Page 1

Medan 24-330C

Berastagi 19-290C

R. Prapat 25-330C

Parapat 20-300C

P. Siantar 18-280C

Sibolga 20-28 0C


Hujan guntur

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Rabu

BMKG Polonia

RABU, Kliwon, 29 September 2010/20 Syawal 1431 H

No: 23281 Tahun Ke-64

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-

TNI Siap 2011 Jakarta Bantu Polri Lumpuh Total JAKARTA(Antara): Tentara Nasional Indonesia ( TNI) siap menerjunkan pasukannya untuk menanggulangi terorisme manakala diperlukan, kata Panglima TNI Laksamana Agus Suhartono. “(Untuk) Penanganan teroris kita punya pasukan khusus. Manakala itu diperlukan, kemudian kebijakan politik memerintahkan kita bersamasama dengan Polri, kita akan melakukan itu,” ujar Agus Suhartono usai dilantik menjadi Panglima TNI oleh Presiden Susilo Bambang Yudhoyono di Istana Negara, Jakarta, Selasa (28/9). Namun, menurut Agus, keterlibatan TNI dalam memberantas tindakan terorisme masih harus menunggu atu-

JAKARTA(Waspada): Kemacatan lalulintas Jakarta semakin parah. Pemerintah Provinsi DKI Jakarta belum mampu mengatasinya, bahkan jumlah kendaraan makin meningkat. Diprediksi tahun 2011 lalu lintas Jakarta lumpuh total.

ran yang tengah digodok bersama oleh semua pihak yang tergabung dalam Badan Nasional Penanggulangan Terorisme. “Itu yang digodok bersama. Mudah-mudahan ke depan ada sinergi cukup bagus antara TNI dan Polri. Tapi pengarahan keterlibatan pada penanggulangan terorisme kita tunggu mekanisme dari Badan Nasional Penanggulangan Terorisme,” katanya.

Data Polda Metro Jaya, Selasa (28/9) akan ada 12 juta kendaraan hilir mudik pada 2011 di jalan Jakarta. Diperkirakan, bila tidak diambil langkah cepat dan tepat, lalulintas Jakarta lumpuh. Polisi merilis tahun 2010 ini jumlah kendaraan di Jakarta mencapai 11.362.396 unit k e n d a r a a n . Te rd i r i d a r i 8.244.346 unit kendaraan roda dua dan 3.118.050 unit kendaraan roda empat. Jika jumlah kendaraan ta-

Lanjut ke hal A2 kol. 7

hun ini ditambah dengan masuknya kendaraan baru sebanyak 700 ribu kendaraan, maka akan ada 12 juta kendaraan menyemut di jalan Jakarta. Data 700 ribu kendaraan baru ini menyitir pernyataan Gubernur DKI Jakarta Fauzi Bowo. Foke, demikian ia sering dipanggil, memperkirakan ada 700 ribu kendaraan baru yang akan dipasarkan di Jakarta pada tahun 2011 nanti.

Lanjut ke hal A2 kol. 7

3 Wanita Kamboja Selundupkan Sabu Dan Morfin Rp16,1 M

MK Putuskan Pilkada Ulang Di 17 Kelurahan Kota T. Balai

TANGERANG (Waspada): Dalam dua hari, tiga wanita warga negara Kamboja ditangkap Tim Customs Tactical Unit (CTU) Bandara Soekarno-Hatta karena berupaya menyelundupkan 3.950 gram atau 3,95 kilogram methampetamine atau sabu dan 2.033 gram atau 2,033 kg morfin melalui Jakarta. Estimasi barang bukti yang disita sebesar Rp 16,1 miliar. ”Ini baru pertama kalinya warga Kamboja menjadi penyelundup narkotika ke Indonesia melalui Bandara Internasional Soekarno-Hatta,” kata Kepala Kanwil Direktorat Jenderal Bea Cukai Provinsi Banten, Nazar Salim kepada wartawan di Pabean Soekarno-Hatta, Selasa (28/9).

TANJUNGBALAI (Waspada) : Mahkamah Konstitusi (MK) memutuskan pemungutan suara ulang Pilkada Tanjungbalai di 17 kelurahan. Ketua KPUD Tanjungbalai, Firmansyah Mingka kepada Waspada melalui saluran telefon, Selasa (28/9) mengatakan, pemungutan suara ulang di 17 kelurahan, dan diikuti seluruh pasangan calon,” kata Firmansyah. Ke 17 kelurahan yakni, di Kec Teluknibung meliputi Kel Betingkuala Kapias, Pematangpasir, Seimerbau, Kapias Pulau Buaya. Untuk Kec Seitualang Raso meliputi Kel Seiraja, Muarasentosa, Sumbersari, Pasarbaru, dan Keramat Kubah. Selanjutnya, untuk Kec

Kepala KPPBC Tipe Madya Pabean Soekarno-Hatta, Bahaduri Wijayanta menjelaskan, Sabtu sekitar pukul 11:30, tersangka PT ,25, datang dengan menggunakan pesawat Thai Airways nomor penerbangan TG-433 dari Bangkok ke Jakarta. Pada dinding atas dan bawah tas punggung atau ransel (bag pack) berwarna biru yang dibawa tersangka ditemukan dua kemasan berisikan sabu senilai Rp 2,85 miliar. Keesokan harinya, Minggu pukul 11:30, petugas menangkap VV ,32, karena kedapatan membawa morfin seberat 2,033 kg senilai Rp 10,165 miliar. Tersangka datang dari Bangkok ke Jakarta dengan

Lanjut ke hal A2 kol. 7

KENDARAAN bermotor bergerak perlahan melewati Jalan MT Haryono, Jakarta, baru-baru ini.


Tanjungbalai Utara hanya Kel TB Kota III, sedangkan di Kec Tanjungbalai Selatan meliputi Kel Pantaiburung, dan Perwira. Di Kec Datukbandar Timur meliputi Kel Pulausimardan dan Selatlancang, sementara di Kec Datukbandar hanya Kel Sijambi, Sirantau dan Pahang. Firmansyah menjelaskan, Ketua Majelis Moh. Mahfud MD dibantu anggota M Arsyad Sanusi, dan Maria Farida Indrati, memutuskan Pilkada ulang di 17 kelurahan, karena pasangan nomor urut 6 Eka Hadi Sucipto-Afrizal Zulkarnain, terbukti melakukan money politics secara terstruktur, sistematis dan masif.

Lanjut ke hal A2 kol. 7

Menag: Calhaj Di Ring Dua Disediakan Transportasi Dan Dapat Sisa Uang Rumah


KANTOR Bea dan Cukai bandara Soekarno Hatta berhasil menggagalkan upaya penyelundupan sabu dan kokain yang dibawa kurir Kamboja, Afrika dan Thailand, Selasa (28/9).

Tim Advokasi Siap Hadapi Kasus Mantan Wakil Walikota Ramli Mohon Hak Asimilasi MEDAN ( Waspada): 11 Advokat tergabung dalam tim a d v o k a s i m a n t a n Wa k i l Walikota Medan, DR Drs Ramli Lubis, MM menyatakan siap menghadapi proses hukum kliennya di persidangan dalam kasus ruislagh KBM (Kebun Binatang Medan). “Selain itu kami selaku

kuasa hukum Ramli Lubis, juga telah memohon agar berkas perkara itu segera dilimpahkan,” kata Ketua Tim Advokasi, Hasrul Benny Harahap, SH, M.Hum kepada wartawan dalam jumpa pers di kantornya, Selasa (28/9).

Lanjut ke hal A2 kol. 4

BACA DI HALAMAN DALAM Pelayanan RS Di Indonesia Masih Rendah Keinginan masyarakat Indonesia untuk berobat ke luar negeri cukup tinggi. Hal ini disebabkan masih rendahnya pelayanan terhadap pasien di Indonesia. A5

Penertiban Babi Dimulai Minggu Ini Walikota Medan mengatakan, penertiban ternak babi di Kec. Medan Denai dimulai minggu ini. Hal itu dilakukan sesuai peraturan tentang larangan usaha ternak berkaki empat. A3

JAKARTA (Antara): Menteri Agama (Menag) Suryadharma Ali mengakui pelaksanaan ibadah haji kadang mengundang kekhawatiran karena meski merupakan kegiatan rutin namun sangat dinamis. Hal itu dapat terlihat dari perkembangan baru yang menonjol pada tahun 2010, yaitu bertambahnya jumlah kuota haji Indonesia dari 210 ribu menjadi 221 ribu, kata Menag pada pengarahan pembukaan qur’ah (undian) Maktab Jamaah Haji Indonesia 1431 H/2010 M di Jakarta, Selasa (28/9). “Perkembangan itu mempengaruhi persiapan yang dilakukan,” katanya di Jeddah. Idealnya, menurut Menag, jamaah haji dapat menempati pemondokan dekat dengan Masjidil Haram agar mudah melaksanakan ibadah tanpa menggunakan transportasi yang pengaturannya sangat rumit. Tapi, kata dia, hal itu tidak mudah karena beberapa hal, seperti jumlah jamaah haji

Indonesia yang sangat besar dengan persaingan perolehan pondokan dengan negara lain sangat ketat dan harga sewa pondok yang sangat kompetitif. Kenyataan di lapangan sulit dihindari, kata dia, karena itu harus dicarikan solusinya dengan kiat-kiat khusus yang dapat mengurangi tekanan pasar dalam penyewaan rumah dan mengatasi masalah lainnya. Bertolak dari pemikiran

tersebut, kata dia, penyewaan rumah tahun ini dilakukan lebih dini dengan menurunkan tim sembilan. Semua itu dimaksudkan agar tim memiliki kesempatan untuk memilih lokasi pemondokan dengan harga logis dan terjangkau, kata Menag. Menag mengatakan, jumlah pemondokan yang akan ditempati jamaah dan petugas di Makkah sebanyak 347 ru-

Kloter I Calhaj Sumut Tempati Maktab 34 MEDAN (Waspada): Kelompok terbang (Kloter) I jamaah calon haji (calhaj) asal Sumatera Utara yang akan berangkat tanggal 11 Oktober mendatang, akan menempati maktab (pemondokan) 34 wilayah Jumaizah. Demikian disampaikan Ketua Pantia Penyelenggaraan Ibadah Haji (PPIH) Embarkasi Medan Drs H Syariful Mahya

Bandar, MAP dan Sekretaris Drs H Abdul Rahman MA, melalui telefon selularnya, dari Jakarta, Selasa (28/9), usai mengikuti qur’ah nasional. Syariful Mahya menyebutkan, untuk kloter 2, maktab 58 Bakhtumah, kloter 3 maktab 9 wilayah Syisyah. Kloter 4 maktab 44 wilayah Mislafah,

Lanjut ke hal A2 kol. 7

Menkeu: TDL Naik 15% Hingga 2013 Menkeu tetap menginginkan adanya kenaikan tarif dasar listrik ( TDL) sebesar 15 persen hingga 2013. Alasannya, jika TDL tidak naik maka anggaran tidak akan efektif dan terbakar begitu saja untuk subsidi. B12


BENDERA Filipina dilatarberalakangi kapal USS Blue Ridge, yang tiba di pelabuhan North Harbor, Manila.


KE 13 pria asal Lubuk Pakam, Deli Serdang, menunggu pemeriksaan polisi di ruang tunggu Kasat Reskrim Mapolres Kota Lhokseumawe, Selasa (28/9).

13 Penjual Buku Asal L. Pakam Diamankan KOTA LHOKSEUMAWE ( Waspada): Aparat Polres Lhokseumawe, Senin (27/9) malam, mengamankan 13 orang warga asal Kec. Lubukpakam, Kab. Deliserdang, dari salah satu rumah kos di Jalan Kenari, Kec. Banda Sakti, Kota Lhokseumawe. Ke 13 pria itu yakni, Masriadi, 33, Warga Dusun Ampera, Desa Sekip, Murhadi Ugan-

Ini Jodoh Atau Salah Densus

AS Minta Maaf Bendera Filipina Dipasang Terbalik WASHINGTON (Waspada): Pemerintah Amerika Serikat (AS), meminta maaf secara resmi kepada Filipina atas insiden ‘bendara terbalik’ pada pertemuan Presiden Barack Obama dengan kepala negara ASEAN di New York Jumat lalu. Bendera Filipina berwarna merah, putih dan biru dengan ornamen bintang berwarna kuning tersebut dipasang terbalik saat Presiden Filipina Benigno Aquino III berbincang dengan Presiden Obama tepat di depan barisan bendera. Lanjut ke hal A2 kol. 1

mah berkapasitas 200.855. Sebanyak 210 rumah berkapasitas 125.845 (63 persen) masuk dalam kategori ring satu. Sebanyak 164 rumah berkapasitas 75.010 (37 persen) masuk ring dua. Jamaah yang pemondokan di ring satu tidak ada pengembalian dana transportasi. Sedangkan yang menempati pemondokan di ring dua disediakan transportasi dan jamaah mendapat pengembalian sisa uang sewa rumah. Ia menjelaskan pula, sesuai dengan ketentuan pemerintah Arab Saudi, jamaah yang menempati pemondokan dengan jarak lebih dari 2.000 meter dari Masjidil Haram harus disediakan fasilitas transportasi. Target mendapat pemondokan di Markaziyah 95 persen dan lima persen di nonMarka-ziyah tercapai. Jamaah yang mendapat pemondokan di luar Markaziyah mendapat pengembalian uang sebesar 100 real Arab Saudi, kata Suryadharma Ali.

Bintang Tua Film Titanic Meninggal Usia 100 Tahun HOLLYWOOD (AP): Gloria Stuart, aktris pemeran Rose DeWitt Bukater tua dalam film Titanic, meninggal dunia di usia 100 tahun pada Senin (27/9) waktu setempat. Sylvia Thompson, putri dari Gloria kepada kantor berita Associated Press membenarkan kabar tersebut. Sang ibu, meninggal setelah mengalami gagal

Lanjut ke hal A2 kol. 4

JODOH adalah satu dari empat rahasia tuhan yang tak diketahui hambaNya. Meski jadwal pernikahan telah ditetapkan, undangan pernikahan telah disebar, tak ada yang mampu memastikan apakah rencana dan niat itu terwujud atau tidak. Tapi, sungguh mengejutkan bahkan mungkin menyakitkan apa yang terjadi pada Bawor atau Wahono asal Lampung. Calon mempelai bagi Siti Aisyah itu urung menikah lantaran ia dicokok Densus 88 di Medan terkait perampokan Bank CIMB Niaga. Seharusnya ia menikahi Siti Aisyah, Kamis pekan lalu di Lampung. Namun, Wahono ditangkap beberapa hari menjelang pernikahannya. Lanjut ke hal A2 kol. 7

da, 24, Jalan Sudirman, Kel. Lubukpakam, Teddi Zulfansyah, 47, Jalan Ampera, Desa Sekip, Ade Irmansyah, 28, Jalan Pembangunan, Indra Syahputra, 31, Jalan Thamrin, Kelurahan Desa Lubukpakam. Rajiono, 31, Gang Ampera No 48, Desa Sekip, Yusrizal, 33, Jalan Pembangunan II Desa Sekip,

Lanjut ke hal A2 kol. 2

Mantan Bupati Aceh Timur Ditahan LANGSA (Waspada): Setelah menghabiskan waktu panjang melalui surat panggilan Kejari Langsa hingga tiga kali, mantan Bupati Aceh Timur, Azman Usmanuddin, Selasa (28/9) petang, mendatangi Lembaga Pemasyarakatan. Putusan yang sama dari Mahkamah Agung (MA) RI, juga menyeret Ketua DPRK Langsa,

Lanjut ke hal A2 kol. 1

erampang Seramp ang net

TEGUH adik Wahono yang menikahi Siti Aisyah, calon mempelai kakaknya.

- Untung gue bukan orang Jakarte - He...he...he...

Medan 24-33 0C

P.Sidimpuan 19-29 0C

R.Prapat 25-33 0C

Penyabungan 20-30 0C

Berastagi 18-28 0C

Sibolga 20-28 0C Hujan guntur


WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

  z Edisi Luar Kota RABU, Kliwon, 29 September 2010/20 Syawal 1431 H  z No: 23281 Tahun Ke-64

Terbit 24 Halaman (A1-12, B1-12)  z Harga Eceran: Rp 2.500,-

Janda Korban Konflik Demo Tuntut Uang Duka Cita

BANDA ACEH (Antara): Puluhan janda dan ahli waris korban konflik asal Kabupaten Aceh Besar menuntut kejelasan dana diat (uang duka cita), karena dalam dua tahun terakhir mereka tidak mendapatkannya lagi. Pertanyaan itu disampaikan dalam unjukrasa ke Gedung DPR Aceh di Banda Aceh, Selasa (28/9), sekaligus meminta lembaga itu mendesak Pemerintah Aceh dan Badan Reintegrasi Aceh (BRA) untuk segera menyalurkan bantuan korban konflik yang masih tertahan. Kordinator aksi, Agusta Muktar mengatakan, pihaknya menuntut kejelasan tentang dana diat yang dulu dijanjikan diberikan kepada tiap korban konflik Rp3 juta pertahun, namun dalam dua tahun terakhir banyak korban tidak menerimanya. “Kami meminta BRA segera menyalurkan dana diat yang merupakan hak dari korban yang suaminya, anggota keluarganya telah dibunuh di masa konflik,” katanya. Dikatakan, korban konflik gelisah dengan pernyataan petinggi BRA beberapa waktu lalu yang menyebut, BRA tidak lagi menganggarkan dana diat mulai tahun ini. Menurutnya, jika kebijakan itu benar berlaku, maka sangat menyakitkan hati korban konflik. “Kami tidak meminta harga nyawa keluarga kami dibayar, karena nyawa orang yang kami cintai tidak sanggup dihargai ber a p a p u n , t e t a p i k a m i m e m i n t a Lanjut ke hal A2 kol 3

Maling Larikan Brankas Kopdit CV BMS Berisi Rp95 Juta


KORBAN KONFLIK. Salah seorang warga korban konflik asal Kabupaten Aceh Besar, tak kuasa menahan tangisnya saat bertemu dengan anggota DPR Aceh, di Banda Aceh, Selasa (28/9). Ratusan warga korban konflik yang sempat diancam di tengah perjalanan oleh kelompok tak dikenal saat hendak menuju DPR Aceh itu, meminta anggota dewan mendesak Badan Reintegrasi Aceh (BRA) menepati janjinya yang akan menyalurkan batuan dana diyat tahun 2010 bersumber dari pemerintah pusat.

PEMATANGSIANTAR (Waspada): Kantor Koperasi Kredit (Kopdit) CV Bina Mitra Sejahtera (BMS) di Jalan Sisingamangaraja, Kel. Bane, Kec. Siantar Utara, Kota Pematangsiantar, Selasa (28/9) dinihari dimasuki maling dan kemudian melarikan brankas berisi uang milik para anggota Rp95 juta. Keterangan dihimpun maupun penuturan Ketua, Sekretaris dan Bendahara/ Manajer Kopdit W. Turnip, SE, KF. Sitanggang dan M. Lumbangaol di tempat kejadian, diduga kawanan maling memasuki kantor dengan merusak gembok pintu harmonika. Sedangkan kantor Kopdit malam hari tanpa penjagaan. Kawanan maling menuju ruangan tempat penyimpanan brankas di bagian belakang dan membuka kunci pintu secara paksa serta memboyong brankas seberat 300 kg lalu membawanya dengan mobil yang menunggu di depan. Brankas itu berisi uang kontan Rp80 juta lebih dan dua buku BPKB sepeda motor inventaris kantor. Menurut W. Turnip aksi pencurian itu diketahui sesudah tetangga sebelah kantor memberitahu salah seorang pengurus Kopdit, karena merasa curiga melihat pintu harmonika terbuka. Polsek Siantar Utara dan Polresta Pematangsiantar yang menerima laporan tentang pencurian itu segera melakukan penyelidikan dan menyita satu gembok rusak sebagai barang bukti. Kopdit yang didirikan 14 Juli 2002 itu memiliki 4.300 anggota di Pematangsiantar dan Simalungun serta memiliki Lanjut ke hal A2 kol 2

Mantan Bupati Aceh Timur Gol Polisi Amankan 13 Warga L. Pakam Di Lhokseumawe

KOTA LHOKSEUMAWE (Waspada): Personel polisi dari Markas Polisi Resort Kota Lhokseumawe mengamankan 13 warga asal Kec. Lubuk Pakam, Kab. Deliserdang, Sumatera Utara, dari salah satu rumah kos Jalan Kenari, Kec. Banda Sakti, Pemerintah Kota Lhokseumawe, Senin (27/9), sekitar pukul 22:00. Ke 13 pria itu yakni Masriadi, 33, Dusun Ampera, Desa Sekip, Murhadi Uganda, 24, Jalan Sudirman, Desa Lubuk Pakam Pekan, Teddi Zulfansyah, 47, Jalan Ampera, Desa Sekip, Ade Irmansyah, 28, Jalan Pembangunan, Indra Syahputra, 31, Jalan Thamrin, Desa Lubuk Pakam Pekan. Selanjutnya, Rajiono, 31,

Gang Ampera No 48, Desa Sekip, Yusrizal, 33, Jalan Pembangunan II Desa Sekip, Zulfan Lubis, 28, Jalan Ampera, Desa Sekip, Dedi Sapryanto, 28, Jalan Thmren, Gang Saudara, Ahmad Wardana, 28, Bengkong Indah, Batam, Kalpin, Lubuk Pakam, Roni, Jalan pembangunan, dan Musriadi, 27, Lubuk Pakam. AKBP Kukuh Santoso, Kapolres Kota Lhokseumawe, Selasa (28/9) melalui AKP Bambang S, Kasat Reskrim di ruang kerjanya kepada wartawan menjelaskan, ke 13 pria asal Lubuk Pakam itu diamankan berdasarkan laporan warga, di mana mereka masuk

Ketua DPRK Langsa Menyusul LANGSA (Waspada): Setelah tiga kali dipanggil melalui surat oleh Kejari Langsa mantan Bupati Aceh Timur, Azman Usmanuddin, Selasa (28/9) petang akhirnya mendatangi Lembaga Pemasyarakatan (LP). Putusan yang sama dari Mahkamah Agung (MA) RI, juga menyeret Ketua DPRK Langsa, Muhammad Zulfri yang akan menyusul masuk penjara (gol), Rabu (29/9) hari ini.

JAKARTA( Waspada): Kemacatan lalulintas Jakarta semakin parah. Pemerintah Provinsi DKI Jakarta belum mampu mengatasinya, bahkan jumlah kendaraan makin meningkat. Diprediksi tahun 2011 lalu lintas Jakarta lumpuh. Data Polda Metro Jaya, Selasa(28/9) akan ada 12 juta kendaraan hilir mudik pada 2011 di jalan Jakarta. Diperkirakan, bila tidak diambil langkah cepat dan tepat, lalulintas Jakarta lumpuh. Polisi merilis tahun 2010 ini jumlah kendaraan di Jakarta mencapai 11.362.396 unit kendaraan. Terdiri dari 8.244.346 unit kendaraan roda dua dan 3.118.050 unit kendaraan roda empat.

Lanjut ke hal A2 kol 7

10 meter jatuh dan longsor dengan kedalaman 9 meter. Abrasi ini juga menyebabkan besi baja pagar jalan ikut runtuh. Muhammad, 60, salah seorang warga Purba Lama mengatakan, abrasi ini terjadi malam hari. Tiba-tiba tembok penahan jebol dan jatuh diikuti runtuhnya pembatas jalan. Kondisi ini sangat membahayakan pengguna jalan, Lanjut ke hal A2 kol 3

Waspada/Alpin Lubis

ABRASI: Jalinsum Panyabungan-Kotanopan, Kab. Mandailing Natal, di Desa Purba Lama, Kec. Lembah Sorik Merapi abrasi sepanjang 10 meter karena hujan beberapa hari terakhir. Foto direkam, Selasa (28/9).

TNI Siap Terlibat Penanggulangan Teroris

2011 Lalulintas Jakarta Lumpuh

Jalinsum PanyabunganKotanopoan Kembali Abrasi PANYABUNGAN (Waspada): Ruas Jalan Lintas Sumatera (Jalinsum) Panyabungan - Kotanopan di Desa Purba Lama, Kec. Lembah Sorik Merapi, Kab. Mandailing Natal kembali amblas sepanjang 10 meter, Senin (27/09) malam. Hal itu terjadi karena hujan yang turun terus-meneruis beberapa hari terakhir. Pantauan Waspada, Selasa (28/09), kondisinya cukup parah, dan tembok penahan jalan sepanjang

Mantan orang nomor satu Aceh Timur itu datang ke LP sendiri, tanpa didampingi kerabat dan Penasehat Hukum (PA) Habsah, SH. Beberapa saat kemudian jaksa dari Kejari Langsa muncul di LP. Demikian juga dengan PH bersangkutan. Lanjut ke hal A2 kol 3

Suasana kemacatan lalulintas di Jakarta.


Lanjut ke hal A2 kol 3


PRESIDEN Susilo Bambang Yudhoyono (kedua kanan) dan Ibu Negara Ani Yudhoyono (kanan) memberikan ucapan selamat kepada Panglima TNI Laksamana TNI Agus Suhartono (kiri) dan Isteri, Tetty Su-giarti seusai acara pelantikan Panglima TNI di Istana Negara, Jakarta, Selasa (28/9). Dalam kesempatan yang sama, Presiden melantik Kepala Staf Angkatan Laut (KASAL) yang baru Laksa-mana Madya TNI Soeparno. JAKARTA (Waspada): Pasukan TNI akan siap terlibat dalam penanggulangan gerakan terorisme di Indonesia. Bila nanti peran TNI benar-benar diperlukan, maka TNI akan segera turun tangan. Panglima TNI yang baru Laksamana TNI Agus Suhartono menyampaikan hali ini usai dilantik di Istana Negara, Selasa (28/9). “Kita

punya pasukan khusus dan manakala itu diperlukan dan bila politik memerintahkan kita ikut menangani bersama-sama Polri, kita akan melakukannya,” tegasnya. Agus mengatakan TNI akan mengi k u t i a r a h a n d a r i B a d a n Na s i o n a l Lanjut ke hal A2 kol 1

900 Guru Non PNS Di Madina Menanti Tunjangan Fungsional

Nasihat Ba’asyir Untuk Ariel:

Shalat DanTobat

JAKARTA ( Waspada): Pimpinan Jama’ah Ansharut Tauhid, Ustad Abu Bakar Ba’asyir menjalani penahanan bersama Ariel ‘Peterpan’ di Rumah Tahanan Badan Reserse dan Kriminal Mabes Polri. Sang Ustad sering menasihati tersangka video porno itu untuk rajin melaksanakan shalat dan bertaubat. “Saya sering nasihati Ariel, supaya bertobat dan menjalankan shalat lima waktu,” kata Abu Bakar Ba’asyir seperti dikutip asisten pribadinya, Hasyim Abdullah, di Mabes Polri, Jakarta, Selasa (28/9). Ariel pun tampaknya menuruti nasihat pengasuh Pondok Pesantren Al Mukmin, Ngruki, Solo itu. Tersangka kasus video mesum itu semakin rajin menunaikan shalat. “Ya akhirnya Ariel memang sekarang sering shalat ,” kata dia. Selain itu, Ba’asyir pun tampaknya semakin diberi keleluasaan di dalam tahanan. Semula, pria 71 tahun itu dilarang menunaikan shalat berjamaah. Namun, kini dia sudah bisa melaksanakan shalat berjamaah dengan tahanan lainnya. “Ustad sekarang sudah jadi imam tiap kali shalat wajib,” kata dia. Ba’asyir ditangkap pada 9 Agustus. Dia dituduh terkait dengan Jaringan teroris yang menggelar latihan di Pegunungan Jalin, Jantho, Aceh Besar. Ba’asyir yang ditahan hingga 15 Desember itu dijerat dengan Pasal 7, 9, 11, 14 Lanjut ke hal A2 kol 2

Bintang TTua ua FilmT itanic FilmTitanic Meninggal HOLLYWOOD (AP): Gloria Stuart, aktris pemer a n R o s e D eW i t t Bukater tua dalam film Titanic, meninggal dunia di usia 100 tahun pada Senin (27/9) waktu setempat. Sylvia Thompson, putri dari Gloria kepada kantor berita Associated Press membenarkan kabar tersebut. Sang ibu, meninggal setelah mengalami gagal pernapasan di rumahnya di Los Angeles pada Minggu (26/9) malam. “Dia juga adalah seorang yang berhasil selamat dari penyakit kanker payudara. Dia memiliki kehidupan Lanjut ke hal A2 kol 4


Teguh adik Wahono yang menikahi Siti Aisyah, calon mempelai kakaknya.

Ini Jodoh Atau Salah Densus JODOH adalah satu dari empat rahasia tuhan yang tak diketahui hambaNya. Meski jadwal pernikahan telah ditetapkan, undangan pernikahan telah disebar, tak ada yang mampu memastikan apakah rencana dan niat itu terwujud atau tidak. Tapi, sungguh mengejutkan bahkan mungkin menyakitkan apa yang terjadi pada Bawor atau Wahono asal Lampung. Calon mempelai bagi Siti Aisyah itu urung menikah lantaran ia dicokok Densus 88 di Medan terkait perampokan Bank CIMB Niaga. Seharusnya ia menikahi Siti Aisyah, Kamis pekan lalu di Lampung. Namun, Wahono ditangkap beberapa hari menjelang pernikahannya. Keluarga mana yang tak panik, calon mempelai mana Lanjut ke hal A2 kol 2

PANYABUNGAN (Waspada): 900-an lebih guru non pegawai negeri sipil yang terdiri guru-guru madrasah bernaung di bawah lingkungan Kantor Kementerian Agama Kabupaten Mandailing Natal saat ini menanti dicairkannya dana tunjangan fungsional dari Kantor Perbendaharaan Negara ( KPN) yang akan ditrasfer ke rekening masingmasing. Keterangan diperoleh dari para guru non PNS ini di kota Panyabungan Selasa (28/9), pihak kantor Kementerian Agama Madina telah menyerahkan segala sesuatu yang

Lanjut ke hal A2 kol 7

Serampang - Sedih melihat wajah nenek tu ... - He.... he....he....

Berita Utama


Warga Minta Pembangunan Jalan Provinsi Sipiongot Segera Direalisasikan


RUSAK: Kondisi Jalan Lintas Sumatera Kabupaten Padanglawas Utara sampai saat ini, Selasa, (28/9) masih rusak dan berlubang, sehingga membutuhkan perbaikan.

Jalan Rusak Di Jalinsum Palas Sulitkan Investasi GUNUNGTUA (Waspada): Jalan rusak di sepanjang Jalinsum Kec. Portibi, Kab. Padanglawas Utara yang merupakan kawasan investasi saat ini kondisinya begitu memprihatinkan. Anggota DPRD Padanglawas Utara Ashar Efendi Hasibuan mengungkapkan, kawasan tersebut adalah kawasan investor seperti perkebunan dan pabrik kelapa sawit, tapi infrastruktur jalan cukup memprihatinkan, akses pendukungnya tidak maksimal. Kondisi jalinsum dan jalan kabupaten yang begitu rusak parah membuat anggota Komisi II DPRD Padanglawas Utara prihatin. Karena untuk menambah dan mendukung investor dalam usahanya yang akhirnya dapat meningkatkan perekonomian warga harus ditunjang dengan infrastruktur yang baik. Ia meminta agar anggaran dari pusat untuk pelapisan ulang jalan di Kabupaten Padanglawas Utara, sebagian dialokasikan untuk memperbaiki jalan rusak di kawasan tersebut. Disebutkannya, warga Padanglawas Utara juga punya hak sama dengan warga lainnya yang ada di daerah lainnya, untuk menikmati hasil pembangunan. Termasuk perbaikan ruas jalan rusak. Jika perbaikan ruas jalan dilakukan akan menambah investor yang masuk. Pasalnya, investasi dan investor akan lancar menjalankan aktivitas bisnisnya di kawasan Padanglawas Utara. (csp)

TNI Siap ....

Penanggulangan Terorisme (BNPT), yang kini tengah dikaji bersama. Dengan demikian, diharapkan ada sinergi yang baik antara TNI dan Polri ke depannya. Kesiapan ini, menurut Agus, telah ditopang oleh sejumlah latihan yang digelar oleh Kopassus dari TNI AD dan Detasemen Jala Mangkara (Denjaka) dari TNI AL. “Itu upaya peningkatan kemampuan pasukan khusus yang kita miliki. Tapi pengerahan keterlibatan dalam penaggulangan terorisme kita tunggu mekanisme dari Badan Nasional Penanggulangan Terorisme,” tegasnya kemudian. Agus menambahkan pasukan ini sudah siap digunakan. Hanya tinggal tunggu mekanisme penggunaannya. Namun soal jumlah pasukan yang siap, Agus masih enggan berkomentar. Dilantik Presiden Presiden Susilo Bambang Yudhoyono di Istana Negara, Selasa(28/9), melantik Laksamana TNI Agus Suhartono sebagai Panglima Tentara Nasional Indonesia (TNI) yang baru. Pelantikan dihadiri Wakil Presiden Boediono,sejumlah pejabat tinggi negara antara lain, Ketua MPR Taufik Kiemas, Ketua Mahkamah Konstitusi Mafud MD, Ketua Badan Pemeriksa Keuangan Hadi Poernomo, dan para pimpinan DPR.Para menteri koordinator dan menteri Kabinet Indonesia Bersatu II tampak hadir dalam acara pelantikan itu. Pelantikan diawali dengan pembacaan Keppres Nomor 51/TNI/2010 tentang pengangkatan Laksamana TNI Agus Suhartono sebagai Panglima TNI, dan Keppres Nomor 52/TNI/2010 tentang peng-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport Jawaban Problem Catur: 1. ......, Bg1+. 2. Rh4, Bh2+. 3. Gh3, Kg5. 4. Kg3 (KxK, fxK+mat), BxGh3+. 5. Rg4, g6. 6. Bxg6 atau hxg6; Bh3xKg3+. 7. Rf5, Bxf3+mat. Atau 7. Rh4, Bh3+mat.

angkatan Laksamana Madya TNI Soeparno sebagai Kepala Staf Angkatan Laut. Se t e l a h i t u , Pre s i d e n memimpin pembacaan sumpah dan janji jabatan yang diikuti oleh Agus dan Soeparno. Acara kemudian dilanjutkan dengan penandatanganan berkas pelantikan. Sidang paripurna DPR pada Senin 27 September 2010 secara bulat menyetujui pengangkatan Agus Suhartono sebagai Panglima TNI. Panglima TNI baru itu oleh DPR diharapkan mampu menuntaskan agenda reformasi di tubuh TNI secara menyeluruh. Semua fraksi di DPR menyetujui Agus sebagai satusatunya calon yang diajukan oleh Presiden Yudhoyono itu, setelah uji kelayakan dan kepatutan yang digelar pada 23 September 2010. Agus Suhartono menggantikan Jenderal TNI Djoko Santoso yang memasuki masa pensiun. Agus yang sebelumnya menjabat Kepala Staf Angkatan Laut itu, mengawali pendidikan militer di Akademi Angkatan Laut pada 1978. Pria kelahiran Blitar, Jatim, itu mengenyam sedikitnya sepuluh pendidikan militer tingkat lanjut. Pendidikan militer terakhir yang dia dalami adalah “Maritime Force Commander” pada 2006. Beberapa jabatan yang pernah dia emban, antara lain komandan sejumlah kapal perang, staf ahli Panglima Komando Armada RI Kawasan Timur (Armatim), Panglima Komando Armada RI Kawasan Barat (Armabar), dan Irjen Departemen Pertahanan. (kps/ant)

Maling Larikan ....

asset Rp 4,8 miliar. Pengurus koperasi meminta anggota tidak perlu cemas, sebab tidak berpengaruh atas uang simpanan mereka. Kapolresta Pematangsiantar saat dikonfirmasi melalui Kasubbag Humas Iptu Altur Pasaribu menyebutkan pencurian itu masih dalam penyelidikan. (a14)

Shalat Dan ....

jo 15 jo UU Tindak Pidana Terorisme. Sementara itu, Nazril Irham alias Ariel ditahan dalam kasus beredarnya video porno dirinya dengan artis Cut Tari dan Luna Maya. Vokalis group band Peterpan itu dijerat dengan Pasal 29 dan 35 UU Pornografi serta asal 282 KUHP tentang asusila. (VIVAnews)

Jawaban TTS:

Ini Jodoh Atau ....

yang tak berduka atas kejadian tak terduga itu. Prosesi sakral lagi bersejarah dalam hidup setiap manusia itu berantakan lantaran penangkapan oleh Densus 88. Kita apresiasi kerja aparat untuk memberantas terorisme. Tak hendak saya menafikannya. Namun dalam kasus ini, berapa banyak yang dirugikan. Terlebih Wahono. Wahono dan empat orang rekannya dilepaskan Densus pada Minggu (26/9) lalu. Mereka yang semula diduga terkait teroris dan perampokan Bank CIMB Niaga

Jawaban Sudoku: 6 7 4 8 1 2 5 3 9

3 2 1 9 7 5 8 4 6

8 5 9 6 3 4 7 2 1

5 9 8 1 2 3 4 6 7

2 1 6 7 4 8 3 9 5

4 3 7 5 9 6 1 8 2

9 6 3 4 5 1 2 7 8

1 8 2 3 6 7 9 5 4

7 4 5 2 8 9 6 1 3 406

GUNUNGTUA (Waspad): Warga Kecamatan Dolok (Sipiongot), Kabupaten Padanglawas Utara meminta Gubsu H Syamsul Arifin agar mengintruksikan Dinas Jalan dan Jembatan Sumatera Utara untuk membangun jalan mulai dari Kecamatan Halongonan, Pangirkiran sampai Kecamatan Dolok dan Dolok Sigoppulon untuk segera dituntaskan. Pasalnya jika dilihat di daerah lainnya, jalan provinsi ini lebih jelek dari jalan kabupaten. Hal tersebut diungkapkan putra daerah Kecamatan Dolok, Ishak Harahap, yang juga anggota DPRD Padanglawas Utara dari Partai Demokrat,

Senin (27/9) di Gunungtua. Dikatakannya, jalan menuju Halongonan hingga ke Dolok dan Dolok Sigoppulon kupak-kapik, sehingga sering terjadi kecelakaan dan merenggut nyawa manusia. Padahal status jalan itu adalah jalan provinsi, tapi anehnya, pihak Pemprovsu seolah-olah tutup mata dengan pembangunan jalan tersebut. “Jika diperhatikan Pendapatan Asli Daerah (PAD) di daerah ini cukup potensial yakni lahan pertanian seperti karet dan kelapa sawit,” paparnya. Bahkan, kata dia, jika ada investor yang melirik daerah khususnya di daerah hutan

t a n p a t u a n y a k n i Hu t a n Silogo-logo dan hutan Gumarutar, ribuan hektare hutan tersebut belum tersentuh manusia. Tokoh pemuda Kecamatan Dolok Kosim Sitompul mengatakan, daerah Dolok sangat potensial. “Harapan kami baik Pemkab Paluta dan Pemprovsu jangan tutup mata dengan kondisi jalan yang sudah rusak parah tersebut, kalau jalan itu tidak diperbaiki, mungkin

selamanya daerah itu akan menjadi daereah tertinggal,” harapnya. Menurut pengamatannya, kira-kira panjang jalan yang sangat parah itu sekitar 46 km, sebenarnya jika jalan itu bagus, jangka waktu dari Sipiongot ke pusat ibukota Kecamatan Dolok tidak akan memakan waktu yang banyak, tapi karena jeleknya jalan tersebut sehingga membuat perjalanan yang sangat lama. (csp)

Duka Masih Menyelimuti Keluarga Korban Penikaman

GUNUNGTUA (Waspada): Truk pengangkut tandan buah sawit tidak menjaring bawaannya, dapat membahayakan pengendara. Demikian dikatakan Riswan Harahap, pengendara yang melintas di Jl. Sisingamangaraja Pasar Gunungtua, Padanglawas Utara, Senin (27/9). Menurutnya, karena angkutannya mendulang ke atas truk, dan tidak membuat pengamanan dengan menjaringnya, barangnya sewaktu-

waktu bisa terjatuh. Maka, akan membahayakan pengguna jalan lainnya. Bahkan, akan membuat celaka, khususnya pengendera roda dua dan pejalan kaki yang tepat berada di belakangnya. Untuk itu, diminta Dinas Perhubungan Padanglawas Utara agar melakukan penertiban kendaraan angkutan tandan buah sawit (TBS) agar menggunakan jaring, untuk menghindari kecelakaan kepada pengendara lainnya. (csp)

A N G K O L A S E L ATA N (Waspada): Isak tangis di rumah keluarga almarhumah Sayhrina Lubis, 28, masih menyisakan kepedihan yang mendalam, pasca meninggalnya korban akibat leher ditusuk dengan benda tajam. Kepedihan itu turut dirasakan warga yang dekat dengan korban. Informasi yang dihimpun Waspada di Desa Kampung Lalang dan Desa Napa, di rumah duka korban di Kecamatan Angkola Selatan, menurut warga pelakunya ditengarai sudah merencanakan pembunuhan itu. Robbi Lubis, abang kandung korban mengharapkan aparat kepolisian secepatnya

2011 Jakarta ....

Bogor, dan Cianjur, Jawa Barat. Tapi, bisa dipastikan kalau mobil-mobil baru itu paling banyak untuk pasar Jakarta. Bila sebagian besar pemilik kendaraan itu bekerja di Ibukota, maka lalu lintas di dalam tol secara otomatis akan bertambah banyak dan kemacetan dipastikan akan bertambah parah. “Dan dua tahun ini sudah terjadi pembengkakan pertumbuhan kendaraan,” ujar Fauzi Bowo. Data Polda Metro Jaya dan p e r n y a t a a n Fo k e s a n g a t masuk akal, jika melihat data

yang dikeluarkan saat ajang pameran terbesar otomotif 2010, Indonesia International Motor Show yang gelar Agustus 2010 lalu. Dalam perhelatan itu dibukukan penjualan Rp2,4 triliun. Angka ini melampaui target transaksi sebanyak Rp2,2 triliun. Jumlah mobil terjual fantastis, sekitar 10 ribu mobil. “Setidaknya 10 ribu mobil terjual dalam ajang selama sepekan ini,” kata Ketua Umum Gabungan Industri Kendaraan Bermotor Indonesia (Gaikindo) Sudirman MR.

Tentunya jumlah mobil sebanyak itu akan makin mempercepat kelumpuhan lalulintas Jakarta. Ini sesuai dengan data Dinas Perhubungan DKI Jakarta menunjukkan, pertambahan jumlah kendaraan pribadi di Jakarta mencapai 1.117 per hari atau sekitar 9 persen pertahun. Sementara pertumbuhan luas jalan relatif tetap, sekitar 0,01 persen per tahun. Jika tak segera ada pembenahan pola transportasi, pada tahun 2014 Jakarta diperkirakan akan mengalami kemacetan total. (Vivanews)

Mantan Bupati ....

“Terpidana Azman Usmanuddin terbelit atas kasus tindak pidana korupsi penyelewengan dana Inbub tahun 2002-2003 dengan kerugian negara Rp.4.185.850.000, berdasarkan hasil audit BPKP,” ungkap Kajari Langsa, Adonis, SH melalui Kasi Pidsus Firmansyah, SH kepada wartawan di ruang kerjanya, Selasa (28/9). Diterangkan, kasus ini disidangkan pada 2008 di PN Langsa, dengan vonis satu tahun penjara. Tapi yang bersangkutan banding ke PT dan divonis empat tahun penjara. “Selanjutnya Azman kasasi ke MA dan divonis satu tanun penjara, namun tidak dibebani kerugian negara, kecuali membayar denda Rp50 juta subsidair satu bulan kurungan,” ujarnya. Pihak Kejari Langsa mengaku terkesiap ketika mengetahui yang bersangkutan datang langsung ke LP. “Kami terkejut karena yang bersangkutan datang tiba-tiba, padahal janji sebelumnya dia datang pukul 16:00, sebab dia

datang dari Medan,” demikian Firmansyah. Terkait putusan yang sama terhadap Ketua DPRK Langsa, Muhammad Zulfri dipastikan masuk penjara Rabu (29/9). “Bila tidak datang akan dieksekusi secara paksa, Kamis (30/9),” ungkapnya. Ketua DPRK Kota Langsa Muhammad Zulfri divonis MA dengan hukuman satu tahun penjara, dalam kasus keterangan palsu di persidangan PN Langsa ketika menjabat anggota KPU Kota Langsa, dalam perkara pembentukan tim uji baca Al-Quran calon Walikota/Wakil Walikota tahun 2006 lalu. Ketika ditanya tentang mengapa berlarut-larutnya eksekusi, Firmansyah berdalih bahwa sebelumnya terpidana mengajukan permohonan penundaan eksekusi ke kejaksaan selama tiga hari hingga seminggu, dengan alasan mengalami beban psikologis sehingga harus menenangkan diri serta menjelaskan permasalahannya kepada keluarga.

“Atas alasan itulah kami selaku jaksa dan selaku manusia yang memiliki hati nurani, mengabulkan permohonannya. Namun bila yang bersangkutan tidak mengindahkan janjinya pada hari Rabu, maka Kamis akan dieksekusi paksa,” demikian Firmansyah. Sementara Kadis PU Kota Langsa TM Tarkun yang terbelit kasus korupsi pengadaan 39 unit komputer di lingkungan Pemko Langsa hingga kini belum dieksekusi. Padahal mantan Kabag Umum itu juga sudah divonis MA sejak 4 Agustus 2010 . Sedangkan mantan Kadis Perindustrian Perdagangan Koperasi dan UKM Djakfar Djuned, MA sudah masuk bui, Selasa (21/ 9). Dia ditangkap di rumahnya Lr. Rukun Damai Gp. Pineung Kec. Syiah Kuala, B. Aceh. Djakfar divonis dua tahun penjara terkait kasus pemotongan dana bantuan bergulir dari sejumlah koperasi saat ia menjabat Kadis Koperindagkop Kota Langsa, pada 2006. (b23)

nah menerima lagi,” kata ibu empat anak, yang mengaku suaminya tewas ditembak saat konflik. Nurazizah mengaku dana diat yang pernah diterimanya, sangat membantu ibu tunggal itu dalam menghidupi anaknya yang masih dalam usai sekolahan. “Uang itu sebagian besar saya gunakan untuk menyekolahkan anak-anak saya, kalau untuk hidup sehari saya jadi buruh upahan di sawahsawah orang,” katanya. Janda korban konflik lain, Nisah, asal Iboh, Kecamatan

Seulimum, Aceh Besar mengaku baru sekali menerima dana diat sebesar Rp2 juta. “Saya cuma sekali terima Rp2 juta, saya tidak tau orang bisa dapat Rp 3 juta, kenapa saya hanya dua juta,” kata Nisah yang suaminya tewas ditembak Orang Tak Dikenal (OTK) tahun 2001 saat mengembala kerbaunya di ladang. Mereka meminta pemerintah melanjutkan pemberian dana diat secara permanen dan tanpa tersendat, karena itu sangat membantu keluarga mereka. Sementara Ketua DPR

Aceh, Hasbi Abdullah di depan massa mengatakan, pihaknya segera memanggil Gubernur Aceh Irwandi Yusuf dan Pemimpin BRA untuk meminta kejelasan terkait penyaluran dan kelanjutan dana diat. Menurut Hasbi, pihaknya sudah meminta BRA untuk mendata kembali korban konflik penerima diat agar penyalurannya tepat sasaran. “Jadi mungkin mereka sekarang sedang bekerja dan kita harus memaklumi bahwa baru-baru ini mereka sudah melakukan penggantian pimpinan,” ujarnya.

Bintang Tua ....

Film-film yang telah dibintanginya, dari mulai The Invisible Man, The Prisoner of Shark Island, Roman Scandals, Gold Diggers of 1953, Here Comes the Navydan, hingga Rebecca of Sunnybrook Farm. Film Land of Plenty karya sutradara Win Wenders yang diproduksi pada tahun 2004, menjadi penampilan terakhirnya di dunia akting. Menilik kehidupan pribadinya, Gloria pernah menikah dua kali. Pernikahan pertamanya dengan Blair Gordon Newell pada tahun 1930 dan bercerai di tahun 1934. Tak lama setelah bercerai, ia menikah dengan Arthur Sheekman hingga kematian memisahkannya. Arthur meninggal pada tahun 1978. Gloria meninggalkan seorang putri, empat cucu dan 12 cicit.

Kabar kepergian Gloria, membuat rekan mainnya di Titanic berduka. “Saya sangat sedih mendengar hilangnya wanita yang luar biasa. Saya merasa diberkati dan telah bertemu dengannya, mengenal dan berakting bersamanya. Siapapun yang pernah menghabiskan waktu dengannya akan tahu bahwa dia adalah cahaya yag luar biasa. Dia akan sangat dirindukan,” kata Kate Winslet. Tak beda dengan Winslet, Leonardo DiCaprio juga begitu mengagumi sosoknya. “Orang yang luar biasa manis, seorang aktris fantastis, dan seseorang yang selalu berjuang untuk apa yang dia yakini. Dia adalah salah satu aktris besar terakhir dari era Emas Hollywood. Saya m e ra s a t e r h o r m a t t e l a h bekerja bersamanya,” katanya.

Dishub Paluta Diminta Tertibkan Truk Angkutan TBS Tak Pakai Jaring

Jika jumlah kendaraan tahun ini ditambah dengan masuknya kendaraan baru sebanyak 700 ribu kendaraan, maka akan ada 12 juta kendaraan menyemut di jalan Jakarta. Data 700 ribu kendaraan baru ini menyitir pernyataan Gubernur DKI Jakarta Fauzi Bowo. Foke, demikian ia sering dipanggil, memperkirakan ada 700 ribu kendaraan baru yang akan dipasarkan di Jakarta pada tahun 2011 nanti. Kata Foke, 700 ribu kendaraan itu termasuk yang akan dipasarkan di Depok, Bekasi,

Azman Usmanuddin menjadi terpidana setelah sebelumnya divonis bersalah oleh MA atas kasus penyelewengan jabatan terkait Instruksi Bupati (Inbub) tahun anggaran 20032003, menyebabkan kerugian negara Rp4 miliar lebih. Atas kasus tersebut, MA memvonis satu tahun penjara dan denda Rp50 juta, subsidair satu bulan kurungan.

