surat kendaraan dan kaca spion. “Mereka ditangkap karena berkendara dengan ugal-ugalan dengan memenuhi ruas jalan tanpa menggunakan helm. Tindakan mereka dapat membuat situasi tidak kondusif,” kata Kapolsekta Medan Kota Kompol Sandy Sinurat, Senin (7/11). Konvoi kendaraan tersebut semula diikuti patroli anggota Brimob dan segera menghubungi personel Polantas Polsek Medan Kota agar iring-iringan itu diamankan. Begitu tiba di Jalan Juanda, kata Sandy, petugas menghentikan belasan sepedamotor itu dan memba-

wanya ke Mapolsekta. Hasil pemeriksaan, delapan sepedamotor tidak memenuhi perlengkapan dan hampir seluruh pengendara tidak memakai helm sehingga di tilang. “Mereka semua akhirnya dikembalikan kepada orangtuanya setelah diberi peringatan dan imbauan tidak mengulangi perbuatannya, serta melengkapi kendaraannya bila berkendara,” sebut Sandy. Dia mengatakan, pengamanan terhadap konvoi kendaraan saat malam hingga dinihari dilakukan berdasarkan instruksi pimpinan guna mengantisipasi dan mempersempit ruang gerak para geng kereta. Sandy menambahkan, pihaknya sudah beberapa kali melakukan imbauan ke sekolah-sekolah yang berada di jajaran Polsekta Medan Kota agar parasiswatidakmengikutigengkeretayangsempat menimbulkan keresahan di masyarakat. (m27)

Senpi Kanit Dan Panit Diperiksa Propam Polresta MEDAN (Waspada): Propam Polresta Medan melakukan pemeriksaan senjata api (senpi) milik seluruh Kanit dan Panit di jajaran Polsekta sehubungan dengan adanya informasi hilangnya senpi salah seorang perwira, Senin (7/11). Waka Polresta Medan AKBP Pranyoto yang dikonfirmasi Waspada usai pemeriksaan yang dilakukan Propam di Reskrim Unit Jahtanras Polresta Medan di lantai II mengatakan, pemeriksaan senjata ini rutin dilakukan Polresta Medan. “Hanya pemeriksaan rutin yang nantinya dilakukan terhadap seluruh anggota Polresta Medan. Untuk tahap pertama ini, seluruh perwira senpi diperiksa apakah izinnya sudah mati, sekaligus kita melakukan pengawasan terhadap senpi anggota,” sebutnya. Ketika ditanya pemeriksaan senpi ini karena ada masalah dengan anggota yang memiliki senpi, Pranyoto menyatakan tidak ada. “Hanya pemeriksaan rutin terhadap anggota Polresta Medan,” ujarnya. Sedangkan Kasi Propam AKP Benno Sidabutar ketika dikonfirmasi wartawan hasil pemeriksaan tersebut mengatakan, semua senpi milik perwira Polresta Medan masih ada dan tidak ada yang hilang. “Pemeriksan dilakukan untuk memeriksa kepemilikan senpi

milik para Kanit Reserse, Kanit Sabhara, Kanit Lantas, Kanit Binmas juga senpi milik para kepala unit (Panit),” katanya. Dijelaskan Benno, pemeriksaan senpi dilakukan dengan mengecek nomor senjata perwira yang bersangkutan. Dari hasil pemeriksaan ini nanti bisa diketahui apakah ada senpi milik perwira di Polsek yang hilang atau tidak. “Kalau nanti ada yang kehilangan senpi, perwira tersebut akan kita tindak karena dianggap lalai,” ujarnya. Pantauan Waspada, sekira pukul 16:00, seluruh perwira di jajaran Polsek sudah berdatangan di Polresta Medan. Setelah berkumpul di depan Propam Polresta Medan, mereka kemudian berjalan menuju ke ruang Jahtanras yang ada di lantai II gedung Sat Reskrim. Setelah mendengar arahan dari Waka Polresta Medan AKBP Pranyoto yang didampingi Kasi Propam AKP Benno Sidabutar, petugas Propam dan Paminal melalukan pemeriksaan senpi seluruh perwira sampai selesai. Wartawan yang mencoba mengambil foto pemeriksaan tidak diperbolehkan oleh anggota Propam yang berjaga di pintu masuk dengan alasan perintah pimpinan karena pemeriksaan senpi ini sifatnya internal. (m39)

Kapoldasu Diminta Beri Penghargaan Kapolresta Dan Kasat Reskrim

Waspada/Andi Aria Tirtayasa

TERSANGKA DSC (tangan diborgol) disaksikan Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan sedang memperagakan bagaimana cara membawa lari sepedamotor milik Syafrizal Harahap di depan lokasi bangunan di Jalan Baru Gang Mekar, Desa Tembung, Kecamatan Percut Seituan, Senin (7/11).

MEDAN (Waspada): Lembaga Cegah Kejahatan Indonesia (LCKI) Sumut meminta Kapoldasu memberikan penghargaan kepada Kapolresta Medan dan Kasat Reskrim yang berhasil mengungkap kasus pembunuhan warga AS dengan menangkap dua pelakunya. “LCKI Sumut memberikan dukungan sepenuhnya kepada Kapolresta Medan Kombes Tagam Sinaga, SH,MH dan Kasat Reskrim Polresta Medan AKP Yoris Marzuki SIK, SH, karena telah berhasil mengungkap serta menangkap dua pelakunya,” kata Ketua LCKI Sumut Drs. Parlin Sihotang, SE,MSi, Minggu (6/11). Menurut Parlin, keberhasilan Tim Serse Polresta Medan patut diacungkan jempol karena bukan tidak sulit mengungkap kasus perampokan dan pembunuhan yang semula

belum diketahui identitas para pelakunya. Biasanya, kasus-kasus tersebut sangat lambat bisa terungkap oleh aparat kepolisian, bahkan ada yang nggak terungkap. Namun Tim Serse Polresta Medan bisa mengungkap kasus perampokan yang berujung dengan kematian. “Kalau tidak bekerja tanpa mengenal rasa lelah dan letih, mustahil Tim Serse Polresta Medan pimpinan Kapolresta Kombes Pol Tagam Sinaga dan Kasat Reskrim AKP Yoris Marzuki dengan cepat dapat mengungkap kasus perampokan ini,” ujar Parlin. Untuk itu, LCKI Sumut menilai Kapolresta Kombes Pol. Tagam Sinaga, dan Kasat Reskrim AKP Yoris Marzuki, serta anggotanya sudah pantas diberikan penghargaan khusus oleh pimpinannya Kapoldasu dan Kapolri. (m39)

Medan Metropolitan


WASPADA Rabu 9 November 2011

Penyertaan Modal PD Perhotelan Ditunda Waspada/Ist

PENGURUS Happy Taekwondo Club Medan memberikan daging kurban kepada orangtua atlet, Minggu (6/11).

Happy Taekwondo Club Potong Hewan Kurban MEDAN (Waspada): Happy Taekwondo Club Medan berpusat di Kompleks DPR Jln. Purwosari, Pulo Brayan Bengkel, melaksanakan penyembelihan hewan kurban 2 ekor sapi, Minggu (6/11). Daging kurban sebanyak 200 paket, dibagikan kepada para atlet, klub-klub taekwondo dan fakir miskin. “Pemotongan hewan kurban ini atas partisipasi dan kerjasama pengurus serta orangtua atlet yang berlatih di Happy Taekwondo Club Medan,” ujar Ketua Happy Taekwondo Club Medan, Muhammad Rifai di dampingi Anuar Saleh Nasution selaku sekretaris kepada wartawan. Menurutnya, Happy Taekwondo Club Medan yang diresmikan 20 Mei 2011, terus meningkatkan pembinaan atlet taekwondo dengan tiga program, yakni, peningkatan prestasi, peningkatan organisasi dan peningkatan silaturahmi. “Pemotongan hewan kurban ini salah satu program peningkatan silaturahmi,” katanya. Selain itu, dengan pemotongan hewan kurban, jiwa kita semakin terhubung dengan ketaqwaan kepada Allah SWT. “Kita dapat memupuk keikhlasan, kejujuran dan kesabaran yang membimbing kita mencintai Allah dan akhirnya juga mencintai makhluk ciptaanNya,” kata Anuar Saleh.(m27)

LIRA Sumut Berbagi Dengan Sesama MEDAN (Waspada): DPW Lumbung Informasi Rakyat (LIRA) Sumut bekerjasama dengan Yayasan Annadi Al-Arabi Indonesia, Minggu (6/11), menyembelih 13 ekor hewan kurban terdiri dari dua lembu dan 11 kambing. Penyembelihan hewan kurban yang berlangsung di Jln. Lembu tersebut dipandu Gubernur LIRA Sumut H. Rizaldi Mavi, MBA di dampingi Sekretaris LIRA Sumut Oscar Siagian SKM unsur pembina lainnya seperti Rusdi Lubis, SH dan dr. Candra Syafei, SpOG. Bertindak sebagai koordinator pemotongan hewan kurban Chalid Ahmad Balatif dan Yusuf Baoda. Saat ditemui wartawan di Graha LIRA Sumut Jln. Bukit Barisan II Medan, Senin (7/11), Rizaldi Mavi mengatakan, penyembelihan hewan kurban ini sebagai bentuk kepedulian atau berbagi kasih kepada sesama. Daging kurban tersebut dibagi-bagikan kepada keluarga besar Yayasan Annadi Al-Arabi Indonesia, kaum dhuafa dan warga muslim sekitar lokasi. LIRA Sumut dan Yayasan Annadi Al-Arabi Indonesia sepakat akan melaksanakan penyembelihan kurban setiap tahun pada perayaan Idul Adha. (m46)

MEDAN (Waspada): DPRD dan Pemerintah Provinsi Sumatera Utara (Pemprovsu) akhirnya sepakat menunda penyertaan modal untuk Perusahaan Daerah (PD) Perhotelan senilai Rp5 miliar. Selanjutnya dewan meminta Pemprovsu mengevaluasi keuangan dan kinerja perusahaan tersebut. Penundaan pemberian penyertaan modal PD Perhotelan itu dilakukan setelah Badan Anggaran (Banggar) DPRD melakukan pembicaraan dengan Tim Anggaran Pemerintah Daerah (TAPD) saat membahas RPAPBD 2011. Hasil pembicaraan itu disampaikan pada rapat paripurna dewan, Selasa (8/11). Juru bicara Banggar DPRDSU Muslim Simbolon mengatakan, setelah usulan penyertaan modal PD Perhotelan dibahas, akhirnya diputuskan untuk ditunda. Selanjutnya, Pemprovsu diminta mengevaluasi keuangan dan kinerja PD Perhotelan. Hasil evaluasi itulah nantinya yang akan menentukan kelangsungan perusahaan daerah tersebut. Masih layak dipertahankan untuk mendapat penyertaan modal atau dibubarkan saja. Sementara itu, berbagai kritikan masih terus dilontarkan fraksi-fraksi DPRDSU terhadap kinerja Pemprovsu, terutama untuk bidang pendidikan. Dewan menilai, Pemprovsu belum mampu memenuhi anggaran 20 persen untuk pendidikan, sebagaimana digariskan konstitusi. Fraksi Partai Amanat Nasional (FPAN) menyebutkan, ketentuan 20 persen anggaran untuk pendidikan itu tidak untuk

ditawar-tawar. Menurut juru bicara FPAN Irwansyah Damanik, tidak ada logika yang dapat diterima untuk melegalisasi pengingkaran atas konstitusi dengan dalih mendesaknya kebutuhan untuk hal lain-lain. Disebutkan Irwansyah Damanik, alokasi anggaran sebesar 20 persen sesungguhnya merupakan bukti kesadaran pemerintah pada visi pembangunan selama Orde Lama dan Orde Baru. Karena itu, ketentuan yang digariskan melalui konstitusi itu sifatnya memaksa. ‘’Karenanya, FPAN tidak ikut bertanggungjawab atas pelanggaran konstitusi ini dan akibatakibatnya dikemudian hari,’’ kata Irwansyah Damanik. Tingkatkan kualitas Senada dengan itu, juru bicara Fraksi Partai Persatuan Pembangunan (FPPP) Ahmad Hosen Hutagalung juga meminta Pemprovsu benar-benar memprioritaskan program pendidikan. Katanya, kualitas pendidikan di Sumut masih perlu ditingkatkan sesuai perkembangan zaman. Menurut Hosen, hasil riset UNDPmenyebutkanbahwamutu pendidikan bangsa Indonesia (termasuk Sumut) masih memprihatinkan. Jauh di bawah Singapura, Malaysia, Thailand dan Filiphina bahkan Vietnam. Riset ini juga menjelaskan mutu pendidikan Indonesia berada pada peringkat 107 dari 174 negara. ‘’Sementara di Asia, Indonesia berada di urutan terakhir dari 12 negara,’’ katanya. Fraksi ini juga menyoroti terlambatnya pengajuan dan

pembahasan RPAPBD Sumut tahun 2011. Kata Ahmad Hosen Hutagalung, harus diakui bahwa keterlambatan itu dikarenakan situasi politik yang ditandai kurang harmonisnya hubungan legislatif dan eksekutif. Sesuai Permendagri No.13 tahun 2006 disebutkan bahwa pengajuan pembahasan RPAPBD dilakukan bulan Juli dan persetujuannya dilakukan pada bulan Agustus, sehingga pembahasan APBD murni dapat dimulai awal September. Sekarang dengan waktu yang tinggal 1,5 bulan lagi, FPPP sangat mengkhawatirkan pelaksanaan PAPBD ini. ‘’Walaupun Plt. Gubsu telah berjanji akan berusaha sekuat tenaga agar pelaksanaannya tepat waktu,’’ kata Hosen Hutagalung. Setuju PAPBD Meski diwarnai banyak kritikan, saran dan masukan, namunakhirnyasembilanfraksi(minus FPPRN) dalam pendapat akhirnya menyetujui Perubahan Anggaran Pendapatan dan Belanja Daerah (PAPBD) yang dilakukan Pemprovsu. Pada PAPBD ini, Pemprovsu mengajukan pertambahan anggaran Rp486,9 miliar. Dengan begitu total APBD Sumut tahun 2011 menjadi Rp5,1 triliun lebih. Penambahan anggaran ini seluruhnya digunakan untuk belanja tidak langsung. Yakni diperuntukkan bagi keperluan aparatur pemerintahan, seperti peningkatan gaji, tunjangan, biaya perjalanan dan lainnya. Sementara biaya langsung (infrastruktur) berkurang Rp5 miliar lebih. (m12)

Partai Golkar Medan Area Sembelih Dua Lembu MEDAN (Waspada): Pengurus Kecamatan (PK) Partai Golongan Karya (Golkar) Medan Area menyembelih dua ekor lembu untuk dibagikan kepada kaum dhuafa yang berada disetiap kelurahan Kecamatan Medan Area, Minggu (6/11). Dalam penyembelihan hewan kurban yang dihadiri selain para pengurus PK Partai Golkar Medan Area serta masyarakat setempat yang dilaksanakan di halaman Sekretariatnya Jalan Tembaga No 24 Medan. Ketua PK Partai Golkar Medan Area M Yani didampingi Sekretaris Zaharuddin Pane mengatakan, kegiatan kurban ini merupakan rutinitas PK Golkar Medan Area setiap tahunnya pada saat hari raya Idul Adha. Tahun ini menyembelih 2 ekor lembu yang dibagikan kepada kaum dhuafa di setiap kelurahan Kecamatan Medan Area. “Sedikitnya 300 bungkus daging kurban kita bagikan kepada kaum dhuafa, sebagai wujud rasa kepedulian PK Golkar Medan Area di hari raya Idul Adha tahun ini,” sebutnya. Menurutnya, dengan acara pembagian daging hewan kurban ini diharapkan dapat lebih mempererat lagi tali silahturahmi masyarakat dengan Partai Golkar, yang nantinya dapat menyerap suara rakyat untuk memenangkan Golkar pada Pemilu 2014. Ketika disinggung tentang upaya PK Golkar Medan Area mengambil hati masyarakat,Yani mengatakan, kalau dirinya beserta para pengurus lainnya akan selalu berusaha semaksimal mungkin untuk mengambil hati masyarakat yang berada di Kecamatan Medan Area guna memenangkan Golkar pada Pemilu nanti.(m39)

Cabang Sumut. “Mudah-mudahan tahun depan dapat lebih ditingkatkan lagi,” harapnya. Dari tiga ekor lembu yang disembelih, satu ekor merupakan kurban dari keluarga Indra Buana Said. Sedangkan dua ekor lagi masingmasing kurban dari Drs. Muhammad Syahrir; Edward Thahir, S.Sos; Drs. Hendra DS; Farianda Putra Sinik; Zulkifli Husein, SE; Zulfan Ridho Ananda bin Zultaufik Nasution; Shah Alam Putra bin H. Agus S Lubis. Kemudian H. Solahuddin bin H. Abdul Gaffar Nasution; Ahmad Rivai bin Fadlan Parinduri; Muhammad Zul Ardi bin Muhammad Yunan; Yoesdinoer bin Nurdin; Endang Tisniwati binti H. M. Turso; Irwan Asril bin Maralaut Simatupang dan Suharti binti Sugeng Padmowiyoto. Pendistribusian daging kurban dibagikan kepada yang berhak menerima melalui 360 lembar kupon, termasuk warga di sekitar lahan perumahan PWI Cabang Sumut. (rel/m08)

Menyinggung peluangnya menjadi calon Gubsu, Herry Lontung enggan bercerita panjang lebar mengingat periode-sasi pasangan Syamsul – Gatot masih tersisa dua tahun lagi. “Kita belum membicarakan masalah pencalonan Gubsu. Siapa saja berhak mencalonkan dan dicalonkan oleh partai karena semuanya tergantung keputusan partai,” ujarnya. Namun Herry Lontung mengaku siap dicalonkan sebagai Gubsu periode 2013-2018 jika diamanahkan oleh Partai Hanura untuk memimpin Provinsi Sumut lima tahun kedepan. “Sebagai kader partai, saya siap jika dicalonkan. Tapi, itu kan harus melalui mekanisme di proses internal. Kita tunggu saja apa keputusan partai karena terlalu dini untuk membicarakan masalah itu,” kata Herry Lontung. (m50)


Sekretaris Golkar Sumut H.Hardi Mulyono, SE, MAP di dampingi unsur pengurus saat menyaksikan penyembelihan hewan kurban.

Golkar Sumut Sembelih 44 Kurban MEDAN (Waspada): DPD Partai Golkar Sumatera Utara menyembelih 44 kurban terdiri dari 37 ekor kambing dan 7 ekor lembu di Sekretariat Jln. KH Wahid Hasyim Medan, Selasa (8/11) pagi. Hewan kurban itu didistribusikan ke-33 kabupaten/kota se-Sumatera Utara. Wakil Ketua DPD Partai Golkar Sumut H. Wagirin Arman, S.Sos di dampingi Sekretaris H. Hardi Mulyono, SE, MAP me-

nyatakan, penyembelihan hewan kurban yang dilakukan di Kantor Golkar itu merupakan agenda rutin setiap tahun. “Ini sebagai bukti Partai Golkar masih terus eksis dan dicintai masyarakat. Daging kurban yang sudah disembelih itu akan dibagikan langsung kepada masyarakat dan kaum dhuafa yang membutuhkannya,” ujar Wagirin didampingi HM Hanafiah Harahap SH, Dra

Hj Eli Seniwati , Drs H Tukarimin Adenan dan Syahril Siregar. Prosesi penyembelihan kurban disaksikan masyarakat di sekitar Kantor Golkar juga para kader dan pengurus partai di antaranya Drs H Isma Fadli Pulungan, SH, Mulkan Ritonga dan Ramli Arianto. Dari 7 ekor lembu yang disembelih tersebut, satu ekordiantaranyamerupakankurbandariKetuaUmumDPPPartai Golkar Aburizal Bakrie.(m25) Waspada/Amir Syarifuddin

COUNTRY Manager Muslim Hands Internasional untuk Indonesia H. Khairul Rahmi (ketiga dari kanan) bersama masyarakat Jln. Gaharu Medan, Senin (7/11) menyembelih kurban.

Muslim Hands Kurban 30 Sapi


KNPI Medan Sembelih 7 Hewan Kurban

Waspada/Rudi Arman

MEDAN (Waspada): Persatuan Wartawan Indonesia (PWI) Cabang Sumatera Utara (Sumut) menyembelih tiga ekor lembu di lahan perumahan PWI Cabang Sumut Jln PWI (Gg. Tawon) Dusun XVI Desa Sampali, Kecamatan Percut Seituan, Kabupaten Deliserdang, Selasa (8/11). Penyembelihan kurban tersebut disaksikan langsung Ketua PWI Cabang Sumut Drs. Muhammad Syahrir; Sekretaris Edward Thahir, S.Sos; Bendahara Drs. Agus S Lubis; Wakil Sekretaris Zul Anwar Ali Marbun; Ketua Tim Tanah dan Pelaksana Pembangunan Graha PWI Sumut Abyadi Siregar, unsur Pengurus PWI Cabang Sumut lainnya serta Kades Sampali Ir. Hj. Sri Astuti. Ketua PWI Cabang Sumut Drs. Muhammad Syahrir mengatakan, penyembelihan hewan kurban pada perayaan Idul Adha merupakan wujud kepedulian sosial keluarga besar PWI

MEDAN (Waspada): Anggota DPR RI H. Herry Lontung Siregar dan keluarganya menyerahkan tiga kurban untuk disembelih dan dibagi-bagikan kepada kader Partai Hanura serta warga tidak mampu di Kota Medan. Penyembelihan tiga ekor lembu tersebut berlangsung di Jln. Pimpong Medan, Senin (7/ 11). Turut hadir Wasekjen DPP Partai Hanura Natalis Situmorang, Ketua DPC Dasril, pengurus DPD Abdul Manaf, Ibrahim Husin, Alex A Kawilarang SIP, Nanang G Soetarjo, Ricky P Siregar, Ardjoni Munir, Ketua Panitia Misnun A Nugraha dan pengurus PAC se Kota Medan. “Penyembelihan kurban ini dilakukan secara rutin setiap tahun sebagai wujud rasa syukur dan bentuk pengorbanan sesuai ajaran Islam,” ujar Herry Lontung kepada wartawan di sela-sela penyembelihan kurban tersebut.

KETUA KNPI Medan Zulham Effendi Siregar (pakai peci) didampingi M Said, SP (kiri) menyerahkan daging kurban, Senin (7/11).

PARA pengurus PK Golkar Medan Area ketika menyembelih lembu yang dagingnya dibagikan kepada kaum dhuafa di sekretariat Jalan Tembaga No 24 Medan, Minggu (6/11).

PWI Sumut Sembelih Kurban

Herry Lontung Serahkan Tiga Kurban

PLN Kurban 7 Lembu, 4 Kambing MEDAN (Waspada): PT PLN (Persero) Wilayah Sumatera Utara melakukan penyembelihan hewan kurban sebanyak 7 ekor lembu dan 4 ekor kambing pada perayaan Hari Raya Idul Adha 1432 H, di kantor PLN Jln. Yos Sudarso No. 284 Medan, Minggu (6/11). Ketua panitia H. Al Arqam didampingi Sekretaris H. Syaiful Lubis dan Humas Yulizar W menyebutkan, daging hewan kurban tersebut disalurkan kepada panti asuhan Al Washliyah Pulo Brayan Medan, panti asuhan Bani Adam, masyarakat pinggir Sungai Mati, Titi Sewa Tembung, masyarakat sekitar kantor PT PLN Wilayah Sumut, serta pegawai setempat. Menurut Al Arqam, kurban tersebut berasal dari tabungan para pegawai yang disisihkan setiap bulan. Kurban ini sebagai bentuk rasa syukur para pegawai atas karunia yang diberikan Allah SWT untuk saling berbagi kepada masyarakat yang membutuhkan. Sebelum penyembelihan hewan kurban dilakukan, ustadz Ahmad Syafii Harahap, SAg menyampaikan tausyiah tentang semangat berkurban sebagaimana telah diajarkan Nabi Ibrahim dan anaknya Nabi Ismail. Karena itu, Ahmad Syafii mengajak masyarakat yang mampu melaksanakan kurban agar bisa saling berbagi. (m41)


KETUA PWI Cabang Sumut Drs. Muhammad Syahrir didampingi Sekretaris Edward Thahir, S.Sos; Bendahara Drs. H. Agus S Lubis dan unsur pengurus lainnya serta warga sekitar Gg. Tawon menyaksikan penyembelihan hewan kurban di lokasi lahan perumahan PWI Cabang Sumut Jln. PWI Dusun XVI Desa Sampali Kecamatan, Percut Seituan, Kabupaten Deliserdang, Selasa (8/11).

MEDAN (Waspada): Dewan Pengurus Daerah (DPD) KNPI Kota Medan melaksanakan penyembelihan tujuh ekor hewan kurban, yakni, lima ekor lembu dan dua ekor kambing, Senin (7/11) di depan kantor KNPI Medan, Jln. Merbabu. Sebelum penyembelihan hewan kurban, Ketua KNPI Medan Zulham Effendi Siregar menyerahkan secara simbolis hewan yang akan disembeli kepada panitia, selanjutnya daging hewan kurban dibagikan kepada kaum duafa dan warga tidak mampu. Zulham kepada wartawan mengatakan, kepedulian kepa-

da sesama seperti yang tersirat dari pelaksanaan ibadah kurban menjadi salah satu modal utama mencapai kemajuan. Bagi mereka yang memiliki kemampuan lebih membantu saudara yang kurang mampu, sebab berkurban merupakan wujud syukur atas nikmat yang diberikan Allah SWT sekaligus mewujudkan semangat solidaritas sosial melalui kemampuan untuk berbagi. Selain itu, kata Zulham, semangat berkurban bisa meningkatkan persaudaraan di antara pemuda yang tergabung di KNPI, khususnya generasi muda Islam. Menurut dia, deng-

an memupuk kepedulian serta kearifan sosial sedari muda, maka diharapkan potensi kepedulian itu terus berkembang di hati pemuda. Pelaksanaan kurban tahun ini, kata dia, merupakan kedua kali dilaksanakan KNPI Medan, dan penyembelian hewan kurban berasal dari pengurus KNPI Medan dan bantuan Pemko Medan. Tampak hadir PK KNPI se-Kota Medan dan pengurus KNPI Medan, diantaranya, Munawar Halil, Yose Rizal, Ruli Affandi, Oskar Jambak, M Said, Suhair i Ramadhan, Iwan Suherman dan Mandor. (m27)

MEDAN (Waspada): 30 Ekor sapi kurban disalurkan Muslim Hands Indonesia pada perayaan Idul Adha tahun ini. 20 Di antaranya disalurkan di Sumatera Utara dan 10 lainnya disebar ke daerah lain. “Di Indonesia, Muslim Hands telah menyalurkan kurban sejak 2005. Selain Sumatera Utara, pada tahun ini kurban juga disalurkan ke Aceh, Jawa Timur, Jawa Tengah dan Jawa Barat,” ujar Country Manager Muslim Hands Internasional untuk Indonesia H. Khairul Rahmi kepada wartawan disela-sela penyembelihan kurban di Jln. Gaharu Medan, Senin (7/11). Khairul mengatakan, 20 ekor sapi yang disalurkan Muslim Hands untuk Sumatera Utara disebar ke Medan, Deliserdang, Serdang Bedagai dan daerah lain yang dianggap sangat membutuhkan. “Dalam proses penyembelihan dan distribusi, kita melibatkan masyarakat di daerah

masing-masing. Baik yang terkait dengan lokasi penyembelihan, pembagian maupun penentuan hari penyembelihan,” jelasnya. Khairul menambahkan, Muslim Hands adalah Lembaga Swadaya Masyarakat (LSM) kemanusiaan yang berpusat di London. Di Indonesia, LSM ini berpusat di Kota Medan. Sejak pertama kali hadir di tanah air, pasca tsunami di NAD tahun 2004, Muslim Hands concern dengan berbagai kegiatan bantuan kemanusiaan di Indonesia. Kegiatan kurban tersebut memiliki sejumlah manfaat sosial kemasyarakatan. Dalam konteks itu Islam bermaksud mendidik umatnya agar memiliki kepekaan dan solidaritas tinggi terhadap sesama. “Kurban adalah media ritual selain zakat, infak dan sedekah yang disiapkan untuk mengejawantahkan sikap kepekaaan sosial itu,” tandasnya. (m28)

IAIN SU Sembelih 10 Hewan Kurban MEDAN (Waspada): Institut Agama Islam Negeri Sumatera Utara (IAIN SU) menyembelih hewan kurban sebanyak delapan ekor lembu dan dua kambing pada perayaan Idul Adha. Pemotongan dilaksanakan di Kampus II IAIN SU Jl.Williem Iskandar, Minggu (6/11). Ketua Panitia Kurban Syahruddin Siregar, MA mengatakan, peserta kurban di tahun 2011 M atau 1432 H ini sebanyak 58 orang yang terdiri dari jajaran pimpinan dan staf di lingkungan IAIN SU dan keluarganya, serta mitra kerja IAIN SU. Hewan kurban nantinya akan didistribusikan kepada orang-orang yang berhak menerima daging kurban (mustahak) selain dari para pekurban. “Sepertiga daging diserahkan kepada para pekurban, sedangkan dua pertiga daging lainnya dibagi menjadi 334 kupon untuk musta-

hak dan panitia. Sedangkan 116 kupon menjadi pendamping bagian setiap pekurban. Dalam kata lain, sejak dahulu telah ditradisikan setiap pekurban mendapat dua kupon pendamping dari daging kurbannya,” sebut Syahruddin. Selain itu, mulai tahun ini daging kurban juga akan dibagikan kepada anak-anak yatim dan masyarakat desa binaan IAIN melalui kupon yang dihimpun oleh Lembaga Pengabdian Kepada Masyarakat IAIN SU. Direktur Pascasarjana IAIN SU Prof.Dr.Nawir Yuslem, MA mengatakan kurban adalah salah satu bentuk ibadah yang disyariatkan kepada kaum muslimin dan muslimat. Kurban menjadi bukti cinta dan rasa syukur seorang hamba kepada Allah SWT, sebagaimana halnya telah dicontohkan oleh Nabiyullah Ibrahim AS dan anaknya Ismail AS. (m49)

Ragam Publikasi Lokasi Banjir Keliru, Thailand Makin Terpuruk



Rabu 9 November 2011

SEJUMLAH gambar menampilkan pesawat Airbus milik Thai Airways International terendam banjir di bandara Don Mueang telah memicu salah persepsi bagi warga di luar Thailand yang menganggap kota Bangkok tertutup bagi jalur penerbangan. Sebagian foto yang dimuat oleh agensi asing memuat gambar pesawat Thai Airways International yang terendam banjir - namun bukan gambar baru, dan bukan di bandara Bangkok, yang kini telah kering dan beroperasi secara normal. Hal tersebut membuat Thailand makin terpuruk, dan tentunya membuat pihak penerbangan lokal dan pihak pengelola Bandara Suvarnabhumi, yang merupakan gerbang utama ke negara tersebut. Menurut pejabat berwenang di Bandara Suvarnabhumi, kawasan ini merupakan kawasan dengan tingkat pencegahan banjir

paling kuat dan saat ini beroperasi seperti biasa. Tuduhan terhadap penyudutan media, khususnya media asing, yang kurang memberikan publikasi kurang akurat kepada publik bahwa Thailand memiliki dua bandara dan salah satu yang terbesar diantaranya tetap berfungsi dengan normal. “Selama (media) memuat gambar pesawat terendam di Don Mueang, dan tidak secara jelas menyatakan bahwa bandara utama, Suvarnabhumi, masih berfungsi, maka kami akan kehilangan lebih banyak lagi pengunjung yang enggan datang, menambah penghinaan

pada penderitaan,” ujar Somchai Sawasdeepon, senior executive wakil presiden Airports of Thailand Plc (AoT). Pihak Executive Centara Hotels & Resorts, satu dari agensi operator pariwisata terbesar Thailand, setuju bahwa kebanyakan orang di luar Thailand tidak menyadari bahwa banjir hanya melanda Don Mueang. Namun, mereka mengatakan bahwa wisatawan Asia telah merubah arah tujuan mereka ke negara-negara lain dan wisatawan Eropa telah menunda perjalanan mereka ke kawasankawasan yang tidak terkena banjir termasuk Phuket, Samui, Krabi, dan Chiang Mai. Mereka mengeluhkan bahwa pemerintah, Lembaga Pariwisata Thailand dan Kementerian Pariwisata dan Olahraga tidak melakukan upaya yang cukup untuk memperbaiki salah persepsi yang kini tengah terjadi. Somchai kembali menegaskan keyakinannya bahwa bandara utama mampu mengatasi

Muslim China Bangun Industri Halal MUSLIM China terus membangun dan memperkokoh eksistensinya dengan mengembangkan industri halal untuk memenuhi kebutuhan umat Muslim di negaranya, dan ekspor ke negara-negara Muslim lainnya. “Sudah lebih dari 10.000 pabrik, restoran makanan dan minuman yang menerima sertifikat halal,” kata Ketua Komisi Makanan Halal Ningxia, Wang Shengjun, di Yinchuan, ibukota propinsi Ningxia, ketika menerima para wartawan Indonesia dan Malaysia, Selasa. Selain itu, lanjut dia, Ningxia punya dua kawasan industri halal di Wuchong, salah satu kota di provinsi itu. Nilai produk halal di Ningxia telah mencapai 50 juta yuan atau senilai Rp70 miliar. Ningxia adalah provinsi di China yang mendapatkan otonomi sejak tahun 1958 karena etnis Hui identik dengan Muslim dan merupakan mayoritas dari 35 etnis China lainnya yang hidup di Ningxia. “Dari 6,3 juta warga yang tinggal di Ningxia, 2,25 juta atau 38 persen merupakan etnis Hui yang Muslim, sisanya adalah etnis Han, dan etnis China lainnya,” kata Wang Shengjun. Industri halal Ningxia terus melebarkan sayapnya ke pasar domestik, bahkan penerbangan dari Beijing ke Urumqi, atau Beijing ke Yinchuan,

ibu kota Ningxia, makanan di pesawat semuanya sudah berlabel halal. “Bukan hanya domestik, kami sudah bekerja sama dengan industri halal Arab Saudi, Qatar, Mesir dan Malaysia untuk saling mengakui sertifikat halal sehingga produk kami dapat masuk ke pasar mereka, begitu juga sebaliknya,” kata Wang Shengjun. Ketika ditanya mengapa dengan Indonesia belum, dia mengakui hubungan industri halal dengan Indonesia baru saja dijajaki. “Kami baru mulai kerja sama internasional sejak tahun 2008, tetapi dengan Malaysia sudah sejak tahun 2006. Kami sudah berkunjung ke Indonesia. Kami mau kerja sama dengan industri halal Indonesia karena Indonesia adalah penting bagi kami,” tambah ketua komisi industri halal Ningxia. Industri halal Ningxia sudah dilengkapi dengan laboratorium yang paling canggih di China didukung 15 pakar, 300 staf. “Biaya untuk mendapatkan sertifikat halal sangat murah, yakni hanya 3.700 yuan atau Rp5,1 juta,” katanya. Walau sudah banyak perusahaan memiliki label halal namun sewaktu-waktu petugas akan datang ke pabrik dan meninjau proses produksi mereka. (Syafri)

bencana banjir, meski menyatakan bahwa kemungkinan banjir akan melanda Suvarnabhumi memang ada meski kemungkinannya kecil. Ia membawa sejumlah wartawan untuk memeriksa fasilitas penanganan banjir di bandara Suvarnabhumi pada akhir pekan lalu. Namun, banyak diantara fotografer yang memposisikan gambar mereka dari sudut tanggul yang berdekatan dengan bandara. Foto-foto inilah yang telah banyak beredar dalam beberapa hari terakhir. Dinding tanggul setinggi 3,5 meter dibangun mengelilingi bandara. Pembangunan tanggul ini dimulai pada 1995 dan rampung pada 2000, yang diperkirakan mampu mencegah arus air. Pekan lalu, Departmen Jalan Raya Thailand menguji kekuatan tanggul dengan mengebornya dan hasil tes menunjukkan bahwa dinding tanggul sangat aman untuk mencegah banjir dari luar jika tinggi air kurang dari ketinggian 3,5 meter. Bencana banjir terburuk di Thailand hingga kini telah menelan sedikitnya 506 nyawa dan beberapa orang masih dinyatakan hilang. Demikian pernyataan resmi yang disampaikan oleh Departemen Pencegahan Bencana dan Mitigasi Thailand. Meski banjir saat ini dilaporkan sudah mulai menyurut di beberapa provinsi bagian hulu, tetapi masih tinggi di sekitar 25 provinsi di kawasan utara dan pusat termasuk ibu kota Bangkok. Banjir diperkirakan telah merendam sekitar 1,2 juta rumah atau 3,2 juta orang. Sebanyak 13 dari 50 distrik di Bangkok juga sudah terendam banjir dan dikhawatirkan banjir terus mengalir ke pusat ibu kota. Sekitar 11.000 pengungsi juga masih berdiam diri di lokasi pengungsian di seluruh penjuru Bangkok. Banjir terparah ini terus berlanjut sejak akhir Juli lalu dan melanda sebanyak 9,4 juta orang di 64 provinsi. Puluhan pabrik di kawasan industri juga lumpuh akibat banjir dan sekitar 600.000 orang terancam kehilangan pekerjaan mereka. Kerugian akibat banjir ini diperkirakan mencapai 2030 miliar dolar AS. (net/rzl)

Ribuan Orang Bantu Seniman China Bayar Pajak RIBUAN orang menyumbangkan lebih dari 800.000 dolar kepada seniman pembangkang China Ai Weiwei, sebagian di antaranya melemparkan uang yang dibentuk seperti pesawat ke dalam pekarangan rumahnya untuk membantunya membayar rekening pajak yang mereka pandang sebagai tekanan pemerintah. Kampanye sumbangan itu – juga dalam bentuk transfer lewat rekening bank dan uang dimasukkan dalam amplop atau uang yang dililitkan ke buah dan kemudian dilemparkan ke dalam halaman rumahnya – jarang dilakukan bagi pembangkang China karena ancaman tindakan balasan terhadap merekamereka yang mendukung para pengecam tokoh penting pemerintah. Hampir 20.000 orang telah mengirim lebih dari 5,3 juta yuan (840.000 dolar), kata Ai, sejak dia mengumumkan seminggu lalu bahwa biro pajak Beijing menuntut agar dia membayar tunggakan pajak dan denda senilai 15 juta yuan (2.4 juta dolar). “Bantuan uang ini menunjukkan orang-orang yang ingin mengungkapkan pendapat mereka lewat uang,” kata Ai kepada AP. “Itu menunjukkaan, di jaman Internet ini, masyarakat punya penilaian dan nilai sendiri. Orang-orang menggunakan metode ini untuk meninjau ulang tuduhan bahwa saya menunggak pajak.” Ai, seorang seniman yang vokal mengecam pemerintah ditahan selama tiga bulan awal tahun ini di tengah-tengah penindasan terhadap para pembangkang. Penahanan dan tuntutan pajak terhadap dirinya dipandang para aktivis sebagai upaya menghukumnya. Hutang Yang Akan Dibayar Ai mengatakan, uang yang bantuan pendukungnya itu akan dijadikannya sebagai pinjaman yang akan dibayar kelak. Liu Yanping, seorang sukarelawan di perusahaan Pengembang Budaya Palsu Beijing milik Ai, mengatakan banyak sumbangan tersebut disertai dengan pesan dukungan, termasuk “Saudaraku, ijinkan saya jadi pemberi kredit untukmu” dan “Seluruh keluarga sudah digerakkan, semuanya akan jadi pemberi pinjaman,” kata Liu. Ada pula pesan yang berbau puitis “Berjalanlah menuju cahaya, kegelapan akan berlalu.” Ai menuntut polisi agar mengembalikan buku rekening bank yang disita polisi dari studionya ketika mereka menahannya dan agar dia diijinkan bertemu dengan mantan manajer dan akuntan kantornya. Sementara itu, satu suratkabar milik negara Global Times mengutip keterangan para pakar yang mengatakan, Ai bisa jadi dicurigai ‘mengumpulkan dana ilegal’. Suratkabar itu juga mengatakan gerakan tersebut tidak mewakili sebagian besar rakyat China. “Adalah hal biasa bila sejumlah orang menunjukkan dukungan mereka baginya dengan jalan memberikan sumbangan. Namun orang-orang ini jumlahnya sangat



FOTO banjir menggenangi pesawat Thai Airways International, yang dimuat oleh media asing. Foto ini bukan diambil dari bandara utama di Bangkok, yang dilaporkan kering dan beroperasi normal.

Emas Bergerak Di Bhutan BHUTAN adalah kerajaan terakhir di Himalaya. Negara kecil itu terletak di sudut dan celah gunung tertinggi di bumi ini. Negara tersebut merupakan tempat istimewa yang tidak memiliki jalan beraspal sampai tahun 60-an, terbatas bagi para turis asing sampai tahun 70-an dan tidak punya televisi sampai tahun 1999, inila negara terakhir di dunia yang mengakses siaran televisi. Ketinggian dan pemandangan alamnya akan membuat Anda menarik nafas penuh rasa kagum. Di negara ini lingkungan dihormati. Kerajaan menjadikan lingkungan sebagai satu dari empat pilar kebahagiaan yang harus dilindungi. Lingkungan dipandang sebagai ‘sumber kebahagiaan negara’ yang lebih penting dari ‘produk domestik negara’. Begitupun, seperti negara lainnya, Bhutan terus bergerak mengikuti arus modernisasi dan mulai mempertimbangkan memanfaatkan sumber daya alam yang mereka miliki secara bertanggungjawab. Air adalah salah satu sumber daya alam yang melimpah di negara itu. Emas Bergerak “Sebagian orang menye-

butnya ‘emas bergerak’,” kata Sherup Tenzing, ahli mesin di Druk Green Power Corporation di Chhukha, tentang air di negara itu. “Alur sungai di Bhutan dirancang alam sedemikian rupa sehingga bisa menghasilkan energi sangat besar – yang juga bersih.” Bhutan sekarang ini memanfaatkan air menjadi energi bersih dalam skala besar. Listrik tenaga air merupakan sumber utama listrik di negara itu dan para pakar mengatakan negara tersebut masih menggunakan 5 persen dari potensi yang ada. “Setelah tahun 2020 kami punya target merampungkan 15 perusahaan listrik berikutnya dan 3 di antaranya dalam pembangunan dan menjalani proses yang baik,” kata Tenzin. Perusahaan pembangkit listrik tenaga air pertama Bhutan ini dibangun di Chhukha, sekitar dua jam berkendera-an dari ibukota Thimphu. Bendungan yang menampung air tersebut luar biasa besar dan indahnya. Bendungan itu ibaratnya mewakili kebesaran para dewa, termasuklah dewa air. Meski dibangun di tengah-tengah kawasan hutan, dinding bendungan dihiasi dengan lukisan yang menggambarkan kehidupan Budha. Di Bhutan, listrik tenaga air menjadi bisnis yang sa-

ngat besar. Energi bersih yang dihasilkan negara kecil ini (ukurannya seluas Swiss dengan jumlah penduduk lebih sedikit) dijual ke negara tetangga Bhutan yang sangat membutuhkan listrik: India. “Lebih 60 persen pendapatan kotor nasional berasal dari listrik tenaga air,” kata PM Bhutan Jigme Thinley kepada CNN. Dia mengatakan, bisnis energi bersih tersebut sangat tepat bagi negaranya. “Bhutan secara ekologi adalah wilayah yang sangat rapuh. Dan kami mewujudkan listrik tenaga air ini karena prosesnya ramah ekologi, semuanya sesuai dengan skema mengalirnya sungai atau tidak menimbulkan kerusakan bagi ekologi,” kata sang PM. 80 Persen Sudah Berlistrik Meski pembangunan perusahaan pembangkit listrik tenaga air ini dijamin tidak merusak lingkungan, tidak semua orang yakin akan hal itu. Contohnya Dasho Paljor J. Dorji, seorang penasehat pemerintah. Dia sangat khawatir terlalu banyak bendungan didirikan untuk menjadi pembangkit listrik tenaga air akan merusak makhluk yang tinggal di dalam air. “Sungguh disayangkan, begitu banyaknya sungai yang

dialihkan alirannya. Tujuannya memang bagus. Tapi sebaiknya kita biarkan sebagian sungai mengalir secara alami dengan keindahannya,” kata Dorji. 80 Persen penduduk negeri itu sekarang sudah menikmati listrik dan tujuan negara itu seluruh penjuru negeri sudah diterangi listrik pada tahun 2013, dan semuanya tersedia lewat listrik tenaga air. Energi bersih itupun sudah mengubah banyak kehidupan di Bhutan. Listrik ikut membantu meningkatkan pendapatan keluarga. Sebelumnya, setelah memanen padi, keluarga petani harus menghabiskan waktu selama beberapa hari untuk melepaskan bulir-bulir padi dari batangnya. Sekarang para petani hanya tinggal menghidupkan mesin listrik untuk melakukan perontokan bulir padi itu, artinya pekerjaan mereka lebih efisien dan cepat. Seorang petani bernama Zangmo berkata “Sebelum ada listrik, kami menghadapi banyak masalah. Kami tergantung pada kayu api untuk semuanya. Saya tidak tahu bagaimana pembuatan listrik, tapi saya sangat senang dengan kehadirannya.” Syafri/CNN

SENIMAN China Ai Weiwei (kiri) berbicara dengan seorang pejabat dari Biro Pajak Lokal Beijing di rumahnya di Beijing 1 November lalu. kecil jika dibandingkan dengan total penduduk China,” demikian tajuk di suratkabar berbahasa China dan Inggeris itu. Suratkabar itu juga mempertanyakan apakah Ai benar-benar perlu meminjam uang untuk membayar pajak tersebut. Seniman yang sudah terkenal di skala internasional itu telah memamerkan karya-karyanya di London, New York dan Berlin dan sudah mengumpulkan banyak uang dari penjualan hasil karyanya yang dilelang dan dipajang di galeri-galeri. “Saya memang sangat kaya, tapi ini masalah yang berbeda,” kata Ai tentang kecaman suratkabar itu. “Saya katakan sekali lagi, saya akan membayar setiap sen yang saya pinjam. Saya tidak melakukan ini demi kepentingan saya sendiri,” tegasnya. Syafri/

BHUTAN mengandalkan air sebagai pendapatan negara tersebut, sampai-sampai air disebut sebagai emas bergerak.

Luar Negeri


WASPADA Rabu 9 November 2011

Pesawat Tak Dikenal Jatuh Dan Meledak Di China SHANGHAI, China (Antara/AFP): Satu pesawat yang tidak dikenal jatuh dan meledak di daratan China Timur, kata media pemerintah Selasa (8/11),tetapi kecelakaan itu tetap misterius dan kemungkinan tentang adanya korban juga belum diketahui. Kecelakaan itu terjadi di provinsi Zhejiang dekat kota Lishui, Senin petang akibat kabut tebal, kata Radio National China milik pemerintah, tetapi penduduk lokal mngemukakan kepada AFP dan polisi segera menutup lokasi itu bagi publik. Suratkabar Beijing News yang mengutip para pejabat lokal yang mengatakan mereka melihat sesuatu yang tampaknya seperti pesawat jatuh di puncak bukit dan meledak. Seorang pejabat di lokasi itu mengatakan pesawat itu bukan pesawat sipil, kata berita itu. Majalah Caixin Century, sebuah mingguan berpengaruh memperkirakan pesawat kemungkinan pesawat militer, milik swasta atau digunakan untuk pertanian. Kementerian-kementerian pertahanan dan pertanian tidak bisa segera dihubungi untuk diminta komentar. Ketika ditanya tentang laporan-laporan mengenai kecelakaan pesawat itu, seorang pejabat pemerintah lokal yang menolak namanya disebutkan, mengemukakan bahwa penyelidikan sedang dilakukan tetapi menolak memberi komentar lebih jauh. Penduduk yang tinggal dekat lokasi jatuhnya pesawat jatuh itu mengatakan pesawat itu membawa satu atau dua orang, tetapi jumlah itu tidak dapat dikonfirmasikan. Polisi telah menutup lokasi itu, tambah mereka. “Lokasi itu ditutup jadi saya tidak tahu apa yang terjadi,” kata seorang penduduk melalui telepon. Pusat Informasi Hak Asasi Manusia dan Demokrasi yang berpusat di Hongkong , yang pendirinya memiliki kontak luas di China mengatakan tentara telah menutup dan mengamankan lokasi itu. Jika pesawat itu dikonfirmasikan sebagai pesawat militer,ini merupakan musibah kedua dalam hanya kurang sebulan,setelah satu pesawat tempur jatuh di tanah dsn meledak dalam pameran dirgantara Oktober lalu, menewaskan seorang dari dua pilotnya.

Anwar Akan Menjadi PM Malaysia Meski Dipenjara KUALA LUMPUR, Malaysia (Waspada): Anwar Ibrahim memang pribadi yang penuh kontroversi di Malaysia. Tetapi menurut seorang petinggi partai oposisi Malaysia, Anwar Ibrahim tetap akan menjadi PM Malaysia meskipun berada di dalam penjara. Sekjen Partai Tindakan Demokratik (DAP) Malaysia Lim Guang Eng, yakin bahwa Anwar Ibrahim akan menjadi perdana menteri meskipun dirinya dihadapkan pada masalah hukum. DAP sendiri berada dalam koalisi Pakatan Rakyat yang merupakan oposisi pemerintah. Ucapan Lim ini merupakan bentuk respons dari Ketua Persatuan China Malaysia (MCA) yang mempertanyakan siapa yang akan menjadi perdana menteri, bila Pakatan Rakyat berkuasa di Malaysia. “Jelas sekali Anwar (yang akan menjadi perdana menteri). Hal ini sudah ditetapkan oleh ketiga partai (termasuk dalam koalisi Pakatan Rakyat),” jelas Lim Guang Eng seperti dikutip The Star, Selasa (8/11). “Meskipun dirinya berada di dalam penjara, Anwar akan tetap menjadi perdana menteri,” tegasnya. Saat ini posisi Anwar Ibrahim memang tidak lepas dari kontroversi kasus sodomi yang diarahkan kepada oleh mantan ajudannya, Saiful Bukhari Muslim pada Juni 2008 lalu. Kasus ini bukan pertama kali dituduhkan kepada Anwar. Dakwaan ini kerap diartikan sebagai langkah penjegalan bagi Anwar yang memang bermaksud untuk ikut serta dalam pemilu mendatang. Anwar, yang merupakan mantan Deputi Perdana Menteri Malaysia, mengklaim Perdana Menteri Najib Razak telah melakukan konspirasi atas kasusnya. Dirinya bersikeras Pemerintah Malaysia telah memanipulasi kasus sodomi setelah kalangan oposisi meraih kemenangan besar pada Pemilu 2008 lalu. Sementara koalisi Pakatan Rakyat sendiri diisi oleh partai seperti DAP, Partai Keadilan Rakyat dan PAS atau Partai Islam se-Malaysia. Ketiga ini bergabung untuk melawan Pemerintah Malaysia yang berdekade lebih dikuasai oleh Partai Umno. Pakatan Rakyat bermaksud untuk turut serta dalam pemilu Malaysia mendatang yang akan berlangsung tahun depan. Mereka pun mengincar kemenangan, dengan mengetengahkan reformasi di Malaysia sebagai bahasan kampanye.

Gempa Guncang Tiga Negara BEIJING, China (Waspada): Gempa bumi dengan kekuatan beragam telah mengguncang tiga negara dan laporan korban 10 cedera terjadi di Filipina ketika getaran berkekuatan 5,0 skala Richter mengguncang daerah selatan negeri itu, demikian dilaporkan Selasa (8/11). Gempa bumi berkekuatan 6,9 skala Richter mengguncang timurlautTaiwan pukul 10:59 Selasa waktu Beijing, kata Survei Geologi Amerika Serikat (USGS). Episenter gempa terletak pada kedalaman 209,5 kilometer, pada awalnya ditetapkan berada di 27,29 derajat lintang utara dan 125,86 derajat bujur timur. Dari Hongkong diberitakan bahwa gempa itu bertitik pusat di kedalaman 222 km. Pada awalnya ditetapkan bahwa gempa terjadi di 27,20 derajat lintang utara dan 125,80 derajat bujur timur. Dari Tokyo, Jepang, juga diberitakan terjadi gempa berkekuatan 6,8 skala Richter Selasa mengguncang kuat di perairan pulau Okinawa, namun tidak ada kekhawatiran mengenai tsunami, kata lembaga AS dan Jepang. Gempa itu terjadi di Laut China Timur, 218 km di barat Naha, prefektur Okinawa, kata Survei Geologi AS. Kedalaman gempa ada pada 222 km. Tidak ada laporan segera mengenai korban cedera atau adanya kerusakanakibatgempa,yangterjadipadapukul11.59waktusetempat. Jepang, terletak di persimpangan empat lempeng tektonik, mengalami 20 persen dari gempa terkuat yang tercatat di bumi setiap tahun. Bencana tsunami pada 11 Maret mengakibatkan sekitar 22.000 orang tewas atau hilang, dan memicu krisis nuklir di pabrik listrik tenaga nuklir Daiichi di Fukushima, timurlaut negara itu. Gempa di Filipina terjadi di kota kecilValencia, di pulau Mindanao, Senin dan menghancurksn 23 rumah, satu toko besi dan satu toko pangan di kota berpenduduk 150.000 jiwa itu, kata kantor pertahanan sipil lokal. Para korban itu akibat dihantam benda-benda dan puing bangunan yang jatuh ketika gempa terjadi pukul 17:43 waktu setempat (16:43WIB),tetapi tidak ada yang luka parah, kata seorang pejabat pertahanan sipil. Survai Geologi AS mengatakan gempa itu berkekuatan 5.0 skala Richter sementara para ahli gempa Filipina menyatakan gempa itu berkekuatan 5,2 skala Richter. (ap/ok/ant/rtr/m10)

Gema Internasional

Seputar ASEAN Vietnam Dan Korsel Sepakat Lakukan Kerjasama Nuklir


MASIH TERUS MENUNTUT PENGGULINGAN PRESIDEN: Para pemrotes anti-pemerintah berbaris untuk menuntut penggulingan PresidenYaman Ali Abdullah Saleh di Taiz, kota diYaman Selatan, Selasa (8/11).Yaman masih terus diguncang aksi menuntut penggulingan Presiden, namun Abdullah Saleh makin kukuh dengan pendiriannya untuk tetap bertahan sampai akhir masa jabatannya.