Jalinsum ....

sebab di bawah terdapat jurang yang sangat dalam. Kita sangat berharap kepada dinas terkait segera memperbaikinya. Sebab, dapat menimbulkan korban jiwa, apalagi di daerah ini terdapat tikungan-tikungan tajam, kalau pengendara tidak hati-hati bisa masuk jurang, tambah Muhammad. Hal senada juga dikatakan sopir angkutan kota Panyabungan-Kotanopan, Hanafi Lubis, 43. Ia berharap agar dinas terkait secepatnya memperbaiki jalan yang abrasi tersebut. (cpin)

Janda Korban ....

kepedulian pemerintah terhadap hak kami, hak anakanak yatim,” ujar Agusta. Sebagian korban konflik mengaku sudah menerima dana diat itu selama tiga kali (Rp9 juta), namun ada pula yang baru menerima Rp2 juta. Meski demikian dalam dua t a h u n t e r a k h i r, m e r e k a mengaku sama sekali belum menerima dan kelanjutannya juga tidak jelas. Seorang janda korban konflik, Nurazzizah ,45, asal Gampong (desa) Keumire, Kecamatan Kuta Cot Glie, Aceh Besar mengatakan, dirinya terakhir menerima dana diat pada 2008 yang diakumulasikan dari jatah tiga tahun sebesar Rp9 juta. “Setelah itu saya tidak perMedan setelah diperiksa selama seminggu, ternyata Densus 88 tak kunjung menemukan bukti keterlibatan kelimanya dalam dua tindak pidana tersebut. Wahono mungkin merugi berkali-kali. Gadis pujaan hatinya, Siti Aisyah yang seharusnya telah menjadi istrinya kini justru menikah dengan orang lain. Entah ia harus sakit hati, atau malah berbesar hati. Pasalnya suami mantan calon istrinya itu tak lain adiknya sendiri, Teguh Subagio. Ya inilah takdir. Ini adalah jodoh. (kps)

yang hebat. Aku tidak sedih tapi aku bahagia untuknya,” kata Sylvia. Bintang film Poor Little Rich Girl telah berhasil berjuang melawan kanker payudara 20 tahun yang lalu dan didiagnosa menderita kanker paru-paru lima tahun lalu. Pada 4 Juli lalu, Gloria merayakan ulang tahunnya yang ke-100. Pesta dihelat atas inisiatif sutradara Titanic James Cameron dan istrinya Suzy Amis. Saat membintangi film Titanic pada tahun 1997, Gloria masih berusia 87 tahun. Atas perannya itu, ia sempat menjadi aktris tertua yang dinominasikan mendapatkan Oscar. Sayangnya, ia harus merelakan patung emas itu kepada Kim Basinger.

menangkap pelaku pembunuhan terhadap saudara perempuannnya itu yang telah membina rumah tangga dengan Sakeus Sembiring alias Datuk 29 selama satu tahun. “Kalaulah adik ipar kami Sakeus itu mengetahui istrinya terbunuh, pastinya dia sangat kecewa akibat kami tidak mampu menjaga adik kami itu dari bencana yang telah menimpanya,” katanya. Kapolres Tapanuli Selatan AKBP Subandriya melaului Kasat Reskim AKP Waiman, Se n i n ( 2 7 / 9 ) s o re m a s i h mengejar pelaku pembunuhan terhadap Syahrina Lubis korban penikaman di leher dengan kedalaman 7 sentimeter. (crm)

WASPADA Rabu 29 September 2010

18 Jahitan Di Leher Akibat Disayat Pencuri P. S I D I M P U A N (Waspada): Safiatun, 52 (foto) kritis setelah menjadi korban pencurian dan tindakan kekerasan oleh tersangka RS, 20, warga Kelurahan Ujung Padang Lingkungan III, Kecamatan Padangsidimpuan Selatan. Korban harus menderita luka serius karena pelaku merampas perhiasannya kalung dan anting-anting secara paksa saat dia berusaha mempertahankan barang berharga miliknya. Pada kejadian itu untuk mempertahankan kesela-matan jiwanya Safiatun nekad menahan sayatan pisau dari RS dengan jari tangan yang menempel di lehernya ketika RS mencoba mendorong dan merampas kalung korban. Kejadian itu ketika dia bekerja sebagai pekerja kebersihan di rumah dinas eks BI di Jalan Kenanga, Selasa (28/9) sekitar pukul 09:15. Akibat dari kekerasan itu, satu jari tangan wanita tersebut mengalami putus dan keempat jari tangannya mengalami luka serius dan mendapat beberapa jahitan. Bahkan leher korban harus mendapati 18 jahitan dari sayatan pisau yang digunakan tersangka RS. Korban mengaku RS melarikan diri sambil membawa emas jenis kalung 12 gram yang dirampas dari leher dan anting-anting 1 gram yang dicopot langsung dari telinga korban. Safiatun yang bersimbah darah akhirnya dibawa ke rumah sakit terdekat. Kemudian dibawa keluarganya dan dirawat di rumahnya di Gang Es Deli Kelurahaan Ujung Padang. Kapolres Kota Padangsidimpuan AKBP RB Arif melalui Kabag Ops KOMPOL.Darfin Purba mengatakan sudah mengetahui identitas tersangka pencurian dengan tindakan kekerasan terhadap Safiatun. (crm)

DPRD Paluta Dinilai Mandul Atasi Masalah GUNUNGTUA (Waspada): Berbagai masalah yang tidak selesai dan tidak ada kejelasan hingga kini menjadi persoalan yang rumit bagi kalangan DRPD Padanglawas Utara. Saat ini kasus yang tengah berkembang adalah indikasi sejumlah anggota DPRD Paluta telah mengkhianati amanah rakyat, terkait persoalan APBD 2010. Seorang tokoh masyarakat yang tidak berkenan disebutkan identitasnya, Selasa (28/9) menuturkan, persoalan di daerah Paluta kini begitu banyak, namun tidak ada kejelasannya. Ia mengungkapkan, yang paling disesalkan adalah perihal pengusulan pembatalan APBD yang kini timbul tenggelam.“Sampai sekarang tidak ada perkembangannya, namun tersiar kabar beberapa oknum dalam tim 19 sendiri di DPRD dianggap mengkhianati temannya,” ujanya. Selain itu, tentang mandulnya BK Dewan sudah tidak dipertanyakan. Pengaduan oleh dewan seakan tidak dipertimbangkan. Seharusnya, berdasarkan konfigurasi kekuatan politik DPRD saat ini, pihak yang paling sibuk bekerja adalah BK. Namun faktanya BK DPRD sulit bekerja sesuai yang diharapkan. “Ada banyak permasahan yang harus ditangani di DPRD ini, seperti kasus CPNS, APBD, Perda dan banyak lagi, tetapi semua itu dibiarkan saja,” ujarnya. (csp)

90 Guru Non PNS ....

Lubis. Kepala Kantor Kementerian Agama Madina dihubungi melalui Kepala Seksi Madrasah dan Pendidikan Agama Islam ( Mapenda) Drs Abdus Saman mengatakan, pihaknya b e l u m m e m p e ro l e h a p a kendala tidak dicairkannya dana tunjangan itu. Sa m a n m e n j e l a s k a n , jumlah guru yang berhak menerima dana fungsional selama 6 bulan ini sebanyak 923 orang, dengan besaran Rp 250 ribu per bulan dengan total sebesar Rp1,5 juta per guru. (a24)

Polisi Amankan ....

kering di kamar kos. Kasus ini sedang kita dalami, sementara waktu mereka tetap kita amankan di Mapolres,” katanya. Hasil interogasi polisi menunjukkan, ke 13 pria itu ke Lhokseumawe hanya untuk menjual buku-buku pelajaran tambahan untuk siswa SD. Beberapa buku itu yakni Basaha Inggeris, Matematika dan beberapa buku pelajaran tambahan lainnya. Yusrizal, 33, ketua kelompok pedagang buku pelajaran tambahan untuk siswa SD, ketika ditanya di ruang tunggu Kasat Reskrim menjelaskan, mereka menggeluti jual beli buku sejak enam bulan terakhir. Begitu pun, ada beberapa anggota baru bergabung dua minggu. Dia mengaku baru pertama kali masuk Aceh. “Rencana kami tadi malam mau melapor ke kepala desa setempat. Karena hujan, rencana itu kami tunda hingga Selasa (28/9). Namun pukul 22:00 kami ditangkap polisi,” kata Ysrizal. (cmun)

berkaitan dengan persyaratan administrasi pencairan tunjangan yang bersumber dari APBN tersebut ke KPPN Padangsidimpuan. “Sesuai petunjuk pelaksanaannya, pihak kantor Kementerian Agama di wilayah Tabagsel akan menyerahkan p e r s o a l a n a d m i n i s i t ra s i pencarian dana tunjangan ke KPN Padangsidimpuan, dan pihak KPN sendiri yang akan mentransfer dana tunjangan tersebut ke rekening para penerima,” ujar salah seorang guru madrasah Lokot Husna kota itu tanpa melapor. “Menindaklanjuti laporan tersebut, kami langsung meluncur ke lokasi untuk membuktikan kebenaran informasi yang diberikan warga. Sampai di sana, kami mendapati 13 pria dari Lubuk Pakam. Saat itu kami juga menemukan satu amplop ganja kering di pintu kamar depan ruang tamu. Karena itu mereka kita boyong ke Mapolres untuk penyelidikan lebih lanjut. Ini kita lakukan sebagai langkah antisipasi untuk menghindari hal-hal yang tidak diinginkan,” terang Bambang S. Hingga kini ke 13 pria tersebut belum ada yang mengaku sebagai pemilik barang haram itu. Untuk membuktikan, apakah ganja itu milik mereka atau bukan, polisi akan melakukan tes urine. Menjawab Waspada, Kasat Reskrim mengatakan, belum ada bukti kuat yang menunjukkan mereka itu komplotan teroris. “Mereka kita tahan, karena kita mendapati satu amplop ganja


MENUNGGU DIPERIKSA: Ke 13 pria asal Lubuk Pakam, Deli Serdang, Sumatera Utara, menunggu pemeriksaan polisi di ruang tunggu Kasat Reskrim Mapolres Kota Lhokseumawe, Selasa (28/9).

Berita Utama


WASPADA Rabu 29 September, 2010

Kemenangan Masyarakat Labura

Satu-satunya Di Sumut:

Langkat Peroleh Penghargaan Piala WTN JAKARTA (Waspada): Stabat dinyatakan sebagai ibukota Kabupaten Langkat yangt merupakansatu-satunyakotadiSumut yang memperoleh penghargaan Piala WTN (Wahana Tata Nugraha) Tahun 2009. Menteri Perhubungan RI Freddy Numberi langsung menyerahkan Piala WTN tersebut kepada Bupati Langkat Ngogesa Sitepu di kantor Kementerian Perhubungan RI di Jakarta, Selasa (28/9). MenhubRIFreddyNumberi mengemukakan, penghargaan tersebutgunamendorongPemda untuk meningkatkan tertib lalulintas dan angkutan kota, mendorong peran serta masyarakat dalam meningkatkan disiplin berlalu lintas, mendorong terwujudnya peningkatan pelayanan jasa angkutan umum dan mendorong terciptanya sistem transportasi kota yang efektif, berkualitas, tertib, aman dan lancar. Menurutnya,tahuninitercatat 21 kota di tanah air yang menerima penghargaan tersebut masing-masing Surabaya, Pekanbaru, Surakarta, Probolinggo, Sukabumi, Mojokerto, Tarakan, Madiun, Lumajang, Kabupaten Badung, Bone, Sragen, Stabat

(Kabupaten Langkat), Kabupaten Wajo, Kabupaten Ciamis,Tulung Agung, Padang Panjang, Kabupaten Pesisir Selatan, Kabupaten Klungkung, Kabupaten Karang Asem, Kabupaten Buleleng. Sedangkan dua kota penerima PialaWTN kategori angkutan umum adalah Bandung dan Semarang. Selain itu terdapat empatkotapenerimapenghargaan pialaWTN kategori lalu lintas yaitu Denpasar, Balikpapan , KabupatenJeparadanKabupaten Tuban. Bupati Langkat Ngogesa Sitepu didampingi Kapolres AKBP Mardiyono dan Kadis Perhubungan Langkat Syahmadi seusai menerima anugrah penghargaan tersebut mengemukakan, penghargaan Piala WTN yang kelima kalinya ini menjadi tantangan untuk lebih berbuat maksimalpadatahunmendatang. Lintas koordinasi antar instansi serta kesadaran yang tumbuh dari masyarakat hendaknya terus dipelihara dan ditingkatkan. “Terlebih juga dalam tahun ini Langkat meraih penghargaan bidang kebersihan dan penataan lingkungan lewat Anugerah Piala Adipura yang beberapa waktu

lalu diserahkan Presiden RI di Istana Negara,” ujar bupati menjelaskan. Kabag Humas Pemkab Langkat H Syahrizal menyebutkan, penghargaan Piala WTN untuk Kota Stabat akan di jemput di Bandara Polonia Medan, Rabu (29/9) oleh sejumlah tokoh dan pemuka masyarakat serta diarak dengan kendaraan hias. “Acara syukuran berlangsung di Rumah Dinas Bupati di Stabat, Kamis (30/9),” ujar Syahrizal seraya menambahkan acara tersebutsejumlahanakyatimjuga disantuni. (a01)

Maling Larikan Brankas Berisi Uang Rp95 Jt

BUPATI Langkat Ngogesa Sitepu ketika menerima penghargaan Piala WTN ( Wahana Tata Nugraha) dari Menteri Perhubungan RI Freddy Numberi di Jakarta, Selasa (28/9).

PEMATANGSIANTAR (Waspada): Kawanan maling, Selasa(28/9) dinihari berhasil melarikan satu brankas berikut uang Rp95 juta di dalamnya dari kantor Koperasi Kredit (Kopdit) CV Bina Mitra Sejahtera (BMS) di Jalan Sisingamangaraja, Kel. Bane,Kec. Siantar Utara, Kota Pematangsiantar. Pengurus Kopdit, Ketua, Sekretaris dan Bendahara dan ManajerKopdit W.Turnip,SE,KF.Sitanggang dan M. Lumbangaol di tempat kejadian mengatakan, diduga kawanan maling memasuki kantor dengan merusak gembok pintu harmonika. Sedangkan kantor Kopdit malam hari tanpa penjagaan. Kawanan maling menuju ruangan tempat penyimpanan brankas di bagian belakang dan membuka kunci pintu secara paksa serta memboyong brankas seberat 300 kg lalu membawanya dengan mobil yang menunggu di depan. Brankas itu berisi uang kontan Rp80 juta lebih dan dua buku BPKB sepeda motor inventaris kantor. (a14)

nyebabkan kerugian negara Rp4 miliar lebih. Atas kasus tersebut, MAmemvonissatutahunpenjara dan denda Rp50 juta, subsidair satu bulan kurungan. “Terpidana Azman Usmanuddin terbelit atas kasus tindak pidana korupsi penyelewengan dana Inbub tahun 2002-2003 dengan kerugian negara Rp.4.185. 850.000, berdasarkan hasil audit BPKP,” ungkap Kajari Langsa, Adonis, SH melalui Kasi Pidsus Firmansyah, SH kepada wartawan di ruang kerjanya, Selasa (28/9). Diterangkan, kasus ini disidangkan pada 2008 di PN Langsa, dengan vonis satu tahun penjara. Tapi yang bersangkutan bandingkePTdandivonisempattahun penjara. “Selanjutnya Azman kasasi ke MA dan divonis satu tanun penjara, namun tidak dibebani kerugian negara, kecuali membayar denda Rp50 juta subsidair satu bulan kurungan,” ujarnya. Pihak Kejari Langsa mengaku terkesiap ketika mengetahui yang bersangkutan datang langsung ke LP.“Kami terkejut karena yang bersangkutan datang tibatiba, padahal janji sebelumnya dia datang pukul 16:00, sebab dia datang dari Medan,” demikian Firmansyah. Terkait putusan yang sama terhadap Ketua DPRK Langsa, Muhammad Zulfri dipastikan masuk penjara Rabu (29/9). “Bila tidak datang akan dieksekusi secara paksa, Kamis (30/9),” ungkapnya. Ketua DPRK Kota Langsa Muhammad Zulfri divonis MA dengan hukuman satu tahun

penjara, dalam kasus keterangan palsu di persidangan PN Langsa ketika menjabat anggota KPU Kota Langsa, dalam perkara pembentukan tim uji baca Al-Quran calon Walikota/Wakil Walikota tahun 2006 lalu. Ketika ditanya tentang mengapa berlarut-larutnya eksekusi, Firmansyah berdalih bahwa sebelumnya terpidana mengajukan permohonan penundaan eksekusi ke kejaksaan selama tiga hari hingga seminggu, dengan alasan mengalami beban psikologissehinggaharusmenenangkan diri serta menjelaskan permasalahannya kepada keluarga. “Atas alasan itulah kami selaku jaksa dan selaku manusia yang memiliki hati nurani, mengabulkan permohonannya. Namun bila yang bersangkutan tidak mengindahkan janjinya padahariRabu,makaKamisakan dieksekusi paksa,” demikian Firmansyah. Sementara Kadis PU Kota Langsa TM Tarkun yang terbelit kasus korupsi pengadaan 39 unit komputer di lingkungan Pemko Langsa hingga kini belum dieksekusi. Padahal mantan Kabag UmumitujugasudahdivonisMA sejak 4 Agustus 2010 . Sedangkan mantan Kadis Perindustrian Perdagangan Koperasi dan UKM DjakfarDjuned,MAsudahmasuk bui, Selasa (21/9). Dia ditangkap dirumahnyaLr.RukunDamaiGp. Pineung Kec. Syiah Kuala, B. Aceh. Djakfar divonis dua tahun penjaraterkaitkasuspemotongan danabantuanbergulirdarisejumlah koperasi saat ia menjabat Kadis Koperindagkop Kota Langsa, pada 2006.(b23)

13 Penjual Buku...

Untuk membuktikan, apakah gan-jaitumilikmerekaataubukan, polisi akan melakukan tes urine. Menjawab Waspada, Kasat Reskrim mengatakan, belum ada bukti kuat yang menunjukkan mereka itu komplotan teroris. “Mereka kita tahan, karena kita mendapati satu amplop ganja kering di kamar kos. Kasus ini sedang kita dalami, sementara waktumerekatetapkitaamankan di Mapolres,” katanya. Hasilinterogasipolisimenunjukkan, ke 13 pria itu ke Lhokseumawe hanya untuk menjual buku-buku pelajaran tambahan untuk siswa SD. Beberapa buku itu yakni Bahasa Inggris, Matematika dan beberapa buku pelajaran tambahan lainnya. Yusrizal, 33, ketua kelompok pedagang buku pelajaran tambahanuntuksiswaSD,ketikaditanya di ruang tunggu Kasat Reskrim menjelaskan, mereka menggeluti jual beli buku sejak enam bulan terakhir.Begitupun,adabeberapa anggota baru bergabung dua minggu. Dia mengaku baru pertama kali masuk Aceh. “Rencana kami tadi malam mau melapor ke Kepala Desa setempat. Karena hujan, rencana itu kami tunda hingga Selasa (28/ 9). Namun pukul 22:00, kami ditangkappolisi,”kataYsrizal.(cmun)


Mantan Bupati ... MuhammadZulfriyangakanmenyusul masuk penjara, Rabu (29/ 9) hari ini. Mantan orang nomor satu Aceh Timur itu datang ke LP tanpa didampingi kerabat dan Penasehat Hukum (PA) Habsah, SH. Beberapa saat kemudian jaksa dari Kejari Langsa muncul di LP. Demikian juga dengan PH bersangkutan. Azman Usmanuddin menjadi terpidana setelah sebelumnya divonis bersalah oleh MA atas kasus penyelewengan jabatan terkait Instruksi Bupati (Inbub) tahun anggaran 2003-2003, me-

AS Minta Maaf... Di Filipina, bendera negara yang dipasang terbalik merupakan sinyal yang menyatakan negara sedang berperang. ‘Kesalahanitutidakdisengaja,’ ungkap juru bicara Kedutaan Besar AS di Manila, Filipina, Rebecca Thompsonmenyikapiinsidentersebut, sambil menambahkan AS sangat menghargai kedekatan hubungan dan kemitraan kedua negara.” Thompsontidakmengatakan siapa yang membuat kesalahan tersebut atau bagaimana itu bisa terjadi. (rtr/rzl)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport Jawaban Problem Catur: 1. ......, Bg1+. 2. Rh4, Bh2+. 3. Gh3, Kg5. 4. Kg3 (KxK, fxK+mat), BxGh3+. 5. Rg4, g6. 6. Bxg6 atau hxg6; Bh3xKg3+. 7. Rf5, Bxf3+mat. Atau 7. Rh4, Bh3+mat.

Zulfan Lubis, 28, Jalan Ampera, Desa Sekip, Dedi Sapryanto, 28, Jalan Thmren, Gang Saudara, Ahmad Wardana, 28, Bengkong Indah, Batam, Kalpin, warga Lubukpakam, Roni, Jalan pembangunan, dan Musriadi, 27, warga Lubukpakam. AKBP Kukuh Santoso, KapolresKotaLhokseumawe,Selasa (28/9) melalui AKP Bambang S, Kasat Reskrim di ruang kerjanya kepada wartawan menjelaskan, ke 13 pria asal Lubukpakam itu diamankan berdasarkan laporan warga, di mana mereka masuk ke kota itu tanpa melapor. “Menindaklanjuti laporan tersebut, kami langsung meluncur ke lokasi untuk membuktikan kebenaran informasi yang diberikan warga. Sampai di sana, kami mendapati 13 pria dari Lubukpakam.Saatitukamimenemukan satu amplop ganja kering di pintu kamardepanruangtamu.Karena itu mereka kita boyong ke Mapolres untuk penyelidikan lebih lanjut.Inikitalakukansebagailangkah antisipasiuntukmenghindarihalhal yang tidak diinginkan,” terang Bambang S. Hinggakinike13priatersebut belum ada yang mengaku sebagai pemilik barang haram itu.

Jawaban TTS:

Jawaban Sudoku: 6 7 4 8 1 2 5 3 9

3 2 1 9 7 5 8 4 6

8 5 9 6 3 4 7 2 1

5 9 8 1 2 3 4 6 7

2 1 6 7 4 8 3 9 5

4 3 7 5 9 6 1 8 2

9 6 3 4 5 1 2 7 8

1 8 2 3 6 7 9 5 4

7 4 5 2 8 9 6 1 3 406

Waspada/Surya Efendi

KAPOLDASU PATROLI: Kapoldasu Irjen Pol Oegroseno bersama anggota melakukan patroli sepedamotor mengitari sejumlah kawasan di Hamparan Perak, Deli Serdang, Selasa (28/9). Patroli dilakukan untuk memberikan penyuluhan kepada warga dan perangkat desa agar pro aktif dalam kasus kriminal, terutama penanganan teroris dan melaporkan kepada polisi bila ada orang yang dicurigai. Dia juga minta agar Siskamling diaktifkan kembali.

Karzai Menangis, Bom Bunuh Deputi Gubernur Afghanistan KABUL, Afghanistan (AP): Seorang pengebom bunuhdiri menewaskan seorang deputi gubernur provinsi Afghanistan bersama lima orang lainnya Selasa (28/ 9), di timur negara itu, demikian menurut polisi. Namun kemudian, Presiden Afghanistan Hamid Karzai sambil menangis mengatakankekerasan,menakutkan para pemuda sehingga mereka akan memilih lari dari negara itu. Pelakupengebomanmenabrakkan kendaraan roda tiganya yang sarat bahan peledak ke salah satu dari dua kendaraan yang beriringanmembawaDeputiGubernur Khazim Allayar ke kantor-

nyadikotaGhazni.Putranyayang telah dewasa, seorang keponakan dan seorang pengawalnya juga terbunuh dalam peristiwa itu, kata kepala polisi provinsi Ghazni Zarawar Zahid. Dua warga sipil yang berada dekat lokasi ledakan juga terbunuh dalam ledakan tersebut dan sejumlah lainnya cedera, katanya. Para pejabat pemerintah Afghanistanadalahsasaranutama seranganTaliban dan pemberontak lainnya yang melancarkan kampanye pembunuhan terhadap orang-orang yang bekerja sama dengan pemerintah dan pasukan NATO.

Allayar, yang menjabat tugas tersebut selama lebih dari tujuh tahun, selamat dalam satu usaha pengeboman dua bulan lalu di kota Ghazni. Karzai mengutuk serangan itu dalam pernyataannya. Dia kemudian menyerukan dalam pidatonyakepadarakyatAfghanistan agar menjauhi kekerasan. Karzai menyatakan para pemuda akan memilih untuk meninggalkannegaranyagunamenghindari kekerasan yang berlanjut di Afghanistan. Belum ada pihak yang menyatakan bertanggung jawab atas pengeboman Selasa itu. (m07)

Sindikat Pengedar Ganja Dibekuk MEDAN (Waspada): Tiga lelaki diduga pengedar ganja dibekuk aparat kepolisian dalam penyergapan dari tiga lokasi terpisah, Selasa (28/9). Dari ketiga tersangka yakni IP, 24, kos di kompleks Bik Gina Jalan Letjen Djamin Ginting Gang Gembira disita barang bukti 37 bungkus ganja, tersangka DH, 27, penduduk Jalan Bunga Raya, Asam Kumbang, disita 44 bungkus ganja dan tersangka Rk, 40, warga KelambirV, Helvetia, disita 1 Kg ganja. KapolsektaMedanBaruAKP Saptono melalui Kanit Reskrim Iptu Muchdi Hasibuan, SH kepada Waspada mengatakan, sindikat peredaran ganja antar kabupaten terkuak berdasarkan adanya SMS dari warga. “Laporan warga itu langsung kita tindaklanjuti,” ujarnya. Polisi yang melakukan penyelidikan di Jalan Letjen Djamin Ginting bertemu dengan tersangka IP yang sedang duduk-duduk diduga mengantongi ganja. Lalu, petugasmenyarusebagaipembeli ganja mendekati tersangka untuk melakukan transaksi narkoba. Tersangka yang tidak curiga langsung memberikan daun ganjayangsudahdikemasdengan

kertas Koran. Ketika memberikan ganja itu, IP langsung dibekuk petugas.Darinyadisita37bungkus ganja dan uang Rp10.000. Sedangkan tersangka DH dibekuk di Jalan Seroja kawasan Asam Kumbang dekat ternak kandang ayam dan darinya disita 44 bungkus ganja. Sementara tersangka Rk

Tim Advokasi Siap...

Harahap, sehubungan kliennya sudah mempunyai hak atas Hak Asimilasi(pembebasanbersyarat) dan jaminan atas perkara pidana terdahulu yang dihadapi Ramli Lubis. “Terkaitperkarapidanaterdahulu, Ramli Lubis sudah berhak mendapat Hak Asimilasi dan pembebasan bersyarat, namun kasus ruislagh Kebun Binatang Medan telah mengabaikan hak dan jaminan terhadap kliennya, sebab belum adanya persetujuan dari Kejagung maupun Kejari,” tegas Benny Harahap. BennyHarahapmengatakan, alasan Hak Asimilasi/pembebasan bersyarat Ramli Lubis sudah memenuhi syarat, hal ini sesuai Peraturan Menteri Hukum dan HAMRINo:M.01.PK.04-10Tahun 2007 tentang syarat dan tata cara pelaksanaan Asimilasi/pembebasan bersyarat, cuti menjelang bebas, dan cuti bersyarat. Untuk itu, persetujuan Asimilasi/pembebasanbersyaratkliennyasudah

sewajarnya dikabulkan oleh kejaksaan. BennyHarahapmengatakan, dengan diabaikannya hak Asimilasi/pembebasan bersyarat itu, maka kliennya menderita kerugian yang cukup besar. Ditambah lagi, sebagai pertimbangan kejaksaan, dua tersangka lain dalam kasus ini tidak dilakukan penahanan. Benny Harahap, kejaksaan dapat secepatnya melimpahkan kasus kliennya ke Pengadilan NegeriMedan,sehinggakepastian hukum bagi Ramli Lubis cepat diperolehnya. Selain itu, persetujuan memberikan hak Asimilasi/ pembebasan bersyarat kepada kliennyasegeradisetujuikejaksaan. Sebelumnya, Kejari Medan kepada sejumlah wartawan menyatakan,hinggasaatinitimKejagung dan Kejari Medan masih menyempurnakan berkas tuntutan Ramli Lubis. Mereka menjadwalkanawalOktoberinisudah dilimpahkan. (h05)

tua yang dinominasikan mendapatkan Oscar. Sayangnya, ia harus merelakan patung emas itu kepada Kim Basinger. Film-film yang telah dibintanginya, dari mulai The Invisible Man, The Prisoner of Shark Island, Roman Scandals, Gold Diggers of 1953, Here Comes the Navydan, hingga Rebecca of Sunnybrook Farm. Film Land of Plenty karya sutradaraWinWenders yang diproduksi pada tahun 2004, menjadi penampilan terakhirnya di dunia akting. Menilik kehidupan pribadinya, Gloria pernah menikah dua kali. Pernikahan pertamanya denganBlairGordonNewellpada tahun 1930 dan bercerai di tahun 1934. Tak lama setelah bercerai, ia menikah dengan Arthur Sheekman hingga kematian memisahkannya. Arthur meninggal pada tahun 1978. Gloria meninggalkan

seorang putri, empat cucu dan 12 cicit. Kabar kepergian Gloria, membuat rekan mainnya di Titanic berduka. “Saya sangat sedih mendengar hilangnya wanitayangluarbiasa.Sayamerasa diberkati dan telah bertemu dengannya,mengenaldan berakting bersamanya. Siapapun yang pernah menghabiskan waktu dengannya akan tahu bahwa dia adalah cahaya yag luar biasa. Dia akan sangat dirindukan,” kata Kate Winslet. Tak beda dengan Winslet, Leonardo DiCaprio juga begitu mengagumi sosoknya. “Orang yang luar biasa manis, seorang aktrisfantastis,danseseorangyang selalu berjuang untuk apa yang dia yakini. Dia adalah salah satu aktris besar terakhir dari era Emas Hollywood. Saya merasa terhormat telah bekerja bersamanya,” katanya.

Didampingi sejumlah rekannya seperti Untung Hariono, Syafrinal, Julisman, Benny Harahap menegaskan, mereka telah siap menghadapi perkara kliennya apabila sudah dilimpahkan ke Pengadilan Negeri Medan. Menurut Benny Harahap, setelah tim advokasi mempelajari proses ruislagh Kebun Binatang Medan itu, maka mereka menilai tidak ada persoalan hukum yang dilanggar oleh kliennya. “Semua dalam proses ruislagh itu telah sesuai mekanisme dan ketentuan hukum yang berlaku dalam ruislagh lahan Kebun Binatang Medan,” tegas Benny Harahap. Menurut Benny Harahap, pihaknya berharap Kejari Medan segera melimpahkan berkas perkara kliennya itu ke Pengadilan NegeriMedanuntukprosespersidangan, hingga ada kepastian hukum bagi Ramli Lubis. Di samping itu, lanjut Benny

Bintang Tua... gagal pernapasan di rumahnya di Los Angeles pada Minggu (26/ 9) malam. “Dia juga adalah seorang yang berhasil selamat dari penyakitkankerpayudara. Diamemiliki kehidupan yang hebat. Aku tidak sedih tapi aku bahagia untuknya,” kata Sylvia. Bintang film Poor Little Rich Girl telah berhasil berjuang melawan kanker payudara 20 tahun yang lalu dan didiagnosa menderita kanker paru-paru lima tahun yang lalu. Pada 4 Juli lalu, Gloria merayakan ulang tahunnya yang ke100. Pesta dihelat atas inisiatif sutradara Titanic James Cameron dan istrinya Suzy Amis. Saat membintangi film Titanicpadatahun1997,Gloriamasih berusia 87 tahun. Atas perannya itu, ia sempat menjadi aktris ter-

ditangkap Polsekta Medan Sunggal dari Jl. Pinang Baris, Medan Sunggal. Menurut Kapolsek Medan Sunggal AKP Sonny Nugroho,SIK melalui Kanit Reskrim IptuWidi Setiawan, SH, tersangka Rk mengaku ganja itu dari Aceh dan rencananya hendak dibawa ke Lubuk Linggau, Jambi melalui jalan darat. (m31)

AEKKANOPAN (Waspada): Kemenangan pasangan calon H.Kharuddinsyah Sitorus SE yang akrab disapa H.Buyung/ H.Syahmenan SH.MHum dalam pemilukada Labuhanbatu Utara adalah kemenangan masyarakat secara keseluruhan dimana dengan terpilihnya Bupati dan wakil Bupati diharapkan dapat membawa daerah yang baru dimekarkan ini lebih maju lagi. Demikian dikatakan H.Buyung didampingi ketua PBR Labuhanbatu Utara H.Husein Situmorang kepadaWaspada, Selasa (28/9). Menurutnya, kemenangan tersebut adalah amanah atau kepercayaan masyarakat kepada dirinya. “Saya mengucapkan terimakasih kepada Pj.Bupati Labura H.Asrin Naim, Kapolres dan Dandim Labuhanbatu, Panwaslu, KPUD dan jajarannya serta seluruh masyarakat yang sudah mensukseskan Pemilukada di daerah ini, dan khusus kepada seluruh masyarakat pengguna jalan sewaktu kami melaksanakan kampanye agak terjadi kemacetan untuk itu saya dan tim kampanye mohon maaf,” ujarnya. Dikatakannya, dia akan merangkul semua komponen masyarakat untuk membangun Labuhanbatu Utara, tidak ada pengkotakkan karena yang sudah berlalu biarlah berlalu mari kita bangun daerah ini untuk maju dan cepat sejajar dengan daerah lainnya. Hasil perhitungan sementara Pemilukada Labuhanbatu Utara, pasangan nomor urut 1 H.Kharuddinsyah Sitorus SE/ H.Syahmenan,SH, MHum memperoleh suara 73.378 suara atau 45.89 Persen, pasangan nomor urut 2 Drs.H.Daudsyah MM/Ir.H.Subahri Ritonga memperoleh 44.127 suara atau 27.60 persen, sedangkan pasangan nomor urut 3 Ir.Salomo P Hutabarat/ Drs.Untung Priatno memperoleh 42.386 suara atau 26.51 porsen.(a29)

3 Wanita Kamboja... menggunakan pesawat Thai Airways nomor penerbangan TG-433. Bubuk berwarna cokelat muda itu dikemas dalam empat bungkus plastikdandisimpandalamdindingatasdanbawahtasungguberwarna hitam. Kepala Seksi Penindakan dan Penyidikan Kantor Bea dan Cukai Tipe Madya Pabean Soekarno-Hatta, Gatot SugengWibowo menambahkan, pada hari, pesawat, dan motif sama, petugas menangkap SP (27) karena membawa sabu seberat 2.050 gr atau 2,05 kg. Estimasi nilai dari barang berbentuk kristal bening itu sebesar Rp 3,075 miliar.(kps)

TNI Siap Bantu... Agus menjelaskan saat ini TNI melakukan upaya peningkatan kemampuan pasukan khas dari berbagai angkatan. “Pasukankhusussiap,kantugasangkatanmenyiapkanpasukannya. Kita selalu menyiapkan, sekarang mereka siap digunakan, tinggal bagaimana menggunakannya. Kita punya kemampuan,” katanya. Agus menyebutkan pasukan khusus yang siap diterjunkan di antaranya adalah Kopassus dari Angkatan Darat, Detasemen Jala Mangkara dari Angkatan Laut, Detasemen Bravo dari Angkatan Udara.

Ini Jodoh Atau... Keluargamanayangtakpanik,calonmempelaimanayangtakberduka atas kejadian tak terduga itu. Prosesi sakral lagi bersejarah dalam hidup setiap manusia itu berantakan lantaran penangkapan oleh Densus 88. Kita apresiasi kerja aparat untuk memberantas terorisme. Tak hendak saya menafikannya. Namun dalam kasus ini, berapa banyak yang dirugikan. Terlebih Wahono. Wahono dan empat orang rekannya dilepaskan Densus pada Minggu (26/9) lalu. Mereka yang semula diduga terkait teroris dan perampokan Bank CIMB Niaga Medan setelah diperiksa selama seminggu, ternyata Densus 88 tak kunjung menemukan bukti keterlibatan kelimanya dalam dua tindak pidana tersebut. Wahono mungkin merugi berkali-kali. Gadis pujaan hatinya, Siti Aisyah yang seharusnya telah menjadi istrinya kini justru menikah dengan orang lain. Entah ia harus sakit hati, atau malah berbesar hati. Pasalnya suami mantan calon istrinya itu tak lain adiknya sendiri, Teguh Subagio. Ya inilah takdir. Ini adalah jodoh.(kps)

Kloter I Calhaj...

Waspada/Ismanto Ismail

INTEROGASI Kanit Reskrim Polsekta Medan Baru Iptu Muchdi Hasibuan, SH menginterogasi tersangka pengedar ganja antar kabupaten di ruang kerjanya, Selasa (28/9) sore.

kloter 5 maktab 32 wilayah Rei’zahir, kloter 6 maktab 70 wilayah Jarwal, Jumaizah. Kloter 7 maktab 24 wilayah Aziziah Janubiah, mahbaz Jin. Kloter 8 maktab 44 wilayah Misfalah, kloter 9 maktab 60 wilayah Syar’i Masyour. Kloter 10 maktab 29 wilayah Aziziah Janubiah, Aziziah Syamaliah. Kloter 11 maktab 56 wilayah Bakhutmah, kloter 12 maktab 32 wilayah Maabdah, Rei Zahir. Kloter 13 maktab 3 wilayah Mahbaz Jin, kloter 14 maktab 58 wilayah Baktumah, kloter 15 maktab 55 Bakhutmah, kloter 16 maktab 47 wilayah Bakhutmah. Kloter 17 maktab 47 wilayah Bakhutmah dan kloter 18 maktab 56 wilayah Bakhutmah. “Sedangkan kloter 19 yang tidak penuh satu kloter akan bergabung dengan calhaj embarkasi lainnya. Semoga tidak ada kendala bagi seluruh calhaj asal Sumatera Utara terkait dengan maktab yang akan mereka tempati nantinya,” kata Mahya Bandar. Dia juga mengungkapkan, acara qur’ah nasional dibuka secara resmi oleh Menag Suryadharma Ali yang dihadiri Dubes RI untuk Arab Saudi dan Kesultanan Oman Gatot Abdullah Mansyur, Konjen RI di Jeddah Zakaria Anshar, Staf Tehnis Urusan Haji di Jeddah Dr Syairazi Dimyanti para Kepala Kementrian Agama se Indonesia serta Kabid Haji. (m36)

MK Putuskan Pilkada... Putaran Kedua Batal Dikatakan Firmansyah, dengan keluarnya putusan MK, maka Pilkada Kota Tanjungbalai putaran kedua harus dibatalkan. Jadi, kata Firmansyah, anggaran yang semula direncanakan untuk putaran kedua, digantikan untuk Pilkada ulang di 17 kelurahan tersebut. Mengenai jadwal pemungutan suara ulang tersebut, menurut Firmansyah, paling lambat dilaksanakan 60 hari setelah penetapan MK. “ Inikan perintah, jadi kita harus siap melaksanakannya, dan sebagai langkah awal kita akan kordinasi dengan pihak terkait,” jelas Firmansyahdanmenambahkan,jikaPilkadaulangsudahdilaksanakan, dan ada pasangan calon yang memperoleh suara 30 persen tambah 1, tidak ada lagi putaran kedua. Sidang putusan perkara Nomor 166/PHPU.D-VIII/2010 perihal permohonan perselisihan hasil Pemilukada Tanjungbalai, dengan pemohon Ir H Darwin Zulad,MSi dan HM Syarifuddin Harahap, serta termohonKPUDTanjungbalai,sempattertundabeberapakali. Awalnya, putusan akan dibacakan sekira pukul 14.00, namun ditunda menjadi 16.00, dan baru dibacakan sekira pukul 19.30. SelainTanjungbalai, MK juga membacakan putusan sengketa hasil Pilkada Kabupaten Luwu dan Bulu Kumbah Provinsi Sulawesi Selatan. (a37/crs)

2011 Jakarta... Kata Foke, 700 ribu kendaraan itu termasuk yang akan dipasarkan di Depok, Bekasi, Bogor, dan Cianjur, Jawa Barat.Tapi, bisa dipastikan kalau mobil-mobil baru itu paling banyak untuk pasar Jakarta. Bila sebagian besar pemilik kendaraan itu bekerja di Ibukota, maka lalu lintas di dalam tol secara otomatis akan bertambah banyak dan kemacetan dipastikan akan bertambah parah. “Dan dua tahun ini sudah terjadi pembengkakan pertumbuhan kendaraan,” ujar Fauzi Bowo. Data Polda Metro Jaya dan pernyataan Foke sangat masuk akal, jika melihat data yang dikeluarkan saat ajang pameran terbesar otomotif 2010, Indonesia International Motor Show yang gelar Agustus 2010 lalu. Dalam perhelatan itu dibukukan penjualan Rp2,4 triliun. Angka ini melampaui target transaksi sebanyak Rp2,2 triliun. Jumlah mobil terjual fantastis, sekitar 10 ribu mobil. “Setidaknya 10 ribu mobil terjual dalam ajang selama sepekan ini,” kata Ketua Umum Gabungan Industri Kendaraan Bermotor Indonesia (Gaikindo) Sudirman MR. Tentunya jumlah mobil sebanyak itu akan makin mempercepat kelumpuhan lalulintas Jakarta. Ini sesuai dengan data Dinas Perhubungan DKI Jakarta menunjukkan, pertambahan jumlah kendaraan pribadi di Jakarta mencapai 1.117 per hari atau sekitar 9 persen pertahun. Sementara pertumbuhan luas jalan relatif tetap, sekitar 0,01 persen per tahun. Jika tak segera ada pembenahan pola transportasi, pada tahun 2014 Jakarta diperkirakan akan mengalami kemacetan total(Vivanews)

Medan Metropolitan

WASPADA Rabu 29 September 2010


Penertiban Babi Dimulai Minggu Ini MEDAN (Waspada): Walikota Medan Rahudman Harahap mengatakan penertiban ternak babi di kecamatan Medan Denai dimulai minggu ini. Hal itu dilakukan sesuai peraturan Walikota Medan No. 23 tahun 2009 tentang larangan usaha ternak berkaki empat, disusul keputusan Walikota Medan No.423/757 K tentang pembentukan tim pengawas usaha ternak kaki empat. “Penertiban ini bukan semena-mena dilakukan, tetapi disertai dengan solusi terbaik

yaitu memberikan bantuan biaya transportasi pemindahan ternak sebesar Rp76.000 per

Keluarga Besar SMAN-1 Halal Bi Halal MEDAN (Waspada): Keluarga besar SMA Negeri-1 mengggelar halal bi halal 1431H sekaligus penepung tawaran calhaj pegawai Tata Usaha Nelly Nirwana Harahap yang menunaikan rukun Islam kedua kalinya ke tanah suci Makkah Almukarramah. Acara berlangsung di halaman sekolah Jalan T. Cik Ditiro No. 1 Medan, Sabtu (25/9), dan dikemas secara khusus yang dihadiri para guru, Kepala SMAN-1 Dra Hj Rebekka Girsang, staf wakasek bidang kurikulum Drs Aswal Scorpio, PKS dan ketua, anggota komite sekolah. Kepala SMAN 1 Medan Rebekka Girsang mengatakan, halal bi halal secara umum sudah dilaksanakan beberapa hari lalu diikuti oleh para murid dan dihadiri orangtua murid. Bertujuan untuk mempererat tali silaturrahmi sekaligus ukhuwah Islamiyah. Ustadz Amhar Nasution dalam tausyiahnya, mengajak umat muslim khususnya agar menjaga persatuan dan persatuan serta agar tidak gontok-gontokan sesama kita dalam bingkai membina spiritual. Dikatakan Amhar, perjalanan haji sangat sakral dan ritual. Maka kepada calhaj yang berangkat, berdoalah di Mutltazam agar teman-teman yang belum berangkat dapat dipanggil oleh Allah ke Baitullah untuk naik haji. “Karena ini merupakan perintah Allah SWT, segeralah tunaikan ibadah haji jika kamu mampu baik secara fisik maupun materi dengan bertawaf mengelilingi Ka’bah tujuh kali, sa’i dari bukit safa dan bukit marwa serta wukuf di Arafah serta melontar zumroh. Menginjakkaan kaki dengan bertawaf maka kita telah melaksanakan apa yang telah dilakukan terhadap 25 Nabi,” ujar Amhar yang juga dosen STIK-P Medan tersebut. Sebelumnya pembacaan ayat suci Alquran oleh Muhammad Safii qori nasional asal Kota Medan dan diakhiri dengan doa serta makan bersama dan hiburan.(m25)

Halal Bi Halal Alumni HMI UISU Meriah MEDAN (Waspada): Halal bi-halal dan silaturrahim Keluarga Besar Alumni Himpunan Mahasiswa Islam (HMI) se-UISU yang dilaksanakan di Hotel Madani Jalan Sisingamangaraja Medan, berlangsung meriah dan penuh kekeluargaan. Ketua panitia Yanhar Jamaluddin didampingi Sekretaris Hasinuddin dan steerring comitte Nurul Azhar Lubis, Senin (27/ 9) mengatakan sekitar 120 alumni turut hadir pada acara Halal bi Halal dan Silaturrahim tersebut, termasuk di antaranya sesepuh alumni HM Yamin Lubis dan Zainuddin Tanjung serta alumni senior antara lain Muhardi Sarjan, Fauziah Dongoran MKI, Yulizar Parlagutan Lubis, Nurul Azhar Lubis dan Nimelda. Yanhar menyampaikan halal bi halal dan silaturrahim ini dilaksanakan bertujuan untuk merajut kembali komunikasi dan ukhuwah antar sesama alumni HMI se- UISU , sehingga antar sesama alumni tetap terjalin hubungan yang akrab dan penuh kekeluargaan. Acara diisi juga dengan menyerahkan santunan kepada anak yatim dari Panti Asuhan Al-Washliyah Jalan Ismailiyah dan Panti Asuhan Putri Aisyiah Jalan Santun Medan serta memberikan bingkisan kepada para sepuh alumni HMI se UISU antara lain HMYamin Lubis, Zainuddin Tanjung, Chairuddin Kawa dan kepada pihak-pihak lain yang turut berjasa dalam perkembangan dan kemajuan Himpunan Mahasiswa Islam di UISU. Dalam tausyiahnyaYamin Lubis mengingatkan kepada alumnialumni HMI se- UISU yang telah sukses hendaknya betul-betul membina umat karena sesungguhnya umat Islam itu adalah bersaudara. Berdasarkan hasil rapat tim formatur telah terbentuk susunan pengurus Forum silaturrahim alumni (Forsila) HMI se-UISU masa kepengurusan 2010-2011 yang diketuai oleh Fajri Effendi Pasaribu, Wakil Ketua Yanhar Jamaluddin dan Muhardi Sarjan, sekretaris Fenty Maimunah Simbolon, bendahara T Gita Aisyaritha dibantu beberapa koordinator. (m29)

Mahasiswa Tertembak Senapang Angin MEDAN (Waspada): Seorang mahasiswa perguruan tinggi swasta, Sofyan Sirait, menderita luka tembak senapang angin di Jalan Kapten Muslim Gang Selamat, Medan, Selasa (28/9). Saksi mata kepada Waspada mengatakan, kejadian berawal saat korban warga Perdagangan, Kabupaten Sergai, bersama dua rekan satu kosnya di Jalan Kapten Muslim Gang Selamat, berboncengan tiga naik sepeda motor Yamaha Jupiter MX. Korban saat itu duduk diboncengan paling belakang. Namun, tidak jauh dari rumah kos tiba-tiba korban minta turun dari bocengan karena bagian pinggangnya mengeluarkan darah. Teman korban yang diboncengan posisi ditengah Timbul mengakui ada mendengar suara tembakan diduga dari salah satu bangunan berlantai tiga tidak jauh dari lokasi kejadian tersebut. Kemudian korban langsung dibawa ke RS Sari Mutiara karena luka tembak dari pinggangnya terus mengeluarkan darah. Saat ini korban masih menjalani perawatan di ruang Melati-VIII rumah sakit tersebut. Menurut saksi, korban tertembak peluru senapang angin. Disebut-sebut, korban akan menjalani operasi luka tembak ke RS Haji Adam Malik. (m31)


KORBAN PELURU NYASAR: Sofyan Sirait korban peluru nyasar mendapat perawatan di Rumah Sakit Sari Mutiara Medan, Selasa (28/9), hingga saat ini pihak keluarga belum mengetahui secara pasti asal peluru yang melukai punggung kiri belakangnya.

ekor bagi babi berusia di atas 4 bulan dan Rp60.000 di bawah 4 bulan,” kata Rahudman di hadapan seribuan masyarakat kecamatan Medan Denai pada saat melakukan sosialisasi pemindahan ternak babi, Selasa (28/9). Selain itu, kata Rahudman, Pemko juga memberikan bantuan benih ikan lele kepada peternak babi yang ingin beralih usaha kepada budidaya ikan lele sebanyak 2.000 ekor sesuai dengan luas lahan disertai tenaga pendamping cuma-cuma. Sedangkan solusi ketiga yakni melakukan relokasi, namun saat ini Pemko belum menemukan lahan sehingga tidak mungkin dilaksanakan. “Yang pasti kita melakukan denganduaalternatifyaknimemberikan bantuan transportasi dan bantuan benih ikan lele. Untuk itu saya berharap kepada seluruh peternak agar dapat memahaminya. Namun, penertiban ini secara bertahap,”

ungkap Rahudman. Dijelaskan mantan Sekda Tapsel ini, Kota Medan merupakan kota metropolitan yang harus dijaga dengan baik, jadi dengan kehadiran ternak kaki empat tersebut maka sangat tidak mendukung. Untuk itu, sudah pasti ditertibkan walaupun secara bertahap tanpa ada gesekan antara Pemko dengan peternak.“Kita tidak ingin terjadi keributan dalam penertiban ternak tersebut. Namun, diminta kepada peternak agar tetap bersedia ditertibkan. Jadi, mulai minggu ini penertiban dilakukan,” ucapnya. Ditambahkan Rahudman, sampai saat ini sudah 67 peternak menerima bantuan transportasi pemindahan ternak tersebut dengan jumlah ternak 900 ekor. Jadi, bagi yang sudah menerima bantuan itu dalam minggu ini mulai memindahkan ternaknya. Pada sosialisasi kemarin nyaris terjadi kericuhan, pasal-

nya sejumlah masyarakat peternak babi tetap tidak bersedia dipindahkan. Menurut mereka solusi yang diberikan Pemko tidak memihak terhadap peternak. Untuk itu, para peternak bersorak menolak penertiban. MenurutWilson Manalu salah seorang peternak, peternak tidak bersedia memindahkan ternaknya dari kawasan itu terkecuali direlokasi. Menurut dia, ketidaksediaannya memindahkan ternaknya karena tidak ada lahannya di tempat lain. “Kami tidak bersedia dipindahkan, karena tidak ada lahan lain di luar tempat ini,” ucapnya. Hadir pada sosialisasi itu, Sekda Kota Medan HM Fitriyus, Kabag Humas Pemko Medan Hanas Hasibuan, Wakil Ketua DPRD Kota Medan Ikhrimah Hamidy, sejumlah Satuan Kerja Perangkat Daerah (SKPD), para camat se Kota Medan, dan masyarakat kecamatan Medan Denai khususnya peternak kaki empat. (h10)

MDP-PT YFA Sepakat Salurkan 1.000 TKW MEDAN (Waspada): Dewan Pimpinan Pusat Masyarakat Demokrasi Pembangunan (DPP MDP) Sumatera Utara bersama PTYosan Fadinda Abadi (YFA), perusahaan outsourching nasional, menandatangani Memorandum of Understanding (MoU) perekrutan dan penyaluran 1.000 tenaga kerja wanita. Para tenaga kerja wanita (TKW) itu akan dipekerjakan di dua perusahaan asing memproduksi hasil laut di kabupaten Tulang Bawang Provinsi Lampung. Penandatanganan nota kesepakatan yang dilaksanakan di Sekretariat DPP MDP Sumatera Utara, Jl. Murai no.135 F Sei Sekambing B Medan, Sabtu (25/ 9), juga membahas tentang pelatihan tenaga kerja terampil bagi kader MDP, Ketua Umum DPP MDP Sumut M Ahyar yang akrab disapa A’ang didampingi Sekjen H Idrus Djunaidi, pengurus harian M. Nasib dan Yohana menyebutkan, pihaknya sangat berterimakasih kepada pihak PT Yosan yang memberikan kepercayaan kepada MDP untuk bekerjasama dalam perekrutan tenaga kerja.