Kelompok HAM Global Serukan Solidaritas Dengan Palestina CAPE TOWN, Afrika Selatan (Antara/AFP): Masyarakat internasional seharusnya memperlihatkan solidaritas yang sama pada Palestina seperti yang mereka lakukan dalam perjuangan untuk mengakhiri apartheid di Afrika Selatan, kata kelompok hak asasi manusia Russel Tribunal. Tribunal minta “agar Masyarakat Sipil Global meniru semangat solidaritas yang telah menyumbang pada berakhirnya apartheid di Afrika Selatan”. Sebelumnya, pada pembukaan sidang tahunan kelompok itu di Cape Town, Sabtu, tokoh perdamaian Afrika Selata Uskup Desmond Tutu menuduh Israel mengalami amnesia kolektif.

“Mereka lupa sejarah mereka sendiri. Mereka lupa apa yang Nabi mereka sendiri katakan mengenai Tuhan kami,” kata penerima hadiah Nobel perdamaian itu dalam pidato pembukaan pertemuan Russel Tribunal Internasional mengenai Palestina Senin (7/11). Kelompok itu dibentuk pada 2009 bersama model organisasi induknya, oleh mendiang filosuf Bertrand Russel, yang menyoroti kejahatan perang AS di Vietnam pada 1960-an. Delapan orang juri kelompok itu termasuk penerima NobelIrlandiaMairead Corrigan dan feminis Prancis, Gisele Halimi. Organisasi itu mengumumkan pertemuannya mendatang akan diadakan tahun depan di NewYork, untuk mempertanya-

kan mengapa PBB gagal bertindak dalam resolusinya terhadap Israel. Secara keseluruhan, Russel Tribunalmemilikisekitar30komisi yang memusatkan perhatian pada berbagai konflik. Federasi Zionis Afrika Selatan mengecam sayap Palestina kelompok itu sebagai “kampanye politik kotor”. Abbas tak ikut Pemilu Presiden Otoritas Palestina Mahmodud Abbas mengatakan dia akan merundingkan rencana Pemilu Kepresidenan Otoritas Palestina dan Dewan Legislatif Nasional yang akan digelar pada 2012 mendatang. Namun Abbas tampaknyatakakanberpartisipasi dalam pemilu tersebut. Dalam pembahasan yang dilakukan bersama Pejabat Hamas Khaled Meshaal tersebut, Abbas sudah meminta para pejabat-

Inggris Desak Sanksi, Bukan Kekuatan Militer Atas Syria STRASBOURG, Inggris (Antara/AFP): Menteri Luar Negeri Inggris William Hague menyerukantekananinternasional“yang ditingkatkan”, dan bukan campur tangan militer, guna mengakhiri penindasan keras di Syria. “Saya kira jawaban (atas penindasan) saat ini atau setelahnya bukan campur tangan militer dari luar,” kata Hague kepada wartawan di Strasbourg, setelah pertemuan dengan para menteri DewanEropaSenin(7/11). Situasi di Syria “jauh lebih rumit” ketimbang keadaan di Libya sebelum NATO ikut campur pada Maret, katanya. “Kita takkan bisa menerapkan jawaban yang sama di Syria seperti di Libya,” kata Hague sebagaimana dikutip AFP. “Namun saya memang berpendapat kita mesti menerapkan tekanan internasional yang ditingkatkan terhadap rejim (Bashar) Al-Assad.” Sanksi tambahan terhadap pemerintah Presiden Bashar AlAssad akan diajukan, kata Hague. “Tentu saja, Inggris ingin satu resolusi dapat disahkan di Dewan Keamanan PBB sehingga menghasilkan pengutukan dunia atas penggunaan kekerasan terhadap rakyat sipil oleh rejim Syria,” katanya. Syria saat ini menghadapi

sanksi AS dan Uni Eropa, tapi Rusia dan China memveto resolusi Dewan Keamanan PBB yang ditujukan terhadap Damaskus pada Oktober. Komentar Hague dikeluarkan saat oposisi Dewan Nasional Syria menyerukan“perlindungan internasional buat rakyat sipil” di tempat bergolak di kota Homs di Syria tengah, Homs —yang dikepung oleh pasukan pemerintah dan tempat bentrokan mematikan antara tentara dan tersangka tentara pembelot. Hague mengatakan ia“mencela” penindasan brutal sejak protes anti-pemerintah meletus pada pertengahan Maret. Menurut perkiraan PBB, sebanyak 3.000 diduga telah tewas dalam peristiwa tersebut. “Tentu saja, kami harus menilai rejim Syria melaluitindakannya,bukanlewat kata-katanya. Tindakannya tetap tak bisa diterima dan merupakan pelanggaran total terhadap konsep paling dasar hak asasi manusia,” kata Hague. Mohon bantuan Pemerintah Syria mendesak Liga Arab agar membantunya menghadapi AS — yang dituduhnya terlibat dalam aksi berdarah, sementara oposisi meminta‘perlindungan internasional’ buat

warga sipil. Kelompok pan-Arab tersebut, yang sedang berusaha menerapkan rancangan aslinya guna mengakhiri penindasan berdarah selama delapan bulan olehpemerintahSyriaataspemrotes, menyatakan Liga Arab menerima permintaan yang dimuat di dalamsuratdariMenteriLuarNegeri SyriaWalid Al-Muallem. Surat tersebut menuduhWashington secara nyata terlibat dalam peristiwa berdarah di Syria dan meminta Liga dengan 22anggota itu untuk mengutuk keterlibatan tersebut dan melaku-

ra: Israel yang anak emas AS serta Turki sebagai sekutu terpercaya AS di dalam organisasi Pertahanan Eropa (NATO).Washington khawatir bahwa menghadapi Israel danTurki tidak bisa dilakukan secara terpisah-pisah. Kelambanan AS menghadapi krisis ini, kalau dikaitkan dengan pemilihan presiden AS tahun 2012 bisa menjadi isu yang signifikan bagi kampanye presiden khususnya jika AS terpukul oleh para penentangnya di Sidang Umum PBB dalam hal pengakuan Palestina sebagai sebuah negara. Situasi ini menjadi masalah besar di Gedung Capitol dan memberikan kesempatan pada partai oposisi Republik menyerangPresidenBarackObama karena tidak mempertahankan kepentingan Amerika dan Israel. Kongres AS juga bisa menjadi lebih heboh dan bisa menghidupkan kembali legislasi berkenaan dengan peristiwa Armenian genocide yaitu pemusnahan secara teratur dan terencana terhadap bangsa Armenia sebanyak

lebih kurang satu setengah juta orang dibunuh pada zaman raja Turki Ottoman. Kongres AS gagal memperoleh dukungan pada saat dilaksanakan voting. Tetapi para pendukungnya bisa mengkalkulasikan bahwa kondisi yang buruk antara Israel danTurki akan mendorong para pelobi Israel yang tangguh agar tidak lagi mendukung Turki, memunculkan kemungkinan resolusi akan lolos. Sementara itu, ekspor atau penjualan senjata kepadaTurki akan menghadapi penelitian yang lebih cermat. Obama tidak akan banyak waktu untuk mencegah kemerosotan lebih jauh. Israel sedang melihat untuk membangun ikatan dengan Asia, Eropa, dan Amerika. Sementara itu, Arab Spring mengembangkan pandangan bahwa Israel semakin tinggi terisolasi setelah negara-negara seperti Mesir dan Jordania mengkaji ulang hubungan mereka dengan Israel. Juga terlihat bahwa pemerintahan Obama sedang menggelepar karena menyalah-

gunakan proses perdamaian dan Israel khususnya. Pertemuan Obama bulan lalu dengan Erdogan dianggap krusial. Obama hanya bisa mengambil langkah-langkah penting saja. Bahkan tersirat dengan menggerakkan armada ke-6 ALAS dari Norfolk menuju Mediterania Timur, hanya untuk memberi sinyal bahwa AS takkan mentolerir tindakanyangmengarah pada naval clashes di Mediterania. Obama menjelaskan pada Erdogan bahwa AS tidak akan berdiri di sampingTurki terhadap Israel. Jika strategi Turki menggerakkan angkatan lautnya ke Mediteranian berarti akan merusak stabilitas regional. Obama dapat menawarkan kerjasama dengan Turki dan Israel untuk mengakhiri blokade parsial Gaza, meminta Erdogan agar Hamas menhentikan sama sekali tembakan peluru kendali ke arah Israel. PM Erdogan mempunyai sebuah pilihan: Dia bisa menaikkan popularitas domestik dengan memperdalam konfrontasi dengan Israel atau dia

kan apa yang perlu guna mengakhirinya, kata kelompok itu di dalam satu pernyataan. Liga Arab takmemberiperincianmengenai tuduhan keterlibatan AS di dalam pertumpahan darah di Syria, demikian laporan AFP Senin. Namun Syria pada masa lalu menuduh Dutabesar AS untuk Damaskus Robert Ford menghasut kerusuhan dengan mengunjungi pusat protes, sebelumWashington menarik dia pada Oktober, setelah“ancaman yang dapat dipercaya terhadap keselamatannya di Syria”.

Dokter Michael Jackson Dinyatakan Bersalah LOS ANGELES, AS (Antara/Reuters): Dokter pribadi Michael Jackson dinyatakan bersalah, karena secara tak sengaja menghilangkan nyawa orang dalam kematian penyanyi itu, setelah pengadilan selama enam pekan, yang menarik perhatian penggemar Michael di seluruh dunia. Dr. Conrad Murray telah menyatakan dia tak bersalah karena memberi pelantun Thriller ter-

Krisis Baru, Hubungan Turki-Israel Meruncing IBARATNYA, bagian timur wilayah Mediterania telah menjadi semacam kancah persaingan dengan gaya retorik saling mengancam. MenteriTurki untuk Urusan Hubungan dengan Uni Eropa telah menebarkan ancaman bahwa negerinya kemungkinan sekali akan menghentikan eksplorasi gas dan minyak di kawasan Cyprus. Hal ini berkaitan pula dengan pemerintahan Lebanon yang didominasi oleh kelompok Hizbullah yang masih melanjutkan perang verbal dengan Israel berkenaan dengan penemuan gas di lepas pantai Haifa. PM Turki Recep Erdogan melibatkanTurki dalam negosiasi antara Cyprus dan Israel tentang kemungkinan eksplorasi bersama. Erdogan menyatakan bahwa Israel akan dicegah ikut mengeksploitasi minyak dan gas di bagian timur Mediterania. Melihat krisis baru yang bisa melanda kawasanTimurTengah dan wilayah Mediterania,Washington sepertinya menangkap ‘alarm’ konflik antara kedua nega-

pejabat dari Fatah agar mempersiapkan diri dalam pemilu tersebut, demikian diberitakan Al Hayat, Senin. Abbas pun kembali mengingatkankeanggotadaripartainya dalammenyikapipemilumendatang, bahwasannya Abbas tak akan mengikuti pemilu tersebut. Belakangan ini, fraksi Hamas di Jalur Gaza tampak lebih dekat dengan Fatah, terutama pasca pertukarantahananPalestinadan pasukan Israel. Khaled Meshaal juga tampak sudah mulai menerima sikap Abbas. Meshaal pun sempat mendesak Abbas agar mengadakan dialog intra-Palestina untuk membentuk pemerintahan gabungan. Solidaritas yang menguat tentunya akan sangat bermanfaat bagi Palestina yang sedang membangun negaranya.

berpikirsebaliknyadenganmengajakmelakukansegalausahayang konstruktif yang akan membantu stabilitas regional. Melihat kepada tekanan AS terhadapTurkidanberdiridisamping Israel, bukan tak mungkin menimbulkan gejolak baru di kawasanTimurTengah. Israel seperti berada di atas angin. Kalau pilihan Turki dengan memperdalam konfrontasi dengan Israel, konflik tidak saja antara keduanya, Turki dan Israel, bahkan negara-negara Arab, antara lain Iran, Syria, dan Lebanon akan ikut terjun dalam konflik berada bersama-sama dengan Turki. UntukdiingatbahwaTurkisedang bersiap-siapmenggantikanMesir yang selama ini dianggap menjadi pimpinan negara-negara Arab menghadapi dunia Barat khususnya dengan AS. Dunia internasional akan melihat sejauh mana kemampuan AS menyelesaikan krisis yang bisa memicu konflik baru di Timur Tengah dan kawasan Mediterania. (Kosky)

sebutdosismematikanobatkeras penghilang sakit, propofol, yang diputuskan sebagai penyebab utama kematian bintang pop itu pada 25 Juni 2009. Jaksa penuntut umum telah menyatakan Dr. Conrad bertindak sembrono dan mengabaikan cara penggunaan propofol untuk membantu Michael agar bisa tidur. Sementara itu pengacara pembela menyatakan Michael menggunakan sendiri propofol dalam dosis yang mematikan. Dr. Conrad Murray (58) tidak memberi kesaksian dalam pengadilandiLosAngeles.Iadigiring dengan tangan diborgol ketika hakim memerintahkan dia ditahan sebelum pembacaan hukuman pada 29 November. Ia dapat menghadapi hukuman sampai empat tahun penjara. Dr. Conrad menelan ludah saat mendengar putusan tersebut tapi kelihatan tenang. Di luar gedung pengadilan, lebih dari 100 penggemar Michael bersorak. Juri berembuk selama hampir sembilan jam sebelum mencapai putusan dengan suara bulat. Michael Jackson ditemukan takbernafasdirumahmewahnya di Los Angeles pada 25 Juni 2009, dalam usia 50 tahun, sekitar tiga pekan sebelum dijadwalkan memulai serangkaian konser di London, Inggris, dengan tujuan kembalinya bintang pop itu ke panggung. Petugas paramedis berusaha menyelamatkan nyawa penyanyi tersebut dan bergegas membawa mayatnya ke rumah sakit tempat dia dinyatakan meninggal. Kematiannya ditetapkan karena kelebihan dosis obat penenang dan obat bius, propofol —yang biasanya digunakan dalam operasi.

SEOUL, Korea Selatan (Antara/AFP): Vietnam Selasa (8/11) setuju untuk mengembangkan kerjasama pembangunan pembangkit listrik tenaga atom dengan Korea Selatan (Korsel) dalam upayanya mencari sumber energi yang lebih besar. Keputusan itu membuka jalan Korsel untuk partisipasi dalam proyek pembangunan pembangkit listri tenaga atom pertama di negara yang lapar-energi, Vietnam. Kesepakatan itu dicapai dalam pembicaraan antara Presiden Vietnam Truong Tan San dan timpalannya dari Korsel Lee Myung-bak, kata kantor Lee. Sang berada di Korsel untuk melakukan kunjungan tiga hari. Kedua pemimpin sepakat pada kebutuhan untuk memperkuat kerja sama guna membangun pembangkit tenaga atom untuk tujuan damai, kata pernyataan bersama. “Kedua belah pihak menyoroti catatan khusus dari proposal Korsel pada pengembangan pembangkit listrik tenaga nuklir Vietnam yang didasarkan pada teknologi Korsel, serta mengembangkan sumber daya manusia, teknologi dan kerjasama di sejumlah bidang terkait,” katanya. Korsel telah mengoperasikan 20 pembangkit nuklir, yang menghasilkan 35 persen dari kebutuhan listriknya, dan berencana untuk membangun 12 pembangkit listrik lagi selama 14 tahun ke depan. Seoul juga bersumpah untuk tetap bertahan pada pengembangan tenaga atom meskipun munculnya kekhawatiran setelah terjadinya gempa dan tsunami di Jepang pada 11 Maret yang menyebabkan kecelakaan terburuk pembangkit atom di dunia dalam 25 tahun terakhir. Bulan lalu, Jepang resmi memperoleh kesepakatan untuk membantu membangun dua reaktor nuklir diVietnam dan pada bulan Oktober tahun lalu Hanoi menandatangani kesepakatan dengan Rusia senilai sekitar AS$5,6 juta untuk pembangkit listrik nuklir pertamanya.

Taliban Mengaku Tanggungjawab Atas Serangan Di Pakistan ISLAMABAD, Pakistan (Antara/Xinhua-OANA): Taliban Pakistan mengaku bertanggungjawab atas serangan bunuh diri yang menewaskan tiga orang dan melukai delapan lainnya di kabupaten barat laut Swabi Pakistan. Seorang mantan pejabat setempat yang mendukung pasukan keamanandalammemerangiTalibanmenjadisasarandalamserangan itu. Hanif Jadoon, seorang mantan walikota di daerah Swabi, diserang pada saat dalam perjalanan kembali dari shalat Subuh di satu masjid di daerah Malikbad, Swabi di dalam kendaraannya Senin (7/11). Hanif putra Jadoon dan pengawalnya juga tewas dalam serangan itu. Polisi mengatakan bahwa bom bunuh diri tersebut diperkirakan menggunakan delapan kilogram bahan peledak dalam serangan itu. Seorang juru bicara Taliban, Sirajuddin, mengaku bertanggung jawab atas serangan itu dan mengatakan Hanif Jadoon menjadi sasaran karena ia telah bekerja sama dengan pasukan keamanan dalam pembunuhan seorang komandan Taliban lokal tahun lalu. JadoonadalahanggotaPartaiAwamiNasional (ANP)yangberkuasa tingkat provinsi mendukung operasi pasukan keamanan melawan Taliban, yang juga menargetkan para pemimpin partai itu, keluarga mereka dan pendukung ANP di masa lalu karena dukungan mereka kepada pasukan keamanan. Ketua pusat ANP Asfandyar Wali Khan mengutuk serangan itu dan mengatakan bahwa partainya akan melanjutkan dukungan kepada kekuatan melawan gerilyawan. Khan mengatakan bahwa serangantersebuttidakdapatmencegahANPuntukbersikapmelawan gerilyawan Taliban.

Presiden Obama Ucapkan Selamat Idul Adha WASHINGTON (Waspada): Presiden AS Barack Obama mengucapkan selamat Hari Raya Idul Adha kepada umat Islam di seluruh dunia. Presiden Obama mengatakan dalam satu pernyataannya yang dikeluarkan Gedung Putih Minggu (6/11), “Istri saya Michelle dan saya menyampaikan selamat Idul Adha kepada umat Islam di seluruh dunia dan selamat bagi mereka yang menunaikan ibadah Haji. Ribuan warga Muslim-Amerika termasuk di antara mereka yang bergabung dalam salah satu pertemuan paling besar di dunia untuk menunaikan ibadahnya di Makkah dan tempat suci lainnya.” “Ketika umat Islam merayakan Idul Adha ini, mereka juga akan memperingatikeinginanNabiIbrahimuntukmengorbankanputranya dengan mendistribusikan makanan kepada kaum fakir miskin di seluruh dunia. Mereka bergabung dengan Amerika Serikat dan masyarakatinternasionaldalamusahakemanusiaanuntukmembantu perjuangan untuk menyelamatkan Tanduk Afrika dan mereka yang menjalani pemulihan akibat gempa bumi di Turki.” “Atas nama rakyat Amerika, kami menyampaikan doa kami pada musim Haji ini. Eid Mubarak dan Hajj Mabrur.” (spa/m10)

Hakim Spanyol Hukum Komandan ETA 105 Tahun Penjara MADRID, Spanyol (Antara/AFP): - Hakim pengadilan Spanyol hari Senin menjatuhkan hukuman 105 tahun penjara pada mantan komandan militer ETA Javier Garcia Gaztelu, alias “Txapote”, karena pembunuhan seorang politikus Sosialis dan pengawalnya. Txapote (45) dinyatakan bersalah dalam peledakan bom mobil yang menewaskan anggota parlemen daerah Basque Fernando Buesa dan pengawalnya, Jorge Diez, di kotaVictoria, Spanyol utara, pada 22 Februari 2000. Dua orang lagi cedera dalam serangan itu. Hukuman yang dijatuhkan tiga hakim Pengadilan Nasional, otoritas yudisial tertinggi, itu merupakan vonis pertama terhadap anggota kelompok itu sejak ETA pada 20 Oktober mengumumkan diakhirinya kekerasan dalam perjuangan mereka untuk mendirikan negara merdeka Basque. Txapote, yang ditangkap di Prancis pada 2001, diserahkan kepada pengadilan Spanyol pada Desember 2007 setelah dijatuhi sejumlah hukuman berat puluhan tahun oleh pengadilan Spanyol karena serangkaian serangan.


ACARA AMAL DI SEOUL. Para wanita membuat satu penganan tradisional Korea kimchi atau kubis yang dipermentasi, pada satu acara amal di Seoul City Hall Plaza, Seoul, Korea Selatan, Selasa (8/11). Kira-kira 2.000 relawan membuat kimchi seberat 270 ton Selasa untuk disumbangkan hasil penjualannya kepada warga miskin yang amat membutuhkan pada musim dingin nanti.


WASPADA Rabu 9 November 2011


Garansi Sheva

Legenda Soviet Meninggal Dunia MOSKOW (Antara/AFP): Federasi Sepakbola Rusia melaporkan, legenda Uni Soviet yang merebut medali emas Olimpiade Melbourne 1956, Valentin Ivanov (foto), meninggal dunia dalam usia 76 tahun, Selasa (8/11). Ivanov telah memainkan 287 pertandingan dan mencetak 124 gol bagi Torpedo Moscow. Dia memenangi dua titel Soviet pada 1960 dan 1965. Mendiang 59 kali membela Soviet dengan sumbangan 26 gol. Striker subur itu juga berperan penting saat Tim Beruang Merah memenangi Piala Eropa 1960. Setelah gantung sepatu, Ivanov menjadi pelatih Torpedo dan memimpin klub itu menjuarai Liga Rusia 1976. Sebagai manajer, dia juga memenangi tiga Piala Soviet pada 1968, 1972 dan 1986.

Yunani Lawan Rumania Batal BUCHAREST (Antara/AFP): Rencana laga eksibisi Yunani dan Rumania pada 15 November di Jerman, dibatalkan karena Federasi Sepakbola Jerman tidak bersedia menjadi tuan rumah. “Pertandingan melawan Yunani tidak jadi. Laga dibatalkan karena faktor keamanan.,” kata Ketua Federasi Sepakbola Rumania Mircea Sandu dalam wawancara dengan Televisi Dolce Sport. “Federasi Jerman tidak berani menjamin keamanan, karena mereka sendiri memiliki masalah tentang pendukung mereka,” katanya lagi. Hellas menginginkan duel itu di Kota Reutlingen, kota yang banyak dihuni warga pendatang dari Yunani. Mereka pun sedang mencari tempat alternatif untuk menyelenggarakan pertandingan, kemungkinan di Austria. Juara Eropa 2004 lolos ke putaran final Euro 2012 setelah berada di puncak klasemen kompetisi grup. Yunani akan menjamu Rusia pada 11 November, sebelum menjajal Rumania.

KIEV (Waspada): Bintang veteran Ukraina Andriy Shevchenko (foto), telah memasuki fase akhir dalam karir gemilangnya. Namun Sheva berharap mampu mengatasi kendala cederanya, agar dapat memahkotai pencapaiannya dengan kesuksesan Euro 2012. Ukraina menjadi tuan rumah bersama Polandia untuk turnamen akbar empat tahunan tersebut. Itu akan menjadi momen yang tepat bagi sang peraih Ballon d’Or 2004 dan bintang Dynamo Kiev ini, guna memberi kebanggaan pada negaranya sebelum gantung sepatu. Pelatih Ukraina Oleg Blokhin, ikon sepakbola era Uni Soviet, berulang kali menggaransi, Sheva tetap merupakan bagian penting dalam timnya. Skill dan pengalaman mantan mesin gol AC Milan itu, menurutnya, jadi hal vital untuk sukses Euro di negeri sendiri. “Andriy bukan sekedar pemain sepakbola. Dia sosok yang hebat dan memiliki wibawa yang tidak terbantahkan, sehingga sangat diperlukan tim kami,” sanjung Blokhin, seperti dilansir AFP, Selasa (8/11).

“Saya harap dia dapat mengatasi cederanya, dan mendapatkan kembali bentuk terbaiknya untuk memulai Piala Eropa. Sementara itu, kami akan melakukan apapun untuk membantunya,” ujarnya lagi. Sebagai tindak lanjut dari garansinya, Blokhin pun memanggil penyerang Dynamo Kiev itu untuk laga eksibisi melawan Jerman di Kiev pada 11 November, kemudian Austria di Lyiv pada 15 November. Sheva yang menderita sakit kronis pada bagian punggungnya, mengaku sedang menjalani serangkaian perawatan medis di Jerman dan Inggris. Dia pun sangat berharap, bisa gabung dalam tim nasional untuk kampanye Euro 2012. “Saya hanya akan bergabung dengan tim nasional untuk Piala Eropa, jika saya merasa sedang bagus dan siap untuk menghadapi kompetisi memperebutkan

tempat di tim inti,” janji Sheva. “Jika saya mendapati ada masalah kesehatan dan gagal untuk memenuhi tuntutan ketat sebagai anggota tim nasional, saya tidak akan pergi ke lapangan. Saya tidak ingin mempermalukan tim kami dan diri sendiri,” katanya menambahkan. Simbol Ukraina Namun dia tetap yakin masih berguna bagi Ukraina, meskipun mungkin tidak benar-benar bugar seperti saat berjaya di Kiev dan Milan. “Saya akan melakukan apapun yang diharapkan, agar bugar untuk Piala Eropa. Bagaimanapun, hanya Blokhin yang akan memutuskan apakah saya cukup bugar untuk bermain dalam timnya di Euro 2012,” tekad Sheva. Yuri Syomin, pelatih Dynamo Kiev, menggaris bawahi pentingnya Sheva bagi tim nasional. Dia pun berjanji, klubnya akan melakukan upaya terbaik untuk membantu veteran 35 tahun itu supaya siap dan benarbenar bugar. “Andriy talenta yang benar-benar hebat dan layak menerima respek, baik

sebagai pemain mau-pun secara pribadi. Kami berusaha membantunya agar dapat bermain di Euro dalam bentuk terbaiknya,” tutur Syomin. “Musim ini kami memutuskan memberikannya lebih banyak waktu untuk beristirahat dan be-rekreasi. Dia kebanyakan hanya bermain pada pertandingan kandang Dynamo di Kiev,” tambahnya. Rekan-rekan Sheva


Problem Catur Jawaban di halaman A2 8







1 A








Van Marwijk Sampai 2016

Spanyol. “Saya orang Argentina dan impian saya, membela negara saya. Semoga penjelasan ini bisa menjernihkan semuanya,” harap Zarate, yang pernah lima kali memperkuat tim Argentina U-20 pada 2007 silam dengan catatan dua gol. Untuk Tango Senior, dia terpaksa masih menanti karena Sabella punya banyak koleksi bomber beken, di antaranya Lionel Messi, Gonzalo Higuain, Sergio Aguero, Carlos Tevez dan Diego Milito. Sabella malah memanggil empat pemain berbasis domestik untuk kualifikasi mendatang, yakni bek Clemente Rodriguez dan kiper Agustin Orion (Boca Juniors) serta gelandang Rodrigo Brana dan bek tengah Leandro Desabato (Estudiantes). Albiceleste menjamu Bolivia pada Jumat (11/11) di Buenos Aires, empat hari kemudian bertarung melawan Kolombia di Barranquilla. (m15/fif/ap)


AMSTERDAM (Antara/ AFP): Pelatih Belanda Bert van Marwijk akan memperpanjang kontrak sampai Piala Dunia 2014 di Brazil serta Euro 2016 di Prancis. “Ini segera terealisasi, segala sesuatunya berjalan dengan baik. Hal yang belum terealiasasi adalah penandatanganan,” kata agennya, Rob Jansen. Menurut laporan De TeleAP graaf, tidak ada hal baru dalam ikatan kontrak dengan pelatih yang sudah membawa Belanda ke final Piala Dunia 2010 tersebut. Sebelumnya beredar kabar, PSV Eindhoven berusaha mengontrak pelatih berusia 59 tahun itu, yang menggantikan Marco van Basten pada Agustus 2008. Van Marwijk saat ini terikat kontrak hanya sampai Euro 2012. Di bawah asuhannya, De Orange lolos otomatis ke PolandiaUkraina 2012, setelah memenangi 10 pertandingan Grup E.

Matador Ambil Lagi Navas

Tabarez Positif Sikapi Krisis Cedera

M A D R I D ( Wa s p a d a ) : Winger Sevilla Jesus Navas (foto) dan bek Malaga Ignacio Monreal, dipanggil pelatih Spanyol Vicente Del Bosque untuk laga eksibisi melawan Inggris pada Sabtu (12/11) dan Kosta Rika tiga hari kemudian. Del Bosque mengatakan, Navas dan Monreal diambil lagi oleh El Matador, karena bermain bagus sepanjang musim ini di La Liga Primera. “Mereka (Navas dan Monreal) masuk tim, karena mereka pernah bersama kami sebelumnya dan juga bermain bagus,” beber Del Bosque, seperti diberitakan AFP, Selasa (8/11). Navas masuk tim saat La Furia Roja memenangi Piala Dunia 2010 di Afrika Selatan. Tapi dia sudah tidak pernah memperkuat tim nasional sejak turnamen itu karena cedera. Del Bosque juga memanggil bintang Barcelona Andres Iniesta, yang absen pada laga kualifikasi Euro 2012 bulan lalu

Posisinya di line-up starting kemungkinan digantikan Navas. Laga lawan Inggris dan Kosta Rika sepanjang sepekan ke depan akan sangat prospektus bagi kapten Spanyol Iker Casillas. Jika dimainkan Del Bosque, maka kiper Real Madrid itu bakal menyamai rekor tampil kiper legendaris Andoni Zubizarreta yang mencatat 126 caps membela La Furia Roja. (m15/ant/afp/sky)

MONTEVIDEO (Waspada): Pelatih Uruguay Oscar Tabarez (foto kiri) tetap bersikap positif, kendati timnya tengah dilanda krisis cedera pemain jelang pertandingan kualifikasi Piala Dunia 2014 melawan Chile. Penyerang Inter Milan Diego Forlan, salah satu pemain yang dipastikan absen. La Celeste juga tidak akan diperkuat penyerang Abel Hernandez, gelandang Alvaro Fernandez dan Walter Gargano, serta bek Jorge Fucile. “Inilah saatnya untuk berpikir apa yang kami miliki, dan sedikit (memikirkan) apa yang tidak kami miliki, meski yang terakhir ini cukup signifikan,” tutur Tabarez, seperti dilansir Reuters, Selasa (8/11). “Jika tidak, kami hanya akan memusingkan masalah, dan bukan solusinya,” katanya lagi. Juara Copa America 2011 dan semifinalis Piala Dunia 2010 itu juga kehilangan bek Maximiliano Pereira, akibat masih




Putih melangkah, mematikan lawannya tiga langkah.

Tymoschuk dan Olexander Shovkovsky, Andriy simbol tim nasional Ukraina,” klaim striker Andriy Voronin. “Tidak mungkin membayangkan tim kami tanpa dirinya. Saya akan benar-benar senang untuk bermain di Euro 2012 bersama dirinya,” tukas bomber Dinamo Moscow, yang pernah membela Liverpool tersebut. (m15/uefa/ant/afp)


Zarate Masih Menanti Tango BUENOS AIRES (Waspada): Pelatih Argentina Alejandro Sabella, Senin (Selasa WIB), menambahkan empat pemain bagi timnya untuk menghadapi kualifikasi Piala Dunia 2010 melawan Bolivia dan Kolombia. Tetapi nama Mauro Zarate (foto) tetap belum masuk di dalamnya. Padahal striker Inter Milan yang baru mendapat paspor Italia itu sangat berharap dapat membela Tim Tango, sehingga tidak akan mau bergabung jika dipanggil Cesare Prandelli, allenatorre Gli Azzurri. “Jika Prandelli memanggil saya masuk tim, saya akan katakan tidak. Saya tak mau bermain untuk negara lain,” beber Zarate dalam Forza Italian Football, Selasa (8/11). Mantan striker Lazio itu mendapat paspor Italia, karena memiliki darah Azzurri dari ibunya, Catalina Riga, asal Catanzaro di Italia Selatan. Sedangkan ayahnya, Sergio, pesepakbola Argentina keturunan campuran Chile-

di tim nasional juga memberi nilai tinggi terhadap bakti Sheva. “Bersama Anatoly

Skuad Spanyol Kiper

: Iker Casillas (Real Madrid), Jose Manuel Reina (Liverpool/Inggris), Victor Valdes (Barcelona). Belakang : Alvaro Arbeloa, Sergio Ramos dan Raul Albiol (Real Madrid), Carles Puyol dan Gerard Pique (Barcelona), Jordi Alba (Valencia), Ignacio Monreal (Malaga). Tengah : Xabi Alonso (Real Madrid), Sergio Busquets, Xavi Hernandez, Cesc Fabregas dan Andres Iniesta (Barcelona), Santiago Cazorla (Malaga), Javi Martinez (Athletic Bilbao). Depan : David Villa (Barcelona), Juan Mata dan Fernando Torres (Chelsea/Inggris) David Silva (Manchester City/Inggris), Fernando Llorente (Athletic Bilbao), Jesus Navas (Sevilla). melawan Republik Ceko dan Skotlandia, akibat cedera otot paha belakang. Matador juga akan diperkuat gelandang Barca Cesc Fabregas. Mantan kapten Arsenal ini mengalami cedera otot paha belakang dalam latihan hingga keluardaritimjelangmenghadapi Ceko dan Skotlandia. Sebaliknya winger Barca Pedro Rodriguez dicoret dari skuad karena sedang dibekap cedera.


terkena sanksi FIFA. “Kami akan coba menyiapkan tim, yang bisa dimasukkan ide-ide yang kami dapat dari berbagai sudut pandang taktis, guna diterapkan dalam latihan,” tekad Tabarez.

KESEHATAN 1. Obat demam takaran 81mg yang disumpalkan ke mulut penderita stroke di dalam pesawat dan sembuh tanpa cacat. 3. Human Immunodeficiency Virus. 6. Singkatan Spesialis Bedah Saraf. 7. Penumpukan lemak yang berlebihan di dalam badan (Pengidapnya memiliki respon yang lambat terhadap rasa “puas” terhadap makanan). 9. Pil warna hitam untuk obati diare. 10. Singkatan gelar dokter gigi. 12. Nama jenis kacang yang dapat menurunkan kolesterol LDL, kaya vitamin dan mencegah kanker usus besar. 14. Obat bubukan/tepung. 16. Cara untuk mencegah kehamilan dengan menggunakan alat atau obat. 20. Zat yang dibentuk oleh bagian tubuh tertentu dan dibawa ke jaringan tubuh lainnya untuk menggiatkan kerja alat-alat tubuh. 21. Zat pembuat kapsul obat, dulu terbuat dari kulit babi, kini dari tulang ikan. 22. Tidak makan dan minum mulai tengah malam hingga pagi sebelum periksa darah dan urine. 23. Bengkak pada dahi atau kepala akibat benturan.

1. Sejenis sayuran yang disebut berkhasiat memperbaiki kinerja ginjal. 2. Buah yang kaya vitamin/nutrisi, daunnya untuk pembungkus. 3. Menstruasi. 4. Obat yang digunakan untuk disfungsi ereksi (Hati-hati bagi orang yang baru terkena serangan jantung dan stroke, penurunan fungsi hati dan ginjal serta darah rendah). 5. Merek vitamin C produksi Bayer, larut dalam air berasa jeruk, proteksi terhadap flu. 8. Pilih/tulis tanpa spasi: Vitamin A, Vitamin B atau Vitamin C yang ketinggian kadarnya dalam darah diduga mencegah kanker paru, namun belum cukup bukti. 11. Pemanis yang meningkatkan risiko penyakit jantung dan obesitas jika dicampur pada makanan atau minuman. 13. Dosis (Inggris). 15. Obat berbentuk cairan berasa manis. 17. Badan; Tubuh. 18. Ikan yang dapat melindungi pria dari kanker prostat jika dimakan 1-3 kali setiap bulan. 19. Salah satu alat kontrasepsi.

Uruguay memuncaki klasemen sementara kualifikasi Piala Dunia 2014, mengoleksi empat poin dari dua pertandingan pertama. Chile berselisih satu poin dengan mereka. (m15/ant/rtr)

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sedang (***), bisa diselesaikan dalam waktu kurang dari sepuluh menit. Jawabannya lihat di halaman A2 kolom 1.

1 7

8 8 6 2 1 9 8 4 5 6 2 9 4 7 9 8 6 5 3 9 7 8 6 9 7 3 2 7 5 4 9 9 3 ***405



WASPADA Rabu 9 November 2011

City Nyaris Sempurna LONDON (Waspada): Arsitek Arsenal Arsene Wenger memuji ‘setinggi langit’ Manchester City, yang kini memimpin sendirian di puncak klasemen Liga Premier dengan keunggulan lima poin di atas Manchester United. “Jika mereka tetap seperti ini sampai bulan Desember, maka Anda bisa mengatakan bahwa sangat sulit untuk mengejar mereka,” tutur Wenger, seperti dilansir Mirror Football, Selasa (8/11). Wenger menilai, Citizens nyaris sempurna. “Tak ada satu pun tim yang tidak memiliki kelemahan, baik di liga ini maupun liga lainnya. Tapi City mempunyai kualitas, mereka bisa mencetak banyak gol, bisa sangat efisien,” tambahnya. Pelatih asal Prancis itu juga mengatakan, David Silva (foto) dan kawan-

kawan sangat impresif saat melakoni laga tandang, seperti ketika memukul Tottenham Hotspur dan mempermalukan MU 6-1. “City telah memperlihatkan pot e n s i m e r e k a ,” b e b e r Wenger. Klub asuhan Roberto Mancini itu bersama Newcastle United, saat ini juga belum terkalahkan. Citizens hanya sekali kehilangan tiga poin saat ditahan imbang 2-2 oleh Fulham. Karenanya, gelandang andalannya Yaya Toure yakin, City bisa meraih gelar Premiership dengan syarat menaklukkan Chelsea dan

Liverpool pada partai tandang. “Kami punya peluang menjuarai Liga Premier. Kami datang ke Old Trafford dan menang,” klaim Toure dalam SkySports. Pasukan Mancini akan menghadapi jadwal berat sebelum Natal dengan menjajal Newcastle, Liverpool, Norwich, Chelsea dan Arsenal di liga domestik. Juga melawan Bayern Munich dan Napoli di Liga Champions. “Kami masih memiliki laga besar di Stamford Bridge dan Anfield. Jika ingin melaju jauh di kompetisi ini dan ingin juara, kami perlu mengalahkan semua tim,” tekad Toure. “Kami sadar ini akan sangat sulit. Tetapi terus bekerja keras dan fokus pada semuanya, maka semuanya akan baik-baik saja,” tambah gelandang Pantai Gading, adik bek City Kolo Toure tersebut.

Silva Terbaik Dia pun membantah anggapan, mental juara pemain City belum teruji. “Kami bermain dengan mental berbeda dan mental pemenang. Tim telah mencapainya, Anda harus berpikir positif, Anda harus kuat,” tukas mantan pemain Barcelona berusia 28 tahun itu. Lonjakan performa The Eastland juga banyak dipengaruhi aksi hebat striker anyar nya Sergio ‘Kun’ Aguero, sehingga Mancini seperti tanpa masalah kendati menghukum mantan kapten tim Carlos Tevez. Edin Dzeko pun telah menemukan ketajamannya lagi, sedangkan David Silva makin leluasa mendemonstrasikan gocekan maut dan dribbling cepatnya. Bahkan menurut bek Micah Richards, Silva saat ini merupakan pemain terbaik di English Premier League (EPL).

“Terkadang saya hanya menonton dan mengagumi rekan-rekan saya. David Silva salah satu pemain favorit saya,” sanjung Richards. “Beberapa hal yang dia lakukan sungguh menakjubkan dan dia orang yang sangat rendah hati. Saya pikir semua pemain terbaik itu rendah hati,” tambah jebolan akademi Citizens ini. Richards pun merasa, Silva pemain terbaik di Negeri Pangeran Charles pasca didatangkan dari Valencia. Silva telah 68 kali membela City di berbagai ajang dengan torehan 10 gol dan 24 assists. “Ketika pertama kali datang, orang-orang tidak begitu yakin apakah dia bisa bermain di Liga Premier. Tapi dia benar-benar menakjubkan, mudah-mudahan dia bisa terus seperti itu,” harap Richards. (m15/mf/sky/rtr)

Kuszczak Budak Setan Merah LONDON (Waspada): Kiper Tomasz Kuszczak (foto) menyerang klubnya, Manchester United. Kepada The Sun yang dikutip Selasa (8/11), penjaga gawang asal Polandia itu mengaku, telah diperlakukan bagai budak oleh Sir Alex Ferguson, manajer Setan Merah MU. “Saya telah menjadi budak untuk Manchester. Saya frustrasi, tapi saya tidak ingin memfitnah atau mengkritik Ferguson, itu bukan gaya saya,” ungkapnya.

Kuszczak gabung The Red Devils sejak 2006 silam. Saat itu dia menjadi kiper kedua di belakang Edwin van der Sar, namun nasibnya malah bertambah buruk sejak sang legenda pensiun akhir musim lalu. Bukannya naik pangkat menjadi kiper utama, dia malah digeser menjadi kiper ketiga di belakang David de Gea dan Anders Lindegaard. “Saya telah berbicara dengan Sir Alex Ferguson baru-baru ini. Saya minta

sekarang dia membiarkan saya pergi, sebelum bursa transfer Januari dibuka,” bebernya. “Saya bilang kepada dia bahwa saya ingin main dan kembali ke tim nasional, karena Piala Eropa 2012 tinggal sebentar lagi. Tapi, sepertinya dia tidak peduli,” tambah Kuszczak. Dia pun merasa, sepertinya tidak ada harapan lagi. Selama lima tahun jadi warga Old Trafford, Kuszczak baru 32 kali tampil di Liga

Premier dan musim ini bahkan belum pernah sekali pun bermain. “Kepindahan tentu akan mengingatkan manajer Polandia tentang diri saya, tapi saya tidak mendapat izin dari klub. Apakah mereka melakukan itu secara jahat? Saya sedih mereka bertindak seperti itu,” sesalnya. “Saya punya respek kepada Ferguson. Sebab bagi saya, dia seorang manajer yang hebat. Tapi saya harap dia akan melepas saya pada

Ja n u a r i n a n t i ,” katanya menambahkan. Nasibnya lebih parah dibanding Dimitar Berbatov, yang belakangan juga hanya menjadi pemanis bangku cadangan Setan Merah. (m15/vvn/sun) AP

Semifinal Target Pertama Timnas U-23 JAKARTA (Waspada): Komandan Satlak Prima, Tono Suratman, memuji penampilan perdana Timnas U-23 asuhan pelatih Rahmad Darmawan (RD), yang menggunduli Kamboja 6-0 pada laga pertana Grup A SEA Games 2011. “Saya menghimbau agar semangat pemain Timnas Indonesia semakin tertantang setelah mengalahkan Kamboja 6-0 dalam pertandingan perdana SEA Games XXVI,” tutur Tono di Jakarta, Selasa (8/11). Dia pun mengingatkan, semifinal merupakan target pertama pasukan RD. Kemenangan pertama atas Kam-

boja, menurutnya, harus jadi modal utama menuju laga lainnya agar lolos dari Grup A. Apalagi di Grup A, tambah Tono, Indonesia memiliki lawan tangguh dengan menjajal Singapura, Thailand, dan juara bertahan Malaysia. “Saya berharap dalam pertandingan nanti selalu meraih poin penuh dan minimal seri,” katanya lagi. Tono yakin, semua lawan

di Grup A bisa diatasi, catatannya pemain harus menjaga kekompakan tim. “Dengan satu persatuan yang kuat, bisa memenuhi harapan yang diimpikan hingga mencapai semifinal nantinya,” tukasnya. Melangkah ke semifinal, tukasnya, merupakan target pertama, langkah berikutnya adalah tampil di final. “Siapapun lawan yang akan dihadapi di final nanti tidak ada masalah. yang penting kata kuncinya Tim Nasional Indonesia bisa menyuguhkan medali emas bagi Merah-Putih,” tambah Tono. Rabu (9/11) ini, Malaysia menantang Thailand (pkl 16.00) kemudian Kamboja menghadapi Singapura (pkl 19.00). Se-

Klasemen Grup A Indonesia Malaysia Singapura Thailand Kamboja

1 1 1 0 1

1 0 0 0 0

0 1 1 0 0

0 0 0 0 1

6-0 0-0 0-0 0-0 0-6

3 1 1 0 0

Klasemen Grup B Timor Leste Vietnam Myanmar Laos Brunei Filipina

2 2 2 2 2 2

2 1 1 0 0 0

0 1 1 1 1 0

0 0 0 1 1 2

4-2 3-1 3-2 4-5 3-4 2-5

6 4 4 1 1 0

dangkan Indonesia baru tampil lagi Jumat (11/11) mendatang mulai pkl 17.00 WIB melawan Singapura. (yuslan)

Stadion Akuatik Paling Ramai Pengunjung PALEMBANG (Waspada): Stadion Akuatik di Komplek Olahraga Jakabaring, Palembang, Sumatera Selatan, paling ramai dikunjungi masyarakat dibandingkan arena olahraga lain, jelang SEA Games XXVI, 11-22 November 2011. Ketua Komite Pembangunan SEA Games (SEAG) XXVI Rizal Abdullah di Palembang, Selasa (8/11) mengatakan, desain yang megah dan sangat berbeda pada Stadion Akuatik itu mengundang rasa keingintahuan masyarakat yang mengunjungi Jakabaring Sport City. “Yang paling menarik perhatian masyarakat di Jakabaring Sport City ini adalah Stadion Akuatik. Mungkin karena bentuknya yang lain daripada yang lain, sehingga membuat penasaran masyarakat,” ujar Rizal. Secara pribadi, dia juga tertarik dengan bangunannya karena menyerupai kepompong. “Dari kejauhan saja sudah indah terlihat, apalagi dari dalam akan bertambah kekaguman. Rasanya tidak percaya, Palembang memiliki stadion semegah itu,” papar Kepala Dinas PU Cipta Karya Sumsel tersebut. “Memang yang paling riskan itu Stadion Akuatik, karena proyeknya besar dan waktu penyelesaian pembangunannya sangat mepet. Tapi akhirnya bisa selesai, sehingga saya merasa lega sekali, apalagi kini sudah bisa dikunjungi masyarakat seperti layaknya suatu kegiatan wisata,” katanya lagi. Peringkat kedua yang sering dikunjungi masyarakat adalahWisma Atlet Jakabaring,


ROMBONGAN pembawa Bendera Kontingen bersiap untuk latihan pergelaran parade bendera negara peserta SEA Games XXVI di Lapangan Benteng Kuto Besak (BKB) Palembang, Sumsel, Selasa (8/11). Sebanyak 11 bendera negara peserta diarak dari Benteng Kuto Besak mengelilingi Jalan Merdeka, Palembang. disusul pelataran Stadion Gelora Sriwijaya Jakabaring, arena ski air, dan taman di depan Danau Jakabaring yang menjadi bagian depan arena menembak dan voli pantai. Wisma atlet ramai dikunjungi masyarakat terutama dari kalangan mahasiswa dan lembaga sosial masyarakat, menyusul merebaknya kasus korupsi dalam pembangunannya melibatkan politisi Nazaruddin. Sedangkan taman di depan Danau Jakabaring menjadi objek wisata baru bagi pengunjung, karena menampilkan pemandangan yang indah setelah area

itu dibersihkan dan dikeruk untuk menambah kedalaman. Para pengunjung mendatangi tempat itu, sekaligus menyaksikan atlet ski air Indonesia melakukan latihan pada setiap pagi dan sore hari. Menurut Pengelola Aset Pemprov Sumsel di Jakabaring, Rusli Nawi, terjadi peningkatan signifikan terhadap jumlah pengunjung Komplek Olahraga Jakabaring menjelang pelaksanaan SEA Games. “Jakabaring Sport City ini seakan menjadi daerah tujuan wisata baru bagi masyarakat Kota Palembang. Arena pertan-

dingan baru menjadi tujuan, seperti Stadion Akuatik, ski air, Stadion Menembak, hingga Stadion Gelora Sriwijaya Jakabaring,” tuturnya. Guna menjaga aset Pemprov Sumsel itu, pihaknya melakukan penetapan jam malam kunjungan pada Komplek Olahraga Jakabaring. “Saat ini ada petugas yang berjaga di depan pintu masuk, jika sebelumnya dikenakan parkir maka kali ini tidak lagi. Tapi, untuk malam hari, kunjungan dibatasi hingga pukul 20.00 WIB,” tambahnya. (ant/m18)


WASPADA Rabu 9 November 2011

A11 Futsal Liga Media Siwo PWI Sumut Diundur

Berbasis Porwanas Waspada/Yuslan Kisra

KETUA KONI Rita Subowo dan Menpora Andi Mallarangeng foto bersama Pengurus PSSI Periode 2011-2015 diketuai Prof Djohar Arifin Husin di Hotel Sultan, Jakarta, Selasa (8/11).

Menpora Minta Tata Timnas Ketua KONI Kukuhkan Kabinet Djohar JAKARTA (Waspada): Disaksikan Menteri Pemuda dan Olahraga Andi Mallarangeng, Ketua Umum KONI/KOI Rita Subowo resmi mengukuhkan kepengurusan PSSI periode 2011-2015 di Hotel Sultan, Jakarta, Selasa (8/11). Dengan demikian, kabinet pimpinan Djohar Arifin Husin sudah mendapat legalitas dari otoritas olahraga tertinggi di tanah air untuk menjalankan aktivitasnya di sepakbola nasional, setidaknya untuk empat tahun mendatang. “Selamat kepada semua pengurus PSSI yang baru saja dikukuhkan. Tugas dan tanggung jawab Anda semua sebagai pengurus PSSI dalam mengembangkan sepakbola di tanah air

tidak ringan. Karena itu, saya berharap semuanya sungguhsungguh menjalankan amanah sebagai pengurus PSSI,” ujar Rita dalam sambutannya. “Kepada pengurus PSSI yang lama dan tidak lagi mendapat tempat pada kepengurusan baru, saya ucapkan terima kasih atas dedikasinya selama ini. Biarkan kepengurusan saat ini bekerja demi kemajuan sepakbola nasional,” tambah Rita. Senada itu, Menpora me-

ngatakan pengurus PSSI yang baru butuh kerja untuk menata prestasi timnas di kancah internasional. Dia pun meminta semua pihak agar mendukung kepengurusan hasil Kongres PSSI di Solo beberapa waktu lalu. “Pengurus PSSI yang baru harus diberi kesempatan untuk bekerja terlebih dahulu. Harus dipahami, progres timnas junior kita sedang menanjak. Kemarin, Timnas U-23 baru saja menang telak atas Kamboja di laga pertama SEA Games 2011. Ini tentu sangat menggembirakan,” tegas Andi. Selain itu, lanjutnya, progres menanjak tidak kalah ditorehkan timnas U-14 yang akan tiba

dari Milan, Rabu (9/11) ini. Selain mempertahankan gelar, tim U14 hasil AC Milan Junior Camp juga mengalahkan tim U-14 AC Milan Academy 2-0. “Melihat kenyataan ini, cukup melegakan bagi kita. Sebab progres pemain muda kita cukup menjanjikan. Untuk Timnas Senior, memang kita sulit berbicara banyak di tingkat internasional. Tapi secercah harapan tumbuh dari anak-anak muda kita demi mewujudkan impian kembali menjadi ‘Macan Asia’ seperti yang pernah ditoreh dulu,” beber Andi. Dalam arahannya, Ketua Umum PSSI mengatakan pengukuhan yang dilakukan sebagai jawaban atas rumor duetnya

bersama Farid Rahman hanya untuk tiga bulan. Setelah itu, akan dilakukan Kongres Luar Biasa (KLB) untuk menunjuk ketua dan wakil dari pihak-pihak tertentu. “Pengukuhan hari ini (kemarin-red) membuktikan bahwa rumor yang beredar selama ini hanyalah bohong belaka. Kepengurusan kita akan berlangsung hingga empat tahun ke depan sesuai mandat kongres,” ucapnya. “Memang kita terus diganggu, tapi kita semua tetap harus fokus untuk bekerja sesuai bidang dan tanggung jawab masing-masing,” pungkas Djohar. (yuslan)

Darwin Resmi Terima SK PSSI JAKARTA (Waspada): Ketua Umum PSSI Sumut, Drs H M Darwin Syamsul, resmi menerima Surat Keputusan (SK) Pengukuhan Personalia Pengurus PSSI Sumut periode 2011-2015 di Hotel Mulia Senayan, Jakarta, Selasa (8/11). Penyerahan SK untuk pengurus PSSI Sumut tersebut diberikan langsung oleh Ketua Umum PSSI Djohar Arifin Husin didampingi Bernhard Limbong, dan Sekretaris Komite Eksekutif (Exco) PSSI, Sarluhut Napitupulu, beberapa saat setelah pelantikan dan pengukuhan Pengurus PSSI Pusat oleh Ketua Umum KONI/KOI Rita Subowo. Menariknya, penyerahan SK bernomor SKEP/43/JAH/XI/ 2011 tertanggal 3 November 2011 itu menjadi kegiatan pertama bagi Djohar usai dilantik

dan dikukuhkan bersama sejumlah pengurus PSSI masa bakti empat tahun ke depan. “Harapan saya, pengurus PSSI Sumut baru bisa menyelesaikan masalah yang terjadi di Sumut, tentunya dengan merangkul semua pihak demi kepentingan sepakbola Sumut ke depan,” pinta Djohar saat ditemui Waspada mengomentari penyerahan SK bagi pengurus PSSI Sumut itu. Darwin yang juga ikut menyaksikan pengu-kuhan Pengurus Pusat PSSI memastikan sudah berupaya merangkul semua elemen yang ada. Meski diakuinya tidak begitu mudah untuk bisa memuaskan semua pihak. “Tapi sejak awal saya sudah bertekad untuk merangkul semua pihak. Sebab saya memang

tidak ada tendensi lain untuk memimpin sepakbol Sumut. Semuanya murni untuk pengabdian dan demi kemajuan sepakbola Sumut,” kata Darwin. Mengenai program terdekat, pengusaha asal Kota Medan ini mengatakan pihaknya akan melakukan konsolidasi dengan kepengurusan kabupaten/kota di Sumut. Tentunya dengan melakukan pembenahan internal organisasi demi perbaikan yang ke arah yang lebih baik. “Setelah melakukan konsolidasi, kami akan menggelar Raporda (Rapat Pimpinan Organisasi Daerah) untuk menetapkan peraturan organisasi dan program kerja. Salah satu program kerja yang menjadi perhatian adalah pembinaan usai dini,” tandas Darwin. (yuslan)

Waspada/Yuslan Kisra

KETUA PSSI Sumut Drs H M Darwin Syamsul, menerima Surat Keputusan (SK) Pengukuhan Personalia Pengurus PSSI Sumut 2011-2015 di Hotel Mulia, Senayan, Jakarta, Selasa (8/11).