Hal ini, papar Aang, sejalan dengan tujuan organisasi Masyarakat Demokrasi Pembangunan, yang ingin memberikan satu perubahan positif kepada masyarakat. “Kita akan berusaha semaksimal mungkin membantu PT Yosan Fadinda Abadi untuk merekrut masyarakat yang membutuhkan pekerjaan,” tegasnya. Menurut Aang, kesempatan ini merupakan satu harapan baru bagi masyarakat yang belum mendapat pekerjaan tetap. “Daripada mereka menjadi TKI ke luar negeri seperti selama ini, lebih baik mereka bekerja di negeri sendiri dengan gaji yang cukup besar. MDP akan memanfaatkan kesempatan ini sebaik-baiknya dan menyampaikan informasi ini kepada seluruh warga MDP maupun masyarakat luas lainnya,” tambahnya. Sementara itu Direktur Utama PT Yosan Fadinda Abadi H Anrizal Ramaputra, SE menyebutkan, kerjasama dengan pihak DPP MDP Sumut adalah yang pertama kalinya dilakukan pihaknya. PTYFA menilai meski MDP adalah sebuah organisasi baru, namun telah memilki ja-


Ketua Umum DPP MDP Sumut, M Ahyar berjabat tangan dengan Direktur Utama PT Yosan Fadinda Abadi H Anrizal Ramaputra, SE usai penandatangan MoU disaksikan Sekjen DPP MDP, H Idrus Djunaidi, pengurus harian M. Nasib dan Yohana.

ringan luas di tengah masyarakat Sumut, khususnya kota Medan. “Kami menilai organisasi MDP memiliki kemampuan dalam mensosialisasikan dan merekrut tenaga kerja untuk dipekerjakan di perusahaan mitra PT YFA. Selain itu MDP memilki komitmen dalam membantu masyarakat terutama dalam upaya menciptakan lapangan kerja bagi masyarakat yang belum ber untung “ ucap Anrizal. Anrizal juga menjelaskan, tentang fasilitas yang diperoleh para pekerja wanita yang akan ditempatkan di perusahaan yang bergerak dalam bidang pengolahan hasil laut tersebut, antara lain, penghasilan (gaji) Rp1,2 juta sampai Rp2 juta perbulan yang diakumulasikan dari UMR dan lembur. Pihak perusahaan juga menyediakan fasilitas pemondokan dan klinik kesehatan dan yang terpenting para pekerja disertakan dalam seluruh program jamsostek sebagai wadah perlindungan bagi para pekerja. Persyaratan bagi perkerja, antara lain, perempuan/wanita usia minimal 17 sampai 35 tahun, memiliki KTP, tamatan minimal SD (bisa baca tulis), tinggi badan minimal 150 cm, berbadan sehat dan sanggup bekerja di suhu dingin. Bagi masyarakat berminat bisa mengirimkan lamaran selambat-lambatnya tanggal 11 Oktober 2010 ke alamat secretariat DPP MDP Sumut yang ditujukan kepada Pimpinan PT Yosan Faninda Abadi, Jalan Garu III No 33 Medan. Untuk kerja sama lainnya, PT YFA juga berencana akan membuat pelatihan pekerja terampil bagi kader MDP yang dilaksanakan secara bertahap sesuai kebutuhan dari permintaan perusahaan penguna tenaga kerja yang menjadi mitra PT. YFA. (m08)

Waspada/ME Ginting

Walikota Medan Rahudman Harahap memberikan keterangan soal pemindahan ternak babi di kecamatan Medan Denai di hadapan peternak babi, Selasa (28/9), di Kel. Tegal Sari Medan Denai.

Anggota Densus 88 Gadungan Ditangkap MEDAN (Waspada): Mengaku anggota Densus 88 berpangkat Ajun Komisaris Polisi (AKP), pria berinisial NG, 30, warga Desa Lau Kesumpat, Kec. Mardinding, Kab. Karo, diringkus petugas kepolisian saat melintas di depan markas Polsekta Pancurbatu, Senin (27/9) siang. Guna pengusutan selanjutnya, NG kini mendekam dalam sel sedangkan korbannya Herawati br Karo telah membuat laporan pengaduan. Kepada polisi, korban menjelaskan, awal perkenalan mereka terjadi beberapa minggu lalu saat Herawati pergi ke pesta ulang tahun temannya di kawasan Tanjung Selamat, Kec. Medan Tuntungan. Di acara itu, Herawati bertemu dengan NG. Dalam perkenalan mereka, pria NG mengaku sebagai anggota Polri berpangkat AKP yang bertugas di Densus 88 Pekan Baru. Merekapun saling tukar nomor telefon selulernya. Sejak pertemuan pertama itu, hubungan keduanya semakin akrab dan mereka juga sering bertemu. Keakraban mereka tidak disiasiakan oleh NG lalu mengajak Herawati untuk bertemu orangtua gadis itu.

Dengan menggunakan mobil rentalan yang diperoleh NG melalui temannya Mawan yang tinggal satu kos dengannya, mereka meluncur menuju kampung orangtua Herawati di Tiga Lingga, Kabupaten Dairi. Menerima kabar dari Herawati, keluarganya berkumpul menunggu kedatangan anak gadisnya bersama calon menantu yang seorang perwira polisi itu. Sesampainya di rumah orangtua Herawati, NG dan Herawati disambut sejumlah keluarga yang sudah berkumpul di rumah. Setelah bertemu keluarga Herawati, Natanael dan Herawati kembali ke Medan. Namun, saat masih dalam perjalanan menuju Medan, salah seorang keluarga Herawati yang tadinya ikut berembuk saat kedatangan NG, mendapat firasat kurang baik. Dia kurang yakin bahkan tidak percaya kalau NG itu adalah seorang anggota Polri berpangkat AKP bertugas di bagian Densus 88 di Pekan Baru. Merasa curiga, keluarga tersebut segera menghubungi David Barus, seorang keluarganya yang berada di Medan. Kepada David diceritakanlah

tentang tetek bengek pria berinisial NG itu. Menerima penjelasan dari keluarganya di kampung, David Barus segera menghubungi Herawati untuk bertemu dengannya. Herawati yang sudah mengenal David, menyetujui permintaan itu. Di perjalanan mereka bertemu dengan David Barus yang sebelumnya sudah menghubungi petugas Polsekta Pancurbatu. Begitu mobil yang disopiri NG tiba di depan Mapolsekta Pancurbatu, polisi langsung menstopnya. Selanjutnya NG dan Herawati digiring ke komando sekaligus diinterogasi. Pada saat itulah diketahui kalau NG telah melakukan penipuan. Untuk proses selanjutnya NG masih diamankan di Mapolsekta Pancurbatu. Kapolsekta Pancurbatu AKP JK Tampubolon mengatakan, tersangka NG bukanlah anggota Densus 88 melainkan seorang petani Pisang. “Saat ditanya logo Densus, pria NG tak mengetahuinya sehingga dia langsung kita tahan,” jelas AKP JK Tampubolon. Menurut AKP JK Tampubolon, tersangka NG dikenakan pasal penipuan. (cat)

Medan Metropolitan


WASPADA Rabu 29 September 2010

Penundaan Musda Partai Demokrat Berpotensi Timbulkan Konflik MEDAN (Waspada): Agenda pelaksanaan Musyawarah Daerah (Musda) Partai Demokrat Sumut mendesak untuk segera dilaksanakan pada Oktober mendatang. Jika terus tertunda, dikhawatirkan dapat menimbulkan friksi-friksi yang berpotensi menimbulkan konflik di DPD dan 33 DPC partai pemenang Pemilu 2009 itu. “Sebaiknya DPP Partai Demokrat segera menetapkan tanggal pelaksanaan Musda. Apalagi saat ini suasana di DPCDPC sangat kondusif,” kata Wakil Ketua DPD Partai Demokrat Sumut, Ahmad Ikhyar Hasibuan kepada Waspada, Selasa (28/9). Ahmad Ikhyar mengatakan, DPD Partai Demokrat Sumut sebenarnya berprasangka baik dengan sikap DPP yang belum juga mau menentukan tanggal pelaksanaan Musda. Meskipun kepanitiaan Musda sendiri sebenarnya sudah terbentuk sejak Juni lalu, dan sudah tiga kali mengajukan usulan tanggal pelaksanaan ke pusat.

Usulan pertama pada 29-31 Juli. Kemudian pada bulan Agustus dan menyerahkan kepada DPP tanggal pelaksanaannya, serta usulan terakhir 24-26 September. Namun sampai saat ini DPP tetap belum menyikapinya. Padahal idealnya, pelaksanaan Musda II sendiri seharusnya dilakukan pada Juli 2010, sesuai dengan waktu pelaksanaan Musda I. “Usulan itu sudah kita sampaikan secara lisan dan tertulis. Bahkan sudah ada pembicaraan dengan Wakil Ketua Umum DPP Jhonny Allen Marbun. Namun tetap belum ada kejelasan soal pelaksanaan Musda,” kata politisi senior yang akrab dipanggil Ayah itu. Menurut Ahmad Ikhyar, jika terus tertunda, maka dikhawatirkan akan ada pihak-pihak yang berusaha memanfaat situasi tersebut sehingga berpotensi mengulang peristiwa yang terjadi di Musda pertama Partai Demokrat Sumut pada 2005 lalu. Ketika itu, banyak terjadi pemecatan-pemecatan kepengurusan DPC menjelang Mus-

Sindikat Pemalsu KTP Diringkus MEDAN (Waspada): Reskrim Unit Judi/Sila Polresta Medan membekuk sindikat pemalsu Kartu Tanda Penduduk (KTP) dari salah satu rumah di Jalan Utama, Kec. Medan Area, Senin (27/ 9) malam. Tersangka yang diamankan lima orang termasuk pencetak, pemesan dan calo untuk membuat KTP palsu. Para tersangka yang diamankan masing-masing HD, N, BS, AR dan FP, kesemuanya warga Medan. Kapolresta Medan Kombes Pol Tagam Sinaga kepada wartawan, Selasa (28/9) mengatakan, barang bukti yang disita berupa satu unit komputer, satu unit scanner, tiga lembar KTP asli, tiga lembar KTP palsu, dua stempel Dinas Kependudukan Pemko Medan, satu stempel Dinas Kependudukan Kab. Deli Serdang, satu stempel Dinas Perindag Medan dan satu stempel Dinas Perindag Deli Serdang. Kasus ini terungkap berawal dari laporan warga kepada polisi yang menyebutkan di kawasan Jalan AR Hakim Medan ada seseorang yang mau menyerahkan KTP palsu. Kemudian polisi melakukan penyelidikan dan menangkap tersangka BS dan AR. Kemudian petugas melakukan pengembangan. Dari pengakuan kedua tersangka itu, polisi meringkus HD di Jalan Utama. Lalu tersangka N dan FP dibekuk di kawasan Jalan Gaharu Medan. Dari hasil pemeriksaan, para tersangka membuat KTP palsu dengan meminta bayaran sebesar Rp25 ribu sampai Rp50 ribu. Tindakan mereka ini diakui para tersangka sudah lama digeluti dan hasilnya dibagi rata. Mereka mencetak sendiri tidak ada melibatkan instansi pemerintahan. Untuk mempertanggungjawabkan perbuatannya, para tersangka dijebloskan ke dalam sel Mapolresta Medan. (m39)

Otak Pencurian, Penggelapan Dokumen PT RAS Diburon MEDAN (Waspada): Kasus pencurian dan penggelapan dokumen PT RAS yang hingga kini masih terus dilidik oleh Polresta Pekanbaru dengan menetapkan satu orang tersangka Mus, 49, yang juga merupakan karyawan PT RAS. Ternyata, dari pengembangan polisi disinyalir masih ada melibatkan seorang aktor intelektual yang terlibat dalam kasus tersebut. Menurut DH, warga Kota Pekan Baru, yang juga tercatat sebagai Komisaris PT RAS, di Medan, Senin (27/9) menjelaskan, pencurian dan penggelapan dokumen itu diduga kuat selain tersangka Mus sebagai pelaku, masih ada seorang aktor intelektual berinisial KTT, penduduk Kota Medan, yang kini masuk dalam Daftar Pencarian Orang (DPO) Polres Metro Jakarta Utara (Jakut) dalam kasus pemalsuan. Hal tersebut dikuatkan berdasarkan pengeluaran surat DPO oleh Polres Jakarta Utara dengan Nomor: DPO/179/VI/2010/REsju/ TGL 16 Juni 2010 yang ditandatangani Kapolres Metro Jakarta Utara Kombes Drs Rudy Sufahriadi. Kini kasus pemalsuan itu masih dalam penyelidikan pihak Kepolisian, dan terlapor KTT (foto) masih terus dalam pengejaran anggota Reskrim Polres Metro Jakut. “Saya menduga, dibalik tersangka Mus ada aktor intelektual yang kini terus diburon polisi. Karena, DPO itu juga mantan pimpinan di PT RAS. Oleh karenanya, kita mendesak pihak kepolisian untuk mengusut kasus ini hingga ke akar-akarnya,” pinta DH. Penggelapan dan pencurian dokumen yang dilakukan oleh karyawan PT RAS yang terletak di Jalan Setia Budi, Limah Puluh, terjadi tahun 2009 lalu. Hingga kini petugas Sat Reskrim Polresta Pekan Baru berhasil menangkap satu orang tersangka Mus. Sementara Kasat Reskrim Polresta Pekan Baru AKP Sapta Maulana Marpaung SH.SIK, saat dikonfirmasi wartawan melalui seluler mengatakan, pihaknya masih terus melakukan penyelidikan dan pengembangan terhadap kasus tersebut.(cat)

15 Perajin Sumut Ikuti Pameran Di Malaysia MEDAN (Waspada): Sebanyak 15 perajin asal Sumatera Utara binaan Himpunan Pengusaha Muda Indonesia (HIPMI) dan Pertamina Sumut mengikuti pameran di Malaysia pada acara Forum Bisnis dan Pameran Asean 100 Leadership Forum 2010 di Hotel Shangrilah, Kuala Lumpur Malaysia, mulai 28-30 September 2010. Rombongan Usaha Kecil Menengah (UKM) binaan HIPMI dan Pertamina Sumut yang akan memamerkan berbagai produk hasil kerajinan tersebut diberangkatkan Koordinator Program Kemitraan dan Bina Lingkungan (PKBL) Pertamina Regional I Medan, OK Khaidar Aswan, di kantor Pertamina Jl. Yos Sudarso Medan, Senin (27/9). OK Khaidar Aswan mengatakan, para UKM binaan HIPMI dan Pertamina tersebut agar membuat suatu terobosan yang baik untuk meningkatkan mutu hasil kerajinan yang diperbuat. Dia juga mengimbau kepada UKM untuk lebih baik lagi menjalin hubungan kepada para pengusaha-pengusaha muda di Asean agar hasil kerajinan di Sumatera Utara bisa dipasarkan secara baik. “Pameran ini sangat penting untuk diikuti guna memasarkan produk-produk kerajinan UKM binaan HIPMI dan Pertamina Sumut,” ujarnya. Sementara itu, Ketua BPD HIPMI Sumut, Said Aldi Al Idrus mengatakan, ke-15 perajin UKM asal Sumut ini akan memamerkan hasil kerajinan dari HIPMI seperti dari BPC HIPMI Serdang Bedagai, Deliserdang, Pematang Siantar, dan Simalungun. Dia menyebutkan, rombongan UKM ini langsung dikoordinir bidang UKM HIPMI, Sulkarnaen, SE dan Mahmudin Rambe. “Kita berharap kegiatan ini nantinya bisa memasarkan produk kerajinan Sumut dan turut memasarkan pariwisata di Sumut. Mudah-mudahan kegiatan ini bermanfaat bagi penggerak UKM di Sumut,” ujar Aldi seraya mengatakan, acara tersebut dihadiri Perdana Menteri Malaysia, Dato’ Seri Nazib Tun Razak yang akan diikuti ketua-ketua pengusaha muda se Asean. (m41)

da. Sehingga menimbulkan konflik friksi-friksi dan merusak tatanan partai. “Artinya, pengalaman jelek Musda pertama jangan sampai terulang kembali di Musda kedua ini. Gaya-gaya lama itu jangan diulangi lagi,” kata mantan anggota DPRD Sumut itu. Ahmad Ikhyar yakin seluruh DPC dan DPD Partai Demokrat di Sumut saat ini sudah sangat siap untuk memilih pemimpin partai ke depan. Terbukti pada Kongres Partai Demokrat lalu, seluruh DPC sudah sangat bijak menentukan pilihan tanpa intervensi dari manapun. Sehingga pada Musda ini, baik DPD dan DPC Partai Demokrat di Sumut pastinya siap mengawal agar proses demokrasi berjalan baik dan kondusif,

seperti yang dilakukan pada kongres. Apalagi Ketua DPD Partai Demokrat Sumut Palar Nainggolan pernah menyatakan siap mengantarkan pelaksanaan Musda ini agar berlangsung demokratis. Apalagi, katanya, sejumlah nama calon kandidat yang muncul seperti Ketua DPRD Sumut Saleh Bangun, Sekretaris Partai Demokrat Sumut Rahmad Hasibuan,Walikota Medan Rahudman Harahap serta sejumlah nama lainnya, sudah memiliki kualitas dan kapabilitas serta loyalitas terhadap partai. “Sehingga kader itu pun sudah pasti tahu memilih siapa pemimpin yang terbaik dan lebih baik dari dirinya,” katanya. Karena itu, Ahmad Ikhyar berharap DPP Partai Demokrat

dapat segera menetapkan tanggal pelaksanaan Musda pada Oktober mendatang. Serta dapat menjadi wasit yang baik dalam Musda yang memiliki agenda memilih pemimpin serta menyusun program kerja partai lima tahun ke depan. Terutama untuk persiapan menghadapi Pemilu 2014. “Tugas partai ke depan itu sangat berat. Makanya jangan sampai tertunda lagi,” katanya. Lebih jauh Ahmad Ikhyar juga mengingatkan kembali kepada seluruh DPC Partai Demokrat Sumut untuk tetap mempertahankan suasana kondusif dan tidak terpancing isu-isu dari luar. “Serta tetap menggunakan hati nurani dalam menentukan pilihan nantinya,” jelasnya.(h11)

Warga Tuntut Kades Copot MEDAN (Waspada): Ratusan warga Desa Tanjung Anom, Kec. Pancurbatu, Kab. Deliserdang, mendatangi kantor Camat Pancurbatu, Senin (27/9). Warga datang menumpang mobil angkot dan sepedamotor tiba di kantor Camat sekira pukul 10.30 WIB. Mereka menuntut agar Kepala Desa Tanjung Anom Mar, diberhentikan dari jabatannya karena dinilai tidak pantas lagi sebagai pemimpin di desa itu. Alasannya, kata seorang warga, karena oknum Kades telah mencemari desa mereka dengan cara melakukan perselingkuhan dengan seorang wanita bersuami yang tak lain warganya sendiri. Selain itu, oknum Kades diduga telah menyelewengkan bantuan bencana alam angin puting beliung serta selalu bertindak semena-mena. Salah seorang warga, mengatakan, oknum Kades Tanjung Anom pernah kedapatan berselingkuh oleh seorang tukang berinisial ER, warga Dusun III. Ketika itu ER sebagai kuli bangunan menemukan oknum

Kades berselingkuh dengan seorang perempuan berinisial NL. Selain itu, kata warga, oknum kades juga dituding menggelapkan bahan material bangunan untuk korban angin puting beliung di desa itu sekitar tiga bulan lalu. Ketika bencana alam menimpa Desa Tanjung Anom, ada sekitar 20 rumah yang mengalami kerusakan. Namun bantuan dari Bupati Deliserdang tidak diberikan kepada semua warga yang ketimpa musibah tapi hanya untuk beberapa orang saja. Selebihnya dijual oleh oknum kades kepada warga yang tidak ketimpa musibah. Warga lainnya Ponia menambahkan, kalau oknum Mar memungut biaya tinggi dalam pengurusan KTP. “Sebulan lalu saya mengurus KTP melalui oknum Kades, tapi kepada saya disuruh diurus lagi membuat Kartu Keluarga. Supaya bisa mengurus KTP kepada saya dikenakan biaya Rp80.000. Apa kalau mau mengurus KTP mesti ganti kartu keluarga lagi, walau masih baru mengurus kartu

keluarga,” keluh warga. Pjs Camat Pancurbatu W Karo-Karo, SE kepada wartawan mengatakan, dalam waktu dekat usulan warga Desa Tanjung Anom akan ditindaklanjuti. “Per mintaan warga yang menginginkan kepala desanya dicopot dari jabatannya akan ditindak lanjuti. Aspirasi warga sudah saya terima dan saya berjanji akan menindak lanjutinya. Dalam waktu dekat akan kita panggil saksi-saksi untuk diperiksa terkait dengan aspirasi yang disampaikan warga terutama yang menyaksikan perselingkuhan itu,” ujarnya. Menur ut W Karokaro, pihaknya juga akan memintai keterangan saksi-saksi atas penyimpangan bantuan Bupati atas bencana alam di Desa Tanjung Anom. “Jika Kades Tanjung Anom terbukti melakukan penyimpangan, kasus ini akan kita serahkan kepada Badan Permusyawaratan Desa (BPD) Desa Tanjung Anom untuk mengambil tindakan selanjutnya,” jelas W Karo-Karo seraya meminta kesabaran warga untuk tidak bertindak anarkis. (cat)

Inggris Butuh Banyak Tenaga Kesehatan STIKes Mutiara Indonesia Lantik 784 Wisudawan MEDAN (Waspada): Sebanyak 784 lulusan program studi Strata-1 (S-1) dan Diploma-3 (D3) Sekolah Tinggi Ilmu Kesehatan (STIKes) Mutiara Indonesia diwisuda di Gedung Selecta Jalan Listrik Medan, Sabtu (25/9). Wisuda tahun akademik 2009/2010 ini dipimpin Ketua STIKes Mutiara Indonesia, Dra Ivan Elisabeth Purba MKes ini turut dihadiri Ketua sekaligus Pendiri Yayasan Sari Mutiara Drs. W Purba, anggota Dewan Perwakilan Daerah Republik Indonesia (DPD RI) yang juga Badan Pengurus HarianYayasan Sari Mutiara, Parlindungan Purba, SH, MM. Hadir juga Koordinator Kopertis Sumut/ NAD, Prof Dr Zainuddin MPd, Ketua Aptisi Sumut, H Bahdin Nur Tanjung SE MM, Ketua Ikatan Bidan Indonesia (IBI) Cabang Medan, Dinaria Girsang SPSi MPSi, orangtua wisudawan dan undangan lainnya. Dalam acara ini, Parlindungan Purba tak sekadar menyampaikan ucapan selamat kepada para wisudawan dan keluarganya karena telah menamatkan pendidikan di STIKes Mutiara Indonesia. Bahkan pihaknya, siap mengantar atau membantu alumni untuk go international dengan bekerja di luar negeri. Dari kunjungan kerja di Inggris pekan lalu, lanjut Parlindungan, negara ini membutuhkan banyak tenaga kesehatan dari berbagai negara. Karena itu, ia mengemukakan siap membantu para alumni STIKes Mutiara Indonesia untuk bekerja di Inggris terutama bagi alumni yang menguasai bahasa asing. Untuk menyukseskan pro-

gram ini, Parlindungan meminta pimpinan STIKes Mutiara Indonesia untuk dapat menjalin kerja sama dengan sejumlah rumah sakit di Malaysia yang merupakan bagian dari negara persemakmuran Inggris. ‘’Di Malaysia, mereka akan dilatih terutama dalam penguasaan Bahasa Inggris sebelum di kirim ke Inggris. Peluang kerja lain juga telah dirintis ke Abu Dhabi dalam beberapa tahun terakhir,’’ ungkap senator yang dikenal dekat dengan masyarakat itu. Secara khusus, Parlindungan berharap, alumni STIKes Mutiara Indonesia dapat menjadi ‘sarinya dari mutiara’ yang dapat menjadi teladan dalam kehidupan berbangsa dan bernegara. ‘’Kebutuhan tenaga kesehatan di Sumut terus meningkat sejalan dengan makin tingginya kesadaran masyarakat akan pentingnya kesehatan,’’ tambahnya. Parlindungan mendukung berbagai upaya peningkatan mutu lulusan dan staf pengajar yang dilakukan STIKes Mutiara Indonesia yang saat ini sedang mempersiapkan diri menjadi Universitas Mutiara Indonesia. Demikian pula dengan rencana pengembangan Yayasan Sari Mutiara untuk mendirikan rumah sakit baru berkualitas yang dikhususkan melayani kesehatan masyarakat menengah ke bawah. ‘’Ini sesuai pesan Bidan S Sitanggang, orangtua kami yang membangun praktik Bidan Berijazah S Sitanggang pada tahun 1962. Kemudian berkembang menjadi Klinik Bersalin Sitanggang, Rumah Sakit Sitanggang hingga menjadi RSU Sari Mutiara. Saat ini ada RSU Sari Mutiara di

Medan dan Lubuk Pakam serta beberapa Klinik Sari Mutiara di Deli Serdang, Langkat dan Medan,’’ katanya. Sementara itu, Ketua STIKes Mutiara Indonesia, Dra. Ivan Elisabeth Purba, MKes mengemukakan, STIKes Mutiara Indonesia berusaha meningkatkan kualitas lulusannya dengan mengembangkan kurikulum, peningkatan pendidikan dosen, peningkatan prasarana dan sarana pendidikan serta meningkatkan hubungan kerjasama dengan instansi pemerintah dan asosiasi profesi. Ivan yang juga kandidat Doktor ini menambahkan, pihaknya telah menjalin kerja sama dengan RSUP H Adam Malik, RSU Dr. Pringadi Medan, RSJ Daerah Provsu, RS Persahatan Jakarta, RS Harapan Kita Jakarta, RS Taman Harapan Baru Jakarta, RS Budi Kemuliaan Jakarta, RSUD Tarakan dan Ambulance Gawat Darurat (108) Dinas Kesehatan DKI Jakarta. ‘’Hari ini dilantik 784 alumni terdiri dari sarjana kesehatan masyarakat, sarjana keperawatan, profesi nurse, ahli madya kebidanan, ahli madya keperawatan, ahli madya analis kesehatan serta ahli madya analisa farmasi dan makanan,’’ jelasnya. Dukungan atas rencana pengembangan STIKes Mutiara Indonesia menuju Universitas Mutiara Indonesia juga disampaikan Koordinator Kopertis Sumut/NAD Prof Dr Zainuddin MPd dan Ketua Aptisi Sumut H Bahdin Nur Tanjung SE MM. Bahkan dua praktisi pendidikan Sumut ini berterima kasih atas peran Yayasan Sari Mutiara untuk ikut mencerdaskan sumber daya manusia di Sumut. (m26)

Waspada/David Swayana

Ketua STIKes Mutiara Indonesia Dra. Ivan Elisabeth Purba, MKes melantik seorang wisudawati dari 784 lulusan program studi Strata-1 (S-1) dan Diploma-3 (D-3) STIKes Mutiara Indonesia yang diwisuda di Gedung Selecta Jalan Listrik Medan, Sabtu (25/9).

Waspada/Rudi Arman

Kasat II Dir Narkoba Poldasu AKBP Andi Rian menyaksikan petugas Laboratorium Forensik Polri Cab. Medan menguji narkoba jenis ekstasi disaksikan tersangka sebelum dilakukan pemusnahan barang bukti narkoba senilai Rp4,1 miliar di halaman Dir Narkoba Poldasu, Selasa (28/9).

Narkoba Rp4,1 M Dimusnahkan MEDAN (Waspada): Direktorat Narkoba Polda Sumut memusnahkan barang bukti narkotika dan obat-obatan terlarang senilai Rp4,1 miliar yang disita dari 8 orang tersangka, di halaman Mapoldasu, Selasa (28/9). Narkoba yang dimusnahkan, 33,395 gram daun ganja kering, 760 gram tepung warna putih, 55 gram zat pewarna, 15 gram tepung bahan baku pil ekstasi warna merah jambu, 170 butir ekstasi warna merah jambu, 195 butir ekstasi warna biru, 30 butir ekstasi warna kuning, 7.773 butir ekstasi warna merah jambu berlogo kupu-kupu, 4188 butir ekstasi warna kuning logo H, 1,526,4 gram sabu. Direktur Narkoba Polda Sumut Kombes Pol Jhon Turman Panjaitan usai pemusnahan barang bukti mengatakan, pemusnahan tersebut hasil tangkapan sejak akhir Juli sampai Septem-

ber 2010, dengan meringkus delapan tersangka dari berbagai daerah.“Sedangkan barang bukti yang disita dari tangan tersangka juga bervariasi. Tercatat, sabu dan ekstasi menjadi prioritas para tersangka,” katanya. Dijelaskannya. tersangka yang ditangkap Muhammad Fahrozi Lubis alias Adek alias Adeng dan Denni Agusta Rangkuti. Keduanya ditangkap 21 Juli 2010 di Jalan Asrama Kel. Dwikora, Kec. Medan Helvetia. Dari tangan keduanya disita 33.600 gram ganja. Kemudian Ponco Handoko ditangkap 23 Juli di Jalan Sumba, Kel. Pandau Hilir, Kec. Medan Perjuangan. Dari tangannya disita 507 pil ekstasi berbagai warna dan logo, serta 901 gram bahan baku pil ekstasi. Ahmad Effendi Hasibuan dan Syaiful Azhari ditangkap pada 30 Juli di Jalan Bustaman Gang Jaya Kesuma VI, Kec Percut Sei Tuan,

Kab. Deli Serdang. Dari tangan keduanya petugas menyita 41 gram sabu-sabu. Selanjutnya, tersangka Lim Sin Co ditangkap pada 17 Agustus, di Terminal Pemberangkatan Bandara Polonia Medan. Dari tangannya, petugas menyita 1.500 gram sabu-sabu, 7867 butir ekstasi warna merah jambu logo kupu-kupu dan 4.258 pil ekstasi warna kuning logo H. Selanjutnya, Sulaiman Tarigan dan Herdinel ditangkap pada 24 Agustus di Jalan Ileng, Kel. Paya Pasir, Kec. Labuhan Deli. Dari tangan keduanya petugas menyita, 51,4 gram sabu-sabu. Dalam pemusnahan narkoba itu turut juga dihadiri, Kajati, Balai POM, Dinas Kesehatan dan Kalabfor. “Kegiatan rutin pemusnahan barang bukti narkoba ini sesuai dengan amanat UU No. 35 Tahun 2009 tentang narkotika,” tandas Kombes Pol Jhon Turman. (m39)

Paulus Sinambela Pimpin HKTI MEDAN (Waspada): Paulus Sinambela, SH terpilih sebagai Ketua DPP HKTI Sumut setelah mengalahkan rivalnya Bupati Langkat Ngogesa Sitepu pada Musyawarah Provinsi Luar Biasa (Musprovlub) Himpunan Kerukunan Tani Indonesia (HKTI) Sumatera Utara, di Hotel Tiara Medan, Senin (27/9). Sebelumnya, pada pemilihan Ketua DPP HKTI Sumut putaran pertama oleh 23 pengurus HKTI kabupetan/kota, Ngogesa Sitepu tertinggal 6 suara dibawah Paulus Sinambela. Ngogesa mendapat 7 suara, sementara Paulus mendapat 13 suara. Karena sesuai tata tertib pemilihan, calon yang mendapat dukungan minimal 5 suara lolos putaran kedua, maka pemilihan putaran kedua kembali dilakukan. Pada putaran kedua yang ditambah satu suara dari DPP (Dewan Pimpinan Provinsi) dan satu suara dari DPN (Dewan Pimpinan Nasional) sehingga menjadi 25 jumlah hak suara, Ngogesa Sitepu lebih dulu unggul 6 suara. Namun dalam perhitungan kertas suara ke tujuh, suara untuk Paulus Sinambela mulai tampak hingga suara bagi Ngogesa dan Paulus sempat imbang 12-12. Tetapi akhirnya Ngogesa kalah dan Paulus mendapat 13 suara hingga terpilih Ketua DPP HKTI Sumut periode 2010-2015. Paulus Sinambela kepada wartawan mengaku, berterimakasih atas kepercayaan yang diberikan peserta Musprovlub kepada dirinya. Paulus menyebut dalam masa kepemimpinannya akan berjuang dan bekerja untuk peningkatan dan kemakmuran masyarakat petani. Menurut Paulus, selama ini petani ibarat orang yang terlupakan. Iapun akan merangkul seluruh elemen masyarakat

bagaimana meningkatkan taraf hidup petani, sebab petani merupakan orang terhormat di republik ini. Dalam menangani persoalan yang dihadapi petani saat ini, Pulus bersama unsur DPP HKTI Sumut nantinya akan membentuk tim khusus dan berkoordinasi dengan pengurus DPN HKTI Pusat. Musprovlub HKTI yang dihadiri Wakil Ketua DPN HKTI Pusat Rusfian, SH dan Wakil Sekretaris Guntur Limbong, SH.M.Hum dibuka Sekretaris Jenderal HKTI Pusat DR. Benny Pasaribu diikuti 23 peserta dari kabupaten/kota. Usai Musprovlub hari ini , Selasa (28/9) akan digelar Rapat Kerja Daerah (Rakerda). Sebelumnya, Sekjen DPN HKTI DR Benny Pasaribu dalam sambutannya mengakui hingga saat ini HKTI belum “berakar”, sehingga kedepan menjadi tanggung jawab pengurus untuk membesarkannya. Benny Pasaribu menyebutkan, kedepan jika para petani belum

merasakan apa arti HKTI di kabupaten/kota dan pengurusnya tidak bisa berbuat, maka demi petani para pengurus HKTI harus mundur. Benny Pasaribu berharap agar HKTI bermanfaat bagi petani, para pengurus harus bekerjasama dan selalu membuka jaringan untuk memperkuat HKTI, bukan seperti selama ini yang hanya mengaku organisasi perjuangan petani, namun belum berbuat. “Menjadi pengurus HKTI adalah pengorbanan,” katanya. Ketua Panitia Musprovlub dan Rakerda HKTI Sumut Drs Tuangkus Har ianja, MM bersama Wakil Sekretaris Binsar M Simatupang, SE,MM menyebutkan, pelaksanaan Musprovlub HKTI Sumut atas petunjuk DPN HKTI untuk melaksanakan tugas, aktivitas kegiatan di kabupaten/kota se Sumut. Sehingga dengan selesainya Musprovlub dapat menghasilkan kebijakan organisasi. (m08)


Wakil Ketua DPN HKTI Pusat Rusfian,SH saat memberi ucapan selamat kepada Ketua DPP HKTI Sumut terpilih, Paulus Ronal Sinambela, SH.

Muhammadiyah Medan Kota Silaturrahim Dan Nonton Bareng MEDAN (Waspada): Keluarga Besar Pimpinan Cabang (PC) Muhammadiyah Medan Kota mengadakan Silaturrahim Syawal 1431 H di Masjid Taqwa Jalan Demak, No.3 Medan,serta nonton bareng ‘Sang Pencerah’, Minggu (26/9). Sekretaris PC Muhammadiyah Medan Kota, Suheri, SPd mengatakan, silaturrahim Syawal tersebut merupakan program tetap sebagai ajang mempererat tali silaturrahim dan ukhuwah Islamiyah antara pimpinan cabang, ranting, majelis, ortom, pimpinan amal usaha, karyawan dan guru di lingkungan PC Muhammadiyah Medan Kota. Kegiatan yang diawali dengan pembacaan ayat suci AlQuran oleh qori Muhd. Iskandar, SPdI dan dilanjutkan ceramah oleh Ustazd DR H Faisar Ananda, MA tersebut, turut dihadiri PD Muhammadiyah Kota Medan diwakili Ir. H. Syahrul Jalal, MBA dan Drs. H. Ibnu Hajar Harahap serta ratu-

san keluarga besar PC Muhammadiyah Medan Kota. Al-Ustazd Faisar Anda dalam ceramahnya, mengajak seluruh jamaah untuk senantiasa mendekatkan diri kepada Allah, sebab setiap aktivitas yang dilakukan manusia tidak terlepas dari peran Allah dalam menentukan keberhasilannya. “Untuk itu orientasi kehidupannya tidak saja diarahkan kepada duniawi, tetapi harus disertakan pada ukhrawi sehingga menimbulkan sikap ikhlas dan jujur dalam segala hal yang dilakukannya,” kata Ustazd Faisar Ananda. Sementara itu, Ketua PC Muhammadiyah Medan Kota, Drs. Anwar Sembiring, MPd mengajak seluruh komponen yang ada untuk menjalankan amanah sesuai dengan program yang sudah ditetapkan dengan baik karena pertanggungjawabannya bukan hanya saja kepada manusia tetapi juga kepada Allah SWT.

Anwar meminta agar diadakan kembali pendataan anggota dan seluruh aset yang ada di PC Muhammadiyah Medan Kota, baik yang bergerak maupun tidak bergerak. Pada kesempatan itu, juga dilakukan Gerakan Amal Sholeh (GAS) untuk pembangunan Masjid Taqwa Muhammadiyah Ranting Kelurahan Masjid yang dipandu Paiman Sumardi, SPd (Ka. SMP M-1 Medan) dan terkumpul dana Rp11.920.000. Setelah melakukan kegiatan Silaturrahim, keluarga besar PC Muhammadiyah Medan Kota mengadakan nonton bareng “Sang Pencerah” di Studio 21 Thamrin Plaza Medan. Hal ini untuk mengingatkan bagaimana perjuangan KH Ahmad Dahlan dalam upaya memajukan bangsa dan Organisasi Persyarikatan Muhammadiyah di usia masih muda saat itu dengan semboyan “Hidup Hiduplah Muhammadiyah Bukan Sekedar Mencari Hidup di Muhammadiyah”. (m41)

Medan Metropolitan Pelayanan RS Di Indonesia Masih Rendah



Rabu 29 September 2010

Azwan Hakmi Lubis Dirut RSUP HAM MEDAN (Waspada): Keinginan masyarakat Indonesia untuk berobat ke luar negeri, seperti Malaysia masih cukup tinggi sehingga diperkirakan uang yang mengalir ke luar negeri hingga tahun 2010 ini senilai Rp200 triliun. Hal ini disebabkan masih rendahnya pelayanan terhadap pasien di rumah sakit-rumah sakit di Indonesia. “Tahun 2004 sebanyak Rp70 triliun dana yang mengalir ke luar negeri, jadi estimasinya tahun 2010 sekitar Rp200 triliun dana yang akan mengalir ke sana,” kata Direktur Jenderal Bina Pelayanan Medik dr. Supriyantoro, Sp.P, MARS saat serah terima jabatan Dirut RSUP H. Adam Malik (HAM) dari Djamaluddin Sambas kepada Azwan Hakmi Lubis, Selasa (28/9). Dia mengakui kalau pelayanan di rumah sakit di luar negeri lebih profesional daripada

rumah sakit-rumah sakit yang ada di Indonesia. “Masih diakui juga kalau masih banyak keluhan-keluhan masyarakat tentang pelayanan. Tapi ada juga rumah sakit kita pelayanannya bagus. Namun kasus demi kasus ada juga yang kecewa dengan pelayanan,” ungkapnya. Dijelaskannya, keluhan-keluhan pasien biasanya dilatarbelakangi miss komunikasi, kurangnya pelayanan dan kurangnya rasa empati. “Untuk mengatasi hal ini yang terpenting kita

Waspada/ Rustam Effendi

BEDAH RUMAH: Anggota dan pengurus IPK Medan Labuhan secara gotong royong bersama warga sekitar membedah rumah Karsiem di Jalan Rawe 2 Lingkungan 4, Kel. Tangkahan, Minggu (26/9).

IPK Bedah RumahWarga Miskin BELAWAN (Waspada): Ikatan Pemuda Karya (IPK) Medan Labuhan membedah satu unit rumah warga miskin di Jalan Rawe 2 Lingkungan 4, Kel. Tangkahan, Minggu (26/9). Sebelum dibedah rumah berukuran 6 x 7 yang dihuni Karsiem, 37, bersama 8 anaknya itu rusak parah dengan kondisi berlantai tanah dan berdinding tepas serta beratapkan rumbia yang sudah bocor. “Rencananya lantai akan disemen dan atap diganti menjadi atap seng. Sedangkan dindingnya masih menggunakan tepas tapi yang baru,” kata Ketua PAC IPK Medan Labuhan Dariono, disela kegiatan. Kegiatan bedah rumah yang dilaksanakan berkerja sama dengan pengurus ranting IPK Kel. Tangkahan itu merupakan program tahunan IPK Medan Labuhan dalam bentuk kepedulian sosial. “Ini bukti nyata dari karya kita selaku IPK. Selain itu pada bulan Ramadhan kemarin, kita juga telah membagikan paket lebaran kepada ratusan anak yatim,” timbal Selamet Riadi, Ketua Ranting IPK Kel Tangkahan, didampingi sekretaris Sugiono. Pekerjaan bedah rumah dilakukan anggota dan pengurus IPK secara bergotong royong dengan warga sekitar. Tampak hadir dalam kegiatan itu Lurah Tangkahan Nirmaluddin Hasibuan, SH mewakili Camat Medan Labuhan yang kebetulan berhalangan. (cre)


Ketua AMPI Medan Denai Udin Arbie menyerahkan pataka kepada tiga Ketua Sub Rayon AMPI se Kec. Medan Denai.

Tiga Pimpinan Sub Rayon AMPI Medan Denai Terpilih MEDAN (Waspada): Ketua Rayon Angkatan Muda Pembaruan Indonesia (AMPI) Kec. Medan Denai Udin Arbie mengatakan siap membesarkan sayap organisasi pemuda ini di kecamatan Medan Denai, sehingga kelak tidak saja memberi kebanggan bagi kader tetapi juga masyarakat luas sebab AMPI selalu berupaya dekat dan tanggap dengan kepentingan masyarakat. Hal itu dikatakan Udin Arbie di sela-sela Musyawarah Sub Rayon dan Pokkar AMPI se Kecamatan Medan Denai di aula kantor Kelurahan TSM I Jalan Ahmad Thahir/Mandala By Pass Medan, Minggu (26/9). Acara tersebut dihadiri unsur DPD AMPI Kota Medan Benny Parlaungan, Ojak Manurung dan Ridwan Koto, Ketua PK Golkar Medan Denai Zulkifli Iqbal, Ketua PK KNPI Medan Denai Romi Ahmad Lubis dan ratusan kader AMPI se kecamatan itu. Udin Arbie mengatakan, sebagai organisasi sayap Partai Golkar, AMPI tentu akan berjuang sekuat tenaga untuk mensosialisasikan Golkar ke tengah-tengah masyarakat sehingga menjadi partai yang disenangi dan dekat di hati masyarakat. “Itu makanya, dalam reformasi kepengurusan hingga ke tingkat kelurahan dan lingkungan, kita menempatkan kader-kader muda dan enerjik, yang dipimpin kader yang memiliki jiwa sosial kemasyarakatan yang tinggi,” ujarnya. Sementara itu, dalam musyawarah Sub Rayon AMPI se Kecamatan Medan Denai, terpilih Irwansyah Baong selaku Ketua Sub Rayon Mandala I, Anwar Ramang Piliang Ketua Sub Rayon Mandala III dan Zuhamsyah Wami Ketua Pokkar Tanah Tinggi. Untuk 3 Sub Rayon lainnya akan digelar minggu depan sebelum Pelantikan Rayon AMPI Kec. Medan Denai yang direncanakan 10 Oktober 2010 mendatang. Selanjutnya, 3 Ketua Sub Rayon terpilih diberi waktu dua minggu menyusun komposisi kepengurusan. Ketua Panitia Juanda Iqbal mengatakan, pelaksanaan musyawarah sub rayon ini serentak dilakukan untuk memantapkan roda organisasi sekaligus untuk memeriahkan pelantikan yang akan dilakukan secara serentak nantinya bersama Rayon AMPI Medan Denai. (m41)

harus memperbaiki pelayanan, jadi kita harus melihat kekurangan kita apa dan kelebihan mereka apa. Dan perlu komitmen yang tinggi mencapai itu semua,” katanya sembari mengatakan tahun 2012 sudah diterapkan RS standart internasional di Indonesia. Pelayanan medis di daerah terpencil juga masih jauh yang diharapkan. Untuk itu, katanya, institusi pendidikan dan yang terkait bisa membentuk tenagatenaga medis yang handal untuk diletakkan di sana. Terbuka menerima kritikan Dia juga berharap kepada direktur RSUP HAM yang baru untuk bisa mengatasi atau membawa balik pasien-pasien yang berobat ke luar negeri

untuk berobat ke RSUP HAM. “Saya yakin tidak lama lagi, pasien tidak akan berobat lagi ke luar negeri. RS. Adam Malik mampu mengatasi keluhankeluhan itu semua,” imbuhnya. Supriyantoro juga mengingatkan agar direktur yang baru dapat meningkatkan pelayanan sehingga pasien lebih percaya kepada RSUP HAM dan tidak ada alasan lagi pasien pergi keluar negeri untuk berobat. “Oleh karena itu dukungan dari SMF dan seluruh instalasi sangat diharapkan.” Supriyantoro juga berpesan agar direktur yang baru bersikap terbuka menerima kritik dari semua pihak dan jadikan kritikan tersebut sebagai kontrol bagi kepemimpinannya. “”Tumbuhkan suasana

kondusif serta kekompakan antar staf untuk menjamin kelancaran tugas, dan jangan raguragu melaksanakan reformasi dan inovasi untuk meningkatkan mutu pelayanan kesehatan, selama dalam koridor hukum,” tambahnya. Sedangkan Dirut RSUP HAM yang baru Azwan Hakmi Lubis mengatakan, ke depan agar lebih meningkatkan mutu layanan. “Untuk itu dukungan dari seluruh SMF dan instalasi sangat diharapkan.” Hadir pada sertijab tersebut, Kadis Kesehatan Sumut, Kadis Kesehatan Medan, sejumlah direktur rumah sakit yang ada di Medan maupun luar Medan, Kepala Kesehatan Daerah Militer I/BB serta direksi dan pejabat fungsional RSUP HAM. (cmai)

Masyarakat Harus Awasi Polisi MEDAN (Waspada): Masyarakat harus melakukan pengawasan terhadap polisi. Sebab, kewenangan yang dimiliki polisi sangat besar di antaranya bisa menghentikan orang-orang yang dicurigai untuk menanyakan identitas, melakukan pemeriksaan dan sebagainya. “Kalau tidak dilakukan pengawasan atau mengontrolnya, maka bisa saja terjadi penyalahgunaan wewenang,” kata Kapolda Sumut Irjen Pol Drs Oegroseno, SH melalui Kabid Humas Kombes Pol Drs H. Baharudin Djafar, MSi saat menjawab pertanyaan peserta kuliah umum mahasiswa baru Fakultas Hukum dan Ekonomi Universitas Dharmawangsa (Undhar), Senin (27/9) sekira pukul 17:30. Baharudin mengakui, ma-

sih ada terdengar keluhan-keluhan di tengah masyarakat seperti harus membayar saat membuat laporan ke polisi. Hal-hal seperti inilah yang harus diperbaiki bersama. “Ini tidak boleh lagi terjadi. Masyarakat sudah susah karena menjadi korban kejahatan, kenapa diminta uang lagi. Betapa parahnya pelayanan kita,” urainya. Dia menegaskan, pihak kepolisian tidak pernah meminta uang agar seseorang bisa masuk menjadi polisi. Namun Baharudin mengaku ada oknum polisi yang memanfaatkan momentum itu. “Memang ada polisi memanfaatkan momentum itu dan tindakan tersebut tidak benar. Bahkan Kapolda sendiri tidak bisa membantu orang kalau mau masuk polisi sebab

diumumkan secara terbuka dan diawasi secara eksternal misalnya media, Lembaga Swadaya Masyarakat (LSM) dan sebagainya,” jabarnya seraya menambahkan hati nurani harus dikedepenkan dalam bertugas. Sebelumnya, Baharudin memaparkan bagaimana Polda Sumut mengelola keamanan masyarakat. Ancaman faktual yang terjadi belakangan ini seperti teroris, katanya, sebenarnya itu hanya ujung (atas) saja padahal tapi yang lebih banyak berada di bawah. Rektor Undhar Kusbianto, SH,MHum didampingi Purek III Salahuddin menyebutkan, kuliahumum ini untuk menambah wawasan mahasiswa tentang pentingnya keamanan, ketertiban masyara-kat. (m43)

10 Pelajar Korban Sinabung Dapat Beasiswa HIPKI PNFI MEDAN (Waspada) : Lembaga kursus dan pelatihan (LKP) dan AMIK/STMIK Intelcom Globalindo mendukung program seratus beasiswa yang dicanangkan Himpunan Penyelenggara Kursus Indonesia (HIPKI) dan Pendidikan Non Formal dan Informal (PNFI). Dukungan tersebut dengan memberikan beasiswa terhadap sepuluh pemuda/i korban gunung Sinabung secara penuh berupa biaya hidup dan pendidikan selama mengikuti pelatihan maupun perkuliahan. Korwil DPP HIPKI, S Petrus di Medan, kemarin menyatakan, bantuan yang diberikan oleh pengurus HIPKI ini merupakan salah satu bentuk kegiatan sosial didalam hal pendidikan demi terciptanya kemajuan sumber daya manusia di Sumatera Utara. “Sehingga dengan SDM yang semakin baik dan berdaya guna akan menciptakan lapangan kerja atau setidaknya mampu meningkatkan perekonomian bagi dirinya maupun keluarganya. Apalagi mereka-mereka adalah para korban bencana gunung Sinabung,” ujar di kantor Korwil DPP HIPKI Wilayah Sumut & NAD di Jl. Setiabudi, Medan. Bencana ini dapat diambil hikmahnya, lanjutnya, walau kerugian harta dan benda, namun dapat terjalinnya hubungan persaudaraan se bangsa dan se tanah air karena seluruh stakeholder yang ada memberikan perhatiannya kepada masyarakat sekitar. “Seperti halnya tokoh pendidikan Sumatra Utara Ir Syamsuddin Lubis MM, Re k t o r d a n p e m i l i k L K P Intelcom Globalindo berkenan menanggung 10 orang seluruh biaya hidup dan biaya pendi-

dikan bagi pemuda/i korban bencana alam gunung Sinabung untuk belajar di STMIK/ AMIK Intelcom Globalindo dan LKP Intelcom Globalindo Kisaran,” ujarnya. Dia berharap sepuluh pemuda/i yang mendapat beasiswa tersebut memanfaatkan sebaik-baiknya didalam hal menggali ilmu dan menerapkannya di tengah-tengah masyarakat untuk meningkatkan perekonomian dirinya maupun daerah. Kesepuluh pemuda/i tersebut adalah Mahmud Jani Ginting alumni SMK Swasta Pencanawan asal desa korban bencana Desa Kutambelin, Jekson Sitepu alumni SMA Negeri Berastagi asal Desa Payung, Jonatan Bangun alumni SMA Katolik Kabanjahe asal Desa Payung, Rio Ardianta Sitepu alumni SMA Negri Simpang Empat. Syarizal Ginting alumni SMK Negri I Berastagi asal Desa Kutambelin, Sandri Sitepu alumni SMK Swasta Pijer Podi Berastagi asal Desa Naman, Jason Sembiring alumni SMK Indonesia membangun asal Desa Kutambelin, Dalin Efrata Sitepu alumni SMK N I Berastagi asal Desa Kutambelin, Dedi Irwansyah Surbakti alumni SMK N I Berastagi, Junita br Ginting alumni SMA Darmabakti dan Dedy Irwansyah Surbakti alumni SMK N I Berastagi. Sementara itu dari jumlah 100 yang di targetkan telah tercapai jumlah 36 pelajar, adapun Lembaga Kursus dan Pelatihan (LKP) yang telah mengakuisi dan bersedia menandatangani fakta integritas untuk menampung calon peserta 100 beasiswa HIPKI PNFI ini adalah LKP. Van den Berg Berastagi

Kab.Tanah Karo, LKP. Progresiv Sumbul Kabupaten dairi, LKP NNI Sidikalang Kab. Dairi, LKP. Putri Salon Panji Bako Kab. Dairi, LKP. CII Sidikalang Kab. Dairi, LKP. Ningsih Salon Kodya Medan, LKP.Alberto Kodya Medan, LKP. Prrincess Willem Medan, LKP. Uis Gara Batik Kodya Medan, LKP.Vickom Indo Berastagi Kab.Tanah Karo, LKP.DD’s Three Light Kabanjahe Kab. Karo, LKP. DD’s Microskill Kabanjahe Kab.Tanah Karo, LKP.Mitra Andalan Kodya Medan. Menyinggung model 100 Beasiswa PNFI Gratis total ini, S. Petrus.P AmPd menyatakan pengertian gratis total dalam hal ini adalah ditanggung biaya pendidikan dan biaya hidup sampai selesai dan mampu bekerja atau berwirausaha mandiri. Sumber pendanaannya adalah dari swadaya LKP atau sumber-sumber lainnya yang tidak mengikat. Kabid PNFI & PAUD Dinas Pendidikan Provinsi Sumatera Utara Dra Yuniar menyatakan, cukup banyak program yang telah dilaksanakan oleh PNFI & PAUD Sumatera Utara untuk bencana alam gunung Sinabung, diantaranya bakti sosial LKP dengan melaksanakan praktek kursus yang berorientasi melayani masyarakat korban Sinabung seperti, pangkas rambut, membuat sendal dari kain perca, dan lainnya. “Sedangkan program 100 beasiswa HIPKI PNFI ini merupakan program yang sangat positif dan mengandung nilainilai kemanusiaan yang cukup tinggi. Program ini telah mendapat dukungan dari ibu HJ Fatimah Habibie, dan telah bersedia menjadikan program ini menjadi salah satu agenda ibu gubernur,” ujarnya. (m38)


Korwil DPP HIPKI Wilayah Sumut & NAD, S Petrus P foto bersama dengan para peserta Program 100 Beasiswa HIPKI PNFI untuk Korban Sinabung.