USU-Medan Putra Seri Biranta FC Tekad Ulang Sukses

628 Peserta Kejurprov PBSI Sumut

Batubara Jadikan Tenis Meja Unggulan

peserta tetap menjunjung tinggi sportivitas. Ketua Umum KONI Sumut, Gus Irawan SE Ak MM, optimis bulutangkis Sumut dapat berkembang dan memberi kontribusi bagi daerah pada kejuaraan nasional. Dikatakan, ini sudah ditunjukkan Pengprov PBSI Sumut yang menjaga tradisi lolos ke PON XVIII di Riau pada tahun depan. Sebagai jawara wilayah Sumatera pada pelaksanaan Pekan Olahraga Wilayah (Porwil) lalu, atlet bulutangkis diharapkan dapat meningkatkan prestasi menghadapi PON. Dalam sambutannya, Johannes IW menyebutkan Kejurprov ini merupakan kalender kerja tahunan PBSI Sumut yang bertujuan menjaring pebulutangkis pemula dan remaja untuk dibina pada pelatihan daerah. Kejurprov ini juga menjadi ajang penjaringan kelompok ta-

runa dan dewasa dalam persiapan Kejurnas di Pekanbaru, 29 November-3 Desember 2011. Ketua Panpel Kejurprov, KasimWijaya, menambahkan 628 peserta terdiri atas 16 kabupaten/kota masing-masing Asahan, Binjai, Lang-kat, Labuhanbatu, Labuhanbatu Selatan, Medan, Madina, Padangsidimpuan, Padanglawas, Sergai, Simalungun, Pematangsiantar, Tebingtinggi, Tapanuli Utara, dan Tanjungbalai. Kelompok pertandingan terdiri atas tunggal anak-anak putra-putri, tunggal pemula (pa/pi), tunggal remaja (pa/pi), tunggal taruna (pa/pi), tunggal dewasa (pa/pi), ganda pemula (pa/pi), ganda remaja (pa/pi), ganda taruna putra, ganda dewasa (pa/pi), ganda veteran 85 tahun (pi), ganda veteran 90 tahun (pa), dan ganda veteran 100 tahun (pa). (m18)

LIMAPULUH (Waspada): Batubara mempersiapkan tenis meja sebagai cabang olahraga unggulan. “Ini sesuai prospek dimiliki, Batubara tempat berkembang atlet tenis meja yang akhirnya dapat mengharumkan nama daerah di tingkat provinsi maupun nasional,” tukas Ketua Persatuan Tenis Meja Seluruh Indonesia (PTMSI) Kabupaten Batubara, Helman, Selasa (8/11). Langkah awal dilakukan berkaitan pembinaan Sumber Daya Manusia (SDM), seperti bibit atlet dan tenaga pelatih agar sejalan kesiapan administrasi dalam melaksanakan tugas organisasi yang diamanahkan. Pengembangan olahraga maupun tenis meja katanya membutuhkan partisipasi aktif masyarakat secara luas. Dunia usaha, setidaknya dapat mengucurkan dana Corporate Social Responsibility (CSR) sangat dibutuhkan dalam gerak maju pembangunan di sektor olahraga dan kepemudaan. “Ini sejalan dukungan Pemkab Batubara terhadap bangkitnya prestasi olahraga,”ujar Helman yang juga Kadis Budparpora setempat.(a13)

Pardomuan Pimpin KONI Simalungun PARAPAT (Waspada): Musyawarah Olahraga Kabupaten (Musorkab) KONI Kabupaten Simalungun yang digelar di Hotel Patra Jasa, Parapat, Sabtu (5/11) lalu, memilih Pardomuan Nauli Simanjuntak sebagai ketua umum periode 2011-2015. Musorkab yang dibukaWakil Ketua KONI Sumut, Agung Sunarno, diikuti 16 pengurus cabang (Pengcab) olahraga se-

tempat. Rapat pemilihan Ketua Umum KONI Simalungun yang diikuti dua calon, Pardomuan Nauli Simanjuntak dan Darwin Saragih, sempat berjalan tegang karena ada beberapa Pengcab minta menjadi pemberi suara. Namun pimpinan rapat Parsaoran Manullang menyatakan sesuai keputusan rapat panitia dengan pengurus Pengcab serta ketentuan yang telah diatur

dalam pelaksanaan Musorkab KONI Simalungun yang berhak memberikan suara hanya 16 Pengcab. Dalam pemungutan suara, Pardomuan meraih 13 suara dan Darwin tiga suara. Usai terpilih, Pardomuan mengatakan akan berupaya menjalin kemitraan dengan Pemkab dan DPRD Simalungun untuk meningkatkan prestasi. (a29)

orang dengan ketentuan usia bebas. Wartawan yang bukan anggota PWI 5 orang, usianya minimal 30 tahun,” tambah Halomoan. Saat pertandingan berlangsung , peserta diwajibkan menurunkan formasi minimal 3 anggota PWI dan 2 wartawan nonanggota di lapangan. Ini merupakan keputusan mutlak yang tidak dapat diganggu gugat,” ujarnya lagi. Menurut Jonny Ramadhan Silalahi, ketentuan demikian dilaksanakan karena Liga Media 2011 berbasis Porwanas (Pekan Olahraga Wartawan Nasional), yang akan dilaksanakan tahun 2013 mendatang di Surabaya, Jawa Timur. “Sesuai hasil Rakernas Siwo PWI 2011 di Kendari, 27-29 Mei lalu, syarat peserta Porwanas harus sudah berstatus anggota biasa PWI,” jelas Jonny, yang bersama Ketua Siwo PWI Sumut SR Hamonangan Panggabean ikut menjadi peserta di Kendari. Jadi melalui Liga Media

2011, tukas Jonny, Siwo ingin memantau sekaligus menjaring calon pemain futsal untuk membela PWI Sumut pada Porwanas 2013. “Rencananya, PWI Sumut akan mengirimkan dua tim futsal untuk event akbar di Surabaya nanti, yakni tim prestasi dan tim usia 40 tahun ke atas. Sesuai perhitungan kami, futsal terutama usia 40 merupakan salah satu cabang andalan kita,” timpal Monang Panggabean. Karenanya hasil pantauan dan penjaringan dari Liga Media 2011, tekad Monang, bakal dimatangkan melalui Pelatda berjalan kemudian makin diintensifkan setelah pelaksanaan Liga Media 2012. Khusus untuk Liga Media 2011, menurut Syamsir, pendaftaran peserta dibuka 1-8 Desember di Kantor PWI Sumut, Jln Adinegoro/Parada Harahap Medan, mulai pkl 10.00-15.00 WIB atau dapat menghubungi contact person 081361456933 dan 082163851927. (m42)

Taklukkan AC Milan Academy

KASDAM I/BB Brigjen TNI I Gede Sumertha KY PSC MSc (3 kiri), Ketua Umum KONI Sumut Gus Irawan SE Ak MM (kiri), Ketua Umum Pengprov PBSI Sumut Ir Johannes IW (kanan), Ketua Panpel Kejurprov Kasim Wijaya (2 kiri), dan Sekum PBSI Sumut H Syari Arwansyah (kanan) foto bersama trofi Indocafe yang diperebutkan pada Kejurprov PBSI Sumut di Gedung PBSI Sumut, Jl Willem Iskandar Medan Estate, Selasa (8/11).

MEDAN (Waspada): Sekira 628 peserta dari 16 daerah mengikuti Kejuaraan Provinsi (Kejurprov) PBSI Sumut di Gedung PBSI Sumut Jl Willem Iskandar Medan Estate, Selasa (8/11). Kegiatan yang digelar hingga Sabtu (12/8) ini memperebutkan Piala Indocafe dan dibuka Kasdam I/BB Brigjen TNI I Gede Sumertha KY PSC MSc. Turut dihadiri Ketua Umum KONI Sumut Gus Irawan SE Ak MM dan Ketua Umum Pengprov PBSI Sumut Ir Johannes IW, Kasdam I/BB mewakili Pangdam I/BB Mayjen TNI Lodewijk F Paulus mengatakan pihaknya menyambut positif pelaksanaan kejuaraan tersebut. Bahkan dia meyakini kegiatan yang turut diikuti pebulutangkis muda usia ini mendukung peningkatan prestasi bulutangkis di daerah. Tak lupa, Pangdam meminta seluruh


KETUA Panpel Liga Media Piala Gubsu III Halomoan Samosir bersama Sekretaris M Syamsir dan Jonny Ramadhan Silalahi (Wakil Ketua Siwo PWI Sumut) dan Yonan Febrian, membahas persiapan kejuaraan di Kantor PWI Sumut, Jalan Adinegoro Medan, Selasa (8/11).

Sukses Besar Indonesia All-Star Team

MEDAN (Waspada): Kesebelasan PSK USU harus puas dengan torehan satu angka setelah ditahan tanpa gol oleh PS Medan Putra pada penyisihan Grup D Turnamen Antarklub PSMS 2011 di Stadion Kebun Bunga Medan, Selasa (8/11). Dengan hasil itu, baik USU maupun Medan Putra sama-sama mengemas empat poin setelah pada laga pertama meraih kemenangan. Duel kedua tim tersebut pun berlangsung dalam keadaan lapangan kurang mendukung akibat diguyur hujan deras. Begitupun, kedua tim tetap tampil mengotot meski peluang demi peluang selalu gagal berbuah gol hingga laga berakhir. Sebelumnya, akibat hujan deras, pertandingan pertama antara Indian Football Tim (IFT) dan Sinar Medan, terpaksa dihentikan pada menit 13. Laga kedua tim yang saat dihentikan skor masih 0-0 akan dilanjutkan pada jadwal yang sudah ditentukan panitia. Sementara itu, Biranta FC yang akan menghadapi PS Telkom, Rabu (9/11) ini, bertekad mengemas poin penuh. Selain untuk memperbesar peluang lolos fase grup, kemenangan juga dimaksud mengulang sukses mereka di laga perdana saat menaklukkan Medan Utara 1-0. “Kita tetap akan menurunkan format yang sama ketika Biranta mengungguli Medan Utara. Mengandalkan kecepatan rotasi antarpemain dalam menembus pertahanan lawan. Selain tidak membiarkan lawan lebih lama mengolah bola,” ujar Ketua Umum Biranta FC, Yose Rizal didampingi Sekretaris Eva, dan Manajer Tim M Yacob, Selasa (8/11). Dikatakan, kemenangan tim asuhan duet pelatih Sucipto Hadi dan Suyono di laga perdana diharapkan menjadi motivasi para pemain untuk meraih sukses di laga berikutnya, khususnya saat menghadapi PS Telkom.“Untuk itu, para pemain harus tampil maksimal dan tidak menganggap enteng lawan,” tambah pelatih Biranta FC, Sucipto. (m42/m24)

Waspada/Setia Budi Siregar

MEDAN (Waspada): Pelaksanaan kejuaraan futsal bertajuk Liga Media Siwo PWI Sumut Piala Gubsu III yang seyogyanya digelar 26 November - 4 Desember 2011, diundur menjadi tanggal 10 Desember - 18 Desember mendatang. Menurut Ketua Panitia Liga Media 2011 Halomoan Samosir didampingi sekretaris Muhammad Syamsir di Medan, Selasa (8/11), pengunduran jadwal Liga Futsal tahun ini merupakan hasil keputusan pengurus Siwo Sumut dan PWI Cabang Sumut. Didampingi Wakil Ketua Siwo PWI Sumut Jonny Ramadhan Silalahi serta pengurus Ayub Kesuma dan Yonan Febrian, Halomoan mengatakan, panpel melakukan demikian demi menindaklanjuti masukan dari calon peserta. “Khususnya terkait pelaksanaan SEA Games XXVI di Palembang dan Jakarta pada 1122 November, yang dipastikan menyedot enerji para wartawan olahraga. Sebagian pengurus juga ada yang melakukan peliputan langsung, sehingga persiapan nantinya dikhawatirkan kurang maksimal,” papar Halomoan. Menyangkut syarat peserta juga ada perubahan. Sebelumnya, peserta yang memperkuat masing-masing tim disyaratkan terdiri dari 6 anggota PWI dan 4 wartawan non-anggota yang telah bekerja selama 3 tahun di media. “Rapat memutuskan, peserta anggota PWI menjadi 5


PEMAIN Medan Utara, Ichsanul Rizki (15), melepas tendangan di bawah pengawalan ketat lawan yang berujung gol kedua bagi timnya pada penyisihan Grup I Super Seri Festival (SSF) U-12 di Lapangan Air Bersih Medan, Selasa (8/11).

MILAN, Italia (Waspada): Anak-anak Indonesia All-Star Team (IAST) yang berusia 1315 tahun membuktikan, layak menjuarai Intesa Sanpaolo Cup 2011, setelah dalam laga ujicoba mengalahkan AC Milan Academy 3-2 di Centro Sportivo Pozzo, Selasa (8/11). Laga kedua tim berlangsung seru dalam laga berdurasi 2x40 menit. AC Milan Academy dengan pemain berpostur lebih tinggi dan rata-rata kelahiran 1997 dibuat kelabakan. IAST lebih banyak mengambil inistiatif serangan di babak pertama dan harusnya unggul lebih dulu setelah Adnan Faturrahman dijatuhkan di dalam kotak terlarang. Wasit menunjuk titik putih, tetapi sayangnya Sabeg Fahmi Fachrezy gagal memanfaatkan peluang emas tersebut.

Milan Academy juga banyak mengandalkan serangan balik, tetapi tak satu pun serangan lawan membahayakan gawang IAST yang dikawal Muhammad Fadly Habibi. Hingga turun minum, skor tanpa gol. Menit 53 Milan Academy unggul lebih dulu. Rahmanto cs berusaha bangkit membongkar pertahanan lawan. Sabeg membayar kegagalannya dengan dua gol kemudian dimantapkan gol Gavin menit 68. Tujuh menit jelang bubaran, tendangan bebas Milan Academy dari jarak 20 meter memperkecil kedudukan menjadi 3-2. Kemenangan IAST angkatan kedua ini lebih baik ketimbang tahun lalu, saat angkatan pertama yang menjuarai Intesa Sanpaolo Cup 2010 digunduli Milan Academy 0-5.

Acungan Jempol Pelatih AC Milan Academy memberikan acungan jempol buat anak-anak IAST. “Mereka sangat bagus. Secara keseluruhan mereka memiliki skill teknis yang bagus, cerdas, dan tentunya ini menjadi pengalaman yang baik buat mereka,” kata Gallicchio. “Bagi kami ini sebuah laga friendly, tetapi bagi mereka ini sebuah impian. Mereka bermain sangat baik dan saya ikut senang mereka memenangkan pertandingan ini,” tambahnya. “Saran saya adalah mereka harus terus belajar dan mengasah skill. Mereka harus tumbuh dengan skill bermain taktik. Tidak cukup bermain dengan sepuluh atau 12 pemain, mereka harus tumbuh sebagai tim,” demikian Gallicchio. (m33/m42/goal)

Supriyantoro Ketuai Shiroite Sumut MEDAN (Waspada): Jabatan Ketua Umum Pengda Shiroite Karatedo Sumatera Utara diserahterimakan dari Kol CPM Sudirman kepada Kol CPM Supriyantoro SIP di Garuda Plaza Hotel Medan, Selasa (8/11). Acara serah terima jabatan turut dihadiri pengurus Pengda Shiroite Karatedo Sumut termasuk Ketua Harian Dr Rosihan Arbie serta undangan lainnya. Pergantian ini pun dilakukan bersamaan berakhirnya masa tugas Kol CPM Sudirman sebagai Danpomdam I/BB. Dalam kata-kata perpisahannya, Sudirman berharap Shiroite Karatedo mampu menjadi lembaga beladiri kebanggaan masyarakat Indonesia, khususnya Sumut. Karena itu, Sudirman berharap pengurus maupun penggantinya lebih aktif membina atlet yang sekarang sudah mencapai 1.800 orang. “Sebagai Ketua Umum Pengda Shiroite Sumut hampir dua tahun, saya sudah berusaha bekerja maksimal, walaupun belum memenuhi harapan.

Waspada/T Junaidi

KETUA Umum Pengda Shiroite Karatedo Sumatera Utara yang baru dilantik, Kol CPM Supriyantoro SIP (tiga kiri) diabadikan usai serah terima jabatan bersama Ketua Harian Dr Rosihan Arbie (kiri), Komisi Teknik Lambok Hutapea, dan Kol CPM Sudirman, Selasa (8/11). Saya berharap pembinaan atlet tetap menjadi perhatian pengurus baru dan mampu membuat perencanaan lebih baik ke depannya,” ucap Sudirman mengakui Sumut memiliki karateka berbakat di tingkat nasional. “Kembangkan terus kemampuan atlet dengan berpedoman pada teknik yang telah

diajarkan pelatih,” katanya. Sementara itu, Kol CPM Supriyantoro SIP sangat mengharapkan dukungan semua pengurus agar harapan pejabat lama bisa terkabulkan. Selain itu, Supriyantoro juga menanti masukan atlet maupun pengurus, agar roda organisasi berjalan dengan baik. (m19)

Laju Sempurna SSB Medan Utara SSF U-12 SSB Patriot MEDAN (Waspada): SSB Medan Utara kembali memetik poin penuh di laga keduanya dengan menundukkan SSB Kenari Utama 3-0 pada penyisihan Grup I Super Seri Festival (SSF) U-12 SSB Patriot di Lapangan Air Bersih Medan, Selasa (8/11). Atas kemenangan itu, Medan Utara melaju ke babak 32 besar dengan hasil sempurna (enam poin) setelah pada laga pertama mengalahkan tuan rumah Patriot B. Kenari Utama dan Patriot B selanjutnya akan bersaing memperebutkan posisi runner-up grup. Bermain di lapangan berlumpur, anak-anak Medan Utara tetap tampil ngotot. Rizki Ariesta berhasil mencetak gol pembuka Medan Utara di paruh babak pertama sebelum akhirnya laga kedua tim diguyur

hujan lebat. Bermain di bawah guyuran hujan, Medan Utara terus tampil menekan untuk menguasai permainan. Hasilnya, dua gol kembali dicetak melalui kaki Ichsanul Rizki dan Rizki Ariesta mengubah kedudukan 3-0. Kemenangan juga diraih SSB Rajawali pada laga perdananya saat menghadapi SSB Tasbi B. Gol tunggal Rangga di babak pertama sudah cukup untuk meloloskan Rajawali dari penyisihan Grup J dan tinggal menghadapi Disporasu A untuk merebut juara grup. SSB Surya Putra Sampali yang bersaing di Grup G, turut mengemas poin penuh dengan mengalahkan Medan Soccer 2-0. Selain membuka peluang melaju ke 32 Besar, kemenangan itu sekaligus menebus

kekalahan mereka di laga pembuka atas PTP Wil I-A. Di Grup H, Putra Mulia kembali harus puas dengan satu poin akibat ditahan Sunggal Putra 0-0. Pada laga sebelumnya, Putra Mulia juga ditahan Gumarang B 0-0. Nasib Putra Mulia selanjutnya akan ditentukan lewat laga penyisihan grup terakhir antara Gumarang B dan Sunggal Putra, Kamis (10/11) besok. Laga Kompas dan Cemara Putra Sampali terpaksa dihentikan sebelum waktunya akibat hujan deras dan lapangan tergenang air. Tiga pertandingan lainnya antara SSB Citra Perkasa vs Mandiri, USU Junior vs SP Marindal, dan Ladon A vs Bumi Serdang Damai terpaksa ditunda dan dilanjutkan Rabu (9/11) ini. (m42)



WASPADA Rabu 9 November 2011

Isu Pemain Hengkang Menguat MEDAN (Waspada): Izin pulang ke kampung halaman dalam rangka Idul Adha sempat meredupkan kabar bakal hengkangnya 11 pemain dari mes Kebun Bunga. Namun ketidakhadiran mereka di Medan, Selasa (8/11), membuat spekulasi tersebut kembali menguat. Seperti diketahui, tim seleksi memberi izin hingga Selasa kepada pemain karena latihan

akan kembali digelar. Namun dari 11 pemain yang pulang kampung, hanya Ramadhan

Syahputra dan Edi Kurnia yang sudah kembali ke Medan. Edi sendiri tak sempat ikut latihan karena baru tiba siang hari. Menariknya dari pemain yang belum kembali, hanya Zainal Anwar yang memberikan keterangan soal keterlambatan tiba di Medan. Sementara Ahmad Kurniawan, Eko Prasetyo, Ledi Utomo, Deni Rumba, Kerry Yudiono, Anton Samba, Cucu

Motor 1000 cc Janjikan Kesenangan


CALON kiper utama PSMS Medan, Achmad Kurniawan (baju hitam), belum kembali ke mes Kebun Bunga pascaizin liburan Idul Adha hingga Selasa (8/11).

VALENCIA, Spanyol (Waspada): Era motor 800 cc akhirnya berakhir di MotoGP Valencia dengan ditandai kemenangan Casey Stoner, Minggu (6/11) lalu. Mulai musim 2012 mendatang, MotoGP akan menaikkan kapasitas mesinnya dari 800 cc menjadi 1000 cc. “Saya tidak berpikir bahwa itu akan mengubah cara pebalap berkendara,” kata Stoner dikutip dari Autosports, Selasa (8/11). Era 800 cc yang dimulai sejak lima tahun lalu akhirnya berakhir di Sirkuit Ricardo Tormo. Di sirkuit yang sama pula, era 1000 cc akan dimulai ketika para pebalap menguji motor mereka hingga Rabu (9/11) ini. Meski tarikan mesin jadi lebih

kencang, Stoner meyakini hal itu takkan mengubah gaya membalap para rider secara radikal. “Saya hanya berpikir (motor 1000 cc) itu akan memberi kita lebih banyak tenaga putaran dan lebih banyak kesenangan di saat gigi tinggi. Namun, Anda harus tetap mampu mengendalikan kekuatan tersebut tentunya, sama seperti 800 cc,” ujar Stoner. Selain Stoner, Stefan Bradl mendapatkan hadiah dari tim Honda. Seusai berhasil menjuarai Moto2, tim LCR Honda meminta pebalap asal Jerman itu mengendarai motor LCR dalam tes di Valencia. Seperti diketahui, Bradl memastikan diri menjadi pebalap

Hasil Latihan Selasa (8/11) Casey Stoner Dani Pedrosa Ben Spies Randy de Puniet Valentino Rossi Andrea Dovizioso Hector Barbera Cal Crutchlow Karel Abraham Stefan Bradl Kousuke Akiyoshi Franco Battaini Ivan Silva Carmelo Morales Gianluca Nannelli

(Australia/Repsol Honda) (Spanyol/Repsol Honda) (AS/Yamaha Racing) (Prancis/Rizla Suzuki) (Italia/Ducati Marlboro) (Italia/Yamaha Tech 3) (Spanyol/Pramac Racing) (Inggris/Yamaha Tech 3) (Rep Ceko/Cardion AB) (Jerman/LCR Honda) (Jepang/Repsol Honda) (Italia/Ducati Marlboro) (Spanyol/BQR Inmotec) (Spanyol/Laglisse BMW) (Italia/Grillini Team)

1m32.322s (34 lap) 1m32.861s (27) 1m33.226s (64) 1m33.544s (40) 1m33.857s (54) 1m34.064s (38) 1m34.174s (47) 1m34.363s (56) 1m34.602s (50) 1m34.778s (52) 1m35.728s (25) 1m36.797s (18) 1m37.159s (44) 1m38.989s (23) 1m39.173s (24) JUARA dunia MotoGP asal Australia, Casey Stoner (kiri), menerima hadiah mobil BMW 1 Series M Coupé sebagai pebalap terbaik di sesi kualifikasi dengan prestasi 12 pole position sepanjang musim 2011 di Sirkuit Ricardo Tormo, Valencia, Selasa (8/11).



DUEL klasik antara Joe Frazier (tengah) kala menjatuhkan Muhammad Ali di ronde ke-15 pada pertemuan pertamanya di Madison Square Garden, New York, 8 Maret 1971 silam. Inzet Joe Frazier.

“Smokin” Joe Frazier Tutup Usia PHILADELPHIA, AS (Waspada): Mantan juara dunia kelas berat, Joe Frazier, meninggal dunia di rumah sakit, Philadelphia, Amerika Serikat, Selasa, (8/11) dinihari. Petinju dengan julukan “Smokin” Joe itu menghembuskan nafas di usia 67 tahun. Seperti dilansir Reuters, Frazier meninggal akibat penyakit kanker hati. Dalam perjalanan kariernya, Frazier merupakan petinju yang terkenal lewat pertarungan triloginya dengan legenda tinju lain, Muhammad Ali, pada 1971-1972. Sepekan sebelum meninggal, Frazier mengatakan berat badannya menurun. Saat rekan-rekannya seperti Jesse Jackson dan Larry Holmes berniat mengunjunginya, petinju yang gemar merokok itu menolak. Selain duel klasik melawan Ali, Smokin Frazier tercatat sebagai peraih medali emas Olimpiade 1964, juara dunia kelas berat pada 1970 kala memukul Jimmy Ellis dengan kemenangan KO. Setelah mempertahankan gelarnya beberapa kali, termasuk melawan Ali pada 1971, Frazier kehilangan gelarnya di

Vettel Kagum Yas Marina YAS MARINA, Abu Dhabi (Waspada): Red Bull Racing tiba diYas Marina jelang balapan GP Abu Dhabi akhir pekan nanti. Sebastian Vettel, telah memastikan gelar juara dunia, pun menyambutnya dengan antusisas. “Trek di Abu Dhabi sangat khusus. Balapan di mulai saat senja dan selesai malam hari,” kata Vettel, Selasa (8/11). Dikatakan, bagian bawah Hotel Yas Marina dan pitlane di sirkuit serasa di basement. “Saat ke luar dari pitlane berasa seperti ke luar dari garasi parkir bawah tanah,” tambah pebalap asal Jerman itu.(m33/auto)

tangan George Foreman di Kingston, Jamaika (1973). Namun, dalam duel ketiganya melawan Ali pada 1975, pertarungan berlangsung sangat brutal sehingga dijuluki “Thriller in Manila”. Saat itu, mata Frazier bengkak dan nyaris tertutup sehingga wasit memutuskan Ali menang TKO di ronde 15. Selama 1968-1973, Fraizer memenangkan 32 pertandingan di mana 27 di antaranya berakhir KO. Empat kekalahan dideritanya saat bertemu Ali dan George Foreman (masing-masing dua kali). Kendati sempat terlibat perang dingin, Muhammad Ali turut mengirimkan ucapan belasungkawa kepada keluarga Joe Frazier. Ali pun mengatakan dunia tinju kehilangan seorang juara yang hebat. “Saya akan selalu mengingat Frazier dengan hormat dan rasa kagum terhadapnya. Simpati saya untuk keluarga tercintanya,” kata Ali. (m33/rtr)

Pasang Iklan

Telp. 4528431 HP. 081370328259 Email:

terbaik di kelas Moto2 sekaligus mengalahkan sang pesaing, Marc Marcquez. Untuk kelas 125cc, Nico Terol dinyatakan sebagai rider terbaik. Sebagai bentuk penghargaan atas suksesnya, Bradl mendapatkan kesempatan menjajal motor RC213V. Sayang, Bradl belum mampu beradaptasi dan harus puas mengakhiri sesi latihan di peringkat 10. Dalam latihan ini, Jorge Lorenzo juga belum tampil karena masih dalam tahap penyembuhan pascacedera. (m33/auto)

Hidayat dan Ari Priyatna absen tanpa kabar. “Hanya Zainal Anwar yang memberikan keterangan sakit. Yang lain absen,” ujar anggota tim Pelaksana Teknis PSMS, Fityan Hamdy. Namun dari deretan pemain yang belum kembali, Ferry Aman Saragih sudah tak terlihat dalam latihan sepekan terakhir sebelum libur Idul Adha. Tak ayal, mantan kapten Deltras Sidoarjo itu paling kencang dihembuskan angkat koper. Calon Asisten Pelatih PSMS, Suharto, membenarkan ketidakhadiran beberapa pemain. Namun mantan Pelatih PSMS musim lalu ini kembali menegaskan pemain hanya izin karena libur Idul Adha. “Mereka kan sudah izin libur Idul Adha. Ya, kita masih tunggulah mereka kembali,” ujar Suharto santai. Sebelumnya, beberapa pemain yang dikonfirmasi mengenai kabar ini sempat membantah isu tersebut. Dalam hal ini, Achmad Kurniawan dan Denny Rumba menyebutkan dirinya sudah komit bersama Ayam Kinantan dan izin untuk

berkumpul dengan keluarga. Di lain pihak, kebutuhan akan sosok gelandang serang membuat PSMS sangat menantikan kedatangan wajah-wajah baru. Salah satunya adalah Orlando de Melo Juninho yang santer dikabarkan akan datang ke Medan. Juninho awalnya direncanakan hadir di Medan sejak pekan lalu. Namun mantan pemain Minangkabau FC ini menunda kedatangannya karena ada urusan di Brazil. Dikatakan, Juninho harus mengantar ibunya berobat. Namun ia memastikan dalam dua hari ke depan akan tiba di Kebun Bunga. Pemain yang disebut-sebut jebolan Akademi Sepakbola Manchester United itu terdengar sangat antusias ke Medan. Pemain berusia 22 tahun ini mencoba semakin mencintai sepakbola Indonesia. “PSMS klub yang besar dan punya suporter yang fanatik dan punya historis yang luar biasa. Yang saya inginkan hanyalah punya kesempatan untuk bermain dan saya harap kesempatan itu ada di PSMS,” jelasnya. (m33)

Sumatera Utara

WASPADA Rabu 9 November 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:11 12:24 12:11 12:18 12:18 12:15 12:11 12:07 12:14 12:13

‘Ashar 15:31 15:45 15:32 15:38 15:39 15:35 15:32 15:27 15:34 15:34

Magrib 18:11 18:23 18:12 18:17 18:18 18:18 18:12 18:08 18:14 18:13



Shubuh Syuruq


19:21 19:33 19:22 19:28 19:28 19:28 19:22 19:18 19:24 19:23

04:42 04:57 04:42 04:51 04:50 04:44 04:42 04:37 04:45 04:45

04:52 05:07 04:52 05:01 05:00 04:54 04:52 04:47 04:55 04:55

L.Seumawe 12:17 L. Pakam 12:10 Sei Rampah12:09 Meulaboh 12:21 P.Sidimpuan12:08 P. Siantar 12:09 Balige 12:09 R. Prapat 12:06 Sabang 12:24 Pandan 12:10

06:08 06:23 06:09 06:18 06:16 06:10 06:08 06:04 06:11 06:12

Zhuhur ‘Ashar 15:38 15:30 15:30 15:41 15:28 15:29 15:29 15:26 15:45 15:30





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:16 18:19 18:09 18:21 18:11 18:10 18:11 18:08 18:22 18:13

19:26 19:20 19:19 19:31 19:21 19:20 19:21 19:18 20:32 19:23

04:49 04:41 04:40 04:52 04:37 04:39 04:39 04:35 05:57 04:39

04:59 04:51 04:50 05:02 04:47 04:49 04:49 04:45 05:07 04:49

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:10 12:12 12:21 12:14 12:11 12:18 12:06 12:16 12:09 12:09

18:12 18:13 18:20 18:16 18:12 18:18 18:07 18:17 18:12 18:10

19:22 19:23 19:30 19:26 19:22 19:28 19:17 19:27 19:22 19:20

04:39 04:42 04:54 04:44 04:42 04:50 04:37 04:47 04:39 04:40

04:49 04:52 05:04 04:54 04:52 05:00 04:47 05:57 04:49 04:50

Panyabungan 12:07 Teluk Dalam12:14 Salak 12:12 Limapuluh 12:08 Parapat 12:09 GunungTua 12:07 Sibuhuan 12:06 Lhoksukon 12:16 D.Sanggul 12:10 Kotapinang 12:05 AekKanopan 12:17

06:16 06:07 06:06 06:19 06:03 06:06 06:05 06:02 06:23 06:06

15:30 15:32 15:42 15:34 15:33 15:39 15:27 15:37 15:30 15:29

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:06 06:08 06:21 06:10 06:09 06:16 06:03 06:14 06:05 06:06

Zhuhur ‘Ashar 15:27 15:34 15:32 15:28 15:30 15:27 15:26 15:37 15:30 15:25 15:27




Shubuh Syuruq

18:10 18:18 18:14 18:08 18:11 18:09 18:09 18:15 18:12 18:07 18:08

19:20 19:28 19:24 19:18 19:21 19:19 19:19 19:25 19:22 19:17 19:18

04:35 04:42 04:42 04:38 04:40 04:36 04:35 04:48 04:40 04:34 04:37

04:45 04:52 04:52 04:48 04:50 04:46 04:45 04:59 04:50 04:44 04:47

06:02 06:08 06:08 06:05 06:06 06:02 06:01 06:15 06:06 06:01 06:03

Mobil Patwal Tubruk Becak

Satu Penumpang Tewas Waspada/Hotma Darwis Pasaribu

DIRUT PT Dirgantara Group, Hj. Nurmah Khaidar Aswan menyaksikan penyembelihan hewan kurban di kawasan Kampoeng Niaga Dirgantara, Batang Kuis.

Dirgantara Bagikan Daging Kurban Kepada Warga Dan Karyawan BATANGKUIS (Waspada): Untuk ke sekian kalinya, PT Dirgantara Group melaksanakan agenda tahunan melaksanakan penyembelihan hewan kurban pada hari raya Idul Adha, yang dibagikan kepada masyarakat sekitar dan karyawannya. “Selain menunaikan ibadah, penyembelihan hewan kurban juga merupakan implementasi kegiatan sosial PT Dirgantara Group, yang mempererat hubungan silaturahmi dengan masyarakat,” kata Dirut PT Dirgantara Group, Hj. Nurmah, yang pada tahun ini penyembelihan hewan kurban tidak didampingi General Manager, OK. Khaidar Aswan karena tengah melaksanakan rukun islam ke lima di tanah suci, Makkah. Penyembelihan dua ekor sapi dilaksanakan Senin pagi (7/11), di kawasan wisata budaya Kampoeng Niaga Dirgantara Batang Kuis,disaksikankaryawandanDirektrisPTBumiDeliHusadaNuzila MahdayaniAswan, Direktur PTBumiDeliHusadaKhalisdaKhuraira Aswan,DirekturDirgantaraPos, YulidaMahfizaAswandan Drektur Dirgantara Training Centre, Anjas Asmara Aswan. NuzilaAswan,usaimenyaksikanpenyembelihanmengatakan, ini hal yang wajib. “Kami juga mendoakan agar Pimpinan Umum PT Dirgantara diberi kesabaran dan kesehatan dalam melaksanakan ibadah haji di tanah suci, dan sekembalinya dari tanah suci menjadi haji mabrur,” doanya yang diaminkan Dirut PT Dirgantara Group, Hj. Nurmah Kahidar Aswan. Saat pembagian daging hewan kurban, sejumlah warga, fakir miskin dan jompo, berduyun mengambil daging kurban sesuai dengan jumlah kupon yang dibagikan 2 hari sebelum penyembelihan hewan kurban. Harapan warga saat mengambil daging kurban melalui kupon yang telah dibagi dua hari sebelumnya, PT Dirgantara Group terus melaksanakan penyembelihan hewan kurban, sehingga keberadaan PT Dirgantara Group sangat berarti bagi warga sekitar.“Kami doakan PT Dirgantara Group tambah maju, menjadi perusahaan yang kokoh dan menjadi bagian penting di tengah masyarakat Batang Kuis,” ujar warga.(a07)

Dua Bocah Jatuh Ke Sungai 1 Tewas, 1 Masih Dicari SILINDA (Waspada): Dua bocah jatuh ke Sungai Batu Masage, Kec. Silinda, Kab. Serdang Bedagai saat akan mengambil air untuk menyiram ladang, Senin (7/11) pukul 11:00. Satu korban ditemukan meninggal dunia dan seorang lagi dalam pencarian. Menurut keterangan di Mapolres Serdang Bedagai, Senin (7/11), kedua korban yakni Ester Simanjuntak, 13, dan Nova Simanjuntak, 7, warga Desa Batu Masage, Kec. Silinda, pagi itu bersama orangtuanya hendak menyemprot ladang. Sampai di ladang keduanya mengambil air di sungai Batu Masage. Saat mengambil air itulah mereka terjatuh ke sungai dan dibawa arus. Ketika itu ada seorang anak bernama Desi, 9, melihat keduanya terjatuh, dan memberitahu orangtuanya. Setelah ditemukan, mayat korban dibawa ke Puskesmas Silinda untuk visum. Sedangkan adiknya Nova Simanjuntak, belum diketahui nasibnya. Kasubbag Humas Polres Serdang Bedagai, AKP ZN Siregar yang dikonfirmasi membenarkan kejadian itu.(a08/c03)

Cabuli Gadis Di Bawah Umur Diadukan Ke Polisi BINJAI(Waspada):Ch,17,wargaJalanApelIIIKelur.Sukaramai, Kec. Binjai Barat, Senin (7/11), diadukan ke Polres Binjai oleh orang tua Bunga, 15, bukan nama sebenarnya, penduduk jalan Palapa Lk IV, Kel. Suka Maju, Kec. Binjai Barat, karena mencabuli anak gadisnya Orangtuanya didampingi korban yang masih berstatus pelajar itu, mengadu ke Polres Binjai sesuai Lp/1182/XI/2011 SPKT B Reskrim, 7 November 2011. Kini tersangka Ch masih dalam pelacakan pihak berwajib. Kasat Reskrim Polres Binjai AKP Roni Bonic, S.Ik ketika dikonfirmasi, Selasa (8/11), membenarkan adanya pengaduan itu. Peristiwa tersebut terjadi sekitar Maret 2011. Ketika itu korban dibawa tersangka ke rumahnya. Korban dibujuk rayu agar melakukan hubungan intim, tapi korban menolak. Beberapa hari kemudian tersangka kembali membawa korban ke rumahnya yangdalam keadaan kosong, dan membujuk rayu akan bertanggungjawab. Akhirnya korban menuruti permintaan tersangka, dimana hubungan intim itu akhirnya berlangsung beberapa kali. Namun saat korban minta pertanggungjawaban, tersangka mengelak sehingga kasusnya diadukan ke polisi. (a05)

Apotek Kimia Farma Dibobol Maling TEBINGTINGGI (Waspada): Apotek Kimia Farma di Jalan Jenderal Suprapto, Kota Tebingtinggi dibobol maling. Akibatnya uang senilai Rp13 juta dalam brankas, lenyap. Pelaku diperkirakan masuk melalui atap asbes ruko lantai dua tersebut, lalu ke ruang tempat penyimpanan uang dengan mencongkel kunci pintu. Petugas PolresTebingtinggi yang mendapat laporan langsung melakukan olah TKP, Senin (7/11) pagi, mengambil sidik jari pelaku di meja ruangan dan kotak brankas di ruangan yang digunakan untuk praktek dokter spesialis kandungan. Terlihat kunci pintu ruangan dalam apotek tersebut rusak. Apoteker Kimia Farma, Untung Tri ketika dikonfirmasi mengatakan, baru mengetahui kejadian itu ketika membuka ruko, Senin (7/11) pagi. “Petugas apotek, A. Ginting yang pertama menemukan pintu kamar ruangan rusak, lalu melaporkannya kepada kami. Belum diketahui obat-obatan yang hilang, karena masih didata,” jelasnya. Setelah dihitung kehilangan uang di dalam brangkas cash box tersebut berkisar sebesar Rp 13 juta. Kanit Resum Polres Tebingtinggi, Iptu Topan HT di lokasi, memperkirakan pelaku masuk dengan merusak atap. Ternyata, selain membobol apotek pelaku juga masuk ke toko buku di sebelahnya melalui asbes. Satu handpone dan uang Rp100.000 lenyap dari laci toko.(a11)

STABAT (Waspada): Oknum Polantas Resort Langkat yang mengemudikan mobil dinas Patwal, menubruk becak yang ditumpangi pasangan suami istri. Dalam peristiwa di jalan umum Kel. Pekan Tanjungpura, sekira pukul 06:00, Selasa (8/11) itu, seorang tewas. Berbagai keterangan yang dihimpun, mobil dikemudikan oknum Polantas yang disebut berpangkat Briptu itu melaju dari arah Aceh menuju markas Satlantas di Stabat. Saat melintas di Jalinsum Kel. Pekan Tanjungpura, mobil yang dikendarainya menubruk penumpangbecakdayung,SitiMaryam, 54, bersama suaminya Usman, warga Desa Payaperupuk

Kec.Tanjungpura hingga terseret beberapa meter. Belumdiketahuipastiapakah oknum polisi itu mengantuk saat menyetir, atau faktor kelalaian korban. Oknum tersebut langsung membawa kedua korban ke RSU Tanjungpura, tetapi beberapa saat kemudian Siti Maryam meninggal dunia. Sementara suaminya, Usman, menurut pihak RSU Tanjungpura telah dirujuk ke salah saturumahsakitdiMedan,karena kondisinya kritis. ‘’Saat kejadian korban menuju pasar untuk belanja kebutuhan jualan rujak sehari-hari,’’ tutur Idris, warga Kel. Pekan Tanjungpura. Sementara Kanit Patroli Satlantas Polres Langkat, Ipda Aruan ketika dikonfirmasi Waspada beberapa jam setelah kejadian, terkesan enggan berkomentar. Aruan hanya menyebutkan

pangkat oknum tersebut masih Briptu. Sedangkan Kasat Lantas Polres Langkat, AKP Faidil Zikri yang dikonfirmasi, juga terkesan menutupi kejadian itu. ‘’Sudah tidak ada masalah, kami bersama Kapolres sedang berada di rumah duka memberi santunan,’’ ujarnya tanpa menjawab lebih lanjut atas berbagai pertanyaan seputar kronologis kejadian. Kapolres Langkat AKBP Mardiyono, bahkan tidak menjawab ketika ditanya sanksi yang akan diberikan kepada anggotanya. Mobil Patwal yang menubruk juga menghilang pasca kejadian. Beredar kabar mobil berada di Mapolsek Tanjungpura untuk pengusutan lebih lanjut, namun kenyataannyatidakada.Pantauan di Mapolres maupun di markas Satlantas dari pagi hingga siang, mobil yang ringsek juga tidak terlihat.(a03)

Warga Pesisir 3 Kecamatan Akan Jebol Bendungan Mangrove P. BRANDAN (Waspada): Warga pesisir dari tiga kecamatan di Teluharu yang diperkirakan mencapai 4.500 orang, Rabu (9/ 11) hari ini bertekad menjebol bendungan areal mangrove di Desa Lubuk Kertang, Kec. Brandan Barat yang kini menjadi perkebunan kelapa sawit. Akumulasi kekesalan warga pesisir terhadap pelaku konversi tampaknya telah mencapai puncak. Massa bersatu karena merekaakhir-akhirinimerasakan dampak nyata dari pemusnahan hutan mangrove, merendam pemukiman mereka khususnya apabila pasang naik. Wilayah yang terendam ternyata tidak hanya di Desa Kelantan, tapi juga Desa Perlis, Kec. Brandan Barat termasuk sebagian pemukiman warga pesisir di lingkungan Sei. Bilah, Kec. Sei Lepan. Ke tiga wilayah ini kabarnya termasuk daerah paling rentan diterpa pasang.

Massa rencananya turun melalui jalur laut menggunakan sejumlah armada boat dan perahu motor, menuju lokasi dengan menempuh perjalanan sekitar 30 menit. Mereka akan menjebol paluh-paluh yang telah dibendung untuk meminimalisir dampak penetrasi air laut ke pemukiman mereka. Eman, warga Desa Perlis kepada Waspada mengatakan, saat ini setiap musim pasang air laut tidak hanya merendam pemukiman, tapi juga hingga ke badan jalan. Kondisi ini membuat warga pesisir sangat resah. Presidium KNTI Region Sumatera, Tajrudin Hasibuan, ST mengkonfirmasikan kepada Waspada, Selasa (8/11), pihaknya bersama NGO dari KIARA dan WalhiSumut,sangatmendukung aksi masyarakat. “Kami akan terusmengawalsampaipengusaha termasuk oknum pejabat hengkang dari kawasan ini,” tegasnya.

Rencana aksi ini, lanjut dia, telah diberitahu kepada Bupati Langkat, Ngogesa Sitepu beserta jajaran SKPD terkait, termasuk Kapolres Langkat. “Insya Allah jika tidak ada halangan, aksi masyarakat positif digelar,” ujar Presidium Kesatuan NelayanTradisional Indonesia (KNTI) itu. Tajrudinmenambahkan,saat ini masyarakat telah sadar bahwa praktikalihfungsimembawadampak besar bagi lingkungan pesisir. Dampak yang dirasakan bukan hanyanaiknyaairpasang,tapiekses yang tak kalah serius, yakni kerusakanekosistemyangmengancam kelangsungan hidup nelayan. Dia sangat menyesalkan, beberapawaktulalukasusalihfungsi hutan mangrove di Desa Lubuk KertanginisudahditanganiDinas Kehutan Sumatera Utara termasuk Polda Sumut, tapi hingga kini tindak lanjut penanganan perkaranya tetap tak jelas, seperti ada kesan di ‘peti es’ kan.(a02)

Budaya Proposal Hilangkan Wibawa Pemerintah PANGKALANSUSU (Waspada): Instansi pemerintah diminta menghilangkan kebiasaan meminta-minta kepada perusahaan BUMN atau swasta, dalam setiap membuatacaraatauevent.Budayamemintalewatpengajuanproposaldapatmenjatuhkankewibawaan pemerintah. Demikian ditegaskan SekretarisDPCPartaiNasionalBanteng Kemerdekaan(PNBK)Kab.Langkat, ImamWibowo, ketika diminta tanggapannya atas kebiasaan oknum di instansi pemerintahan yang kerab mengajukan proposal dalam setip menyelenggarakan event. “Kebiasaanmengajukanproposal kepada pelaku usaha menunjukkan budaya malu sudah tidakada.Budayasepertiiniharus dihilangkan. Instansi pemerintah semestinya memberi contoh kepada masyarakat agar bisa hidup mandiri tanpa harus meminta-

mintakepadapihaklain,”ujarnya. Dia prihatin, Camat Pangkalansusu termasuk nominasi ranking satu dalam pengajuan proposalbantuandibandingenam kecamatan, dua kabupaten dan satu kotamadya yang berada di wilayah kerja PT Pertamina EP Field Pangkalansusu. Yang menambah keprihatinan politisi itu, akibat banyaknya melayani proposal, anggaran untuk program Corporate Social Responsibility (CSR) yang seharusnyalebihurgendemimemberdayakanprekonomianmasyarakat, malah dikurangi Pertamina. Imam juga mengkritisi Pertamina yang dianggap tidak tegas menolakproposal.Diamintamanajemen perusahaan migas itu mengalokasikan anggaran yang lebih untuk pemberdayaan ekonomimasyarakat,ketimbangmelayani proposal dari instansi pemerintah.

Di tengah gencarnya sorotan publik, Camat Pangkalansusu kembali mengajukan proposal bantuan sarana dan prasarana ke Pertamina EP untuk kegiatan sosialisasi antisipasi gerakan teroris, dari Badan Nasional Penanggulangan Teroris (BNPT). KLO Pertamina EP Pangkalansusu, Daniel Munthe didampingi Pws Humas, Rusmida, saat dikonfirmasi Waspada mengatakan, pihaknya akan memprioritaskan program pemberdayaan ekonomi masyarakat sesuai memorandum Field Manager No. 587/EP11B8/2011-SO. “Kami akan selektif melayani permohonan bantuan dengan harapan dana yang dikeluarkan untuk proposal dapat ditekan, supaya program CSR dapat berjalansesuaiharapan.Namundemikian, kami tetap berupaya menjaga relationship dengan para stakeholders,” ucapnya.(a02)

Festival Beduk Tropi Ketua DPRD Deliserdang LABUHANDELI (Waspada): Festival beduk dan karnaval/ pawai takbir malam takbiran Idul Adha 1432 Hijriah memperebutkan tropi bergilir Ketua DPRD Deliserdang, berlangsung Sabtu (6/11) malam, di Lapangan 10 November, Pasar X, Desa Ma-

nunggal, Kec. Labuhandeli. Pembukaan festival oleh Ketua DPRD Deliserdang Hj. FatmawatyTakrimdihadiriCamat Labuhandeli Dedi Maswardy diwakili Sekcam Drs. H. Gongma Harahap, Kades Manunggal Misgiat, tokoh masyarakat dan

Waspada/Feirizal Purba

KETUA DPRD Deliserdang Hj. Fatmawaty Takrim didampingi Sekcam Labuhandeli Drs. H. Gongma Harahap melakukan pemukulan beduk perdana.

tokoh agama. Fatmawty mengemukakan, festivalbedukinigunamemeriahkan malam takbiran Hari Raya Kurban (Idul Adha). ‘’Sekaligus sebagai syiar Islam serta mempererat silaturrahmi sesama umat Islam,’ ’katanya. Selanjutnya Ketua DPRD DS didampingi Sekcam Labuhandeli Gongma Harahap, Kades, dewan juri melakukan pemukulan beduk perdana. Sebelumnya, Sekcam atas nama Camat Labuhandeli menyatakandukunganterhadapfestival beduk dan karnaval maupun kegiatan syiar agama lainnya. Juara Umum Remaja Masjid Al-Khairiyah sekaligus menerima tropi bergilir Ketua DPRD Deliserdang yang diserahkan Kades Manunggal Misgiat. Juara II RM Al-Mukhlisin, III. RM Baiturrahman, IV. RM RM Al-Amaliah, V. RM Al-Jihad, VI. RM Nurul Hidayah, VII. RM Al-Iman dan VIII. RM Al-Ikhlas. Minggu (6/11), shalat Idul Adha di Lapangan 10 November dengan imam dan khatib HM Marahalim Harahap.(m34)

Waspada/Eddi Gultom

BUPATI Sergai Ir. H.T. Erry Nuradi, M.Si didampingi Sekdakab Drs. H. Haris Fadillah, M.Si melantik kepengurusan Tim Penggerak Pemberdayaan dan Kesejahteraan Keluarga (TP PKK) Kabupaten Sergai masa bakti 2010 – 2015 diketuai Ny. Hj. Evi Diana Erry.