Waspada/Mursal AI

TANDA TANGAN: Dirjen Bina Pelayanan Medik dr. Supriyantoro, Sp.P, MARS menandatangi berkas serah terima jabatan disaksikan Dirut RSUP HAM yang baru dr. Azwan Hakmi Lubis, Sp.A, Mkes (tengah) dan Dirut RSUP HAM lama dr. Djamaluddin Sambas, MARS, di Aula RSUP HAM, Selasa (28/9).

Pemerintah Harus Mampu Antisipasi ‘Sadikin’ MEDAN (Waspada): Melonjaknya jumlah masyarakat miskin yang menjadi pasien Jaminan Kesehatan Masyarakat (Jamkesmas) di Sumatera Utara, harus menjadi perhatian serius pemerintah. Tidak tertutup kemungkinan adanya masyarakat yang ’sadikin’ (sakit sedikit menjadi miskin) ikut menjadi peserta Jamkesmas. “Karena itu, pemerintah melalui instansi terkait harus mampu mengantisipasi kelompok masyarakat ’sadikin’ ini,” tegas anggota DPD RI asal Sumut Parlindungan Purba, SH, MM kepada Waspada di Medan, Selasa (28/9). Sebagaimana dipaparkan Kadis Kesehatan Sumut dr. Candra Syafei, SpOG ketika melakukan kunjungan kerja bersama Komisi E DPRDSU ke Jakarta baru-baru ini, angka kemiskinan di Sumut berkisar 1,8 juta jiwa. Namun jumlah peserta Jamkesmas 4,2 juta jiwa. Jika data tersebut diteliti, lanjut Parlindungan, tidak tertutup kemungkinan adanya kelompok masyarakat ’sadikin’ yang terdaftar menjadi peserta Jamkesmas. Dalam hal ini,

’sadikin’ dimaksud adalah kelompok masyarakat ekonomi menengah yang mengaku miskin ketika jatuh sakit dan menjalani rawat inap (opname) di rumah sakit. Namun ada juga kelompok masyarakat ’sadikin’ yang benarbenar jatuh miskin akibat sakit karena tidak bisa bekerja. Kelompok ’sadikin’ yang kedua ini biasanya sering dialami para pedagang. Ketika mereka sehat dan bisa bekerja, maka mereka memiliki penghasilan yang relatif besar. Sebaliknya, ketika mereka jatuh sakit, praktis mereka tidak bisa berdagang dan tidak memiliki penghasilan. Umumnya, para pedagang tersebut tidak memiliki asuransi atau jaminan sosial lainnya sehingga tidak mampu menutupi biaya pengobatannya selama sakit. “Jadi, masalah kelompok masyarakat ’sadikin’ ini harus segera diantisipasi pemerintah. Apakah kelompok pedagang tersebut bisa dikategorikan sebagai masyarakat miskin,” ujarnya. Karena itu, Parlindungan mendesak pemerintah mulai dari tingkat pusat hingga kepala

lingkungan untuk melakukan pendataan terhadap penduduk miskin secara transparan. Pendataan tersebut harus dilakukan secara transparan dan terpadu dengan melibatkan instansi terkait. “Bagi masyarakat yang dikategorikan miskin dan layak menjadi peserta Jamkesmas, maka harus diberikan tanda khusus berupa penempelan stiker di rumahnya. Dengan demikian, program Jamkesmas benar-benar tepat sasaran,” tambahnya. Selain itu, pemerintah harus mampu mengantisipasi kemungkinan semakin bertambahnya jumlah penduduk miskin akibat kasus Pemutusan Hubungan Kerja (PHK) yang dialami kelompok masyarakat tertentu. “Ketika mereka masih memiliki pekerjaan, tentunya mereka memiliki penghasilan dan asuransi. Tapi setelah mengalami PHK, praktis mereka tidak memiliki penghasilan tetap lagi. Yang harus diingat, UU telah mengatur bahwa rumah sakit tidak boleh menolak pasien yang membutuhkan pertolongan medis,” demikian Parlindungan. (m26)

FSPTI-KSPSI H Aceng Eno Siap Buktikan Legalitas MEDAN (Waspada): Ketua Umum Federasi Serikat Pekerja Transportasi Indonesia–Konfederasi Serikat Pekerja Seluruh Indonesia (FSPTI-KSPSI) H. Aceng Eno Mulyono siap menghadapi gugatan pihak manapun. Apalagi selama ini, dia selalu memenangkan gugatan di pengadilan terkait posisinya sebagai ketua organisasi tersebut. “H Aceng Eno sudah dua kali digugat di pengadilan terkait posisinya sebagai Ketua KSPSIFSPTI dan selalu menang. Itu sudah jelas membuktikan legalitas organisasi kami,” kata Ketua KSPSI-FSPTI Sumut Rizaldi Mavi didampingi Sekretaris Hendra Mika Siahaan kepada Waspada di sekretariatnya Jalan Denai Medan, Selasa (28/9), menanggapi pemberitaan terkait persidangan gugatan Abi Sofyan terhadap H Aceng Eno. Rizaldi menjelaskan, pihaknya siap menghadapi sikap Abi Sofyan yang menempuh jalur hukum dan melakukan gugatan terhadap FSPTI-KSPSI versi mereka. Namun yang perlu diantisipasi, bisa saja gugatan itu dilakukan sebagai upaya untuk membentuk opini seolaholah pihak yang menggugat adalah kepengurusan yang legal. Kecurigaan tersebut timbul, karena ternyata setelah berkalikali kalah di pengadilan, pihak Abi Sofyan terus melakukan gugatan. Terakhir PN Jaksel da-

lam amar putusannya No.1594/ Pdt.G/2009/PN. Jaksel, tanggal 27 Juli lalu juga memenangkan H Aceng Eno dan menolak gugatan Abi Sofyan, karena gugatannya dinilai tidak memenuhi kualifikasi sebagai penggugat (error in persona). “Menggugat suatu perkara di pengadilan itu sah-sah saja. Tetapi jangan sampai menggugat di pegadilan itu hanya untuk mencari-cari kesempatan dan mengulur waktu untuk menyampaikan teori pembohongan untuk menyatakan versi mereka adalah yang legal,” katanya. Karena itu, dia meminta semua pihak yang merasa sebagai kepengurusan yang sah agar menunjukkan bukti legalitasnya. “Kami siap beradu bukti. Bahwa kami memang sah menurut hukum,” katanya. Selain selalu menang saat digugat, jelasnya, H. Aceng Eno juga menang ketika menggugat duaoknumpengurusDPCFSPTIKSPSI yang menuduh mereka memalsukan logo KSPSI dengan membuat surat palsu. Sementara Hendra Mika menambahkan, seluruh pengusaha dan pemerintah agar berhati-hati menghadapi oknum-oknum pimpinan pekerja yang mengaku sebagai pengurus FSPTI-KSPSI yang sah. Sebaiknya meminta oknum tersebut menunjukkan buktinya secara hukum.

Dia juga mengimbau kepada seluruh Ketua DPC FSPTIKSPSI di Sumut agar jangan terpengaruh dengan opiniopini dangkal yang tidak bisa dipertanggungjawabkan secara hukum. Seperti diberitakan sebelumnya, selama ini ada dualisme kepengurusan DPP FSPTIKSPSI, pertama dibawah kepemimpinan Abi Sofyan yang berafiliasi dengan KSPSI versi Syukur Sarto, berkantor di Jalan Gunung Sahari Jakar Pusat dan dan kepemimpinan versi H. Aceng Eno yang berafiliasi KSPSI versi Jacob Nuawea dengan berkantor di Jalan Raya Pasar Minggu Jakarta Selatan. Akibatnya juga terjadi dualisme kepengurusan FSPTI-KSPSI di Sumut. Pihak Abi Sofyan sendiri menggugat kepengurusan H. Aceng Eno ke PN Jaksel pada 24 November 2009 lalu dengan nomor perkara 157/Pdt.G/ 2009/PN Jaksel. Namun hakim dalam amar putusannya No.1594/Pdt.G/2009/PN. Jaksel, tanggal 27 Juli lalu menolak semua materi gugatan Abi Sofyan, karena upaya hukumnya tidak memenuhi kualifikasi sebagai penggugat (error in persona). Hakim menilai gugatan yang diajukan Abi Sofyan salah kaprah karena H Aceng Eno diangkat berdasarkan hasil Munaslub FSPTI-KSPSI pada 22-24 April 2008 lalu di Bandung. (h11)



WASPADA Rabu 29 September 2010

Antisipasi Konflik Sepanjang Masa Oleh Dr Drs H.Ramli, MM Peningkatan derajat sebuah konflik juga dapat dilihat dari pihak-pihak yang terlibat



Tanggung Jawab Kedaulatan, ReformasiTNI DiTangan Agus


capan selamat bertugas atas promosi karier mengalir deras ke alamat Laksamana Agus Suhartono sebagai Panglima Tentara Nasional Indonesia (TNI) menggantikan Jenderal TNI Djoko Santoso. Presiden Susilo Bambang Yudhoyono di Istana Negara, Jakarta, Selasa (28/ 9) sore melantik Panglima TNI yang baru setelah melewati babak ‘’fit and proper test’’ dengan mulus di DPR RI sehari sebelumnya. Seperti sudah diperkirakan dan diberitakan, sidang paripurna DPR pada Senin 27 September 2010 secara bulat menyetujui pengangkatan Agus Suhartono sebagai Panglima TNI. Panglima TNI baru ini oleh DPR diharapkan mampu menuntaskan agenda reformasi di tubuh TNI secara menyeluruh. Jangan sampai mandek. Tanpa banyak interupsi dan protes, semua fraksi di DPR menyetujui Agus sebagai satusatunya calon yang diajukan oleh Presiden SBY dalam uji kelayakan dan kepatutan oleh DPR RI. Komisi I DPR RI memberikan perhatian khusus terhadap sejumlah agenda yang harus menjadi prioritas pelaksanaan tugas Panglima TNI meliputi: menuntaskan reformasi di lingkungan TNI, melakukan strategi yang lebih pasti untuk memenuhi kebutuhan minimum “essential forces”. Aganda khusus lainnya mengembangkan postur anggaran TNI setara dengan belanja rutin dan belanja modal dengan terus meningkatkan kesejahteraan prajurit. Kemudian, penguatan peran TNI di wilayah perbatasan, khususnya wilayah perbatasan maritim dan daerah rawan separatisme. Kita mengharapkan Panglima TNI yang baru lebih tegas bersikap dalam konteks pelanggaran wilayah perbatasan khususnya dengan Malaysia. Sikap tegas yang diharapkan tentu saja rasional. Jangan pula sampai menimbulkan permasalahan baru yang tidak diinginkan karena putusan diambil saat emosi. Intisari Saat ini Malaysia memang selalu memprovokasi Indonesia dengan melanggar wilayah perairan Indonesia, dan sikap Reformasi di tubuh arogansi Malaysia itu dilandasi dengan tangguhnya armada angkatan TNI harus total, tanggung semakin perang mereka di laut. Dengan persenjajawab Panglima baru taan canggih yang dimiliki Malaysia saat wajar saja kalau negara tetangga itu untuk meningkatkan ini menganggap enteng TNI-AL Indonesia, profesionalisme dan ke- seakan-akan kalau terjadi kontak senjata Malaysia dengan mudah memenangkan sejahteraan prajurit. peperangan di laut. Dilihat dari sejarah konflik dengan Malaysia sejak zaman Orde Lama di bawah pimpinan Presiden Soekarno, Indonesia dikenal keras menentang Malaysia dengan slogan konfrontasi: ‘’Ganyang Malaysia’’ dan memang sikap keras itu membuat Malaysia takut. Tapi, belakangan ini terlalu banyak pertimbangan yang dipikirkan pemerintah Indonesia, seperti persenjataan perangnya semakin uzur hingga banyaknya ketergantungan Indonesia atas Malaysia, termasuk nasib dua juta TKI menjadikan Indonesia banyak mengalah. Sepertinya Indonesia harus berpikir panjang untuk melawan sekalipun Malaysia terang-terangan melakukan pelanggaran kedaulatan Negara Kesatuan Republik Indonesia (NKRI). Kita menilai dan masyarakat terlihat senang melihat kemajuan reformasi di tubuh TNI pasca tumbangnya rezim Orde Baru tahun 1998. Apalagi kalau dilihat secara yuridis formal, di mana reformasi internal TNI ditandai dengan keluarnya Ketetapan MPR Nomor VI dan VII/MPR/2000 tentang paradigma baru TNI, dan ditindakjanjuti dengan UU nomor 2 tahun 2002 tentang Pertahanan Negara dan UU nomor 34 tahun 2004 tentang TNI. Semuanya itu menjadi ‘’starting point’’ penting bergulirnya reformasi internal TNI secara lebih terarah, jelas, dan ligitimed. Setelah sepuluh tahun lebih berjalan, dapat disimak arah reformasi TNI semakin positif sekalipun dalam praktiknya belum semuanya mencapai sasaran (maksimal), tapi yang pasti sudah ada sinyal positif yang ditunjukkan TNI, mulai soal doktrin, struktur maupun kultur. Lihat saja faktanya, saat ini TNI sudah sangat jauh berubah dibanding sebelum tahun gerakan reformasi 1998. Bahkan mantan Menhan Yuwono Sudarsono, menyatakan kalau satu dasawarsa pasca gerakan reformasi, proses reformasi internal TNI sudah mencapai 80 persen lebih. Kini, TNI tidak lagi berpolitik, meskipun banyak purnawirawannya terus bergerilya untuk memegang kekuasaan di pemerintahan. Begitu pula dalam reformasi bisnis TNI diharapkan terus bergulir sehingga nantinya benar-benar putus. Meskipun TNI tidak boleh berbisnis bukan berarti kesejahteraan prajurit boleh diabaikan, tidak! Menjadi tanggung jawab Laksamana Agus Suhartono Panglima TNI yang baru untuk terus meningkatkan kesejahteraan dan profesionalitas anak buahnya. Apalagi kalau melihat tantangan ke depan semakin berat, tidak saja mengamankan kedaulatan bangsa dari ancaman dari luar tetapi juga dari dalam negeri sendiri, termasuk internal TNI, seperti semakin maraknya jaringan terorisme, aksi perampokan bersenjata api laras panjang jenis M16, AK-47, narkoba dll.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: BW Rp. 11.000,FC Rp. 30.000,Halaman depan BW Rp. 33.000,Halaman depan FC Rp. 90.000,Ukuran kolom: 40,5 mm

khir-akhir ini berita di media massa cukup ramai membicarakan konflik. Terutama konflik yang terjadi di Bekasi. Kasus ini menjadi istimewa karena berhasil mengetuk pintu istana, sehingga Presiden RI Bapak Dr. Susilo Bambang Yudhoyono menyampaikan keprihatinannya yang mendalam atas peristiwa tersebut. Hal yang perlu digarisbawahi adalah bahwa sebenarnya peristiwa konflik yang terjadi di Indonesia cukup sering terjadi, baik itu konflik sosial maupun konflik politik. Konflik yang sama terus menerus mengalami pengulangan. Memahami konflik Dalam kehidupan sehari-hari konflik merupakan sesuatu yang mudah ditemukan. Hal ini disebabkan karena konflik merupakan sebuah gejala sosial. Konflik merupakan produk hubungan sosial dan karena itu konflik tidak dapat terpisahkan dari kehidupan sosial. Konflik adalah salah satu sebab terjadinya ketidakharmonisan masyarakat. Meski demikian sebahagian besar konflik yang terjadi adalah konflik yang berhasil diselesaikan oleh pihak-pihak yang sedang berkonflik. Hal ini menunjukkan bahwa konflik yang terjadi di masyarakat tidak selalu berkembang luas dan menjadi konflik yang besar. Menurut Ted Robert Gurr ada empat fenomena yang merupakan kondisi konflik: (1).Pihak yang terlibat minimal dua pihak; (2). Keterlibatan pihak pertama dan kedua merupakan bentuk hubungan yang saling memusuhi; (3).Terdapat tindakan kekerasan dengan tujuan mengisolasi, melukai, menghancurkan. (4).Pertentangan yang terjadi dapat dilihat dan ditemukan oleh pihak lain.

Apa yang dijelaskan oleh Ted Robert Gurr mengandung pemahaman bahwa fenomena konflik itu dapat diamati dan dinilai serta dicermati secara lebih mendalam. Artinya gejala konflik dapat dianalisa dan dibaca sehingga dapat diantisipasi. Selain itu juga konflik dapat dicari pemecahannya. Dengan demikian sebuah konflik akan dapat dicari jalan keluarnya sehingga konflik yang terjadi tidak berlarut-larut. Pada dasarnya yang menyebabkan membesarnya konflik adalah ketika terjadi peningkatan derajat sebuah konflik. Jika merujuk pada teori yang dikemukakan Ted Robert Gurr maka peningkatan konflik terjadi karena konflik telah memenuhi empat syarat yang telah disebutkan. Dengan kata lain konflik mengalami peningkatan dari konflik lisan menjadi konflik fisik yang dapat juga melibatkan bendabenda seperti benda keras maupun benda tajam. Peningkatan derajat sebuah konflik juga dapat dilihat dari pihak-pihak yang terlibat. Derajat konflik dapat dikatakan mengalami peningkatan jika pihak yang terlibat mengalami penambahan jumlah. Atau dapat dikatakan bahwa pihak yang terlibat dalam sebuah konflik bertambah dari satu orang atau beberapa orang menjadi banyak orang. Dengan kata lain dalam pemahaman ini dapat dikatakan terjadi peningkatan konflik dari konflik personal menjadi konflik kelompok. Biasanya dalam konflik seperti ini setiap kelompok mengidentifikasi simbolsimbol seperti etnis, agama atau simbol lainnya. Pentingnya konsensus Hal yang paling menarik dari sebuah konflik adalah bagaimana se-

buah konflik berakhir. Namun dalam konteks penyelesaian konflik, yang menjadi pertanyaan adalah bagaimana mengakhiri sebuah konflik. Ini menyangkut peran negara sebagai lembaga yang berwenang dalam menciptakan ketertiban di masyarakat. Sebuah konflik dengan demikian memiliki cara penyelesaian. Dari berbagai macam cara yang ada tentu saja ada cara yang paling diutamakan. Cara tersebut adalah cara yang dampaknya tidak buruk bagi masyarakat yang berkonflik. Istilah lain yang merupakan istilah yang sering disandingkan dengan konflik adalah istilah “konsensus”. Istilah ini memiliki arti bahwa individu atau kelompok atau pihak-pihak yang sedang berkonflik sepakat untuk mengakhiri konflik. Konsensus terjadi jika terdapat titik temu antara pihak-pihak yang berkonflik. Dengan kata lain dalam proses kompromi disepakati beberapa poin perdamaian yang didalamnya terdapat kontrak dimana tidak ada pihak yang merasa dirugikan, dan tidak ada pihak yang merasa paling diuntungkan. Jadi dapat dikatakan bahwa seharusnya konsensus adalah salah satu metode yang paling diutamakan dalam menyelesaikan konflik. Dalam konsensus hal yang utama adalah adanya keinginan dari kedua belah pihak untuk menyelesaikan konflik secara damai. Hal ini berarti bahwa setiap pihak harus bersedia mengurangi tuntutannya terhadap pihak yang lain. Sebaliknya setiap pihak juga harus bersedia menerima beberapa hal yang merupakan bagian dari pihak lain. Dengan kata lain kunci dari keberhasilan konsensus adalah adanya toleransi pada masing-masing pihak yang berkonflik. Dalam konsensus toleransi memiliki arti bahwa meskipun terdapat perbedaan pada masingmasing pihak, tetapi perbedaan itu bukan merupakan alasan untuk saling bermusuhan. Perubahan pandangan dari pihakpihak yang berkonflik mutlak diperlukan dalam konsensus. Hal ini pulalah

yang menjadi problem terbesar dalam konsensus. Seringkali terjadi kesulitan dalam mengubah pandangan pihak yang berkonflik. Namun perubahan pandangan dapat terjadi jika pihak mediator yang menjadi penyelenggara konsensus dapat mencari hal-hal umum yang merupakan titik temu perbedaan pandangan yang terjadi diantara kedua belah pihak yang berkonflik. Dengan kata lain mediator atau penyelenggara konsensus harus punya perencanaan yang matang dan strategi yang baik untuk dapat menyatukan persepsi yang dimiliki pihakpihak yang berkonflik. Mediator atau penyelenggara konsensus harus tahu seluk beluk konflik dan paham betul karakter pihak-pihak yang berkonflik. Memahami budaya juga merupakan syarat mediator penyelesaian konflik dalam konsensus. Penutup Munculnya konflik merupakan hal yang biasa dalam kehidupan masyarakat. Namun yang perlu diantisipasi adalah bagaimana agar konflik yang terjadi tidak mengalami peningkatan dan tidak mengalami perluasan. Jikapun terjadi perluasan dan peningkatan derajat sebuah konflik, maka konteks konflik yang terjadi di Indonesia memerlukan metode konsensus sebagai cara penyelesaian. Nilai-nilai sosial-politik yakni musyawarah untuk mufakat yang didasari oleh adanya toleransi harus tetap dipegang teguh. Menurut saya, nilai-nilai tersebut merupakan nilai-nilai yang tetap perlu ditanamkan dan dikembangkan dalam kehidupan bermasyarakat. Apalagi, saat ini, nilai-nilai tersebut hampir dilupakan, terutama sekali dikalangan generasi muda. Akhirnya, hal yang perlu diingat oleh pemerintah dan masyarakat adalah bahwa pendekatan antisipasi konflik merupakan pendekatan yang perlu dilakukan secara terus menerus. Semoga kita dapat belajar dari pengalaman yang ada. Penulis adalah Mantan Wakil Walikota Medan

Ragam Tafsir Yusril Vs Hendarman Oleh Muhammad Sa’i Rangkuti, SH, MH Yusril mengaku puas terhadap putusan ini. Meski begitu, ia mengelak jika putusan ini dikaitkan dengan kepentingan pribadinya


usril Ihza Mahendra yang juga Mantan Menteri Hukum dan HAM menghentikan langkah Hendarman Supandji sebagai Jaksa Agung. Upaya uji materi pasal 22 ayat (1) huruf d Undang-undang No. 16 Tahun 2004 Tentang Kejaksaan dikabulkan sebagian oleh Mahkamah Konstitusi (MK). MK menyatakan Pasal 22 Ayat (1) huruf d Undang-Undang Nomor 16 Tahun 2004 tentang Kejaksaan Republik Indonesia (Lembaran Negara Republik Indonesia Tahun 2004 Nomor 67, Tambahan Lembaran Negara Republik Indonesia Nomor 4401) adalah sesuai dengan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945 secara bersyarat (conditionally constitutional). Syarat tersebut adalah konstitusional sepanjang dimaknai “masa jabatan Jaksa Agung itu berakhir dengan berakhirnya masa jabatan Presiden Republik Indonesia dalam satu periode bersama-sama masa jabatan anggota kabinet atau diberhentikan dalam masa jabatannya oleh Presiden dalam periode yang bersangkutan”. Dalam putusannya, berdasarkan analisa hukum saya MK juga memerintahkan Presiden untuk segera mengambil langkah atas keputusan MK. Ini mempunyai makna sebelum ada tindak lanjut dari pemerintah untuk sementara jabatan Jaksa Agung dijalankan wakil Jaksa Agung Darmono. Dengan demikian, tugas dan fungsi Kejaksaan Agung masih tetap bisa berjalan. Namun, di amar putusannya Mahfud juga menegaskan setelah putusan ini Presiden SBY bisa mengangkat kembali Hendarman Supandi sebagai Jaksa Agung. ”Bisa diangkat kembali Presiden, atau dijadikan Pjs (pejabat sementara) atau demisioner. Hukum tidak akan mempersulit tapi memberikan jalan,” ungkapnya. Hal ini akhirnya telah membuahkan hasil terhadap Undang-Undang Kejaksaan yang tidak tegas dalam mengatur jabatan Jaksa Agung, sebagaimana keterangan Ketua MK juga menyatakan bahwa putusan MK menghentikan kontroversi yang saat ini berjalan. Bahwa Presiden Susilo Bambang Yudhoyono juga tidak bersalah karena tidak melantik kembali Hendarman sebagai Jaksa

Agung. ”Tindakan Presiden tidak salah karena dalam UU Kejaksaan tidak diatur, maka MK memberikan batasan apakah mengikuti jabatan presiden atau seperti UU MK yang merupakan gabungan umur dan masa jabatan,” jelasnya. Lain lagi keterangan dengan pemohon Yusril Ihza Mahendra. Menurut Pakar Hukum Tata Negara dari Universitas Indonesia itu, putusan MK membuktikan bahwa Presiden Susilo Bambang Yudhoyono telah melakukan kesalahan. Yusril mengaku puas terhadap putusan ini. Meski begitu, ia mengelak jika putusan ini dikaitkan dengan kepentingan pribadinya. Ragam tafsir putusan MK Menurut anggota Komisi III DPR Bambang Soesatyo, keputusan MK menunjukkan keteledoran pihak Istana dalam pengangkatan Jaksa Agung. Dalam putusannya, MK menyatakan bahwa masa jabatan jaksa agung dibatasi sesuai masa jabatan presiden. Menurut Bambang, putusan MK ini jelas merupakan pukulan telak bagi pihak Istana. Dia meminta semua pihak, termasuk Presiden, untuk harus menghormati dan menaati putusan MK ini. Lainnya halnya komentar Anggota Komisi III DPR, Nudirman Munir yang mengatakan, meskipun MK mengabulkan permohonan uji materi Yusril, namun proses hukum kasus Sisminbakum tetap berlanjut. Putusan MK yang memberhentikan Hendarman tidak mengubah keputusannya sehingga Yusril tetap berstatus tersangka. Nudirman yang juga Wakil Ketua Badan Kehormatan (BK) DPR menilai

putusan MK membawa dampak terhadap penegakan hukum di Indonesia dan efek psikologis khususnya terhadap kejaksaan. Apakah Presiden dinilai salah dalam pengangkatan Jaksa Agung? Nudirman, anggota Fraksi Golkar itu, mengatakan tidak. Alasannya, keputusan SBY melanjutkan Hendarman Supandji sebagai Jaksa Agung tanpa surat keputusan adalah hasil konvensi ketatanegaraan yang selama ini disepakati. Pendapat berbeda disampaikan Staf Khusus Presiden Bidang Hukum, HAM dan Pemberantasan Korupsi Denny Indrayana.Menurutdia,pasca-putusan MK, jabatan jaksa agung yang di duduki Hendarman tetap legal. Denny didukung oleh Menteri Sekretaris Negara (Mensesneg)SudiSilalahi.Sudimenegaskanbahwa hanyapresidenyangbisamengangkatdan memberhentikan Jaksa Agung. Sedangkan dalam putusan Uji materi UU Kejaksaan ini dua Hakim Konstitusi Achmad Sodiki dan Horjono memiliki pendapat berbeda. Achmad Sodiki menyatakan Pasal 22 Ayat (1) huruf d UU 16/ 2004 berbunyi Jaksa Agung diberhentikan karena “berakhir masa jabatannya” dan bertentangan dengan Pasal 1 Ayat (3) dan Pasal 28 D Ayat (1) UUD 1945, sepanjang tidak ditafsirkan sesuai masa jabatan Presiden dan masa jabatan cabinet. Sedangkan Haryono mengatakan kedudukan Pasal 22 Ayat (1) huruf d tersebut haruslah dikaitkan dengan ketentuan lain yang terdapat dalam UU Kejaksaan secara keseluruhan, karena substansi ayat a quo. Jaksa Agung Muda Bidang Pengawasan Marwan Effendy menilai Ketua MK Mahfud MD terlalu berlebihan karena telah mengeluarkan keputusan yang menyebut Hendarman Supandji tidak lagi menjabat Jaksa Agung. Mahfud dinilai melanggar undang-undang. Marwan menegaskan sebagai Ketua MK, Mahfud MDdananggotamajelishakimMK,bolehboleh saja memutuskan bahwa jabatan Hendarman Supandji tidak sah. Marwan pun mengakui bahwa putusan gugatan MK itu final dan mengikat. Syarifuddin Suding, Ketua Fraksi Hanura yang juga duduk di Komisi III yang membidangi hukum itu menyarankan agar ada pejabat ad interim sebelum ada penunjukan Jaksa Agung definitif. Sebab, Jaksa Agung itu jabatan yang mengkoordinir seluruh jaksa di Indonesia.

Sementara itu, anggota Komisi III lainnya, Herman Herry, meminta agar semuapihakharusarifmenerimaputusan MK dan harus menjadi pelajaran dalam penegakan hukum ke depan. Anggota Fraksi PDI-P itu yakin akan ada pro dan kontra terkait putusan perkara yang melibatkan Hendarman selama setahun terakhir. Tanggapan lainnya oleh Trimedya Panjaitan yang mengatakan ini tamparan bagi pemerintahan SBY karena keteledoran administrasi berakibat fatal secara hukum.Yusril dinilai cerdas melihat celah hukum ini yang tidak pernah menjadi perhatian orang selama ini. Namun, Ketua DPP PDI Perjuangan bidang hukum ini menilai keputusan MK agak banci dan tidak tegas karena tidak berlaku surut. Padahal kalau berbicara hukum, legal standingYusril saat mengajukan gugatan jelas karena dia merasa dirugikan dengan ditetapkannya jadi tersangka. Penulis adalah Advokat, Praktisi Hukum

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Pertamina: Petronas besar karena gaji - Gaji kecil, kepala pun pening * Isu teroris bisa pengaruhi investasi di Sumut - Padahal tanpa isu pun inves tor minim * Pemko Medan dinilai tak profesional gunakan anggaran - Main tabur saja, he...he...he


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Balyan Kadir Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


WASPADA Rabu 29 September 2010

Singkirkan Pemikiran Ellwood

Minusnya Tenaga Ahli PNPM Mandiri PNPM Mandiri adalah program Nasional pemberdayaan masyarakat secara mandiri .Program pemerintah ini yang saru ini telah menunjukkan hasil yang menggembirakan .Keberhasilan program ini berdasarkan swadaya masyarakat sangat efektif dalam program ini.Pemerintah hanya menyediakan aspal beton,maka ribuan jalan disiapkan dengan mudah. Wajah cantik program ini ternyata dinodai oleh segelintir pengurus PNPM.Cerita ini penulis dapat dari pengaduan masyarakat dusun IV.Desa kota rentang ,kecamatan hamparan perak ,kabupaten Deli serdang.Di dusun ini akan digulirkan program PNPM pembuatan drainase (parit jalan air limbah).Tapi oleh Pengurus PNPM,parit tersebut dibuat dibelakang rumah,lokasi parit inilah yang memberatkan warga,sepertinya PNPM kekurangan tenaga ahli rancang bangun tata dranase yang benar. Beberapa warga mencemaskan berbagai masalah yang muncul jika PNPM memaksakan kehendak membuat parit dibelakang rumah,seperti:1. mengundang pembuangan sampah dan kotoran yang menimbulkan penyumbatan.2.mengundang dijadikan WC pada malam hari.3.Mengundang pertengkaran antar warga 4.Menyulitkan gotong royong warga karena lokasi parit yang sempit.5.Pencemaran udara sangat dekat dengan rumah.6 Penyeborotan tanah untuk memperluas dapur rumah dengan menutup permukaan parit.7.menimbulkan sumber penyakit 8.Menciptakan Budaya hidup kurang sehat. Melalui surat terbuka ini saya meminta kepada Bapak pengurus PNPM desa kota Rantang,Kecamatan Hamparan perak ,agar memperhatikan keluhan masyarakat.karena lokasi derainase sangat bertolak belakang dengan ilmu rancang bangunan drainase tata kota yang sudah berjalan.Selayaknya deraisane berada didepan rumah penduduk ,di sisi gang,guna menerima semua air dari rumah ,sekaligus menghantarkanya keparit besar dipinggir jalan utama.Beberapa perumahan melaksanakan model ini karena terbukti dapat menghindri banjir. Melalui tulisan ini saya juga meminta perhatian dari bapak Dinas kesehatan kecamatam Hamparan perak,agar berperan dalam tinjauan kesehatan berbagai program PNPM.Lokasi derainase di belakang rumah sangat rentan terhadap penyakit .Terasa mubajir sebuah pembangunan justru menimbulkan berbagi jenis penyakit gatal-gatal karena bakteri ,jamur,dan virus.Lokasi parit belakang tempat tumbuh suburnya telur nyamuk malaria yang menimbulkan penyakit demam berdarah. Nama dan alamat ada pada Redaksi

Kepada Kepala Dinas Pendidikan Deli Serdang Dengan hormat, Di sini saya mewakili guru-guru dan penjaga sekolah Sewilayah Kec. Hamparan Perak Kab.Deli Serdang melaporkan pada bapak tentang Bendahara Koperasi Pegawai Negeri (KPN) Trihandayani Kec Hamparan Perak sbb Pertama, tujuan pendirian Koperasi kan untuk mensejahterakan anggotanya, tapi saat anggota membutuhkan selalu dipersulit dengan alasan tidak ada simpanan. Kedua, yang tak masuk akal, bendahara yang hanya seorang PNS itu sekarang memilki kekayaan luar biasa, seperti: Show room sepeda motor, lapangan futsal, galon air minum isi ulang, rumah mewah dan mobil. Ketiga, dulu kami sudah pernah berunjukrasa dengan membubuhkan tanda tangan melalui Ibnu Salman,SPd, tapi ternyata aspirasi kami diabaikan. Beginilah nasib guru dan penjaga sekolah daerah terpencil, yang hanya dijadikan lahan oleh para jajaran atasannya. Tolong pak dibenahi agar KPK menjadi sehat. Demikian laporan ini saya utarakan dengan sebenarnya, tanpa ada rekayasa.

Oleh Fajar As

Trickle down effect adalah kejahatan ekonomi yang mengakar pada pola pemikiran neo imperialisme atau neo liberalisme yang berpusat di AS dan Eropa Barat


rof. David Ellwood, dekan Harvard Kennedy School sahabat Susilo Bambang Yudhoyono (SBY) pada tanggal 15 September 2010 memberi kuliah (presidential lecture) di Istana Negara NKRI di hadapan SBY, Boediono, para Menteri Kabinet SBY. Ada juga kelompok yang disebut Dewan Ekonomi Nasional, Dewan Industri Nasional, Dewan Inovasi Nasional, dan para pemimpin redaksi media massa. Setelah mencermati apa yang dikuliahkan Ellwood bahwa dalam kenyataannya kuliah tersebut adalah lagu lama dan kelihatannya sedang dikubur dalam-dalam di tempat kelahirannya di Amerika Serikat (AS). Terutama tentang teori pertumbuhan ekonomi atau efek penitisan dari atas ke bawah (trickle down effect) yang dalam kenyataannya adalah kejahatan ekonomi yang mengakar pada pola pemikiran neo imperialisme atau neo liberalisme yang berpusat di AS dan Eropa Barat. Mengapa disebut kejahatan ekonomi, karena dalam prakteknya teori ini telah memberi peluang sangat besar kepada usaha skala besar padat modal, padat teknologi canggih untuk menggerakkan kapitalnya merajalela. Pada saat yang sama mengkonsentrasikan kekayaan dalam skala yang sangat ekstrim. Kejahatan ekonomi telah sedemikian rupa menciptakan jurang kesenjangan yang sangat lebar antara para penggerak kapital skala besar tersebut dengan bagian terbesar warga negara yang berada di negeri-negeri yang sedang berkembang. Bila ada penitisan ke bawah maka skala penitisan sungguh sangat kecil dan sangat terbatas. Data-data di Indonesia terlihat penitisan terhadap sekitar 20% dari sege-

Ketika kurikulum berbasis sekolah (KBK) di awal tahun 2000-an diakses di internet untuk sosialisasi, orang tua ramai-ramai memberi tanggapan bahwa tugas (PR) anak-anak di sekolah terlalu membebani. Akibatnya, banyak anak yang kehilangan kebebasan masa bermain. Oleh karena itulah, maka pada kurikulum tingkat satuan pendidikan (KTSP) pemerintah mengatur beban belajar peserta didik (lihat Permendiknas No. 22 Thn 2006 ttg Standar Isi). Di sana telah diatur bahwa beban belajar siswa SMP sekitar 42 jam perminggu dengan jumlah mapel 11 tambah pengembangan diri ekuvalen 2 jpm (MTs masih ditambah mapel Al Quran Hadis, Aqidah Akhlak, Fikih, Sejarah Kebudayaan Islam, dan bahasa Arab). Bayangkan anak harus belajar 15 mapel/minggu, jauh melampaui beban anak sekolah di mana pun di belahan dunia ini. Anak-anak di Eropa hanya 5-6 pelajaran. Masih pengaturan beban belajar. Satuan per jam pelajaran SMP/MTs = 40 menit. Sedangkan beban tugas anak hanya boleh 40% dari jam tatap muka. Misal, mapel Matematika 4 jpm, maka beban tugas anak per minggu hanya boleh 40% x 4 x 40 = 64. Artinya, anak hanya boleh dibebani 64 menit/minggu mengerjakan tugas mapel Matematika. Guru harus bisa merancang tugas mandiri terstruktur atau tugas mandiri tidak terstruktur untuk alokasi waktu tersebut. Kenyataan di sekolah, guru tidak mengabaikan atau tidak pernah tahu aturan ini. Parahnya, sekolah tidak pernah mengatur agar para guru mesti saling berkoordinasi di kelas saat memberikan tugas kepada peserta didik. Akibatnya adalah anak dikepung berbagai beban tugas yang luar biasa sehingga acapkali harus larut malam baru selesai mengerjakannya. Bukan hanya terbebani tugas, tetapi juga terbebani biaya mengakses internet dan biaya printout. Bagi anak dari keluarga berpunya mungkin tak ada masalah, tetapi anak yang tak memiliki, ini sangat membebani. Ada pula sekolah/madrasyah membuat kebijakan belajar hingga sore pada kelas-kelas unggul. Setelah kelas regular pulang, anak-anak di kelas ini mengikuti les tambahan mapel tertentu. Karena tidak adanya koordinasi sesama guru dan pembimbing, ujungnya jam tambahan sore itu tidak berimplikasi untuk membantu anak mengerjakan tugas pelajaran (kalau tak mengatakan justru menambah beban anak yang lain lagi). Sudah saatnya satuan pendidikan mengindahkan ini. Sekali lagi, beban anakanak kita sungguh luar biasa. Adakah guru “pemburu tugas” sudah menyiapkan segala beban tugas mengajar dan perancangan perangkat mengajar lainnya? Tepuk dada jangan hanya mengikutkan selera. Shr Percut Sei Tuan, Deliserdang

Rodiana Br Siregar

Hatta Radjasa Sebagaimana Ellwood, Hatta Rajasa (Hatta) telah dengan penuh keyakinan menyatakan bahwa pembangunan perekonomian Indonesia berbasis kepada teori trickle down effect. Tokoh Hatta ini disamping berfungsi Menko Perekonomian juga Ketua Umum Partai Amanat Nasional. Sebagai Menko seharusnya tokoh ini harus sangat cerdas dan mampu menyusun desain besar pembangunan perekonomian NKRI yang berbasis kekuatan bagian terbesar warga NKRI dan berbasis Kekuatan Spesifik Indonesia. Jadi bukan menjadi bersikap latah dan asal-asalan mendukung teori trickle down effect. Teori dan proses trickle down effect dari makna kosakatanya saja terlihat sebagai satu bentuk pembangunan kekayaan dalam skala ekstrim di level atas, dengan rancangan bila pembentukan kekayaan ini bagaikan pengisian air di bak air maka bila bak terus diisi air maka mengalirlah airnya ke bawah. Demikianlah kekayaan akan menetes ke level bawah. Teori ini sangat licik, memang lahir dari pemikiran bebal. Oleh karena

pembangunan kekayaan di level atas dilakukan oleh manusia-manusia pemilik kapital di mana mereka pasti tidak terlepas dari nafsu manusia untuk memiliki kelebihan dari manusia lainnya. Bila usaha menunjukkan perkembangan yang tinggi, maka penetesan ke bawah dapat saja dikurangi dan malah ditiadakan. Jadi sangat berbeda dengan bak air di mana bila air terus masuk maka pasti mengalir ke level bawah. Apa yang dilakukan pengusaha skala besar AS dan Eropa Barat yang berkaitan dengan teori ini adalah dengan segala cara, dengan cara halus maupun dengan cara kasar termasuk dengan cara mengobarkan perang besar di luar negerinya, dengan cara spionase, merekayasa perebutan kekuasaan yang penuh kekerasan dan pertumpahan darah. Tetesan keuntungan ke pihak-pihak di luar pemilik kapital sangat terkontrol. Dominasi pengusaha skala besar AS menjadi harga mati dari seluruh industri dan perdagangan internasional. Hatta, termasuk SBY, Boediono, dan seluruh elit Indonesia yang berada di sekitar pusat kekuasaan harus memahami betapa jeniusnya pencipta prinsip pembangunan ekonomi Indonesia merdeka, di mana diatur bahwa : perekonomian disusun sebagai usaha bersama berdasar atas asas kekeluargaan. Rancangan membangun usaha besar Indonesia yang disebut menjadi sebagian dari 500 pengusaha versi Fortune International, mengacu kepada teori trickle down effects, membangun Amerikanisme, dan sejenisnya sungguh sangat bertentangan dengan sistim perekonomian yang disusun sebagai usaha bersama berdasar atas asas kekeluargaan. Sistim tersebut adalah amanat revolusi17Agus-tus1945danamanatnasional Indonesia. Betapa Hatta telah sedemikian rupa mendistorsi anggaran dasar dan citacita PAN. Justru siapapun tokoh PAN mutlak harusmembuangjauh-jauhteoritrickledown effect. Penulis adalah Pengamat Ekonomi – Politik Internasional

(Menanggapi Tulisan Faisar Ananda Arfa) Oleh Fery Ramadhansyah Ada beberapa istilah yang agak rancu ketika penyebutannya disandangkan pada hal-hal yang memiliki kontradiksi makna


ebagai contoh, di beberapa tulisan, banyak orang yang mengatasnamakan dari kalangan akademis, mereka mengangkat tema seputar Islam dan modernisasi, emansipatoris, kebebasan berfikir dan lain sebagainya. Padahal semua ini bukanlah murni semata dari perkembangan epistimologi Islam itu sendiri melainkan saduran dan adopsi dari kerangka epistimologi agama di luar Islam. Ketika kata modernisasi disandingkan dengan Islam, tentu kerangka berfikir awalnya adalah Islam itu kuno, negara Muslim itu terbelakang dan umat Islam itu primitif. Lebih spesifik lagi akan muncul kesimpulan Islam adalah budaya Arab, dan beragama Islam identik pada transformasi budaya Arab ke dalam negara-negara non Arab. Atau ketika bicara soal kesetaraan gender, karena melihat proporsi wanita tidak seimbang dengan pria dalam banyak hal, maka disimpulkan memasung kebebasan yang merupakan hak asasi manusia. Bahkan, dengan dalih ilmiah segala sesuatu harus bisa diukur dan dibuktikan secara empirik. Sehingga harus dihapuskan sekatsekat yang menghalangi kebebasan berfikir untuk memperoleh pembuktian tersebut. Dan jadilah, akal seperti Tuhan di atas Tuhan. Dalam persoalan hubungan negara dan agama ini juga. Kalau tidak dibilang kerancuan epistimologi, berarti hanya sekedar membeo. Sebab, jika dianalisa secara kritis dijumpai perbedaan yang cukup signifikan ketika membahas relasi (‘alaqah) negara dan agama. Secara

Pengaduan KDRT Kepada Kapolsek Padang Sidimpuan Saya yang bertanda tangan di bawah ini : Nama : Rodiana Br Siregar, Umur : 38 Tahun Agama : Islam Pekerjaan : Ibu Rumah Tangga Alamat : Aek Nabara Tonga Palas Dengan segala hormat sehubungan dengan kedatangan surat saya ini kehadapan Bapak Kapolres Padang Sidimpuan ,datang untuk mengadukan mengenai Kekerasan Dalam Rumah Tangga (KDRT) yang mana sekitar 15 tahun saya berumah tangga dengan suami saya SH dengan alamat Aek Nabara Tonga Kecamatan Palas (PALUTA). Selama saya berumahtangga, sejak belum punya anak sampai sekarang saya sudah mempunyai anak dua. Saya terus saja dipukuli, ditunjang sampai babak belur tak kunjung berhenti. Saya diperlakukan seperti binatang. Jelas saya sudah trauma atas perbuatannya, untuk sementara terpaksa saya melarikan diri ke Rantau Parapat Labuhan Batu tempat keluarga saya, menunggu ada penyelesaian hukum dari pihak Kepolisian KAPOLRES Padang Sidimpuan. Mengingat pengaduan saya tidak ditanggapi di KAPOLSEK Barumun Tengah, dan begitu juga surat pengaduan tidak ada diberikan saya—sebagai bukti bahwa saya sudah mengadu. Pada saat itu juru periksa adalah MP pangkatnya saya tidak tau sehingga tak terbayang yang surat pengaduan saya tanggal 26 Mei 2010 dan masalah Visum dari PUSKESMAS Binaga Kecamatan Barumun Tertanggal 26 Mei 2010 juga tidak ada. Justru itu saya nohon sangat Kepada Bapak KAPOLRES Padang Sidimpuan agar saya dapat perlindungan hukum yang sebenar-benarnya. Demikianlah surat pengaduan saya ini saya sampaikan dengan pikiran sehat dan waras. Kiranya agar ditangkap tapi tolong pak! Jangan ditangkap lepas seperti tindakan oknum di aparat di Barumun Tengah. Mungkin hanya ini yang dapat saya sampaikan agar kiranya laporan saya ini bias ditanggapi. Dan sebelumnya saya ucapkan ribuan terima kasih.

nap warga NKRI, dan bila warga NKRI saat ini berjumlah sekitar 240 juta pribadi, maka yang mendapat penitisan hanya berjumlah sekitar 48 juta pribadi dan 192 juta warga NKRI maksimal hanya menonton, terancam kemiskinan, miskin, fakir miskin, terlantar, tuna wisma, buta huruf, terasing, dan kelaparan. Jangan terpukau dan tersesat oleh data yang diajukan oleh administrasi SBY seakan-akan jumlah warga NKRI yang miskin hanya 31,03 juta pribadi. Angka ini lahir dari metode pengukuran warga miskin yang diterapkan oleh Badan Pusat Statistik, suatu metode yang pada hakekatnya sangat melecehkan harga diri manusia Indonesia. BPS menetapkan,bahwa seseorang warga NKRI itu miskin bila pendapatannya maksimal Rp3.972.000 / tahun. Bandingkan dengan metode AS di mana warga mereka dalam kategori miskin bilapendapatannyamaksimalRp110.000.000 atau USD 11,000 / tahun. Presiden AS (George W. Bush Senior) dahulu berusaha menekan Jepang agar mengurangi angka defisit AS (yang ternyata gagal total). Pada masa George W. Bush Junior (si penghasut perang) dan Barack Obama bolak-balik menekan China agar mengurangi angka defisit AS dengan cara mempertinggi nilai Yuan. Ternyata Hu Jintao (Presiden China) menolak keras tekanan AS, dan menegaskan tidak ada hubungannya nilaiYuan dengan defisit perdagangan AS. Terlihatlah kekeliruan fatal SBY, Boediono, apa yang disebut Dewan Ekonomi Nasional, Dewan Industri Nasional, dan Dewan Inovasi Nasional yang tetap mengekor dan memuja pola neo imperialisme dan neo liberalisme AS. Kendati seorang pakar ekonomi terkemuka AS (Joseph

Stiglitz) yang juga adalah sahabat dekat SBY telah memperingatkan agar SBY mengkesampingkan teori pertumbuhan (trickle down effect) dan menyadari bahwa kekuatan Indonesia adalah di desa-desa, bukan di kota-kota. Singkirkanlah angan-angan yang tidak berfaedah terhadap kehidupan bagian terbesar warga NKRI, yaitu menciptakan beberapa usaha skala besar yang masuk apa yang disebut 500 besar usaha versi Fortune International sebagaimana dicanangkan Chairul Tanjung (Ketua Dewan Ekonomi Nasional). Betapa menyedihkan mempersaksikan wajah muram SBY yang oleh beberapa tokoh disebut kurang percaya diri, dan betapa semakin meluasnya kekecewaan bagian terbanyak warga NKRI mempersaksikan kesulitan perekonomian, di mana keseluruhannya ini adalah akibat kekeliruan besar pola berpikir.

Persoalan Hubungan Negara - Agama

Hormat Saya Guhampar, DS

Banyaknya PR Kelas Unggulan


konseptual bahwa agama di Barat (Kristen) dan di Timur (Islam) yang menjadi dua agama terbesar di dunia memiliki prinsip berbeda dan pengalaman sejarah masingmasing. Di mana satu peradaban muncul karena dipicu oleh spirit kebergamaan, sementara peradaban lain muncul karena dominasi agama berhasil diruntuhkan. Jadi, kalau sosio-historis masing-masing keduanya merupakan premis yang dijadikan barometer, maka konklusi yang dihasilkan tidak tepat alias salah. Diskursus tentang hubungan negara-agama bukan hal baru. Di Eropa, sejak abad 18 sudah dimulai membahas peran agama dalam masyarakat. Pada saat itu, masyarakat Eropa yang mayoritas beragama Kristen, mulai tidak percaya otoritas lembaga keagamaannya. Karena dengan serta merta, setiap kali muncul kekritisan berfikir terutama dalam hal ilmu pengetahuan, maka dengan segera dihakimi tidak sesuai dengan ajaran Tuhan. Dalam sejarah bisa dilihat bagaimana Copernicus dan Galileo dihakimi terkait pernyataan tentang pusat tata surya. Disebutkan bahwa matahari adalah rotasi bumi, bukan matahari yang mengitari bumi akan tetapi sebaliknya. Karena dianggap berseberangan dengan yang tertulis di kitab suci merekapun dihukum.