Bupati Sergai Lantik Pengurus TP PKK Masa Bakti 2010-2015 SEI RAMPAH (Waspada): Bupati Serdang Bedagai Ir. HT. Erry Nuradi, M.Si melantik keanggotaan/kepengurusan Tim Penggerak Pemberdayaan Kesejahteraan Keluarga (TP PKK) Kabupaten Sergai, masa bakti 2010 – 2015. Pelantikan disaksikan Sekdakab Sergai Drs. H. Haris Fadillah, M.Si, para Asisten, Staf Ahli Bupati, Kepala SKPD dan Camat se Kabupaten Sergai, di aula Sultan Serdang kompleks kantor Bupati Sergai di Sei Rampah, Senin (7/11). Susunan kepengurusan, Ketua Ny. Hj. Evi Diana Erry yang sebelumnya dilantik Ketua TP PKK Provinsi Sumut, 6 Desember 2010,Wakil Ketua I, Ny. Hj. Marliah Soekirman,Wakil Ketua II, Ny. Hj. Imas Haris Fadillah, Sekretaris, Drs. KP. Sitorus dan Bendahara Ny. Doliana M. Syafi’i. Kemudian Ketua Pokja I, Ny. Ruminta Rudy Sitorus, Ketua Pokja II, Ny. Hj. Dewi Iriani Rapotan Siregar, Ketua Pokja III, Ny. Hj. Irna Widiani Ifdal dan Ketua Pokja IV, Ny. Julastri Zaniyar beserta para anggota. Bupati Sergai Ir. H.T. Erry Nuradi, M.Si mengatakan,PKKsebagaiorganisasiperempuan terbesar yang mana dalam kiprah dan andilnya telah membantu tugas-tugas pemerintahan seperti mensukseskan Program KB di masyarakat, posyandu serta kesehatan ibu dan

anak. Demikian juga di bidang pendidikan, dengan adanya kegiatan PAUD serta pembinaan masyarakat dalam mensejahterakan keluarganya sekaligus meningkatkan kualitas hidup sehat dalam keluarga. Untuk itu Pemerintah Daerah akan terus memfasilitasi pendanaan, pembinaan, bimbingan dan kesertaaan pada program-program yang relevan dengan program pembangunan di daerah. Selaku Pembina PKK Sergai, Bupati Sergai Ir. H.T. Erry Nuradi, M.Si meminta TP PKK Sergai memberdayakanmasyarakatuntukmengoptimalkan halaman pekarangan rumahnya guna meningkatkan perekonomian keluarga, misalnya menanam sayursayuran atau buah-buahan di halaman rumah. Disampingitu,langkahoptimalisasipemanfaatan pekarangan ini, menurut Bupati, salah satu upaya alam mewujudkan one village one product, minimal satu kecamatan menghasilkan satu jenis produk andalan sebagai hasil budidaya tanaman dari pekarangan rumah penduduk, sebagai ciri khas desa maupun kecamatan masing-masing. Untuk itu diminta kepada SKPD terkait seperti Dinas Pertanian serta Dinas Kehutanan dan Perkebunan untuk bersinergi dengan TP PKK Kecamatan dalam penyediaan bibit dan keperluan lainnya, ujar Bupati Erry Nuradi.(a08)

Tersangka Kasus Dana DBH, Mantan Kadis Pendapatan Diperiksa Kejari TEBINGTINGGI (Waspada): Mantan Kadis Pendapatan Tebingtinggi, Drs. SR, tersangka kasus Dana Bagi Hasil (DBH) pertambangan tahunanggaran 2008,2009,2010diperiksaKejari Tebingtinggi Deli, Senin (6/11). Pemeriksaan berlangsung sekira 5 jam mulai pukul 11:00 hingga pukul 16:00. Kepada tersangka diajukan 17 pertanyaan terkait penggunaan dana bagi hasil bantuan pemerintah pusat yang masuk dalam APBD, di ruang tertutup staf pidsus. Sebelumnya, 17 lebih saksi diperiksa termasuk Bendahara dan Sekretaris Dinas Pendapatan. Terkait hal tersebut, Kasi Pidsus Kejari Tebingtinggi, ZulfanTanjung, SH menerangkan, pemeriksaan tersangka merupakan panggilan kedua, setelah panggilan pertama tidak hadir

karena alasan sakit. Tersangka didampingi pengacaranya, Aldian Pinem, SH. Ketika ditanya jumlah kerugian negara dalam kasus DBH tersebut, Zulfan mengatakan masih diselidikiauditordariProvinsiSumut. Soalpenahanan tersangka, dia menyebut mantan Kadis Pendapatan selaku pengguna anggaran dalam dana DBH itu, sudah ditetapkan sebagai tersangka sejak 3 Oktober 2011. Tapi tersangka belum ditahan, karena belum ada perintah pimpinan. “Belum ada perintah pimpinan untuk menahan tersangka,” ujarnya. Dana Bagi Hasil Rp10 miliar itu merupakan hasil dari daerah penghasil pertambangan yang dibagikan kepada daerah-daerah yang tidak mempunyai hasil tambang, seperti Tebingtinggi dan beberapa daerah lainnya.(a11)

Jawaban Pemda Dan Pansus Ranperda Inisiatif DPRD Sergai SEIRAMPAH (Waspada): Jawaban Pemerintah Daerah (Pemda) atas pandangan umum fraksi-fraksi DPRD Sergai tentang 6 Ranperda Pemkab Serdang Bedagai tahun 2011, disampaikan Wakil Bupati Sergai, Ir. H. Soekirman, Senin (7/11), di gedung DPRD Sergai di Desa Firdaus, Kec. Sei Rampah. Sementara jawaban Pansus Ranperda Inisiatif DPRD terhadap pendapat pemerintah atas dua Ranperda Inisiatif DPRD, disampaikan Ketua Pansus, H. Usman Effendi Sitorus , SAg. Wabup Sergai, H. Soekirman dalam jawabannya memaparkan sepakat atas usul Fraksi Golkar,tentangprogramprioritasRPJMDSergai, tahun 2010-2015 dengan mengalokasikan 20 persen total anggaran belanja langsung pada 19 program prioritas dimaksud, dari total 287 program yang ada pada RPJMD. “Terkait Ranperda Pajak Bumi dan Bangunan pedesaan dan perkotaan, kami sependapat dengan Fraksi PKB, bahwa pajak itu merupakan upaya pematangan dan pembentukan kemandirian daerah, dan diharap dapat meningkatkan PAD,” harap H. Soekirman.

Kepada Fraksi PAN, lanjut H. Soekirman, diucapkan terima kasih yang sepakat dan mendukung penetapan Ranperda RPJMD Kab. Sergai tahun 20102015,danRTRWKab.Sergaitahun2013-2031menjadi Peraturan Daerah. Sementara itu Ketua Pansus Ranperda Inisiatif DPRD Sergai, H. Usman Effendi Sitorus menyambut baikkomitmenPemkabdalammenyikapipentingnya pendidikan agama bagi pelajar, dimulai dari pemahaman pelajar terhadap nilai-nilai yang terkandung di dalam kitab Suci Al Quran, khusunya bagi pelajar yang beragama Islam di Kab. Sergai. “Memberi apresiasi kepada Pemerintah Kab. Sergai yang telah memahami filosofi, manfaat dan tujuan Perda pelarangan alat-alat tangkap sebagai upaya yang dapat meminimalisir konflik antara nelayantradisionaldanmodern.Diharapkansuasanatersebut menjadi jaminan bagi para nelayan dalam usaha peningkatan kesejahteraan itu sendiri,” paparnya. Paripurna dipimpinWakil Ketua DPRD, Drs. H. Sayutinur didampingi Wakil Ketua MY Basrun dan Drs. HA. Rahim, dihadiri Anggota DPRD Sergai, Sekdakab Drs H. Haris Fadillah, para Staf Ahli Bupati, Kepala SKPD dan para Camat.(c03)

Calon Sekdako Binjai Simpang Siur BINJAI (Waspada): Calon siapa yang bakal menduduki posisi Sekretaris Daerah Kota Binjai, masih simpang siur. Namun ada informasi, Selasa (8/11), menyebut calon kuat adalah Drs Dwi Anang Wibowo, yang kini Kepala Dinas Pendidikan Kota Binjai. Sedangkan seorang pejabat eselon II di Pemko Binjai, menyebutkan, proses untuk menduduki jabatan Sekretaris Daerah bukan mudah. Apakah Dwi AnangWibowo sudah dua kali menduduki jabatan eselon II. Kemudian, juga masih ada pejabat senior di Pemko Binjai, seperti H. Elyuzar Siregar, SH yang kini Ketua Bappeda Kota Binjai, Drs

H. Muhammad Tulen, Kadis Deperindag dan pasar. Drs H. Aspian, yang baru diangkat sebagai Kadis Aset dan Keuangan Daerah. Ketiganya sudah dua kali menduduki eselon II. BahkanbeberapaanggotaDPRDBinjai,menyebut dewan belum dilibatkan mengenai rencana pergantian jabatan Sekdako Binjai. Sebab DPRD harus memberikan rekomendasi. Ternyata informasi Dwi Anang Wibowo bakal dicalonkan sebagai Sekdako Binjai, menggantikan Drs Iqbal Pulungan, masih pro dan kontra. Sementara beberapa pejabat di Pemko, menilai Iqbal Pulungan masih punya kredibilitas menjadi Sekdako. Apalagi Wali Kota Binjai, HM Idaham tidak pernah mengutarakan pergantian Sekdako.(a04)

Sumatera Utara


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara),Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Feirizal Purba (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

Pengidap HIV/AIDS Di L. Batu 43 Orang RANTAUPRAPAT (Waspada): Jumlah pengidap HIV/ AIDS (Human Immunodeficiency Virus/Aqcuired Immune Deficiency Syondrome) di Kab. Labuhanbatu hingga tahun 2011 ini sebanyak 43 orang. Wakil Ketua Komisi Penanggulangan AIDS (KPA) Kab. Labuhan Batu dr H Alwi Mujahid HasibuanMKesdidampingiWakilSekretaris dr HjYeva Erince menyampaikan hal itu saat Sosialisasi dan DiskusiBersamaInsanPersdalam Penanggulangan HIV/AIDS di L.Batu, Selasa (8/11) di Hotel Darma Melati, Rantauprapat. Alwi menjelaskan, dari 43 orang pengidap HIV/AIDS tersebut, 27 orang laki-laki dan 16 orangperempuan.Telahmeninggal 10 orang, 13 orang sedang dalam pengobatan dengan mengkonsumsi Anti RetroViral (ARV).

Usia termuda pengidap HIV/ AIDS 5 bulan dan tertua 56 tahun dan 1 orang ibu hamil (bumil). Perlu diketahui, katanya, ARV bukan lah obat untuk menyembuhkanHIV,melainkanberfungsi untukmenekanperkembangbiakan virus HIV di dalam tubuh manusia. Dia menambahkan, kegiatan yang dilaksanakan KPA L.Batu ini merupakan salah satu upaya menghambat gerak laju perkembanganpenularanHIV/AIDSwalau diakui upaya yang dilakukan KPA ataukomponenpeduliHIV/AIDS tetaptertinggaldibandingkecepatan penularan HIV/AIDS itu sendiri. Upaya-upaya KPA atau komponen peduli lainnya untuk menghambat laju penyebaran HIV/AIDS bagaikan deret hitung sementar laju penyebaran HIV/ AIDS bagai deret ukur.Tetapi kita harusberjuangterusuntukmemperlambat laju penyebarannya. Menurut Kepala Dinas KesehatanLabuhanBatuini,sosialisasi dan diskusi bersama wartawan

ini juga bertujuan untuk menjadikan wartawan sebagai perpanjangan tangan Pemkab Labuhan Batu. “Khususnya KPA, guna melakukan perlawanan terhadap HIV/AIDS.Wartawanmelaluitulisannya dapat melakukan perlawanan itu,” katanya. Sementara dr Hariyati yang menanganipasienpengidapHIV/ AIDS di RSUD Rantauprapat memamparkan, pemeriksaan untuk mengetahui adanya HIV/ AIDSdidalamtubuhpasiendapat diketahuisecaracepatdenganVCT yang ada di RSU Rantauprapat. Namun demikian, pengidap HIV/AIDStidakbolehdijauhialias mendapat dukungan dari keluarga dan lingkungannya dan mau berdisiplin mengonsumsi ARV agar bisa hidup secara normal seperti manusia lainnya. Dalam kegiatan yang diikuti 50insanpersL.Batuitu,turuthadir Sekretaris KPA Provinsi Sumut Ramadhan dan nara sumber dr Riana Limbong (Kapuskesmas Kec. Rantau Utara). (a18/c07)

Warga Datangi DPRD Batubara Desak Pelantikan BPD LIMAPULUH (Waspada): Warga Desa Barung-Barung, Kec LimaPuluh,melakukanaksidemo ke DPRD Kab Batubara mendesak pelantikan Badan Permusyawaratan Desa (BPD) setempat, sebagaimana dilakukan terhadap BPD pemekaran lain yang telah dilantikpada31Oktober2011lalu. ‘’Ini suatu diskriminasi. Apakahkamiberbedadenganmasyarakat lain,’’ tukas salah seorang masyarakat di sela-sela aksinya, Selasa (8/11). Masyarakat mengaku, pada 4 November 2011 telah menyerahkan surat pernyataan ditandatangani dari 397 warga desa ditujukan kepada Bupati Batubara, DPRD, BPMD dan Camat. Namun sampai sekarang belum di-

tanggapi.Anehnyasuratyangmasuk ke Camat meminta penundaan pelantikan ditanggapi. ‘’Apa mereka mendengar aspirasi segelintir orang dengan mengabaikan manyoritas masyarakat,’’ ujarnya. Informasi berkembang, Pejabat (Pj) Kepala Desa BarungBarung akan diganti tanpa alasan yangjelas.Padahaldiamerupakan putra desa yang selama ini tidak bermasalah. ‘’Jika pergantian terjadi,dikhawatirkanmenimbulkan gejolak,’ ‘ujar warga lainnya. Kedatangan seratusan massa yang dipimpin Ilyas, diterima Komisi A DPRD Kab. Batubara antara lain, Al-As’ari, Sutan Sitompul, Hamonangan Simatupang, Rizky Aryetta, Usman, Amat Muktas dan Aminuddin, diawali

memintai penjelasan Camat Andri terkait proses pemilihan BPD sekaligus langkah sosialisasi dilakukan, sehingga berbuntut polemik di masyarakat. Kesimpulan pertemuan, memintakeanggotaanBPDyangterpilih sebagaimana hasil musyawarah dapat diteruskan memilih pimpinan, sebagaimana digariskan PP No 72Tahun 2005 tentang desa selanjutnya merekomendasikan untuk dilantik. Sedangkan soal pergantian Pj Kades Barung-Barung, Komisi AberpegangkepadaPemkabapakah dilanjutkan atau diganti. Soal tapal batas untuk dilakukan pematokan oleh BPMD menghindari terjadinya konflik horizontal dengan desa tetangga.(a13)

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Truk Sarat Muatan Penyebab Jalan Rusak AEKKANOPAN (Waspada): Akibat beban truk yang mengangkut muatan berlebih dan tidak sesuai dengan kondisi jalan, jalan dan jembatan di Kab. Labuhanbatu Utara (Labura) mengalami kerusakan. Dan bila hal ini terus dibiarkan maka masyarakat akan mengalami kerugian dan Pemkab Labura terpaksa mengeluarkan biaya yang besar untuk memperbaiki jalan dan jembatan yang rusak. Pantauan Waspada, belum lama ini, di beberapa daerah yang terdapat Pabrik Kelapa Sawit (PKS) dan tempat penampungan pembelian TBS kelapa sawit (ram), jalan dan jembatan mengalami kerusakan, seperti di Desa Pulo Jantan, Kecamatan Aekkota Batu, Desa Sonomartani yang terdapat sebuah PKS, Desa Sukarame yang juga terdapat PKS dan ram, serta Desa Pulo Dogom, Kec. Kualuhhulu. Di Desa Pulo Jantan, jalannya kupak-kapik dan berlobang-lobang, begitu juga dengan Desa Sukarame, desaPulo Dogom dan bahkan di Desa Sonomartaniselainjalannyahancur,jembatandisanajuganyarisamblas. Rusaknya kondisi jalan dan jembatan yang daerahnya terdapat PKS dan ram diakibatkan truk yang melintasi jalan tersebut sangat sarat muatan mencapai 20 ton sampai 40 ton. Sementara kekuatan badan jalan dan jembatan hanya 10 ton sampai 15 ton. Bila hal ini terus dibiarkan maka masyarakat akan mengalami kerugian karena akses jalan cepat hancur, begitu juga dengan Pemkab Labura akan menguras biaya yang besar untuk memperbaiki akses jalan dan jembatan tersebut. (a16)

Pelatihan Pakem Paket Tahap III RANTAUPRAPAT (Waspada): Kelompok Kerja (Pokja) Penanggulangan KemiskinanTerpadu (Paket) Kab. Labuhanbatu, melaksanakan pelatihan terhadap Panitia Kemitraan (Pakem) Paket Tahap III, baru-baru ini di Hotel Darma Melati. Rantauprapat. Koordinator Pokja PAKET L.Batu Sutrisno didampingi Pokja lainnya, antara lain, Ilham Maulana, Ghozali Harahap dan Hasnah Putri Jaya Siregar, kepadaWaspada, di sela-sela pelatihan, mengatakan, Panitia Kemitraan (Pakem) yang menjadi peserta pelatihan terdiri dari, Pakem Kelurahan Sidorejo, Sigambal, Danau Balai, Urung Kompas dan Sioldengan, Kec. Rantau Selatan. Ilham Maulana menambahkan, tujuan dari pelatihan ini adalah untuk meningkatkan kapasitas Pakem dalam mengelola kegiatan baik dibidang ekonomi, sosial, sarana dan prasarana lingkungan (fisik) agar terpeliharadenganbaikdanmemberikanmanfaatkepadamasyarakat. Dengan pelatihan ini, katanya, Paket untuk tahun 2012 di Kab. Labuhanbatuakanberjalanlebihbaiklagibagikemanfaatanmasyarakat. Pelatihan terlaksana tidak terlepas dari bantuan Corporate Social Responsibility (CSR) Bank Syariah Mandiri, Rantauprapat. (a18)

Waspada/Budi Surya Hasibuan

BUPATI H TIgor Panusunan Siregar pada acara KB Kes di desa Janji Kec. Bilah Barat.

Negara Kuat Harus Didukung SDM Berkualitas RANTAUPRAPA(Waspada): Negara yang kuat harus didukung oleh sumber daya manusia (SDM) yang berkualitas, baik dalam bidang kesehatan, pendidikan, perekonomian dan lain sebagainya. Pembangunanmanusiaberkualitasituharusdimulai dari kelompok masyarakat terkecil, yaitu keluarga. Untuk itu mari kita tingkatkan ketahanan keluarga dengan kembali melakukan sosialisasi terhadap delapan fungsi keluarga, yaitu fungsi agama, sosial budaya, cinta kasih, perlindungan, reproduksi, sosialisasi dan pendidikan, ekonomi, dan fungsi bina lingkungan. Hal itu disampaikan Bupati Labuhanbatu Dr H Tigor Panusunan Siregar SpPD dalam amanat

tertulisnya yang dibacakan oleh Kepala Badan Badan Pemberdayaan dan Keluarga Berencana, Heli Fenida SKM MKes, pada acara apel gabungan di halaman Balai Diklat Badan Kepegawaian Daerah Labuhanbatu, Senin (7/11). Hadir pada kesempatan itu antara lain, Plt Sekdakab Labuhanbatu H Ali Usman Harahap SH, Asisten Administrasi Umum Ahmad Muflih SH, Kepala BKD Aswad Siregar SE MAP, Kadis Pendapatan, Pengelolaan Keuangan dan Aset Daerah Erwin Siregar SH, Kadis Kehutanan dan Perkebunan Ir Jumingan, Kaban Lingkungan Hidup Romiduk Sitompul SH, para eselon III, IV dan staf di jajaran Pemkab Labuhanbatu. (c07)

Belasan Siswa Di Kotapinang Terjaring Razia KOTAPINANG (Waspada): Belasan siswa sejumlah sekolah di Kec. Kotapinang, Kab. Labuhanbatu Selatan (Labusel), terjaring razia kasih sayang yang digelar Satuan Polisi Pamong Praja (Satpol PP) dan Dinas Pendidikan Pemkab Labusel, Selasa (8/11) siang. Sebanyak 13 siswa yang terjaring yakni RH, RdH, dan MI masing-masing siswa SMP Negeri 1 Kotapinang. RTH siswa Madrasah Tsanawiyah Swasta Islamiyah Kotapinang. Kemudian AAP, Kr, ARF, ST, dan An siswa Madrasah Aliyah Swasta Islamiyah Kotapinang. ES, NKH, ES, dan AKS masing-masing siswa SMA Negeri 1 Kotapinang. Seluruh siswa tersebut dijaring petugas saat sedang asyik bermain internet di sejumlah warung internet (warnet) di Kotapinang. Siswa yang seluruhnya laki-laki itu tertangkap basah bermain

internet menggunakan seragam sekolah di saat jam pelajaran masih berlangsung. Tanpa memberikan perlawanan berarti, seluruh siswa digiring petugas ke Markas Satpol PP di Jalan Prof HM Yamin untuk didata dan diberikan pengarahan. “Tadi kita melakukan razia terkait maraknya ulah siswa bolos sekolah, dari sejumlah warnet kita menjaring 13 siswa yang membolos,” kata Kasi Operasional Satpol PP, Sadino yang dikonfirmasi usai operasi tersebut. Dia menjelaskan, operasi tersebut digelar untukmemberikanefekjerakepadasiswaagartidak bolos sekolah. Seluruh siswa kata dia, disuruh membuat perjanjian untuk tidak mengulangi perbuatannya.Usaididata,katadia,seluruhsiswakembali diserahkan ke sekolahnya masing-masing. (c18)

Mushalla Al Ikhlas Terbakar

Hubungi kami

� Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

WASPADA Rabu 9 November 2011

Waspada/Iwan Has

WARGA Desa Barung-Barung, Kec Lima Puluh yang melakukan aksi demo ke gedung DPRD Kab. Batubara di Lima Puluh.

Warga R. Prapat Kewalahan Mendapatkan Premium RANTAUPRAPAT (Waspada):Warga Rantauprapat kembali kewalahan untuk mendapatkan BBM jenis premium. Satu-satunya SPBU di inti kota Rantauprapat, Kab. Labuhanbatu, sudah satu pekan terakhir mengalami kekosongan pasokan. Sementara permintaan terhadap komoditi ini sangat dominan bagi warga setempat. Pantauan Waspada, keresahan seperti yang terjadi di bulan September lalu, kembali dialami warga. Betapa tidak, warga harus mempersiapkan waktunya, khusus untuk mendapatkan bensin saat SPBU tersebut melakukan pengisian, sedangkan pasokan BBM jenis solar, tidak mengalami gangguan. “Mau bagaimana lagi bang, harus stand by di sini dan antri. Kadang malah sudah satu jam ikut antrian, ternyata giliran kita, stok bensinnya sudah habis”, terang Udin ketika dikonfirmasi

Waspada saat antri, Senin (7/ 11). Menurut konsumen lainnya, Hartono, hal ini sudah berlangsung sepekan terakhir. Jika ia tidak mendapatkanbensindiSPBUtersebut,terpaksaiaharusmenggantinya dengan BBM jenis Pertamax. “Susah kadang bang, kalau ngisi di eceran, takut mesin rusak. Maklum, kadang ada pengecer yang nakal jadi, daripada rusak, biarlah pakai Pertamax yang lebih mahal dari bensin”, ujar Hartono. LainlagidengankeluhanSiregar, ia terpaksa berkendaraan beberapa kilometer dari rumahnyakeSPBUyangadadisepanjang Jalinsum. Pasalnya, biasanya dia harus membawa jerigen untuk stokBBMyangdigunakankeluarganya. “Lama-lama bingung melihat pemerintah ini. Seperti saya ini, namanya juga tinggal di pinggiran kota, ya terpaksa harus punyastokminyakminimalsatujerigen. Nah,kalauudahbegini,terpaksalah saya mencari SPBU lainnya arah

keluar kota”, kata Siregar. Sebelumnya, kondisi ini sudah pernah terjadi pada bulan September lalu. Bahkan pada saat itu, kekosongan BBM jenis premium atau bensin, berlangsungduapekan.Anehnya,kondisi ini hanya terjadi di SPBU inti kota Rantauprapat,sedangkandiSPBU lainnya di sepanjang Jalinsum, berlangsung normal. MandurSBPU,Erik,membenarkankondisitersebut.Pihaknya juga merasa jengkel dengan macetnya pengiriman pasokan dari pertamina, apalagi dia ketahui bahwa, pasokan premium di SPBU lainnya yang berada di sepanjang Jalinsum, tidak mengalami masalah. “Abang masih ingat kan dua bulan yang lalu, ya terulang lagi sekarang. Jujur bang, kami juga bingung, bolak balik kami komplainkePertamina,tapitidakditanggapi,”terangErikkepadawartawan saat ditemui di SPBU. (c07)

Banjir Marbau Akibat Perambahan Kawasan Hutan Bukit Barisan LABURA (Waspada); Banjir yang melanda daerah Kec. Marbau Kab. Labura melalui sungai Marbau dan Sungai Milano dituding akibat maraknya perambahanhutankawasanBukitBarisan, demikian dikatakan Ketua ForumKomunikasiPeduliMasyarakat Marbau (FKPMM) H Redho Yaman Harahap kepada Waspada, Sabtu (5/11). Menurut RedhoYaman, dalam kurun waktu lima tahun terakhir,kegiatanperambahanhutan di hulu Sungai Marbau dan Sungai Milano semakin marak. Kawasan Bukit Barisan yang seyogianya dilestarikan itu digunduli, dandisulapmenjadikebunkelapa sawit dan karet.

Padahal, hutan itu berfungsi untuk menahan curah hujan. Logikanya, saat hujan turun air tersebut tidak langsung mengalir ke sungai. Sebab air itu sebagian meresap dan ditahan akar kayu. “Namun karena kayu sudah ditebangi, tak ada lagi yang menyimpanairdansaathujan,air langsung mengalir ke sungai. Sungai tidak sanggup menampung debit air yang deras, meluap dan merusak fasilitas pemerintah, rumah dan tanaman,” kata Redho Yaman. Mantan anggota DPRD Labuhanbatu yang terkenal vokal itu mengatakan, dalam waktu 20 tahun terakhir tidak pernah banjir sebesarini.Makanya,kamiberkeyakinan meluapnya sungai

Marbau dan Sungai Milano sehinggameruntuhkanjembatan lintasan kereta api dan menggenangi 627 rumah serta sekitar 2000 hektar kebun kelapa sawit sekaligusmenjeboltanggulsungai, jelaskarenaulahperambahhutan di hulu sungai Hasil pantauan Waspada, Sabtu (5/11) kegiatan perambahan hutan marak dilakukan di Des Pematang, Batutunggal, Seiraja,HatapangdanMerantiomas, Kec. Na IX - X. Kemudian di Desa Rombisan, Sibito dan Terangbulan, Kec. Aeknatas. Ribuan hektar Hutan Kawasan dengan kemiringan 45 derajat ditebangi lalu dijadikan kebun kelapa sawit dan karet. (a17)

KOTAPINANG (Waspada): Mushalla Al-Ikhlas di Jalan Lintas Sumatera (Jalinsum), Lingkungan Labuhan Lama, Kel. Kotapinang, Kec. Kotapinang, Kab. Labuhanbatu Selatan (Labusel), Selasa (8/ 11)dinihariterbakar.Takadakorbandalamperistiwa ini, namun kerugian ditaksir puluhan juta rupiah. Peristiwa terbakarnya musala itu pertama kali diketahui, oleh sejumlah pengendara yang melintas. Saat itu, sekira pukul 1.30 Wib, mereka me-lihatkobaranapimenjulangdaridindingbawah sebelah selatan bangunan yang bersebelahan dengan rumah persulukan itu. Kejadian itu lantas diberitahukan kepada warga sekitar. Sembari menunggu datangnya bala bantuan, wargabergotongroyongmemadamkanapidengan cara menyiram. Namun upaya warga sia-sia, api dengan cepat merambat ke bagian atas musala Tak berselang lama, tiga unit mobil pemadam

tibadilokasi.Hanyadalamhitunganmenit,petugas berhasil melokalisir dan memadamkan api, sehingga tidak merambat ke pemukiman warga. Meskidemikian,taksatupunperlengkapanmusala yang terselamatkan. “Tadi kami dikagetkan adanya teriakan warga. Sewaktu dilihat rupanya mushala yang terbakar,” kata R Harahap, salah seorang warga. Kanist Reskrim Polsekta Kotapinang, AKP PTambunan yang dikonfirmasi mengatakan, belum diketahui apa yang melatarbelakangi terbakarnya musala tersebut. Namun, dugaan sementara disebabkan hubungan pendek arus listrik. Hingga kini pihak Polsekta Kotapinang masih melakukan penyelidikan dan telah memeriksa dua saksi yang pertama kali melihat kejadian itu. “Kita masih menyelidiki penyebab kebakaran ini. Kerugian ditaksir 40 juta-an,” katanya. (c18)

Polisi Tangkap Pencuri 500 Kg Besi TANJUNGBALAI (Waspada) : PolsekTanjungbalai Selatan menangkap tersangka pencuri 500 kilogram besi di Jalan Juanda Lk. II, Kel. TB Kota I Minggu (6/11). Tersangka yang ditangkap, Jun, 32, warga Jalan Karya, Gg. Damai Link I, Kel Selatlancang, Kec. Datukbandar, Kota Tanjungbalai. Dia diamankan bersama barang bukti besi cor berbentuk segi empat panjang 5 meter dengan berat 500 kilogram, papan panjang bekas cor sebanyak 50 keping dan triplek 9 inci sebanyak 20 lembar. Informasi dihimpun Waspada, penangkapan berawal ketika korban Syahrizal Harahap, 52, warga Jl. Julius Usman Link I, Kel. Pantaiburung, Kec. Tanjungbalai Selatan, melaporkan kehilangan barang kepada Polsek setempat pada 4 Nopember 2011. Menindaklanjuti laporan itu, PolsekTanjung-

balai Selatan lantas turun ke lokasi kejadian guna penyelidikansekaligusmengumpulkanbarangbukti. Berdasarkan petunjuk dan keterangan sejumlah saksi, akhirnya petugas mencurigai tersangka Jun. Dan, setelah alat bukti cukup, maka petugas Polsek Tanjungbalai Selatan mengejar dan menangkap tersangka tanpa perlawanan. Dari lokasipenangkapan,tersangkadigiringkeMapolsek untuk proses lebih lanjut. Kapolres Tanjungbalai AKBP Edward P Sirait dikonfirmasi melalui Kasubbag Humas AKP Y Sinulingga di dampingi Kapolsek Tanjungbalai Selatan Kompol B Siallagan danWakapolsek AKP H Simanjuntak, membenarkan penangkapan. KataSinulingga,tersangkamasihmenjalanipemeriksaan intensif.“Masih diambil keterangannya,” ujar Sinulingga. (a14)

Puluhan Hektar Kebun Kelapa Sawit Tergenang Banjir BAGANBARU -Batubara (Waspada): Diperkirakan 30 sampai 40 hektare tanaman kelapa dan sawit di Desa Baganbaru Kec. Tanjungtiram Batubara digenangi air asin.Akibatnya,sebut petani disana,Selasa (8/ 11) tanaman kelapa mengalami gangguan pertumbuhan, buahnya kecil dan pohon sakit-sakitan terancam mati Warga sejak awal mengkuatirkan dibangunnya drainase pada tahun 2009 lalu menimbulkan dampak masuknya air asin ke kebun petani di sana. Sekarang kenyataan sudah dua tahun tanaman sawit, kelapa masih digenangi air laut yang masuk melalui bangunan drainase tersebut menyebabkan tanam an terancam mati. Untuk mengantisipasi kerugian petani lebih besar, sudah diusulkan agar diba ngun dua buah pintu klep penangkal masuknya air laut. Menurut warga, walau sudah dialokasikan dana APBD Batubara 20 11 sebesar Rp100 juta membangun dua pintu klep , ternyata sampai Selasa (8/11) belum terlihat tanda-tanda dimulainya pekerjaan. Kades Baganbaru Ponirin dihubungi via ponsel,Selasa (8/11) mengatakan, pembangunan dua buah pintu klep dana APBD 2011 belum dimulai, mengingat kondisi jalan rusak berlumpur sulit mengangkut bahan material bangunan tersebut. (a12)


PULUHAN hektar tanaman kelapa,sawit di Baganbaru terancam mati akibat digenangi air asin. Gambar,lokasi rencana dibangunnya pintu klep mengatasi masuknya air asin.

Sumatera Utara

WASPADA Rabu 9 November 2011


PSAB Berbiaya Rp9,7 M Di Dairi Tak Berfungsi SIDIKALANG (Waspada): Umumnya warga Kec. Tigalingga, Kab. Dairi kecewa atas pembangunan Proyek Sarana Air Bersih (PSAB) berbiaya Rp9,7 miliar tahun 2009. Sebab hingga sekarang, air tidak dapat dinikmati pelanggan sebagaimana diharapkan. Waspada/ist

KETUA DPC Partai Demokrat Langkat yang juga Ketua DPRD Langkat,H Rudi H Bangun,SE. MAP menyaksikan hewan kurban yang sudah selesai disembelih.

Ketua Demokrat Langkat Kurban 4 Ekor Sapi MEDAN (Waspada): Ketua DPC Partai Demokrat Langkat yang juga Ketua DPRD Langkat,H Rudi H Bangun,SE. MAP memberikan kurban sebanyak 4 ekor sapi yang dibagikan kepada seluruh kader dan simpatisan Partai Demokrat Langkat yang tersebar di seluruh PAC dan ranting di seluruh wilayah Kabupaten Langkat. Pemotongan hewan kurban dilakukan di sekretariat DPC Partai Demokrat Langkat di Stabat,Senin (7/11). Acara itu dihadiri Ketua DPRD Langkat,Rudi H.Bangun,SE,MAP, anggota DPRD Kab.Langkat dari Fraksi Partai Demokrat,antara lain, Adnan, Nedy dan seluruh Ketua PAC dan Ranting Partai Demokrat Langkat serta kader dan simpatisan Partai Demokrat Langkat. Rudi H.Bangun yang juga sebagai Ketua DPC PD Langkat mengatakan,pelaksanaanpembagiandaginghewankurbankeseluruh kader partai dan simpatisan Partai Demokrat untuk memepererat talisilaturahmidanpersaudaraanantarasesamakaderPartaiDemokrat yang bertepatan dengan Hari raya Idul Adha 1432 H. Hal ini rutin dilakukan setiap tahunnya digelar DPC Partai Demokrat Langkat agar para kader dan simpatisan Partai Demokrat Langkat merasakan sedikit rezeki dari kader Partai Demokrat yang telah duduk sebagai anggota DPRD Langkat . Ke depannya seluruh kader dan simpatisan Partai Demokrat diharapkan semakin kompak dan solid dalam menghadapi tantangan di masa yang akan datang sehingga Partai Demokrat akan semakin besar di Kabupaten Langkat ini,ujar Rudi. Ketua DPRD Langkat yang juga Ketua DPC Partai Demokrat Langkat, H Rudi H Bangun,SE,MAP juga mengatakan,pada momen Hari Raya Idul Adha 1432 H ini, hendaknya kita sebagai umat beragama hendaknya senantiasa berkurban dan beramal dengan menyisihkan sebagian dari harta untuk disumbangkan kepada orang yang membutuhkan agar rezeki kita ditambahkan Allah SWT di tahun-tahun berikutnya . Selain itu agar senantiasa diberikan nikmat dan kesehatan, karena sebagian dari harta benda yang kita miliki adalah hak bagi orang-orang yang kurang mampu, demikian Rudi H Bangun. (m14)

Kesadaran Masyarakat Memakai Helm Masih Minim KISARAN (Waspada): Kesadaran masyarakat Kisaran menggunakan helm dalam berkendara roda dua dinilai masih minim, dan hal itu masih terlihat jelas saat malam hari dan merayakan hari besar. Hal itu diungkapkan, Kasat Lantas Polres Asahan, AKP Eko Hartanto, melalui KAnit Laka Ipda MP Pardede, ditemui Waspada, saat patroli, peringatkan malam Idul Adha 1432 H, baru-baru ini. Diamenjelaskan,malamperayaanituseluruhjalanbesardiKotaKisaran dipadatipenggunajalanyangsebahagianbesarrodadua.Namunsayangnya, mereka tidak memakai helm. “Semua jalan penuh, dengan roda dua, danyangpalingbanyakpenggunasepadamotoradalahkalanganremaja dan pelajar, dan tidak memakai helm,” ujar Pardede. Menurutnya, hal itu adalah kebiasaan masyarakat tidak memakai helm,apalagisaatmalamharidanperayaanharibesar.Padahal,bahaya menantimerekawalaupunmerekasadarakanhalitu.Namundemikian, SatLantasPolresAsahan,terusmelakukaninovasidalammembangkitkan kesadaran masyarakat untuk memakai helm, berupa pemasangan spanduk, sosialisasi kepada pelajar, dan memberikan hadiah kepada pengguna sepeda motor yang memakai helm standar, serta merekrut klub motor untuk menjadi mitra dalam sosialisasi safety riding. “Kita akan terus berusaha agar masyarakat sadar akan memakai helm. Karena berdasarkan data, Asahan tercatat sebagai peringkat keempat laka lantas di Provinsi Sumut, dan sebahagian besar adalah roda dua dengan korbannya terbanyak kalangan pelajar dan remaja,” ujar Pardede. (a15)

Wali Kota Kurban Tiga Ekor Lembu Dan Satu Kambing BINJAI (Waspada): Walikota Binjai HM Idaham, SH, MSi bersama isteri dan dua anak serta keluarga besarnya berkurban tiga ekor lembu dan satu ekor kambing, di kediaman orangtuanya di jalan Samanhudi, Binjai Kota. Walikota Idaham mengatakan, Insya Allah setelah menjadiWali Kota Binjai, keluarga besar Idaham tetap menjalankan perintah berkurban.“Alhamdulilah ini sebagai wujud ketaatan seorang hamba kepadasangpencipta,sebagaiperintahuntuksalingmencintaisersama,” ujar Idaham kepada wartawan. Wali Kota mengimbau kalangan yang mampu untuk berkurban karenainisalahsatuwujudmempererathubunganukhuwahislamiyah, serta memberikan rasa kasih sayang kepada sesama muslim, selain juga perintah dari Allah SWT. Sementara DPC PPP Binjai juga menyembelih hewan kurban satu ekor lembu di sekretariat kantor partai berlambang Ka’bah itu, di Jalan Mongonsidi, Binjai Kota. Pelaksanaan kurban disaksikan Ketuanya, Irhamsyah Pohan, serta para pengurus harian DPC PPP Binjai.(a04)

Jalan Ke Istana Limalaras Rusak TG TIRAM (Waspada): Ruas jalan menuju obyek wisata Istana Limalaras Kec Tanjungtiram, Kab Batubara rusak, dan tergenang air biladiwaktupenghujan,sehinggamenganggupenggunajalanmelintas. Pengamatan Waspada Minggu (6/11), ruas jalan menghubungkan obyek wisata yang mempunyai nilai sejarah kedatukan itu, mengalami kerusakan ditandai lubang di tengah jalan karena aspalnya terkelupas sehingga dipenuhi air bila dimusim penghujan. Amir dan Hasan, warga sekitar mengatakan, kerusakan sudah berlangsung lama. Semula hanya lubang kecil, namun, karena tidak adanya upaya penampalan sehingga jadi melebar. Menurutnya, banyak pengunjung yang datang ke lokasi obyek wisata merasa kecewa melihat kondisi jalan. Sedangkan perhatian DinasPUselakudinasteknis,sejauhinibelumadadansangatdiperlukan melakukan langkah penanggulangan ke lapangan demi menjaga nama baik Batubara di mata masyarakat luar daerah. Kerusakan jalan ini juga berimbas kepada pengemudi betor maupunpengojek yangsetiapharimengangkutpenumpangmelewati jalan menuju desa sekitar maupun Kec Sei Balai, serta jalan lintas pantai lain yang menghubungkan Batubara dengan Asahan dan Tanjung Balai.(a13)

Pengobatan Gratis Meriahkan HKN STABAT (Waspada): Dalam peringatan Hari Kesehatan Nasional (HKN), jajaran Dinkes Langkat menggelar berbagai kegiatan di antaranya pengobatan gratis dan donor darah. Demikian Kadis Kesehatan Langkat, Drg. Herman Shadeck, Senin (7/11). Diuraikan,pengobatan dan pemeriksaan kesehatan gratis berlangsung di Lapangan Desa Sukarakyat Kec. Bahorok, Selasa (8/11) dengan sasaran 300 orang. Sementara donor darah di aula Dinkes Langkat 11 November, melibatkan warga lima kecamatan terdekat. ‘’Kegiatan kita gelar dengan tujuan masyarakat senantiasa sehat dan jika ada gejala sakit, cepat diatasi untuk dirawat,’’ katanya.(a03)

Salah seorang warga desa Tigalingga,Titus Tarigan, 45, kepada Waspada mengatakan, Pemkab Dairi tahun 2009, membangun PSAB berbiaya Rp9,7. Sumber air diambil dari dusun Sibakkurung Desa Jumagerat Kecamatan Tigalingga. Dikatakan,usai pembangunannyadilaksanakan,warga hanya sekitar 4 bulan dapat menikmati air. Kemudian air terputus hingga sekarang. Terputusnya air dari hulu, karena

dibeberapa titik, pipa berpecahan.Sehinggaair.Haltersebut menurutnya, sudah dilaporkan langsung kepada anggota dewan, MartuaAnahampun,yangberasal dari Dapil (Daerah pemilihan) IV,termasuk kecamatan Tigalingga.Sebabsebelumnyakerusakan itu sudah berulangkali di laporkan kepada dinas PU Cipta Karya, namun belum mendapat tanggapan. Anggota DPRD, Martua Anahampun didampingi Wakil ketua,Ir Benpa Hisar Nababan, dikonfirmasi Waspada, Selasa (8/ 11), mengakui telah menerima laporan wargaTigalingga,seputar proyek yang tidak berfungsi itu. Dinas PU Cipta Karya,selaku pengelola proyek, sudah kita desak, agar segera memperbaiki proyek tersebut. Namun hingga sekarang, belum diperbaiki. Menurut Martua, kerusakan proyek sarana air minum,terjadi pada pipa yang berpecahan di beberapa titik.Sehingga air terbuang.Didugapipayangdipasang

tidak memenuhi standart. Dalam waktu dekat pihak terkait dengan proyekituakankitapanggildalam sidang, sebutnya. Dikatakan, dia sendiri sudah melihat proyek itu di lapangan. Sangat disayangkan, tidak berfungsi. Padahal dananya cukup besar, mencapai Rp9,7 miliar. Namun Martua kurang jelas mengetahui, sumber dana proyek tersebut,apakahdariAPBDatauAPBN. Namun besar kemungkinan, bersumber dari APBN. Kepala Dinas PU Cipta Karya, Amister Lumban Gaol, hendak di konfirmasi, Selasa tidak berhasil. Dirut PDAM Tirta Nciho Sidikalang, Ir Rafael Ginting, hendak dikonfirmasi juga tidak berhasil. SumberdikantorPDAMTirta Nciho Sidikalang, mengatakan proyek tersebut murni dikelola dinas Cipta Karya. Dalam kepanitiaantenderPDAMtidakdiikutkan, kendati dana proyek itu, hasil merupakan hasil lobby PDAM dari Jakarta.(a20)


PULUHAN hektar hutan di Desa Sei Tempurung, Kec. Sei Kepayang Timur, Kab. Asahan tidak jauh dari bibir pantai timur Asahan hilang karena dirambah, mengakibatkan habitat alam mulai rusak bahkan punah.

Kasus Perambahan Pantai Timur Asahan

Ada Dua Pendapat Berlawanan KISARAN (Waspada): Kasus dugaan perambahan hutan manggrove di Pantai Timur Asahan, tepatnya di Desa Sei Tempurung, Kec. Seikepayang masih tahap peningkatan penyidikan. Ada dua pendapat berlawanan, yang satu menyatakan wilayah itu termasuk kawasan hutan, namun yang lain menyatakan tidak. Dualismeberlawanitudinyatakan tim ahli Dinas Kehutanan Asahan dan Provinsi Sumut. Berdasarkan tinjuan lapangan dan pengkajian data, lahan mengatas namakan S alias Ayok, melihat PetaTata Guna Hutan Kesepakatan (TGHK) No 293/KPTS/UM/ 12/1982, wilayah itu termasuk kawasan hutan lindung, sama halnya dengan merujuk SK Menteri Kehutanan No 44/2005, wilayah itu juga tetap termasuk kawasan hutan. Sementara bila dilihat peta tapal batas wilayah hutan oleh panitia pada November 2005, wilayahitubukanlahkawasanhutan, dan letaknya tepat di perba-

tasan hutan Patuntungan dan Hutan Sungai Boras, Kec. Seikepayang. Demikian Kapolres Asahan, AKBP Marzuki MM, melalui Kasat Reskrim, AKP Fahrizal didampingiKasubagHumasAKP R Berutu, ditemui Waspada di ruang kerjanya, Selasa (8/11). Menurutnya dengan adanya dualisme itu, belum bisa ditetapkansiapatersangkautama,karena kedudukan wilayah hutan masih mengambang. Namun demikian Polres terus melakukan penyidikan, dengan memeriksa panitia tapal batas, dan mencari keabsahan tapal batas yang menyatakan itu bukanlah kawasan hutan. “Masalah ini masih dalam pemeriksaan, dan bila semua unsur terpenuhi, akan dilimpahkan kepada Kejaksaan Tanjungbalai, untuk menuju proses persidangan,” ujar Fahrizal. Menurut Fahrizal, kasus ini sudahduakalidilimpahkankepada Kejari Tanjungbalai, dan dua kali juga dipulangkan, karena

menurut mereka ada beberapa yangbelumterpenuhi,danPolres akan melengkapinya dan menunggu hasilnya peningkatan penyidikan. “Kita berharap Kejari Tanjungbali bisa respon dengan ikut menyelidikinya, terutama dualisme pendapat tim ahli yang menyatakantermasukatautidaknyakawasanhutan,”ujarFahrizal. Tersangka Baru Menurut Fahrizal, bila hasil pemeriksaan kawasan yang dikerjakan itu termasuk kawasan hutan,makaakanditetapkanAyok sebagai tersangka, namun tidak tertutup kemungkinan ada tersangka baru yaitu panitia tapal batas yang menyatakan kawasan itu bukan kawasan hutan. Sedangkan Ayok, menjadi saksi saja. “Kita sedang memeriksa panitia tapal batas, dan minta keabsahan tapal batas tersebut, karena berdasarkan TGHK dan SK Menhud No. 44, wilayah itu kawasan hutan. Sehingga dualisme itu bisa terpecahkan,” ujar Fahrizal.(a15)

PLN Tanjungbalai Bagikan Daging Kurban TANJUNGBALAI (Waspada): PT. PLN (Persero) Ranting Tanjungbalai Cabang Rantauprapat menyembelih dan membagibagikankurbankepadaparapensiunan, pegawai outsourching, fakir miskin dan warga sekitar di halaman kantor, Selasa (8/11). Pembagian itu, dilakukan Manager PT.PLN (Persero) RantingTanjungbalai Ir. Abdul Kholik Nasution di dampingi Bagian Pelayanan Pelanggan, Timbul Silalahi dan disaksikan Kepala Cabang PT. PLN Rantauprapat Ir. Abdul Haris Nasution dan Asmen SDM Zulkifli Lubis. Abdul Kholik mengatakan, perayaan Idul Adha merupakan momentum yang mengajak dan mengingatkan umat untuk ikhlas berkurban kepada orang lain. “Idul Adha mengajarkan kita rela berkurban demi saudara-sau-

dara yang kurang mampu. Penyembelihan dan pembagian kurbanhariini,merupakanbentuk peduli PLN terhadap masyarakat sekitar, ini moment yang tepat kami turut berperan berbagi dengan masyarakat kurang mampu,” ujar Abdul Kholik. Dijelaskannya,jumlahhewan kurban yang diserahkan PT. PLN RantingTanjungbalai ini, diharap bakal meningkat dari tahun ke tahun. Kendati demikian, kata Abdul Kholik, yang terpenting bukan dari sisi jumlah melainkan harus mengutamakan semangat berkorban. “Pada prinsipnya, melalui momentun Idul Adha ini, PT. PLN Ranting Tanjungbalai membina kebersamaan dengan seluruh masyarakat,karyawan,mitrakerja serta pengelola kantor jaga,” ujar Abdul Kholik.

Listrik Pra Bayar Pada kesempatan itu, Abdul Kholik Nasution mengimbau kepada seluruh pelanggan PLN agar segera bermigrasi ke listrik prabayar. Menurut Abdul Kholik, pelanggan yang akan mendapat KWH meter pra bayar itu, sama sekali tidak dipungut bayaran, kecuali membeliToken (isi ulang energi listrik) perdana seharga Rp20 ribu. “Syarat pendaftaran migrasi listrik pra bayar cukup membawa foto kopi KTP dan rekening. Jadi, sudahsaatnyaberalihkelistrikpra bayar,solusicerdasuntukpenggunaan listrik yang lebih terkendali. Pelangganjangantakut,meskipun KWH meter beralih ke prabayar, namun harga per KWH tetap. Ini semua tujuannya untuk meminimalisirkerugianpelangganmaupun PLN,” ucap Kholik. (a14)

MEDAN (Waspada): DPRD Sumut menilai rekomendasi pertambangan tidak berpihak kepada masyarakat, terutama tentang pinjam-pakai kawasan hutan untuk eksplorasi di Kab. Mandailing Natal (Madina). Ketua Fraksi Partai Amanat Nasional (FPAN) DPRD Sumut Parluhutan Siregar, berbicara kepadaWaspada, di gedung dewan, Senin (7/11). Dia mengatakan kecewa, karena Pemprovsu terkesan berpihak pada PT Sorik Mas Mining (SMM). Sebelumnya, Plt. Gubsu dalam surat No.522/8173 tanggal 5 Agustus 2011 mengeluarkan rekomendasi tentang pinjam pakai kawasan hutan dan eksplorasi dan eksploitasi pertambangan PT SMM. Menurut Parluhutan Siregar,

kebijakan tersebut tidak berpihak pada masyarakat. Karena seluruh komponen terkait PT SMM meminta pemerintah tidak mengeluarkan izin. Komponen tersebut di antaranya masyarakat kawasan pertambangan, Lembaga Swadaya Masyarakat (LSM), hasil rapat Muspida Plus Pemkab Madina. Termasuk DPRD Sumut, lewat laporan tim pencari fakta, kata Siregar. Padahal, Kementerian Kehutanan menyebut eksplorasi PT SMMsaatiniilegal.Karena,belum mendapat izin dari Menteri Kehutanan. Parluhutan menyebutkan, sebagian areal PT SMM berada di kawasan Taman Nasional Batang Gadis (TNBG). Bila ingin memanfaatkan lahan itu maka

sesuaidenganPP10/2010,perusahaan harus memiliki izin pinjam pakai kawasan hutan lindung Dalam mengeluarkan rekomendasi Pemprovsu diduga tidak berkoordinasi dengan DPRD Sumut. Padahal hampir seluruh fraksi di lembaga legislatif itu meminta pemerintah untuk menghentikan Izin Usaha Pertambangan(IUP)EksplorasiPTSMM. Juru bicara FPKS Amsal Nasution,dengantegasmengatakan bahwa pemerintah harus melakukanpenghentianIUPeksplorasi PT SMM. Selanjutnya, Amsal Nasution dari Fraksi PKS mendorong dilakukan re-negosiasi dan pengkajian ulang terhadap kontrak karya PT SMM.Tujuannya, untuk mengakomodir kepentingan masyarakat dan daerah. (m12)

Rekomendasi Tambang Tak Berpihak Pada Masyarakat

Waspada/Sori Parlah Harahap

JALAN rusak dan berlumpur menyebabkan sejumlah truk pengangkut sawit dan CPO terjebak.

Hujan, Sejumlah Jalan Di Simangambat Sukar Dilintasi SIMANGAMBAT (Waspada) : Musim hujan saat ini membuat jalan menuju berbagai desa di Kec. Simangambat, Kab. Padanglawas Utara rusakparahdanberlumpursehinggasukardilintasi. Akibatnya, anak sekolah pun kesulitan karena tidak bisa lagi mengunakan sepeda motor untuk berangkat ke sekolah. Rahmad Hasibuan, warga Pekan Minggu, Simangambat menuturkan, sejak hujan turun dalambeberapamingguini,jalandesarusakparah. Warga yang biasanya mengunakan sepeda motor sangat susah untuk melintasinya karena jalan berlumpur. “Warga harus bersusah payah dan pengendara harus turun untuk menarik sepedamotor mereka,” jelasnya Lebih lanjut dikatakannya, beberapa hari lalu sejumlah truk pengangkut sawit dan CPO terjebak di tengah lumpur. Melihat keadaan itu

katanya, warga sudah tidak heran lagi, karena situasi seperti itu sudah biasa. “Lami berharap perhatian pemerintah agar jalan diaspal,” harapnya. Sementara, Efendy Siregar mengemukakan, kondisiinimengganggumobilitaswarga,terutama yang ingin menjual hasil buminya. Begitu juga untuk warga yang ingin berurusan dengan aparat pemerintah. Bahkanhargajual-belisemakintinggi,namun itu semua harus ditanggung masyarakat Simangambat. Sejak kemerdekaan dan bahkan pemekaran, ternyatapengerasandanpengaspalanjalanutama penghubung antar desa tak pernah dilakukan. Seperti di Desa Bataag Pane I - Pekan Minggu, Simangambat - Marlaung dan Simpang Baragas menuju ibu kota Kec. Simangambat, Lakkimat Pekan Sabtu. (a35)

2 Tewas Dan 1 Luka Berat Korban Lakalantas PEMATANGSIANTAR (Waspada): Dua tewas dan satu luka berat akibat tubrukan antara sepeda motor dengan sepeda motor, mini bus angkutan umum dengan sepeda motor dan antara mini bus angkutan umum dengan mobil pribadi, di Simalungun. Korban tewas Daniel Pardede, 28, swasta, warga Jalan Sisingamangaraja, Kel. Parapat, Kec. Girsang Sipanganbolon, Kab. Simalungun dan Mayor Sitorus, 54, petani, Dusun I Rininhol, Desa Silakkidir, Kec. Hutabayu Raja, Simalungun. Sedangkan korban luka berat Jerry Butarbutar, 24, sopir, warga Perumnas Bah Lias, Kel. Perdagangan, Kec. Bandar, Simalungun. Lakalantas yang mengakibatkan tewasnya Daniel Pardede, ketika sepeda motor Honda Astrea Prima BK 2299 TH yang dikemudikannya ditubruk mini bus penumpang umum Wisata Indah BK 1627 TK dikemudikan Mangihut Gurning, 51, warga Desa Pardomuan, Kec. Ajibata, Kab. Toba Samosir, di Jalan Sisingamangaraja, Kel. Parapat. Laka lantas yang mengakibatkan tewasnya Mayor Sitorus akibat sepeda motor Honda Blade BK 2885 XW dikemudikannya ditubruk dari belakang oleh sepeda motor Suzuki Thunder BK 4602WU dikemudikan Budiman, 15, warga Dusun Panggalangan, Desa Bolok, Kecamatan Bosar Maligas, Simalungun yang membonceng Sari,

15, pelajar, warga Desa Bahal Batu, Kecamatan Hutabayu Raja di jalan umum Km 40-41 jurusan Pematangsiantar-Parbutaran, Desa Silakkidir, Kecamatan Hutabayu Raja. Sepeda motor dikemudikan Budiman menubruk sepeda motor dikemudikan Mayor Sitorus dari belakang ketika sepeda motor Mayor Sitorus hendak berbelok ke kanan. Akibat ditubruk dari belakang itu, Mayor Sitorus mengalami luka berat dan akhirnya meninggal saat dirawat di RSU Tiara, Kota Pematangsiantar. Sedang Budiman dan Sari hanya mengalami luka ringan akibatterjatuhbersamasepedamotoryangmereka kenderai. Sementara luka berat dialami Jerry Butarbutar ketika mobil mini bus angkutan umum FASerigala BK 1405 TU dikemudikannya ditubruk mobil pribadi Mitsubishi Kuda BK 555VV dikemudikan Robi Akbar, 26, swasta, warga Desa Masjid Lama, Kecamatan Talawi, Kabupaten Batubara di jalan umum Km 26-27 jurusan PematangsiantarPerdagangan, Senin (7/11) pukul 19:00. Kapolres Simalungun AKBP M Agus Fajar H, SIK saat dikonfirmasi melalui Kasubbag Humas AKPHPanggabean,SH,KasatLantasAKPBaginda Sitohang dan Kanit Laka Ipda Alsem Sinaga, Selasa (8/11) menyebutkan laka lantas itu masih dalam penyelidikan Sat Lantas.(a30)

Bandar Togel Dari Batubara Ditangkap Di Simalungun PEMATANGSIANTAR (Waspada): Tersangka bandar judi toto gelap (Togel) merangkap tukang rekap dari Kabupaten Batubara, CP, 31, warga Dusun I, Desa Tanjung Kasau, Kecamatan Sei Suka, Batubara ditangkap saat mengumpulkan rekap di wilayah hukum Polres Simalungun. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik melalui Kasubbag Humas AKP H. Panggabean, Kasat Reskrim AKP M. Adenan AS, SH, S.Ik, MH dan Kapolsek Perdagangan AKP TP Butarbutar, SH, Selasa (8/11), menyebutkan penangkapan terhadap CP dilakukan sesudah dilakukanpengembanganterhadapanakbuahnya yang ditangkap selaku penulis judi togel/Kim, Minggu (6/11) pukul 22:30. Ketikaselesaimengumpulkanrekappenjualan juditogel/Kim,personilSatReskrimPolresbersama Polsek Perdagangan segera mencegat sepeda

motor digunakan CP dan menangkapnya. Saat dilakukan penggeledahan, ditemukan berbagai barang bukti yang disita dari CP terdiri tiga lembar kertas rekap angka tebakan judi togel/ Kim dan hasil penjualan angka tebakan judi togel/ Kim Rp 630.000. Sepeda motor Yamaha Jupiter MX warna biru tanpa plat nomor polisi yang digunakan CP mengumpul rekap, turut disita. CP bersama barang bukti selanjutnya dibawa ke Mapolsek Perdagangan dan diproses. Menurut pengakuan CP, dia bertindak selaku Bandar dan sekaligus pengumpul rekap serta sesudah dikumpulkan, rekap judi togel/Kim itu langsung dibawa ke rumahnya di Tanjung Kasau. “CP sudah ditetapkan sebagai tersangka dan ditahan, karena diduga melakukan tindak pidana perjudian dan melanggar Pasal 303 KUH Pidana,” sebut Panggabean.(a30)

Karyawan Larikan Hasil Penjualan Barang PEMATANGSIANTAR (Waspada): Tjaw Kim, 43, warga Jalan Ade Irma Suryani, Kelurahan Melayu,KecamatanSiantarUtara,KotaPematangsiantar mengadukan karyawannya, Jep, 25, warga, Bah Tebu Kecamatan Tapian Dolok, Kabupaten Simalungun, karena diduga melarikan seluruh uang penjualan berbagai jenis barang kelontong sebanyak Rp 68 juta milik Tjaw Kim. KeterangandihimpundaninformasidariPolres Pematangsiantar, Selasa (8/11) menyebutkan Jep didugamelarikanhasilpenjualanbarangkelontong milik Tjaw Kim sesudah diberangkatkan berjualan pada Minggu (30/10) pukul 22:00 ke luar kota dan tidak pernah melaporkan hasil penjualan barang kelontong itu sampai akhirnya diketahui pada Kamis (3/11) pukul 17:00. Tjaw Kim mengetahui Jep tidak menyetorkan hasilpenjualanbarangkelontongmiliknyasesudah melakukan pengecekan terhadap mobil yang digunakanJepmenjualbarangkelontongitu.Seperti biasanya, sesudah pergi berjualan selama empat hari, para karyawan melaporkan hasil penjualan mereka dan menyerahkannya kepada Tjaw Kim, tapi Jep tidak melakukan itu hingga menimbulkan tanda Tanya bagi Tjaw Kim. Sebelum melakukan pengecekan mobil yang digunakan Jep ke gudang, Tjaw Kim lebih dulu

menghubungiJepmelaluiHPpukul12:00.Namun, HP milik Jep tidak aktif hingga Tjaw Kim memutuskan pergi ke gudangnya utnuk mencek apakah mobil yang dibawa Jep berjualan sudah kembali atau tidak. Ketika sampai di gudang miliknya, ternyata mobilyangdigunakanJep sudahdidalam gudang. Melihat itu, Tjaw Kim langsung bergegas ke rumah Jep. Namun, sesampainya di sana, Tjaw Kim tidak bertemu dengan Jep. Menurut keterangan kakaknya, Jep bersama istri dan anaknya sudah pergi pagi itu pukul 05.30. Mendengar itu, Tjaw Kim segera bergegas kembali ke gudang miliknya untuk melakukan pengecekan sisa-sisa berbagai jenis barang kelontong yang dibawa Jep berjualan. Ternyata, barang kelontong sudah banyak yang terjual, tapi tidak disetor Jep hingga Tjaw Kim mengalami kerugian mencapai Rp 67.830.000. Sesudah melakukan pencarian terhadap Jep, tapi tidak berhasil, Tjaw Kim akhirnya mengadu ke Polres. Kapolres Pematangsiantar AKBP Alberd TB Sianipar, SIK, MH saat dikonfirmasi melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin, Selasa (8/11) menyebutkan pengaduan Tjaw Kim masih dalam penyelidikan.(a30)

B4 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

PS : Power Stearing PW : Power Window RT : Radio Tape VR : Velg Racing EW : Electric Window

BMW 320i LE a/n. Sendiri Ex Dokter Th. 95. Biru met, sgt orisinil, mesin sehat, full sound. Hrg. 63Jt. Nego. Hub. 061 77700712

DAIHATSU Terios TX Th. ‘08, Matic, Wrn hitam metalic, pajak 1 thn, mbl cantik, 1 tangan dari baru, Rp. 155Jt. Jl. SM. Raja No. 200 (depan UISU). 0815 337 336 88 / 7851402 DAIHATSU PROMO SERBU Khusus November Xenia Angs. 3,3 Jt-an (4 thn)

Hub. DIKA 0852 7074 7744 - 77443877



Ready Stock! Xenia, Pick Up, Terios, Luxio, Sirion. DP Mulai 15% Angs. Murah, Proses Cepat,

Data dijemput, Mobil diantar 0812 6005 2465 Simpan nomor ini sewaktu2 Berguna.



DAIHATSU Feroza Thn. 96 Biru, silver, Cat asli, mobil sehat Rp. Nego. HP. 0853 6255 5172 / 0813 7094 4002 DAIHATSU Taft Feroza ‘94 hijau metalik, BK Medan, asli, dua nama Pool satu tahun, AC Velg Racing, ban baru, body kaleng dan mesin bagus. Harga 46 Jt damai. Peminat serius Hub. 0852 7630 2013


Gran Max Pick Up 1.3...DP 8 Jt’an Angs 2 Jt’an Luxio D........................ DP 15 Jt’an Angs. 4 Jt’an Xenia 1.0 Dly.............. DP 14 Jt’an Angs. 3 Jt’an Terios TS Xtra............... DP 18 Jt’an Angs. 4 Jt’an Pesan New Xenia sekarang !!! Hub. Erwin HP. 0812.6315.4132 (061) 7740.2067


New Xenia, New Terios, Pick Up Grand Max, All Ready Stock (Cash/Kredit) Hub. Tonny 0821 63 63 2927 / 061-762 54 641

DAIHATSU Taruna Tipe CSX Thn. 2000. Complit AC, Tape, P. Window, P. Steering, Mulus. Harga 87Jt. Hub. 0852 62 53 7479

DICARI/DIBELI Xenia Li 2004 dan Avanza 1,3. E M/T 2004. Hub. 0857 6321 5482

5 CM 6 CM

Rp. 65.000 Rp. 78.000

DAIHATSU TAFT BADAK 81 Trooper 90. Pjk Pjg. Ban baru, 4x4 aktif. 0853 6077 9299 DAIHATSU Gran Max 1.5 D Thn. 2008 AC, Tape, VR, PS, CL, Jok kulit, Biru met, BK Mdn Rp. 78Jt Net. Hub. 0853 7089 9893



Honda Jazz DP 30 Jt-an atau cicilan 2,5Jt. Honda CRV Bunga 0% atau DP 50 Jt-an Honda Freed Bunga 0% atau Dp 30 Jt-an Gratis 1 x Angsuran, Cash Back Langsung Full Hadiah !!! Ready Stock !!! Hub. DEVIN 0813 7580 2313

HONDA Jazz 2005 Dijual, Matic LCD + TV, Sensor Parkir, Hrg. 130Jt Nego. Hub. 0813 7692 5959 ISUZU Panther New Hi Grade Thn. 97. W. Hijau metalic, komplit. H. Nego. Hub. 0853 6247 1430 / 0812 6056564 ISUZU Panther Hi-Grade Thn. ‘95 Dijual. Hijau metalic, AC, DB, PS, PW, BR/VR, DVD, Remote, Alarm, Mobil mulus. Harga Rp. 63Jt (nego). Hub. 0813 9730 8787


New Panther Grand Touring Type J, LS, LV, Pick Up, Ready Stock!!, Irit, Kuat, Awet. Terima Tukar Tambah. Info: Astra Isuzu. 061-6844 8554, 0813 7591 5420




MERCY C200 ‘97

Abu2 met, BK Mdn, AC DB, Air bag, ABS, Jok klt, CD, MP3, Sound System, PW, VR, CL, EM, PS, Ban Baru, Original 95%, DP 30Jt. Angs. 1,9Jt. Hub. 0852 7630 3900 / 0852 7507 6512


MITSUBISHI L300 Minibus 1993 Starwagon. Bensin Hub. Jl. Medan Utara 33. Acuan, Cash Credit. Tukar Tambah. 0811 63 5101

NISSAN LIVINA XR M/T. Thn. 2008. Biru met, BK Rp. 130Jt. Net. Hub. 0853 6161 5977

7 CM 8 CM

Rp. 91.000 Rp. 104.000


New Grand Livina HWS Autech, Juke, March, Xtrail, Tcone Cash/Credit. Bisa bantu tukar tambah. Hub. Mili 0852 7033 7739 # NISSAN 100% BARU # Grand Livina - March X-Trail. Disc + Hadiah menarik. ALDY. 0813 8300 3509

- 061.750 90395

OPEL BLAZER THN. 01. Warna biru metalic. Hrg. 59Jt Nego. Hub. 0853 5856 6898 OPEL BLAZER MONTERA ‘00

Htm met, CL, PW, PS, Ban Besar Baru, RT, Jok kulit, Sound Syst, DP 20 Jt. Angs. 1,94Jt. Hub. 0852 7690 3900 / 0852 7507 6512

OPEL Blazer LT Injection Biru Abu2 met Th. 96. Sgt orisinil sekali, mulus, mesin sehat, CD Canger, Hrg. 49Jt Nego. Hub. 061-6967 9753


Carry PU 1.5 FD, Rp. 8 Jt-an Angs. 2.531.000,APV Arena Rp. 11 Jt-an Angs. 4.073.000,Splash GL Rp. 13 Jt-an Angs. 4.069.000,Hub: 0812 654 0809 / 77722121

SUZUKI Baleno Thn. 2001. W. Hijau muda BK Mdn, Siap pakai. Buat pemakai. HP. 0821 6080 2009 SUZUKI Carry Futura Minibus Thn. 92. W. Biru, BK Baru, Asli Medan, 29Jt/Nego. 0813 6150 8497


W. Putih, AC, RD, DVD, BR, Lanjut kredit DP 20,5 Jt, Sisa 32 X Rp. 1.553.000, Plat BL, Sehat & Rapih, Jok kulit Hub. 0813.7043.0346 Maaf TP

- SUZUKI Carry MB ‘87, BK Mati, W. abu, Rp. 12 Jt. - Yamaha Jupiter Z, New ‘10, over kredit, balik DP 5 Jt. 505.000x24, Hub. 0813 7081 2212 TP SUZUKI Realvan GRV Thn. 2003. Biru metalic, AC DB, Mulus, Rp. 66 Juta. Hub. HP. 0812 6463 253 SUZUKI Baleno Thn.97, Warna abu2 Silver met, lengkap, terawat. Medan asli Rp. 65Jt Nego. Hub. 0812 6388 8038 SUZUKI Carry MB Thn. 91 K. Alexander W. Hitam, AC, Tape, VR, mobil kaleng2. cantik, mulus, siap pakai. Hub. Jl. Karya Gg. Cimacan No. 9 HP. 0813 755 11277

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih

TOYOTA Kijang LX 1.8 Bensin Thn. 2004. New. AC, Tape, VR, PS, CL, Jok kulit, silver, plat BM Rp. 105Jt. Hub. 0852 7538 3218



PESAN SEKARANG JUGA Hub. Predi Simatupang 0813.6165.1801 - 0853.6207.2000

TOYOTA Innova Type G 2006, Biru, Bensin, Siap pakai. Plat BK. Hub. 0811 65 4880

TOYOTA Kijang Super - G Dijual Segera. Thn. 96/97. Hijau met, AC DB, DVD, PS, PW, VR, BR, Mobil sangat mulus. Hrg. 69Jt. Damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90. Sei Agul 20 Mtr Dari Simpang (4) Lampu Merah. TOYOTA Kijang Gren Extra Dijual Segera. Thn. 95. Biru met, AC DB, PS, PW, CL, VR, BR, Mobil sangat mulus. Hrg. 72,5Jt damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90 Sei Agul 20 Mtr Dari Simpang (4) Lampu Merah

TOYOTA Green Extra Tahun 1994 W. Abuabu, BK Medan asli, Siap pakai. Mulus. D. AC, Tape, VR, PW, HP. 0811 654158 TOYOTA Avanza Th. ‘09. 1300cc, Type G. Wrn hitam metalik, mbl ctk sekali 1 tangan dari baru, Rp. 143Jt. Kembar Ponsel Jl. SM. Raja No. 200 (Depan UISU). (061) 7851402



PURBA : 0813 9736 0333

TOYOTA Yaris Thn. 2006 Automatic warna silver metalic. Hrg. 138Jt. Nego. Hub. 0853 5856 6898

Rabu, 9 November 2011



TIMOR DOHC. Thn. 1998. W. Biru malam, BK Mdn Siap pakai. HP. 0821 6080 2009

BUTUH PINJAMAN TUNAI Tanpa Jaminan, Bunga Ringan Hub. 0852 7088 1612


SEPEDA MOTOR YAMAHA XEON DIJUAL Bulan Nov. 2010 (Pake Setahun). Warna hitam, mulus Rp. 12,5Jt. Hub. 0853 7080 8888






SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000



LAHI : 0813 7057 0061



Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

DO RE MI JOK MOBIL KHUSUS AVANZA/INNOVA Rp. 1.350.000,Jok (model press) + Alas

Avanza, Innova, Yaris, Rush, Fortuner, DP Ringan, Proses cepat, Terima tukar tambah, Hadiah TV Hub. 0813.9767.3580


Toyota Kijang Krista Diesel Thn 2000, W. Biru, Sudah 4x Byr Rp. 3.680.000 x 32, DP 30 Jt, Kembali 27 Jt/saja Hub. 0813.6207.8393 Mobil Jeep Willys Thn. 1943 Dijual. Mesin Kijang, mulus dan siap pakai, warna hijau tentara, setiur kiri. Harga Rp. 25Jt/ Nego. Hub. ASEP/0821 6765 1001



JL. S. PARMAN BLOK DD No. 3-4 PETIDAH - MEDAN (DEPAN SEKOLAH ST. THOMAS 2 MEDAN) Telp. 061-4522123, 77602123 JL. MAKMUR No. 10 A, MEDAN (MASUK DARI JL. ADAM MALIK / JL. KARYA) TELP. 061-6639123, 76501123

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:



Untuk informasi lebih lengkap hub

TEL. (061) 4155678 TEL. (061) 7350 777 TEL. (061) 4555 928

TEL. (061) 4576602 FAX. (061) 4561347


BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

PT. CAPELLA MULTIDANA Butuh Uang Tunai...???





Kini Kami Hadir di depan Anda

TOYOTA AVANZA Rp 350.000 + Driver / hari

Syaratnya Mudah Hanya Jaminkan BPKB Spd mtr & Betor Anda

Angsuran Murah...!!! Proses cepat..!!! Aman BPKB-nya..!!! Khusus sepeda motor unit di Asuransikan + Diskon 1x Angsuran

TOYOTA Kijang Super th. 93. 1500cc. Warna abu2 met, BK Medan, mulus Rp. 58Jt. Hub. (061) 699 81177 TOYOTA Soluna Tipe XLi, EFI. Thn. 2002. Complit AC, Tape CD, TV, VR, PS, W. Silver Stone. Mulus. Harga 60Jt. Hub. 0852 62 53 7479

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

TIMOR Th. 97. Velg Racing, SOAC warna biru, AC, Tape. Hub. 0852 9663 2368

RINALDY 061 -77444353 - 082166386699 Jl. Karya Kasih komplek Pondok Karya prima Blok B no. 1 Medan – Indonesia Website : Facebook: Rinaldy Gultom MENERIMA TITIPAN / BAGI HASIL MOBIL



BUKTIKAN SENDIRI... Hubungi: (061) 664.5745 0853.6022.8968


JAMINAN: BPKB, SURAT TANAH, EMAS, PROSES CEPAT MAX Rp. 300 JUTA JANGKA WAKTU 5 THN Telp. (061) 8446489, 8826936, 8477880, 7954444, 7368754, (0622) 430780, (0624) 5737456, (0623) 348322



TV, LCD, Kulkas, Handycam, DSLR, Laptop, LCD, Proyektor, PS 1, 2, 3, Sound system, dll Hub. Joel 0853.5895.2998




TV LCD 32” P. Sonic = 3,4Jt. 32”LCD/LG=3,2JT, 42” LCD Samsung=3,5Jt, 34 Sony = 2 Jt, 29” Flat Baru LG =2 Jt, 29” Bekas 900rb - 1,7 Jt. 14 - 21=300rb - 650rb, 17” LCD Monitor 1Jt, 22”=1,5jt. PS1=400rb, PS 2=800rb, DVD 200rb, Vortable = 700rb. Ampli Gitar=700rb, Sansui TechnicsSU 7600- Spk. BMB =14,5Jt - EQ - TV Mobil - 500rb.


Handicam Sony HI-8=1Jt Mini DV =2Jt, DVD/HDD=3Jt, Camera 5 Mp=12 Mp 500rb - 1,2J, Fax=600rb, LCD Projector Toshiba/Sanyo=2,8Jt. Printer HP=450rb




Jual AC Baru/Bekas 1/2, 3/4, 1 1/2, 2 Pk 1,2Jt. AC Window 1 Pk=800rb. Kulkas 1 Pt-2Pt-600rb - 1,2Jt, 2 Pt. Super Jumbo=1,9Jt. M. Cuci 1 Tb-2 Tb=600rb - 1,2 Jt. M. Cuci baru=1,2Jt (2 Tb. 9 Kg) Genset 3000w 2 Jt, Pompa Air, Sanyo - P. Cliner

UD. SENANG HATI Hub. 4517509 - 0821 6322 4343 - 69677449, Jl. Sekip 67 A





0812 60444275


WC 0812 642 71725







845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F


WASPADA Rabu 9 November 2011

0 7 . 0 0 Si D o e l A n a k Sekolah 07.45 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang 14.30 Cek & Ricek 15.30 Barbie In Chrismas Carol 17.00 Seputar Indonesia 17.30 Silet 18.00 Dewa 20.00 Mega Sinetron : Putri Yang Ditukar 21.00 Mega Sinetron : Anugerah 22.30 Mega Sinema 00.30 Seputar Indonesia Malam


07.00 Inbox 09:03 Halo Selebriti 10:00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 SCTV FTV 14.30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Jebakan Betmen 17.00 Liputan 6 Petang 1 7 . 3 0 Pa r a d e F T V Istimewa 19.30 Janji Cinta Aisyah 20.00 Liputan 6 Terkini 20.03 Janji CInta Aisyah 21.00 Pesantren & Rock Roll Season 2 22.30 Liputan 6 Terkini 22.33 SCTV FTV Utama

07:30 Wooow…! 08:30 Omg - Oh My God 09:30 Segeeerr Beneerrr 10:30 Potret Jalanan 11:00 PU 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang 15:00 Mantap (Live) 16:00 Topik Petang (Live) 16:30 Fenomania 17:00 Warkop Series 18:00 Pesbukers (Live) 19:00 Super Deal 2 Milyar 20:30 Sinema Spesial 22:30 Guinness World Record Smashed 23:30 Ultimate Guinness World Of Record 00:00 Sunting 00:30 Topik Malam (Live) 01:00LensaOlahRagaMalam(Live) 01:30Ripley’sBelieveItOrNotSeason

07.00 Disney Club 07.30 Disney Club 08.30 Upin & Ipin 09:00 Cerita Pagi 10.30 Diantara Kita 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.30 Lintas Petang 16.00 Aksi Juara 16.30 Zona Juara 18.00 Animasi Spesial 19.00 Sampeyan Muslim 20.00 Aishiteru 21.00 KEsucian CInta 22.00 Sinema Utama Bollywood 00:00 Lintas Malam

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Headline News 10.05 Eleven Show 11.05 MDG’s Insight 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Sentilan Sentilun 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.05 Suara Anda 20.30 Journalist On Duty 21.05 Top Nine News 22.05 Mata Najwa 23.00 Metro Sports

06:00 - Fokus Pagi

07:00 - KISS Pagi 07:30 - FTV Pagi 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea): The Fugitive Plan B 13:30 - Drama Asia (korea): My GirlFriend Is Gumiho 15:00 - KISS Sore 16:00 - Fokus 16:30 - Drama Asia (Korea): Queen Of Reversal 18:30 - Drama Asia (Mandarin): Monkey King 20:00 - Tutur Tinular 22:00 - Mega Asia


07:30 Ranking 1 08:30 Derings 10:00 Ngulik 10:30 IBU 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Ceriwis 14:30 86 15:00 Keluarga Minus 15:30 Sketsa 16:00 Happy Family 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 Derings 21:00 Bioskop TransTV 23:00Kakek-KakekNarsis 00:00 Bioskop TransTV : 01.0Reportase Malam

06:30 Apa Kabar Indonesia 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break Live 11:30 Tahukah Anda? 12:00 Live News Kabar Siang 13:30 Nostalgia 14:30 Live News Kabar Pasar 15:00 Selera Asal 15:30 Bumi & Manusia 16:30 Sport File 17:00 Live News Kabar Petang 19:30 Jakarta Lawyers Club 23:00 Apa Kabar Indonesia Malam 00.00 Live News Kabar Malam

08.00 Avatar 09.30 Obsesi 10.30 Abdel Temon 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 13.30 Global Siang 14.00 Petualangan Panji 14.30 Deny Manusia Ikan 15.00 Hand Made 15.30 Berita Global 16.00 Top Banget 16.30 Fokus Selebriti 17.00 Penguin Of The Madagascar 17.30 Spongebob 19.00 Awas Ada Sule 20.00 Big Movies 23.00 Big Movies

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Ricky Martin/rtr

Ricky Martin Nikahi Pasangan Sejenis

Pernikahan Singkat Seleb Hollywood

Ricky Martin dilaporkan akan menikahi sang kekasih lamanya CarlosGonzalezsetelahmemperolehstatuskewarganegaraanSpanyol. Penyanyi berusia 39 tahun itu, merupakan ayah dari anak kembar berusia tiga tahun bernama Matteo dan Valentino telah menjalin hubungan dengan Carlos Gonzales selama empat tahun. Ia memilih mendaftar menjadi warga negara Spanyol guna memperoleh kemudahan dari kebijakan negara yang bisa melegalkan pernikahan sesama jenis di tahun 2005, seperti dikutip dari El Pais. Pemerintah tampaknya terbuka menyambut bintang pelantun Livin’ La Vida Loca dan tak seperti biasanya, ia tak mengumumkan apakah ia sebenarnya warga negara Puerto Rico atau AS. Ricky belum berkomentar atas laporan itu, tetapi surat kabar itu mengaku bahwa Ricky akan mengikat tali pernikahan di Spanyol ketimbang di salah satu negara bagian AS yang membolehkan pernikahan sesama jenis.(ant)

SIAPAPUN menginginkan usia pernikahan mereka bisa langgengselamanya,takterhitung tahun, bulan, minggu atau hari. Namun ada sejumlah selebritis Hollywood yang hanya bisa mempertahankan pernikahannya dalam tempo beberapa saat. Kim Kardashian dan Kris Humphries (72 hari). Romantisme hanya mampu bertahan enam 6 bulan dan malah menuju ke perceraian semenjak pernikahan mewah antara Kim Kardas-

Kami Perusahaan sedang berkembang membutuhkan Professional muda untuk menempati posisi sebagai Telemarketing dengan persyaratan sbb: 1. Pria/ wanita umur maks. 30 thn 2. Berpenampilan menarik 3. Berpengalaman dibidang Telemarketing/ Marketing

PRIVAT SIKLUS guru datang kerumah, SD, SMP, SMA, Semua pelajaran bel: (061) 91425300/082117835595


(TEMPAT KURSUS TERBAIK DI MEDAN) Word + Excel 200 Rb (2 minggu) Word + Excel + Internet 300 Rb (3 minggu) Ms. Office + Internet 450 Rb (1 bulan) Design Grafis (Komplit) 600 Rb (1 bulan) Autocad 2D, 3D 300 Rb (10 hari) Merakit komputer/ Installing 400 Rb (6 hari) Web Design/ Web Programing500 Rb (10 hari) Daftarkan lsg belajar, waktu bebas, Tanpa batas usia Jl. Sei Batang Hari No. 170 Medan Telp. (061) 844.2158 - Website:

Perusahaan Telekomunikasi, membutuhkan beberapa orang karyawan (TEKNISI) - Pria (Muslim) usia 18 - 23 tahun - Min. SMU/ STM/ Madrasah Aliyah Lamaran diantar ke: Jl. Pukat II No. 77 Medan (1 minggu)

HOTEL MADINAH : AL-HARAM (5*) HOTEL MAKKAH : JAWHARAT ANFAL (4*) HOTEL JEDDAH : AL AZHAR (5*) JARAK HOTEL KEMESJID ±60 METER Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis * Seluruh Jamaah Tertanggung ASURANSI

Kantor Pusat: Gedung Gelora Plaza Jl. S.M. Raja No. 4 Medan Cabang: Jl. Sri Ratu Safiatuddin (Peunayong) Banda Aceh Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488


WASPADA Media yang Tepat untuk Iklan Anda





HOMESTAY Jl.Guru Sinumba I No. 2 (belakang Pondok Surya) Sei Agul Medan, Fasilitas lengkap dan Parkir luas, Sewa harian, Mingguan & bulanan Hub. (061) 7792.9636 dan 0821.6555.3717

Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA


ALAT KANTOR DIJUAL Sejumlah Lemari Plat Besi Cabinet 4 Laci, Brangkas, Msn Facsimil, Msn Tik, Printer Epson LQ 300 + dan 2170 Hub. 0852.9631.1464

Dijual 9 Pintu Ruko Jalan Keadilan No. 2 SImp. Jalan Cemara, LB. 4x16m, Row depan 6m, Fasilitas: SHM, PLN, PAM, COcok untuk usaha Paraktek dokter, warnet, gudang, toko HP NB: 60m dari Jl. Cemara Jalan Lintas, H. 450 Jt, KPR perbulan 4 Juta, Full keramik, SIap Huni ±50 Juta, Sisa 3 unit HUB: 7772.2123 - 7759.8123 HP. 0811.651.123




JUAL RUGI Rumah Komp. Golden Hill Sei Mencirim, Kp. Lalang, Harga 250 Jt, Harga Pasaran 280 Jt, Boleh Bayar 2x, 125 Jt sekarang Sisanya 1 tahun lagi Tanpa bunga dan cicilan bulanan

DIBUTUHKAN SEGERA Tenaga kerja wanita usia 17 - 40 thn dengan posisi sebagai: BABY SITTER, PRWT JOMPO, PRWT PRIBADI, PRT. Syarat: Fc. Ijazah, KTP, KK, Gaji bersih 700 rb s/d 1.500 Rb/bln + U. cuti + Bonus + THR. Makan, Asrama, dijemput loket, gratis HUB: YYS. MAREL MANDIRI Jl. Cengkeh Raya NO. 18C Medan HP. 0813.6199.9211 - 0813.9664.5507

Ingin Promosikan Produk Anda Harian



Uk. 135x65m, Harga Rp. 75.000/M (Nego) di Kuala Namu, Desa Pematang Biara, Kec. Pantai Labu, Dipinggir jalan, Ada juga tanah kaplingan, Harga Rp. 15 Jt/ Kapling, Investasi pasti untung Hub. PakBonadi 0813.6121.3390 - 0853.7347.5646





Hub: 0813.7690.4089



TERAPHY “TOTOK DARAH WALET PUTI” Mengobati: Stroke, Syaraf Terjepit (HNP). Jantung, Kanker, Gagal, Ginjal, Dll. Alamat: Jln. Pasar III Krakatau Gg. Mulia. No. 14B - Medan (HP. 0821 6020 9118)



TANAH MURAH Jl. Binjai, L. 3432m dan Jl. Ring Road, L. 21x72m, SHM Serius call: 0812.8637.3459 - 0819.827.459


S e b u a h p e r u s a h a a n p ro p e r t y y a n g s e d a n g berkembang. Membutuhkan tenaga kerja dalam bidang-bidang berikut ini: Keuangan (KEU) - Pria/ wanita, min. 23 tahun - Pendidikan minimal D3 - Berpengalaman dibidangnya minimal 2 tahun - Menguasai ilmu keuangan secara baik Administrasi (ADM) - Pendidikan minimal D3 - Berpengalaman dibidangnya minimal 2 tahun - Menguasai Administrasi Perusahaan - Mampu menguasai laporan administrasi perusahaan Marketing Manager (MMG) - Memiliki pengalaman dibidangnya minimal 3 tahun (Property) - Memiliki kemampuan manajerial dan pengolahan yang baik - Mampu bekerja dibawah tekanan target - Mampu memotivasi tim Marketing (MKR) - Pria/ wanita, Max 30 tahun - Berpenampilan menarik - Memiliki pengalaman dibidangnya minimal 1 tahun (Property) - Memiliki kemampuan komunikasi dan presentasi yang baik - Memiliki kendaraan sendiri Manager (MGR) - Pria/ wanita, max. 30 tahun - Memiliki pengalaman dibidangnya minima 5 tahun - Memiliki kemampuan manajerial dan pengelolaan yang baik - Memiliki kemampuan memimpin tim, karyawan dan perusahaan - Mampu merancang dan mengimplementasikan strategis perusahaan dengan baik - Mampu bertindak inisiatif, cepat dan tepat - Siap bertanggung jawab atas kinerja dan hasil yang dihasilkan Lamaran dapat diantar langsung ke kantor WASPADA dengan kode RBM atau dapat juga diantarkan langsung ke: Jl. Bukit Barisan Dalam No. 19 (depan Lapangan Merdeka, gang setelah kantor BCA) lamaran selambat-lambatnya diantarkan 1 minggu setelah iklan in ditayangkan

Reguler 9hr, 13 dan 14hr Arbain di Madinah Plus Mesir Plus Turkey Plus Jordan Aqsha Plus India Kashmir Plus Dubai


Tukang pangkas berpengalaman, Ada jaminan (50.000/ perhari) Hub. 0853.6126.7657 (Putra)


Umroh Umroh Umroh Umroh Umroh Umroh Umroh

KANTOR PUSAT MULTAZAM MEDAN JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP. (061) 457.6116 - 7731.3385 HP. 0812.6495.8456 - 0813.6137.2321 - 0812.648.1828

DIBUTUHKAN 2 (dua) orang Tukang pangkas berpengalaman untuk ditempatkan di Denpasar - Bali Hub. 0852.3778.0876 (Dendy)

Kualifikasi: 1. Pria - Islam 2. Usia maximal 35 tahun 3. Mampu membaca AlQur’an 4. Pendidikan min. D3/ S1 Teknik Informatika 5. Menguasai Hardware dan Software dan Jaringan 6. Jujur, tanggung jawab dan disiplin tinggi 7. Bersedia bekerja dengan shift 8. Pengalaman kerja 1 tahun dibidangnya Kirim lamaran Anda paling lambat 11 november 2011 ke: PT. Macan Berkah Internasional, Madinah Syariah Supermarket Plaza Millenium LT. Dasar, Jl. Kapten Muslim No. 111, Medan 20123 Ditujukan kepada: Ibu Ivo Fawzie Andayani










PT. Macan Berkah Internasional, Madinah Syariah Supermarket Supermarket Syariah Pertama di Indonesia - Mencari Tenaga Kerja Profesional untuk di posisi:




danberpacaranlagipadaJuli2006. Tak tanggung-tanggung, pernikahanpertamamerekagelar dalam satu upacara pernikahan di atas kapal pesiar di St. Tropez pada 29 Juli 2006. Mereka menandatangani dokumenpernikahandipengadilan Beverly Hills pada 3 Agustus, dan pernikahan ketiga terjadi di Nashville pada 17 Agustus. Keduanya mengajukan gugatan perceraian secara terpisah pada 27 Nopember 2006. (hr/ajekoi)

Izin Usaha: 503/1099.SK.HO/SL/NT/08

1. 2. 3. 4. 5. 6. 7.

Segera kirimkan CV anda selambat²nya 1 minggu Kantor Pusat PT. Mandiri Bahagia 20239 Jl. Bhayangkara No. 434F Medan Telp. (061) 662.8353 - 662.8256

hian dan suaminya pemain basket NBA, Kris Humphries. Terhitungcuma72harisetelahpernikahan mereka dan dua pekan setelah upacara pernikahan dua babak disiarkan di E!, Kardashian dikabarkan mengajukan gugatan cerai. Kid Rock dan Pam Anderson (4 bulan). Rock dan Anderson pertama kali mulai berkencan pada 2001, berlanjut ke pertunangan pada 2002 dan berpisah pada 2003. Mereka akur kembali

MULTAZAM Berpengalaman professional

Adapun fasilitas yg diberikan: 1. Gaji pokok 2. Tunjangan/ insentif, dll


Kim Kardashian dan Kris Humphries/




07:30 Selebrita Pagi 08:00 Strike 08:30 Hitam Putih 09:30 Ups Salah 10:00 Spotlite 11:00 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-citaku 14:00 Dunia Air 14:30 Koki Cilik 15:00 Ayo Menyanyi 15:30 Asal Usul Fauna 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Petualang: Sur. 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 01:00 Sport7 Malam 01:30 Redaksi Malam* **m31/G


Syarat: - Minimal tamatan SMA sederajat - Usia maksimal 23 thn - Sehat jasmani dan rohani - Disiplin dan bertanggung jawab Lamaran dikirim langsung ke: PT. WIJAYA KESUMA BINTANG Medan - Binjai Km. 12 Jl. Langsa No. 1 (Pabrik Sepatu) HP. 0813.6149.6646



Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik


: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH Dijual Uk. Tanah 10x18m, Rumah 10x14m, 3KT, 2 KM, Garasi, Carport, R. Sholat, SK Camat, Lokasi dekat Gaperta Ujung, Arah Tj. Gusta, Harga Rp. 250 Jt Hub. 0853.7080.8888


Rumah 2 Tkt, Keramik Uk. 5x19m, Harga nego Jl. Tempuling No. 87 Hub. 0813.7660.3636

TANAH Dijual di Sinaksak Siantar, Seluas ±40 Rantai, Harga 42,5 Jt/Rantai, Cocok utk perumahan, Surat Kepala Desa HP. 0852.7619.6214 - 0813.7003.2752








JL. SEJATI/ PUKAT II NO. 61C MEDAN (DAERAH AKSARA/ MANDALA) TELP/ FAX. (061) 732.5009 - (061) 6998.5068





PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243




1.Asli Akta Hibah Tgl. 26 Nop 1968 No. 29. Yang diperbuat dihadapan Panusunan Batubara pada waktu itu Notaris Di Medan. 2.Surat Asli Kontrak Sewa Beli Ter Tgl. 21 Oktober 1955 No. 69. 3.Asli Surat Penyerahan Tgl. 11 Oktober 1960. Tercecer Antara KH. Wahid Hasyim. Bagi yang menemukan. Dan a/n. HARIS SIANIPAR. Bagi yang menemukan harap” Menghubungi: - 0813 800 37824 - 0813 8990 0752 - 0813 76309072

DEPOT AIR MINUM CASH & CREDIT Pemasangan Depot Air Minum berkualitas dengan

Ultra Violet Tanwing (Australia) * Depot Mineral, RO dan HEXAGONAL * Menyediakan Mobil Tangki Air Pegunungan * Menyediakan Segala perlengkapan Depot * Menyediakan Teknisi Depot

UD. PANDAN PUTIH Jl. Jemadi 67 Medan HP. 0813 6130 9280 0852 1369 9288

WASIRI (Untuk Ambeien)

Dan Akan Diberikan Hadiah Sepantasnya. TERCECER

BPKB Sp. Motor BK 6717 IW. a/n. M. IDRIS ABDULLAH Alamat: Jl. Sempurna No. 56 M. Kota No. Mesin: HB 61 E - 1575105 TERCECER

Telah tercecer 1 (Satu) berkas, Surat Ganti Rugi Camat Medan Denai No. 616/Akta/86 Tgl. 27 Agustus 1986 An. HAFNISYAH LUBIS. Seluas +/ - 150 M2. Bagi yang mendapatkannya mohon dikembalikan ke Jl. Letda Sujono Gg. M. Nur No. 9 atau Hubungi HP. No. 0812 6080 140 akan diberi hadiah sepantasnya.


1 Surat Keterangan No. 217/3ML/1980. An. SUKUR IDRIS 2. Surat Pernyataan Melepaskan Tanah Dengan Ganti Rugi No. 593.83/927/Sp. Motor/M.L/2009. An. Sutan Irwansyah Lubis.



KENANGA CITI HOTEL My Residence in Medan

Jl. Sisingamangaraja No. 82 Medan Telp. (061) 734.2106

Ingin Promosikan Produk Anda



Media yang Tepat untuk Iklan Anda

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar. Dpt Diperoleh di Sumatera - Aceh



Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

Hub: (061) 7365429 - 7362887






Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.1222


Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat



Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari



Sri Mulyani Merapat Djoko Calon Kuda Hitam


ertemuan Presiden Susilo Bambang Yudhoyono (SBY) dengan Direktur Pelaksana Bank Dunia Sri Mulyani Indrawati di Istana Negara kemarin mendapat perhatian besar dari kalangan politikus. Sri disebut-sebut bakal meramaikan bursa Capres 2014 mendatang. Tentu saja posisi Capres dari Demokrat terlalu tinggi dan bakal menimbulkan ‘’bom waktu’’ bagi internal Demokrat karena Sri bukan kader partai. Peluang kader Demokrat jauh lebih besar menjadi Capres, seperti Ketua Umum DPP Partai Demokrat Anas Urbaningrum, Djoko Suyanto dll. Kalau masalah kedekatan Demokrat atau SBY dengan Sri Mulyani tidak bisa dibantah. Namun masih terlalu pagi mengatakan Sri bakal dicalonkan sebagai Capres. Kalaupun Sri berminat dengan caranya merapat ke Istana, paling banter mantan Menteri Keuangan itu bakal ditempatkan sebagai Cawapres. Hemat kita, jalan menuju Capres dari Demokrat penuh lika-liku, masih terlalu panjang, dan itu diketahui dari penjelasan sejumlah tokoh Demokrat bahwa mereka masih ingin bekerja dalam 1-2 tahun untuk kepentingan rakyat pasca ‘’reshuffle’’ kabinet dua bulan lalu. Bahkan, pencalonan Demokrat disebutkan baru akan diumumkan setelah Pemilu 2014. Artinya, Demokrat lebih memikirkan hasil Pemilu baru bicara Pilpres. Jika Pemilu sukses dan Demokrat mampu mempertahankan suaranya maka tidak sulit bagi partai yang didirikan SBY itu untuk menentukan siapa Capres dan Cawapresnya. Sebab, mereka bisa langsung mengusulkan tanpa harus bergabung dengan partai-partai lainnya. Pemilu dan Pilpres 2014 masih jauh, namun sejumlah Capres sudah bermunculan, seperti dari Golkar (Aburizal Bakrie), Gerindra (Prabowo Subianto). Keduanya sudah pasti dicalonkan kader partainya karena memiliki hak ‘’veto’’ alias tidak ada yang bisa menandingi kualitasnya dalam manajerial maupun pendanaan dengan kekayaan hingga triliun rupiah. Sebenarnya, PDI Perjuangan pun tidak akan jauh beda dengan Golkar dan Gerindra. Hak ‘’veto’’ itu ada di tangan Megawati Soekarnoputri. Sayangnya, suami Intisari Mega (Taufiek Kiemas) pagi-pagi sudah menyarankan agar istrinya tahu diri, tidak lagi mencalonkan diri sebagai Capres karena Djoko Suyanto ‘’kuda sudah dua kali kalah dan faktor usia. Sepeluang pada putrinya (Puan Mahitam’’bakal Capres dari dangkan harani) pun ditentang oleh Guruh SoekarDemokrat berpasangan noputra karena dinilai masih muda. Sehingga siapa Capres dan Cawapres dari PDIP dengan Sri Mulyani masih tanda tanya besar. Sama seperti Demokrat. Kalau Megawati mau pastilah dia yang akan maju lagi dalam Pilpres 2014. Sebab, hanya ada satu matahari di PDIP. Begitu pula jika Mega mengalihkan pada putrinya (Puan) sepertinya akan mendapat dukungan dari internal partai (mayoritas tergantung putusan Mega). Tapi, tidak demikian jika PDIP mengambil calon dari luar partai, seperti Prabowo sebagai Capres. Sebab, kecil kemungkinan suara Gerindra bisa mengalahkan perolehan suara PDIP dalam Pemilu mendatang. Tidak logis jika kader PDIP hanya ditempatkan sebagai Cawapres. Memang kalau dihitung dari perolehan suara Pilpres 2009, kans Mega memenangkan Pilpres 2014 sangat besar setelah SBY tidak boleh lagi maju untuk ketiga kalinya sesuai dengan ketentuan perundangan. Di atas kertas popularitas Mega di atas Capres-Capres lainnya. Kadernya militan. Namun begitu, hitung-hitungan di atas kertas bisa berubah dan sulit ditebak arahnya. Apalagi pemilih kita pada umumnya lebih banyak yang belum menentukan pilihannya alias mengambang sehingga jika tidak memiliki kemampuan ekstra dalam pendanaan maka laju Mega bakal terganjal menjelang hari pemilihan (pencoplosan) dan dia kalah lagi. Bagaimanapun juga dari segi finansial sepertinya Aburizal di atas angin. Namun ‘’handicap’’ Ical, panggilan akrabnya, cukup besar karena dia bukan berasal dari etnis Jawa, tapi kelahiran atau putra Sumatera. Nasibnya bisa seperti Jusuf Kalla, putra terbaik Sulawesi Selatan, yang populer dan punya kemampuan sebagai negarawan namun hanya memperoleh suara relatif kecil dalam Pilpres 2009. Sehingga peluang Ical pun akan relatif kecil, kecuali dia mau menjadi Cawapres atau mencari pendamping Cawapres yang tepat dari etnis Jawa, seperti Ketua MK Mahfud MD atau Prabowo. Demokrat sendiri hemat kita masih akan melakukan survei, namun figurnya tidak akan jauh dari: Ani Yudhoyono (istri SBY), Pramono Edhie (KSAD), Anas Urbaningrum (Ketum Partai Demokrat), dan Djoko Suyanto (Menko Polkam). Keempatnya punya sisi plus dan minus, namun kans Pramono Edhie tampaknya lebih pas karena memiliki banyak sisi plusnya. Tentunya dia harus pensiun dari KSAD dan memiliki ‘’track record’’ yang cemerlang sampai pensiun dari ketentaraan. Jika kasus Papua dan Aceh sampai memanas dan menimbulkan banyak korban dalam 1-2 tahun mendatang bukan mustahil pencalonan Pramono Edhie bakal terkendala juga sehingga kans Anas bisa tiba-tiba mencuat. Nama yang kita sebut terakhir ini harus bisa membuktikan harta kekayaannya yang meningkat pesat dan perjalanan politiknya mulus, tidak menggunakan ‘’money politics’’ sebagaimana dituduhkan Nazaruddin. Sekalipun peluang Ani Yudhoyono terbuka lebar namun komitmen SBY yang ‘’mengharamkan’’ keluarganya ikut dalam Pilpres 2014 masih terngiang di hati masyarakat. Ada sikap tidak konsisten jika istri SBY dipaksakan maju. Sehingga kans terakhir tentunya Djoko Suyanto. Inilah bakal Capres‘’kuda hitam’’ dari Demokrat berpasangan dengan Sri Mulyani, yang pembahasannya diperkirakan menimbulkan debat, tarik-menarik dalam internal partai berlambang mercy itu.+


Faks 061 4510025


+6282162685244 Yth. Bpk Arifin Srg ! Mari sama2 kita bahas masalah khilafiah dlm pelaksanaan amalan yg kita amalkan, tapi jgn kita ego dan memaksakan hrs ini itu yg paling benar. Mari sama2 kita buka hati ini utk menerimaa perbedaan (semua punya dasar). Krn yg tdk ada perbedaan adalah ‘aqidah..wsslam said van bullah kisaran. +6281360923093 Saya sangat heran , selama ini banyak yang merespon tanggapan2 dr.arifin.s.soal agama Islam, padahal dengan jelas beliau berkata, ikuti Alquran dan Hadis, jika seorang yang beragama Islam tidak mau mengikuti ajaran Alquran & hadis, maka mereka diragukan keIslamannya. Salam buat dr. Arifin .s.dan BRAVO selalu WASPADA. +62811670435 Kemarin pas waktu shalat dzuhur di Masjid Silatur rahim, Jl Pelajar, Teladan yg potong daging kurban pada gak shalat. Rupanya motong daging lebih utama dari shalat wajib disana. Innalillahi wa inna ilaihi rajiun. +6282161886831 Assalamu alaikum .. Waspada .. Tolong dulu usulkan sama Walikota tdk ada yg bagus dan becus kerjaan..Betor2 dari dulu udah mau di tertiban sampai sekarang belum ..Jalan Thamrin pun begitu juga , apa yg bisa di kerjakan pemko..Di kuasai org2 kaya semua.Dan sukak 2.. Nya aja..Tolöng waspada usulkan sama walikota.Dari ucok hrp.Terimakasih. +6282161886831 Pemerintah seharusnya mengembalikan undang2 1945 yg asli..Lihat negara amburadul terus semua mau raja..Mau ngatur..Semua yg di obah2 pak gusdur kembali ke semula..Ni dasar undang2 45.Kembali.Trimakasih..Dari lubis... +6281361970409 Ass,kreu seumagat Ilahi Rabbi jangka alu bie aceh cinta, Allah bi rezki di Coffe Shop Helsinki simpang setia jadi kota sumatra, gampong ulon rab dgn laot teungku kawee ungkot dimalam senja, meah desya lon bateen ngon lahe gantoe lon hade memat jaro dua.meah bak babah beu trok lam hate, beek na desya lee di padang mahsya, IDUL ADHA jino ka teuka, ALLAH TAA’ALA, ALLAH YG ESA, Allahhu akbar walilla hil hamda, dari kelurga besar Cofee Shop Helsinki medan wasalam, +6282161886831 Assalamu alaikum..Waspada..Tolong Pak Rahudman tertiban BETOR2 Binjai dan Pakam ini...Dan tempat2 parkir mobil jalan Thamrin Terimakasih, wassalam, Ucok hrp +6285275437438 Kepada Yth Redaksi Waspada, Hari ini senin tgl 7 Nov Harian Waspada udah terbit tapi kami Pelanggan di Lhoksukon Acut tidak masuk? ini ulah agen yg namanya Ismail, kami mohon supaya DIGANTI aja agennya !

WASPADA Rabu 9 November 2011

SEA Games & Citra Positif Bangsa Oleh Dr Drs H.Ramli Lubis, MM Bangsa yang mempunyai citra diri positif tidak akan berlama-lama menghabiskan energinya untuk sesuatu yang tidak bermanfaat.


embangunan di berbagai sektor di negeri ini semakin kasat mata telah mengalami penggerusan. Indikatornya cukup sederhana saja. Laju pertumbuhan pembangunan kitalebihlambatjikadibandingkandengan negara tetangga. Sebut saja Malaysia, Singapura ataupun Thailand. Ada semacam kelesuan dalam diri anak bangsa dalam kehidupan berbangsa dan bernegara. Saling curiga mencurigai satu sama lain, bahkan saling intai, saling menjatuhkan dan saling tidak mempercayai telah menjadi warna keseharian. Akibatnya sinergitas pembangunan cenderung terlupakan dan menjadi faktor ke sekian setelah prioritas lainnya. Tapi semangat berbangsa dan bernegara itu seperti memercik ketika terjadi kemenangan beruntunTimnas Sepakbola Indonesia di ajang piala AFF Suzuki 2010. Meskipun akhirnya Indonesia gagal memetikpeluangemasdenganmenjadijuara, tapi percikan sinergitas elemen bangsa melalui sepakbola itu dirasakan benar kehadirannya. Sayangnya cuma sebentar saja sebelum kemudian kembali dirasuki berbagai kekisruhan dalam pengelolaan persepakbolaannegeriini—yangberujung dengan semakin terpuruknya prestasi Timnas kita. Tidak hanya olahraga, sarana olahraga sepertinya juga dekat dengan semangat dan sinergitas anak bangsa. Lapangan Ikatan Atletik Djakarta (Ikada) pada 19 September 1945 telah menjadi saksi tempat digelarnya Rapat Raksasa yang kemudian menjadi sumber motivasi bagi seluruh rakyat untuk meneruskan perjuangan dalam mengisi kemerdekaan. Peristiwa 66 tahun lalu di lapangan Ikada merupakan sikap heroik generasi muda dalam bentuk pengerahan massa. Pemuda masa itu menyatakan kebulatan tekad memberikan dukungantetaptegaknyaNegaraKesatuan Republik Indonesia (NKRI). Saat itu pemuda Jakarta tidak sabar menunggu pemindahan kekuasaan dari tentara Jepang kepada bangsa Indonesia seperti yang tercantum dalam teks proklamasi kemerdekaan 17 Agustus 1945. Inilah semangat kolektif yang bisa mengukir sejarah yang menjadi semangat dari generasikegenerasi.Bangsainiharuspintar mencari momen penting dan strategis untuk menggelorakan kembali semangat perjuangan kolektif itu. Bukan sekedar retorika kosong yang cuma sebatas seremornial semata.