Ketika tuntutan pemisahan antara agama dan urusan dunia (baca : sekularisme) itu semakin keras, kemudian munculah liberalisasi dalam segala bidang. Dogma agama diragukan, dan untuk mencapai langkah kemoderenan maka harus meninggalkan nilai-nilai keagamaan tradisional. Lalu hal ini merambah luas hingga terjadi pemisahan atara negara dan agama. Jika yang dipahami bahwa pola hubungan negara-agama seperti ini, maka hasilnya adalah sekularisme seperti yang diistilahkan oleh penulis Inggris George Holoyake pada tahun 1846. Agama dianggap penghambat kemajuansehinggabutuh dibuat rel tersendiri. Dan jadilah wewenang pemerintah adalah masalah publik, dan wewenang agama masalah privat. Halyangcukupanehmemang, ketika banyak ilmuwan Muslim dengan seabrek disiplin ilmu agama yang seharusnya menjaga kemurnian intelektualitas Islamjustrumalahmendestruksi ajaran Islam tersebut. Tentu kalau benarpijakannalaryangdigunakan,pasti akan diperoleh kesimpulan yang objektif. Inilah yang diindikasikan—meminjam istilah Donald Eugene Smith—bahwa selain tipe intelektual organik; yang berpandangan Islam adalah agama sekaligus politik, ada juga tipe intelektual sekular; yang berpandangan Islam adalah agama bukan politik. Negara harus beragama Ketika kendali agama dilepas dari negara apa yang akan terjadi. Mungkin, kalau negara yang dimaksud corak masyarakatnya sama di Eropa. Namun, apakah sama kalau itu berlaku pada negara yang

mayoritas masyarakatnya Muslim. Dalam konsepsi Islam—seperti yang dikemukakan oleh Sayyid Quthb, Rasyid Ridha dan Al Maududi—dikenal istilah Islamhuwaaddinuwaaddaulah(Islamadalah penyatuanantaraagamadannegara).Sebagai agama rahamatan lil alamin, Islam sudah dipersiapkan untuk semua lini kehidupan sampai hal-hal yang terkecil. Jadi bukan semata agama yang mengurusi akhirat atau yang sifatnya privat saja. Dan sejak sistim negara Islam pertama terbentuk di Madinah hingga runtuhnya imperium Turki usmani, Islam identik dengan negara. Terbukti setelah melalui pasang surut kejayaan, peradaban Islam terus berkembang dan berlangsung lama. Malah, justru ketika Turki (1924) yang dipimpin oleh Musthafa Kemal Ataturk merombak sistim khilafah dan memutus total kendali agama terhadap negara, bukan jadi moderen tapi jadi hancur. Jadi benarseperti yang dikatakan Swidler bahwa pemikiran tentang pemisahan antara agama dan negara tidak mempunyai presedensejarahdalamkehidupanNabi.Praktek sekularisasi hanya ada dalam pemikiran Kristen pada abad pertengahan, yang dari situkemudianmenimbulkanrevolusiindustri dan era pencerahan di beberapa negara belahan Eropa lainnya. Oleh karenanya, agama perlu mengawal negara. Karena negara dijalankan oleh manusia, dan manusia sering alfa serta cenderung mengikuti hawa nafsu. Di sinilah agama hadir untuk meluruskan dan menyeimbangkan kehidupan manusia selama di dunia. Lalu kemudian, agama mana yang harus dipakai, tentunya sesuai konteks demokrasi maka agama mayoritas penduduknyalah yang digunakan. Penulis adalah Mahasiswa pasca sarjana IAIN Sumut, Alumnus Univ. Al Azhar-Mesir

Menjelang Muswil III PAN Aceh Oleh Tarmidinsyah Abubakar, SE Aklamasi dalam perspektif PAN sesungguhnya bukan sesuatu yang tabu


elang MusyawarahWilayah (Muswil) III PAN Aceh 16 Oktober 2010 di Banda Aceh, para kader di seluruh Aceh akan dihadapkan pada sebuah tantangan politik yang sangat menentukan. Kenyataan ini sesungguhnya hanya dirasakan oleh kader yang memiliki sensitifitas tinggi dalam menterjemahkan perkembangan politik partai dalam dinamika persaingan politik di provinsi Aceh. Kini di usianya yang ke 12 PAN di Provinsi Acehyangtelahdipimpinolehtigaketua,yaitu Said Mudhahar Ahmad, Jamaluddin Ahmad dan dua periode terakhir dipimpin Azwar Abubakar berada dalam lima besar partai pemenang Pemilu di Aceh—dihadapkan pada momentum penyegaran organisasi yangsalahsatunyaadalahsedangmengalami hamiltuauntukmenantikelahiranpemimpin barunya yang akan menahkhodai partai ini di masa datang. Isu aklamasi Aklamasi adalah sebuah model pengambilankeputusanyangmengedepankan

kesepakatan seluruh pihak terhadap salah satu opsi yang diyakini terbaik untuk kepentingan semua pihak tanpa mengorbankan nilai-nilai yang berlaku dalam organisasi dan secara umum memenuhi tuntutanprinsip-prinsipdemokrasi.Aklamasi akan sulit diwujudkan tanpa melalui proses skenario diplomasi lintas kandidat dalam pemilihan orang, apalagi pemenuhan hak tidak hanya berlaku bagi orang yang dipilih tetapi juga pemenuhan tuntutan hak politik tim dan pengikut kandidat. Aklamasi dalam perspektif PAN sesungguhnya bukan sesuatu yang tabu, namun aklamasiyangdimaksudsetelahmempertimbangkan secara matang manfaat strategis bagi organisasi. Seluruh kandidat secara berkesadaran dan ikhlas melepaskan haknya kepada seseorang dengan pertimbangan kepentingan yang lebih banyak orang. Salah satu yang perlu diwaspadai adalah aklamasi konspiratif yang bertujuan mementingkan kepentingan segelintir elit dan kelompok. Skenario aklamasi konspiratif secara kualitatif merupakan metode pengambilan

keputusanyangbertentangandenganprinsip demokrasi dan ajaran partai PAN. Jikapun hal ini dapat terjadi dan terlaksana dalam suatumusyawarah PAN maka pengambilan keputusan semacam tersebut merupakan pemaksaan kehendak.Yang paling urgen dari anasir tersebut adalah penghinaan terhadap kader PAN di daerah sekaligus telah menginjak-injak hak dan harga diri sesama. Pengambilan keputusan selalu menyisakan persoalan besar dan kecil biasanya dalam bentuk kepuasan dalam pemanfaatan hak mereka yang berpartisipasi. Apalagi metode aklamasi yang bersifat konspirasi, dimana seseorang yang terpilih dalam kepemimpinannya berorientasi ke atas dan hanya menyisakan perhatian kecil kepada pengikutnya. Dalam sebuah pemilihan tidak dapat dipungkiri sebagian besar beredar penggunaan uang sogok atau politik uang. Seharusnya PAN yang hadir mengusung salah satu misinya anti KKN perlu melakukan upaya antisipasi terhadap berlakunya permainan uang sogok untuk mempengaruhi pemilihan baik internal maupun eksternal. Positioning Idealnya pemimpin partai harus bebas dari ikatan persekongkolan kekuasaan agar dalam kepemimpinannya mampu menerapkan nilai-nilai transparansi ketika menyuarakan aspirasi politik anggotanya.

Beresikotinggiketikaseorangpimpinanpartai politik memiliki seabrek masalah, konon lagi rahasia kebobrokannya disimpan secara rapi oleh pihak lain, dimana suatu saat akan menjadi kunci untuk menundukkannya dalam persaingan politik. Dampak negatif dari kondisi ini tentu tidakhanyamelandaseorangketuasaja,tetapi dapat merusak partai secara keseluruhan dalamkepercayaanrakyat.Dengandemikian partai secara otomatis tidak akan dipilih pada Pemilu dan pemilihan rakyat di masa datang. Salah satu persoalan mendasar yang dihadapi PAN saat ini adalah penempatan posisi partai (positioning) dalam sistim kekuasaan di Aceh. Sebagian besar kader justru tidak paham terhadap keberadaan posisi partai apakah sebagai oposisi atau sebagai mitra pemerintah Aceh. Jika sebagai oposisi maka sikap pimpinan tentu berlawanan dengan pemerintah demikian sebaliknya jika sebagai mitra tentu fasilitas politik apa yang telah dinikmati PAN dan seluruh kadernya. Tantangan kader lain pada Muswil PAN Acehkaliiniadalahbagaimanakaderbersikap menentukan posisi partai secara kelembagaanterhadapkekuasaanpemerintahAceh pasca Muswil nantinya. Adakah pemimpin PAN Aceh mampu memperjelas posisi partai dimata rakyat Aceh? Penulis adalah Sekretaris DPW PAN Aceh


Laporan Khusus

WASPADA Rabu 29 September 2010

Keceriaan para mahasiswa baru UISU ketika mengikuti ABA-MB Tahun Ajaran 20102011. Bawah, Masjid Jamik, yang bersejarah dan terletak di bagian depan, menjadi landmark kampus induk Al Munawwarah Jl. SM Raja, Teladan, Medan.

ABA-MB Cerminan Eksistensi UISU Yang Tak Pernah Surut

Ketua Umum Yayasan UISU Ir. H. Helmi Nasution, MHum (kanan) berbincang akrab dengan Sekretaris Umum Yayasan UISU, Ir. H. Arfis Amiruddin, MSi.

Keceriaan para mahasiswa baru mengikuti ABA-MB 2010/2011.

Para Dekan Fakultas UISU, semua hadir di acara ABA-MB 2010-2011.

9 Fakultas UISU Jl. SM Raja Teladan Medan:

Fakultas Hukum (Informasi: 061-7869780) Program Studi: Ilmu Hukum, Konsentrasi: 1. Hukum Pidana. 2. Hukum Perdata. 3. Hukum Internasional Fakultas Agama Islam: (Informasi: 061-7868449) Program Studi: 1. Akhwatul Syakhsyiah 2. Pendidikan Agama Islam Fakultas Ekonomi: (Informasi: 061-7869880) Program Studi: 1. Ilmu Ekonomi dan Studi Pembangunan (IESP) 2. Manajemen 3. Akutansi Fakultas Sastra: (Informasi: 061-7869911) Program Studi: Bahasa dan Sastra Inggris Fakultas Keguruan dan Ilmu Pendidikan (Informasi: 061-7869730) Program Studi: 1. Pendidikan Bahasa dan Sastra Indonesia 2. Pendidikan Pancasila dan Kewarganegaraan. 3. Pendidikan Sejarah. 4. Pendidikan Matematika 5. Pendidikan Biologi. 6. Pendidikan Fisika Fakultas Ilmu Sosial dan Ilmu Politik (Informasi: 061-7865070) Program Studi: 1. Ilmu Administrasi Negara. 2. Ilmu Komunikasi Fakultas Pertanian (Informasi: 061-7866442) Program Studi: 1. Agroekoteknologi. 2. Sosial Ekonomi Pertanian. 3. Teknologi Hasil Pertanian Fakultas Kedokteran (Informasi: 061-4572733, 4570702, 4142993) Program Studi: Pendidikan Dokter Fakultas Teknik (Informasi: 061-7868049) Program Studi: 1. Teknik Mesin. 2. Teknik Elektro. 3. Teknik Sipil. 4. Teknik Industri. 5. Teknik Informatika Program Pasca Sarjana: Program Studi: 1. Magister Managemen. 2. Magister Sastra. 3. Magister Ilmu Hukum. (***)

UNIVERSITAS Islam Sumatera Utara (UISU) telah menggelar Acara Bimbingan Akademik Mahasiswa Baru (ABAMB) tahun 2010 terhadap ribuan mahasiswa baru mereka di kampus Al Munawwarah, Jl. SM Raja, Teladan, Medan pada, 22 dan 23 September. Dengan mengikuti proses perkenalan kampus, yang dahulunya juga dikenal dengan Opspek ini, resmilah mahasiswa baru tahun ajaran 2010-2011 tersebut bergabung menjadi mahasiswa di salah satu perguruan tinggi yang terkenal, dengan predikat universitas Islam tertua di luar Pulau Jawa. Lewat ABA-MB ini juga, UISU telah membuktikan jati diri, sebagai universitas besar. Eksistensi yang telah ditunjukkan di enam dekade, sejak berdiri di tahun 1952 dan tidak pernah surut, di tengah tantangan era persaingan yang semakin ketat, dengan banyaknya universitas lain. Ketua Panpel ABA-MB Dr. Ir. Rachmat Adiwiganda, MSc, mengatakan, ABA-MB 2010 diikuti para mahasiswa dari sembilan fakultas dibawah naungan UISU, y ang membina 25 Program Studi Sarjana (S1). “Para mahasiswa baru yang mengikuti ABA-MB tidak hanya dari Medan, atau Sumut. Tetapi juga datang dari daerah luar, seperti Aceh, Sumbar, Riau, dan juga dari provinsi lain,” katanya. “Kita tentu bersyukur, karena kegiatan ABA-MB tahun ini telah berjalan dengan lancar, diikuti para mahasiswa baru, dengan dibimbing para senioren mereka. Acara pembukaan berlangsung meriah, dihadiri Rektor dan Pembantu Rektor, semua Dekan dari sembilan fakultas, para Dosen, serta Pengurus Yayasan UISU,” ucap Ir. Rachmat. Sekretaris Umum Yayasan UISU, Ir. H. Arfis Amiruddin, MSi, menambahkan, lewat kegiatan ini juga tercermin rasa kebersamaan dan keceriaan, dalam sebuah keluarga besar UISU. “Rasa kebersamaan dan bersatu ini juga, yang telah membuat UISU terus dikenal dan tetap eksis,,” ucapnya. Dalam pidato sambutan mewakili Ketua Umum Yayasan UISU, di pembukaan ABA-MB 2010, Ir. H. Arfis menyebut, salah satu alasan kenapa UISU tetap menjadi pilihan utama, karena memiliki kelebihan yang tak dimiliki universitas lain, yakni, pembinaan di sini tak hanya bersifat duniawi, tetapi juga Islami. “Pendidikan yang juga mengutamakan Imtaq atau, Iman dan Taqwa, tak hanya Iptek,” ucap Arfis. Ketua UmumYayasan UISU, Ir. H. Helmi Nasution, MHum, dalam kesempatan ini mengungkapkan, kepercayaan para mahasiswa baru untuk kuliah di UISU, di kampus Al Munawarrah, merupakan bukti bahwa universitas ini tetap menjadi salah satu pilihan terbaik, selepas menamatkan SMA/SMK. Kepercayaan yang telah mereka berikan tentu harus kita respon, yakni dengan mewujudkan visi dan misi UISU. Bukan hal mudah memang, bisa tetap eksis di usia yang sudah lebih setengah abad dan terus berupaya menjadi terbaik, di tengah-tengah persaingan yang kian ketat. “Alhamdulillah, dengan tekad dan kerja keras, dan tentu berkat kebersamaan kita semua, UISU bisa tetap eksis menjadi bagian dari dunia pendidikan di Sumut. Apalagi UISU punya motto 58 Tahun Untuk Pendidikan, Demi Izzatul Islam Wal Muslimin,” ungkap putra salah satu pendiri, UISU H. Bahrum Jamil Nasution ini. UISU, papar Helmi, memiliki Visi: Menjadi Perguruan Tinggi Islam, andal teruji, bermartabat mulia, dicintai masyarakat dan diridhoi Allah Swt, dengan Misi: Melaksanakan pendidikan dan pengajaran, penelitian, untuk membentuk Sarjana Muslim dan Nasional yang berkualitas, beriman, bertaqwa, berakhlaq mulia, berilmu, dan beramal shaleh, turut serta berperan dalam pembangunan ummat Islam, agara, bangsa dan negara Republik Indonesia, demi kemashlatan dan kesejahteraan ummat manusia. Akhirnya, sebut Helmi, kami sadar UISU bisa terus berkembang, juga tak lepas dari dukungan dan doa masyarakat. “Karenanya, kami senantiasa terus memohon dukungan dan doa agar UISU bisa terus eksis untuk mendarma-baktikan diri bagi kemajuan bangsa dan negara. UISU sekarang bukan lagi sekedar milik yayasan atau rektorat, tetapi sudah menjadi bagian dari asset Sumatera Utara,” papar Helmi. (***)

Rektor: Kualitas Alumni UISU Bisa Diuji REKTOR UISU dr. Chairul M Mursin, SpAn mengatakan, jumlah mahasiswa baru yang mengikuti Acara Bimbingan Akademik Mahasiswa Baru (ABAMB) Tahun ajaran 2010-2011 ada seribuan orang. Jumlah ini nantinya akan terus bertambah, karena akan ada mahasiswa pindahan yang bakal menyusul bergabung. “Kita akui, anak-anak memang masih ada yang ragu untuk bergabung sekarang. Namun, sejalan dengan waktu, mereka nantinya pasti bakal menetapkan pilihan. Karena kita juga bisa membuktikan eksistensi UISU tidak pernah surut, dalam menjalankan amanah yang diemban,” ucap dr. Chairul Mursin, yang ditemui di ruang kerjanya Biro Rektor UISU, kampus induk Al Munawwarah, Teladan, Medan. “Kita memiliki tekad untuk tetap menjadi yang terbaik, mewujudkan visi dan misi UISU. Hal ini tentu bisa menjadi alasan kenapa para tamatan SMA/SMK tetap memilih UISU sebagai jenjang pendidikan mereka selanjutnya. Karena, mereka menilai UISU tetap sebagai salah satu universitas swasta terbaik, dan kualitas para alumni UISU di Teladan ini bisa diuji. Tahun lalu saja lebih dari 100 alumni UISU lulus seleksi CPNS”. “Secara akademik, UISU tetap memiliki staf akademik yang sangat berkompeten dan punya legalitas. Seperti staf-staf pengajar di Fakultas Pertanian, Fakultas Hukum, juga di Kedokteran, dengan 10 orang guru besar yang dahulunya ikut membangun UISU. Sampai sekarang, mereka masih tetap setia bersama kita,” papar Chairul Mursin. Rektor mengakui jumlah mahasiswa baru di Tahun Ajaran 2010-2011 ini memang ada penurunan dibanding tahun-tahun sebelumnya, dan semuanya ini tak lepas dari imbas kisruh yang belakangan terjadi di UISU.

Dr. Chairul M Mursin, SpAn. “Kisruh UISU tentu membawa kerugian, terutama bagi proses kuliah mahasiswa. Tetapi kita di sini tetap solid. Dan dengan kebersamaan yang dimiliki, kami juga yakin, semua kesulitan yang terjadi saat ini suatu waktu akan berakhir,” ungkap Rektor lagi. Dia juga mengatakan, memang benar ada mahasiswa UISU yang kemudian memilih pindah, dan hal itu tak pernah dihalang-halangi. Namun jumlah mereka yang pindah menjadi tidak seberapa dibanding jumlah mahasiswa baru yang masuk. Dengan bergabungnya mahasiswa baru, jumlah mahasiswa yang kuliah di UISU saat ini tak kurang 7.000-an orang, dibimbing staf pengajar yang berjumlah 800-an. Kepada para mahasiswa baru, Rektor, selaku pimpinan Universitas, mengucapkan selamat datang di kampus Al Munawwarah, serta selamat bergabung dalam komunitas kampus UISU yang penuh sejarah dan perjuangan sebagai universitas tertua di luar P. Jawa. (***)

UISU Tetap Menjadi Pilihan Nomor Satu SELEPAS menyelesaikan pendidikan di SMA/SMTK, melanjutkan jenjang pendidikan ke perguruan tinggi sudah menjadi keharusan saat ini. Tersebar banyak Perguruan Tinggi Swasta di Medan, namun bukan hal sulit untuk menentukan salah satu di antaranya.

UISU, dengan kampus induk Al Munawwarah, Jl. SM Raja, Teladan, Medan, adalah salah satu PTS yang selalu kebanjiran mahasiswa di setiap tahun akademik baru. Para lulusan SMA/ SMTK, pada umumnya memilih UISU karena memang sudah akrab dengan nama besarnya atau juga atas rekomendasi kawan, saudara dan juga orang tua. Beberapa mahasiswa baru yang ditemui di sela-sela Acara Bimbingan Akademik Mahasiswa Baru (ABA-MB) Tahun Ajaran 2010/2010 di kampus Al Munawwarah, Teladan, Medan mulai Rabu (22/9) menyebut, UISU menjadi pilihan, setelah harapan diterima di Perguruan Tinggi Negeri, kandas karena tidak lulus seleksi. Tidak hanya para tamatan SMA/SMTK di Cahaya Isna Kirani (kiri) dan Tata Prawira Medan, atau Sumut, yang kuliah di sini, Yudha, pilih Fakultas Hukum UISU.

karena memang ada banyak mahasiswa baru yang datang dari Aceh, Riau, Sumbar dan provinsi lain. Cahaya Isna Kirani Lubis, misalnya. Dia adalah dara kelahiran Lhokseumawe 1992, yang baru menamatkan studi di SMA Negeri I Kuta Binge, Kec. Julok, Aceh Timur. Gadis manis yang kedua orang tuanya menjadi guru di Aceh ini, kemudian memilih Fakultas Hukum UISU sebagai tempat kuliah, karena sudah tahu UISU adalah salah satu PTSterbaik. “Saya memilih UISU juga karena atas saran orang tua, karena UISU dengan kampus di Jl. SM Raja Medan ini memang sudah dikenal luas. Apalagi kakak pertama, kan, memang lulusan UISU juga, di Fakultas Ekonomi,” ungkap Cahaya, yang berharap bisa cepat-cepat lulus kuliah dan dapat kerja dengan mudah setamat dari sini. Tata Prawira Yudha, tamatan SMA Negeri 2 Medan, juga menetapkan hati melanjutkan kuliahnya di Fakultas Hukum UISU. Putra dari pasangan WH Pranggono dan

Yuhelma yang menetap di Kel. Sari Rejo, Kec. Medan Polonia ini, juga mengaku pilihan atas UISU tak lepas dari saran orang tua. “Soalnya ada sepupu, juga sudah kuliah di sini. Lagi pula, UISU memang sudah diakui, statusnya aja kan sudah Akreditasi A?” ucap Tata, setengah bertanya. “Memang, sebelumnya kita juga tanya ke kawan-kawan mau pilih yang mana.Tetapi saya mantap memilih UISU di Teladan,” aku Tata, yang tak ingin berlama-lama kuliah, supaya cepat lulus, kemudian bekerja agar tak lagi memberatkan orang tua. Seperti para lulusan SMA lain, Atina Rahmatika, juga tak butuh waktu lama untuk menentukan PTS pilihan sebagai tempat menimba ilmu selanjutnya. Atina merupakan lulusan SMA Dr. Wahidin, yang berlokasi di Jl. Yos Sudarso, Kec. Medan Labuhan, dan memilih kuliah di Fisipol UISU. Putri pasangan Iskandar dan Cut Mariani ini, yang pada 28 September ini berulang tahun ke-20 mengatakan, dia memilih UISU

karena dari dahulu universitas ini memang telah memiliki nama besar.“Saya sendiri yang memilih UISU, yang kampusnya di Teladan ini, dan orang tua kemudian merestui. Saya ingin kuliah sebaik-baiknya, kalau sudah lulus kepingin cari uang sendiri, mau membuat orang tua bangga,” papar Atina, yang berdomisili di kawasan Medan Marelan. (***)

Atina Rahmatika, akan kuliah di Fisipol UISU.

Luar Negeri


Rabu 29 September 2010


Israel Desak Kapal Yahudi Tak Masuki Perairan Gaza

Tentara AS Ditahan Karena Bunuh Dua Temannya Di Irak

GAZA CITY, Jalur Gaza (Antara/AFP): Sebuah kapal perang Israel Selasa (28/9) memerintahkan satu kapal aktivis Yahudi agar mengubah tujuannya ketika berusaha memasuki wilayah perairan di sekitar Jalur Gaza, kata seorang penumpang. “Mereka menghubungi kami dan menanyakan kami siapa, dari mana kami datang dan tujuan kami,” kata Yonatan Shapira kepada AFP melalui telepon satelit. “Mereka mengatakan kami sedang mendekati satu daerah yang berada di bawah blokade angkatan laut dan meminta kami mengubah tujuan,” katanya. Bunyi suara melalui alat pengeras suara mendesak kapal itu Irene“mengubah tujuan” dapat terdengar dari kejauhan. Shapira mengatakan kapal berbendera Inggris, yang membawa tujuh aktivis Yahudi dari Eropa dan Amerika Serikat dan dua wartawan, berada 30 km dari pantai Gaza dan telah diawasi kapal angkatan laut Israel. Israel berikrar akan mencegah kapal itu dan mengalihkannya ke pelabuhan Ashdod, Israel selatan jika berusaha memasuki perairan Gaza. Shapira sebelumya mengatakan kapal itu berharap akan tiba di Gaza dalam beberapa jam ke depan. Para aktivis itu berikrar mereka tidak akan melakukan konfrontasi dengan pasukan Israel. “Kami memiliki kebijakan damai dan tindak konfrontasi,” kata Shapira, mantan pilot Israel, Minggu. “Tetapi jika tentara Israel mencegat kapal itu, kami tidak akan membawanya ke Ashdod.” Di masa lalu, Israel mengatakan pihaknya akan mengirimkan kargo kemanusiaan ke Gaza melalui darat setelah menggiring kapal-kapal seperti itu ke Ashdod.

BAGHDAD, Irak (AP): Seorang tentara Amerika ditahan di Irak sehubungan dengan penembakan maut atas dua prajurit Amerika lainnya dan mencederai seorang lainnya setelah terjadi pertengkaran sesama mereka, kata militer AS Selasa (28/9). Satu pernyataan pasukan AS mengatakan Prajurit Neftaly Platero berada dalam tahanan untuk pemeriksaan atas pembunuhan Kamis di Fallujah, kota bekas kubu pemberontak 65 km di barat Baghdad. Kol. Barry Johnson, seorang jurubicara militer AS, mengatakan satu ‘cekcok mulut’ terjadi di antara empat prajurit dan tersangka ‘diduga mengangkat senjatanya dan mulai menembak prajurit lainnya.’ Para korban yang tewas dalam peristiwa tersebut disebut sebagai Pentagon seperti Prajurit John Carrillo Jr., 20, dari Stockton, California, dan Prajurit Gebrah P. Noonan, 26, dari Watertown, Connecticut. Mereka adalah anggota Batalion ke-3, Resimen Infantri ke-15, Brigade Infantri Tim Tempour ke-4 yang berpangkalan di Fort Stewart, Georgia. Nama prajurit yang terluka belum disiarkan. Tidak ada rincian lebih lanjut yang diberikan. Jurubicara militer Brigjend. Jeffrey Buchanan mengatakan pasukan AS ‘amat sedih dengan kejadian tragis ini.’ (m07)

Walikota Mexico Tewas Dipukuli Dengan Batu MORELIA, Mexico (AP): Seorang walikota kota kecil Mexico dan seorang pembantunya ditemukan tewas dipukuli dengan batu di satu negara bagian barat yang berada di bawah pengaruh kartel obat bius. Dia merupakan pemimpin kota kelima yang dibunuh di Mexico sejak pertengahan Agustus. Jaksa Agung negara bagian Michoacan, Jesus Montejano, mengatakan mayat Walikota Tancitaro, Gustavo Sanchez, dan penasehat kota Rafael Equihua ditemukan di dalam satu truk pick-up yang ditinggalkan di satu jalan kumuh dekat kota Uruapan. Jurubicara Montejano, Jonathan Arredondo, mengatakan mulanya bahwa para korban digorok dengan golok hingga tewas, namun jaksa agung mengbatakan mereka dibunuh dengan batu. Arredondo mengatakan polisi berusaha untuk menduga-duga motif pembunuhan itu. Tancitaro, satu kota berpenduduk 26.000 jiwa, berada di satu kawasan di mana tentara telah merusak lebih dari 20 laboratorium selama tahun lalu dan sejumlah polisi tewas oleh para tersangka anggota pedagang obat bius. Tahun lalu ketua dewan kota, Gonzalo Paz, telah diculik, disiksa dan dibunuh. Kemudian Desember lalu, walikota dan tujuh pejabat kota mengundurkan diri setelah mengatakan mereka telah diancam oleh para pedagang obat bius dan polisi lokal tidak hadir di pekerjaan mereka. (m07)

Los Angeles Dilanda Panas LOS ANGELES, California (AP): Musim panas menyengat saat ini melanda Los Angeles ketika gelombang suhu tinggi mencapai rekor tertingginya Senin (27/9) dan situasi itu juga melanda kotakota pantai lainnya di kawasan California. Los Angeles membuka pusat-pusat pendinginan untuk para penduduk sementara para pemadam kebakaran disiagakan menghadapi kebakaran hutan, namun amat sedikit angin yang bertiup di tengah kegersangan diakibatkan panas terik itu. Di pusat kota Los Angeles suhu tercatat 113 derajat Fahrenheit (kira-kira 45 Celsius) selama beberapa menit pada tengah hari, yang memecahkan rekor sepanjang masa yang tercatat 112 derajat Fahrenheit (44 Celsius) pada 26 Juni 1990, kata Stuart Seto, seorang pakar cuaca di kantor National Weather Service di Oxnard. Rekor suhu tertinggi di pusat kota tercatat pada 1877. Tidak diketahui pasti apakah temperatur akan terus meningkat Senin. Temperatur berlanjut berfluktuasi sekitar 112 derajat Fahrenheit (44 Celsius) pada siang, kata Seto. Rekor tertinggi yang lama tercatat pada 27 September ketika suhu sekitar 106 derajat Fahrenheit (41 Celsius). Ratusan ribu warga California keluar rumah dan membanjiri pantai-pantai terkenal di akhir pekan pada saat suhu tinggi. Kota Los Angeles mendesak masyarakat untuk menggunakan berbagai fasilitas Taman dan Rekreasi, pusat perawatan jompo dan perpustakaan kata sebagai pusat pendinginan. (m07)

Chavez Klaim Menang Dalam Pemilu, Tolak Oposisi Kecil KARAKAS, Venezuela (Antara/AFP): Presiden Venezuela Hugo Chavez mengatakan partai haluan kirinya meraih suara mayoritas dan juga kursi di pemilihan legislatif dan mengejek klaim oposisi yang mengatakannya bahwa pihaknya telah kehilangan dukungan signifikan. Pemimpin itu menolak partai oposisi ‘kecil’ yang mencegah partainya mempertahankan kekuasaan di parlemen (Majelis Nasional) dan mengklaim menang tipis dalam pemilihan umum. “Mereka selalu berbohong, memanipulasi,” kata Chavez dalam konferensi pers pertama sejak pemilu, menggunakan baju hangat berwarna kuning, biru, merah, menyerupai bendera Venezuela. “Tidak ada keraguan bahwa kekuatan revolusioner mendapat kemenangan besar pada Minggu,” kata Chavez Senin (27/9) mengacu pada ‘revolusi sosialis yang dia pimpin dalam hampir 12 tahun masa kepemimpinannya.’ Komisi pemilihan hanya memberi angka kursi yang dimenangkan, bukan jumlah suara. Perubahan kontroversial dalam aturan pemilu itu berarti partai Chavez mendapatkan lebih banyak kursi dibandingkan suara yang dia peroleh. Chavez mengklaim Partai Bersatu Sosialis Venezuela (PSUV) yang mendukungnya meraih 5.422.040 suara sementara kubu oposisi koalisi, Unity Table (MUD) memperoleh 5.320.175 suara. Dia mengatakan 520.000 suara lainnya dimenangkan oleh partai haluan kiri lain, Homeland For Everyone (PPT) yang merupakan pecahan dari partainya dan tidak dapat dikategorikan dalam koalisi oposisi. Menurut perhitungan suara resmi, partai Chavez meraih 95 kursi sementara pihak oposisi merebut 63 kursi sementara PPT mendapat dua.

Kremlin Pecat Walikota Moskow



Polisi dan tentara menyelidiki lokasi ledakan bom bunuhdiri yang menewaskan deputi gubernur Provinsi Ghazni, Afghanistan, Mohammad Kazim Allahyar, di Ghazni Selasa (28/9). Para pengebom bunuhdiri yang menggunakan sepedamotor membunuh Allahyar dan lima orang lainnya Selasa, kata sejumlah pejabat kepolisian.

Kim Angkat Putranya Jadi Jenderal Militer SEOUL, Korea Selatan (Antara/Reuters): Pemimpin Korea Utara Kin Jong-il yang sakit-sakitan telah mengangkat anak laki-laki bungsunya sebagai jenderal militer, demikian media negara Selasa (28/9) dini hari, menandai tahap pertama dari suksesi dinastiknya. Kim Jong-il, 68, diyakini menderita stroke pada 2008, tapi kesehatannya yang menurun diperkirakan belum akan membuatnya pensiun sekarang, kata beberapa pakar. Mereka mengatakan anak laki-lakinya Kim Jong-un masih sangat muda dan belum berpengalaman untuk mengambil tampuk pimpinan pemerintahan sepenuhnya. Beberapa pejabat intelijen mengatakan anak laki-laki berusia 20-an tahun “kesayangan pemimpin” itu telah dikenali tahun lalu sebagai calon pemimpin masa depan di negara yang memiliki cukup material fisil untuk sedikitnya delapan senjata nuklir itu. Puteranya itu, yang kurang dikenal, diperkirakan lahir pada 1983 atau 1984. Melewati infor-

masi sederhana, bahkan menurut standar Korea Utara (Korut) yang sangat suka berahasia, dia bersekolah di Swiss dan menjadi favorit ayahnya. Kim juga memberi pangkat jendral pada saudara perempuannya, Kyonghui, yang telah dianggap sebagai pendukung utama anak laki-laki mudanya itu, lapor kantor berita KCNA. Penunjukan Kim muda itu terjadi sebelum pembukaan pertemuan Partai Pekerja yang berkuasa, Selasa, dalam langkah yang beberapa pengamat perkirakan akan menandai dimulainya proses pergantian pemimpin di Korut. Para penguasa daerah akan diawasi dengan dekat dalam Konferensi Pekerja itu, pertemuan terbesar yang seperti itu di

negara tersebut dalam 30 tahun, untuk menandai perubahan yang dapat mempengaruhi kebijakan ekonomi dan luar negeri negara miskin itu. Beberapa pakar mengatakan hasil yang bersahabat dengan pasar dari pertemuan itu merupakan keberlanjutan yang diperkirakan dari sistimnya sekarang ini. Kekhawatiran terbesar adalah tanda rezim akan runtuh yang dapat menimbulkan kekacauan internal, aliran pengungsi besarbesaran dan pertukaran militer. China dan Jepang adalah ekonomi nomer dua dan tiga di dunia dan, dengan Korea Selatan (Korsel), mencatat mendekati 20 persen dari output ekonomi global. Ketidakstabilan di Semenanjung Korea akan memiliki implikasi yang menyeramkan pada ekonomi global. “Konferensi itu sendiri seyogyanya membuka pintu pada perubahan kepemimpinan yang tertib dan dalam satu cara atau lainnya perbaikan ekono-

mi, keuntungan eonomi jangka panjang bagi ekonomi bersama Korea,” kata Goohon Kwon, pakar ekonomi Korea dan ketua bersama riset di Goldman Sachs di Seoul. Pada pertemuan partai semacam terakhir 30 tahun lalu, Kim, ketika itu berusia 38 tahun, memulai peran resminya untuk menggantikan ayahnya dan pendiri Korut dengan menerima gelar Partai Pekerja. Tapi dengan menandai kemunculan Kim muda, beberapa pakar mengatakan Korut sedang mempersiapkan kepemimpinan kolektif ayah dan anak, yang akan memperkuat cengkeraman keluarga itu terhadap kekuasaan. Jika Kim meninggal dengan tiba-tiba, anak laki-lakinya yang ketika itu dikenali sebagai pemimpin bukan sungguhan, akan dikelilingi oleh orang-orang kepercayaan keluarga dekat, yang telah ditunjuk ke jabatan-jabatan senior di Partai Pekerja dan militer dalam beberapa bulan belakangan.

7.400 Tewas Dalam Satu Dasawarsa Kekerasan Yang Landa Timteng JERUSALEM (Antara/AFP): Lebih dari 7.400 orang tewas akibat kekerasan Israel-Palestina sejak meletusnya perlawanan Palestina, atau intifada, kedua 10 tahun lalu bulan ini, demikian sebuah kelompok hak asasi ma-

nusia Israel. Sebagian besar dari 7.454 orang yang tewas itu adalah warga Palestina, yang tercatat 6.371 orang, atau sekitar 85 persen, dari seluruh korban kekerasan tersebut, kata kelompok

HAM B’Tselem dalam satu pernyataan Senin. Di antara warga-wargaPalestinayangtewas itu, 1.317 orang belum dewasa. Korban Palestina itu termasuk sedikitnya 2.996 orang yang tidak mengambil bagian dalam

87 Senator AS Minta Obama Tekan Abbas WASHINGTON (Antara/ AFP): Delapanpuluh-tujuh senator Amerika Serikat meminta Presiden Barack Obama agar mendesak Presiden Palestina Mahmoud Abbas tidak meninggalkan perundingan perdamaian dengan Israel. “Penting sekali agar semua pihak tetap di meja. Tidak ada pihak boleh mengancam untuk pergi ketika baru saja pembicaraan dimulai,” kata para anggota parlemen itu, mayoritas sangat besar dari badan yang memiliki 100 kursi, menulis dalam sepucuk surat pada Obama. Abbas berulang kali memperingatkan dia akan meninggalkan pembicaraan jika Israel meneruskan pembangunan di

tanah Palestina yang diduduki, tapi negara Yahudi itu membiarkan pembekuan sebagian permukiman itu terlewati waktunya. Ketika sebuah buldoser melintasi Tepi Barat dengan lamban untuk beraksi Senin, Abbas mengatakan pada wartawan di Paris, dia tidak akan bergegas menanggapi penolakan Israel untuk memperpanjang pembekuan itu, tapi pertama-tama akan berkonsultasi dengan para pemimpin Palestina dan Arab. Dia akan membicarakan langkah itu dengan gerakannya Fatah dan Organisasi Pembebasan Palestina (PLO) pekan ini serta bertemu dengan para menlu Arab pada 4 Oktober.

“Kami mendesak anda untuk terus menekankan pada pemimpin Israel dan Palestina bahwa pembicaraan langsung, sementara sulit, memberikan harapan terbaik untuk mencapai perjanjian perdamaian yang berarti dan kekal,” kata para anggota parlemen itu dalam surat mereka pada Obama. Minta di Paris Presiden Prancis Nicolas Sarkozy mengatakan dia akan meminta Abbas, PM Netanyahu dan Presiden Mesir Hosni Mubarak ke pembicaraan perdamaian di Paris sebelum akhir Oktober. Sarkozy membuat pengumuman itu pada konferensi pers dengan Abbas setelah pembicaraan di Paris, Senin.

permusuhan ketika mereka tewas dan 2.193 yang mengambil bagian, kata kelompok tersebut. Sisanya termasuk 694 orang yang mungkin atau mungkin bukan pejuang, di samping 240 orang yang dibunuh dan 248 polisi yang dipekerjakan oleh pemerintah yang dipimpin Hamas yang tewas dalam perang Gaza 2008-2009. Orang-orang Palestina menewaskan 1.083 warga Israel pada periode waktu yang sama, termasuk 741 warga sipil, dari mereka itu 124 orang yang belum dewasa. Korban tewas lainnya sebanyak 342 orang adalah anggota pasukan keamanan. Selasa(28/9)menandaiulang tahun ke-10 kunjungan kontroversial Ariel Sharon ke kompleks Masjid Al Aqsa di Kota Tua Jerusalem, kejadian yang secara luas dianggap sebagai pemicu intifada, atau perlawanan, kedua. Empat tahun berikutnya telah menyaksikan sejumlah pengebom bunuhdiri Palestina di kota-kota Israel dan serbuan skala luas militer Israel di Tepi Barat yang diduduki negara Yahudi itu dan Jalur Gaza.

MOSKOW, Rusia (AP): Presiden Rusia memecat Walikota Moskow Yury Luzhkov Selasa (28/9), yang mengakhiri masa kekuasaannya selama 18 tahun, setelah dia berhasil mengubah penampilan kota tersebut. Namun dia menikmati liburan pada saat kebakaran hutan menyebabkan kotanya mengalami dampak buruk akibat bencana tersebut. Presiden Dmitry Medvedev menandatangani satu dekrit yang membebaskan walikota berusia 74 tahun itu dari tugasnya karena ‘hilangnya kepercayaan’ pada dirinya, demikian menurut Kremlin. Dengan langkah yang telah lama dinantikan itu, PMVladimir Putin dan Medvedev mengirimikan sinyal kuat bahwa tidak satu pun pemimpin regional yang tidak dapat dibebastugaskan. Spekulasi atas masa depannya di posisi walikota telah guncang dalam beberapa hari terakhir, yang memaksanya untuk menyatakan Senin bahwa dia tidak akan mengundurkan diri — satu opsi yang menurut wanita jurubicara Medvedev telah diajukan kepadanya. Belum ada reaksi Selasa baik dari Luzhkov atau Putin. Selama beberapa tahun Luzhkov masih tetap menduduki jabatannya meski ada desas-desus bahwa hari-hari akhir jabatanya sudah makin dekat. Dengan pemecatannya saat ini, maka kini saat Kremlin untuk memilih penggantinya, yang juga harus menjamin kesetiaan sebelum pemilihan parlemen 2011 dan pemilihan presiden 2012. (m07)

Menlu Seiji: Tak Ada Masalah Teritorial Dengan China TOKYO, Jepang (Antara/AFP): Menteri Luar Negeri Jepang Seiji Maehara menegaskan pada Selasa (28/9) bahwa “tidak ada permasalahan teritorial” atas kepulauan yang menjadi fokus pertikaian dengan China, menurut laporan kantor berita Kyodo. Dia juga mengatakan, penahanan kapten kapal nelayan China yang menyulut perseteruan terkini antara kedua raksasa ekonomi Asia itu dinilai pantas, menurut laporan tersebut Senin (27/ 9). Kapten kapal China, yang dibebaskan pekan lalu, ditahan pada 8 September setelah terjadi tabrakan dengan dua kapal patroli Jepang di Laut China Timur dekat dengan kepulauan yang disengketakan. China menyebut kepulauan itu Diaoyu dan Jepang menamainya Senkaku. Dalam perselisihan terburuk antarsaingan lama Asia, China menyerukan penahanan kapten kapal sebagai tindakan tak sah, memperdebatkan kepemilikan kepulauan sebagai bagian dari China sejak zaman kuno. Beijing telah melakukan serangkaian protes diplomatik, penghinaan dan ancaman. Sumber dari pihak industri mengatakan China telah menghentikan ekspor mineral bumi langka yang penting untuk Jepang, tuduhan yang disangkal oleh Beijing. China juga pekan lalu menahan empat warga Jepang — karyawan dari perusahaan yang bertugas membersihkan bekas senjata kimia masa penjajahan Jepang — setelah diduga merekam satu instalasi militer. Jepang pada Senin, meminta akses konsuler untuk menemui mereka dan juga menyerukan kepada China untuk menarik dua kapal patroli perikanan di dekat kepulauan tersebut. Akhir pekan lalu Jepang membebaskan kapten kapal China, yang disambut seperti pahlawan saat kembali pulang, dan kejadian tersebut memicu semangat patriotisme dan sentimen antiJepang, dinyatakan dalam bentuk sejumlah blog internet dan unjuk rasa kecil di jalanan. China merespons penglepasan kapten kapal pada Sabtu pagi dengan mendesak Jepang permintaan maaf dan kompensasi atas penangkapan dan penahanan.Washington — yang khawatir dengan perkembangan kekuatan militer China —menegaskan kembali komitmennya terhadap aliansi keamanan Jepang yang sudah dilakukan lebih dari setengah abad.


Rekor Dunia Konser Nonstop 24 Jam Di Delapan Negara BERLIN, Jerman (Waspada): Seorang musisi asal Jerman yang ingin memecahkan rekor dunia sekaligus mempromosikan album CD terbarunya, akhir pekan ini menggelar konser nonstop 24 jam di delapan negara. Vicente Patiz, 34, mengawali konsernya di kota Oberhausen, Jerman Sabtu kemarin dan berangkat sejauh 1.000 km untuk kembali manggung di Belgia, Belanda, Luxembourg, Prancis, Swiss serta Liechtenstein dan mengakhiri konsernya di Austria Minggu (26/9). Dalam konsernya, Patiz memainkan musik gitar Mediterania yang diciptakannya sendiri, dan tampil selama 1-1/2 jam pada tiap penampilan yang dihadiri antara 20 hingga 100 orang. “Tidak semua konser dilakukan pada waktu-waktu menyenangkan,” ujar Patiz. Sangat sulit mengajak orang Swiss untuk datang ke konser pada Minggu pagi.” “Saya merasa sedikit lelah, namun sangat bangga,” ujarnya, sambil menambahkan, penampilannya tersebut akan didaftarkan masuk dalam rekor dunia Guinness World Records. Rekor terakhir dipegang Jeff Aug yang menggelar konser nonstop 24 jam di enam negara pada Maret 2009 lalu. (rtr/rzl)



WASPADA Rabu 29 September 2010

Ujian Sulit Tanpa Rooney LONDON (Waspada): Mesin gol Manchester United (MU) Wayne Rooney dipastikan absen dalam laga tandang melawan Valencia dinihari WIB nanti di Stadion Mestalla.


Samuel Eto’o rawan kehilangan Diego Milito (kanan).

Inter, Werder Serupa ROMA (Waspada): Inter Milan dan Werder Bremen dilanda masalah serupa jelang matchday II Grup G Liga Champions dinihari WIB nanti. Tuan rumah Inter bermasalah dengan kondisi fisik Diego Milito dan Goran Pandev, yang dikhawatirkan untuk turun lapangan di Stadion San Siro. Keduanya merupakan ujung tombak andalan I Nerazzurri di garis serang, sehingga alenatorre Rafael Benitez terjebak problem sulit untuk mencari penggantinya. Benitez pun kemungkinan harus mengubah sistem permainan, karena tinggal penyerang asal Prancis Jonathan Biabiany dan bomber remaja dari Brazil Coutinho yang bisa mendampingi Samuel Eto’o. La Beneamata juga tidak akan dibela kapten Javier Zanetti, gelandang Thaigo Motta dan bek tengah Walter Samuel serta Marco Materazzi. Hal serupa juga menimpa Werder, yang tidak akan diperkuat kapten Torsten Frings, pe-

HEAD-TO-HEAD INTER MILAN VS BARCELONA 09/12/08 LC 01/10/08 LC 24/11/04 LC 14/09/04 LC

Werder Bremen Inter Milan Werder Bremen Inter Milan

nyerang Peru Claudio Pizarro dan bek Jerman Clemens Fritz. Menurut pelatih Thomas Schaaf, masalah itu membuat timnya semakin sulit menghadapi sang juara bertahan. “Masalah cedera pemain ini amat menyakitkan kami,” ungkap Schaaf dalam AFP, Selasa (28/9). “Kami kehilangan para pemain bermutu dan ini merupakan tantangan tersendiri. Saya harap mereka dapat turun lagi secepat mungkin, tapi mereka kemungkinan absen dalam dua laga mendatang,” katanya lagi. Sebelumnya Si Hijau Putih juga sudah kehilangan bek Naldo, Petri Pasanen dan Sebastian Boenisch. Namun Marko Marin yang jadi bintang saat menahan 2-2 Tottenham Hotspur

2 1 1 2

Inter Milan Werder Bremen Inter Milan Werder Bremen

1 1 1 0

pada matchday I, tidak ada yang perlu dikhawatirkan di Milano. “Sangat sulit melawan tim kuat dan berpengalaman seperti Inter,” ucap Marin kepada SkySport24. “Tapi kemenangan lawan Hamburg (Sabtu, 3-2) membuat kami memiliki rasa percaya diri tinggi, kendati Inter di dalam stadion mereka sendiri tetap sebagai tim favorit. Mereka merupakan salah satu tim terkuat dan tidak pernah mudah melawan mereka,” tambahnya. Ini merupakan pertemuan ketiga kalinya bagi kedua tim di babak penyisihan grup Liga Champions. Hasil empat laga sebelumnya mencerminkan keseimbangan, Si Biru Hitam hanya unggul satu gol saja. (h01/sky/ant/afp)

Beckham Bebas Sanksi Galaxy LOS ANGELES, AS (Waspada): Los Angeles Galaxy telah memutuskan untuk tidak mengambil tindakan terhadap David Beckham (foto) kala menghadapi ulah suporter yang mencela dirinya pasca kekalahan dari New York Red Bulls, kata klub tersebut. Mantan kapten Inggris itu mendekati suporter tersebut dan mengatakan “Katakan ke wajah saya” setelah fans itu mengejeknya atas dugaan Beckham terlibat seks dengan pelacur. Insiden yang tertangkap kamera tersebut terjadi di bawah tribun area terowongan dekat ruang ganti Galaxy. “Kami sudah memeriksa kembali insiden tersebut secara internal dan memutuskan tidak diperlukan tindakan,” kata Direktur Komunikasi Galaxy, Patrick Donnelly, Selasa (28/9). Suporter tersebut meneriakkan “stop dengan pelacur”, yang memicu kemarahan Beckham saat hendak berbalik ke kamar ganti sebelum menanggapi “Apakah Anda ingin mengatakannya lagi? Ingin mengatakannya lagi? Anda mengenakan kaus Galaxy?!” Insiden tersebut tertangkap kamera dan dimuat dalam laman tabloid News Of The World. Ofisial liga juga mengevaluasi

Rooney mengalami cedera pergelangan kaki ketika MU ditahan 2-2 oleh Bolton akhir pekan lalu, sehingga tidak berangkat ke Spanyol. “United berangkat keValencia Selasa pagi tanpa diperkuat striker Wayne Rooney,” demikian pernyataan resmi MU, Selasa (28/9). Kendati cederanya dianggap tidak terlalu serius, seperti dikatakan pelatih Sir Alex Ferguson dalam, striker Inggris berusia 24 tahun itu tidak prima untuk melawan Los Ches. Rooney juga sedang menghindari media menyusul tuduhan dia terlibat perkawinan dengan seorang wanita PSK. Mantan striker dan pelatih Inggris Kevin Keegan yang sekarang komentator televisi ESPN mengatakan, “Anda tidak dapat selamanya terikat kontrak kemudian menjual foto perkawinan Anda dan tiba-tiba mengaku ‘itu bukan tujuan saya kemudian ingin membalik suasana’.” “Tapi satu yang saya ingatkan, peliharalah rumah dan keluarga dari hal yang tidak sepatutnya. Penampilan Rooney tanpa gol di Bolton menunjukkan rasa percaya dirinya sedang dipertaruhkan,” tambah Keagan. Selain Rooney, United juga kehilangan winger veteran Ryan Giggs karena ada masalah pada urat kakinya. Mereka gabung dengan Antonio Valencia (per-

gelangan kaki), Michael Carrick (urat Achilles) dan Owen Hargreaves (lutut) dalam daftar cedera skuad Setan Merah. Ini ujian sulit bagi Red Devils, padahal pemilik tiga kali juara Eropa itu ditahan tanpa gol oleh Rangers pada matchday I Liga Champions 14 September lalu di Old Trafford. Rangers pada matchday II nanti akan menjamu Bursaspor yang tiba di Ibrox dengan membawa Dimitar Ivankov, penjaga gawang yang juga pencetak gol Eropa. Kiper Bulgaria berusia 34 tahun itu tidak saja mampu

menghentikan tendangan penalti, tetapi juga mencetak gol ke gawang lawannya. Hebatnya lagi, dia sudah melakukannya sebanyak 43 kali sepanjang karirnya. “Saya berdoa kami akan memenangi penalti Rabu. Saya akan melayang menangkap bola seperti biasanya. Mencetak gol dalam pertandingan Liga Champions merupakan ambisi besar yang belum saya lakukan,” tekad Ivankov. “Saya tidak perduli sebanyak 50.000 pendukung fanatik Rangers akan mencemooh saya bila saya gagal. Mereka boleh

HEAD-TO-HEAD VALENCIA VS MAN UNITED 20/02/01 LC 14/02/01 LC 21/03/00 LC 08/12/99 LC 29/09/82 UEFA 15/09/82 UEFA

Man United Valencia Valencia Man United Valencia Man United

berteriak sesuka hati mereka,” ujarnya lagi. Kepada News of the World, dia sebelumnya telah mengatakan; “Penyandang rekor dunia adalah Rogerio Ceni dari Sao Paulo. Dia memiliki 90 gol dan hanya 36 melalui penalti. Lebih

1 0 0 3 2 0

Valencia Man United Man United Valencia Man United Valencia

1 0 0 0 1 0

dari 50 melalui titik tendangan bebas.” “Saya terbaik dengan 43 gol, semuanya melalui titik penalti. Itu membuat saya sebagai kiper terhebat dalam sejarah sepakbola Eropa,” katanya menambahkan. (h01/ant/rtr/now)

MATCHDAY II LIGA CHAMPIONS MALAM INI Grup A Inter Milan (Italia) v Werder Bremen (Jerman) Tottenham Hotspur (Inggris) v Twente (Belanda) Grup B Hapoel Tel Aviv (Israel) v Lyon (Prancis) FC Schalke 04 (Jerman) v Benfica (Portugal) Grup C Glasgow Rangers (Skotlandia) v Bursaspor (Turki) Valencia (Spanyol) v Manchester United (Inggris) *RCTI Live mulai pkl 01.45 WIB Grup D Rubin Kazan (Rusia) v Barcelona (Spanyol) Panathinaikos (Yunani) v Copenhagen (Denmark)

Harapan Gol Raul


masalah tersebut sebagai standar prosedur sebagaimana dikatakanWakil Presiden Eksekutif Bidang Komunikasi MLS, Dan Courtemanche. Tahun lalu, Beckham didenda 1.000 dolar AS karena memberi isyarat pada seorang suporter yang menghinanya dari tribun. Fans Galaxy marah karena Beckham, pemain dengan bayaran tertinggi MLS (6,5 juta dolar AS), absen dalam 17 pertandingan pertama musim kompetisi MLS agar bisa bermain bagi AC Milan. Pekan lalu, Beckham mengajukan gugatan hukum melawan satu mingguan selebriti

di AS yang menyiarkan dugaan bahwa dirinya tidur dengan pelacur. Gugatan tersebut diajukan ke pengadilan Los Angeles dan menuduh majalah tersebut terlibat fitnah yang mengakibatkan gangguan emosi. Gugatan itu juga menyebut nama seorang perempuan berusia 26 tahun, Irma Nici, yang mendaftarkan dirinya dalam lamannya sebagai “gadis panggilan paling dicari di dunia”. Nici diduga tidur dengan Beckham beberapa kali, termasuk di sebuah hotel di New York tidak lama setelah bergabung dengan Galaxy pada 2007. (m33/ant/afp)

BERLIN ( Waspada): FC Schalke 04 sangat membutuhkan kemenangan kandang atas SC Benfica pada matchday II Grup B Liga Champions dinihari WIB nanti. Hanya tambahan tiga poin yang bisa membantu mereka kembali ke jalurnya musim ini setelah kekalahan atas Olympique Lyon pada matchday I. Tuntutan The Royal Blues sejalan dengan harapan striker veteran Spanyol Raul Gonzalez untuk terus mencetak gol. Raul mencetak gol pertamanya pasca menanti selama 599 menit saat Schalke ditahan 2-2 oleh Moen-

chengladbach dan dia ingin menambahnya saat menjamu Benfica. “Saya sangat menginginkan gol pertama itu dan saya lega saya berhasil,” tekad mantan Pangeran Bernabeu itu, yang keluar dari Real Madrid saat libur musim kompetisi. Pelatih Felix Magath telah membangun kekuatan timnya di seputar bomber berusia 33 tahun itu. Magath berharap Raul kembali pada habitatnya seperti saat menghasilkan 228 gol bagi El Real dalam 550 laga liga dan 66 gol di Liga Champions. “Sekarang lebih mudah bagi


Striker Villarreal Giuseppe Rossi (kiri) bergaya merayakan golnya ke gawang Malaga dengan rekan setimnya Borja Varelo di La Rosaleda Stadium, Selasa (28/9) pagi WIB.