SEA Games Jika tak ada aral merintang, Indonesia akan menjadi tuan rumah SEA Games ke 26 yang akan digelar di Jakarta dan Palembang. Pembukaan ajang olahraga negara-negara Asia Tenggara tersebut rencananya dimulai pada tanggal 11 November2011.Tanggalinidipercayabanyak orang sebagai tanggal yang membawa keberuntungan. Keberuntungan itu berkonotasi pada tumbuhnya semangat kebersamaan, bergeloranya kembali sinergitas berbagai elemen bangsa untuk merasa sebagai satu bangsa dan sama-sama bergerak membangun negeri ini. Inilah keberuntungan terbesar yang diperolehbangsainidalam perhelatan olahraga tersebut. Semangat kebersamaan yang memercik dalam Piala AFF kemarin semestinya juga muncul dan tumbuh serta berkembang sehingga menjalari berbagai sektor pembangunan. Tetapi syaratnya harus ada prestasi dari para atlet kita. Prestasi yang gilang gemilang adalah pencetus yang strategis akan rasa kebanggaan sebagai bangsa Indonesia. Karena ternyata bangsa ini sedang merasa haus akan prestasi dan kebanggaan sebagai anak bangsanya. Rakyat kita bukan orang yang tidak mencintaibangsanya,tapikebanyakangenerasi muda tidak tahu harus mulai dari mana dalam mencintai tanah airnya ini. Maka prestasi olahraga adalah jawaban yang paling strategis. Indonesia pernah menjadi tuan rumah SEA Games sebanyak tiga kali yaitu padatahun1979,1987,dan1997.Ketiganya menjadi kebanggan bagi rakyat Indonesia. Apalagi pada ketiga tahun penyelenggaraan itu, Indonesia menjadi juara umum, dari sembilan kali juara yang telah diraih. Saat menjadi tuan rumah waktu itu, kita berhasil meraih 410 Medali. 194 Emas, 101 Perak, dan 115 Perunggu. Bayangkanlah saat itu, betapa banyak rakyat Indonesia yang bangga dan sepenuhnya memberi dukungankepadapenyelenggaradanatlet

kita. Jika dibanding dengan 3 SEA Games yang lalu, kali ini semangat itu rasanya memang kurang hingar bingar. Bahkan tidak sedikit anak muda sekarang yang benar-benar tak tahu kapan perlombaan olahraga terbesar di AsiaTenggara itu akan digelar.Masyarakatkitabanyakyangapatis. Boleh jadi hal itu disebabkan kabar tentang kekisruhan hukum dalam pengerjaan sarana olahraga telah sampai lebih dulu daripada perhelatan olahraga itu sendiri. Memang begitu. Ketidakpedulian masyarakat khususnya generasi muda bangsa itu telah dipupuk sedikit demi sedikit oleh perilaku buruk birokrasi dan berbagai pengalaman buruk dengan pemerintahan. Tapi sikap terbaik kita saat ini, dalam kondisi seperti ini adalah melupakan sementara kasak-kusuk persoalan tersebut. Lupakan dulu! Para atlet harus konsentrasi kepada prestasi yang akan diraih dalam perlombaan nanti. Mari kita bersikap sebagai rakyat yang baik, yang berusaha sepenuhhatimenjadituanrumahbagi para tamu dari 10 negara peserta. Sebagai anak bangsa, kita tentunya berharap agar dukungan terhadap perhelatan bangsa-bangsa Asia Tenggara ini datang dari seluruhelemenbangsa. Karena SEA Games tidak saja merupakan ajang un-juk kebolehan bagi atlet, pelatih, dan seluruh pembina, tetapi juga merupakan kesempatanbagisuatunegarauntukmemperlihatkan kemajuan yang telah dicapai. Kita harapkan perhatian serupa terlihat dalam mendukung semua haldemisuksesnyapestaolahragatersebut. Dan SEA Games adalah momen penting bagi bangsa Indonesia untuk membangun citra positif diri bangsa. Citra positif Modal dasar bagi kesusksesan seseorang adalah kepercayaan dirinya. Dengan membangun percaya diri, maka kesuksesan hanya tinggal selangkah lagi. Demikian pula dengan bangsa, kemajuan bangsa akan sangat ditentukan dengan rasa percaya diri bangsa. Adalahcitradiriyangpositifyangsecara alamiah akan membangun rasa percaya diri. Bangsa yang mempunyai citra diri positif tidak akan berlama-lama menghabiskan energinya untuk sesuatu yang tidak bermanfaat. Citra diri bangsa yang positif mendorong elemen-elemen bangsa untuk melakukan sesuatu yang masih dapat ia lakukan. Ia akan fokus pada hal-hal yang masih bisa dilakukan,

bukannya pada hal-hal yang sudah tidak bisaialakukanlagi.Darisinilah,terdongkrak rasa percaya diri suatu bangsa. Dampak langsung dari citra bangsa yang positif adalah semangat juang yang tinggi.Bangsayangmemilikicitradiripositif, percaya bahwa bangsanya jauh lebih berhargadaripadamasalah,ataupunberbagai masalahyangsedangdihadapinya.Bangsa seperti ini akan bisa melihat bahwa hidupnya jauh lebih indah dari segala krisis dan kegagalan jangka pendek yang harus dilewatinya. Segala upaya dijalaninya dengan tekun untuk mengalahkan masalah yang sedang terjadi dan meraih kembali kesuksesan yang sempat. Inilah daya juang yang lebihtinggiyangmunculdariorangdengan citra diri positif. Bangsa yang memiliki citra diri yang positif akan mendapatkan berbagai manfaat, seperti; pertama, membawa perubahan positif. Bangsa yang memiliki citra diri positif maka berbagai elemen bangsanya senantiasa mempunyai inisiatif untuk menggulirkan perubahan positif bagi lingkungan tempat ia berkarya. Mereka tidak akan menunggu agar kehidupan menjadi lebih baik, sebaliknya, mereka akan melakukan perubahan untuk membuat kehidupan menjadi lebih baik. Kedua, mengubah krisis menjadi keberuntungan. Selain membawa perubahanpositif,bangsayangmemilikicitrapositif memiliki ciri mampu mengubah krisis menjadi kesempatan untuk meraih keberuntungan. Citra diri yang positif mendorong orang untuk menjadi pemenang dalam segala hal. Di dalam bangsa yang bercitra positif, kekalahan, kegagalan, kesulitan dan hambatan sifatnya hanya sementara. Fokus perhatian mereka tidak melulu tertuju kepada kondisi yang tidak menguntungkantersebut,melainkanfokus mereka diarahkan pada jalan keluar. Penutup Untuk kepentingan pembangunan bangsa, negeri ini harus memiliki citra positifyangakanmenumbuhkanrasapercaya diri sebagai bangsa. Citra positif ini adalah kesatuan pemahaman dan sinergitas serta kebersamaan dalam laju pembangunan. Citr diri bangsa yang terpantik ini nantinya akan membuahkan rasa percaya diri kolektif anak bangsa. Momen SEA Games adalah momen strategis untuk memantik citra diri bangsa yang positif itu.Tentu berbagai tantangan kedepansiapmenghadang—yangterbesar justru sikap ketidakpenerimaan dari diri elemen bangsa sendiri.Tapi dalam kondisi seperti ini, sikap terbaik sebagai seorang anak bangsa adalah meyakini akan munculnya citra positif yang bermuara kepada semangat kolektif membangun bangsa. Penulis adalah Mantan Wakil Walikota Medan.

Menggugat CSR Setengah Hati Oleh Arifin Saleh Siregar, MSP Kalau hanya memberi pancing saja, ini tidak etis dan tidak berkeadilan karena harta masyarakat berupa kekayaan alam sudah berpindah tempat ke kantong perusahaan.


ecara sederhana, CSR (corporate social responsibility) atau tanggung jawab sosial perusahaan adalah suatu konsep yang mewajibkan perusahaan untuk memenuhi dan memperhatikan kepentingansemualapisandankelompok masyarakat di mana perusahaan tersebut berdiri atau menjalankan usahanya. Salah satu bentuk dari CSR yang sering diterapkan di Indonesia adalah community development (pemberdayaan masyarakat) yang lebih menekankan pembangunan sosial dan pembangunan kapasitas masyarakat sehingga akan menggali potensi masyarakat lokal. Di Indonesia, seperangkat ketentutan sudah mengatur CSR. Salah satunya ada di UU No 40Tahun2007tentangPerseroan Terbatas, tepatnya Pasal 74 ayat 1 yang menyebutkan ”Perseroan yang menjalankan kegiatan usahanya di bidang dan/atau berkaitan dengan sumber daya alam wajib melaksanakan tanggung jawab sosial dan lingkungan”. Pasal 2 mempertegas bahwa ”Tanggung jawab sosial dan lingkungan merupakan kewajiban Perseroan yang dianggarkan dan diperhitungkan sebagai biaya Perseroan yang pelaksanannya dilakukan dengan memperhatikan kepatutan dan kewajaran”. Namun, meski CSR sudah menjadi tuntutan masyarakat dan kewajiban perusahaansertasudahdiaturdalamperaturan perundang-undangan, tapi tak jarang ditemukan program CSR yang masih setengahhati.Setengahhati,karenapelaksanaannyabelumsesuaidengansemangatdan nilai-nilai yang ada dalam CSR tersebut. Setengah hati, karena yang terjadi adalah ketergantungan terhadap perusahaan dan bukanpemberdayaan.Setengahhati,karena peruntukkan dana CSR itu tidak sampai kepadasasaranyangsemestinya.Setengah hati juga, karena intervensi pemerintah yang terlalu jauh dan disangsikan pengelolaan anggaran CSR tersebut bisa menjadi kabur. “Kebaikan hati perusahaan” Dalamkontekspemberdayaanmasyarakat, sering ditemukan program atau kegiatan CSR yang dilakukan justru terkesan hanya pertunjukkan ”kebaikan hati perusahaan”. Dari pemberian beasiswa hingga pemberian makanan bergizi bagi anakanak. Dari pengobatan gratis hingga sunat massal.Daripembangunanrumahibadah hingga pengaspalan jalan. Dari pemberian bantuan olahraga hingga bantuan naik haji.Daripencairanproposalkegiatantujuh belasan hingga pemberian uang cuma-

cuma. Tujuannya memang mulia; sebagai wujud peran sosial dan kepedulian untuk masyarakat.Tapiapayangdilakukanperusahaandenganprogramsepertiitudiyakini tidakakanbisamemberdayakanmasyarakat.Ya, maksud hati memberdayakan masyarakat, tapi hasilnya adalah masyarakat terpedaya atau masyarakat yang ketergatungan. Mereka jadi malas karena yakin akanbantuandariperusahaan.Yangterjadi nantinya adalah “tangan di bawah”, mengharap kebaikan perusahaan. Ini tentu sangat berbahaya. Sebab, kalau perusahaan itu nantinya pergi atau kontraknya sudah habis, masyarakat tak akan bisa apa-apa. Bantuan tidak ada lagi, sementara masyarakat sudah kadung terlalu “enak” dengan beragam bantuan tersebut. Penerapan CSR sering kali masih bersifat corporate giving atau bermotif amal atau charity dan corporate philanthropy yang bermotif kemanusiaan. Padahal menurut Edi Suharto (2008), CSR itu juga harus memenuhi sifat corporate communityrelations ataumembangunhubungan masyarakat dengan perusahaan dan communitydevelopmentyanglebihbernuansa pemberdayaan masyarakat. Pelaksanaan CSR sering disarankan untuk melibatkan pemerintah setempat. Tapi memberikan pengelolaan dana CSR sepenuhnya kepada pemerintah daerah apalagi sampai dimasukkan ke APBD adalah sebuah kekeliruan dan bagian dari setengah hati itu. Dana CSR adalah dana yang berasal dari perusahaan dan diperuntukkanutamanyabagimasyarakat setempat atau komunitas lokal di mana perusahaan berada. Jika dana tersebut dimasukkan ke APBD, maka ceritanya akan lain. APBD adalah milik semua masyarakat di suatu daerah tertentu. Dana yang ada diAPBDharusdinikmatisecaraproporsional seluruh wilayah dan komponen masyarakat. Sedangkan dana CSR tidak bisa didistribusikan secara proporsional untuk semua masyarakat di suatu daerah, sebab dalam hal ini ada masyarakat yang yang harus diutamakan, yakni masyarakat setempat. Program CSR adalah kesepakatan antara masyarakat dengan pihak perusahaan. Jadi memasukkan dana CSR keAPBDakanmenimbulkanketidakadilan bagi masyarakat setempat di sekitar lokasi perusahaan. Hal ini juga sudah diwanti-wantiWapres RI Boediono. Ketika membuka Gelar Karya Pemberdayaan Masyarakat di Ja-

karta Convention Centre, Kamis 15 September 2011 , Wapres dengan tegas meminta dana CSR langsung diberikan kepada masyarakat yang menjadi sasaran. Tak perlu dana itu masuk ke APBD dulu, karena bisa-bisa malah diselewengkan aparat Pemda. Program CSR juga acapkali tidak mampu menyahuti kebutuhan masyarakat. Masyarakat sebenarnya lebih butuh dana bergulir untuk modal usaha rumah tangganya, tapi yang diberikan justru bantuan ternak kambing. Di tempat lain, beberapa perusahaan justru memberikan bantuan dana CSR lewat proposal dari masyarakat. Padahal, salah satu semangat CSRituadalahsemangatadanyakewajiban untuk menyumbangkan dananya (keuntungan) untuk masyarakat. Jika semangatnya kewajiban, maka seharusnya perusahaan tidak menunggu kelompok masyarakat atau pelaku usaha untuk mengajukan proposal mendapatkan dana bantuan. Jika proposal yang datang, itu namanya permohonan bantuan. Sejatinya, perusahaanlah yang mendata dan datang ke kelompok pelaku usaha untuk mengetahui apa yang dibutuhkan kelompok pelaku usaha.

tukan perusahaan baru tersebut diambil dari dana CSR yang ada. Konteks seperti ini cocok untuk CSR perusahaan pertambangan, karena perusahaan jenis ini mengelola sumber daya alam (hasil tambang) yang tidak terbarukan. Artinya, ketika perusahaan selesai melakukan eksploitasi (produksi) hasil tambang maka dengan sendirinya mereka akan meninggalkan lokasi perusahaan. Dan tinggallah masyarakat dengan lingkungannya yang sudah berubah dan kekayaan alamnya yang sudah habis. Nah, perusahaan pertambangan tadi lewat dana CSR-nya harus sudah bisa menciptakan perusahaan jenis lainnya, misalnya perusahaan pengalengan buah, pengolahanrempah-rempahdansebagainya, sehingga meski mereka sudah pergi, masyarakat sekitar tetap bisa berdaya, karena masih memiliki lahan usaha dan kegiatan.

Alternatif ke depan Orang bijak sering bilang; jangan memberi ikan, tapi kasihlah pancing, mudah-mudahan ia bisa mandiri, berdiri diataskakisendiri.TapidalamkonteksCSR, kalimat yang pas adalah; kasih ikan kasih juga pancing. Artinya, masyarakat harus mendapat bantuan yang bersifat amal (charity)ataubantuancuma-cumaberupa uang karena sumber daya alam yang ada disekitarnyasudahdieksploitasiperusahaan. Di luar itu, masyarakat juga harus diberikan fasilitas keterampilan lewat beragam pendidikan dan pelatihan agar merekabisaberdayadengankemampuannya sehingga tidak tergantung lagi dengan keberadaan perusahaan. Kalau hanya memberi pancing saja, ini tidak etis dan tidak berkeadilan karena harta masyarakat berupa kekayaan alam sudah berpindah tempat ke kantong perusahaan. Jadi harus ada pemberian “ikan” dandidukungdenganpemberianpancing. Memberiikansajamemangakanberbahaya karena masyarakat akan buncit, jadi malas, dan akhirnya ketergantungan dan gampang diperdaya. Tapi, kalau diikuti denganpemberianpancingmaka,mereka akan sehat, mereka akan bergerak, berupaya dan bekerja, dan akhirnya mereka akan berdaya. Jika mereka sudah berdaya, maka kehadiran perusahaan pun pasti diterima. Alternatif solusi lainnya bisa juga berupa perusahaan harus mengganti perusahaan. Artinya, perusahaan yang selama ini sudah mengelola sumber daya alam harus bisa menciptakan perusahaan baru yang pas dengan karakteristik dan potensi daerah tersebut. Dana pemben-

Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

Penulis adalah Sekretaris Ilmu Kesejahteraan Sosial Fisip UMSU.


SUDUT BATUAH * Yusril: Semua terpidana berhak dapat remisi - Terpidana juga manusia, he...he...he * Kemendag ingin batasi konsumsi beras - Wah melanggar hak asasi neh! * Pembangunan kesejahteraan manusia harus dipertajam - Biar manusia tak berpikiran macam-macam


D Wak

WASPADA Rabu 9 November 2011

Tersendatnya Dana Sertifikasi Guru Mendapat dana sertifikasi bagaikan durian runtuh bagi dunia guru. Dengan bertambahnya gaji maka biaya hidup sedikit dapat diatasi, beberapa anak dapat mengecap perguruan tinggi, sepeda Umar Bakri ditukarkan sepedamotor Astuti, sebagian kecil mulai membeli roda empat yang murah. Alhamdulillah… penderitaan yang panjang mulai sirna, harapan gemilang di depan mata. Sudah hampir dua tahun dinikmati dana sertifikasi sebesar satu kali gaji bagi guru negeri dan sebesar 1,5 juta bagi guru sewasta. Di samping tambahan gaji yang diberikann, pemerintah juga meminta tagihan atas peningkatan kualitas pendidikan. Guru yang telah memiliki sertifikat dinyatakan berkompetensi dan profesional. Mereka diminta peningkatan kinerja kerja yang maksimal mencerdaskan anak bangsa. Perlahan sang guru mulai berlangganan koran atau membeli buku guna improvisasi metode pembelajaran. Perlahan kredit laptop guna mengakses informasi menambah wawasan, sesekali mengikuti penataran demi peningkatan kompetensi diri. Hari berganti bulanpun berlalu,dana sertifikasi mengalami gangguan realisasi,pencairan tak tepat waktu, tak jarang tertunda sampai beberapa bulan, bahkan sampai para guru demo menuntut dicairkan. Tak tau dimana tersendatnya, karena semua pihak yang berkompeten terkesan buang badan, akibatnya dana sertifikasi terlambat sampai empat bulan…? Terkendalanya dana ini berkorelasi terhadapa kenerja guru di lapangan. Sebagian besar guru mulai kewalahan mengatasi keuangan keluarga. Pos-pos kuangan menjadi tak karuan dan menghawatirkan. Beberapa guru berhenti berlangganan koran, sepeda motor terpaksa dijual kembali, kredit laptop terpaksa dikembalikan, penataran tak pernah lagi. Kenikmatan yang pernah direguk kini tak jelas lagi. Mulai bersiap diri mencari pekerjaan sambilan demi biaya pendidikan anak yang semakin tinggi. Upaya pencerdasan anak bangsa mengalami gangguan. Demi menutupi kebocoran keuangan rumah tangga sang guru mencoba demo di jalan. Sebenarnya demo ini sangat terpaksa dilakukan, kurang sedap dilihat dan agak riskan. Tapi.apa boleh buat, semua itu dilakukan guna mengetuk hati pemerintah agar dana sertifikasi dicairkan. Berdasarkan fenomena di atas alangkah indahnya dana sertifikasi guru ini janganlah mengalami kemacatan sampai beberapa bulan.Apalagi sampai guru demo di jalan.Alangkah indahnya dana serifikasi ini masukkan dalam amprah gaji guru negeri, atau rekening guru swasta setiap bulan. Depertemen Pajak hendaklah memperhatikan perberlakuan pajak yang berkeadilan. Sangat rancu guru golongan III dipotong pajak 5 %, sedangkan guru golongan IV dipotong 15 %. Akibatnya guru golongan III mendapat dana sertifikasi lebih besar dibanding golongan IV. Salah seorang guru menunda usulan kenaikan golongan III ke IV demi dana sertifikasi yang lebih besar. Jika pemerintah bersungguh-sungguh pencerdasan anak bangsa, demo di jalan tak seharusnya terjadi. Ketentuan Undang-undang 20% buat dana pendidikan dapat kiranya direalisasikan dengan seksama dan akurat. Hindari penyalahgunaan di lapangan dengan mengawasi kebocoran dan tepat sasaran. Perhatikan kesejahteraan guru sebagai ujung tombak pendidikan. Selamat belajar guru, semoga semakin kompeten dan professional. Di tanganmu anak bangsa kami titipkan, agar menjadi generasi yang cerdas dan berahlak mulia. Semoga wajah pendidikan mengalami peningkatan. Amin. Nada Sukri Pane Hamparan Perak

Selamat Buat Timnas U-23 Saya sangat senang melihat Timnas U-23 di laga perdananya yang telah mampu mengungguli lawannya 6-0, ini membuat kita lebih optimis kembali mengambil posisi di Asia Tenggara khususnya dalam bidang sepak bola. Beberapa kalangan termasuk saya diawal sempat ragu apakah Timnas bisa membangun semangatnya sendiri setelah masuk kedalam group yang berisi tim-tim kuat dari Asia Tenggara ini. Apakah berada digroup “neraka” ini membuat mental anak-anak Timnas U-23 jadi anjlok dalam mengawali pertandingan. Tetapi semuanya terjawab setelah pluit awal permainan ditiupkan, semangat juang nampak cukup tinggi, kemapuan individu dan tim pun nampak semakin solid dibanding pertandingan-pertandingan uji coba sebelumnya, peluang-peluang yang terbuka lebarpun mampu dimanfaatkan dengan baik dan kesimpulan kahirnya Timnas U-23 mampu menepis keraguan-raguan pecintanya. Langkah kedepan tentunya semakin penuh tantangan, disamping stamina yang akan terus berkurang tentu kelas lawan juga mempengaruhi daya juang. Ucapan selamat ini bukan terlalu dini diucapkan, karena tekanan-tekanan yang diterima pemain biasanya sangat tinggi justru sebelum laga perdana, kemampuan tim menaikkan semangat sendiri akan sangat menentukan kualitas daya juangnya, inilah yang membuat saya mengucapkan selamat, selamat mengatasi tekanan awal dan semoga dengan pembukaan yang baik ini semangat juang akan terus terpupuk dan terus membaik sampai akhir kompetisi. Beberapa waktu lalu Timnas senior yang berlaga dalam upaya masuk prakualifikasi Piala Dunia sempat juga membuat kita optimis, walaupun optimisme pendukung itu sekarang sudah hampir punah semoga tidak ikut membunuh semangat juang Timnas senior. Lihatlah betapa besar potensi dukungan suporter Indonesia pada awalawal, walaupun terus semakin berkurang, jangan sampai habis pendukung Timnas. Akan halnya Timnas U-23, justru pendukungnya pada awal-awal kompetisi ini tidak terlalu besar dan signifikan, tetapi jika Timnas U-23 mampu memelihara semangat juangnya dan kekompakan timnya, kami yakin pendukung dan suporternya pasti akan terus bertambah dan bertambah, karena memang sudah dasarnya bahwa Masyarakat Indonesia ini adalah masyarakat pencinta bola, jangan khawatir, berikan saja kami permainan yang baik dan semangat berjuang yang baik, jangan sedikitpun “cuak” dengan tim-tim yang berada satu group dengan Timnas kita, karena sesungguhnya tim merekapun sudah sedikit ketar-ketir menghadapi Timnas, apalgi kita tuan rumahnya. Selamat berjuang Timnas U-23 dan rebut kembali posisi Tumnas sebagai Tim yang disegani di Asia Tenggara. Syamsuddin Nasution, BA Medan

Prof. Dr. Syahrin Harahap, MA

Berkurbanlah Seringkali luput dari perhatian kita bahwa ternyata tidak ada informasi mengenai suatu tempat dihari kemudian yang bersifat indivudualistik. Semua informasi mengenai hari pembalasan diproses dalam rangka pertanggungjawaban atas penyelenggaraan kehidupan individu dan kehidupan bersama. Tidak ada orang yang lolos ke sorga tanpa dipertanyakan tanggungjawabnya menyangkut orang lain dan tidak akan ada manusia yang terjerembab ke neraka jika bukan karena kegagalannya melaksanakan tanggung jawab sosial. Dengan begitu kita dapat mengetahui bahwa persoalan tanggung jawab sosial akan dibawa mati, tidak saja sebagai persoalan dunia. Diduga keras itulah yang menyebabkan keimanan dan kesalehan seseorang diukur dengan sejauh mana ia mencintai orang lain sebagaimana ia mencintai dirinya sendiri. (al-Hadis). Bahkan shalat yang merupakan tiang penyangga utama Islam (arkanul Islam) dimulai dengan mendeclair sikap kepatuhan individu (takbir) dan diakhiri dengan kepedulian sosial (salam). Begitu pentingnya tanggung jawab bukan individual itu hingga Allah Swt., mengabadikannya dalam drama ketaatan Bapak monoteisme, Ibrahim as., dalam bentuk pengorbanan sang oenemu tauhid itu untuk menyembelih anaknya sendiri dengan melibatkan orang lain, sang Ibu dan anaknya bahkan setan (al-ayat) meskipun sudah ratusan tahun mempraktekkan kepatuhan dan ketaatan individual kepada Tuhan. Drama tauhid yang melibatkan sang pembebas kemusyrikan dan indvidualisme itu menumbuhkan kesadaran kita bahwa keberhasilan seseorang sangat ditentukan oleh kesediaan berkorban untuk kepentingan publik. Perintah menyembelih anak sendiri ternyata telah menyimbolkan peran setiap komponen masyarakat dalam pengorbanan untuk membangun hormonitas kehidupan. Ibrahim memerankan pengorbanan sang pemimpin, Siti Hajar menyimbolkan pengorbanan komunitas perempuan, Ismail menyimbolkan pengorbanan generasi muda. Sementara setan menyimbolkan kekerdilan sikap individualistik. Drama pengorbanan sang pelopor tauhid ini memberi isyarat kepada kita bahwa setiap orang harus berkorban untuk kepentingan orang banyak dengan mengorbankan kepentingan dan kemauan diri sendiri (hawa=keinginan dan nafsu=diri sendiri). Hal ini teramat penting karena masalah-masalah kebangsaan kita saat ini sebagian besar terjadi karena tidak adanya kerelaan berkorban dari banyak anak bangsa yang menyebabkan terjadinya segala macam penyimpangan kehidupan disana sini. Banyak orang yang tidak tahan hidup sederhana hingga menempuh cara hidup berpoya-poya di atas penderitaan rakyat. Dilihat secara demikian maka salah satu tugas penting kita sekarang ini adalah bagaimana merevitalisasi semangat berkorban untuk melawan kekerdilan individualistik setan dan iblis. Wallahu A’lamu bi al-Shawab.

Opini B7 Calhaj Non Kuota, Salah Siapa? “ Kalaupun calon haji dan calon hajjah (Calhaj) sudah membayar jauh lebih mahal ketimbang Biaya Penyelenggaraan Ibadah Haji (BPIH) Calhaj regular, tapi tidak sedikit Calhaj khusus batal berangkat pada musim haji tahun ini. Kasus ini seperti wabah yang selalu terjadi setiap musim haji. Anehnya, masalah ini seperti dibiarkan terjadi. Tidak hanya satu-dua kali terjadi. Persoalan haji khusus atau dulu disebut haji ONH Plus yang “terlantar” atau gagal berangkat, sangat sering terjadi. Padahal, dengan membayar lebih mahal, mereka mengharapkan mendapat pelayanan lebih baik, tapi ternyata itu sering hanya sebatas impian. Sebagian di antara mereka malah merasa ditipu oleh perusahaan mengaku Penyelenggara Ibadah Haji Khusus (PIHK). Calhaj yang mengikuti bimbingan penyelenggara haji/umrah ini tentu saja sangat resah. Pasalnya, calon jamaah tak juga diberangkatkan. Pimpinannya didatangi Calhaj sampai di rumahnya. Mereka sangat kesal karena pada 2010 gagal berangkat ke tanah suci dengan alasan tidak jelas, pada 2011 ini gagal lagi dengan dalih Kementerian Agama tidak memasukkan 38 Calhaj ini dalam daftar yang akan berangkat. Setelah kembali gagal berangkat ke tanah suci tahun ini, lagi-lagi, Calhaj kembali dijanjikan diberangkatkan pada 2012. Namun, sebagian Calhaj tampak sudah bertekad bulat menuntut agar uang yang disetor segera dikem-balikan. Mereka mengurungkan niat menunaikan ibadah haji tahun ini dan menyatakan sudah tidak percaya dengan janji-janji manis seperti itu. Sebe-narnya, kenapa ini bisa terjadi, adakah mereka memang hanya jamaah haji non-kuota? Soalnya, tahun lalu, 120 jamaah haji khusus asal Madina, Padangsidimpuan, Medan, Aceh dan Batam dikabarkan “terlantar”. Walaupun saat itu semua jamaah haji dari seluruh dunia sudah berada di tanah suci, tapi mereka masih berada di tanah air tanpa tahu kapan berangkat. Padahal sudah menyetor Rp70 juta. Alhasil, bersama anggota keluarganya, mereka ramai-ramai mendatangi sebuah travel penyelenggara Ibadah Haji Khusus ini. Untuk membahas seputar pelaksanaan haji khusus, berikut wawancara Irham Hagabean Nasution (IHN) dengan Kepala Kantor Wilayah Kementerian Agama Provinsi Sumatera Utara Drs H Abd Rahim, M.Hum (AR) didampingi Kepala Bidang Haji Zakat dan Wakaf Kanwil Kementerian Agama Sumut Drs H Abd Rahman Harahap, MA di Medan, Selasa (8/11).

IHN: Penyelenggaraan ibadah haji khusus, atau yang dulu disebut haji ONH Plus,sepertinya terus bermasalah. Sebenarnya, berapa sih Penyelenggara Ibadah Haji Khusus (PIHK) yang legal di Medan? AR: Di Medan yang legal hanya empat. Ya, hanya empat. Yakni, PT Azizi Kencana Wisata, PT Erni Tour, PT Gelora Indah Lestari dan PT Namira. Sebagian lainnya adalah agen yang bekerjasama dengan perusahaan yang ada di Jakarta. Terus terang, kadang-kadang ada yang “bermain”. Inilah yang mau kita tertibkan. Kementerian Agama Pusat akan menertibkan yang berpraktik seperti PIHK, tapi kenyataannya tidak punya izin. Sudah ada rencana Kemen-terian Agama untuk menertibkan ini. Di antara yang empat ini, PT Azizi KencanaWisata, juga pernah bermasa-lah yang sampai sekarang tidak tuntas. Tahun 2010 PT Azizi memberangkatkan jamaah calon haji non-kuota. Seharus-nya, memberangkatkan jamaah haji sesuai ketentuan dari Kementerian Agama. Antara lain mendaftarkan jamaah di Kementerian Agama Pusat, dan setiap calon jamaah memiliki nomor porsi. Kenyataannya, PT Azizi memberangkatkan lebih 100 jamaah non-kuota. KBIH Humairah sudah dicabut izinnya. Tapi izin PT Azizi kan di Kementerian Agama Pusat, tapi walaupun begitu ini terus kita tindaklanjuti. Yang mau kita tertibkan antara lain KBIH yang menangani Penyelenggaraan Ibadah

Haji Khusus. Ini tak boleh. IHN: Padahal, haji non-kuota kenyataannya justru sering bermasalah. AR: Benar. Haji non-kuota tidak ada kepastian di bidang apapun. Tidak jelas keberangkatannya. Hanya nasib-nasiban. Kebetulan dapat visa, berangkat ke sana nasib-nasiban. Tentu saja ini sangat rentan mengundang masalah yang pada akhirnya menyengsarakan jamaah. IHN: Secara teknis, apa sebenarnya perbedaan mendasar antara haji regular dengan haji khusus? AR: Kalau haji regular, biayanya 3.327 dolar AS, setoran awal Rp25 juta dan difasilitasi pemerintah. Sedangkan haji khusus, setoran awalnya 4.000 dolar AS, totalnya rata-rata 7.000 dolar, walaupun ini masih tergantung kualitas hotel yang disiapkan Penyelenggara Ibadah Haji Khusus yang merupakan perusahaan swasta itu. Tapi, biasanya setoran totalnya untuk haji khusus 7.000 dolar AS. Sedangkan PIHK menyelenggarakan ibadah haji yang sifatnya khusus, karena pelayanannya bersifat khusus antara lain memberikan akomodasi hotel minimal bintang empat di Jeddah, Makkah dan Madinah. Kemudian jarak penginapan dari Masjidilharam dan Masjid Nabawi maksimal 500 meter dan menyediakan catering. Menggunakan penerbangan langsung ke Arab Saudi. Setiap 45 jamaah dibimbing satu

Kita ingatkan, kalau ada jamaah non kuota yang gagal berangkat haji, jangan menyalahkan Kementerian Agama atau Menteri Agama.

pembimbing. Setiap 100 jamaah harus ada petugas medis. Sedangkan haji regular maksimal penginapan 2.500 meter dari Masjidilharam. Sedangkan waktu pelaksanaan ibadah, yang regular 41 hari, sedangkan haji khusus 25 hari. Kuota haji untuk haji khusus tahun ini 70.000, sedangkan yang regular 221.000. IHN: Intinya harus ada nomor porsi. AR: Sekarang ini, kan, banyak sekali agen. Karena sekarang belum ditertibkan, kepada masyarakat diingatkan, agar saat pendaftaran haji khusus ini harus ditanya nomor porsinya. Setiap jamaah haji yang mendaftar ibadah haji khusus, dia terlebih dahulu memilih PIHK-nya, biro penyelenggara ibadah haji khusus. Dan biro inilah yang mendaftarkan jamaah tersebut ke Jakarta dengan surat kuasa. Pendaftaran tidak langsung dilakukan jamaah. Makanya, supaya ada kepastian, masyarakat harus mempertanyakan nomor porsi kepada PIHK. Dan harus dipastikan apakah didaftarkan di Kementerian Agama. Kalau sudah ada nomor porsi berarti sudah ditangani pemerintah. Tanpa ada nomor porsi, berarti itu adalah liar alias non-kuota. IHN: Ketika “diuber” calon haji, seorang yang mengaku penyelenggara ibadah haji khusus berdalih, kegagalan jamaah berangkat tahun ini karena nama Calhaj tidak dimasukkan Kementerian Agama dalam daftar Calhaj yang akan berangkat. Apakah benar begitu? AR: Kita ingatkan, jangan menyalahkan Kementerian Agama atau Menteri Agama. Persoalannya, kenapa dijanjikan kepada jamaah akan berangkat tahun ini tanpa dasar yang jelas. Menteri Agama memprioritaskan jamaah haji regular, itu logis. Karena mereka sudah sangat lama menunggu. Bisa saja dia berpikir, kuota untuk ibadah haji khusus tahun ini seperti tahun lalu, 7.000. Mungkin diperkirakannya, kalau 7.000 otomatis masuk. Ternyata, kuota ini kan hak Menteri Agama. Ternyata terbalik, 7.000 untuk regular dan 3.000 untuk ibadah haji khusus. Dan ini wajar, karena calon haji regular rata-rata sudah menunggu 7-8 tahun. Sedangkan mereka yang tergabung dalam haji khusus baru dua tahun menunggu. Sebelum-sebelumnya memang 7.000 untuk ibadah haji khusus dan 3.000 untuk regular. Sekarang dibalik Menteri Agama. Sekali lagi, ini logis. Mereka mungkin menjanjikan akan berangkat tahun ini karena diperhitungkan kuota 7.000. Ternyata hanya 3.000. Demo pun muncul di Jakarta. Jamaah menuntut janji itu, makanya terjadi keributan. Dan “keributan” ini tidak hanya

di Sumatera Utara, hampir di seluruh provinsi di Indonesia. IHN: Kalau begitu, masyarakat harus ekstra hati-hati, apalagi belum ada tindakan nyata dari pemerintah untuk menertibkan ini. AR: Sekali lagi, kita ingatkan kepada masyarakat agar hati-hati, jangan melalui calo, yang tentu saja biayanya pasti lebih besar. Akan banyak tambahan biaya yang tidak jelas. Ini yang perlu jadi perhatian. Jadi harus yang resmi, yang resmi ini pun harus dilihat apakah masih bermasalah atau tidak. Yang terpenting, harus ada nomor porsi. Jika ada nomor porsi, itu jelas sudah ditangani pemerintah. Saya sudah panggil pengelolanya dan sejumlah jamaah calon haji khusus yang gagal berangkat, ternyata kesalahan pihak penyelenggara menganggap tahun ini Menteri Agama mengalokasikan 7.000. Jamaah dan keluarganya pun menuntut karena sebagian jamaah sudah diberangkatkan. Ternyata sebagian masih bersabar untuk menunggu dan Insya Allah berangkat pada 2012, sebagian lagi mengurungkan niatnya dan mencairkan uangnya di Jakarta. Ada 25 orang menunggu berangkat pada 2012. Saya sudah lihat mereka memiliki nomor porsi. Sedang-kan 13 orang lagi membatalkan untuk berangkat haji dari biro itu dan mencair-kan uangnya di Jakarta. IHN: Soal kewenangan pengelolaan jamaah haji khusus, apa nggak sebaiknya diserahkan ke provinsi? Ini, untuk efektifitas dan efisiensi. AR: Sebenarnya, wacana seperti itu sudah muncul beberapa waktu lalu. Dan sekarang saya dengar sedang dimatangkan. Kalau kewenangan ini sudah diserahkan ke provinsi, pendaftaran jamaah haji khusus akan dilakukan di Kanwil, sedangkan yang regular tetap di Kantor Kementerian Agama kabupaten/kota. Tentu saja ini akan memudahkan jamaah. Kalau izin Penyelenggara Ibadah Haji Khusus kita yang keluarkan, pengawasan pun bisa kita lakukan lebih maksimal. Kalau kewenangan ini diserahkan ke provinsi, akan memudahkan jamaah haji khusus, karena bisa langsung mendaftarkan diri di Kanwil. Tidak lagi dari agen ke agen, kemudian baru ke Penyelenggara Ibadah Haji Khusus di Jakarta. Itu akan membuat biaya sangat mahal. Kasihan kita kepada jamaah. Kepada Penyelenggara Ibadah Haji Khusus kita ingatkan agar memberikan pelayanan yang betul-betul khusus dibandingkan dengan regular. Harus sesuai aturan. Memberikan pelayanan yang plus. Jangan “plus penderitaan”.

Energi Kejujuran Komunikasi Politik Oleh Hari Murti, S.Sos Faktor yang paling mendisenergikan komunikasi seorang pemimpin yang tidak faktual adalah kediaman rakyat di tengah pengetahuannya bahwa pemimpinnya telah tidak faktual.


engapa penting untuk bertindak jujur-jujur saja dalam politik? Karena ilmu politik sekalipun telah mengonfirmasikan bahwa salahsatuteoriterbentuknyanegarakarena memang telah menjadi ketetapan-Nya. Teori ini tidak populer karena ekses dari sekularisme yang muncul pada zaman pengembangan ilmu secara empiris di Abad Pertengahan. Sikap empirisme dan sekularisme ini dikritik habis-habisan oleh filsafat sendiri, yang menyatakan bahwa Tuhan itu gaib bukan karena ia abstrak, tetapi karena pancaindera manusia terlalu kecil untuk mampu menyentuhnya secara empiris. Jika ilmuwan terus berdebat tentang ekosistem kecil yang dikandung sejumput tanah misalnya, bagaimana mungkinbisa mendeskripsikan bagaimana tangan-Nya menciptakan sekian banyak negara ? Jawaban ilmiah Tuhanmembencikebohongan.Ironisnya, politik kita disesaki kebohongan dengantujuan yangdangkal.Secarailmiah politik sendiri, tujuan berpolitik adalah kekuasaan. Nyatanya politik praktis kita menunjukkan tujuan berpolitik sekadar jabatan. Tapi baiklah, setiap kita tentu saja percaya Tuhan. Namun di samping itu, kita juga membutuhkan jawaban ilmiah empiris tentang mengapa harus jujur dalamberpolitik.Marikitabahaspersoalan ini: Politik itu pasti dilakukan dengan komunikasi, baik verbal maupun nonverbal.Jadi,bisadidefinisikanbahwakejujuran dalam politik adalah mengomunikasikan fenomena yang telah, sedang, dan akan terjadi secara deskriptif tanpa harus menghilangkan variabel keterbatasan manusiawi dalam menciptakan perpolitikan yang baik. Namun, ketakutan akan kehilangan popularitas politis telah mendorong orang membuat kebaikan politik itu hanya dengan hanya sebatas kata-kata. Istilah yang kita gunakan adalah tidak fak-

tualatauberbohong, baik secara langsung, tidak langsung, sengaja, atau tidak. Maka, muncullah sosok“superman” yang pada akhirnya terlalu banyak mengecewakan. Mengapa mengecewakan? Karena ia terlalu bodoh tidak mengetahui bahwa yang bakal ia pimpin bukanlah malaikat. Ia terlalu malu untuk menjadi manusia biasa di depan manusia biasa. Terlalu bodoh dan terlalu malu itulah yang membuat ia berbohongtentangyang lalu, kini, dan yang mungkin akan terjadi kelak jika ia memimpin. Ilmu komunikasi punya jawabanscientifictentang mengapa harus deskriptif dalam berkomunikasi terutama yang berkaitan dengan hidup orang banyak. Begini: Komunikasi itu bisa menimbulkan efek positif apabila pesannya diantarkan oleh energi. Kejujuran adalah unsur utama komunikasi yang berenergi itu. Kadang, komunikasi yang tidak deskriptif dan tidak faktual itu tidak berenergi samasekali.Kadangjuga,komunikasiyang tidak faktual terlalu kecil untuk menampung energi yang menyertainya sehingga energi itu bisa liar memakan tuannya sendiri. Bahasa sehari-hari kita, termakan cakap sendiri. Selain itu, komunikasi yang tidak faktual di tengah jiwa yang sebenarnya memiliki dasar sifat jujur, seringkali tidak sinkron antara verbal dan nonverbalnya ketika berkomunikasi sehingga komunikasi itu tidak berenergi. Inilah yang coba untuk ditelanjangi oleh alat semacam lie

detector itu. Lie detector mungkin bisa diatasi dengan kewatakan memainkan peran seperti seorang auktor misalnya atau seorang polos yang tidak tahu ia telah tidakfaktual.Hanyasaja,keduahalinitidak akan bisa mengatasi ujian waktu, ruang, dan kolektifitas memori publik atas komunikasi seorang politisi. Nah, karena Anda adalah seorang manusia biasa, sebenarnya persoalannya bukan apakah Anda telah berbuat salah atau benar di masa lalu, kini, atau akan datangdalampolitik.Tetapi,seberapajauh Anda punya komitmen untuk memilih diksi yang pas atas entitas yang akan diceritakan. Entitas yang tidak didiksikan secara pas, jika tidak disengaja, maka disebut tidak faktual. Jika sengaja, itu disebut kebohongan. Namun, keduanya tetap saja bukan komunikasi yang berenergi. Di sisi rakyat Rakyat adalah komunikan politik, yaitu sasaran komunikasi politik. Ironis,komunikan cenderungmelihatdirinya penuh dosa di tengah cintanya akan kebaikan. Maka, segeralah mereka mencari sosok sempurna dan kemudian kecewa karena memasang standarkelasmalaikatpadamanusiayang menawarkan diri untuk jadi pemimpinnya. Kekecewaan itu karena ia meminta sesuatu yang terlalu sulit dipenuhi oleh manusia biasa. Jadi, sebenarnya persoalan komunikasi politik yang berenergi itu sederhana saja, sesederhana kenyataan hidup sehari-hari manusia yang penuh cacat dan cela yang kemudian disampaikan jika memang harus disampaikan. Masalah menjadi tidak sederhana ketika organ-organ komunikasi yang diberikan-Nya sengaja atau tidak digunakan untuk diksi yang tidak pas dengan kenyataan dalam berkomunikasi. Maka, jadilah manusia dengan komunikasi yang apa adanya karena

memang semua kita adalah manusia biasa. Risikonya Anda tidak popular kata Anda? Pertanyaan baliknya adalah pernahkan Anda rasakan dimensi seni yang muncul dalam sebuah talk show dimana ada seorang yang menjawab begitu polos atas prestasi yang diraihnya? Pertanyaan lainnya adalah apakah Anda tahu mengapa prestasi si polos itu terlihat begitu menonjol? Karena diksi yang digunakan untuk mendeskripsikan prestasi itu begitu sederhana,polos,dankadangndeso.Inilah yang harus dipahami dalam komunikasi politik kita, baik politisi maupun rakyat. Faktor yang paling mendisenergikan komunikasi seorang pemimpin yang tidak faktual adalah kediaman rakyat di tengah pengetahuannya bahwa pemimpinnya telah tidak faktual. Contoh, rakyat diam di tengah pengetahuannya bahwa uang negara banyak yang dirampok. Lalu, lihatlah apresiasi ketika Presiden SBY menggunakan diksi yang pas atas uang negara yang banyak dirampok itu. Artinya, rakyat merasa pemimpinnya mau menjadi penyambung lidah mereka yang telah kelu berteriak tentang perampokan uang negara. Selama ini, diksi Presiden SBY kurang menggambarkan keadaan secara pas atas kenyataan maraknya perampokan uang negara. Maka, mulai hari ini, sebaiknyalah kita apa adanya saja dalam berkomunikasi, siapapun Anda. Bahwa rakyat ini sehari-hari bergelut dengan kenyataan hidup yang kemudian mendewasakan mereka dalam menerima kenyataan kekurangan pemimpin-pemimpinnya. Sekali lagi, komunikasi yang berenergi adalah komunikasi yang jujur, yang hanya akan dilakukan oleh mereka yang siap dengan segala konsekwensi yang mungkin muncul dari kejujuran itu. Biarkan saja sebagian kalangan menganggap itu sebagai kesalahan komunikasi politik berorientasi citra popular. Jikarakyatsudahtahukarakterkomunikasi kita seperti itu, masalahnya sudah clearsejak saat itu. Untuk apa tidak faktual dalam komunikasi kalau kenyataanya banyak mereka yang faktual kemudian menjadi begitu fenomenal karena ia menunjukkansikapegaliter.Mengapaada oratorulung?Karenaiamemaparkanfakta begitu lancar, gamblang dan jernih. Penulis adalah Pemerhati Komunikasi Politik. Alumnus Sekolah Tinggi Ilmu Komunikasi “Pembangunan” Medan.

Ekonomi & Bisnis B8 Langgar Aturan, Izin Penerbit Kartu Kredit Bisa Dicabut JAKARTA (Waspada): Bank Indonesia (BI) akan mengeluarkan sanksi jika penerbit kartu kredit (KK) tidak menaati Peraturan Bank Indonesia (PBI) tentang Alat Pembayaran Menggunakan Kartu (APMK). Sanksi terberatnya adalah pencabutan izin penerbitan kartu kredit.

“Sanksinya memang tidak secara detail ada di PBI APMK. Namun, sanksinya bisa melarang atau meminta penerbit KK melakukan atau tidak melakukan sesuatu. Misalnya, penerbit KK tidak boleh tambah nasabah baru atau yang paling berat adalah dicabut izinnya,” ungkap Direktur Direktorat Sistem Pembayaran BI RonaldWaas di Gedung BI, Jakarta, Selasa (8/11). Lebih lanjut, Ronald menyatakan dalam PBI yang diharapkan keluar akhir bulan ini, tidak

ada denda dalam PBI tersebut. “Untuk PBI ini enggak ada sanksi denda. Saksi denda itu untuk yang pelanggaran yang bersifat pelaporan,” lanjutnya. Sebelumnya, BI pada tahun ini mengeluarkan PBI tentang APMK. Beberapa revisi aturan PBI ini, seperti usia pemegang kartu kredit yang di atas 21 tahun, penghasilan minimal Rp3 juta per bulan, batas bunga maksimal hanya tiga persen per bulan, serta plafonnya pemberian kredit maksimal sebesar

tiga kali penghasilan. Malam Hari BI merevisi aturan Peraturan Bank Indonesia (PBI) mengenai Alat Pembayaran Menggunakan Kartu (APMK) mengatur tata cara penagihan kartu kredit. Ke depan, penagihan kartu kredit tidak boleh dilakukan malam hari. “Tata cara penagihan kita atur, tidak boleh pemegang ditelefon terus menerus karena akan mengganggu. Mereka juga tidak boleh berbicara dengan selain pemegang kartu kredit,” ungkap Direktur Direktorat Sistem Pembayaran BI RonaldWaas di Gedung BI, Jakarta, (8/11). Menurut Ronald, di PBI yang diharapkan akan keluar akhir bulan ini, juga akan diatur bahwa waktu telefon tidak lebih dari jam delapan pagi sampai delapan malam, dan waktu ini berlaku di mana nasabah be-

rada. “Kita juga akan atur cara penghitungan bunganya itu tidak dihitung kapan tanggal transaksinya tetapi dihitung saat merchant mencatatkan transaksinya ke bank. Kecuali transaksi tunai,” lanjutnya. Bentuk pengetatan aturan BI lainnya, lanjut Ronald, adalah minimum payment tetap sebesar 10 persen dan tidak diperbolehkannya penerbit menghitung bunga berbunga. “Jadi seperti biaya charge, materai dan sebagainya tidak boleh ditambahkan terus menerus,” tambahnya. Selain itu, jika nasabah meminta, penerbit wajib memberikan summary transaksi jika nasabah meminta dan penghitungan bunga harus ditulis transparan agar nasabah tahu berapa besaran bunga harus dibayarkannya.(okz)

Emas Jadi Rp520.000 Per Gram MEDAN (Waspada): Terjadinya krisis Yunani berimbas pada kenaikan harga emas di Medan, Selasa (8/11). Saat ini harga emas London berada pada posisi Rp520.000 per gram. Salah satu pedagang emas di Pasar Peringgan Nura Tarigan mengakui kenaikan harga emas itu. Menurutnya, harga emas naik sejak seminggu yang lalu. “Iya, emas naik. Itu sudah seminggu

naiknya, emas London per gram Rp 520.000 kalau emas batangan dengan kadar 99,5 persen harganya Rp 509.000 per gram,” ungkapnya kepada Waspada. Menurut Nura, kenaikan itu disebabkan krisis diYunani, akibatnya berpengaruh pada penjualan emas di tokonya. Selama emas naik ia mengaku penjualan turun mencapai 60 persen sejak Sabtu lalu.

“Berpengaruh kepada penjualan, turunnya mencapai 60 persen. Orang pun nggak berani beli,” tuturnya. Awalnya harga emas batangan hanya Rp500.000 per gram sedangkan emas London Rp509.000 per gram. Nura memprediksi, emas tidak akan turun dalam waktu dekat mengingat kondisi perekonomian masih bergejolak.

WASPADA Rabu 9 November 2011

Sementara itu, salah satu pembeli Rani Farida Nasution, 28, mengungkapkan kenaikan harga emas sangat berpengaruh baginya. Mengingat saat ini dia akan melangsungkan pernikahan dan membutuhkan emas sebagai mahar nikah. “Ya, berpengaruh lah. Lagi pula saya kan mau nikah, jadi harus beli emas untuk mahar,” ungkapnya.(cag)

Medan Green And Clean

Waspada/Zainal Abidin

SEORANG nelayan sedang memperbaiki jaring ikan di antara ratusan kapal ikan di PPI Pusong-Lhokseumawe, Selasa (8/11). Sejak hari raya Idul Adha 1432 H, mereka tidak melakukan aktivitas di laut.

Nelayan Belum Melaut, Harga Ikan Bakal Naik LHOKSEUMAWE (Waspada): Ratusan nelayan sekitar Pusat Pendaratan Ikan (PPI) Pusong, Lhokseumawe belum melakukan aktivitas melaut sejak Idul Adha 1432 H. Akibat penyimpanan ikan di PPI yang baru dibangun itu belum bisa dimanfaatkan, harga ikan laut dalam beberapa hari ke depan terancam mahal. Ilyas, 32, nelayan Pusong kepada Waspada, Selasa (8/11), mengatakan kebiasaan nelayan Pusong tidak melaut sampai seminggu, sejak hari raya kurban. Tradisi itu, menurutnya, turun temurun. Kendati hari tasyrik hanya tiga hari setelah hari raya, namun nelayan baru melaut seminggu setelah hari raya. Selama tidak turun ke laut, para nelayan terlihat sibuk membenahi berbagai peralatan tangkapanikan.Merekamemperbaiki

jaring rusak dan me-nyiapkan beberapa kebutuhan lainnya. Sementara itu, Azhar,38, nelayan asal Meuraksa, Lhokseumawe menambahkan, nelayan yang menggunakan kapal kemungkinan lebih lama masa istirahat lebaran. Pasalnya, Idul Adha kali ini jatuh pada hari Minggu, sehingga selain menunggu hari tasyrik nelayan juga harusmenunggusampaisete-lah hari Jumat.“Setelah selesai menjalankan shalat Jumat, biasanya kamibaruberangkat,”ungkapdia. Syarkawi, 38, juga nelayan asal Pusong mengakui akibat masih banyak nelayan tidak melaut harga ikan dalam beberapa hari ke depan akan mahal. Seperti pengalaman sebelumnya, kebutuhan ikan beberapa hari setelah kurban akan meningkat. Dia menyebutkan, cold

storage (fasilitas peyimpan ikanred) yang dibangun dengan dana otonomi khusus (Otsus) Tahun 2010 di PPI Pusong belum bisa dimanfaatkan. Akibat fasilitas itu belum selesai, hasil tangkapan nelayan tidak bisa disimpan di sana. “Seandainya tempat penyimpan ikan sudah berfungsi, hasil tangkapan sebelumnya bisa dijual ketika nelayan tidak melaut seperti sekarang ini,” jelas dia. Hal yang sama juga terjadi di pantaiTimur dan Pantai Utara Aceh dimana ikan laut segar di kawasan itu langka. Di pasar hanya terlihat ikan yang distok pedagang sebelum lebaran dengan harga relatif mahal. Pantauan Waspada di Pasar Ikan Pantonlabu Kecamatan Tanah Jambo Aye, Aceh Utara, dan Pasar Ikan Lhoknibong, Pantee Bidari, Aceh Timur, Sela-

sa (8/11) siang, stok ikan basah sangat terbatas. Bahkan banyak lapak pedagang masih kosong karena mareka belum mendapat pasokan ikan dari para penggalas ikan atau mugee eungkoet. Di beberapa lapak pedagang, terlihat ikan tongkol dan dencis dengan warna mulai pucat. Meski tidak segar lagi, harganya masih cukup mahal. Untuk ikan tongkol rata-rata dijual Rp20.000 per kg. Sementara dencis, berkisar antara Rp16.000-18.000 per kg. Kondisi ini membuat konsumen lebih memilih membeli udang atau ikan tambak, terutama ikan bandeng. “Bandeng lebih segar dan harganya pun sepadan. Ukuran sedang cuma Rp18.000 per kg,” kata Abdul Rafar, 41, salah seorang konsumen di Pasar Ikan Pantonlabu, kemarin.(b15/b19)

Waspadai SMS Transfer Rekening

Ucapan selamat datang dari masyarakat kepada tim penilai MDGC

Dewan Juri Sulit Tentukan MDGC 2011

PADA hari pertama penjurian di delapan wilayah peserta Medan Green and Clean (MDGC) 2011 yang jatuh pada Selasa (8/11), tim juri sulit tentukan wilayah yang masuk nominasi. Hal ini mengingat masing-masing peserta menunjukkan keunggulan baik dari tanaman, maupun pengolahan sampah. Adapun tim dewan juri yang terdiri dari Unilever, Andri, Pemko Medan, Lies Setyowati, MT, Alex, Yayasan Bumi Hijau Lestari, Susandi, dan Harian Waspada, Hamzah, melakukan penilaian tentang kebersihan, penghijauan, pengolahan sampah, dan partisipasi masyarakat.

“Tentunya banyak yang harus diperhatikan para peserta yaitu tentang pemilahan sampah, kegiatan pemilahan sampah atau bak sampah, replikasi wilayah, alat pengolahan sampah, dan penjualan ke pengepul,” ujar Susandi dari BHL. Ini, lanjutnya, merupakan poin penting di dalam pemilahan karena hal tersebut merupakan berdampingan erat dengan masyarakat maupun lingkungan. Sementara ketika tim dewan juri melakukan kunjungan ke salah satu delapan peserta MdGC hanya dua daerah yang masuk nominasi karena mampu mengisi empat poin penting tersebut. Lurah Sei Kera Hilir 2, Nila Juwita menyatakan memberikan yang terbaik apalagi lingkungan 4 merupakan salah satu daerah maju yang diikutkan dalam kompetisi ini. “Karena masyarakat di daerah lingkungan empat ini beragam pekerjaan, kita mengikutu selera mereka dengan membudidayakan

tanaman merambat seperti markisah, dan sirih,” ujarnya. Fasilitator, Nurjannah didampingi Erlina, 42, salah seorang warga menyatakan warga yang berada di Gg. Amat sekitar 50 kk dimana kendala yang dihadapi adalah warga pendatang yang tidak menetap di lokasi. “Terkadang mereka belum menerima kegiatan warga, dan membuang sampah sembarangan. Hal inilah yang harus kita rubah mindset mereka,” ujarnya. Sedangkan Lurah

Sukaramai I, Derliana menyatakan dukungan dari warga lingkungan 17 sangat baik sehingga meski masuk dalam kategori wilayah berkembang namun mereka tetap solid. “Kedepan lingkungan ini terus diupayakan daerah contoh bagi lingkungan lainnya yang ada di daerah Sukaramai,” ujarnya. Dengan seringnya pertemuan antar warga, lanjutnya, berbagai kekurangan terus dibenahi sedikit demi sedikit.(m38)

Sistem bank sampah yang berjalan baik, menjadi penilaian tim juri MDGC

MEDAN (Waspada): Direktur Lembaga Advokasi dan Perlindungan Konsumen (LAPK) Farid Wajdi meminta kepada masyarakat untuk mewaspadai penipuan berkedok SMS transfer rekening yang belakangan ini mulai marak terjadi. “Setelah SMS minta kirim pulsa, kini mulai marak sms transfer uang ke sejumlah rekening tertentu. SMS ini model sebenarnya telah mulai beredar sejak menjelang Lebaran 2011 lalu dan jauh sebelum heboh content provider sedot pulsa terjadi,” kata Farid Wajdi, kemarin. Farid menyebutkan, SMS minta kirim transfer ke pemilik nomor telepon, misalnya berbunyi: “Tolong uangnya dikirim aja ke BRI Rek: 5045-01-00011850-5 a/n. Nasruddin. SMS aja kalau sudah dikirim, trims.” SMS itu terkirim dari nomor +628217875582, katanya. “Seringkali SMS serupa dari nomor yang berbeda juga bernada sama dan minta ditransfer uang ke nomor rekening BNI, BCA atau bank lainnya. Bagi siapapun yang mendapat SMS seperti itu sebaiknya waspada dan lebih hati-hati. Tindakan itu perlu dilakukan guna melindungi diri sendiri, karena kasus sedot pulsa sampai kini juga belum tuntas,” kata dekan Fakultas Hukum UMSU ini. Dia mengingatkan, tren penipuan lewat pesan singkat (sms) sedang marak saat ini, kalau tidak hati-hati, siapapun bisa menjadi korban. Meski nilainya tidak sebe-

rapa, tapi tetap saja kesal kalau sempat menjadi korban. Modus penipuan adalah bisa saja dengan cara mengirim sms ke calon korban. Isinya, ada undian berhadiah, ikut seminar, meminta agar segera dilakukan transfer pulsa ke nomor telefon atau uang ke nomor rekening pengirim. Si pengirim, menyaru sebagai orang yang begitu dekat atau rekan bisnis dengan calon korban. “Terkait dengan maraknya penipuan dengan modus pesan singkat (SMS) dan mengandung unsur penipuan beredar luas di tengah masyarakat, tapi provider tetap minim edukasi,” ujarnya. Masalahnya di beberapa tempat meskipun telah ada korban dan melaporkan mengalami kerugian akibat peredaran SMS penipuan semacam ‘undian berhadiah, mama minta pulsa, atau transfer uang’, tapi operator tidak ada melakukan antisipasi. Fasilitas operator telah dimanfaatkan untuk melakukan kejahatan, seharusnya ada seleksi. Jika satu sms dikirim ke banyak orang, pasti itu ada sesuatu. Untuk mengantipasi korban akibat sms tipuan, harusnya ada antisipasi berupa edukasi menyangkut potensi kerugian pelanggan. Misalnya dengan cara memberi informasi sugestif, bahwa SMS itu tidak benar dan harus diabaikan. Selama ini provider terkesan ‘menikmati tipuan’ itu, karena makin banyak rangkaian SMS berantai. Tentu mereka dapat

Konsumsi Rumah Tangga Dongkrak Ekonomi Sumut MEDAN (Waspada): Pertumbuhan ekonomi triwulan III 2011 bila dibandingkan triwulan III 2010 (year on year), sebagian besar bersumber dari komponen konsumsi rumah tangga 3,85 persen, diikuti pembentukan modal tetap bruto 1,30 persen, ekspor barang dan jasa neto 1,20 persen (ekspor barang dan jasa 7,85 persen dan impor barang dan jasa 6,65 persen), konsumsi pemerintah 0,32 persen, perubahan stok 0,08 persen, dan konsumsi lembaga nirlaba 0,01 persen. Kepala Badan Pusat Statistik (BPS) Sumut Suharno, kemarin menyebutkan pada triwulan III

2011 bila dibandingkan dengan triwulan yang sama 2010 (year on year), komponen ekspor barang dan jasa merupakan komponen pengeluaran yang menempati urutan pertama dengan laju pertumbuhan mencapai 16,43 persen, disusul oleh komponen impor barang dan jasa 16,13 persen, perubahan stok 12,49 persen, pembentukan modal tetap bruto 6,56 persen, konsumsi rumah tangga 6,15 persen, konsumsi pemerintah 3,28 persen, dan konsumsi lembaga nirlaba 1,70 persen. Dia menyebutkan, komponen konsumsi rumah tangga secara riil meningkat. (m41)

meraup untung lebih besar? Kalangan provider perlu meluruskan isu tersebut, melalui layanan sms juga. Kesan yang muncul provider ikut atau setidaknya membiarkan hasil jarahan sms. “Karena itu, perlu memperkuat kualitas pelayanan termasuk dengan mengefektifkan call center khusus jika ada pelanggan yang mengalami penipuan semacam itu. Mestinya, masing-masing provider itu responsif akan kejadian semacam ini. Apalagi banyak jalan mekanisme pelaporan pelanggan yang dapat ditempuhnya mungkin

dapatlewate-mail,facebook,twitter, atau call center, dan lain sebagainya,” ujar Wajdi. Memang potensi penipuan lewat teknologi handphone sangat besar. Karena itu, provider harus terus mengawasi dengan cermat kegiatannya. Setiap permasalahan, khususnya kejahatan yang menyangkut dunia teknologi komunikasi, harus disosialisasikan agar masyarakat jadi ikut awas. Sebab, keawasan (kewaspadaan) konsumen merupakan benteng terakhir untuk mencegah kasus malpraktik penggunaan teknologi.(m41)

BNI Ikut Meriahkan Idul Adha MEDAN (Waspada): BNI Kanwil Medan dalam rangka merayakan Idul Adha 1432 H menyelenggarakan acara spesial dengan pemotongan hewan kurban yang dilaksanakan di halaman kantor Jl. Pemuda No. 12 Medan Minggu (6/11). Program BNI Berbagi dalam rangka bakti sosial berupa pemotongan dan pendistribusian daging hewan kurban yang disampaikan kepada masyarakat yang berhak dan berada dilingkungan operasional BNI. Selain itu juga sekaligus dilaksanakan pemotongan hewan kurban dari para pegawai BNI se-kota Medan. Jumlah hewan kurban yang dipotong sebanyak tujuh lembu dan dua kambing. Sebelum dilakukan pemotongan hewan kurban diawali dengan acara seremonial yaitu kata sambutan dari manajemen BNI Kantor Wilayah Medan yang diwakili Fery Andajaya, Head of Comsumer & Retail, dilanjutkan dengan penyerahan hewan kurban dari manajemen kepada panitia Helfi Lubis. Mengenai BNI BNI merupakan salah satu bank terbesar di Indonesia, memiliki 1.343 cabang dan sentra kredit yang tersebar di seluruh Indonesia, dan 5 cabang luar negeri (Singapura, Hong Kong, Tokyo, New York dan London), serta perwakilan di beberapa negara di Timur Tengah dan Asia Tenggara. Untuk jaringan elektronik, BNI memiliki 5.842 ATM ditambah 16.000 ATM link dan 24.000 ATM bersama, serta fasilitas phonebanking 24 jam BNI Call di 021-500046 atau 68888 (via ponsel), serta SMS Banking dan BNI Internet banking untuk kebutuhan transaksi perbankan dengan ratusan fitur transaksi.(rel)


PROGRAM berbagi BNI dengan masyarakat sekitar ikut memeriahkan Idul Adha.


WASPADA Rabu 9 November 2011


Pembentukan Pengadilan Ad Hoc Di Papua Belum Perlu JAKARTA (Waspada): Wakil Ketua DPR RI yang juga mengetuai Tim Pemantau Otonomi Khusus (Otsus) Papua dan Aceh Priyo Budi Santoso mengatakan, pembentukan Pengadilan Ad Hoc atas dugaan pelanggaran Hak Azazi Manusia (HAM) berat, yang dilakukan aparat, dalam penangan konflik di Papua dianggap belum perlu. “ Pendirian Pengadilan HAM berat untuk aparat yang terlibat penyerangan terhadap warga pada Kongres Rakyat Papua (KRP) III, tidaklah tepat. Masalah ini sebaiknya disele-saikan berdasarkan hukum yang berlaku. “Itu bukan solusi terbaik untuk menyelesaikan konflik di Papua. Walaupun Komas HAM sudah mengumumkan adanya indikasi pelanggaran HAM,” ujar Priyo di Gedung DPR RI, Jakarta, Selasa (8/11). Menurut dia, Pengadilan HAM berat cenderung memojokkan aparat. Sebab, KRP III yang mendeklarasikan Negara Papua Barat juga sangat keterlaluan. Bahkan, dalam kasus lanjutan di Papua, polisi juga menjadi korban serangan. Meski demikian, DPR, kata Priyo, meminta agar polisi segera menuntaskan penyeledikan atas dugaan pelanggaran HAM berat yang dilaku-

kan aparat pada warga sipil Papua, sebagaimana tuduhan dari Komnas HAM. “Yang pasti kita tidak bisa menggunakan data sepihak dari Komnas HAM saja untuk mengusut dan mengungkap kasus-kasus konflik di Papua, yang seringkali mereka tuding aparat langgar HAM berat di sana. Jadi, simpatinya harus adil,” tegas Priyo. Pada sisi lain Priyo, mengatakan rapat antara anggota tim Otsus dengan pemerintah, akan segera digelar, setelah masa reses minggu depan. “Pada hari pertama kerja, kami akan rapat darurat dengan mengundang wakil pemerintah untuk khusus membicarakan tentang Papua,” ujarnya. Soal Freeport, pemerintah dan DPR, menurutnya sedang dipikirkan opsi-opsi yang mungkin diambil. Diantaranya adalah menghentikan kontrak Freeport Indonesia, melakukan renegosiasi dan perpanjangan kontrak, atau metode alternatif agar perusahaan tambang itu lebih memperhatikan Papua. Priyo juga menyerukan agar perusahaanperusahaan besar yang beroperasi di Papua agar tak mengadu domba aparat TNI/Polri, yang bertugas seba-gai satuan pengamanan, dengan masyarakat lokal. (aya)

Polri Dalami Surat Palsu MK JAKARTA (Waspada): Mabes Polri terus mendalami kasus surat palsu Mahkamah Konstitusi (MK) yang menyeret Ketua DPP Partai Demokrat Andi Nurpati yang merupakan mantan komisioner KPU Pusat dan kini melompat ke partai besutan Presiden SBY. “Sampai kini Polri belum menetapkan tersangka lainnya dalam kasus yang dilakukan secara berkelompok, yakni pembuat surat, penyuruh pembuatan surat, dan pengguna surat palsu tersebut. Masih kurang alat bukti untuk menjerat orang yang diduga menyuruh membuat surat dan pengguna surat tersebut,” kata Kabareskrim Polri Komjen Pol Sutarman di Mabes Polri, Senin (7/11). Menurut Sutarman, penyidik tengah mendalami alat bukti dan terbatasnya alat bukti membutt Polri sedikit kesulitan mengungkap kasus pemalsuan surat MK. “Ya alat bukti minimal harus dua, saksi kan berarti satu alat bukti, bukti lainnya kan surat palsu itu. Yang kita sedang dalami itu,” kata Sutarman.

Namun demikian lanjut mantan Kapolda Metro Jaya itu, penyidik telah menemukan pembeda antara surat MK yang palsu dengan yang asli. “Bahkan hasil penyidikan telah mengungkap Andi Nurpati menggunakan surat palsu MK tersebut,” kata ungkap Sutarman. Namun yang menjadi kesulitan penyidikan adalah apakah surat palsu MK itu digunakan dengan sadar oleh Nurpati atau tidak.”Kita harus mengetahui bahwa dia sadar, bahwa yang distempel dan ditandatangani adalah yang palsu. Itu yang kita membuktikan ke sana, itu yang kita masih ragukan penyidiknya,” kata Sutarman. Dikatakan Sutarman, penyidikan kasus ini akan mengungkap sampai pada tataran pengguna dan penyuruh pembuatan surat palsu ini. “Kita tetap mencari hubungan antara keteranganketerangan yang satunya, mengarahkan bahwa dia sadar bahwa surat itu adalah palsu. Kalau itu dengan sadar bahwa itu yakin surat palsu yang dipakai, nah itu berarti yang kena. Jadi alat bukti cukup,” ucap jenderal bintang tiga itu. (j02)

JAKARTA (Waspada): Mabes Polri terus meningkatkan upaya komunikasi dan pencarian melalui interpol memburu buronan Komisi Pemberantasan Korupsi (KPK) istri tersangka Muhammad Nazaruddin, Neneng Sri Wahyuni. “Misi kita adalah terus menjaga dan meningkatkan komunikasi dengan negara-negara, ya melalui jaringan Interpol. Hanya dengan kerja sama ini kita berharap akan ada hasil yang baik,” kata Kabid Penum Polri Kombes pol Boy Rafli Amar, di Mabes Polri, Jakarta, Senin (7/11). Keberadaan tersangka kasus korupsi di Kementerian Tenaga Kerja dan Transmigrasi ini belum bisa diketahui, padahal Neneng sempat tertangkap bersama suaminya, Muhammad Nazarudin di Kolombia, namun dibebaskan

dengan alasan hanya Nazaruddin yang menjadi buronan Interpol. Neneng adalah tersangka kasus dugaan korupsi pengadaan dan pengawasan pemasangan PLTS di Kemenakertrans untuk beberapa daerah di Indonesia. Dalam kasus ini, pejabat Kemenakertrans, Timas Ginting yang saat pengadaan menjabat sebagai pejabat Pembuat Komitmen (PPK) sudah menjalani proses persidangan di Pengadilan Tipikor. Seperti diungkap dalam surat dakwaan Timas sebelumnya, proyek itu telah membuat Nazaruddin dan istrinya, Neneng meraup keuntungan Rp2,7 miliar dari proyek senilai Rp8,9 miliar tersebut. (j02)


TERIMA MENTERI SAUDI: Presiden Susilo Bambang Yudhoyono menerima kunjungan kehormatan Menteri Perburuhan Kerajaan Arab Saudi Adel bin Muhammad Faqieh (kedua kiri) dan Duta Besar Arab Saudi Abdulrahman Muhammed Amen al-Khayyat (kiri) di Kantor Kepresidenan, Jakarta, Selasa (8/11). Kunjungan tersebut dalam rangka meningkatkan hubungan kerjasama kedua negara.

Mantan Bupati Nias Selatan Diancam Lima Tahun Penjara Polri Tingkatkan Pencarian Neneng JAK ARTA ( Waspada): Mantan Bupati Nias Selatan (Nisel) Fahuwusa Laia diancam 5 tahun hukuman penjara dalam dugaan kasus suap kepada anggota Komisi Pemilihan Umum (KPU) Saut Hamonangan Sirait sebesar Rp99,9 juta. Jaksa Penuntut Umum (JPU) Komisi Pemberantasan

Korupsi (KPK) I KadekWiradana mengatakan, terdakwa menjanjikan sesuatu yaitu memberikan uang sejumlah Rp99,9 juta kepada Saut Hamonangan Sirait yang menjabat sebagai anggota KPU masa jabatan 2007-2012. “Dengan maksud supaya pegawai negeri atau penyelenggara negara tersebut berbuat atau tidak berbuat sesuatu da-

kanlah hal yang mustahil jika bangsa ini menjadi bangsa yang besar karena bangsa ini menjadi semakin bertakwa dan memiliki kepekaan social yang tinggi,” ujar Irman Gusman di Masjid As Salam di Kawasan Bintaro, Jakarta di sela-sela pemotongan hewan kurban Idul Adha (6/11). Peristiwa kurban yang dilakukan oleh Ibrahim bisa dimaknai juga sebagai pesan simbolik agama, yang menunjukkan ketakwaan, keikhlasan, dan kepasrahan seorang hamba Allah pada sang pencipta. Pesan dan makna keteladanan Nabi Ibrahim AS dalam menjalankan perintah Allah yang Maha Kuasa, menurutnya harus bisa ditransformasikan bangsa ini kedalam aksi-aksi nyata dalam menjalankan kehidupan yang lebih baik.Berbagai persoalan bangsa ini menurutnya dapat diatasi jika makna kurban benar-benar terpatri dalam sanubari bangsa ini. “Salah satu makna dalam berkurban itu adalah merelakan apa yang kita cintai demi menjalankan perintah Allah. Jangankan harta, nyawa anak yang dicintainya melebihi dirinya sendiri pun dikorbankan demi kecintaannya pada Allah. Apakah kita tidak mau mencontoh Nabi Ibrahim? Jika tidak dengan nyawa kita paling tidak dengan harta kita atau tenaga kita membangun bangsa ini bersama,” tegasnya. (aya)

Pekerja Diminta Awasi Migrasi JPK JAKARTA ( Waspada): KetuaUmum Konfederasi Serikat Pekerja Seluruh Indonesia (K-SPSI) Sjukur Sarto meminta kalangan pekerja untuk mengawasi proses perpindahan (migrasi) pelaksanaan program jaminan pemeliharaan kesehatan (JPK) dari PT Jamsostek (Persero) ke badan penyelenggara jaminan sosial (BPJS) kesehatan. Permintaan untuk mengawasi pelaksanaan migrasi itu karena dikhawatirkan kualitas pelayanan program JPK itu nantinya akan menurun sehingga menimbulkan kerugian kepada pekerja. “Kami khawatir kualitas pelayanan JPK kepada pekerja akan disetarakan dengan masyarakat miskin dan tidak mampu. Jika ini terjadi maka akan menimbulkan kerugian kepada pekerja. Padahal pekerja membayar iuran untuk mendapatkan pelayanan jaminan sosial. Berbeda dengan masyarakat miskin dan tidak mampu yang iuran kepesertaannya akan ditanggung oleh pemerintah. Oleh karena itu, pelaksanaan

migrasi ini harus diawasi,” kata Sjukur Sarto di Jakarta, kemarin. Seperti diketahui, DPR dan pemerintah mengesahkan UU BPJS yang memuat sejumlah ketentuan. Di antaranya ditetapkannya adanya 4 badan usaha milik Negara (BUMN) penyelenggara jaminan sosial yang ada menjadi 4 BPJS. PT Askes menjadi BPJS Kesehatan dan PT Jamsostek menjadi BPJS Tenagakerja. Sementara PT Taspen dan PT Asabri akan menjadi BPJS yang akan ditentukan selanjutnya. Dengan ini maka program jaminan pemeliharaan kesehatan (JPK) yang diselenggarakan PT Jamsostek untuk kalangan pekerja dipindahkan ke BPJS kesehatan. Sjukur mengatakan, pekerja merasa perlu mewaspadai janji pelayanan kesehatan maksimal dan seumur hidup bagi pekerja melalui BPJS kesehatan. Apalagi kalangan pekerja bisa menjadi masyarakat penerima bantuan iuran dari pemerintah setelah 6 bulan menganggur setelah mendapat pemutusan hubungan kerja (PHK) dari tempatnya bekerja. (j04)

Kemenakertrans Cabut Izin 28 PPTKIS JAKARTA (Waspada): Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar mengatakan dalam dua tahun terakhir pihaknya mencabut izin operasi terhadap 28 Perusahaan Penempatan Tenaga Kerja Indonesia Swasta (PPTKIS) yang dianggap telah melakukan pelanggaran berat. Selain itu juga Kemenakertrans tengah melakukan penilaian dan pemetaan terhadap seluruh PPTKIS di Indonesia yang total jumlah mencapai 565 PPTKIS oleh tim independen. “Evaluasi, pemetaan dan pencabutan izin ini merupakan komitmen pemerintah untuk

melakukan pembenahan sistem perlindungan dan penempatan TKI ke luar negeri, khususnya di sektor pembinaan dan peningkatan kinerja PPTKIS,” kata Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar dalam keterangan persnya di Jakarta, Minggu (6/11). Muhaimin mengatakan Kemenakertrans sudah menyelesaikan verifikasi dan evaluasi terhadap 387 PPTKIS dan masih menunggu hasil pemetaan terhadap 565 PPTKIS yang tengah dilakukan lembaga independen yang dijadwalkan dapat diselesaikan dalam beberapa minggu ke depan. (j04)

dan menganulir Keputusan Komisi Pemilihan Umum Daerah (KPUD) Provinsi Sumut terkait pemecatan empat anggotaa KPUD Kab. Nias Selatan yang lama agar diangkat kembali. Akibat tindakan dan perbuatan penyuapan tersebut terdakwa dijerat Pasal 5 ayat 1 b dan atau Pasal 13 UU Pemberantasan Tindak Pidana Korupsi dengan hukuman lima tahun

penjara dan denda Rp250 juta. Sidang lanjutan akan digelar pada Senin (14/11) mendatang dengan agenda pembacaan replik keberatan dari kuasa hukum Fahuwusa Laia. Usai sidang perdana, terdakwa Fahuwusa kembali dibawa ke LP Cipinang, Jakarta, tempat dia ditahan selama proses penyidikan dan proses sidang. (j02)

Rektor UI Dikecam Dosen Dan Civitas Akademika

Idul Adha Harus Dimaknai Secara Luas JAKARTA (Waspada): Ketua DPD RI Irman Gusman mengatakan Hari Raya Idul Adha hendaknya dimaknai secara luas. Idul Adha memiliki dua makna utama yaitu kesalehan ritual dan kesalehan sosial. Kesalehan ritual berarti dengan berkurban, kita telah melaksanakan perintah Tuhan yang bersifat transedental. Kurban dikatakan sebagai kesalehan sosial karena selain sebagai ritual keagamaan, kurban juga mempunyai dimensi kemanusiaan. Makna yang terkandung pada perayaan hari kurban ini menurutnya memiliki banyak aspek yang bisa diterapkan dalam kehidupan berbangsa dan bernegara sehingga bisa tercipta bangsa dan negara yang bukan hanya bertakwa pada sang khalik, namun menjadi bangsa yang memiliki kepekaan sosial serta menjadi bangsa yang besar. “Pengorbanan Nabi Ibrahim AS untuk menyembelih putra semata wayangnya yang sangat dicintainya, Ismail atas wahyu yang disampaikan oleh Allah, yang kemudian oleh Allah SWT digantikan dengan hewan kurban harus bisa diteladani oleh bangsa ini dan diterapkan dalam kehidupan berbangsa dan bernegara. Jika pengorbanan itu bisa diteladani maka bu-

lam jabatannya yang bertentangan dengan kewajibannya,” kata Wiradana dalam sidang pembacaan dakwaan di Pengadilan Tipikor, Jakarta, Selasa (8/11). Terdakwa lanjut Wiradana, juga meminta Saut untuk mengesahkan kembali dirinya sebagai calon Bupati Nias Selatan periode 2011-2016 berpasangan dengan Rahmat Alyakin


KETUA Institut Solusi Indonesia (ISI) Muhammad Ikhyar Velayati Harahap tengah menyampaikan keterangan pers terkait hasil kajian ISI terbaru tentang kinerja Pemko Binjai di Medan, kemarin.

Kinerja Pemko Binjai Signifikan Dengan Catatan MEDAN (Waspada): Institut Solusi Indonesia (ISI) me-release kajian terbarunya tentang kinerja pemerintahan daerah, Selasa (8/11). Dalam kesimpulan kajian ISI, kinerja Pemko Binjai dalam status signifikan dengan catatan. ‘’Secara keseluruhan, kinerja yang diperlihatkan signifikasi khususnya pada orientasi pelayanan publik. Namun ada beberapa catatan dalam kinerja tersebut,’’ ujar Ketua ISI Muhammad Ikhyar Velayati Harahap kepada wartawan di Medan. Dia menjelaskan kajian ISI tentang pemerintah daerah dilakukan di beberapa kabupaten/kota dengan dengan penilaian pada indikator kinerja yang berorientasi pada pelayanan publik serta tata laksana birokrasi. Dalam catatan ISI, faktor negatif dalam kinerja Pemko Binjai menyangkut pelayanan publik pada sektor pembangunan dan kependudukan. ‘’Kita menemukan bahwa pengurusan Izin Mendirikan Bangunan (IMB) dan pengurusan e-KTP masih buruk. Kalau IMB masih sulit, mahal dan berbelit-belit, pengurusan e-KTP belum menunjukkan pelayanan yang profesional sehingga prosesnya lambat,’’ katanya. Ikhyar juga menyoroti kinerja buruk SKPD yang tidak memiliki koordinasi yang efektif di antara sesama SKPD itu sendiri. ‘’Tidak terbangun team work antar SKPD sehingga terhambatnya pelayanan masyarakat. Masih sangat terasa adanya ego sektoral yang dominan,’’ tandasnya seraya memberikan contoh di Dinas Tarukim, PD. Pasar dan pada pelayanan satu atap. Sedangkan sektor yang memberikan sumbangan positif bagi penilaian kinerja Pemko Binjai antara lain dalam sektor pelayanan kesehatan. ‘’Orang miskin tidak sulit untuk berobat. Selain itu kita mendapati bahwa Jamkesmas dan Jamkesda mudah diakses. Kita mendapati adanya peningkatan intensitas kunjungan dokter kepada pasien,’’ paparnya. Pada sektor lain adalah menyangkut pemutasian jabatan di jajaran Pemko Binjai dan pada penerimaan siswa bari baik di tingkat SMP maupun SMA. ‘’Kita tidak menemukan indikasi adanya praktik KKN dalam kedua sektor tersebut,’’ katanya. Dari temuan tersebut, ISI merekomendasikan agar Wali Kota Binjai segera melakukan pembenahan di sektor-sektor yang dirasa kurang memiliki kinerja positif tersebut. ‘’Hal ini penting dilakukan untuk menjaga performasi Pemko Binjai agar semakin signifikan dalam derap pembangunan,’’ katanya. Ikhar menegaskan, pihaknya melakukan kajian secara berkala secara komprehensif terhadap kinerja pemerintah daerah. ‘’Kita melihat efektivitas pemerintah daerah pasca otonomi daerah cenderung semakin mengalami penurunan dalam kinerjanya dalam melayani masyarakat. Ini sangat bertentangan dengan semangat dan tujuan otonomi daerah itu. Karenanya kita merasa perlu melakukan evaluasi kinerja Pemda di berbagai daerah khususnya di Sumatera Utara ini,’’ katanya. (m07)

JAKARTA (Waspada): Rektor Universitas Indonesia Gumilar Somantri, Selasa (9/11), kembali dikecam sejumlah dosen dan civitas akademika yang tergabung dalam gerakan “Save UI” dalam diskusi dengan media massa. Diskusi ini juga menghadirkan beberapa profesor senior dan anggota Dewan Guru Besar UI, diantaranya Bachtiar Aly, Rhenald Kasali, Tamrin Tomagola dan Pratiwi Sudarmono. Dari beberapa kasus yang dibeberkan, salah satu yang disorot adalah mengenai penerimaan calon mahasiswa jalur undangan. Paparan “Save UI” yang disampaikan Dekan Fakultas Kedokteran (FK) UI Ratna Sitompul (foto) menyebutkan dirinya diserahkan daftar penerimaan calon mahasiswa FK sejumlah 116 nama. Namun, Ratna menyayangkan tindakan semena-mena oleh Gumilar itu karena dilakukan tanpa adanya konsultasi sama sekali dengan Ratna selaku dekan FK. “Dengan tiba-tiba saja saya

disodorkan 116 nama calon mahasiswa jalur undangan. Tapi saya sama sekali tidak tahu menahu asal usulnya mereka. Jadi saya diminta untuk memilih nama-nama yang saya sama sekali tidak tahu jejak rekamnya ataupun kualitasnya mereka. Sebagaidekan,sudahseharusnya saya dilibatkan,” tegas Ratna. Ratna menyayangkan ini karena dirinya merasa tidak bisa maksimal membimbing para mahasiswanya dari awal. “Bagaimana saya bisa maksimal bimbing mahasiswa saya kalau saya tidak mengenal profil mereka sebelumnya? Ini kan

tidak benar.” Pengakuan serupa disampaikan dosen Fakultas Ilmu Budaya (FIB) Riris Sarumpaet. Dengan nada tegas, Riris mempertanyakan integritas rektor Gumilar yang dinilai telah menyimpang. Riris juga merasa malu karena ulahnya rektor yang sengaja menurunkan kualitas mahasiswa di UI. “Saya malu. Di mana-mana, rektor kita selalu bicara soal peradaban.Tapi fakta yang kita lihat sekarang ini adalah dia (Gumilar, red) justru mengajarkan kita peradaban maling,’ kata Riris. Profesor filsafat ini mengaku, para mahasiswa UI menurun kualitasnya dengan adanya permainan ini. Dicontohkan, mahasiswa FIB tidak sesuai dengan standar kualitas yang diinginkan. “Murid-murid jalur undangan di FIB bodoh-bodoh. Saya kesal sekali, dan ini karena ulahnya rektor kita,” tegas Riris. Sementara itu, Rektor UI Gumilar Somantri tidak mengangkat ponsel ketika dihubungi Waspada, Selasa (8/11). (j01)

Antibiotik Berpotensi Membuat Anak Kebal Obat JAKARTA (Antara): Dokterdokter anak di AS menuliskan bahwa lebih dari 10 juta resep obat antibiotik yang tak perlu setiap tahun untuk penyakit seperti flu dan asma, berpotensi membuat anak kebal dari obat, ungkap hasil sebuah studi seperti dikutip Reuters, kemarin. Para peneliti meneliti sampel dari sekitar 65.000 pasien di bawah 18 tahun dari 2006 sampai 2008, yang temuannya kemudian disiarkan di jurnal Pediatrics. Secara keseluruhan, para dokter memberikan resep berisi satu antibiotik untuk setiap lima kunjungan, dan kebanyakan diperuntukkan bagi anak-anak dengan keluhan pernafasan seperti infeksi sinus dan pnemonia. Beberapa dari infeksi itu disebabkan oleh bakteri dari antibiotik. Tapi hampir seperempat dari resep antibiotik untuk anak-anak yang mengalami keluhan pernafasan, seharusnya tidak diberikan. Terutama penyakit bronkitis, flu, asma dan alergi. Itu sama dengan lebih dari

10 juta resep antibiotik setiap tahun yang telah diberikan namun malah membahayakan pasien, kata pemimpin penelitian Adam Hersh dari Universitas Utah di Salt Lake City, AS. “Satu alasan penggunaan berlebihan ini terjadi karena diagnosis sering tidak jelas, dan ini umum terjadi pada infeksi telinga. Keputusan untuk membuat resep sebuah antibiotik padahal sebenarnya tidak perlu, adalah demi keamanan semata,” katanya. Setengah dari resep antibiotik yang diberikan adalah obatobatan “dosis tinggi” untuk melawan rangkaian besar bakteri, namun itu malah membunuh lebih banyak bakteri baik di dalam tubuh dan membuat anak menghadapi infeksi lebih serius akibat bakteri buruk menjadi kebal terhadap antibiotik. “Antibiotik memang mujarab. Ada saatnya anda sungguh membutuhkannya, pertanyaannya menjadi lain manakala kapan kita mesti menelannya,” kata Betsy Foxman, epidemolog dari Fakultas Kesehatan Masyarakat, Universitas Michigan, yang

tidak terlibat dalam penelitian. Lebih lanjut disebutkannya, memberikan antibiotik kepada anak justru ketika mereka tak membutuhkannya akan meningkatkan risiko infeksi kekebalan terhadap antibiotik baik pada diri anak itu maupun masyarakat, ujarnya. “Kami pandang antibiotik secara keseluruhan memang sangat bermanfaat, tapi ada antibiotik yang tak terlalu spesifik, lalu menyerang apapun yang ada di tubuh anda. Dengan membuat hilang mikroba baik yang seharusnya ada dalam tubuh kita, maka kita menyebabkan tubuh kita sendiri menghadapi masalah kesehatan yang tidak kita ketahui.” Lalu bagaimana menghindari kelebihan resep? Hersh mengatakan, tunggulah beberapa hari lagi dan periksa terus kesehatan si anak. “Jika diagnosis masih belum jelas, tanyakan apakah akan aman menunggu sehari atau dua hari dengan pantauan terus menerus ketimbang memulainya dengan menggunakan antibiotik,” pungkasnya seperti dikutip Reuters.



Banjir Masih Mengancam Aceh Timur

11 Lembu Kurban Dari Aceh Sepakat Cabang I Medan MEDAN (Waspada) : 11 Ekor lembu dan 7 ekor kambing kurban keluarga besar Aceh Sepakat Cabang I Medan, disembelih di komplek Panti Asuhan Darul Aitam di Jalan Medan Area Selatan. Sementara lebih kurang 1.100 paket daging kurban dibagibagikan kepada kaum duafa dan kalangan masyarakat di sekitar Jln. Medan Area Selatan dan Amaliun, Senin (7/11). H Kamaruddin Harun, Ketua DPC Aceh Sepakat Cabang I Medan di sela-sela acara kurban menyatakan, sebagaimana biasa penyembelihan hewan kurban biasanya dilakukan hari kedua setiap Idul Adha, mengingat hari pertama warga Aceh sibuk acara kurban di tempat tinggal masing-masing. Bahkan H Daud Ibrahim Denai, koordinator panitia pelaksana kurban Aceh Sepakat Cabang I Medan menyatakan, dibanding kurban tahun 2010, pelaksanaan kurban 1432 H tahun 2011 meningkat yaitu 11 ekor lembu dan 7 kambing. “Ini semua rahmat dari para anak yatim Panti Asuhan Darul Aitam yang berada di di komplek meunasah Aceh Cabang I,” kata Daud Ibrahim Denai. Sementara para peserta kurban antara lain dari H Wahab Usman dari Kurnia Grup, H Ismail Ibrahim, Hj Nurhayati Hamzah, H Arbie Abdulgani, H Sabri Basyah, Masdani, Hj Suzana dan dari keluarga alm HZ Joely. (m32)

Idul Adha Menggugah Keikhlasan JANTHO (Waspada) : Hari Raya Idul Adha tidak saja dimaknai sebagai hari penyembelihan hewan, tapi juga harus dimaknai sebagai hari berbagi dengan sesama umat Islam. Khususnya umat muslim menjadikan Idul Adha sebagai momentum menggugah keikhlasan dan semakin mempererat rasa persatuan dan kesatuan serta tanggungjawab serta memperbaiki segala pola kehidupan. Demikian pesan Bupati Aceh Besar DR Tgk H Bukhari Daud, ketika menjadi khatib Idul Adha di Masjid Agung Al Munawwarah, Kota Jantho, Minggu (6/11). Ia menyatakan Idul Adha menjadi momentum untuk menggugah keikhlasan lebih peduli dan berbagi untuk mencapai keridhaan Allah SWT. Selain itu, Bukhari Daud yang juga Bupati Aceh Besar mengajak semua jamaah dan masyarakat Aceh Besar untuk senantiasa bersyukur kepada Allah SWT yang telah memberikan nikmat yang tak terhitung kepada kita semua. Ketua Panitia kurban Masjid Al Munawwarah, Kota Jantho, Ustad Zaini melaporkan jumlah hewan kurban yang terkumpul pada tahun ini sebanyak 16 ekor sapi, dan delapan ekor kambing. (b05)

PKS Aceh Besar Laksanakan Kurban BANDA ACEH (Waspada) : Dewan Pimpinan Daerah Partai Keadilan Sejahtera (DPD-PKS) Kabupaten Aceh Besar sukses melakukan penyembelihan dan pembagian hewan kurban di sejumlah lokasi di Kabupaten Aceh Besar, Senin (7/11). Untuk tahun ini, DPD PKS Aceh Besar menyembelih 6 ekor sapi dan 9 ekor kambing, yang dilaksanakan di Gampong Meunasah Krueng, Kecamatan Ingin Jaya sebanyak 6 ekor sapi dan 4 ekor kambing, serta di Pulo Aceh sebanyak 5 ekor kambing. Menurut Ketua Pelaksaana, Zulkarnaen Jafar, hewan kurban ini berasal dari donatur perorangan sebanyak 28 orang mendonor untuk 4 ekor sapi, 9 orang mendonor untuk kambing, dan 2 ekor sapi dari Muslim Hands Internasional. Dalam kesempatan itu juga hadir anggota Komisi X DPRRI, Ust. Raihan Iskandar yang meminta kepada kader PKS agar tetap konsisten dalam bekerja melayani masyarakat, peduli dan peka terhadap setiap permasalahan di daerahnya. (b04)

Korem 012 TU Bersihkan Makam Teuku Umar MEULABOH (Antara):Menyambut hari hari pahlawan pada tanggal 10 November 2011 Tentara Nasional Indonesia (TNI) di jajaran Korem 012 Teuku Umar mengadakan karya bhakti pembersihan makam pahlawan nasional Teuku Umar, di Aceh Barat. Komandan Korem 012 Teuku Umar Kolonel Inf Purnawan Widi Andaru, di Meulaboh, Selasa (8/11), mengatakan kegiatan karya bhakti di taman makam pahlawan nasional adalah merupakan suatu wujud kesadaran anggota TNI untuk mengenang jasa-jasa para pahlawan yang telah gugur. “Kegiatan demikian setiap tahun dilakukan prajurit TNI di seluruh Indonesia untuk mengenang jasa pahlawan, kalau untuk teritorial Korem 012 Teuku Umar kita mengadakan karya bhakti di makam pahlawan dan sejumlah tempat umum,” kata Danrem 012 TU.

RSUD Sigli Kurban 4 Sapi, Satu Kambing SIGLI (Waspada) : Manajemen Rumah Sakit Umum Daerah (RSUD) Sigli memotong empat ekor sapi kurban dan satu kambing pada Hari Raya Idul Adha, 1432 H, Selasa (8/11). Satu ekor sapi di antaranya diserahkan kepada Panitia Hari Besar Islam (PHBI) daerah setempat. Sedangkan tiga di antaranya plus satu ekor kambing dipotong di RSU Sigli dan dagingnya dibagikan kepada 260 masyarakat lingkungan RSUD setempat. Direktur RSUD Sigli dr Safwan mengatakan, pemotongan hewan kurban berkat partisipasi PNS dalam lingkungan rumah sakit yang dipimpinnya, melalui dana arisan yang dikumpulkan. (b10)

Waspada/Muhammad Riza

Direktur RSUD Sigli dr Safwan menyaksikan penyembelihan sapi kurban dari hasil arisan PNS di lingkungan RSUD setempat, Selasa (8/11) .

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


WASPADA Rabu 9 November 2011

Waspada/Muhammad Riza

BERKURBAN: Anggota Fraksi PKS DPR-RI asal Aceh M Nasir Djamil (pegang parang) menyembelih satu ekor sapi di meunasah Desa Keumangan, Mutiara, Pidie, Selasa (8/11).

Puluhan Calhaj Plus Kecewa Gagal Berangkat LHOKSEUMAWE (Waspada) : Puluhan calon jamaah haji plus asal Lhokseumawe dan Aceh Utara gagal berangkat disebabkan tidak terdaftarnya dalam kuota haji sebagaimana yang dijanjikan salah satu perusahaan yang menawarkan jasa pengangkutan haji. “Kami jelas merasa dirugikan, apalagi kami sudah diyakini untuk siap-siap berangkat 28 November ini. Setahu saya ada sekitar tiga puluhan lebih calon camaah haji dari Lhok-

seumawe dan Aceh Utara gagal berangkat,” kata Ramli Anwar, Selasa (8/11) di Krueng Geukueh, Aceh Utara. Ramli Anwar bersama istrinya, Kamaliah, sudah sejak 8 Mei 2010 menyerahkan uang setoran awal untuk menunaikan haji plus masing-masing Rp45 juta, dan telah melunasi keseluruhannya Rp70 juta. Sehingga pada tanggal 26 Juni 2011 terhitung Rp140 juta uang yang telah diserahkan untuk keberangkatan dua orang. Namun keduanya kecewa ketika tahu tidak jadi berangkat karena nama mereka tidak terdaftar pada kuota tahun ini. Sejumlah calon jamaah haji lainnya yang mendaftarkan di

perusahaan jasa yang sama juga gagal berangkat dan merasakan kekecewaan yang sama, sebab sejumlah harapan yang telah ditawarkan jasa travel berinisial IK tidak sesuai janji. Padahal Ramli beserta istrinya telah mempersiapkan segalakeperluankeberang-katan. “Sewaktu kami hubungi, pihak yang menangani masalah kami bilang, pokoknya sudah bisa siapsiapkan barang. Tapi tak lama kemudian kami tahu, kami tidak bisa berangkat, dan kami amat kesal,” ucap Kamaliah. Waspada kesulitan untuk menghubungi perusahaan bersangkutan untuk konfirmasi, terlebih dalam suasana lebaran. (b14)

Ombak Ancam Hancurkan Tambak Warga Peudada BIREUEN ( Waspada): Abrasi pantai yang menggila selama beberapa bulan terakhir ini di kawasan Peudada, Bireuen, sangat meresahkan para petani tambak di kawasan itu. Saat ini jarak pantai dengan kawasan tambak 20 meter. Para petani tambak yang resah itu adalah, petambak di Desa Seuneubok Paya, Paya Timu, Paya Induk, Paya Barat, Gampong Baro dan Meunasah Blang serta Gampong Kuku di sebelah barat. Geuchiek Desa Seunebok Paya Razali didampingi Geuchiek Desa Gampong Baroe Jailani Usman di sela-sela meninjau tambak dan kondisi kerusakan pantai di kawasan desanya itu, Selasa (8/11) menyebutkan, luas tambak milik warga tujuh desa di kawasannya sekitar 3.000 hektare dan sekarang jarak antara tambak dengan pinggir laut atau dengan ombak hanya 20 meter lagi dan bila tidak segera diperbaiki ombak akan masuk ke tambak mereka. Untuk mencegah abrasi dan kerusakan areal tambak itu, kata Geuchiek. Pembangunan Jetty di Kuala Jeumpa harus dilanjutkan sampai ke tujuh desa mereka. “ Dari arah timur mulai dari kawasan Kuala Jeumpa, Kecamatan Jeumpa hingga ke barat tujuh desa dan paling barat disekitar Gampong Kuku, Kecamatan Peudada, sekitar tujuh kilometer,” sebutnya. Selama ini, lanjutnya, lagi, luapan air laut masuk ke tambak ketika terjadi pasang purnama,

ikan-ikan peliharaan lepas terbawa arus. Dua petak tambak dekat pantai, kondisinya sudah dangkal, tertimbun pasir. Kecuali itu, sambung Razali, para petani tambak itu juga mengeluh, kecilnya saluran air buka dijembatan darurat lokasi pembangunan Jetty Kuala Jeumpa, sehingga usaha budidaya udang windu ditambak di tujuh desa di Peudada itu, hasilnya tidak maksimal. “Kami berharap kepedulian pemerintah supaya masalah ini dapat segera diatasi sebelum petani tambak banyak menjadi korban keganasan ombak,” harap Geuchiek Desa Seunebok Paya Razali yang diamini Geuchiek Desa Gampong Baroe Jailani Usman dan sejumlah warga lainnya.

Jalan Ke Tambak Tak Layak Selain mengeluh masalah kondisi tambak warga Desa Gampong Baro, Kecamatan Peudada juga mengeluh mengenai kondisi jalan desa mereka ke kawasan tambak yang pernah diaspal sekarang kondisinya sudah phak luyak (hancur). “Jalan aspal sepanjang satu kilometer rusak dan digenangi setiap turun hujan. Kondisi seperti itu mulai dari simpang jalan utama sampai ke jalan tambak tembus ke tepi pantai dilingkungan desa kami, jalan desa kami sudah diaspal itu, rusak lagi karena dilalui kendaraan pengangkut material saat membangun rumah bantuan tsunami beberapa waktu lalu,” jelas Geuchiek setempat Jailani Usman. (cb02)

Waspada/Abdul Mukthi Hasan

Geuchiek Desa Seunebok Paya, Peudada, Bireuen, Razali bersama warga Selasa (8/11) melihat tambak yang terancam dengan mengganasnya ombak di kawasan desanya dalam beberapa bulan terakhir ini.

Kurban Menjadi Sarana Peningkatan Ekonomi Daerah BLANGPIDIE (Waspada) : Pelaksanaan ibadah kurban dinilai mampu meningkatkan perekonomian di daerah, selain akan menimbulkan stimulus berupa peningkatan transaksi serta terselenggaranya aktifitas ekonomi lainnya, Ibadah kurban juga diharapkan dapat menjadi sarana stabilisasi sosioekonomi yang terjadi antara kalangan tertentu yang ada di masyarakat. Analisis dikemukakan Pimpinan Bank Aceh Cabang Blangpidie, Aceh Barat Daya Said Hambali,SE kepada Waspada, Senin (7/11) di sela-sela acara penyerahan dan pelaksanaan hewan kurban bantuan Bank Aceh Cabang Blangpidie di

beberapa titik lokasi yang menjadi cabang pembantu maupun kantor Kas Bank Aceh Cabang Blangpidie. Menurut Said Hambali, masih belum meratanya kondisi social dan ekonomi yang ada di masyarakat saat ini berkemungkinan besar bisa dilakukan penyelerasan dengan memamfaatkan momentum ibadah haji (kurban), selain adanya stimulus (rangsangan) pergerakan disejumlah sektor perekonomian yang ada di masyarakat kegiatan ibadah kurban juga dinilai mampu menjadi sarana peningkatan ekonomi bagi daerah. “Tak dapat dibantah lagi, ibadah kurban jelas menjadi

sarana yang sangat tepat dalam upaya meningkatkan perekonomian di masyarakat dan daerah, banyak sektor riil dan informal terjadi pergerakan yang sangat positif selama momentum lebaran haji (kurban) ini,” jelas Said Hambali. Bank Aceh Cabang Blangpidie sendiri seperti dijelaskan Said Hambali kepada Waspada pada hari raya Idul Adha tahun ini dapat berpartisipasi dengan melaklukan penyerahan 6 ekor kerbau yang dibagikan secara merata di semua kantor cabang pembantu dan kantor Kas yang selanjutnya dilakukan pendistribusian kepada masyarakat sebagai penerima daging kurban. (cb05)

pengalaman tahun-tahun sebeIDI CUT ( Waspada): lumnya bahwa banjir akibat Masyarakat yang berdomisili musim penghujan akan melandi 12 kecamatan dalam Kabuda kawasan wilayah ini sejak paten Aceh Timur, Provinsi September hingga Januari. KeteAceh, diminta tetap waspada. rangan sementara faktor banjir Sebab bencana banjir akibat masih sebatas akibat dangkalguyuran hujan masih berponya Daerah Aliran Sungai (DAS) tensi terjadi khususnya di di sejumlah titik dalam Kab. kawasan pedalaman. Aceh Timur. “Melalui para Camat kita “Sehingga kita usulkan ke sudah ingatkan untuk tetap BNPB di Jakarta untuk normahati-hati sewaktu-waktu lisasi sungai di Aceh Timur dan datangnya banjir, sebab benpembanguan sejumlah tebing cana banjir masih mengansungai, namun hingga belum cam wilayah ini pada setiap ada realisasinya,” kata Ikbal akhir tahun dan awal tahun,” seraya meminta masyarakat ungkap Kepala Badan PeMuhammad Ikbal tetap menjaga kebersihan lingnanggulangan Bencana kungan dan membudayakan Daerah (BPBD) Aceh Timur kembali gotong royong yang Muhammad Ikbal kepada Waspada, Selasa (8/ merupakan warisan indatu, sehingga perlahan 11). Disebutkan, 12 kecamatan yang berpotensi bencana banjir bisa teratasi. Ketua DPRK Aceh Timur, Tgk. Alauddin, SE banjir yakni Kecamatan Pantee Bidari, Indra secara terpisah mengatakan hal yang sama. Makmur, Julok, Darul Falah, Nurussalam, Darul Bahkan dia meminta masyarakat yang Aman, Idi Tunong, Banda Alam, Ranto Peureu- berdomisili di kawasan daratan rendah agar lak, Peunarun, Serbajadi dan Kecamatan Sim- tetap hati-hati dan waspada. “Akhir tahun ini pang Jernih. “Sementara Kecamatan Peudawa sudah lebih 3 sejumlah keocamatan dilanda dan Peureulak Barat tergolong banjir juga, tapi banjir, dan tak tertutup kemungkinan daerah hanya beberapa desa, tapi kalau 12 kecamatan lain akan mengalami hal yang sama,” sebutnya tadi lebih separuh kecamatan itu digenangi seraya meminta masyarakat menjaga lingbanjir,” ujarnya. kungan, khususnya kawasan hutan dilindungi. Ikbal menambahkan, sebagaimana (b24)

KPK Diminta Tindaklanjuti Laporan Korupsi Agara BANDACEH (Antara): Badan Kehormatan DPR Kabupaten Aceh Tenggara, meminta Komisi Pemberantasan Korupsi (KPK) untuk menindaklanjuti laporan indikasi korupsi anggaran oleh bupati setempat senilai Rp8,97 miliar. “Kami mohon laporan kasus korupsi yang telah disampaikan dapat segera ditindaklanjuti sesuai hukum yang berlaku demi membangun kembali citra KPK yang mulai diragukan oleh masyarakat,” kata Ketua Badan Kehormatan DPRK Aceh Tenggara, Tgk Appan Husni JS saat dihubungi dari Banda Aceh, Selasa (8/11). Terkait dengan kasus itu, Badan Kehormatan DPRK Aceh Tenggara juga telah menyurati Ketua KPK yang isinya agar lembaga itu menindaklanjuti laporan itu. Sebelumnya, Tgk Appan telah melaporkan kasus itu ke KPK pada 15 Juni 2011 tentang Laporan Hasil Pemeriksaan (LHP) Badan Pemeriksaan Keuangan (BKP) atas sistem pengendalian laporan keuangan Pemkab AcehTenggara TA 2009 dimana di dalamnya terdapat kas bon 2007-2009 sebanyak Rp8,97 miliar. Terhadap laporan itu, KPK telah menindaklanjuti dengan meminta informasi tindak lanjut atas rekomendasi auditor kepada Lembaga Pengawasan atas pengaduan masyarakat yang ditanda tangani Eko Morjono atas nama Pimpinan PLH Deputi bidang Pengawasan Internal dan Pengaduan Masyarakat.