Valencia Villarreal Barcelona Real Madrid Atl Madrid Espanyol Sevilla Hercules Ath Bilbao Getafe Mallorca Malaga Almeria Osasuna Santander Sociedad S Gijon Levante Deportivo Zaragoza

5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5

4 4 4 3 3 3 2 2 2 2 2 2 1 1 1 1 1 1 0 0

1 0 0 2 1 0 2 1 1 1 1 0 2 1 1 1 1 1 3 2

0 1 1 0 1 2 1 2 2 2 2 3 2 3 3 3 3 3 2 3

9- 3 10-4 9- 4 6- 1 9- 4 5- 8 7- 5 5- 3 8- 7 8- 8 4- 5 11-11 4- 4 3- 5 3- 6 5- 9 4- 9 4-10 2- 5 3- 8

13 12 12 11 10 9 8 7 7 7 7 6 5 4 4 4 4 4 3 2

Villarreal Balikkan Keadaan membalasnya menit 21 dengan menyarangkan gol pertama dari dua golnya di Malaga. Striker Italia Giuseppe Rossi membuat Villarreal berbalik memimpin menit 24, sebelum striker asal Venezuela Salomon Rondon kembali menyamakan kedudukan bagi Malaga menit 30.

Cazorla memperbaiki keunggulan Yellow Submarines menit 33 untuk menyudahi banjir gol babak pertama. Drama belum berakhir kendati winger asal Portugal Eliseu diusir dari lapangan sebelum turun minum, namun tidak ada lagi gol yang tercipta hingga bubaran laga. (h01/ant/afp)

Raul Gonzalez ingin terus mencetak gol bagi Schalke. saya,” tambah Raul, seperti dilansir Reuters, Selasa (28/9). Ketika terakhir bermain pada babak grup Liga Champions tiga tahun lalu, Schalke gagal mencetak gol dalam dua laga kandangnya. Namun Benfica pun belum pernah menang di Jerman dalam

17 kali pertandingan. Hanya saja mereka membuka aksinya denganmengalahkanHapoelTelAviv FC dua pekan lalu di Lisbon. Benfica telah memainkan 32 laga melawan tim Bundesliga, tetapi belum pernah menang di Jerman. Catatan mereka diwarnai enam hasil imbang dan


11 kekalahan. Tim asuhan Jorge Jesus itu sekarang berada di tempat kelima Superliga Portugal dengan sembilan poin dari enam pertandingan, namun sudah sembilan poin di bawah pemimpin klasemen FC Porto. (h01/ant/ afp/uefa)

Messi Masuk

Klasemen La Liga

MADRID (Waspada):Villarreal naik ke urutan dua klasemen La Liga Primera pasca menang 3-2 atas Malaga dalam duel yang seluruh golnya tercipta pada babak pertama. Tempur di La Rosaleda Stadium,Malaga,Senin(SelasaWIB), Villarreal tertinggal menit keempat lewat gol Eliseu. Santi Cazorla


Michael Owen dan Dimitar Berbatov jadi andalan MU di Mestalla.

Lionel Messi dan David Villa berduet lagi.


MOSKOW ( Waspadas): Barcelona akan menurunkan Lionel Messi dalam laga Liga Champions melawan Rubin Kazan, kendati superstar Argentina itu sedang cedera pergelangan kaki. Pemain terbaik dunia itu masuk dalam daftar 19 anggota tim bersama tandemnya David Villa untuk laga tandang ke Rusia pada matchday II Grup D dinihari WIB nanti. Messi menjadi senjata simpanan, sebab El Barca sangat mewaspadai Rubin Kazan yang meraih kemenangan 2-1 di Nou Camp dalam debutnya di kompetisi itu musim lalu. Leg kedua waktu itu berakhir dengan hasil buntu 0-0. “Rubin mengejutkan kami di kandang musim lalu dan itu

sangat mempengaruhi grup ini,” beber Direktur Olahraga Barca Andoni Zubizarreta, seperti diberitakan AFP, Selasa (28/9). “Kondisi cuaca dan sulitnya persaingan menjadi tugas yang sangat rumit ketika kami pergi ke Kazan. Tapi musim ini kami pergi setelah memainkan laga pertama berarti iklim akan lebih menguntungkan,” ucapnya lagi. Rubin Kazan, juara Rusia, memasuki arena setelah meraih kemenangan 1-0 atas Alania Vladikavkaz untuk mempertahankan persaingan meraih gelar. Pasca menderita kekalahan 0-1 dalam laga pembuka Liga Champions di Kopenhagen, Kazan tentu akan berusaha menampilkan kembali semangat kemenangan tahun lalu di Bar-

celona. Ketika itu Alexander Ryazantsev dan Gokdeniz Karadeniz menjadi pencetak gol, kenangan serupa pun bisa saja berulang lagi. “Kami semua dalam suasana percaya diri menjelang pertandingan dengan Barcelona. Kami memenangi laga terakhir di liga domestik dan masih dalam persaingan merebut gelar,” ujar Ryazantsev. “Laga yang akan datang sangat berbeda. Kami dan Barcelona sangat berbeda tahun ini. Tetapi saya harap dujel masih akan menarik,” katanya menambahkan. Pertandingan lainnya di Grup D mempertemukan raksasa Yunani Panathinaikos dengan duta Denmark FC Copenhagen. (h01/ant/afp)


WASPADA Rabu 29 September 2010


Rp2 Juta Tiket Indonesia Vs Uruguay JAKARTA (Waspada): Harga tiket pertandingan persahabatan antara timnas Indonesia melawan timnas Uruguay di Stadion Utama Gelora Bung Karno Jakarta pada 8 Oktober mendatang, menembus angka Rp2 juta. Ketua Panitia Pelaksana (Panpel) pertandingan Joko Driyono di Jakarta, Selasa (28/ 9) mengatakan, penentuan harga tiket itu berdasarkan beberapa pertimbangan terutama masalah komersial. “Salah satu pertimbangannya adalah calon lawan timnas adalah semifinalis Piala Dunia 2010 dan pertandingan ini tergolong special event,” katanya.

Menurut dia, harga Rp2 juta merupakan harga tertinggi dari harga tiket yang akan dijual. Secara umum, harga tiket mulai kelas ekonomi hingga VVIP antara Rp75 ribu hingga Rp2 juta. Adapun jumlah tiket yang akan dicetak untuk pertandingan internasional terbesar tahun ini, kata dia, kurang lebih antara 60-70 ribu tiket dari total kapasitas Gelora Bung Karno

yaitu 80 tempat duduk. “Kami akan memberikan kenyamanan bagi penonton selama pertandingan berlangsung. Jadi semuanya harus dilakukan dengan maksimal,” kata pria yang juga CEO PT Liga Indonesia itu. Ia menjelaskan khusus untuk sistem penjualan tiket pihak LOC atau panpel akan menerapkan dua mekanisme, yaitu sistem online dan manual atau datang langsung sebelum pertandingan. “Pada Senin (4/10), kemungkinan besar tiket online sudah mulai dibuka. Namun, untuk siapa yang akan mengelola

hingga saat ini belum ditetapkan,” katanya. Ditanya masalah keamanan, pria asal Ngawi mengaku telah melakukan koordinasi dengan aparat keamanan. Standar pengamanan pertandingan sama dengan saat menggelar pertandian Pra Piala Asia saat melawan Australia. Untuk kedatangan timnas Uruguay, Joko menjelasakan diperkirakan 6 Oktober nanti melalui Bandara Soekarno Hatta Cengkareng. Kedatangan timnas diperkirakan 5-10 kloter karena pemain tidak datang bersamaan dari Uruguay. (m33/ant)

Kebersamaan Kunci Sukses Inkanas Sumut MEDAN (Waspada): Kebersamaan merupakan kunci keberhasilan Institut Karate-Do Nasional (Inkanas) Sumut dalam membesarkan perguruan sekaligus melahirkan atlet-atlet handal dan berprestasi baik di tingkat daerah, nasional dan internasional. “Segala tantangan akan dapat kita lalui jika dilakukan bersama-sama antara pengurus, dewan guru, para sabuk hitam dan atlet,” ujar Ketua Umum Pengda Inkanas Sumut Ir H Umar Zunaidi Hasibuan MM pada acara halal bihalal keluarga

besar Inkanas Sumut di Hotel Garuda Citra Medan, Selasa (28/ 9) malam. Dikatakan, Inkanas Sumut juga merangkul semua kalangan baik TNI, Polri, instansi pemerintah dan swasta dan lainnya untuk mendukung kemajuan pembinaan. “Kegiatan halal bihalal kali ini juga bertujuan meningkatkan kebersamaan, dimana seluruh pengurus cabang dan dojo di daerah turut hadir,” jelasnya. Dikatakan, wujud dari membangun kebersamaan itu telah menghantarkan banyak kara-

teka Inkanas Sumut menorehkan berbagai prestasi gemilang baik di tingkat daerah dan nasional. “Bahkan dua karateka Inkanas Sumut yakni Jintar Simanjuntak dan TantriWidyasari saat ini menjadi andalan Indonesia untuk menghadapi Asian Games 2010,” tambahnya. Lebih lanjut Umar mengatakan, untuk mempertahankan tradisi menyumbangkan atlet pada SEA Games dan Asian Games, kita terus melakukan kaderisasi secara berjenjang dan berkesinambungan.

Waspada/Dedi Riono

Shensei H Hadismar didampingi Shensei Saleh Malawat dan Surya Fajar menyerahkan bantuan kepada keluarga (alm) pendiri Inakanas Sumut Sheinse Baginda Sitorus di sela acara halal bihalal keluarga besar Inkanas Sumut di Hotel Garuda Citra, Selasa (28/9).

“Saat ini kita telah memiliki atlet junior yang telah mengukir prestasi gemilang di tingkat nasional dan internasional seperti Takashi Hadi, Tifani Hadi dan M Rizki,” jelasnya. Acara halal bihalal sekaligus penyerahan bantuan kepada keluarga (alm) pendiri Inkanas Sumut Shensei Baginda Sitorus dan pelepasan dua insan Inkanas Sumut menunaikan ibadah haji, yakni Shensei Saleh Malawat dan Zainal Ardi turut dihadiri Kapolda Sumut diwakili Dansat Brimobdasu KombesVerdianto Biticaca. Dalam sambutan tertulisnya dibacakan Dansat Brimobdasu, Kapoldasu Irjen Pol Oegroseno berharap insan karate Inkanas Sumut ikut membantu meningkatkan Kamtibnas. Harapan Kapoldasu itu disambut baik Ketua Umum Inkanas Sumut, di mana pihaknya akan menginstruksikan kepada seluruh atlet menjaga ketertiban di daerahnya masing-masing. “Jika dibutuhkan kita juga siap memberi bantuan atletatlet kita untuk meningkatkan Kamtibnas di Sumut,” tambah Umar. Acara juga dihadiri salah satu pendiri Perguruan Inkanas DR H R Willem Waas, Ketua Bidang Organisasi Ir M Tobrani, Sekretaris Jhoni Hasman, Kabid Binpres Inakanas Sumut Shensei H Hadismas M Noer, Shensei Surya Fajar (Lacu), Ketua MSH Sutrisno, anggota MSH Djoko Surojo, para sabuk hitam dan atlet lainnya. (m42)

Futsal Dari Bisnis Menuju Prestasi PON XVIII CABANG olahraga futsal akhir tahun 1990-an diperkenalkan di Indonesia. Usianya pun dikatakan relatif muda dibandingkan sepakbola yang merupakan favorit. Uniknya, futsal belakangan ini lebih favorit ketimbang abangnya (sepakbola-red). Animo masyarakat bermain futsal cukup tinggi yang difasilitasi lapangan bak jamur yang tumbuh di musim hujan. Dari sisi lapangan, futsal sudah unggul dari lapangan sepakbola yang nyaris “punah”. Di Medan, diperkirakan setiap kecamatan memiliki lima lapangan futsal. Sebaliknya, sulit mencari lapangan sepakbola di setiap kecamatan. Mengapa pembangunan lapangan futsal lebih cepat? Jawabnya futsal saat ini merupakan bisnis yang menggiurkan. Pihak investor membangun lapangan futsal untuk mengeruk keuntungan dengan membelakangkan pembinaan. Terbukti dari menjamurnya lapangan futsal di Medan dan Sumatera Utara, umumnya belum ada yang berstandar nasional dan internasional. Pemilik lapangan futsal mendapat pemasukkan sekitar Rp28,8 juta setiap bulannya. Itu masih satu lapangan futsal dengan hitungan per jam Rp80 ribu dikali 12 jam dan dikali 30 hari. Ini masih pemasukkan minimal, bahkan ada yang memperoleh pemasukkan ratusan juta setiap bulannya. Hadirnya lapangan futsal memiliki nilai positif sesuai kaidah pentingnya berolahraga, yakni di dalam tubuh yang sehat terdapat jiwa yang sehat. Masyarakat giat berolahraga dan remaja dapat menghindari dari penyalahgunaan narkoba. Bagaimana dengan pembinaan? Apakah futsal merupakan olahraga hiburan dalam arti sekadar “mencari keringat”? Futsal akan dipertandingan di PON XVIII/2012 di Riau. Sebelumnya, futsal akan dipertandingkan di SEA Games XXVI/ 2011 di mana Indonesia menjadi tuan rumah. Masuknya futsal di pentas multi event parhelatan akbar negara Asia Tenggara

dan pesta olahraga nasional ini memberikan nilai tersendiri, bahwa futsal bukan hanya sekadar bisnis. Tugas berat kembali di tangan PSSI yang masih membawahi cabang futsal. PSSI sendiri masih memiliki tugas berat memajukan persepakbolaan di tanah air kering akan prestasi. Di satu sisi PSSI diharapkan dapat menjuarai SEA Games 2011 dan membenahi kompetisi nasional dengan kehadiran Liga Primer Indonesia (LPI). Mana yang dikedepankan? Tentunya keduanya dapat bergandeng tangan dalam memajukan prestasi olahraga. Hadirnya Badan Futsal Nasional (BFN) dan Badan Futsal Daerah (BFD) di provinsi merupakan jawaban untuk pembinaan futsal lebih baik. Pasalnya, provinsi saat ini masih kebingungan menggelar kompetisi dalam rangkaian mencari bibit pemain futsal. Tidak heran apabila pemain futsal yang menjadi andalan di provinsi merupakan mantan pemain sepakbola yang tidak lagi memperkuat klub sepakbola Liga Indonesia. Seperti Kejurnas Kit Futsalismo yang berakhir Minggu (26/9) lalu di Medan, rata-rata pemain kelompok umum adalah pemain sepakbola yang tidak dipakai lagi oleh klub Liga Indonesia seperti PSMS, PSDS dan Madina Medan Jaya. Padahal futsal berbeda dari sepakbola walaupun samasama “menendang bola”. Peraturan permainan sangat jauh berbeda dibandingkan sepakbola, sehingga sering terlihat masih banyak pemain futsal melakukan kesalahan walaupun pertandingan bersifat kejuaraan nasional. Ini hendaknya menjadi pekerjaan rumah bagi BFD melakukan sosialisasi peraturan pertandingan ke tengah-tengah masyarakat. Sosialisasi ini sangat penting. Selanjutnya, menggelar kompetisi antar daerah atau Pengcab BFD se-Sumatera Utara. Ini merupakan langkah awal yang harus dilaksanakan dalam persiapan menghadapi PON XVIII. #Setia Budi Siregar

Problem Catur


Hitam melangkah, mematikan lawannya tujuh langkah.

Jawaban di halaman A2.


Waspada/Yuslan Kisra

Jajaran pelatih, manajemen serta pemain SM BRItama yang akan tampil di ABL diperkenalkan kepada wartawan di Jakarta, Selasa (28/9).

Wajah Baru, SM Optimis Tatap ABL JAKARTA (Waspada): Upaya keras mendatangkan lima pemain asing yang membuahkan hasil membuat jajaran pelatih Satria Muda BRItama optimistis menatap kompetisi ASEAN Basketball League (ABL) 2010/ 2011. Tidak hanya itu, satu-satunya wakil Idonesia di kompetisi bola basket paling bergengsi di kawasan Asia Tenggara ini bahkan menargetkan menjadi juara. Maklum saja, karena lima pemain impor anyar yang didatangkan berkualitas lebih dari cukup. Belum lagi dengan kehadiran pemain lokal terbaik nasional, yakni point guard Mario Wuysang serta pemain muda berbakat yang musim lalu lebih banyak duduk di bangku cadangan, Abdul Fattah Arifin, plus lima pemain wajah baru, yakni Ryan Febrian, Doni Ristanto, Erick Yusti, Mochammad ‘Bicek’ Firmansyah dan Rayly Pratama. Ryan diambil dari Muba Hangtuah Indonesia Muda Sumatra Selatan, Doni Ristanto sebelumnya memperkuat CLS Knight Surabaya, Erick Yusti terakhir bermain untuk Citra Satria Jakarta, sedangkan Rayly

adalah pemain junior SM dan Bicek sebelumnya bermain di level Kobatama. Sementara itu, nama-nama yang membawa SM menjadi runner-up ABL musim lalu seperti Faisal J Ahmad, Rony Gunawan, Amin Prihantono, Youbel Sondakh dan Christian Ronaldo Sitepu sudah tidak memperkuat tim lagi. Dikatakan, Faisal cs diarahkan berkonsentrasi di kompetisi National Basketball League (NBL) Indonesia demi target mempertahankan gelar. Perubahan signifikan juga terjadi di barisan pemain asing. Sebab tidak ada lagi nama Nakiea Miller dan Alexander Gordon Hartman, dua pemain impor asal Amerika Serikat yang menjadi andalan musim lalu. Sebagai gantinya, jajaran pelatih SM Britama menggunakan jasa Jamal Holden dan Marcus Morrison. Jika musim sebelumnya ada satu satu pemain Asia Tenggara di awal musim, kali ini SM Britama menggunakan kuota maksimal tiga pemain. Francis ‘Kiko’ Adriano, Celedon Camaso, dan Ronald Capati adalah tiga pemain asal Filipina yang memperkuat wakil Indonesia di

Jessy Lolos Babak Kedua JAKARTA (Waspada ): Unggulan kedua asal Indonesia, Jessy Rompies, lolos ke babak kedua Turnamen Sportama International ITF Women’s Circuit berhadiah Rp100 juta setelah menang 6-0, 6-2 atas petenis kualifikasi Devi Hasan di lapangan tenis Elite Club Epicentrum, Kuningan, Jakarta, Selasa (28/9). Kemenangan telak Jessy memang telah diperkirakan sebelumnya, karena perbedaan kelas kedua pemain. Di babak kedua, Jessy yang berperingkat dunia 449 dunia akan ditantang rekan senegaranya, Beatrice Gumulya (901 dunia), pada Kamis (30/9). Menghadapi Beatrice di babak kedua, Jessy menyatakan akan tampil sebaik mungkin, terlebih karena merupakan ajang pemanasan sebelum terjun ke Asian Games di Guangzhou, 12-27 November mendatang. Dua pemain unggulan lainnya, Sandy Gumulya (Indonesia/3) dan Pliphuech Peangthan (Thailand/5) juga lolos ke babak kedua dengan kemenangan

mudah. Sandy, peringkat 590 dunia, menang telak 6-0, 6-0 atas petenis China Zhou Ya dan Pliphuech (773) unggul 6-4, 61 atas Cynthia Melita (926). “Saat ini saya kelas tiga SMA di Salatiga sehingga harus lebih banyak belajar untuk keperluan sekolah dan mengurangi porsi latihan,” tutur Cynthia yang kini duduk di kelas 3 SMA di Salatiga, Jawa Tengah. Pada pertandingan lainnya, Huang Hui-I dari Taiwan menang 7-5, 6-0 atas Wakui Maya (Jepang). Kemenangan serupa dibukukan petenis kualifikasi dari Taiwan, Lee Hua-Chen, yang mengungguli Chan HaoCing 6-7 (4), 6-2, 6-2. Di babak kedua, Huang menghadapi unggulan kelima Pliphuech dan Lee Hua-Chen bertemu Sandy Gumulya. Di nomor ganda, unggulan pertama Ayu Fani Damayanti/ Jessy Rompies menang atas Bella Destriana/Cynthia Melita 6-3-6-0. Sepanjang pertandingan, Ayu/Jessy tampil solid dan mengandalkan bola-bola cepat. (yuslan)

Mendatar 3. Tumor bertangkai di dalam hidung. 4. (Tulis kepanjangan huruf P di kotak yang tepat pada No. 3, 7 dan 11). Gejala awal Diabetes Melitus adalah 3 P, yakni Polifagi (banyak makan), Polidipsi (banyak minum) dan Poliuri (banyak kencing). 7. Lihat pertanyaan no. 4. 11. Tulis pertanyaan no. 4. 12. Buah berserat, berduri dan kulitnya bersusun sisik, mengandung vitamin A dan C. 13. Tulis dalam bilangan: 1/3 (Menurut hadis, perut diisi 1/3 untuk makan, 1/3 untuk minum dan 1/3 kosong). 16. Mahluk hidup terkecil dapat mendatangkan penyakit (tombol lift mengandung mahluk tersebut, diketahui 40 kali lebih kotor di banding toilet). 17. Nama virus tipe B-14 yang merusak sel penghasil insulin di pankreas (Pilih: Coxsackie, Foxsackie atau Foxsakkit) 19. Menggertakkan atau membunyikan gigi saat tidur disebut (Pilih: Traksisme, Bruksisme, atau Preksisme) dapat diperiksakan ke dokter gigi. 22. Sulit tidur (kata asing populer), antara lain akibat stres, kafein dan terlalu banyak makan di malam hari.

Menurun 1. Penyakit menurunnya kesehatan jaringan otak sehingga menurunkan daya ingat dan kemampuan mental. 2. Sesuatu hanya dalam anganangan; Khayalan. 3. Radang zat kelabu sumsum tulang belakang akibat virus, umumnya melumpuhkan anakanak. 5. Fakultas Kedokteran Universitas Indonesia. 6. Obat sakit kepala, pilek dan demam berupa puyer atau tablet. 8. Kata biasa dipakai dokter THT kepada pasien agar mengangkat kepala/melihat ke atas guna memeriksa rongga hidung atau mulut. 9. Organ tubuh yang berguna untuk mengontrol kadar gula darah. 10. Hormon yang dilepas oleh pankreas, yang berfungsi mempertahankan kadar gula darah yang tepat. 11. Penyakit menular dari kutu-kutu tikus. 14. Puru sembilik; Wasir. 15. Obat meredakan sakit kepala, demam dan flu, sering diiklankan. 18. Radang jaringan tubuh, menjadi rongga tempat nanah mengumpul. 20. Minus (pada kacamata). 21. Singkatan tablet.

kompetisi basket Asia Tenggara ini. Selain merombak pemain, SM menggunakan pelatih baru yaitu Octaviarro Romely Tamtelahitu. Pelatih yang biasa dipanggil Ocky ini sebelumnya sukses membawa Muba Hangtuah menjuarai Kobatama 2007 dan asisten pelatih Fictor Gideon Roring di kompetisi lokal IBL dan ABL. Ito, panggilan Fictor, hanya menangani tim NBL. “Semua pemain pemain yang kami rekrut musim ini baik itu asing maupun lokal sesuai permintaan Ocky sebagai head coach.Tentunya juga disesuaikan dengan budget keuangan tim,” kata Ito yang juga GM Basketball Operational SM Britama dalam

keterangan persnya di Jakarta, Selasa (28/9). Ditambahkan, sesuai regulasi yang berlaku di ABL, dua pemain asing non-AsiaTenggara harus dibayar paling tinggi 10 ribu dolar AS per bulan dan pemain asing Asia Tenggara di bawahnya yang merupakan salary cap bagi pebasket ABL. Tentang pelatih, Ito mengaku Ocky memang kandidat utama SM di ABL. Selain mengetahui karakter tim, Ocky dinilai memiliki konsep melatih yang sama dengan Ito. Karena itu, ia pun menempatkan pelatih berdarah Ambon ini pada daftar teratas pelatih yang akan direkomendasikan ke manajemen. (yuslan)

Putra Indonesia Jadi Runner-up BANGKOK (Antara): Tim voli putra junior Indonesia menempati posisi runner-up pada Kejuaraan Voli ASEAN di Ratchaburi Gym, Ratchaburi, Thailand, setelah ditundukkan Thailand 1-3 (26-24, 17-25, 20-25, 19-25), Selasa (28/9). Padahal, di empat laga sebelumnya, tim “Merah Putih” tampil sempurna dengan rekor kemenangan atas Vietnam, Australia, Malaysia dan Myanmar. Namun, tidak jauh berbeda, Thailand juga mengoleksi empat kemenangan serupa atas lawannya. Sayangnya, penampilan menawan Indonesia di laga-laga sebelumnya tidak muncul saat menghadapi Thailand. Di samping tuan rumah mendapat dukungan penuh dari penonton yang memadati GOR, para pemain Indonesia juga banyak melakukan kesalahan sendiri. Kejuaraan Voli ASEAN ini berlangsung pada 24-28 September. Setelah tampil di Bangkok, tim voli putra Indonesia akan kembali berlaga di Kejuaraan Asia yang digelar di Nakhonpathom dan Ratchaburi, 1-9 Oktober mendatang.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sedang (***), bisa diselesaikan dalam waktu kurang dari sepuluh menit. Jawabannya lihat di halaman A2 kolom 1.

6 4 1 5 9

9 9 5

3 7

4 5 9 1 3 7 4 8 6 9 8 7 2

7 3 5 2

5 3 7

8 6 3



WASPADA Rabu 29 September 2010

Langkat Sukses Bendung PSMS STABAT (Waspada): PSMS Medan gagal meraih poin sempurna di laga kedua Turnamen Ngogesa Sitepu Cup I, Selasa (28/9). Kepastian itu didapat setelah tuan rumah PS Langkat Selection berhasil menahan laju Ayam Kinantan 0-0 dalam laga yang berlangsung di Stadion Alun-Alun Stabat. Pada laga tersebut, PSMS tampil dengan line up yang sedikit berbeda dari sebelumnya. Kali ini, duet Gaston Castano dan Kurniawan Dwi Yulianto menghiasi lini depan dengan dukungan gelandang asal Argentina, Jose Sebastian. Sejak awal, PSMS pun langsung menggebrak. Beberapa peluang emas tercipta di antaranya lewat Gaston, namun tendangan eks striker Persiba Balikpapan itu terlalu lemah dan diantisipasi kiper lawan. Tendangan bebas menyusur tanah Vagner Luiz juga gagal berbuah gol. Peluang emas kembali tercipta lewat

kerjasama Gaston dan Zulkarnaen, namun tendangan Gaston masih menyamping. Di babak kedua, PSMS melakukan beberapa pergantian. M Affan Lubis menggantikan peran Jose Sebastian sebagai kreator serangan. Dominasi PSMS pun terus berlanjut di mana berkali-kali Gaston dan Kurniawan mengancam gawang Langkat. Sayangnya, pertahanan ketat tuan rumah menjadi tembok kokoh yang sulit ditembus. Begitu pula, penetrasi Kurniawan yang memberikan umpan matang kepada Gaston gagal dimaksimalkan kekasih aktris Julia Perez itu. Tendangan bebas Affan Lubis juga mampu diantisipasi kiper Langkat, Hermansyah. Masuknya Rinaldo menggantikan Gaston juga tidak banyak berpengaruh. “Dengan permainan kita seperti ini, hasil seri saja sudah bagus,” ujar Pelatih PSMS, Zulkarnain Pasaribu, menam-

bahkan penampilan Gaston dan Jose Sebastian dinilai jauh dari performa maksimal. “Kita sangat buruk dalam finishing. Pemain asing kita tidak bermain seratus persen. Padahal sepanjang pertandingan kita terus menyerang,” tambah Asisten Pelatih PSMS, Suyono. Bagi tuan rumah, keberhasilan ini melanjutkan sukses sebelumnya saat menahan imbang PSDS di laga perdana. “Kita memang instruksikan bertahan untuk menahan PSMS. Saya puas dengan hasil ini,” ujar Pelatih Langkat Selection, Sudarmanto. Penentuan juara turnamen akan ditentukan saat PSMS menghadapi tetangganya, PSDS Deli Serdang , Kamis (30/9) besok. Untuk menjadi kampiun, PSMS harus menang atas tim sesama Divisi Utama itu. Sebelumnya, PSDS menang tipis 32 atas PS Madina Medan Jaya. (m33)

Kadis Pertamanan Medan Resahkan Masyarakat Sepakbola MEDAN (Waspada): Publik sepakbola khususnya penggemar PSMS Medan menyesalkan sikap Kepala Dinas Pertamanan Medan, karena secara arogan telah membangun taman-taman di lokasi parkir StadionTeladan Medan. Ditemui secara terpisah di Medan, Selasa (28/9), mereka terkejut dengan banyaknya bangunan taman-taman di lokasi parkir di stadion yang dibangun pada 1953 itu. Sebelumnya, pihak Dinas Pertamanan Medan juga telah merusak lahan parkir persis di depan stadion. “Bagi kami, masyarakat akan berpikir dua kali untuk datang ke Teladan bila tempat parkir sulit ditemukan,” ujar seorang

penggemar tersebut. Kaum pemerhati sepakbola Medan pun berharap Walikota Medan Rahudman Harahap meninjau lagi sikap Kadis Pertamanan Medan dan membuka kembali lahan parkir di areal Stadion Teladan. “Beginilah kalau seorang pejabat yang kurang mendukung berkembangnya olahraga di daerahnya, akan selalu tidak mendukung program-program pemerintah khususnya di bidang olahraga,” keluh para penggemar. Sementara itu, kalangan pengurus PSMS sendiri heran atas sikap Kadis Pertamanan Medan. Mereka juga nantinya akan menyuratiWalikota Medan tentang

bangunan-bangunan di areal parkir Stadion Teladan. “PSMSpastiakanmengalami kerugian besar seandainya di setiap pertandingan kompetisi nanti tanpa dikunjungi penonton, hanya gara-gara sulitnya mencari tempat parkir kendaraannya,” ujar Sekretaris Umum PSMS, Idris SE. “Kan masih banyak yang perlu dipikirkan oleh Kadis Pertamanan seperti lampu-lampu penerangan di jalanan pinggiran kota. Masih banyak gang-gang di Medan belum memiliki lampu, padahal masyarakat setiap bulannya dikutip retribusi biaya lampu-lampu di jalan,” ketus warga Medan lainnya. (m24)

Tim golf Amerika Serikat bertekad merebut kembali Ryder Cup dari tangan Eropa di Celtic Manor, Newport, Wales, mulai Rabu (29/9) ini. -Reuters-

Tanpa Kejutan Di Latihan Pertama Ryder Cup NEWPORT, Wales ( Waspada): Hari pembuka latihan persiapan tim golf Amerika Serikat (AS) dan Eropa menghadapi Ryder Cup di Celtic Manor, Wales, Selasa (28/9), belum menghadirkan kejutan. Pada Rabu (29/9) ini, Tiger Woods akan membuka pertarungan dengan berpasangan dengan Steve Stricker. Bersama Stricker, Tiger memenangan seluruh empat pertandingan

dalam Presidents Cup tahun lalu. Nantinya, Tiger dan Stricker juga didampingi Hunter Mahan dan Zach Johnson. Setelah itu, tim Eropa akan mengandalkan Franceso dan Edoardo Molinari dari Italia bersama duet Irlandia Utara Graeme McDowell dan Rory McIlroy. Grup kedua tim Eropa menampilkan Lee Westwood, Martin Kaymer, Peter Hanson dan Miguel Angel Jimenez diikuti

Ian Poulter, Ross Fisher, Luke Donald dan Padraig Harrington. Sebaliknya, grup kedua tim AS akan diperkuat Stewart Cink, Matt Kuchar, Jim Furyk dan Jeff Overton dilanjutkan penampilan Phil Mickelson, Dustin Johnson, Bubba Watson dan Rickie Fowler. Tim AS akan dipimpin Corey Pavin selaku kapten, sedangkan kapten Eropa adalah Colin Montgomerie. (m33/ap)

Waspada/Khairil Umri Batubara

Striker PSMS, Gaston Castano (hijau), berusaha memperdayai dua pemain bertahan Langkat Selection dalam pertandingan Turnamen Ngogesa Sitepu Cup I di Stadion Alun-Alun Stabat, Selasa (28/9).

Petenis Cantik Berbeda Nasib TOKYO (Waspada): Victoria Azarenka (foto) melaju ke putaran kedua Turnamen Pan Pacific Terbuka usai mengungguli Lucie Safarova (Rep Ceko) dalam laga tunggal pertamanya pasca pingsan di AS Terbuka, Selasa (28/9). Unggulan delapan asal Belarus yang mendapat bye pada putaran pertama itu, terlalu kuat bagi Safarova dan meraih kemenangan 6-1, 6-3. Azarenka, peringkat 11 dunia, tidak menunjukkan tanda-tanda sakit saat melawan Safarova. Di AS Terbuka lalu, Azarenka mendapat perawatan medis selama beberapa menit di Flushing Meadows sebelum dibawa dengan kursi roda ke rumah sakit untuk diperiksa. “Kadang-kadang sesuatu terjadi sayangnya dengan cara seperti ini,” kata Azarenka mengenai tersungkurnya di pertandingan putaran kedua AS Terbuka dari Gisela Dulko (Argentina). “Saya tidak bisa memandang ke belakang. Saya berusaha untuk melupakan itu semampunya, tetapi orang masih mengingat. Bagi saya, penting untuk maju ke depan,” tambah Azarenkan yang akan menghadapi Marion Bartoli. Bartoli sendiri lolos setelah mengalahkan petenis cantik asal Serbia, Ana Ivanovic. Unggulan


ke-11 dari Prancis itu dengan mudah mencatat keunggulan 6-2, 6-1. Di laga lain, cedera memaksa petenis Slovakia Daniela Hantuchova mundur sekaligus memberi keuntungan kepada favorit tuan rumah, Kimiko Date-Krumm. Kimiko, menyingkirkan juara bertahan Maria Sharapova

di babak pertama, tengah unggul 2-6, 6-0, 4-0 sebelum Hantuchova menyerah. Alhasil, Kimiko terus membuka peluang berprestasi di kampung halamannya. Petenis Rusia Vera Zvonareva pun menang 6-3, 6-3 atas Sara Errani (Italia). Dilansir yahoosports, petenis 26 tahun

itu akan menghadapi petenis Italia lainnya, RobertaVinci. Melawan Tsvetana Pironkova (Bulgaria), Vinci menang 6-4, 6-2. Pada pertandingan lainnya, unggulan ketujuh Elena Dementieva (Rusia) mengalahkan petenis Kazakhtan Yaroslav Shvedova 6-0, 6-1. Unggulan utama asal Denmark, Caroline Woz-

niacki, melenggang tanpa hambatan ketika sukses mengakhiri perlawanan Greta Arn (Hungaria) 6-1, 6-3. Tiket babak berikutnya turut dipegang Flavia Pennetta (Italia), Kaia Kanepi (Estonia), Anastasia Pavlyuchenkova (Rusia) dan Francesca Schiavone (Italia). (m33/ap)

Sumatera Utara

WASPADA Rabu 29 September 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:20 12:33 12:21 12:28 12:27 12:24 12:21 12:16 12:23 12:23

‘Ashar 15:26 15:42 15:27 15:36 15:35 15:26 15:26 15:21 15:29 15:30

Magrib 18:24 18:37 18:25 18:32 18:31 18:28 18:25 18:20 18:27 18:27



Shubuh Syuruq


19:32 19:46 19:33 19:40 19:40 19:36 19:33 19:28 19:35 19:35

04:49 05:02 04:50 04:57 04:57 04:54 04:50 04:46 04:52 04:52

04:59 05:12 05:00 05:07 05:07 05:04 05:00 04:56 05:02 05:02

L.Seumawe 12:26 L. Pakam 12:19 Sei Rampah12:18 Meulaboh 12:30 P.Sidimpuan12:17 P. Siantar 12:28 Balige 12:18 R. Prapat 12:15 Sabang 12:33 Pandan 12:19

06:13 06:27 06:14 06:21 06:21 06:18 06:14 06:10 06:17 06:16

Zhuhur ‘Ashar 15:35 15:25 15:24 15:37 15:20 15:23 15:22 15:18 15:43 15:22





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:30 18:23 18:22 18:34 18:21 18:22 18:22 18:19 18:37 18:23

19:38 19:31 19:30 19:42 19:30 19:30 19:30 19:27 19:46 19:31

04:55 05:49 04:48 04:59 04:47 04:48 04:48 04:45 05:02 04:49

05:05 04:59 04:08 05:09 04:57 04:58 04:58 04:55 05:12 04:59

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:19 12:21 12:31 12:23 12:20 12:27 12:15 12:26 12:19 12:18

18:23 18:25 18:35 18:27 18:24 18:31 18:20 18:30 18:23 18:22

19:31 19:33 19:43 19:35 19:33 19:39 19:28 19:38 19:31 19:30

04:49 04:50 05:00 04:53 04:50 04:56 04:45 04:55 04:48 04:47

04:59 05:00 05:10 05:03 05:00 05:06 04:55 05:05 04:58 04:57

Panyabungan 12:16 Teluk Dalam12:23 Salak 12:21 Limapuluh 12:17 Parapat 12:19 GunungTua 12:16 Sibuhuan 12:16 Lhoksukon 12:25 D.Sanggul 12:19 Kotapinang 12:14 AekKanopan 12:16

06:20 06:13 06:12 06:24 06:11 06:12 06:12 06:09 06:27 06:13

15:22 15:25 15:39 15:27 15:27 15:35 15:20 15:31 15:22 15:24

06:13 06:14 06:24 06:17 06:14 06:21 06:09 06:19 06:12 06:12

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Zhuhur ‘Ashar 15:17 15:24 15:25 15:22 15:23 15:18 15:17 15:34 15:23 15:17 15:20




Shubuh Syuruq

18:20 18:27 18:25 18:21 18:23 18:20 18:20 18:29 18:24 18:18 18:20

19:28 19:35 19:33 19:29 19:31 19:28 19:28 19:38 19:32 19:26 19:28

04:46 04:53 04:51 04:46 04:48 04:46 04:45 04:55 04:49 04:44 04:45

04:56 05:03 05:01 04:56 04:58 04:56 04:55 05:05 04:59 04:54 04:55

06:10 06:17 06:15 06:10 06:12 06:10 06:09 06:19 06:13 06:08 06:09

Meski Disangka Teroris

Istri Dan Anak Ghazali Masih Diterima Masyarakat TANJUNGBALAI (Waspada): Kendati Khairul Ghazali alias Ahmad Ghazali ditangkap dengan sangkaan terorisme, namun masyarakat tetap menerima kehadiran istri dan anak-anaknya di rumah kontrakannya di Jalan Sehat, Gang Pesat, Link. VIII, Kel. Bungatanjung, Kec. Datukbandar, Kota Tanjungbalai. “Jika Kartini Panggabean dan anak-anaknya kembali menempati rumah kontrakannya, kami dengan senang hati menerimanya,” kata Lina, warga Jalan Sehat kepada Waspada, Senin (27/9). Menurut Lena, Ghazali dan istrinya Kartini, termasuk anakanaknya, merupakan warga yang baik.“Tidakpernahributataupun bertengkar dengan tetangga, bahkan selalu menyapa jika bertemuataulewatdidepanrumah,” jelas Lena. Ibu tiga anak ini juga mengungkapkan, selama ini dia sering berkunjung ke rumah Ghazali, sekedar mengobrol atau bermain bareng Kartini dan anakanaknya. “Nggak ada yang nakal anak-anaknya, dan tiap sore

mereka selalu bermain dengan anakku di depan rumah,” kata Lena. Hal sama dikatakan tetangga lainnya,Sari.MalahSarimengaku kasihan dengan kejadian yang menimpa Kartini sekeluarga. “Kami setuju jika Kartini dan anak-anaknya kembali kemari, sebab selama ini kami baik-baik saja,” ujar Sari. Kepala Lingkungan VII, Kel. Bungatanjung, mengatakan, Kartini memang pernah meminta izin untuk menempati kembali rumah yang dikontraknya itu. Pertimbangannya,kataJalaluddin, karena anak-anaknya masih sekolah. Tetapi, Jalaluddin mengaku belum bisa memberikan kepastian, sebab dia harus meminta pendapat masyarakat. “Kami harus meminta pendapat warga, jikaditerimaapasalahnyamereka kembali, dan tak ada hak kami melarangnya, apalagi keluarga Kartini memegang KTP Nasional dan kartu keluarga sah sebagai warga Kota Tanjungbalai,” jelas Jalaluddin. Lebih lanjut dikatakan Jalaluddin,sedikitnyaharusadatanda tangan 10 kepala keluarga yang menyatakan bersedia atau tidak mengenai rencana Kartini kembali ke rumah kontrakannya. “ Dalam waktu dekat ini akan kami tanya pendapat warga,” tutur

Wilayah Tangkap Nelayan Tradisional Terancam P.BRANDAN (Waspada): Presedium KNTI Region Sumatera mendesak pemerintah agar segera mengambil tindakan tegas terhadap pukat trawl yang beroperasi di wilayah perairan Langkat. Sikap tegas pemerintah sangat diperlukan untuk mengantisipasi terjadinya konflik yang lebih luas. Demikian disampaikan Presedium Kesatuan Nelayan Tradisional Indonesia (KNTI) Region Sumatera, Tajruddin HasibuankepadaWaspada,Selasa(28/9)diP.Brandanmenanggapi keresahan nelayan di Langkat terkait operasional pukat trawl di wilayah tangkap nelayan tradisional. “Pemerintah diminta merespon permasalahan ini guna menciptakan stabilitas keamanan di laut,” katanya. Terkait insiden tabrakan antara KM Sumber Rezki GT 25 No.936 asal Belawan dengan perahu nelayan tradisional yang dinakhodai Kamthing Beng dan crew, M.Nasir, Siin, danYahya, pada 17 September, menurut Tajrudin, hingga kini belum jelas penyelesaiannya. Akibat insiden ini, ujarnya, nelayan tradisional kehilangan sarana alat tangkap jaring ikan bawal sejumlah 20 kepala. KM Sumber Rezki sempat dikejar sejumlah nelayan dan pada saat itu terjadi dialog dengan kesepakatan bahwa segala kerugian yang ditimbulkan nelayan akan diganti. Tapi, lanjutnya, yang membuat nelayan kecewa, sampai pada batas waktu yang disepakati, pihak kapal pukat trawl ternyata ingkar janji. (a02)

Keluarga Kepsek SD Paluh Manis Tak Terima Penahanan Ibunya MEDAN (waspada): Pihak keluarga dari Kepala Sekolah SD 053990 Desa Paluh Manis, Kecamatan Gebang, Kabupaten Langkat, Ny Wisnawati, yang ditahan pihak Kejaksaan Pangkalanbrandan sejak 26 Juli 2010 menyatakan tidak terima perlakuan itu karena dugaan korupsi yang dituduhkan kepada ibunya itu sama sekali tidak mengandung bukti kebenaran. Mereka mengatakan kasus itu salah sasaran karena yang melakukan mark-up pembelian bahan-bahan bangunan untuk pembangunan gedung sekolah dari Dana Alokosi Khusus (DAK) pada dua panglong adalah Ketua Komite Sekolah Sapta Darma Ginting yang sampai sekarang tidak ditahan. Reni, 30, warga Stabat dalam keterangannya, Senin (27/ 9) di kantor Redaksi Waspada di Medan mengaku sangat sedih ibunya yang sudah 40 tahun mengabdi dan malah sudah banyak berbuat untuk mengembangkan pendidikan di Langkat dan juga akan memasuki masa pensiun harus mendekam dalam tahanan Kejaksaan Negeri Stabat di Pangkalanbrandan. Reni mengaku ada kejanggalan lain yang tidak bisa diterima dalam menuduh ibunya terlibat korupsi. Dia menyebutkan penahanan ibunya dikarenakan sewaktu pembangunan gedung sekolah itu ibunya selaku Kepsek tidak bersedia memenuhi permintaan pemberian dana dari pelaksana Kepala Dinas Pendidikan dan Pengajaran Stabat yang meminta bagiannya, serta juga dari pihak kejaksaan. (m23)

Waspada/Surya Efendi

PERPUSTAKAAN RUMAH SAKIT TERBAIK: Direktur RSUD Tanjungbalai,dr Hj Diah Retno menerima penghargaan sebagai pengelolaan perpustakaan rumah sakit terbaik pertama tingkat Sumut pada pembukaan Pesta Buku Sumut 2010 di gedung Perpustakaan, Arsip dan Dokumen Daerah Sumut di Jl. Sultan Makmun Al Rasyid depan Istana Maimoon Medan, Jumat (24/9). Penghargaan itu diserahkan Bupati Samosir, Mangindar Simbolon.