Kemudian pada 20 Oktober 2011, Tgk Appan telah menyampaikan ke KPK dokumen tambahan, yakni hasil pemeriksaan BPK atas laporan keuangan Pemkab Aceh Tenggara TA 2009 dimana terdapat satu kasus kerugian daerah, yaitu kas bon senilai Rp8,97 miliar. Dikatakan, temuan BPK terhadap kas bon Rp8,97 miliar merupakan pengeluaran di luar mekanisme APB Kabupaten Aceh Tenggara, karena untuk membiayai kegiatan-kegiatan yang pada saat itu tidak ada anggarannya. Appan menyatakan, DPR Aceh Tenggara sebenarnya tidak pernah memparipurnakan anggaran kas bon tersebut supaya diperlakukan untuk kegiatan-kegiatan sebagai pengeluaran daerah. Ia menyatakan, penerbitan surat perintah pembayaran dana (SP2D) untuk merealisasikan anggaran melalui kas bon adalah tindakan ilegal. Oleh karena itu, dia mengharapkan KPK memanggil pihak Inspektorat Kabupaten Aceh Tenggara untuk memverifikasi kas bon dan mempertanyakan apakah ada SP2d atau tidak. Selanjutnya, KPK juga perlu memanggil DPRK Aceh Tenggara untuk mempertanyakan apakah kas bon tersebut ada diparipurnakan atau tidak, sehingga mengetahui kedudukan dana sebenarnya, kata Tgk Appan yang juga anggota Panitia Anggaran DPRK Aceh Tenggara.


SAMPAH berbagai jenis menumpuk di Jalan Tgk Chik Di Tiro Pantonlabu, Selasa (8/11) siang.

Sampah Menumpuk Di Pantonlabu PANTONLABU (Waspada) : Akibat armada pengangkut terbatas, sampah berbagai jenis menumpuk di sejumlah ruas jalan utama Pantonlabu, ibukota Kecamatan Tanah Jambo Aye, Kabupaten Aceh Utara, Selasa (8/11). Truk pengangkut sampah yang disediakan pemerintah untuk wilayah timur Aceh Utara, termasuk wilayah Pantonlabu hanya tiga unit. Sementara produksi sampah selama perayaan lebaran Idul Adha 2011/1432 H meningkat hingga tiga kali lipat dari hari biasa. “Seharusnya pada masa perayaan lebaran seperti ini, armadanya ditambah. Sehingga sampah terangkut semua dan upaya petugas sampah yang menyapu dan mengumpulkan sampah sejak pagi buta tidak sia-sia,” kataYahya, 43, salah seorang pedagang di Pantonlabu, kemarin.

Usman, 45, pedagang lainnya menambahkan, akibat tidak diangkut ke tempat pembuangan akhir, sampah yang tadinya sudah dikumpulkan petugas, biasanya akan berserak kembali, menjelang siang. Alhasil, sejumlah jalan utama di Pantonlabu, termasuk Jalan Tgk Chik Di Tiro dan Jalan Perdagangan, terlihat jorok karena dipenuhi berbagai jenis sampah, terutama plastik dan kertas bekas. Asri Fauzi, 35, mandor persampahan di Pantonlabu, ketika dikonfirmasi membenarkan kondisi tersebut. “Sama seperti hari-hari biasa, armada yang masuk tetap 3 unit. Sementara produksi sampah luar biasa banyak. Tapi ini hanya bersifat sementara. Biasanya, H+3 sudah normal kembali. Semua sampah yang menumpuk itu akan terangkut semua,” tandasnya. (b19)

Pedagang Air Bunga Kehilangan Omset Lebaran LHOKSEUMAWE (Waspada) : Suasana Idul peziarah di kuburan umum. Adha 1432 Hijriah kali ini dirasakan cukup Fatimah menyebutkan, untuk membantu berbeda oleh para pedagang musiman air bunga para peziarah di kuburan umum, mereka mengaku kehilangan omzet besar, Selasa (8/ menyediakan barang dagangan berupa air 11) lantaran sepinya peziarah di kuburan umum bunga dengan harga Rp10.000 untuk tiap satu di Desa Kutablang, Kecamatan Banda Sakti, Kota mangkuk kecil. (b16) Lhokseumawe Suasana lengang dari pengunjung terlihat di sejumlah kuburan umum di Kota Lhokseu-mawe, kecuali belasan pedagang air bunga yang tetap bertahan demi menunggu warga datang berziarah. Kondisi itu membuat para pedagang air bunga kehilangan omset lebaran yang biasanya dapat menghasilkan pendapatan lumayan dan rutin setiap tahun khususnya pada hari besar agama Islam. Pedagang air bunga asal Desa Kutablang, Fatimah, 33 Waspada/ Zainuddin Abdullah mengaku lebaran kali ini Tiga kakak beradik, Selasa (8/11) menjajakan air bunga untuk semua pedagang musiman para peziarah di pekuburan umum di Desa Kutablang, Kota terpaksa menelan pahit keru- Lhokseumawe demi mengais rezeki di tengah suasana Hari Raya gian lantaran sepinya jumlah Idul Adha 1432 H.


WASPADA Rabu 9 November 2011

B11 Bawa Jenazah, Mobil PMI Terperosok Ke Sungai

Dua Unit Rumah Hangus Di Subulussalam PENANGGALAN (Waspada) : Dua unit rumah milik Sahrul Sinaga, 30 di Jalan T Umar Desa Penanggalan, Kec. Penanggalan, Subulussalam, satu di antaranya bengkel las hangus dilalap api, Selasa (8/11). Tidak ada korban jiwa, namun ditaksir kerugian ratusan juta rupiah. Saat kejadian, bersama anggota keluarga, Sahrul dikabarkan berada dalam rumah dan diselamatkan melalui lantai dua dengan menggunakan tangga. Saksi mata, Heri di lokasi kejadian mengatakan, saat melintas arah Kota Subulussalam dirinya melihat kepulan asap disusul api dari rumah korban. Bersama sejumlah warga, rumah berpintu besi itu didobrak dan anggota keluarga diselamatkan melalui lantai dua dengan menggunakan tangga. Menyusul kejadian itu, sejumlah personil Polri turun ke lokasi kejadian. Dua unit mobil pemadam berhasil menjinakkan api yang sedang melalap rumah yang persis bersebelahan dengan Masjid At Taubah Penanggalan. Menyusul kejadian itu, bantuan masa panik turun dari Dinas Sosial Subulussalam dan pihak lain, seperti selimut, tikar plastik, mi instan, beras, ikan kaleng, peralatan dapur dan sejumlah bantuan lain. Kepada wartawan, Pj Kadis Sosial Anharuddin mengatakan akan membuat sementara tenda darurat dan membantu sejumlah bahan logistik kepada 2 KK dan 11 jiwa di sana. (b28)

AS Pinang, BLANGPIDIE (Waspada) : Mobil ambulans PMI Aceh Selatan dengan nomor polisi BL 637 TZ masuk ke dalam Sungai Alu Sungai Pinang, Selasa (8/11) sekira pukul 05:15. Kapolsup sektor Jeumpa, Bripka Zairin mewakili Subakti, Kapolres Abdya menyebutkan, ambulans tersebut membawa seorang jenazah korban kecelakaan, Sapriadin, 13, warga Desa Blangbladeh, Meukek. Aceh Selatan. Di dalam mobil juga ada Jumilah, 35, dan Heri, 40, orang tua Sapriadin. Seorang balita dan seorang perawat serta Fuadi Saputra, 22, warga Kelurahan Hulu, Tapaktuan yang merupakan sopir ambulans naas tersebut. “Semua korban selamat, hanya mengalami luka ringan,” kata Zairin. Hingga kini polisi masih menyelidiki penyebab kecelakaan mobil ambulan tersebut. “Sekarang polisi sedang memindahkan mobil dari sungai dan membawa korban kecelakaan lain untuk dirawat,” kata Zairin. (b08/cb05)

Dishub Bireuen Diminta Evaluasi Tingginya Angka Lakalantas

SPBU Pengkala Blangkejeren Terbakar, Satu Petugas Kritis BLANGKEJEREN (Waspada) : Stasiun Pengisian Bahan Bakar Umum (SPBU) Pengkala, Kecamatan Blangkejeren, Kabupaten Gayo Lues, Senin (7/11) sekira pukul 20:25 terbakar. Akibatnya, seorang petugas SPBU yang sedang mengisi BBM (Bahan Bakar Minyak) jenis premium mengalami luka bakar di bagian kepala dan kakinya, sehingga harus dirawat intensif di Rumah Sakit Umum Daerah Gayo Lues. Informasi dari saksi mata menyebutkan, api itu bermula ketika Sidik, 28, petugas SPBU sedang mengisi bensin ke salah satu tangki kendaraan pribadi konsumen, ternyata akibat gesekan corong pompa bensin ke salah satu body mobil, timbul percikan api dan langsung mengeluarkan api. Melihat kondisi api membesar, pengendara yang sedang antre bersama petugas kepolisian ikut mengamankan kendaraan yang terbakar serta sekaligus memadamkan api dengan menggunakan pasir dan alat pemadam yang tersedia di SPBU. Dan kini, SPBU dalam pengawasan pihak kepolisian. (cjs)

Pasar Atjeh Rawan Copet BANDAACEH (Waspada) : Selama Hari Raya Idul Adha 1432 Hijriah, kawasan Pasar Atjeh, pusat Kota Banda Aceh dilaporkan rawan terjadi kasus pencopetan sehingga anak-anak yang kehilangan dompet dan uang dari kantong celananya. Kawasan Pasar Atjeh yang palin rawan terhadap aksi copet itu adalah di sepanjang Jalan Tgk. Chik Pante Kulu, taman depan dan samping Masjid Raya Baiturrahman. “Di sini sangat rawan terjadi kasus pencopetan terhadap-anak-anak yang sedang berlebaran,” ungkap seorang pedagang, Selasa (8/11). Seorang pedagang mainan yang mangkal di samping Masjid Raya Baiturrahman, Muslim mengatakan, banyak anak yang kehilangan dompet dan uang dari kantong celananya setelah dijarah para penjahat. (b09)

Ratusan Ha Kebun Warga Dirusak Gajah MEUREUDU (Waspada) : Kawanan gajah liar dilaporkan kalangan petani merusak ratusan hektare areal perkebunan di kawasan Krueng Tijee, Kecamatan Meureudu dan Meurah Dua, Kabupaten Pidie Jaya, sejak beberapa tahun terakhir. Gajah merusak ratusan hektare areal kebun milik warga tani di kawasan pegunungan dan pedalaman Pidie Jaya itu. Hal sama juga terjadi di kawasan Kecamatan Geumpang, Kabupaten Pidie Pidie, Selasa (8/11) dilaporkan sejak lama kawanan gajah liar itu terus mengobrak-abrik dan menghancurkan ratusan hektare tanaman di kebun warga termasuh merusak pondok dan rumah warga di sekitar kebun. Tanaman yang dirusak antara lain, pinang, coklat, pisang dan padi yang sudah siap panen. Selama ini warga hanya pasrah melihat aksi gajah. Sebab tidak ada upaya untuk mengusir satwa liar yang dilindungi tersebut. Kecuali di Pidie Jaya yang sengaja mengundang tim Pusat Latihan Gajah Saree beberapa waktu lalu. (b09)

Petani Keluhkan Irigasi Tersumbat, Sawah Kering TIRO, Pidie (Waspada) : Sejumlah petani di Kecamatan Tiro/ Truseb, Kabupaten Pidie mengeluhkan kondisi irigasi yang tersumbat, sehingga menyebabkan sejumlah areal persawahan di kawasan itu mengalami kekurangan air. “Jika tidak cepat ditanggulangi kerusakan irigasi tersebut, kami mengkhawatirkan musim tanam dan panen padi tahun ini terancam gagal. Penyebabnya, hampir semua saluran irigasi di kawasan itu tersumbat dan tidak dibersihkan oleh pihak dinas terkait,” ujar beberapa petani setempat, Selasa (8/11). Pantauan Waspada di beberapa kecamatan di daerah lumbung pangan Aceh itu, banyak saluran irigasi yang rusak dan tersumbat sehingga airnya tak bisa mengalir. “Jika dilihat kondisi saluran irigasi yang ada sekarang mendesak untuk dibersihkan. Apalagi pada saat memasuki Musim Tanam Rendengan (MTR) 2011/2012 kebutuhan air lumayan banyak untuk diairi ke sawah,” katanya.(b09)

Rebutan Tempat Jualan, Pedagang Dianiaya LHOKSEUMAWE (Waspada) : Akibat perkelahian dua pedagang yang memperebutkan posisi tempat penjualan, antara kios Hamdani yang membelakangi toko Ibrahim, akhirnya Hamdani mempolisikan Ibrahim. Peristiwa itu terjadi, Sabtu (5/11) di jalan line pipa Exxon Mobil, persisnya Desa Me, Kec. Meurah Mulia, Aceh Utara. Awal peristiwa, Hamdani dipukul dengan parang di bagian kepala akibat melarang Ibrahim tidak memotong jaringan listrik yang tujuan ke kiosnya. Dengan berlumuran darah ia dilarikan ke Puskesmas setempat yang akhirnya dirawat inap di RSU Cut Meutia Lhokseumawe sampai, Senin (7/11). Pada Selasa (8/11), Hamdani melaporkan Ibrahim Amin ke polisi yang juga mantan Mukim Teungoh kecamatan itu. Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kasat Reskrim AKP Galih Indra Giri membenarkan atas pelaporan Hamdani. (cmk)

Penipuan Lewat HP Masih Marak BIREUEN (Waspada) : Aksi penipuan lewat Handphone belum juga reda di Bireuen, walaupun cara seperti itu merupakan gaya lama dan banyak warga yang mengetahuinya. Namun, anehnya aksi itu masih juga dilakukan pihak-pihak yang tidak bertangungjawab untuk mengait mangsanya dengan cara mengirim SMS yang berisi pesan seolah-olah pemilik kartu itu mendapat hadiah. Informasi yang diperoleh, Selasa (8/11) seorang pelanggan kartuAS di Kota Bireuen 08536085xxxx, mengungkapkan membeli kartu perdana AS pada seorang pedagang, namun setelah me-makai dua hari lalu masuk SMS dari 082197121979 yang isinya: Selamat, nomor anda mendapat hadiah Rp100 juta dari Telkomsel poin. Info hubungi 082190751588, Ir H Edi Harsono. Pengirim +777. “Saya yakin ini aksi penipuan karena nomor AS saya ini baru saya beli, namun dia tidak berhasil, saya juga berharap kepada para pelanggan kartu selular jangan pernah percaya aksi seperti yang saya alami, karena itu aksi penipuan,” pesan warga Bireuen itu. (cb02)

Ambulans PMI Aceh Selatan yang terjun ke Sungai Alue Sungai Pinang Abdya. Selasa (8/11)


Dua Warga Aceh Barat Hilang Terseret Arus MEULABOH(Waspada): Dua dari tiga yang berstatus satu keluarga di Kabupaten Aceh Barat hilang terseret arus setelah sepeda motor yang ditumpangi ketigannya jatuh ke sungai saat melewati jembatan gantung di Desa Tanjung Bunga Kecamatan Kawai VXI, Senin (7/11) sekira pukul 17.35.

Satu dari tiga korban berhasil ditemukan selamat sementara dua lainnya masih dinyatakan hilang karena terseret derasnya arus sunggai. Korban selamatyangberhasilditemu-kan yakni Bungsu Syarifah,30 sedang korban hilang yakni Rusli,40 dan Ifanda ,5 yang merupakan suami dan anak Syarifah. “Mereka jatuh saat melewati jembatan, warga berhasil menemukan satu orang begitu mengetahui ada yang jatuh ke-

sungai,”kata koordinator Badan SAR Pantai Barat Aceh, T Daan, Selasa (8/11) di Meulaboh. T Daan mengatakan ketigawarga Tanjung Bunga Kecamatan Kaway XVI itu terjatuh bersama sepedamotor Suzuki Arashi akibat kondisi jembatan sudah rusak dan belum diperbaiki. Dikatakan, awalnya Rusli sang ayah telah ditemukan namun karena berusaha mencari anaknya ia ikut menghilang terseret derasnya arus sungai.

Menurut T Daan, sepedamotor milik korban sudah ditemukan pukul 10:00 di lokasi yang tak jauh dari TKP. Penemuan setelah warga sekitar menyisir sungai dengan menggunakan jaring maupun jala. “Sepedamotornya sudah ditemukan, kita kesulitan karena sungai keruh dan arusnya deras. Hingga kini tim SAR yang masih bisa melakukan pencarian. Mereka menggunakan speedboat dan perahu nelayan,”ungkapnya. (cb06)

Kasus Mark-Up Dolomit Dinas Pertanian Agara Dituntaskan KUTACANE (Waspada) : Laporan tiga LSM di Aceh Tenggara terkait indikasi penggelembungan dana proyek pengadaan dolomit 1.000 ton, pada Dinas Pertanian lebih dari Rp 1 miliar, dijanjikan Kapolres AKBP Drs Arsyad KH, akan dituntaskan secara hukum. Di ruang kerja Kapolres yang menerima audensi tiga ketua LSM, Selasa (8/11), masing-masing, Arafik Beruh, dari Gakag, Saleh Selian dari Lira dan Kasirin, SAg, dari SRDK, yang mengkonfirmasi laporan indikasi penggelembungan dana proyek

pengadaan dolomit yang diperkirakan menyebabkan kerugian uang negara lebih dari Rp 500 juta, yang dilaporkan melalui Waka polres Kompol Bambang Eko,sebulan yang lalu, dipertanyakan tindaklanjutnya. Sebagaimana diberitakan Waspada Jumat (7/10) sesuai konfirmasi ke PPTK Dinas pertanian Agara, Ir Kita, membenarkan kegiatan ini dikerjakan oleh CV WU dengan nilai kontrak Rp 1,298 M. Jenis kegiatan pengadaan dolomit super sejumlah 1.000 ton. Dengan harga satuan per Kg dikontrak disebut-

kan Rp 1.298. Hal ini mengundang kecurigaan berbagai pihak di Agara. Pasalnya, kata Kasirin, ketika mereka bersama rekan LSM lainya, Arafik Beruh dan Saleh, melakukan survey harga, terindikasi harga satuan dikontrak jauh lebih tinggi dari harga di pasar. “Ini yang kita temukan di pasar Kutacane, harga jual jauh lebih rendah” kata dia. Disebutkan, harga yang terpantau telah dihitung ongkos angkut maupun PPN dan PPH, berkisar Rp 500. Artinya lebih dari Rp500 juta dana proyek dolomit ini di-

bengkakkan. AKBP Arsyad, mengatakan secara lisan telah disampaikan anggotanya terkait kasus yang dilaporkan tiga LSM, pada Dinas Pertanian Agara. Dikatakan, permasalahan ini akan ditindaklanjuti sesuai mekanisme hukum, diakui nilai penggelembungan dana yang dilaporkan terhitung besar Rp 500 juta, hal ini layak pihak BPKP selaku saksi ahli untuk turun. “ Saya segera memanggil anggota dan tuntaskan kasus ini,” tegas AKBP Arsyad. (b25)

Warga Aceh Utara Dukung Pemerintah Pusat Hidupkan AAF Dan KKA LHOKSEUMAWE (Waspada) : Sejumlah tokoh warga di kawasan industri Aceh Utara menyampaikan dukungannya untuk menghidupkan kembali pabrik pupuk ASEAN Fertilizer (AAF) dan Kertas Kraft Aceh (KKA). Kepala Desa Jamuan, Kecamatan Dewantara, Aceh Utara, Selasa (8/11) mengatakan, setelah Marzuki Daud melalui Waspada mengakui menghidupkan kembali AAF dan KKA tak ada kendala, warga menanggapi serius. “Kami

mendukung program menghidukan kembali pabrik KKA,” tegas Kepala Desa Jamuan T Zainal Abidin. Pernyataan Wakil Ketua Tim Pemantau Percepatan Pembangunan Pemerintah Aceh serta Otsus Papua, Marzuki Daud dinilai sebagai informasi pen-ting bagi masyarakat Aceh. Sehingga warga sekitar kawasan industri tersebut memberikan dukungan penuh kepada pemerintah pusat. (b15)

Laka Lantas, Seorang Tewas BIREUEN (Waspada) : Korban kecelakaan lalulintas yang meninggal dunia di lintas nasional kawasan Kabupaten Bireuen sepertinya tidak pernah sepi. Kali ini Muhammad Isa, 23, asal Desa Pulo Tukok, Kecamatan Batee, Pidie, menghembuskan nafas terakhir setelah sepedamotor Vario BL 4369 PAD yang dikendarainya tabrakan dengan Supra X BL 3361 ZS dikendarai M Faisal, 20, dan Mustafaruddin,13, warga Peulimbang di lintas nasional kawasan Desa Seuneubok Nalan, Senin (7/11). Keterangan yang dihimpun dari anggota Polsek Jeunieb, kecelakaan maut tersebut diduga akibat ban depan motor dikendarai M Faisal meledak, lalu hilang kendali saat itu muncul Vario dari depannya laga kambingpun tak bisa dihindarkan. Setelah kejadian, pengguna jalan lain yang kebetulan saat itu melintaskekawasanitumelarikanketigakorbankePuskesmasJeunieb. Kepala UGD Puskesmas Jeunieb, Irwandi Thaib, Selasa (8/ 11), mengatakan, Muhammad Isa mengalami luka lecet di pipi kiri dan jempol kanan, korban diduga berbenturan di bagian dalam tubuhnya, namun saat itu korban telah meninggal dunia. (cb02/ b12)

Ibu Melahirkan Gratis Biaya Persalinan LHOKSEUMAWE (Waspada) : M Nurdin, Kepala Dinas Kesehatan Aceh Utara, Selasa (8/11) mengatakan, Kementerian Kesehatan meluncurkan program Jampersal (Jaminan Persalinan) bagi ibu melahirkan. Jampersal mulai diberlakukan pada 2011. “Program ini berlaku untuk warga miskin dan kaya. Bagi mereka yang melahirkan dengan normal, biaya yang ditanggung Rp350 ribu. Bukan hanya itu, Jampersal juga menanggung biaya operasi. Klaim uang persalinan cukup dengan melaporkan ke Puskesmas masing-masing,” kata Nurdin. Untuk menyebarluaskan informasi Jampersal, Nurdin mengaku telah memanggil 28 kepala puskesmas dan bendahara di Aceh Utara untuk mengikuti sosialisasi Jampersal di Aula Jamsostek seminggu lalu. Kepala Puskesmas diminta untuk menyampaikan informasi tersebut kepada masyarakat di tempat mereka bertugas. Pada 12 November, sebut Nurdin, pihaknya akan memperingati Hari Kesehatan Nasional ke-47 dengan tema Indonesia Cinta Sehat. Pada hari itu, pihaknya akan menggelar gerak jalan bersama ribuan pekerja kesehatan dan mahasiswa di Akademi Kesehatan di Aceh Utara. (b18)

Mantan Ketua PWA Berobat Ke Medan

Waspada/Mustafa Kamal

Kondisi pabrik PT ASEAN Aceh Fertilizer (AAF) yang sudah tujuh tahun diterlantarkan begitu saja. Menurut tim asistensi percepatan pengoperasian PT AAF, pada awal 2012 akan dioperasikan kembali.

Jangan Anggap Enteng Persoalan Kecil BLANGPIDIE (Waspada) : Persoalan yang sering muncul di masyarakat terkadang sering berubah menjadi anarkis ketika terlambat dan salah dalam penanganannya. Oleh karenanya setiap persoalan yang muncul di tengah masyarakat harus dapat diatasi dengan segera dengan meniadakan dampak sekecil apapun yang dapat membuat persoalan menjadi besar. Pernyataan dikemukakan Komandan Distrik Militer 0110 Aceh Barat Daya (Abdya) Letkol Arm E.Dwi Karyono AS dalam arahannya di upacara serah terima dan laporan korp perwira di aula Makodim setempat, Selasa (8/11). “Jangan anggap enteng persoalan kecil bila menyangkut kepentingan rakyat, seluruh personil harus bisa menangani secara tepat dan tepat setiap persoalan di masyarakat, jangan tunggu sampai menjadi besar,” tegas Dandim. Adapun para perwira yang

BIREUEN (Waspada) : Tingkat kecelakaan di jalan raya di wilayah Kabupaten Bireuen dapat dikategorikan tinggi di Provinsi Aceh. Kapolres Bireuen AKBPYuri Karsono mengatakan, selain tingginya kasus penyalahgunaan narkoba, Bireuen juga masih tinggi angka kecelakaan lalulintas (lakalantas). Karenanya, masyarakat di Kabupaten Bireuen meminta Dinas Perhubungan setempat agar mengevaluasi penyebab terjadinya kecelakaan lalu lintas guna mencari solusinya. Hal ini dikatakan Ketua Forum Komunikasi Pemuda Bireuen (Fokus-PB) Said Fajri, Selasa (8/11). Dia menyebutkan, dengan mempelajari berbagai penyebab kecelakaan sehingga Dinas Perhubungan dapat memberikan solusi. “Cukup sering saya membaca di koran tentang tabrakan di jalan, apakah kita semua diam saja dengan kondisi ini,” ucapnya. Menurutnya, kurangnya sarana seperti rambu-rambu lalulintas juga menjadi penyebab kecelakaan. Begitupun dengan kondisi badan jalan yang tidak sepadan lagi dengan kepadatan arus lalulintas. “Seperti jalan antara Bireuen sampai Matangglumpang Dua,” katanya. Ketua GP Ansor Kabupaten Bireuen, Mukhtaruddin mengatakan, sikap ugal-ugalan di jalan raya terutama para remaja yang perlu dilakukan perbaikan. “Ini perlu dilakukan sosialisasi tentang tertib lalu lintas oleh intansi terkait,” ucapnya. (b17)

LHOKSEUMAWE (Waspada) : Ulama kharismatik Tgk H Mustafa alias Abu Paloh Gadeng, melepas wartawan senior untuk berobat ke salah satu rumah sakit di Medan, Selasa (8/11). Ibrahim Achmad, wartawan senior mantan ketua Persatuan Wartawan Aceh (PWA) menderita sakit gangguan paru-paru. Kondisinya selama dua pekan terakhir dalam keadaan kritis, dirawat di RS PT Arun LNG dengan kondisi kesehatannya belum begitu signifikan. Atas saran tim dokter spesialis RS PT Arun, ia dirujuk ke Medan. “Ia perlu penanganan khusus, karena efek dari penyakit yang dideritanya sudah semakin kronis,” kata istrinya Nurjamaliah. Istri wartawan senior ini mengucapkan terima kasih atas kepedulian masyarakat kota Lhokseumawe, Aceh Utara dan sekitarnya yang memberi perhatian terhadap pengobatan suaminya selama dalam perawatan di RS PT Arun. Keberangkatan Ibrahim Achmad selain dilepas oleh ulama kharismatik/Ketua Majelis Permusyawaratan Ulama (MPU) Aceh Utara Tgk H Mustafa Ahmad alias Abu Paloh Gadeng, juga Pj Bupati Aceh Utara H M Alibasyah,Walikota Lhokseumawe H Munir Usman dan para pejabat lainnya. (b13)

Murid SDN 34 Banda Aceh Kurban Dari Celengan Jumat

Waspada / Sudarmansyah

Dandim 0110 Abdya Letkol Arm E Dwi Karyono AS memberikan cenderamata ke salah seorang perwira Kodim 0110 Abdya yang mendapat posisi baru di luar Kodim Abdya. diserahterimakan, Kapten Inf Rustam Efendi yang menjabat posisi baru sebagai Pasi-Intel Kodim 0116 Nagan Raya, posisi yang ditinggalkan Kapten Inf Rustam Efendi yang sebelumnya Danramil 01/Blangpidie

akan diisi Kapten Inf Aji Barkah yang meninggalkan pos lamanya sebagai Pasi-Ter Kodim 0110 Abdya. Kapten Inf Anjar Asmara Pama di Korem 012 Teuku Umar akan mengisi pos Pasi-Ter Ko-

dim 0110 Abdya tersebut, selanjutnya Kapten Inf Dedi Bermana yang semula memangku posisi Pasi-Ops berpindah tempat sebagai Danramil 07/Babahrot menggantikan Lettu Inf M. Musa. (cb05)

BANDA ACEH (Waspada) : Setiap Jumat sejak setahun lalu, murid Sekolah Dasar Negeri No 34 Kota Banda Aceh di Neusu Jaya menyediakan beberapa celengan sedekah di sekolah itu, siangnya celengan itu dibuka dan ditabung pada rekening khusus. Selain dari celengan masjid, para murid juga mengumpulkan botol air mineral yang ada di sekolah mereka kemudian dijadikan uang disimpan di celengan. Menjelang Hari Raya Idul Adha 1432 Hijriah beberapa hari lalu, sejumlah sedekah yang terkumpul itu dibelikan seekor ternak untuk dijadikan hewan kurban ditambah sumbangan Kepala Sekolah satu ekor sapi disembelih sebagai hewan kurban. Nani, murid kelas V di sekolah itu mengatakan, mereka memotong satu ekor lembu dan satu ekor kambing yang dibeli dari uang hasil celengan selama setahun yang lalu pada setiap Jumat ditambah seekor bantuan ibu kepala SD setempat. Uang dari celengan adalah dari para murid sendiri. Maryam, Wakil Kepala SDN 34 Banda Aceh, Selasa (8/11) mengatakan, sejumlah murid SDN 34, setiap Jumat celeng dibuka kemudian disimpan di rekening khusus. Hewan kurban yang disembelih mereka kemarin dibagikan kepada murid SDN di sekolah itu yang orang tuanya masih kategori miskin. (b09)



WASPADA Rabu 9 November 2011

Pangdam IM : Aceh Tak Perlu Tambahan Personil REDELONG (Waspada) : Pangdam Iskandar Muda Mayor Jenderal TNI, Adi Mulyono, dalam kunjungannya ke Kabupaten Bener Meriah menyebutkan, saat ini kondisi Aceh aman. Dari itu tidak diperlukan tambahan personil, jelang pelaksanaan Pilkada di Aceh.

Waspada/Mustafa Kamal

Pengunjung memadati kawasan objek wisata laut Pantai Ujong Blang Lhokseumawe yang potensial dikembangkan menyambut Visit Aceh 2013, Selasa (8/11).

Sekjen RASSA: ‘Jangan Salah Memaknai Hari Raya’

Warga Tiga Daerah Padati Pantai Ujong Blang

JUILOK (Waspada): Umat Islam se dunia, khususnya di Aceh, diharapkan untuk saling kunjung mengunjung dalam memeriahkan lebaran, baik Idul Adha ataupun Idul Fitri. Hal itu penting mengingat selama ini banyak generasi muda khususnya pemuda dan pemudi salah dalam memaknai hari raya. Demikian Sekjen Rabithah Silaturrahmi Santri se Aceh (RASSA) Tgk HM Iqbal Hanafiah, MA kepada Waspada, Selasa (8/11) di sela-sela halal bi halal di Ponpes Babul Khairi Julok, Aceh Timur. Menurutnya, ketidakpahamnya muda-mudi Aceh belakangan akibat menipisnya ilmu pengetahuan agama dan keimanan yang dimiliki. Untuk itu, sambung H Iqbal diminta peran serta wali dan orangtua sangat mempengaruhi perkembangan dan pertumbuhan generasi muda. “Sehingga saat tibanya lebaran (Idul Fitri dan Idul Adha) dipahami tempat dan rumah-rumah yang harus dikunjung untuk mempererat tali silaturahmi,” sebutnya. “Belakangan kaum muda saat lebaran hanya bersilaturrahmi dengan orangtuanya sendiri. Sementara tetangga dan kerabat serta gurunya yang di sekolah dan di dayah sudah tidak dikunjungi lagi. Sehingga tidak sedikit muda-mudi sekarang memprioritaskan waktu lebaran hingga tiga hari untuk jalan-jalan tanpa arah tujuan yang jelas,” jelas Iqbal. Untuk lebih bermakna lebaran, lanjutnya, diminta umat Islam agar benar-benar memanfaatkan waktunya untuk saling bersilaturahmi dengan tetangga. (b24)

LHOKSEUMAWE (Waspada) : Suasana Idul Adha warga Lhokseumawe, Aceh Utara, Bireuen dan sekitarnya memadati kawasan objek wisata laut Pantai Ujong Blang, Kota Lhokseumawe. Sebuah objek wisata tertua di kota itu. Satu-satunya objek wisata potensial yang terletak di jantung Kota Lhokseumawe yang ramai dikunjungi warga setiap libur lebaran, bahkan setiap akhir pekan kawasan itu hidup sesak bak di pusat perbelanjaan. Kondisi ril garis pantai memiliki panjang sekira 4,2 km, kedua sisi berbatas dengan PT Arun dan Pertamina. Pantauan Waspada, Selasa (8/11), umumnya warga yang berekreasi ke Pantai Ujong Blang mulai berdatangan menjelang siang sampai sore. Berbagai aktivitas warga seperti berenang laut, main bola bagi kawula muda dan bagi keluarga menyantap makan siang bersama. “Aktivitas kami mengunjungi wisata ini hanya ingin mandi laut bersama anak-anak, yang mempunyai hamparan pantai cukup luas ditambah pemandagan proyek vital seperti PT Arun NGL,” kata Fakrurrazi, 34, warga asal Bireuen.

Pembahasan APBK-P 2011 Molor IDI (Waspada): Kinerja eksekutif Aceh Timur, Provinsi Aceh, kembali disorot. Pasalnya, pembahasan Anggaran Pendapatan Belanja Kabupaten Perubahan (APBK-P) 2011 molor dari waktu yang seharusnya. Padahal, sisa waktu dalam tahun ini hanya 1 bulan 20 hari lagi. Demikian Ketua LSM Komunitas Aneuk Nanggroe Aceh (KANA), Muzakir kepada Waspada, Selasa (8/11) di Idi. Menurutnya, molornya pembahasan APBK-P 2011 sudah dilakukan oleh pihak legislatif awal Agustus 2011, sehingga sisa anggaran yang ada bisa dialokasikan ke pos lain dan jika ada pengadaan bisa dilakukan tender. “Ini bukan lagi molor, tapi sudah lebih dari waktu yang seharus-nya,” terang Muzakir seraya menambahkan, seharusnya pihak legislatif menegur dan meminta APBK-P dari eksekutif, sehingga bisa langsung dibahas sesuai dengan aturan dan mekanisme yang seharusnya. Untuk itu, harap Muzakir, agar anggaran yang tersisa tidak terbuang sia-sia maka anggota dewan—khususnya Panggar— segera meminta APBK-P dari eksekutif untuk selanjutnya dibahas sebelum tahun memasuki tahun 2012. “Kinerja eksekutif perlu ditingkatkan, khususnya dalam mempertanggungjawabkan APBK 2011 dan APBK-P,” tandas Muzakir. (b24)

Kinerja Kepsek Perlu Ditingkatkan IDI (Waspada): Kepala Dinas Pendidikan Kab. Aceh Timur, H Agussalim, SH.MH meminta agar kinerja Kepala Sekolah (Kepsek) se Aceh Timur perlu ditingkatkan. Hal itu dianggap penting mengingat perbandingan kinerja di luar negeri seperti di Malaysia yang sangat luar biasa dan mampu membangkit semangat belajar siswa di sekolahnya. “Kepsek adalah ibarat menejer dalam sebuah perusahaan. Jika Kepsek aktif maka seluruh staf pengajar akan aktif dan memiliki tanggungjawab dan kesadaran dalam melaksanakan tugasnya sebagai abdi negara,” ujar H. Agussalim kepada Waspada, Selasa (8/11). Dia mengaku, selama ini kinerja Kepsek sudah memperlihatkan angka menuju ke arah yang lebih baik. Namun beberapa diantara Kepsek masih perlu peningkatan dalam kinerjanya. “Ciptakan suasana sekolah yang baik, sehingga sesama guru tercipta kekompakan.Yang paling penting bangun kebersamaan sesama dan bangkitkan semangat dalam mengabdi,” tandasnya. (b24).

Lembaran Bertuliskan Ayat Alquran Jadi Pembungkus Petasan LHOKSEUMAWE (Waspada) : Warga Tanjong Pineung, Seunuddon, Aceh Utara menemukan lembaran bertuliskan ayat Alquran dalam petasan. Warga baru mengetahui tulisan huruf Arab itu ternyata Surat Annisa, ayat 15, setelah anak-anak meledakan petasan, Selasa (8/11). Jamilah, 30, mengaku menemukan ayat Alquran tersebut setelah petasan meledak. “Setelah saya perhatikan ternyata ayat Alquran,” jelasnya. Ayat Annisa ayat 15 tersebut tertulis dengan tulisan tangan. Sebagian dari ayat telah hancur karena ledakan. Temuan ini kemudian disampaikan kepada tetangga, sehingga menjadi heboh.”Kalau kita menemukan lembaran ayat Alquran, kita akan menaruh di tempat yang lebih tinggi,” ungkap Usman, 54, warga lainnya. Sehingga meledahkan ayat Alquran dengan petasan membuat warga kecewa. (b15)

Perhatian Pemko Kurang Pengelolaan objek wisata laut potensial Pantai Ujong Blang oleh Pemko Lhokseumawe masih terlihat minim untuk meningkatkan fasilitas berbagai penunjang kepariwisataan, ten-

tunya meningkatkan PAD daerah. Kendati disinyalir objek wisata ini lolos dari PAD Lhok-seumawe. “Pemko masih kurang perhatian terhadap pengelolaan objek ini, seperti tidak tersedia pos restribusi resmi, parkir kendaraan, lapak pedagang yang semrawut dan tarif penyewaan berbagai fasilitas tidak menentu dan air bersih yang minim,” ucap Apadin Kora, tokoh warga di objek wisata itu. Tidak adanya pengelolaan ini berdampak negatif kepada pengunjung dan mengurangi rasa kenyamanan mereka, bahkan dikhawatirkan timbulnya aksi premanisme mengambil alih pengelolaan wisata Pantai Ujong Blang. Sementara Duta Pariwisata Aceh 2010 dan 10 besar Putri Pariwisata Indonesia 2011 Cut Nyak Nyak Dhien sangat mendukung pengembangan obkjek wisata itu, mengingat kawasan itu memiliki pantai pondok rujak terpanjang yang pernah ditemui. “Dan itu bisa dijadikan salah satu cirikhas yang harus dipertahankan. Yang terpenting sebelum Visit Aceh 2013 meningkatkan kesadaran masyarakat setempat akan tempat wisata yang ada dsekitarnya agar mampu menjaga dan melestarikan tempat tersebut guna menciptakan kenyamanan bagi wisatawan. Intinya mari kita tingkatkan sadar wisata kenali negerimu, cintai negerimu,” ujarnya. (cmk/cb02)

Anggota DPR Minta Aceh Laporkan Situs Sejarah Ke Pusat LHOKSEUMAWE ( Waspada) : H Raihan Iskandar, Lc, , anggota Komisi X DPR-RI dari Fraksi Partai Keadilan Sejahtera (PKS), Selasa (8/11) meminta Pemerintah Provinsi Aceh untuk segera melaporkan situs-situs sejarah ke pusat untuk diregistrasi. Setelah itu, Pemprov Aceh harus melakukan pengawalan ketat pada saat penyeleksian apakah situs tersebut masuk dalam kelas nasional atau kelas daerah. “Cukup banyak situs sejarah di Aceh yang belum dilaporkan ke pusat, karena itu, saya pikir Pemerintah Aceh sudah saatnya melaporkan untuk proses registrasi. Proses registrasi bisa mencapai dua tahun lamanya. Jika sudah diregistrasi, maka biaya pemugaran situs sejarah menjadi tanggungjawab pusat dengan menggunakan APBN,” kata Raihan. Raihan menuturkan, khusus untuk Pemkab Aceh Utara harus segera melaporkan situs sejarah Makam Malikussaleh ke pusat untuk diregistrasi. Pemerintah Pusat, kata Raihan, serius mengelola berbagai situs sejarah di Indonesia. Situs sejarah Malikussaleh dari bentuknya hampir mirip dengan situs sejarah di Sumatera dan Pulau Jawa.

Anggota Komisi X DPRRI,H Raihan Iskandar, Lc Bentuknya seperti candi dan kanal-kanal. Beberapa sungai mati di Aceh Utara disinyalir kanal-kanal yang digunakan pada masa Kerajaan Sultan Malikussaleh. Untuk membuktikan dugaan ini, Aceh Utara dan Provinsi Aceh perlu memperjuangkan dengan cara mencari pakar arkeolog untuk meneliti hal tersebut. “Indikasi ke sana cukup kuat. Pasalnya, sampai sekarang ada kecamatan yang namanya persis seperti nama kanal yaitu Syamtalira A dan Syamtalira B,” kata Raihan penuh keyakinan. (b18)

Polres Aceh Timur Siap Jaga Kamtibmas

Waspada/Zainal Abidin

Salah satu lembaran surat Annisa ayat 15 masih jelas yang ditemukan warga Tanjong Pineung, Seunuddon dalam bungkusan petasan, Selasa (8/11).

IDI (Waspada): Kepolisian adalah pihak yang menjaga tidak luput dari kekurangan dan masih jauh dari kesempurnaan. Namun selaku aparat penegak hukum polisi siap menjaga Keamanan, Ketertiban Masyarakat (Kamtibmas) dalam wilayah hukumnya. Demikian Kapolres Aceh Timur, AKBP Drs Ridwan Usman didampingi Wakapolres Aceh Timur, Kompol DoniWahyudi kepada Waspada Selasa (8/ 11) di ruang kerjanya. Menurutnya, menjaga keamanan adalah bukan hanya tugas polisi tetapi tanggungjawab semua

komponen masyarakat, apalagi menjelang Pilkada. “Kedamaian itu indah, kedamaian itu harus dijaga. Sebab untuk mendapatkan kedamaian itu sangat mahal harus dibayar,” sebut Ridwan Usman seraya menambahkan, pihaknya sangat mengharapkan masyarakat memberikan informasi yang benar ke polisi terdekat jika melihat dan mengetahui adanya aksi-aksi yang mencurigakan, termasuk jika ada masyarakat yang memakai, menyimpan dan membawa narkoba dari berbagai jenis. (b24)

“Pasca MoU antara GAM dan pemerintah RI 2005 lalu, situasi Aceh kondusif. Namun kalaupun ada permasalahan hanya masalah kriminal biasa. Artinya saya berkeyakinan masyarakat Aceh mengutamakan perdamaian dan mengharapkan keamanan selalu stabil di bumi ‘Serambi Makkah’ini,” jelas Mayjen TNI Adi Mulyono, Selasa (8/11) dalam temu pers usai meresmikan tugu bendera Merah

Putih abadi di puncak Bur Demun, Kp.Bale Atu, Kec. Bukit, Bener Meriah. Kendati dia mengakui ‘tensi’ politik menghangat jelang pilkada, namun hal itu merupakan lazim terjadi saat ini di seluruh daerah. “Tidak ada yang perlu kita khawatirkan. Namun masalah keamanan itu tetap bersifat dinamis. Dan kita berkeyakinan semangat berkebangsaan warga Aceh, untuk menjaga persatuan dan kesatuan dalam bingkai NKRI cukup tinggi ,” kata Adi Mulyono. Sebelumnya ketika meresmikan tugu bendera abadi Merah Putih, Pangdam menyebutkan penghargaannya kepada semua pihak yang memberikan dukungan. Sehingga tugu tersebut dapat berdiri dengan kokoh di salah satu bukit di Bener Meriah. Bupati Bener Meriah Tagore Abubakar AB, menyebutkan dibangunnya tugu bendera, hendaknya mampu meningkatkan semangat nasionalisme

setiapwargadangenerasibangsa. “Proses pembuatan bendera Merah Putih ini menghabiskan waktu tiga bulan. Dengan ukuran panjang 45 meter dan lebar 17 meter. Sementara

di pinggirnya berdiri tegak delapan bambu runcing. Dimana semuanya memiliki makna yakni sesuai dengan peringatan hari kemerdekaan RI, ” kata Tagore. (cb09/b32/b33/cb10)

Waspada/ Irwandi MN

Pangdam IM Mayor Jenderal TNI Adi Mulyono, ketika memberikan kata sambutan dalam peresmian tugu bendera Merah Putih abadi di sebuah bukit di Bener Meriah, Selasa (8/11) siang.

Sejumlah Bendera PA Dirusak OTK BIREUEN ( Waspada): Sejumlah bendera Partai Aceh (PA) yang dipasang di kawasan Simpang IV atau Gle Kapai, Peusangan, Bireuen dan sekitarnya dikabarkan sebagiannya dirusak Orang Tak dikenal (OTK). Pengurus PA wilayah Bireuen mengecam tindakan itu dan meminta pihak berwajib untuk mengusut tuntas kasus perusakan bendera partai lokal itu. Hal itu diungkapkan Sekretaris PA Bireuen, Muzakkir kepada Waspada, Selasa (8/ 11) terkait perusakan puluhan bendera di kawasan Simpang

IV Peusangan itu. “Sekira sepuluh bendera PA terlihat sengaja di rusak, buktinya seperti sengaja dirobek-robek dengan memakai benda tajam,” katanya. Terkait masaah itu, lanjut Muzakkir, pihaknya telah melapor ke pihak berwajib untuk mengusut tuntas, supaya hal serupa tidak terulang lagi. “Di Aceh sekarang ini sedang berjalan demokrasi yang baik, namun yang kita sayangkan masih ada oknum-oknum tertentu yang mencoba merusak tatanan demokrasi yang sedang dibangun di Aceh ini, makanya kami

meminta pihak berwajib supaya mengusut tuntas perusakan bendera PA di Peusangan khususnya di kawasan Simpang IV Gle Kapai, supaya ke depan tidak dialami oleh partai lokal (Parlok) maupun Partai Nasional (Parnas) lain nanti,” harap Muzakkir. Hal senada juga disampaikan pengurus Partai Aceh Kucamatan Peusangan, Kabupaten Bireuen, Rusyidi. Dia menyesalkan ada orang-orang yang merusak atribut partainya. Menurutnya, pengoyakan bendera diduga dilakukan orang tidak senang dengan

partai lokal pemenang Pemilu itu. “Pengurus PA tidak takut dengan aksi orang yang hendak mengacaukan perdamaian,” katanya. Dijelaskan, Partai Aceh merupakan salah satu partai politik lokal di Aceh yang keberadaannya sah secara hukum dan mendapat pengakuan baik secara nasional maupun internasional. Di mana, partai lokal ini terbentuk menyusul lahirnya MoU antara RI-GAM di Helsinki, Finlandia. “Tidak wajar jika ada pihak dengan sengaja melakukan perusakan dengan mengoyak bendera Partai Aceh,” katanya. (cb02/b17)

Saya Tak Simpan Uang… MESKI kepolisian terus memburu dan mengejar pelaku penembakan keluarga penderes karet di Desa Bagok Panah IV, Kecamatan Darul Aman—Idi Cut, Kabupaten Aceh Timur, namun hingga kini modusnya masih misteri dan menjadi PR besar. Sebab, selain aksi itu telah menghilangkan nyawa orang lain secara tidak manusia, dua orang tak dikenal (OTK) dengan menggunakan senjata api (senpi) sejenis AK-47 dan menggunakan sebo (penutup wajah) telah membuat masyarakat Aceh kembali resah. Padahal setelah 15 Agustus 2005 silam seluruh senjata di tangan GAM telah dipotong sebagai tanda perdamaian setelah berkonflik selama 32 tahun lebih antara Pemerintah RI-GAM di Aceh. Motif penembakan Rubiah Binti Abdul Manaf di Desa Bagok Panah IV, Kecamatan Darul Aman–Idi Cut hingga kini masih misteri. Ketika Waspada melayat ke rumah duka Senin (7/11) sejumlah informasi baru berhasil diperoleh, di antaranya adalah dua OTK sempat mendobrak pintu kamar dan sempat mengancam sebelum menembak. Rumah duka tergolong tidak sepi dan bisa dilintasi mobil dari berbagai jenis. Meski loksinya terpaut mencapai 7 kilometer ke arah selatan ibukota Idi Cut, Kecamatan Darul Aman, namun jalan antar dusun di desa itu tergolong ramai dilalui sepedamotor warga yang keluar dan masuk ke desa itu. Abdul Jalil, suami korban yang merupakan saksi kunci dan sempat berhadapan dengan dua pelaku saat pertama membuka pintu rumah mengisahkan, kejadian malam itu sama sekali tidak disangkanya, sebab dirinya sama sekali tidak punya firasat buruk dan tandatanda apapun. Namun tibatiba sekira pukul 23:30 setelah Abdul Jalil bersama isterinya menutup kiosnya dan mengangkut barang-barang dagangan seperti rokok ke rumah didatangi dua OTK. “Suara ucapan salam itu seperti biasa dan seperti orang ingin membeli rokok. Suaranya seperti suara pernah di dengar dan ucapan salamnya bagus. Makanya saya langsung membuka pintu tanpa melihat dari jendela,” ungkap Abdul Jalil seraya menambahkan, setelah ucapan salam salah satu dari keduanya juga meminta rokok. “Bang, na rukok (ada rokok),” ujar Abdul Jalil meniru kalimat yang diutarakan dua OTK sebelum dirinya membuka pintu. Tanpa curiga Abdul Jalil mendekati pintu depan dan langsung mem-

buka pintu. Dirinya sangat terkejut melihat di depan pintu berdiri dua orang dengan pakaian warnanya tidak begitu jelas dilihatnya, tetapi seingatnya di pakaiannya ada lorenglorengnya dan menggunakan penutup muka berwarna hitam, sementara yang satu lagi menggunakan sebo warna putih. Melihat gelegat keduanya lain, apalagi Abdul jalil melihat senjata api yang ditentengnya dia langsung kanan dan masuk ke kamar seraya megunci pintu kamarnya. “Sambil saya tahan pintu saya meminta tolong beberapa kali. Istri saya juga minta tolong,” ujarnya seraya menyebutkan, teriakan minta tolong hanya 3 kjali keluar dari mulut istri saya dan lima kali dari mulut saya,” ujarnya. Ternyata dua OTK itu juga ikut ke pintu dan meminta saya untuk membuka pintu kamar sambil mengancam jika pintu tak dibuka akan ditembak. Saat itulah saya mencoba berteriak yang lebih keras lagi, namun jeritan minta tolongnya langsung disambut dengan suara tembakan dari luar yang menembusi pintu kamar dan mengenai isteri dan beberapa serpihannya terkena di dada Abdul Jalil. Rubiah yang terkana peluru di bagian wajahnya langsung terjatuh di kamarnya bahkan darahpun bercecer di pintu dan di lantai rumah panggung yang berlantai kayu itu. Suara rentetan senjata juga membangunkan seluruh anaknya, terutama anaknya yang paling bungsu

yaitu Agusliadi yang masih berumur 3 tahun lebih. Satu jam setelah kejadian, warga mengetahui kejadian itu langsung merapat ke rumah Abdul Jalil. Kepolisian yang mengetahui kejadian itu juga ikut ke lokasi. Rubiah sempat dilarikan ke RSUD Idi untuk proses visum. Sementara Abdul Jalil hingga pagi masih dirawat di Puskesmas Darul Aman dan kembali ke rumah dengan pengawalan polisi sekira pukul 10:00. Ibu setengah baya itu sepeninggalnya menghadap sang khalik meninggalkan 5 orang buah hatinya, yakni, Afridani, 21, mahasiswi salah satu Akadememi Kebidanan di Kota Lhokseumawe, Juhari, 20, mahasiswa salah satu Akademi Keperawatan di Kota Langsa, Amiruddin, 18 (Kelas III SMAN 1 Darul Aman), Hamdani, 13, (Siswa SMPN 1 Darul Aman) dan Agusliadi yang baru berusia 3 tahun. Rutin Menderes Abdul Jalil juga mengaku, seperti biasanya setiap hari dirinya rutin melakukan aktivitas menderes getah di kebun karetnya yang luasnya lebih kurang 2 hektare yang berjarak 1 kilometer ke arah selatan rumahnya. Sepulang dari menderes dirinya selalu membantu istrinya berjualan di kios kecil yang terletak persis disisi rumahnya. “Saya adalah tergolong orang susah, saya tak punya simpanan uang dalam jumlah banyak, selama ini untuk biaya sekolah anak-anak hanya saya

andalkan hasil dari kebun getah dan jualan kios kecil-kecilan, bahkan untuk biaya sekolah mereka sering saya utang sama toke getah tempat saya jual getah,” sebut Abdul Jalil lagi. Kades Bagok Panah IV, Abdurrahman membenarkan keluarga Abdul Jalil tergolong miskin dan sudah. Namun untuk anak-anaknya dia menghendaki agar berhasil. “Tidak pernah kita dengar Abdul Jalil atau isterinya Rubiah mempunyai perselisiahan dengan warga lainya. Almarhum juga tergolong orang yang pendiam,” ujarnya. Kapolres Aceh Timur AKBP Drs Ridwan Usman melalui Kapolsek Darul Aman AKP Sofyan secara terpisah mengatakan, hingga saat ini pihaknya belum mengetahui apa motif penembakan terhadap korban Rubiah. “Kasus ini masih kita kembangkan dan selidiki lebih mendalam. Apakah modus perampokan, dendam atau liannya kita belum tahu pasti,” tandasnya. Peristiwa yang mengejutkan warga Idi Cut dan sekitarnya terjadi di rumah Abdul Jalil di Dusun Tungku Mae, Desa Bagok Panah IV, Kecamatan Darul Aman, Jumat (4/11) sekira pukul 01:00. Akibat serangan dari OTK, Abdul Jalil mengalami sejulmlah luka serpihan senjata api seperti di lengan dan dada, sementara istrinya tewas dengan luka tembak di bagian kepala tembus rahang. Muhammad H. Ishak

Waspada/Muhammad H. Ishak

Abdul Jalil memperlihatkan bekas serpihan senjata api saat diserang OTK di rumahnya di Desa Bagok Panah IV, Kecamatan Darul Aman, Aceh Timur.

Waspada, Rabu 9 November 2011