Jalaluddin. Sedangkan adik kandung Khairul Ghazali alias Ahmad Ghazali, Ahmad Sofyan mengatakan, saat ini Kartini dan 4 anaknya berada di tempat orang tuanya di Tebingtinggi. “Kakak iparku di tempat orangtuanya,” kata Sofyan. Menurut Sofyan, Kartini dan 4 anaknya berencana pulang ke rumahkontrakandiTanjungbalai. Tetapi, kata Sofyan, rencana itu ditunda,karenarumahkontrakan itu masih berantakan, darah pun berceceran, serta dindingnya berlubang akibat tembakan peluru. “Kami akan meminta pertanggungjawaban Polri untuk

memperbaiki rumah yang rusak itu, dan Kartini bersama anakanaknya akan pulang ke rumah setelah kondisi psikologi mereka normal kembali,” kata Ahmad Sofyan. Istri Khairul Ghazali, Kartini Panggabean dan dua temannya akhirnya dibebaskan Polres Tanjungbalai, Minggu (26/9). Ketigawanitaitu,KartiniPanggabean, Sulastri dan Elvi diamankan di Mapolres Tanjungbalai selama 7 hari pasca penggerebekan Densus 88 di Jalan Sehat, Gg Pesat, Link. VII, Kel. Bungatanjung, Kec. Datukbandar Timur, Kota Tanjungbalai, pekan lalu. (a37/crs) Waspada/Rasudin Sihotang

WARGA: Kartini Panggabean dan 4 anaknya tetap diterima warga Jalan Sehat, Gang Pesat, Link.VIII, Kel. Bungatanjung, Kec. Datukbandar. Saat ini, Kartini masih mengungsi sementara di rumah orang tuanya di Tebingtinggi. Warga Resah, Muspika L. Pakam DITERIMA Tertibkan Panti Pijat Menyalah Pejabat Pemkab Sergai Tak LUBUKPAKAM (Waspada): hasil pertemuan yang dilakMusyawarah Pimpinan Kecamatan (Muspika) Lubukpakam terdiri dari Camat, Dan Ramil dan KapolsekbersamapersonilSatuan Polisi Pamong Praja (Satpol PP) Deliserdang melakukan penertiban terhadap usaha panji pijat S di kawasan Jalan Pantai Labu, Desa Sekip Lubukpakam, Senin (27/9). Tindak penertiban dilakukan karenadidugakuatusahatersebut telah melenceng dan dimanfaatkan sebagai panti pijat berbau prostitusi. Dalam aksi penertiban itu, pihak Muspika bersama Satpol PP menemukan kamar-kamar dan tempat tidur yang digunakan sebagai tempat praktik. Selain mencabut plank merk, petugas juga menemukan perempuanperempuan pekerja sebagai tukang pijat berikut foto-foto perempuantukangpijatdiatasmeja. Camat Lubukpakam Sariguna Tanjung menjelaskan, tindak penertiban terhadap usaha panti pijat S merupakan kelanjutan dari

sanakan di kantor camat, beberapa hari lalu. Kapolsek Lubukpakam AKP M Ikhwan Khalik mengatakan, sekitar tiga bulan lalu warga Desa Sekipmenyampaikankeresahaan atas adanya panti pijat yang juga diduga “plus-plus”. “Sudah berulang kali pihak pemilikusahapantipijatSdisurtai, tapi tidak dihiraukan,” katanya. Bahkan, masalah ini sudah sampaikekomisiADPRDDeliserdang dan ikut serta meninjau lokasi panti pijat ini tapi tidak juga ditutup. Sementara kepada warga Desa Sekip diimbau untuk tidak melakukan perbuatan anarkis dan tetap mentaati prosedur hukum dalam melakukan penertiban. Ratusan warga Desa Sekip yang menyaksikan penertiban menyambut baik apa yang dilakukanpihakMuspikabersama Satpol PP dalam menertibkan pantipijatS yangsudahlamadikeluhkan warga. (a05)

Waspada / Ibnu Kasir

SERAHKAN BUKU JAWABAN: Bupati Langkat Ngogesa Sitepu ketika menyerahkan buku jawaban atas pandangan umum anggota dewan kepada Ketua DPRD H. Rudi Hartono Bangun, dalam rapat paripurna tahap II di Gedung DPRD Langkat di Stabat, Senin (27/9).

Bupati Langkat: Kritisi Anggota Dewan, Sangat Dihargai STABAT (Waspada): Bupati Langkat Ngogesa Sitepu mengemukakan berbagai saran dan imbauan anggota dewan baik yang berhubungan langsung dengan realisasi kegiatan dan dana secara umum , kesemuanya bermuara untuk memantafkan pembangunan demi kesejahteraan masyarakat . ‘’Masukandankritisiitusangat kami hargai dan menjadi catatan berharga untuk kelancaran roda pemerintahan dan pembangunan daerah, kata bupati ketika menyampaikan jawaban atas pandanganumumsejumlahanggota dewan pada sidang paripurna membahas Laporan Pertanggungjawaban Pelaksanaan APBD 2009 yang dipimpin ketuanya H Rudi Hartono Bangun bertempat di gedung DPRD Langkat di Stabat, Senin (27/9). Dalam agenda jawaban yang dibacakan secara bergantian dengan Sekdakab H Surya Djahisa, bupati menjelaskan beberapa hal mendasar yang menjadi sorotan anggota dewan antara lain berkaitan dengan peningkatan pelayanan RSU Tanjungpura, masalah hutan mangrove, infrastruktur, pendidikan Pendapatan Asli Daerahdanmasalahpengawasan. Menyinggung perambahan hutan bakau (mangrove) , bupati menegaskan hutan mangrove dilindungi keberadaannya sesuai Undang-undang No 41 Tahun 1999 tentang kehutanan. Saat ini

para perambah telah diberikan surat peringatan untuk menghentikankegiatannya.Fihakkehutanan dari Pemprovsu telah menangkapsejumlahalatberat yang digunakandansekaranginimasih dalam proses penyidikan.Selain itu kata bupati, pengawasan dan pengamanan hutan mangrove eks PT Sari Bumi Bakau merupakan kewenangan Pemprovsu sesuai keputusan Menteri Kehutanan . Mengenai besarnya tunggakan Pajak Bumi dan Bangunan (PBB) dari PTPN II hingga tahun 2009 tercatat sejumlah Rp 39.512.006.608. Tunggakan itu pada tahun ini telah dibayar sejumlah Rp 13.879.639.002 sehingga sisa utang PTPN II masih ada sebesar Rp 25.632.367.600 di luar dari denda administrasi. Pada rapat paripurna terdahulu, Jumat (24/9) rapat diskor atas permintaan mayoritas anggota DPRD Langkat karena tidak dihadiri Bupati danWakil Bupati Langkat. Beberapa fraksi memberikan tanggapan yang sempat memanas. Dalam hal ini Ketua DPRD Langkat H.Rudi H.Bangun,SE menyampaikan dan menengahi kepada anggota dan Ketua DPRD meminta Bupati Langkat agar memberikan beberapa tanggapan singkatnya agar bisa menyahuti dan menanggapi permintaan mayoritas anggota dewan. (a01)

Berkomitmen Perlu Dievaluasi

SEIRAMPAH (Waspada): MemasukikepemimpinanBupati danWakilBupati SerdangBedagai (Sergai) HT Erry Nuradi dan Soekirman jilid II baru berbilang hari, namun program pembangunan di berbagai sektor yang belum sempat terealisasi dan tertunda selama periode lalu menanti untuk segera dituntaskan sebagaimana implementasi dari visi “lanjutkan. Demikian disampaikan Direktur OS Institute Abdul FirmanKursin,Sabtu(28/9)diSekretariat OS Institute di Seirampah. “Masyarakat Sergai tentu terus menanti sentuhan tangan dingin duet pasangan Erry-Soekirman dalam melanjutkan program pembangunan sebagai “imbalan” atas mandat yang mereka berikan ketika pelaksanaan

pemilukada yang lalu,” kata Firman. Sementara capaian dan bukti pembangunanpadaperiodeyang lalu, kata Firman, tentu menjadi jaminan mutu sekaligus garansi komitmenErry-Soekirmanuntuk melanjutkan program pembangunan pada periode kedua ini. “Kita tentu sangat mengapresiasi semangat dan komitmen itu,” imbuhnya. Namunsemangatkomitmen dalam membangun Sergai tidak sepenuhnya berbanding lurus dengan prilaku beberapa pejabat Pemkab “Tanah Bertuah Negeri Beradat” ini. “Kita mensinyalir banyak pejabat Pemkab Sergai yang tak punya komitmen terhadappembangunan,”kataFirman. Sebagai contoh, lanjutnya, sampai saat ini masih banyak sek-

tor yang bisa mendulang pendapatan asli daerah (PAD) yang belum terberdayakan dan ada banyak pejabat SKPD yang tak peka dengan persoalan ini. “Kabupaten ini dianugerahi kekayaan yang luar biasa, namun potensi yang ada belum mampu dimanfaatkan secara maksimal,” ujar aktivis muda yang sedang studi S2 di Magister Studi Pembangunan USU ini. Berkaitan dengan hal itu, diingatkankepadapasanganErrySoekirman agar jeli dalam mengevaluasi para pembantunya terhadap fakta-fakta yang ada “Bila perlu singkirkan dan ganti saja para pejabat yang tak punya komitmen pembangunan itudenganpejabatyanglain,masih banyak pejabat di lingkungan

Pemkab Sergai yang lebih bisa berbuat,” harap Firman. Belum Ada Pergantian Menanggapi itu, Sekretaris Daerah Serdang Bedagai H Haris Fadillah mengatakan, selaku Ketua Badan Pertimbangan Jabatan dan Pangkat (Baperjakat) untuk menggantikan pimpinan atau pejabat di Satuan Perangkat Kerja Daerah (SKPD) harus dipertimbangkan secara matang dengan menilai aspek prestasi, dedikasi,loyalitasdantidaktercela (PDLT). “Dan sampai hari ini belum ada pergantian, namun masih pada tingkat pembahasan di seluruh SKPD Eselon II, III dan IV sebagai bahan pertimbangan”, tambah Haris Fadillah. (ces)

Puskesmas Rawat Inap Di T. Balai, Dibangun Tapi Tak Terawat UNTUK mendukung peningkatan pelayanan kesehatan dasar bagi warga, Pemko Tanjungbalai saat init membangun Puskesmas Rawat Inap Sipori-pori di Kec. Teluknibung. Puskesmas ini dibangun bukan hanya untuk melayani pasien rawat jalan saja, tapi juga rawat inap. Hanya saja, sejak diresmikan pada 2006 lalu dan sampai kini, Puskesmas tersebut belum bisa melayani pasien rawat inap. Penyebabnya, selain Peraturan Daerahtentangrawatinapbelum ada, fasilitasnya juga belum memadai,bahkantaksedikityang rusak. Tidak sulit menemukan dinding-dinding rusak di area rumah dinas Kepala Puskesmas Rawat Inap, termasuk di sejumlah ruangan Puskesmas. Halamannya, kendati dipasang paving block, namunditumbuhirumput.Lebih parahnya lagi, kamar mandi di ruangan rawat inap dan ruangan lainnya,tidaktersediaairsehingga kondisinya begitu mengkhawatirkan. Berdasarkan penelusuran Waspada, untuk menyalurkan air dari bak penampungan ke sejumlah ruangan, hanya menggunakan selang plastik. Hal itu diduga akibat minimnya alokasi dana untuk pengadaan pipa distribusi. Kurang Serius Kondisi Puskesmas Rawat Inap Sipori-pori yang kian mengkhawatirkan ini, sebetulnya tidak perlu terjadi jika PemkoTanjungbalai,khususnyaDinasKesehatan lebih serius merawatnya. Tidak perlu saling tuding atau mencari alasanuntukmenutupikesalahan masing-masing. “Sejumlah ruangan di Puskesmas Perawatan (Rawat Inap) terlihat dibiarkan terbengkalai akibat tak ada pasien. Sejak diresmikan, petugas Puskesmas tidak pernah memberikan data pasien yang rawat inap di sana,” ungkap Kabid Pelayanan Kesehatan DinkesTanjungbalai,AzhariSima, kepada Waspada, pekan lalu.

Menurut dia, penyebab utama minimnya pasien, karena akses menuju Puskesmas cukup sulit, sebab lokasinya di tengah perkebunan kelapa, dan jauh dari pemukiman warga. “Perbandingannya, akses menuju RSU Dr T Mansyur dan klinikdiTanjungbalailebihmudah dan murah daripada ke Puskesmas Rawat Inap. Misalnya, ongkos ke Puskesmas Rp 20 ribu, maka ke RSU ataupun klinik paling hanya Rp 10 ribu,” tutur Azhari. Selain itu, peralatan kesehatannya kurang memadai, sehingga,kataAzhari,mempengaruhi minat warga berobat ke sana. “Peralatan kesehatan di puskesmas rawat inap untuk tingkat melahirkan saja,” katanya. Kendati demikian, Azhari tak menampik, jika dalam sehari pasti ada warga yang berobat ke Puskesmas Rawat Inap. “ Satu hari ada 3-5 pasien yang berobat, tapi tidak rawat inap,” terang Azhari. Mengenai tarifnya, Azhari mengaku sampai saat ini belum ada peraturan yang menetapkan nilai yang harus dibayar untuk sekali berobat dan menginap. “Perda untuk rawat inap tidak ada, sehingga kami tidak bisa menjelaskan berapa biaya sekali berobat, namun kami mengacu pada harga yang diberikan puskesmas, yakni Rp 2 ribu sekali berobat,” papar Azhari. Menurut aktifis LSM Kota Tanjungbalai AE Sibarani, kalau memang Pemko dan Dinas Kesehatan Tanjungbalai serius merawat Puskesmas Rawat Inap, kendati Perda belum dibuat, seharusnya dinas bisa menerbitkan Surat Keputusan,karenaitumerupakan hak dinas. “Tapi karena kurang serius, ya Puskesmas Rawat Inap dibiarkan berjalan tanpa dilengkapi Perda,” tutur Sibarani. Oleh sebab itu, menurut Sibarani, sebaiknya Walikota Tanjungbalai mempertimbangkan kembali posisi Kadis Kesehatan yang dijabat Syafnir Chazwan. “Banyak masalah timbul sejak Kadis Kesehatan dijabat Syafnir Chazwan, mulai dugaan mark uppengadaanalat-alatkesehatan TA 2009, meningkatnya jumlah gizi buruk, sampai Puskesmas Rawat Inap yang tidak maksimal

Waspada/Rahmad F Siregar

TAK DIRAWAT:Puskesmas Rawat Inap Sipro-pori di Kec.Teluknibung, Kota Tanjungbalai kurang mendapat perawatan dari Dinas Kesehatan. Sejak diresmikan 2006 lalu, Puskesmas ini belum memiliki Perda tentang rawat inap, bahkan fasilitasnya pun sangat mengkhawatirkan. dimanfaatkan,” kata Sibarani. Permintaan serupa sebenarnya sudah pernah disampaikan pihaklegislatif.Saatitu,timPansus DPRD Tanjungbalai dalam paripurna khusus pada 11 Juni 2010 merekomendasikan pencopotan Kepala Dinas Kesehatan dr Syafnir Chazwan. Pencopotan itu direkomendasikankarenaSyafnir Chazwan dinilai kurang memahami tugas dan fungsinya sebagai Kepala Dinas Kesehatan, terutama masalah data penderita gizi buruk serta kurang koordinasi antar anggotanya. Hanyasaja,sampaikini,rekomendasi legislatif itu belum ditanggapi Pemko Tanjungbalai. Buktinya,3bulanpascaparipurna khusus, Syafnir Chazwan tetap menjabat sebagai Kadis Kesehatan. Sekretaris Komisi B DPRD Tanjungbalai Hakim Tjoa Kian Lie juga menilai kinerja Kadis Kesehatan Kota Tanjungbalai Syafnir Chazwan sangat mengecewakan. Kekecewaan itu dilontarkan Hakim karena sampai saat ini pelayanan kesehatan yang dilaksanakan Dinkes kepada masyarakat,belummaksimalatau

masih jauh dari harapan. “ Di sejumlah media disebutkan, Tanjungbalai penyumbang kedua terbesar penderita gizi buruk, ini menunjukkan kinerja Kadis Kesehatan dan jajarannya belum maksimal,” jelas Hakim. Harapan Puskesmas Rawat Inap tak dirawat dengan baik, pengadaan alkes TA 2009 menimbulkan dugaan mark up, dan jumlah gizi buruk meningkat menunjukkan pelayanan kesehatan diTanjungbalai belum maksimal. “Upaya meningkatkan pelayanan kesehatan sudah ada, meskipunbelummaksimal,”kata aktifis LSM, AE Sibarani. Oleh sebab itu, Sibarani berharap,WalikotaTanjungbalaiyang akan datang, lebih baik dan maju dalam meningkatkan pelayanan kesehatan bagi masyarakat, terutama memaksimalkan keberadaan Puskesmas Rawat Inap. “Mudah-mudahanlahWalikota kita yang baru nanti lebih mengutamakankualitasdaripada kuantitas pelayanan kesehatan,” papar Sibarani. Rahmad F Siregar/ Rasudin Sihotang


Sumatera Utara

WASPADA Rabu 29 September 2010

Anak-anak Labuhanbatu Jadi Incaran Penculik RANTAUPRAPAT(Waspada): Seorang bocah berumur 7 tahun yang masih duduk di kelas 1 SD warga Desa Lingga Tiga, Kecamatan Bilah Hulu nyaris diculik sekelompok orang tak dikenal (OTK) menggunakan jaket serba hitam mengendarai mobil Taft Rocky. Demikian Sekretaris LKMD desa Lingga Tiga Ir.Edi Kelana kepada wartawan Senin (27/9). Dari kronologis kejadian yang diceritakan orang tua korban kepada Sekretaris LKMD itu saat Adi bermain di depan rumahnya seorang diri, tiba- tiba berhenti mobilTaft Rocky warna hitam hendak menangkap Adi yang sedang bermain. Karena tak kenal Adi langsung lari kebelakang rumahnya melalui samping. Kemudian, sekelompok orang yang berjumlah sekira 5 orang itu mengikuti dan mengepung Adi hendak menangkapnya. Akan tetapi katakan Minah ibu kandung Adi melihat anaknya diuberuber OTK, langsung menjerit dan berteriak kepada orang asing itu, serta merta OTK yang sempat mengepung Adi kabur. Hal yang sama juga pernah terjadi di Aek Nabara sekitar bulan Maret2010lalu,denganmodusmembelikanjajanolehoknumpenculik yang diduga seorang ibu paruh baya yang berencana akan menculik seorang bocah berumur 8 tahun yang juga menolak menyebutkan namanya, warga Pondok Batu, penculikan digagalkan Sumeliadi, 32, pemuda yang pulang kerja menjual telur. (c01)

Pemkab Harus Tertibkan Anak SD Jadi Gepeng LIMAPULUH (Waspada): Membanjirnya gelandangan dan pengemis (Gepeng) anak usia SD dalam maupun luar Batubara perlu mendapat perhatian serius Pemkab. Karena mereka sengaja merantau berhari-hari bahkan berminggu ke daerah lain. “Ada pameo di luar Batubara, kalau jumpa dengan pengemis laki-laki atau perempuan dituduh pasti itu orang Batubara. Kita merasa malu, tapi ada benarnya. Hanya saja diharapkan Pemkab Batubara melalui Satpol PP, Kabagsos Batubara segera menertibkan pengemis,” ujar Jamain, salah seorang tokoh masyarakat di Batubara, Selasa (28/9). Paling menyedihkan sebagian pengemis masih berusia SD, ada berkedok menenteng kaleng atau kotak amal sumbangan mushala dan masjid. Dalam penertiban pengemis anak-anak itu, katanya, diharapkan mereka dikembalikan kepada orangtuanya dan supaya masuk sekolah kembali. (a30)

Drainase T. Seri Retak-Retak LIMAPULUH(Waspada): Drainase Desa Tanjung Seri, Kec. Sei Suka, Kab. Batubara baru sebulan selesai dikerjakan, kini mulai retak-retak. Proyekyangmenjadisorotanmasyarakatdinilailemahpengawasan pengerjaannya oleh Dinas PU sebagai pemilik proyek. Menurut informasi yang diterima Waspada, proyek itu disubkan kepada anggota DPRD Batubara namun yang menjalankan adalah anaknya yang bekerja di Dispenda Batubara. Sebelumnya, tercantum pada papan plank proyek volume pekerjaan 500 meter, namun menurut warga tidak sampai. Sejumlah warga dan LSM menilai pekerjaan itu parah sekali. Ketua DPC PIS Batubara Zainudin kepada Waspada, Selasa (28/ 9) meminta Bupati Batubara memeriksa langsung proyek drainase Desa Tanjung Seri itu untuk menindak langsung rekanannya. (a31)

Jabatan Bukan Hadiah Dan Warisan LIMAPULUH (Waspada): Bupati Batubara OK Arya mengemukakan, jabatan merupakan amanah yang harus dilaksanakan dengan baik, dan pengangkatan pegawai negeri sipil dalam suatu jabatan bukanlah hadiah atau warisan yang harus dipertahankan. Bupati mengemukakan itu melalui Setdakab Drs. Sofyan MM saat melantik dan mengambil sumpah pejabat eselon III dan IV di lingkungan Pemkab Batubara di kantor bupati, Selasa (28/9). Para pejabat yang dilantik Drs Aladdin Sekretaris Dinas Pendidikan, Drs. Darwis menjadi Kabid Sarana Prasarana Dinas Pendidikan, Drs Sahnan Siregar Kabid Komunikasi Dinas Perhubungan, Mahar Efendi Kabid Rekontruksi BPBD. Adlin, SE Kasi Kantor Camat Sei Balai, OK Rangga Ramadia Krisna, ST Kasi Pendapatan Kelurahan Labuhan Ruku-Talawi, Drs. Syahbuddin menjadi Pengawas Dinas Pendidikan, Sondang Barita, ST pegawai pada Bappeda.(a11)

Bangunan Sumur Bor Aset Pemkab Batubara Dibongkar LIMALARAS (Waspada) :Warga yang bermukim di Desa Limalaras, Kec.Tanjungtiram, Batubara terkejut adanya aksi sekelompok warga menghancurkan bangunan booring (sumur bor) aset Pemkab Batubara di Dusun I, Limalaras, Senin (27/9). Menurut seorang warga, Selasa (28/9), tidak jelas kenapa salah satu bangunan booring (sumur bor) paket bantuan Dinas Pertambangan dan Energi Asahan 2006 di Dusun I, Limalaras, Bogak, PematangRambeidengandanaRp180jutalebihitu,dihancurkan/dibongkar. Padahal booring tersebut sudah 3 tahun beroperasi dan baru saja airnya tak keluar. Warga heran, tangki air dan mesin pengisap bersama meteran listrik dicopot, tidak diketahui untuk apa digunakan. Kata warga, pembongkaran itu atas perintah Kades Limalaras Rd. Ketua Komisi A DPRD Batubara Sakroni, Selasa (28/9) menyesalkan tindakan oknum Kades Limalaras Rd yang diduga memerintahkan pembongkaran bangunan booring aset Pemkab Batubara. Katanya, bukan sembarangan membongkar bangunan atau mau memindahkan aset pemerintah sudah ada ketentuannya. (a30)

DKP Dan Peternakan Labuhanbatu Buka Penawaran Tender Proyek RANTAUPRAPAT (Waspada): Dinas Kelautan Perikanan dan Peternakan Labuhanbatu membuka penawaran tender proyek pengadaan barang dan jasa serta proyek konstruksi pembuatan kolam 2010, Kamis (23/9). Pantauan Waspada, mulai pembukaan penawaran dihadiri sebagian wakil perusahaan yang ikut dalam proses tender tersebut, sedangkan selebihnya tidak hadir. Proyek yang ditenderkan 8 paket. Untuk itu diminta, dari proses yang ada dapat menjunjung tinggi nilai keadilan dalam menentukan pemenang, Panitia tender dan PPK harus selektif dalam menentukan pemenang, juga harus didasari hasilpenilaianyangmemangbenar-benarpadaketentuanperundangundangan yang berlaku. (c01)

Suasana Belajar Siswa SMK 2 Rantau Utara Tak Layak RANTAUPRAPAT (Waspada) : Suasana lingkungan belajar bagi siswa SMK 2 Rantau Utara saat ini sudah sangat memprihatinkan dan termasuk dalam kategori tidak layak, terutama dari sisi kenyaman dan kesehatan siswa yang berjumlah 800 orang lebih. Kondisi dikarenakan kondisi ruang kelas dan lingkungan sekolah yang tidak terawat dengan semestinya yang menggambarkan SMK 2 sepertinya tak terurus, apalagi sekolah tersebut telah memiliki standar international. Salah seorang guru di SMK 2 yang juga merupakan wali murid yang minta namanya tidak dipublikasikan, Sabtu (25/9) mengatakan, kondisi di sekolah ini kurang dari sisi kesehatan dan keindahan. “Sudah banyak material sekolah yang rusak, salah satunya kacakaca jendela yang ada di ruang kelas. Beginilah kondisi sekolah kami, bapak lihat sendiri,” katanya sedih melihat suasana lingkungan tempat mereka bekerja. Bupati Labuhanbatu Dr Tigor P Siregar ketika dikonfirmasi terkait sekolah SMK 2 yang berstandar internasional dengan kondisi sekolah itu mengatakan akan meninjau sekolah terebut dalam waktu dekat. Setahu beliau ada anggaran untuk merawat gedung dan lingkungan sekolah. Mariyaman, tenaga honor dan juga pengelola kantin sekolah yang telah sepuluh tahun menjadi penjaga sekolah menjelaskan, lahan di lingkungan sekolah itu seluas 5 ha, tenaga honor 5 orang yang ada saat ini kurang untuk merawat lingkungan sekolah. (c01)

Sengketa Lahan Warga Asahan Dengan Pengusaha Berlanjut


MUSYAWARAH: Koordinator LBH Publiek Kisaran, Zasnis Sulungs (kiri) terlihat sedang menjelaskan Kecamatan Aek Songsongan, di depan para anggota Komisi A DPRD Asahan, namun salah seorang pengusaha mengakui lahan itu miliknya, dan malah mengadukan ke polisi saat warga memanen hasil kebunnya sendiri. Foto direkam, Selasa (28/9).

Lahan Kantor Walikota T. Balai Masih Bermasalah TANJUNGBALAI (Waspada): Lahan kantor Walikota Tanjungbalai di Jalan Jenderal Sudirman, Kel Sijambi, Kec Datukbandar, masih bermasalah. Seorang warga, Hisar Panjaitan, mengaku, di areal pertapakan kantorWalikota, masih terdapat tanah miliknya seluas 1.615 m2, dan belum diganti rugi oleh Pemko Tanjungbalai. “ Pemko merampas tanahku, dan aku tidak pernah menjual tanahku itu,” kata Hisar Panjaitan kepada Waspada, Senin (27/9). Kendati tak dijual, kata Hisar, Pemko menitipkan uang ganti rugi tanah atas namanya pada 24 Desember 2010 dengan No. 900/234.80sebesarRp204.886.120 kepada PNTanjungbalai tertanggal19Januari2009sesuaikwitansi.

Akan tetapi, Hisar menolak uang titipan ganti rugi itu, dan tetap menginginkan penyelesaian dengan kekeluargaan.“ Kuminta agar diselesaikan dengan penggantian atau tukar guling lahan dengantanahyangterletakantara Jalan Jenderal Sudirman sampai dengan Jalan Alteri seluas 1 Ha,” kata Hisar. Sementara, berdasarkan surat PNTanjungbalai NoW2.U8/ 2192/HT.04.10/IX/2010 perihal mohon petunjuk uang titipan Pemko Tanjungbalai sebesar Rp 204.866.120, dijelaskan, dengan ditolaknya uang titipan ganti rugi lahan tanah oleh Hisar Panjaitan, maka PN memberitahukan kepada pihakWalikotaTanjungbalai untuk datang mengambil uang titipan ganti rugi itu ke Paniteraan PN Tanjungbalai. Dan, dua kali diberitahukan untuk pengambilan uang tersebut, Pemko tidak pernah hadir. Oleh sebab itu, PN Tanjungbalai

memohon petunjuk Ketua PT Medan, untuk tindakan selanjutnya mengenai uang titipan tersebut. “ Tanahku itu sekarang tak bisa kumanfaatkan, jadi hendaknya Pemko mengembalikan tanahku agar bisa kami manfaatkan.Sayamemangtakpernah dan tak berniat menjualnya, hanya saja kalau Pemko ingin memanfaatkannya, silahkah saja, tapi tolonglah diganti atau tukar guling lahan dengan tanah yang terletakantaraJalanJenderalSudirman sampai dengan Jalan Alteri seluas 1 Ha,” tutur Hisar. Kepala Bagian Hukum Setdakot Tanjungbalai, Yusmada Siahaan, mengatakan, Pemko telah berupaya menempuh jalur kekeluargaanuntukpenyelesaian pembebasan tanah perluasan kantor Walikota, namun ditolak pemilik tanah. “ Jadi biarlah masalahinidiselesaikandalamproses hukum,” kata Yusmada. (a37)

Rapat Pembentukan Banggar DPRD Tanjungbalai Dihujani Interupsi TANJUNGBALAI (Waspada): Rapat Paripurna khusus DPRD Kota Tanjungbalai membahas pembentukan Badan Anggaran (Banggar), dihujani interupsi dari anggota dewan, Selasa (28/9). Mereka berbeda pendapat tentang pengajuan anggota Banggar. Ada yang menyatakan harus mewakili fraksi dan komisi, dan ada meminta hanya dari utusan fraksi berdasarkan PP No. 16 Tahun 2009. Kemudian, muncul pengajuan jumlah formasi berdasarkan kesepakatan bersama, dengan rincian 3 dari pimpinan dewan, Fraksi Partai Golkar, Demokrat, PDI P, Pakar Nurani Bangsa masing-masing 2 orang utusan, serta 1dariFraksiPatriotPeduliBangsa. Pengajuan formasi itu, menimbulkan berbagai tanggapan.

Malah Ketua Fraksi PDI P, Leiden Butar-butarmemintahasilRapim sebelumnya dibatalkan. “Hasil Rapim itu tak pernah disepakati dalam rapat seperti ini. Dalam UU, yang duduk sebagai anggota Banggar merupakan utusan fraksi, bukan komisi,” jelas Sekretaris Fraksi PDIP Hakim Tjoa Kian Lie. Paripurna khusus dipimpin Plt Ketua DPRD Surya Darma AR dan Zainab Hadi memutuskan anggota Banggar berjumlah 12 orang.“SetiapdaerahBanggarnya berjumlah ganjil, tapi hasil kesepakatan, jumlah formasi dalam Rapim ditetapkan 12 orang, ini tidak bertentangan dengan PP,” kata Surya Darma. Diskor Paripurna pembentukan

Banggar akhirnya diskor selama 10 menit, karena belum ada kesepakan dalam menentukan jumlah formasi dan utusan dari fraksi. Sidang diskor untuk memberikan kesempatan kepada fraksi di DPRD untuk rapat internal menentukan utusannya di Banggar. Dalam sidang lanjutan, kendati alot dan dihujani interupsi, akhirnya fraksi di DPRD sepakat dalam jumlah anggota Banggar, yakni 12 orang. Para anggota Banggar itu terdiri dari Fraksi Partai Golkar danPatriotPeduliBangsamasingmasing 2 utusan. Kemudian 3 utusan Fraksi Pakar Nurani Bangsa, serta Fraksi Partai DemokratdanPDIPmasing-masing 1 utusan. Selebihnya berasal dari unsur pimpinan dewan. (a37)

Tutup Pertambangan Pasir Kuarsa Jika Tak Miliki Izin LIMAPULUH (Waspada): Wakil Ketua DPRD Batubara AsmadinataDalimunthememinta dinas terkait menutup lokasi pertambanganPTJnjikamemang benar tidak memiliki izin yang dikeluarkanolehpihakberwenang. Demikian ditegaskannya, Selasa(28/9)mengomentaripemblokiran pengangkutan dan pengerukan pasir kuarsa di Desa Gambus Laut, Kec. Limapuluh, Kab. Batubara yang hingga saat inibelumjugamaumenunjukkan legalitas usaha pertambangan

yang dilakukan PT Jn sejak tiga hari yang lalu. Kepada Waspada Asmadinata meyakinkan, usaha pertambangan harus dibekali dengan izin dari berbagai dinas terkait, seperti Dinas Lingkungan Hidup, Dinas PU dan Pertambangan, bahkan kalau berada di kawasan hutan juga harus jelas, tidak sekadar rekomendasi-rekomendasi saja yang harusnya diteruskan untuk menjadi izin. Sementara itu warga Gambus Laut Azizi menerangkan hari

ini iatelahmenemuiKabidHutan Dinas Kehutanan dan Perkebunan Pemkab Batubara Faisal tentang ada tidaknya surat rekomendasi atau surat pegangan perusahaan yang dikeluarkan DinasKehutanantentanglegalitas operasional PT Jn yang diduga masih dalam kawasan hutan. “Kepada saya Faisal mengatakan Dinas Kehutanan tidak pernah mengeluarkansurat rekomendasi atau apapun namanya terkait pertambangan PT Jn,” ujar Azizi. (a31)

TNI Punya Peran Tanggulangi Bencana KISARAN (Waspada): Tugas Tentara Nasional Indonesia (TNI) selain melaksanakan Operasi Militer Selain Perang (OMSP) juga aktif membantu tugas pemerintah dan berperan menanggulangi bencana alam serta bantuan kemanusiaan. Halitudiungkapkan,Danrem 022/Pantai Timur Kolonel Kav. Wahardono dalam pembukaan Geladi Posko I, Selasa (28/9) di alun-alun Makodim 0208/AS, Kisaran. Menurutnya, dalam pelaksanaan geladi itu akan ditemui berbagai persoalan yang harus dicermati, sehingga bisa direspon dan menyelesaikannya dengan mengambil keputusan secara tepat dan tepat. “Keberhasilan dapat diukur dengan sasaran yang akan dicapai, berupa terlaksananya prosedurhubungankomandandengan staf dalam mengendalikan suatu operasi bantuan kepada pemda, dan terjalinnya koordinasi dan komunikasilintassektoraldengan aparat terkait untuk mengatasi setiapgejolaksosialyangmungkin

timbul di wilayah itu,” ungkap Wahardono. Oleh sebab itu, kata Wahardono,diharapkankepadaseluruh penyelenggara berperan proporsional, sehingga rangkaian kegiatan ini berlangsung dengan tertib, kemudian kepada pelaku geladi, dapat menjalaninya dengan penuh kesungguhan. Komandan Upacara, Dan-

dim 0208, Letkol Inf, Handoko Nurseta, dan hadir dalam acara itu,BupatiAsahandiwakiliAsisten I, Zulkarnaen, Danyon 126/KC, Letkol Inf, Eppy Gustiawan, didampingi Kapolres Asahan, AKBP J Didiek Dwi Priantono, Kapolres Tanjungbalai, AKBP Puja Laksana, Ketua DPRD Asahan serta para undangan. (csap)

KISARAN (Waspada): Sengketa antara warga dengan pengusaha perkebunan memperebutkan tanah 120 ha tetap berlanjut, sehingga lahan itu berstatus stanvas (sementara dikuasai negara hingga jelas kepemilikannya). Berdasarkan musyawarah antara kedua belah pihak yang dilakukan Komisi A DPRD Asahan, Selasa (28/9), dengan menghadirkan perwakilan dari Badan Pertanahan Nasional (BPN) dan Dinas Kehutanan Asahan, mereka setuju untuk tidak mengusikdanmemanenbuahsawityangtumbuh di lahan itu, sampai musyawarah selanjutnya diputuskan minggu depan. “Saya setuju, bila tanaman sawit itu tidak ada yang memanen sampai menunggu hasil musyawarah antara dua belah pihak yang akan diputuskan oleh DPRD Asahan, dan bila ada yang berani mengambilnya akan diproses sesuai dengan hukum,” ujar pengusaha perkebunan yang mengaku memiliki lahan di 120 ha di Dusun IV, Desa Tangga, Kecamatan Aek Songsongaan, Asahan, Efendi Taswid, di depan anggota Komisi A DPRD Asahan. Menurutnya, lahan itu dibeli dari Jhony Sihotang, warga Kisaran, pada 2005 dengan perincian 61 sertifikat tanah yang ditumbuhi pohon sawit. Namunwargasekitarmengakuipohonitumiliknya sehingga mereka memetik hasilnya. Oleh sebab itu, Efendi Taswid meminta perlindunganhukumdenganPolresAsahanuntuk melakukan pengamanan di tanahnya. “Saya membeli lahan itu sesuai dengan prosedur, dan dilengkapi dengan sertifikat, jadi

sayamempunyaihaksepenuhnya,”ungkapEfendi. Koordinator LBH Publiek Kisaran, Zasnis Sulungs mewakili warga Desa Tangga menyatakan, tanah itu adalah punya masyarakat yang sudah ditanami sawit puluhan tahun lalu, dan dasar pemilikan SKT dari kepala desa dan camat. Dan , berdasarkan keterangan Jhony Sihotang sebagai pemilik tanah, lahan itu dijual dengan keadaan kosong tanpa ada yang ditanami. Menanggapi masalah itu, Ketua Komisi A DPRD Asahan BunYaddin didampingi Sekretaris, SyamsulQodriMarpauang,danbeberapaanggota lainnya memutuskan wilayah itu berstatus stanvas sambil menunggu hasil pertemuan selanjutnya dijadwalkan pada 7 Oktober. Belum Ditemukan Kasi Sengketa dan Konflik Pertanahan BPN Kabupaten Asahan, Bahrum Simajuntak menyatakan, arsip pemindahan hak dan peta lahan itu belum ditemukan di BPN, sehingga 61 sertifikat atas nama EfendiTaswid belum dike-tahui dengan jelas keberadaannya. Sedangkan Kadis Kehutanan P Sihombing menjelaskan, berdasarkan PetaTata Guna Hutan Kesepakatan (TGHK) tahun 1982, wilayah itu merupakan areal penggunaan lain (APL), namun berdasarkan SK.44/Menhut-II/2005 wilayah itu masuk dalam kawasan hutan, tapi dengan keluarnya P Menhut No: P.50/Menhut-II/2009, Tentang Penegasan Status dan Fungsi Kawasan Hutan, wilayah itu tidak termasuk kawasan hutan register. (csap)

Mafia Tanah Marak Di Asahan KISARAN (Waspada): Mafia pertanahan mulai marak dan terungkap di Kab. Asahan dengan ditemukannya 61 sertifikat tanah seluas 120 ha yang belum dilengkapi pemindahan hak dan peta wilayah di Badan Pertanahan Nasional (BPN) Asahan. Hal itu ditegaskan Direktur Eksekutif LBH Publiek Kisaran Syatriawan Guntur Zas, saat musyawarah dengan Komisi A DPRD Asahan, tentang sengketa tanah warga Dusun IV, Desa Tangga, Kec. Aek Songsongan yang diakui sebagai milik pengusaha perkebunan, Selasa (28/9). Menurutnya, sertifikat itu merupakan permainanmafiapertanahan,sehinggaBPNharus mengungkapnya dengan mencari kelengkapan berkas 61 sertifikat itu. “Bila hal itu tidak bisa dipenuhi oleh BPN, maka 61 sertifikat terindikasi fiktif dan dapat dibatalkan,” ungkap Guntur. Sementara, pemilik 61 sertifikat itu, Efendy Tanswid, mengakui tanah itu dibeli dengan cara resmi dan sesuai dengan prosedur yang berlaku,

dan dia menyatakan, lahan tersebut pernah dilakukan pengukuran ulang oleh BPN. “Saya kurang ingat tahunnya, sekitar tahun 2007 atau 2008 lahan itu diukur kembali oleh BPN, dan permohonannya dilakukan secara resmi diajukan,” ungkap Efendy. Sementara,KasiSengketadanKonflikPertanahan, BPN Asahan, Bahrum Simajuntak, membantah adanya mafia tanah di Asahan, dan menjelaskan kekurangan berkas 61 sertifikat tanah itu disebabkan belum ditemukannya, mengingat arsip di BPN terlalu banyak dan membutuhkan waktu. “Berkas pemindahan hak dan peta tanah itu belum ditemukan, bukan tidak ada,” jelas Bahrum. Namun dia meragukan pengukuran ulang yang dilakukan BPN, disebabkan arsipnya belum ditemukan sehingga letak tanah itu belum bisa ditetapkan di mana berada. Kami akan mencari berkas itu, sehingga kedudukan 61 sertifikat itu jelas. (csap)

Bupati Terpilih Harus Tampung Aspirasi Rakyat KOTAPINANG (Waspada): Bupati terpilih Labuhanbatu Selatan (Labusel) periode 20102015 harus menampung aspirasi masyarakat dalam upaya peningkatan pembangunan segala bidang. Hal itu dinyatakan Ketua Umum PB IKLAS Drs. Rivai Nasution, MM dalam acara halal bi halal 1431 H dan penepungtawaran jamaah calon haji serta pengukuhan pengurus HIPMA Labusel periode 2010-2013 di Lapangan MHB Kotapinang, Labusel, Jumat (24/9). Selain itu, pemimpin Labusel terpilih diharapkan bEkerjasama dengan Pengurus Besar Ikatan Keluarga Labuhanbatu Selatan (PB IKLAS) serta unsur pemuda dan mahasiswa dalam mengawal pembangunan. Sementara, Pj. Bupati Labusel Drs. H. Abd. Rajab Pasaribu MM dalam sambutannya mengakui pelayanan pemerintah, pembangunan dan kemasyarakatan belum sepenuhnya terlaksana. Hal ini disebabkan sarana dan prasarana serta sumber daya manusia (SDM) yang belum memadai. Karena itu, katanya, Pemkab Labusel mengimbau PB IKLAS dan PP HIPMA Labusel bergandengtangandemiterwujudLabuselyangmakmur, sejahtera dan madani yang diridhoi Allah SWT. Harapan serupa juga disampaikan Ketua DPRD Labusel Fery Andhika. Dia minta kegiatan halal bi halal dan silaturahmi yang diselenggarakan PB IKLAS hendaknya terus dikembangkan. Kaya Dan Cerdas Sementara, Penasehat PB IKLAS dan tokoh masyarakat Labusel DR. H. Amarullah Nasution, SE, MBA menilai masyarakat Labusel kaya dan cerdas. Kaya, kata Amarullah, karena setiap tahun banyak masyarakat kabupaten tersebut berangkat ke Tanah Suci Makkah menunaikan ibadah haji. Dan pada tahun ini saja, katanya, jumlahnya

melebihi 500 orang, suatu jumlah yang sangat luar biasa. Sedangkan Salim Fahri didampingi Sekretaris Mahmuddin Siregar SE, dan Bendahara H. Ilham Siregarberharappemerintahdanberbagaielemen masyarakat bekerjasama dengan organisasi yang memayungi semua masyarakat Labusel itu. Selain jamaah calon haji, Pj. Bupati Labusel Abd. Rajab, Ketua DPRD Fery Andhika dan keempat pasangan Cabup/ Cawabup juga ditepungtawari. Dukung Sementar aitu, Pj. Bupati Labura Drs. H. Asrin Naim menegaskan, siapapun yang menang Pemilukada adalah pilihan terbaik warga Labura. “Untukitudiharapkansiapapunnantimemimpin Labura dapat membawa perubahan dan meningkatkan pelayanan kepada warganya,” ujar Asrin Naim didampingi Sekdakab Labura Amran dan Sekretaris KPU Labura H. Thamrin, Senin (27/9) di Posko Desk Pilkada Labura. Menurutnya, figur yang menang itu adalah pilihan rakyat dan yang terbaik untuk Labuhanbatu Utara. Naim mengatakan, Pemkab telah berupaya maksimal untuk menyukseskan agenda akbar itu. “Karena ini merupakan pemilukada pertama di Labura, kabupaten yang baru memekarkan diri dari Labuhanbatu hampir dua tahun lalu,” katanya. Naim juga berterimakasih pada masyarakat Labura yang telah datang ke TPS memberikan hak suaranya. Sementara, warga yang memberikan suara pada Pemilukada Labura mencapai 70 persen dari jumlah 224.771 pemilih, hal itu telah menunjukkan antusias masyarakat. Pantauan Waspada, Senin (27/9), Pj Bupati Labura Asrin Naim didampingi Sekdakab Amran berkeliling memantau situasi dan meninjau TPS di Kec. Kualuhhulu. (m07/csi)

Tubrukan Beruntun Di Jalinsum Medan - Kisaran LIMAPULUH (Waspada): Truk pengangkut barang BK 8359 TN ringsek bagian kabin depan setelah tubrukan beruntun dengan dua truk lain dan satu ambulans di Jalinsum Medan - Kisaran, Desa Simpang Gambus, Kec. Limapuluh, Kab. Batubara, Selasa (28/9) siang. Dalam peristiwa itu sopir dan kernet truk mengalami luka serius dan dievakuasi ke UGD salah satu rumah sakit di Indrapura guna pertolongan medis. Menurut informasi maupun keterangan warga, kecelakaan itu berawal truk ketika BK 8359 TN bertubrukan dengan truk tronton BK 82BB DR yang datang dari arah berlawanan, disusul mobil ambulans menubruk belakang truk. Dalam peristiwa itu, badan truk terlempar ke badan jalan sehingga menimbulkan kemacetan panjang pada ruas jalan dua arah tersebut. Sopir Tewas Sementaraitu,diLabuhanbatudidugamuatan yang melebihi kapasitas, truk jenis colt diesel BB 9050 FA yang memuatan kayu rambung yang

akan diangkut menuju salah satu kilang di Rantauprapat mengalami pecah ban bagian depandiDusunFirdausDesaLinggaTiga,Kecamatan Bilah Hulu Kabupaten Labuhanbatu. Truk tergelincir terjun ke parit hingga menewaskan sopir truk Syahrial, 35, warga Kecamatan Pangkatan. Senin (27/9) sekira pukul 14:00. Paiman, 43, salah seorang warga kepada Waspada yang sempat melihat mayat korban tertimpa timbunan kayu yang diduga korban melompat hendak menyelamatkan diri, karena kurang cepat, korban terhimpit puluhan batang kayu rambung yang sudah dipotong- potong seukuran semeter dua puluh senti yang menghantam bagian kepala korban. Pantauan Waspada,sekira pukul 14:25, mayat korban langsung dilarikan ke Klinik Dr Abdul Salam Kelurahan Sidorejo Kecamatan Rantau Selatan. Kagatur Pos lantas Sigambal Iptu S.Siagian membenarkan. ‘’Kecelakaan disebabkan pecahnya ban bagian depan yang menyebabkan truk menyeret ke parit,’’ ujar Kagatur. (a11/c01)

Kapolres Binjai Tindak Anggota Terlibat Judi


LATIHAN: Danrem 022 Kolonel Kav. Wahardono menyematkan tanda latihan Geladi Posko I kepada personil Kodim 0208/AS, Selasa (28/9).

BINJAI (Waspada) : Kapolres Binjai AKBP Dra Rina Sari Ginting tidak akan mentolerir segala macam aksi perjudian di Binjai termasuk judi Togel, Kim dan judi mesin jackpot. Hal itu dikatakannya kepada wartawan, Selasa (28/9). “Kita akan melakukan menbasmi seluruh bentuk perjudian di Binjai yang selama ini hangat diberitakan di media. Menurutnya, bila ada keterlibatan anggota kepolisian yang membacking aksi judi di wilayahnya, dia tak segan-segan melakukan penindakan langsung. Sementara itu hasil pantauan Waspada di

lapangan, sejauh ini pihak kepolisian di Binjai tetapmelakukanpengangkapanterhadapkegiatan perjudian yang beromzet miliaran rupiah. Namun hingga kini bandar besar judi di wilayah Binjai yang berintial Aj, penduduk Brahrang Kecamatan Binjai Barart masih berkeliaran. Tokoh masyarakat dan tokoh agama di Binjai yang tidak ingin disebutkan jati dirinya meminta Kapolresta Binjai untuk menutup seluruh bentuk perjudian di Kota Binjai. Diakuinya, pihak polresta Binjai telah melakukan penangkapan terhadap perjudian termasuk judi togel dan kim. (a04)

Sumatera Utara

WASPADA Rabu 29 September 2010

Calon Lakukan Money Politics Adalah Haus Kekuasaan KABANJAHE (Waspada) : Calon Bupati Karo Andy Natanael Ginting Manik, Senin (27/9) di sekretariat pemenangan Jalan Padang Mas Kabanjahe mengatakan, calon melakukan money politics dalam Pilkadauntukmeraihkemenanganadalahorangyanghauskekuasaan. Sekaitan itu, dia juga membuat kontrak politik yaitu menyangkut Kabupaten Karo secara menyeluruh dengan isi akan meningkatkan kesejahteraan masyarakat, Kedua, menyangkut Kota Kabanjahe secara khusus dengan dengan isi memprioritaskan pengadaan air bersih yang memadai di Kabanjahe dan sekitarnya.Kontrak ketiga menyangkut Kota Berastagi secara khusus dengan isi akan menata Kota Berastagi menjadi bersih untuk mendukung kepariwisataan. Kontrak politik tersebut ditandatangani Calon Bupati dan Calon Wakil Bupati Karo Andy Natanael Ginting dan H Fakhry Samadin Tarigan. (cmm/a17)

Pemkab Pakpak Bharat Berhalal Bi Halal SALAK, PAKPAK BHARAT (Waspada): Pemkab Pakpak Bharat berhalal bi halal 1431 H bersama elemen masyarakat, Senin (27/ 9) di Gedung Pemkab Komplek Perkantoran Panorama Indah Dlleng Sindeka-Salak. Hadir dalam acara tersebut,Wakil Bupati Ir. H. Maju Ilyas Padang, Ketua DPRD Pakpak Bharat Ir. Agustinus Manik dan beberapa anggota DPRD, Kapolres AKBP Suriadi Bahar (mewakili Muspida Plus), Al Ustadz Irwan Sidebang, Sekda GandiWartha Manik, Pelaksana Tugas (Pgs) Kementrian Agama Drs. Syfrijal Bancin, para pimpinan SKPD. Al Ustadz Irwan Sidebang dalam ceramahnya mengatakan, halal bi halal hendaknya harus bersih dan suci seperti bayi. Juga, imbuhnya, diharapkan kepada masyarakat agar senantiasa untuk tetap memupuk silaturahmi dan tetap menjaga rasa persaudaraan yang tinggi antar sesama umat beragama khususnya di Pakpak Bharat. Kapolres Pakpak Bharat AKBP Suriadi Bahar menyebutkan, Muspida dalam hal ini khususnya Polres Pakpak Bharat mengajak sengenap masyarakat untuk menciptakan wilayah Pakpak Bharat menjadi wilayah yang terhormat, terbaik, dipuji dan disegani oleh wilayah lainnya. (c08)

Bertandang Ke Rumah Teman, Sepeda Motor Lewong PEMATANGSIANTAR (Waspada): Ketika bertandang ke rumah teman, sepeda motor karyawan Maligas A, Syahrir Bardan, 44, warga Perumahan Perkebunan Maligas A, Nagori Pengkolan, Kec. Bosar Maligas, Kab. Simalungun, lewong. Keterangan dihimpun dan pengaduan korban di Polsek Bosar Maligas, Polres Simalungun, Senin (27/9) menyebutkan sepeda motor Yamaha Jupiter MX BK 6785 SV dibawa kabur maling dari jalan umum depan rumah saksi Legimin, Huta Rendahan, Nagori Bosar Maligas, Bosar Maligas, Simalungun, Minggu (26/9) malam. Sepeda motor itu diparkir di pinggir jalan depan rumah Legimin dengan stang dikunci. Sesudah beberapa lama berbincang-bincang dalam rumah Legimin, saat hendak pulang dia sangat terkejut karena sepeda motornya sudah tidak ada. Korban bersama Legimin dan warga lainnya mencoba mencari sepeda motor itu, namun tetap tidak ditemukan hingga akhirnya mengaduk ke Polsek Bosar Maligas. Kapolres Simalungun AKBP Drs. Marzuki, MM saat dikonfirmasi melalui Kabag Ren Kompol Ramli Sirait, Kasubbag Humas Iptu Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK di Mapolres, Selasa (28/9) menyebutkan masih dalam penyelidikan.(a14)

KMPH Adukan Dugaan Mark Up DAK Ke Kejatisu SIMALUNGUN (Waspada): Komunitas Masyarakat Peduli Hukum (KMPH) Pematangsiantar mengadukan dugaan praktik penggelembungan (mark-up) harga plafon gipsum/profil pada pelaksanaan DAK (Dana Alokasi Khusus) Dinas Pendidikan SimalungunTahunAnggaran2009 ke Kejaksaan Tinggi Sumatera Utara (Kejatisu). Pengaduan KMPH dilayangkan pada 14 September 2010 dengan nomor surat R-83/ KMPH/S-S/09/2010, ditandatangani Ketua KMPH RS Gultom dansekretarisPantunNapitupulu. Selain ke Kejatisu, surat pengaduan tersebut juga ditembuskan kepada Jaksa Agung RI, Jaksa Agung Muda Intelijen, Jaksa Agung Muda Tindak Pidana Khusus, Satgas Pemberantasan Mafia Hukum di Jakarta, Ketua KPK di Jakarta dan Kadis Pendidikan Simalungun.

Adapun laporan dugaan Mark-Up proyek DAK tahun 2009 tersebut melibatkan pengusaha/rekanan pemasok bahan gypsum/profildenganinisialMis, penduduk Kec. Percut Seituan. Dalam pengaduan KMPH dikatakan, berdasarkan survei di lapangan diketahui standar harga pasar tertinggi untuk pembeliangypsumdiMedandan sekitarnyaadalahsenilaiRp45.200 per meter kubik dan harga ini sudah termasuk upah pemasangan dan pajak. Namun,dalampelaksanaannyadi250sekolahyangmendapat proyek DAK di Kab.Simalungun harga yang ditetapkan Mis mencapai Rp99.780 per meter kubik sudah termasuk upah pemasangan dan pajak. Harga tersebut dinilai terlalu tinggi hingga lebih dari seratus persen dibanding dengan harga pasaran yang hanya Rp 45.200

10 Pasangan Cabup-Cawabup Karo Siap Kalah BERASTAGI (Waspada): Sepuluh pasangan Calon Bupati/ Calon Wakil Bupati Tanah Karo periode 2010-2015 menandatangani kesepakatan pemilihan kepala daerah/wakil kepala daerah secara damai. Mereka juga menyatakan siap kalah dan siap menang pada Pemilulada Karo 27 Oktober mendatang. Penandatanganan kesepakatan dilakukan dalam suatu acara yang diprakarsai Polres Tanah Karo di Hotel Sibayak Berastagi, Selasa (28/9). Kesepuluh pasangan calon itu yakni nomor urut 1 Siti Aminah br Perangin-angin–Sumihar Sagala, 2. Riemenda Jamin Ginting–Aksi Bangun, 3. Sumbul Sembiring Depari–Prof Paham Ginting, 4. Roberto Sinuhaji– Firman Amin Kaban, 5. Kol (Purn)

Drs Abednego – Ir Sanusi Serbakti, 6. Nabari Ginting–Paulus Sitepu, 7. Dr Ir Petrus SitepuKornalius Sembiring, 8. H Muhammad Ramli Purba – Roni Barus, 9. DR (HC) Kena Ukur Karo Jambi –Terkelin Berahmana dan 10. Andi Natanael Ginting SH – Samadin Tarigan. Penandatanganan itu disaksikan Kapolres Tanah Karo AKBP Ignatius Agung Prasetyoko, Bupati Karo yang diwakili Kaban Kesbang Pol dan Linmas Suang Karo-Karo, Ketua KPUD Karo Benyamin Pinem, Wakil Ketua DPRD Ferianta Purba, Dandim 0205/TK Letkol Inf M Simorangkir, anggota Panwaslu, anggota DPRD Karo dan pimpinan partai politik. Naskah kesepakatan yang ditandatangani di antaranya

Ny Dina Riana Samosir: Generasi Muda Dituntut Siap Bersaing Di Era Globalisasi PANDAN (Waspada) : Ketua TP PKK Tapteng Ny Dina Riana Samosir menyatakan, generasi muda dituntut harus siap dan mampu bersaing dalam era globalisasi saat ini. Terlebih, menghadapi kecanggihan teknologi yang tidak hanya memberikan efek positif bagi etika dan moral anak bangsa ini. Selain Iptek, generasi muda harus selalu menjaga kesehatan. Terlebih bagi Akademi Keperawatan (Akper) Pemkab Tapteng yang diharapkan dapat memberikan peningkatan pelayanan kesehatan bagi masyarakat daerah setempat. Hal itu disampaikan Dina Riana Samosir dalam kuliah umum di hadapan ratusan mahasiswa Akper Pemkab Tapteng di Kampus Akper Kelurahan Sibuluan,Pandan,Tapteng,Kamis (23/9) petang. Dina menegaskan, kendati Akper Pemkab Tapteng masih dalam tahap merintis baik sarana prasarana pendukungnya, namun tidak dapat menjadi alasan untuk mengendorkan semangat dalam proses belajar mengajar.

Pembangunan di Kabupaten Tapteng, kata Dina, pada hakekatnyabelumbisaterhentisampai disinisaja.Banyakpembangunan yang harus diselesaikan dan ditingkatkan demi mencapai tujuan mensejahterakan masyarakat Tapteng ini. “Anggaran Pemkab Tapteng sangatminimuntukmenampung peningkatan pembangunan, jadi perlu terobosan agar mampu menghasilkan income yang lebih besar bagi PADTapteng, sehingga dapat menampung pembangunankesegalasektorvital,termasuk dunia pendidikan seperti Akper Tapteng ini,” ungkap Dina. Hal itu dilakukan agar profesional dan kemahiran para lulusan Akper Tapteng tidak diragukan lagi saat bekerja melayani kesehatan masyarakat. Bupati Tapteng Tuani Lumbantobing yang berhadir juga berpesan agar mahasiswa Akper Tapteng benar-benar memanfaatkan fasilitas yang telah dibangun sejak 2008 silam itu. Direktur Akper Tapteng dr Dimpos Hasugian mengutarakan,

Waspada/Zulfan Nasution

KULIAH UMUM : Dina Riana Samosir menyampaikan kuliah umumnya di depan puluhan mahasiswa Akper Pemkab Tapteng, Kamis (23/9) petang. peserta didik di lembaga pendidikan kesehatan itu sebanyak 58 orang dan menampung puluhan mahasiswa di asrama dengankondisikamarmandiyang masih minim.

Dijelaskan, tenaga pengajar di Akper Pemkab Tapteng ini sebanyak 18 orang, termasuk denganpendidikjenjangpendidikan strata 2 (S2) sebanyak 3 orang dan seorang dokter spesialis. (a18)

Penetapan KBR Dinas Kehutanan DS Bermasalah LUBUKPAKAM (Waspada) : Penetapan Kebun Bibit Rakyat (KBR) di Kabupaten Deliserdang dinilai bermasalah. Ada dua kelompok pengelola yang ditetapkan menerima bantuan, namun diduga tidak pernah bergerak di bidang pengelola tanaman hutan. Hal itu terungkap saat sejumlah anggota kelompok pengelola hutan mangrove asal Kec.Pantai Labu mendatangi kantor Dinas Kehutanan Deliserdang mempertanyakan alasan penetapan kelompok AJ dan M sebagai penerima bantuan KBR, Senin

(27/9). Salah seorang perwakilan pengelola hutan tanaman mangrove asal Desa Paluh Sebaji Kec.Pantai Labu, Nazaruddin sangat menyesalkan sikap Dinas Kehutanan Deliserdang yang menetapkan dua kelompok pengelola tersebut. “Kenapa kelompok AJ yang baru terbentuk Juni 2010 ditetapkan mendapat bantuan KBR, padahalpihaknyasejak2005telah mengelolalahanhutanmangrove di Paluh Sibaji,” paparnya. Nazaruddin menuding penetapan kelompok AJ sebagai

penerima KBR cacat. Hal ini diyakini karena lahan yang diajukan sebagai lokasi penanaman adalah lahan yang sudah dikelola kelompoknya sejak 2005. Dijelaskannya, KBR diperuntukkan kepada kelompok warga atau desa yang perduli kepada lingkungan hidup. Setiap kelompok mendapat dana Rp50 juta, sedangkan tugas kelompok menyediakanlahanpembibitanserta menyediakan lahan untuk ditanami. Sedangkan di Kab. Deliserdang ada sekira 25 kelompok. Dinas Kehuatanan Pemkab

Deliserdang menjelaskan, program KBR diperuntukan kepada kelompok yang perduli terhadap penghijuan. Sedangkan terkait permasalahan adanya dua kelompok yang tidak pernah mengelola tanaman hutan tapi mendapat dana bantuan KBR pihakya tidak mengetahuinya. “Setiap kelompok yang mengajukan permohonan proposal dinilai oleh UPT Ditjen Rehabilitasi Lahan dan Perhutanan Sosial, kemudian ditetapkan oleh Dinas Kehutanan Deliserdang,” ujar Ramadhana, staf Dinas Kehutanan Deliserdang. (a05)

Gadis ABG Korban Pencabulan P. BRANDAN (Waspada): Menggagahi wanita yang masih duduk di bangku kelas tiga SMP, HJH, 21, wargaDesaPaluhmanis, Kec. Gebang,KabupatenLangkat terpaksa berurusan dengan hukum. Tersangka ditangkap keluarga korban dan langsung diserahkan ke Polsek P.Brandan, Senin (27/9). Menurut keterangan, korban,WK, 14, mendapat kiriman paket dari Pangkalan Kerinci,

Riau, yang dikirimkan melalui perusahaan bus antar provinsi perwakilan P.Brandan di Alur, Kec. Sei. Lepan. Di kemasan paket tertera nomor handphone korban. Pelaku yang kerab bergaul di terminal itu mencoba menghubungi nomor tersebut, Minggu (26/9) malam dengan modus menginformasikan ada titipan paket. Keduanya berjanji ketemu di satu tempat di Jl. Lingkar

per meter kubik. Atas adanya mark up dan ketentuan harga yang ditentukan oleh pengusaha bernama Mis tersebut, maka negara berpotensi dirugikan sebesar Rp 3,7 miliar lebih. Kemudian bentuk pelanggaran lainnya yang dilaporkan KMPH antara lain terjadinya praktik monopoli dalam pelaksanaan kegiatan DAK tahun 2009 di Simalungun khususnya untuk pengadaanplafongypsum/profil. Pengadaan plafon gibsum/ profil hanya dilaksanakan dua rekanan masing-masing UD TJ dan CV KM Sejahtera yang direkturnya adalah MIS sendiri. Kemudian, pelaksanaan DAK diduga telah melanggar petunjuk teknis (juknis) dan petunjuk pelaksanaan (juklak) yang seharusnyadilakukansecaraswakelola murni oleh komite sekolah, namun kenyataannya dimonopoli oleh Mis. (a15)

Alurdua. WK dengan perasaan gembiramenerimakirimanpaket datang tanpa sedikit pun menaruhkecurigaanterhadappriayang belum dikenalnya itu. Rayuan tersangka akhirnya berhasil mencabuli korban beberapa kali. Setelah pagi, tersangka mengantarkan korban pulang ke rumahnya di Pelawi Utara, Kec. Babalan, setelah itu pelaku langsung beranjak pergi. Orangtua korban mencium ada sesuatu yang tak beres terhadap putrinya.

Setelah didesak, korban mengakui ia dicabuli pria yang baru dikenalnya. Menerima pengakuan ini, keluarga korban tak terima dan mencari HJH. Pelaku berhasil diamankan selanjutnya diserahkan ke polisi. Kapolsek P. Brandan AKP HM Kosim Sihombing, Senin (27/9) membenarkan kasus tersebut. Menurut dia, pelaku dijerat pasal 82 UU RI No.23 Tahun 2002 tentang Perlindungan Anak dengan ancaman hukuman 15 tahun penjara. (a02)

mentaati dan menepati jadwal, waktu dan tempat kampanye rapat umum dan di luar rapat umum yang disepakati pasangan calon dan tim kampanye. Menolak dan menentang setiap tindakan kekerasan dan anarkisme, bentrok fisik, money politics serta menghindari segala bentuk pelanggaran maupun tindakan anarkis yang merugikan semua pihak. Kemudian mematuhi dan melaksanakan ketentuan dan peraturan perundang-undangan yang berlaku dan keputusan KPUD Karo No:05/ KPU-KK/ Pilkada/ V/2010, tentang pedoman teknis kampanye pada Pemilukada Karo 2010 dengan berkoordinasi kepada Pemkab Karo dan Polres. Pasangan Cabup dan CawabupKaroitu bersamatimkampanye/Jurkam pada mendukung semua tugas Polri dalam penegakan hukum untuk mengambil tindakan tegas setiap orang yang melakukan kejahatan/ pelanggaranhukumdalampelaksanaan Pemilukada Karo. Kapolres Tanah Karo AKBP Ignatius Agung Prasetyoko mengatakan, aparat kepolisian siap mengamankan pelaksanaan Pilkada tersebut dengan memegang prinsip netralitas. Kapolres juga mengajak seluruh pasangan calon, tim pemenangan masing-masing calon dan simpatisan untuk tidak melakukan pelanggaran. (c06)


Pengungsi Sinabung Tuntut Biaya Hidup KABANJAHE (Waspada) : Ratusan pengungsi korban letusan Gunung Sinabung dari Desa Berastepu, Kec. Simpang Empat dan Desa Guru Kinayan, Kec. Payung di Jambur Lige, Kabanjahe, kembali mendatangi gedung DPRD Karo,Senin (27/9). Mereka meminta jawaban atas tuntutan dan usulan mereka kepada Pemkab Karo melalui DPRD Karo, Jumat (23/9) lalu, di antaranya kebutuhan pokok hidup, biaya keperluan anak sekolah dan biaya penunjang lainnya. Namun, karena belum ada jawaban jelas, para pengungsi bersama sejumlah anggota DPRD Karo melakukan long march dari gedung DPRD ke kantor Bupati Karo di Jalan Djamin Ginting. Anggota DPRD yang mendampingi mereka, antara lainWakil Ketua DPRD Karo Ferianta Purba dan Ir. Onasis Sitepu, Ketua Komisi A Sudarto Sitepu, Ketua Komisi C Harison Sitepu serta anggota dewan Rendra Gaule Ginting dan Ir.Thomas Sitepu. Kedatangan pengungsi itu diterima Asisten II Drs. Ismail Ginting, Asisten III Ramli Sembiring, Kepala Bappekab Ir Pantas Samosir, Inspektur Inspektorat KaroWalman Pasaribu dan sejumlah pejabat Pemkab Karo, KapolresTanah Karo AKBP Ig. Agung Prasetioko. Sedangkan mewakili pengungsi di antaranya S Mulia Sembiring dan Ikut Ginting selaku koordinator posko. Dalam pertemuan itu anggota legislatif kembali minta penjelasan pemerintah mengenai tuntutandanpermintaanparapengungsitersebut. Karena, katanya, selama 3 minggu di pengungsian mereka tidak bekerja sehingga tidak berpenghasilan. Juga dipertanyakan menyangkut jaminan keselamatan masyarakat yang sudah pulang kampung.

Mereka juga mempertanyakan dasar pemerintah mengimbau warga dari Desa Berastepu dan Desa Guru Kinayan boleh pulang, sementara tiga desa, Desa Suka Meriah, Desa Bekerah dan Desa Simacem berada dalam radius kurang dari 3.5 km dari Gunug Sinabung belum diizinkan pulang. Sedangkan Desa Guru Kinayan dan Desa Sukameriah masih dalam radius 3,5 km. Pengungsi juga mempertanyakan kebutuhan logistik setelah pulang ke desanya masing-masing, mengingat selama di penampungan, mereka tidak bekerja sehingga persediaan uang sudah habis.MerekamohonkepadaPemkabKaromembantu pengadaan logistik untuk dibawa ke kampung mereka. Salah seorang pengungsi juga mempertanyakan penggunaan bantuan dari Presiden SBY Rp15 miliar. Asisten II Ismail Ginting mengatakan, penanganan tanggap darurat Sinabung 24 September 2010. Alasannya, sesuai peraturan dan perundangundangan apabila penanganan tanggap darurat sudah berakhir, bantuan berupa materi yang berasal dari donatur berbagai pihak dan logistik yang terdaftar di Pemkab Karo tidak dapat disalurkanlagi. Meskidemikian,kataIsmailGinting, bagi pengungsi yang belum mau pulang tidak menjadi masalah kebutuhan hidup sehari-hari akan tetap disiapkan oleh pemerintah. Ismail Ginting menambahkan, bantuan donatur korban bencana alam Gunung Sinabung dari berbagai pihak mencapai Rp 5.126.585.000 dan tidak ada bantuan dari presiden Rp15 miliar. Anggota DPRD Karo, Ir Thomas Sitepu dan Ketua Komisi A Sudarto Sitepu, Senin (27/9) mengatakan, tuntutan para pengungsi itu akan dibahas dalam PAPBD Karo 2010. (c06)

Bursa Calon Ketua PWI Perwakilan P. Siantar-Simalungun Menghangat PEMATANGSIANTAR (Waspada): Panitia pelaksana dan panitia pengarah yang akan melaksanakan Konfrensi PWI Perwakilan Pematangsiantar-Simalungun sudah dibentuk sehubungan akan berakhirnya masa jabatan pengurus periode 2007-2010. Sementara, bursa calon ketua mulai menghangat dengan munculnya nama-nama yang cukupdiperhitungkanmemimpinPWIPerwakilan Pematangsiantar-Simalungun periode tiga tahun kedepan(2010-2013)termasukLimsonHutabarat yangsekarangmasihduduksebagaiketua,mantan ketua periode 2007-2010 Sunardinsyah yang akrab dipanggil Birong. Sedang nama lainnya yang bakal diperhitungkan yakni Pariaman Pakpahan dan lainnya. Pembentukan panitia pelaksana (organizing committee/OC) dan panitia pengarah (steer-

ing committee/SC) dilaksanakan dalam rapat PWI Perwakilan Pematangsiantar-Simalungun dipimpinKetuaPWIPerwakilanLimsonHutabarat dan didampingiWakil Ketua M.Yamin Indra,Wakil Sekretaris Tumpak Panjaitan dan Bendahara Sasongko, SH serta dihadiri para anggota di ruang pertemuan PWI Perwakilan di Pematangsiantar, Sabtu (24/9) sore. Sesuai saran Ketua PWI Perwakilan dalam rapat yang berlangsung demokratis agar dipilih dulu ketua panitia dan ketua panitia memilih sendiri sekretaris serta panitia lainnya, terpilih sebagai Ketua OC Drs Jasa Peranginangin,Wakil Ketua Akam Sibarani, Sekretaris Dra SeniWardani, Bendahara Rikkar Napitu, SH serta dilengkapi seksi-seksi. Sedang Ketua ST terpilih Limson Hutabarat, Sekretaris Drs Kardiman Turnip dan anggota Riswan Efendy.(a14)

Sumatera Utara


Uang DAK Pendidikan Diambil Sebagian Guna Penuhi Panggilan Kejatisu P.SIDIMPUAN (Waspada): Kepala Sekolah Dasar Negeri (SDN) penerima Dana Alokasi Khusus bidang pendidikan Kota Padangsidimpuan 2009, Rosida, dalam sidang lanjutan perkara dugaan korupsi DAK, mengaku mengambil sebagian uang itu untukbiayamemenuhipanggilan Kejaksaan Tinggi Sumatera Utara (Kejatisu) di Medan. Sementara, Kepala SDN lain, Syafri Nasution, mengaku menyerahkan Rp27.600.000 dari total pagu anggaran DAK untuk sekolahnyakepadaterdakwaMH, mantan Kasi Sarana Prasarana Disdik Padangsidmpuan, di warung nasi Mak Nuar pinggir Jalinsum, Kel. Sihitang. Pengakuan itu terungkap dalam persidangan di Pengadilan Negeri (PN) Padangsidimpuan dengan terdakwa MH, Selasa (28/ 9). Sidang dipimpin hakim ketua Tommy Manik, dengan anggota Taufik Nainggolan dan Zulfadli. Pada sidang lanjuta ini, dari 20 Kepala SDN yang diajukan Jaksa Penuntut Umum (JPU) Sri Mulyanti Saragih dan Sartono untuk menjadi saksi, hanya 16 yang hadir memberi kesaksian. Terkait itu, majelis hakim memerintahkan JPU menghadirkan 4 saksi tersebut dalam sidang berikutnya.

Persidanganberlangsungalot karena majelis hakim berusaha membuat para saksi memberikan keterangan sebenarnya, karena banyak saksi berupaya menyembunyikan apa yang mereka rasakan dan alami terkait perkara dugaan korupsi ini. Berbagaicaradilakukanketua majelis,Tommy Manik, agar para saksi yang sudah disumpah itu memberiketerangansebenarnya. Salah satunya dengan cara menyuruh beberapa saksi duduk di kursi pesakitan. Akhirnya cara itu berhasil. Anehnya, setiap menjawab pertanyaan hakim, kuasa hukum terdakwa, dan JPU, jawaban seluruh saksi selalu seragam dan sesuai jawaban saksi yang duduk di kursi pesakitan. Termasuk apakah benar mereka memotong anggaran DAK, mendapat keuntungan dari DAK, dan menyerahkan uang ke terdakwa MH. Seperti saksi Gong Matua Rangkuty, mengaku memotong anggaran DAK itu dan mendapat keuntungan Rp 6 juta. Dia juga mengambil uang DAK tersebut Rp 29,4 juta untuk diserahkan kepada terdakwa MH di kantor Dinas Pendidikan Kota Padangsidimpuan. Saksi Ahmad Rizal Lubis

mengaku untung Rp 7 juta, dan menyerahkanRp29,4jutakepada terdakwa MH. Saksi Maslina menyerahkan Rp 20 juta kepada MH, dan dia mengaku tidak mendapat keuntungan apapun. Karena dia hanya melanjutkan kerja kepala sekolah lama yang sudah meninggal. Latifah Hannum Siregar memperoleh keuntungan dari DAK Rp 6 juta, dan menyerahkan 29,4 juta kepada MH. Ssksi Syafri Nasution memperoleh untung Rp 6 juta dan menyerahkan Rp 27,6 juta kepada MH di warung nasi pinggir Jalinsum Kelurahan Sihitang. NursaidaHarahapmendapat keuntungan Rp 10 juta dan menyerahkanRp26,7jutakepada MH. Saksi Nursaibah Sinaga mendapat keuntungan Rp 8 juta dari DAK yang dialokasikan ke sekolahnya. Sitiasa Pasaribu mendapat Rp 9 juta dan menyerahkan Rp 25 juta ke MH. Kepala SDN yang paling sedikit memperoleh keuntungan dari alokasi DAK ke sekolahnya adalah Rabiah dan Masna Dewi, mereka mendapat Rp 3 juta. Rabiah menyerahkan uang Rp 29,4 juta kepada MH, sedangkan Masna Dewi menyetor Rp 27 juta. Kepada majelis hakim, para saksimengakuperbuatanmereka

yang memotong anggaran DAK itu adalah salah. Karena uang tersebut merupakan uang negara yang diperuntukkan bagi pembangunan sekolah. Untuk itu, majelis hakim menyarankan kepada para saksi agar mengembalikanuangnegaratersebut dengan cara menitipkannya kepada jaksa. Hakim menanyakan kenapa para saksi melakukan itu. Mereka mengaku diperintah langsung walaupun tidak ada bentuk surat perintah sebagai bukti nyata. Merekamaumenurutiitu,karena terdakwa MH mengaku disuruh Kadisdik, PH. “Memang tidak ada terucap sanksi apa yang akan kami terima apabila tidak menyerahkan uang tersebut. Tapi sebagai bawahan, kami harus loyal pada atasan, dan jujursajapadasaatitukamitakut,” kata para saksi. Majelis hakim menunda persidanganhinggapekandepan, Selasa (5/10). Usai sidang terdakwa MH, maka ke-16 saksi jugadimintaikesaksiannyadalam persidangan terdakwa PH, mantanKepalaDinasPendidikan KotaPadangsidmpuan.Parasaksi memberi kesaksian yang sama dengan persidangan terdakwa MH. (a20)

Keuangan Pemkab Madina Defisit PANYABUNGAN(Waspada): KepalaDinasPengelolaKeuangan danAsetDaerahPemkabMadina A.Rasyid Ritonga,MM mengakui defisit anggaran keuangan APBD TA 2010.Hanya saja dia yang baru sekitar 2,5 bulan minggu dilantik menjadi orang nomor satu di dinas keuangan itu belum berani mengungkapkan berapa besaran angka pastinya. “Benar terjadi defisit anggaran di tubuh Pemkab Madina, namun kami membantah jika disebutkan kebobolan.Angka finalnya belum diketahui secara pasti,karena masih dilakukan perhitungan-perhitungan,” ujar

Rasyid Ritonga, Senin ( 27/9). Saat didesak apa penyebab defisit,Ahmad Rasyid yang sebelumnya bertugas sebagai Kadis Kehutanan dan Perkebunan menjelaskan,adanya sejumlah pos pengeluaran yang tak ditampung di APBD 2010, kemudian diperparah belum maksimalnya kucuran Bantuan Daerah Bawahan dari provinsi serta perolehan Pendapatan Asli DaerahPAD)TA 2010yanghingga September ini masih di bawah 50 persen. Rasyid melanjutkan, terjadinya pertambahan jumlah pegawai akibat penerimaan

CPNS tahun 2009 serta pembekakan pengeluaran di pos tunjangan jabatan akibat keterterlambatan masuknya data dari Badan Kepegawaian Daerah Madina merupakan dua dari beberapa hal penyebab defisit. Kebenaran defisit ini tak dibantah Plt Sekdakab Madina, H.Gozali Pulungan, Senin (27/ 9). “Namun, secara teknis, lebih pas dijawab Kadis Pengelola Keuangan dan Aset Daerah,” katanya Defisitanggarantersebutjuga diakui Pj Bupati Madina Ir Aspan Sofian Batubara.MM, namun dia

enggan menyebutkan jumlah besaran defisit yang sebenarnya. Aspan yang juga belum beberapa hari dilantik menjadi Pj Bupati Madina juga membantah jika disebutkan sebagai kebobolan. Menurut keterangan dihimpun,merebaknya khabar keuanganPemkabMadinamengalami defisit sekitar Rp 53 miliar di tahun anggaran 2010 ini juga terungkap melalui bocoran hasil rapat koordinasi Pj. Bupati Madina Aspan Sofian Batubara dengan para pimpinan Satuan Unit Kerja Daerah (SKPD) di ruang rapat bupati, Senin (27/9). (a24)

Terkait Pemberantasan Teroris, Pemkab Tapsel-Palas Siap Dukung Aparat Keamanan P.SIDIMPUAN (Waspada): Pemkab Tapanuli Selatan dan Padanglawas menyatakan kesiapannya mendukung dan bekerjasama dengan aparat keamanan negara dalam pemberantasan jaringan serta kegiatan teroris di daerahnya . “Kitasiapmendukungaparat keamanan negara dalam memberantas aksi terorisme,” kata BupatiTapsel H Syahrul Pasaribu, danWakil Bupati Palas H Ali Sutan Harahap (TSO) secara terpisah usai menghadiri acara halal bi

halal di Makodim 0212/TS, Jalan Imam Bonjol, Kota Padangsidimpuan, Senin (27/9). Bupati Tapsel mengatakan, memang sudah seharusnya semua pemerintah daerah mendukung kinerja aparat keamanan. Apalagi dalam mengantisipasi secara dini terhadap pergerakan teroris dan pengacau keamanan di tanah air. Syahrul M Pasaribu menegaskan,sebagaibentukdukungan tersebut, Pemkab Tapsel akan mensosialiasikan kepada seluruh

masyarakatnyauntukmembantu aparatkeamanandalammenjaga kondusifitas daerah. Wakil Bupati Palas H Ali Sutan Harahap mengatakan, pihaknya akan mengintensifkan kembali Sistem Keamanan Lingkungan (Siskamling) mulai dari tingkat desa/kelurahan hingga tingkat lingkungan atau RT/RW. Diakuinya,selamainiSiskamling sudah mulai langka di Palas dan bahkan hampir sudah tidak ada lagi desa atau kelurahan yang menggalakkannya. Padahal

Pemkab Sergai Salurkan Bantuan Rp 1,2 M Untuk Kube PANTAICERMIN (Waspada): Dinas Sosial Pemkab Sergai menyalurkan bantuan pemberdayaan fakir miskin 2010 Rp 1,2 miliarkepada60KelompokUsaha Bersama (Kube). Bantuan Kube berasal dari dana dekontrasi program kerjasama Dinsos Sergai, Dinsosi Sumut dan Kementerian Sosial itu, tersebar di Kec. Seirampah 15 kelompok di tiga desa, Dolok Masihul 20 kelompok di empat desa, Pantai Cermin 10 kelompok di dua desa, Sei. Bamban 15 kelompok di tiga desa. Masing-masing Kube menerima Rp 20 juta untuk dimanfaatkan sesuai jenis usaha kelompok dalam upaya peningkatan kesejahteraanfakirmiskin.KubeKecamatan Pantai Cermin diserahkan Bupati Sergai HT Erry Nuradi kepada para Ketua Kube. Bantuan barang keperluan nelayan dan ternak kambing arsip diserahkan dalam halal bi halal di halaman Kantor Camat Pantai Cermin, Senin (27/9). Kelompok usaha bersama masyarakat yang menerima bantuan tersebut “Burung Camar” Desa Kotapari untuk jenis usaha nelayan, “Mekar Bersama” Kotapari jenis usaha nelayan, “Mawar Indah” Kotapari jenis usaha beternakkampingarsip,“Menanti Pelangi” Kotapari jenis usaha nelayan,“Bersatu” Kotapari jenis usahanelayan,“Serasi”DesaPantai Cermin Kiri jenis usaha beternak kambing arsip, “Cempaka” Pantai Cermin Kiri jenis usaha beternak kambing arsip, “Mekar Jaya” Pantai Cermin Kiri jenis usaha beternak kambing arsip, “Teratai” Pantai Cermin Kiri jenis usaha beternak kambing arsip, dan “Kenang” Pantai Cermin Kiri dengan jenis usaha beternak kambing arsip. HadirWakil Bupati Sergai H. Soekirman, Ketua TP PKK/anggota DPRD Sumut Ny. Hj Evi

Waspada/Eddi Gultom

BANTUAN KUBE : Bupati Sergai HT Erry Nuradi didampingi Ketua TP PKK Sergai/anggota DPRD Sumut Ny Hj Evi Diana menyerahkan bantuan program pemberdayaan fakir miskin kepada Ketuaketua Kelompok Usaha Bersama (Kube) se-Pantai Cermin, Senin (27/9). Diana, anggota DPRD Sergai Agusnedi, Ketua DPC GOPTKI Sergai Ny. Hj. Marliah Soekirman, para staf ahli bupati, Kadis Sosial HermanSitorus,KadisBinamarga Ir H Yusran Safri, Kadis Tarukim Erwin, Camat dan Uspika Pantai Cermin, Kepala KUA Pantai Cermin Makmur MA, tokoh masyarakat,pemukaagama,paraKades, Kadus kepala dusun dan warga. Bupati dalam sambutannya mengatakan, bantuan yang dikucurkan melalui Kube untuk program pemberdayaan fakir miskin di daerah ini patut disyukuri bersama, karena pemerintah tetap dan terus meningkatkan kepedulian terhadap masyarakat terutama fakir miskin. Bantuan tersebut, harap Erry Nuradi, benar-benar dapat dimanfaatkanmasyarakatmelalui kegiatan Kube. Bantuan program pemberdayaan fakir miskin melalui 60

Kube di Sergai, menurut Erry, bermanfaat bagi 600 kepala keluarga karena setiap satu Kube beranggotakan 10 KK. Dikemukakan, dikucurkannya bantuan untuk Kube itu adalah berkat kepercayaan yang diberikan Pemprovsu dan Kementerian Sosial kepada Pemkab Sergai. “Bantuan yang sama akan terusdiupayakanpeningkatannya pada masa mendatang,” lanjut Bupati. Erry Nuradi juga berharap kepada masyarakat untuk tetap kompak menjaga persatuan serta kebersamaan dalam menjaga suasana Kabupaten Sergai tetap kondusif. Acara silaturahmi itu diisi tausiyah agama seputar halal bi halal oleh Kepala KUA Pantai Cermin Makmur MA yang mengetengahkan bahwa halal bi halal merupakan salahsatu tradisi di Indonesia yang terus dilaksanakan.(a07)

Siskamling ini merupakan cara pengamanan paling efektif di malam hari terhadap lingkungan pemukiman masyarakat. Pendataan warga, khususnya warga pendatang akan semakin diperketat. Seperti identitas, pekerjaan,aktivitasselamainidan apa tujuanya datang ke daerah tersebut. Semuanya akan dipertanyakan,danbilaadahalyangmencurigakan. Maka aparat pemerintahan desa akan mengkoordinasikannya dengan BabinkamtibmasPolridanBabinsaTNI yang ditugaskan di daerah setempat. (a20)

WASPADA Rabu 29 September 2010

Calhaj Asal Madina Berangkat Dalam Kloter XI PANYABUNGAN(Waspada): Sebanyak 491 calon jamaah haji (calhaj) asal Kabupaten Mandailing Natal berangkat melalui kelompok terbang (kloter) XI Embarkasi Polonia Medan. Inisesuaidenganhasilqur’ah atau penentuan waktu/jadwal yang diselenggarakan Kantor

Kementerian Agama Sumatera Utara di Medan beberapa waktu yang lalu. “Berdasarkan hasil qur’ah yang dilakukan Kantor Kementerian Agama Sumut, calhaj asal Madina berjumlah 491 orang diberangkatkan melalui kloter XI, namun kita belum menerima

jadwal keberangkatan maupun jadwal masuk asrama,” ucap Kepala Seksi Urusan Haji dan Umroh Kantor Kementerian Agama Madina melalui stafnya Erwin Nasution, baru-baru ini. Namun Erwin memastikan bahwa dalam waktu dekat pihak Kementerian Agama Madina

akan menerima jadwal keberangkatan itu. Kemenag Madina telah melakukanbeberapakaliManasik Haji. Disamping itu, para calhaj yang berjumlah 491 orang juga sudah memperoleh suntikan vaksin meningitis pada Jumat (17/9) lalu. (a24)

Sumatera Utara

WASPADA Rabu 29 September 2010

Tim Monitoring TP PKK Propsu Berkunjung Ke Pakpak Bharat SALAK ( Waspada): Tim monitoring TP (Tim Penggerak) PKK Provsu terdiri dari Ratna Sari Nasution, Dra Harmayusni Safril dan Jonny Siagian, SH, Jumat (24/ 9 berkunjung ke Desa Salak II, Kecamatan Salak, Kabupaten Pakpak Bharat. Sebelumnya, tim dimaksud telah mengunjungi Desa Kuta Dame, Kec. Kerajaan dan Desa Kuta Jungak, Kec. Siempat Rube, Kab. Pakpak Bharat. Tim melihat perkembangan pembinaan TP PKK desa dan dusun serta kelompok dasa wisma, pembinaan dan pelaksanaan kegiatan desa percontohan

sepanjang jalan protokol menuju daerah wisata, peran serta warga PKK dalam kegiatan swadaya gotong-royong untuk pembangunandesa,pembinaandanpenataan buku-buku adaministrasi PKK juga peningkatan pengetahuandanketrampilanpengurus harian PKK desa. Acara berlangsung di halaman kantor kepala Desa Salak II yang dihadiri oleh Hj Idahliani Sagala Maju PadangWakil Ketua dan Anggota TP PKK Kabupaten Pakpak Bharat, beberapa pimpinan SKPD (Satuan Kerja Perangkat Daerah), Camat dan Kep-

des, Unsur Muspika, Ibu Ketua dan Anggota TP PKK Salak, Ketua dan Anggota BPD Salak II, Pengurus dan Anggota LPM, TP PKK Salak dan Perangkat Desa Salak II, tokoh masya-rakat, adat, agama, pemuda, serta para undangan lainnya se-Kec. Salak. Ketua PKK Pakpak Bharat, Made Tirta Remigo Yolando Berutu melaluiWakil Ketua TP PKK Kabupaten Pakpak Bharat Hj Idahliani Sagala Maju Padang dalam sambutannya mengatakan, untuk kegiatan desa percontohan sepanjang jalan protokol menuju daerah wisata kepada

TP PKK desa diminta agar benarbenar untuk melaksanakan sepuluh program PKK seraya membantu kepala desanya dalam mewujudkan dan melaksanakan program pembangunan. Oleh karena itu, TP PKK Kabupaten Pakpak Bharat juga mengucapkan terima kasih atas kunjungan Tim Monitoring TP PKK Provsu karena hal ini akan lebih memotivasi pengurus TP PKK kabupaten, kecamatan dan desa guna menjalan-kan program-program pembangunan yang direncanakan sebelumnya, ujar Hj Idahliani. (c08)


Sumatera Utara

B6 Batalyon Infanteri 125/ Si’mbisa Gelar Sertijab KABANJAHE (Waspada) : Batalyon Infantri 125/Si’mbisa menggelar serah terima jabatan (Sertijab) di lapangan hijau dipimpin Danbrigif (Brigade Infantri) 7/ RR (Rimba Raya) Kol Inf Ganip Warsito, Senin (27/9). Danbrigif (Brigade Infantri)

7/ RR (Rimba Raya) Kol Inf Ganip WarsitopadasaatsertijabDanyon 125/ Si’mbisa memberikan apresiasi dan rasa terima kasih kepada pejabat lama Letkol Inf Totok Sulistyono beserta istri. Dengan memberikan penugasan yang beragam, maka diha-

rapkan para perwira akan dapat menambah dan mengembangkan wawasan dan pengetahuan serta meningkatkan ketrampilan yang dimilikinya. Sehingga pada saatnya menjadi bekal yang berguna dalam pelaksanaan tugas-tugas berikut-

nya. “Selaku Danbrigif 7/ RR, saya ucapkan terima kasih dan penghargaan yang tulus kepada LetkolInfTotokSulistyonobeserta istri, yang telah melaksanakan tugasnya selama ini dengan baik,” katanya. (cmm/a17)

WASPADA Rabu 29 September 2010


WASPADA Rabu 29 September 2010

B7 Hujan Deras Tumbangkan Pohon

Kurang Dilibatkan, Pemuda Banda Aceh Gelar Kongres BANDA ACEH (Waspada): Selama ini, kalangan pemuda - khususnya di Kota Banda Aceh — terkesan kurang dilibatkan dalam pelaksanaan pembangunan di berbagai bidang oleh pemerintah. Padahal, kalangan pemuda juga memiliki kemam-puan untuk melakukan hal tersebut. Karenanya, kalangan pemuda di Banda Aceh menginginkan keterlibatan dan dilibatkan dalam kegiatan pelaksanaan program pembangunan, terutama yang menyangkut kepentingan masyarakat. Dalam upaya mewujudkan keinginan itu, sejumlah pemuda di Kota Banda Aceh, awal Oktober 2010 ini akan menggelar kongres dan akan membentuk Forum Persatuan Ketua Pemuda se-Kota Banda Aceh, karena dinilai pemerintah kurang melibatkan pemuda dalam membangun kota yang lebih baik. “Peran ketua pemuda di desa-desa di Aceh kurang, padahal ketua pemuda itu bagian dari pemerintahan gampong. Untuk itulah kami berencana melakukan kongres dan membentuk Forum Ketua Pemuda se Kota Banda Aceh,” kata Ketua Panpel Kongres I Ketua Pemuda Kota Banda Aceh, Usman Muhammad Adam, Kamis (23/9).(b07)

SIGLI (Waspada): Hujan deras disertai angin kencang yang melanda Kota Sigli, Pidie, Selasa (28/9) pagi menumbangkan sejumlah pohon dan mengganggu jaringan listrik serta menggenangi ruas jalan utama dalam Kota Sigli. Sebatang pohon kedondong ukuran besar berusia sekira 40 tahun lebih di komplek Asrama TNI Benteng, Kota Sigli tumbang dan merusak instalasi listrik serta hampir menimpa rumah dan warung warga. Pengamatan Waspada, tidak ada korban jiwa dalam peristiwa tersebut. Hanya saja warung kak Atik rusak ringan dan aliran listrik padam karena pohon tersebut tumbang menimpa jaringan listrik. Petugas PT. PLN Persero Cabang Sigli yang mengetahui adanya pohon tumbang di perkampungan tersebut langsung datang ke lokasi memperbaiki jaringan listrik yang rusak. Asmen Tehnik PT. PLN Cabang Sigli, M.Ishak mengatakan, pohon tumbang terjadi di beberapa lokasi Senin (28/9) sekira pukul 17:00. Selanjutnya pada Selasa (28/9) pohon ukuran besar juga tumbang mengganggu jaringan listrik di komplek Asrama TNI Benteng. Hujan yang mengguyur deras sejak pukul 07:00 Wib dan mulai mereda sekira pukul 10:30, menyebabkan ruas jalan utama Kota Sigli tergenang.Warga sulit melitas karena air tergenang setinggi 40 cm.(b20)

Konfercab PWI Aceh X Damaikan Dahlan Dan Iranda

Pembangunan Bendungan Mendesak PEUDADA, Bireuen (Waspada): Pembangunan bendungan irigasi Aneuk Gajah Rhet sebagai pengganti irigasi Peudada yang jebol dihantam banjir bandang tiga tahun lalu, senilai Rp30 miliar sudah terserap Rp16 miliar sudah rampung, namun belum berfungsi lantaran saluran primer belum dibangun. Camat Peudada Munawar, SH menjelaskan hal itu menjawab Waspada di kantornya Kamis (23/9). Dikatakan, para petani Peudada berharap pembangunan saluran primer sepanjang 10 kilomter untuk mengairi areal persawahan seluas 3.200 hektar di Peudada dapat segera dilanjutkan agar dapat berfungsi untuk dimanfaatkan para petani pada setiap musim tanam dua kali setahun. Dikatakan, dari 3.200 hektar sawah di Kec. Peudada hanya seluas 1.200 hektar yang sudah dapat diairi irigasi, sedangkan seluas 2000 hektar lagi masih sawah tadah hujan hasil panen masih belum maksimal. Di tempat terpisah Kepala Mukim Alue Rheing Tgk Yusuf Hamzah dan Kepala Mukim Paya M Yunus Saleh mengatakan, areal persawahan di Kemukiman Alue Rheing dan Paya masih tadah hujan. Hasilnya jauh masih rendah dibanding areal sawah yang diairi irigasi.(b16)

Aceh Dapat Insentif Harga Beras Rp400 ACEH UTARA (Waspada): H. Iskandar Saman, SE, Kepada Perum Bulog Sub Divisi Regional Wilayah I Lhokseumawe, mengatakan, Pemerintah pusat telah menambah insentif harga beras senilai Rp400, khusus untuk Perum Bulog Regional Aceh. Hal ini dilakukan pemerintah khusus untuk pengadaan beras dalam negeri. Dengan adanya tambahan insentif, Harga Pembelian Pemerintah (HPP) dari Rp5060 menjadi Rp5460 per kilogram.“Tambahan insentif ini hanya berlaku untuk Regional Aceh. Tambahan insentif ini juga sebagai perangsang untuk mitra usaha, agar mereka mau menjual beras ke Bulog. Selama ini, harga di pasaran tergolong tinggi,” terang Iskandar Saman kepada Waspada Kamis belum lama ini. Tambahan insentif untuk Perum Bulog Regional Aceh dilakukan sesuai keputusan Perum Bulog Pusat di Jakarta, hal ini dilakukan sebagai langkah penghematan biaya pengiriman beras dari luar Aceh. Kepada mitra usaha Perum Bulog Sub DivreWilayah I Lhokseumawe dihimbau untuk menjual berasnya ke Bulog dan segera memutuskan hubungan perdagangan dengan toke-toke di Medan, Sumatera Utara. Pemutusan hubungan bisnis beras dengan pengusaha di Medan cukup menguntungkan masyarakat Aceh, karena harga beras di pasaran akan stabil dan kualitas beras selalu terjaga dengan baik. “Lebih baik para mitra usaha menjual beras di daerah sendiri, selain menguntungkan mitra usaha juga menmguntungkan masyarakat Aceh,” ucap Iskandar. Jumlah kilang padi yang telah menjadi mitra usaha Perum Bulog Sub Divre Wilyah I Lhokseumawe telah mencapai seratusan lebih, namun yang masih aktif hanya tersisa belasan kilang padi, yakni Kp Hasrat Jaya di Meurah Mulia, Na Bacut di Lhoksukon, Sabar di Bireuen, Dua Saudara di Bireuen, Rahmad di Lhoksukon, Mekar Wangi di Meurah Mulia, Sumber Tanai di Pantonlabu, dan beberapa kilang padi lainnya. (cmun)

Pisang Diserang Bakteri Harus Ditimbun BIREUEN (Waspada): Kepala Dinas Pertanian, Perkebunan, Kehutanan dan Peternakan Kabupaten Bireuen, Ir. H. Azmi Abdullah, baru-baru ini usai acara Salaturrahim dan apel bersama di kantornya mengatakan, untuk mengatasi permasalahan yang meresahkan petani pisang di Kabupaten Bireuen, pihaknya telah melapurkan kejadian tersebut Balai Pengkajian Teknologi Pertanian di Banda Aceh untuk diselidiki penyebabnya. Menurut Azmi, penyakit yang menyerang tanaman pisang itu disebabkan Bakteri Pusarium. “Untuk membasminya pohon pisang yang diserang bakteri itu harus segera dibasmi dengan cara menimbun tanaman yang sudah diserang untuk mencegah penularannya,” ucap Azmi. Lebih lanjut dia menjelaskan, selain penimbunan tanaman yang terserang bakteri, Untuk mencegah penularan pada tanaman lainnya petani juga harus menyemprot dengan bakterisida. Dia mengatakan, tanaman pisang terserang bakteri mematikan tersebut tidak hanya terjangkit di wilayah Kabupaten Bireuen. Namun, hal yang sama juga dialami petani di sebagian besar wilayah Aceh lainnya. Sebelumnya, pada acara Silatarurahmi dan Apel Bersama jajaran intansi tersebut Bupati Bireuen, Nurdin Abdur Rahman antara lain menegaskan kepada PNS di jajarannya untuk bekerja mengharapkan kepada semua PNS untuk bekerja dengan ikhlas serta niat baik.(cb03)

POHON TUMBANG: Pohon kedondong tumbang dan hampir menimpa warung warga di Komplek Asrama TNI, Benteng, Kota Sigli, Selasa (28/9).

Aksi Pendangkalan Aqidah Merambah Bireuen BIREUEN (Waspada): Aksi pendangkalan aqidah merambah wilayah Kab. Bireuen. Sejumlah warga menemukan buku yang menurut mereka bertuliskan tentang ajaran pendangkalan aqidah dengan menyudutkan Islam. Ramadhan, warga Kec. Peudada kepada Waspada, Selasa (28/9) menuturkan, buku yang menyesatkan itu disebarkan di Desa Seuneubok Paya Kec. Peudada, Desa Teupok Tunong Kec. Jeumpa. “Saya menemukan tiga buku dan satu CD,” ucapnya. Dia menyebutkan, penyebar buku dan CD itu menggunakan sepeda motor sekira pukul 10:30. “Mereka melemparkan buku dan CD di rumah yang ada balai pengajian,” terangnya. Pada CD itu, lanjut Ramadhan, dicovernya bertuliskan, “Yang Kuasa Sudah Ubahkan Hati Yang Keras” serta nomor HP yang dapat dihubungi bagi siapa saja yang menginginkan CD tersebut. Kendati demikian, Ramadhan mengaku belum melihat isi CD tersebut atau pun cerita dalam buku-buku tersebut secara detail. “Saya belum membaca semua, tapi sekilas saya baca isinya sangat menyesatkan,” jelas Ramadhan seraya menyebutkan, buku dan CD itu sudah disita polisi. Menurut Ramadhan, akibat beredarnya buku-buku dan CD tersebut masyarakat resah. “Saya menduga penyebaran buku itu melibatkan warga setempat. Kalau tidak mana mungkin mereka tahu

tempat pengajian di kampung-kampung,” jelasnya. Karenanya, dia mengharapkan polisi menangkap pelaku dan mengamankan buku-buku itu guna menghindari kejadian-kejadian yang meresahkan dan mengganggu ketentraman antar umat beragama. Sementara menurut sumber lain, buku dan CD yang menyudutkan Islam itu juga disebarkan oleh pelaku di beberapa desa di wilayah Kec. Plimbang, Kab. Bireuen.

Sementara Kapolres Bireuen melalui Kapolsek Peudada, Ipda Mawardi, SE yang dikonfirmasi via telefon selularnya membenarkan adanya peredaran bukubuku tersebut di sana. “Kami sudah mengamankan empat buku dan satu CD, saya juga belum membaca secara rinci, kami masih di lapangan dan terus mencari buku-buku tersebut,” ucap Mawardi seraya menyebutkan, di mana pada setiap buku judulnya berbeda-beda.(cb03)

ACC Dan YL Motori International Coastal Cleanup 2010

Waspada/Abdul Mukthi Hasan

PERLIHATKAN BUKU: Dua warga Seuneubok Paya, Peudada, Bireeun, Selasa (28/ 9) memperlihatkan buku dan CD yang dinilai dapat mendangkalkan aqidah masyarakat Islam.

NU, Thaliban Khawatir Konflik Horizontal Dan Transaksional Politik BANDA ACEH (Waspada): Upaya Judicial Review terhadap Undang Undang Pemerintahan Aceh tentang calon independen yang belum direspon oleh Mahkamah Konstitusi (MK), merupakan kemunduran demokrasi di Aceh. Hal ini tidak saja dikhawatirkan akan menimbulkan konflik horizontal, melainkan transaksional politik secara besar-besaran. Kekhawatiran ini lahir dari analisis Ketua Nahdhalatul Ulama (NU) Kota Banda Aceh Drs Tgk H Misnan MA (foto), dalam rilis yang disampaikannya kepada Waspada di Banda Aceh, Senin (27/9). Tgk H Misnan menilai, keteledoran MK ini akan berdampak signifikan bagi masyarakat Aceh yang akan menggelar Pilkadasung pada Juni 2011 mendatang. Bagaimana tidak, penghambatan hak politik ini dapat memicu sikap represif yang ditakutkan akan mengancam stabilitas perdamaian Aceh. Menurut dia, tidak sedikit masyarakat Aceh yang menilai kualitas pelayanan pemerintah, baik itu eksekutif, legislatif hingga yudikatif, masih jauh dari harapan. Padahal, pasca perjanjian damai dan musibah tsunami, jumlah uang yang berputar di Aceh lebih dari AS$ 3 milyar. Namun, kondisi Aceh hanya sedikit lebih baik dari segi infrastruktur saja. Bahkan di wilayah Barat-Selatan, kondisinya masih kurang memuaskan.

“Nah kalau non-infrastruktur ya bisa kita saksikan sendiri. Kesenjangan sosial di tengah-tengah masyarakat masih sangat tinggi,” ungkapnya. Berangkat dari kondisi itu dan terlepas dari berbagai kepentingan, Tgk. Misnan berharap kualitas demokrasi Aceh tentunya tak bisa dibiarkan mengalami kemunduran. UUPA perlu segera di judicial review kembali oleh MK, sehingga keinginan masyarakat untuk melihat pmimpin- pemimpin baru yang lebih visioner dapat terealisasi pada 2011 mendatang. “Jangan sampai kita berselisih paham dengan saudara kita sendiri hanya gara-gara itu. Bukankah lebih baik direvisi saja, jika itu benar untuk kemaslahatan umat,” katanya. Dalam kesempatan yang sama, Ketua Thaliban Aceh, H T Anwar Kuta Krueng, menambahkan, Aceh merupakan daerah yang terus bergelut dengan konflik sejak zaman Belanda hingga kemerdekaan. Selama itu pula, semua lini kehidupan masyarakat Aceh mengalami kemunduran baik bidang Pendidikan, Pemerintahan, dan angka kemiskinan masih tinggi, dan banyak masalah lainnya. Karena itu, kata dia, dengan usia perdamaian yang terus beranjak matang, hendaknya pula pemerintah khususnya kalangan legislatif juga mampu menciptakan kematanganberpolitik.Problemacalonindependent hendaknya disikapi dengan bijak

sehingga tidak menciptakan konflik baru. “Artinya, ya kita biarkan saja calon independen itu tetap ada pada Pilkada kali ini. Soal pilihan, saya rasa masyarakat kita sudah sangat matang dalam melihatnya,” tandas HT Anwar, seraya menambahkan, karena itu, MK perlu segera melakukan Judicial Review UUPA. Di tempat terpisah, Koordinator Rumah Perubahan Provinsi Aceh, Samsul B Ibrahim, menyebutkan, pasca penandatanganan perjanjian damai, kualitas demokrasi provinsi Aceh sering menjadi pembicaraan provinsi lain bahkan dunia international. Bagaimana tidak, Aceh telah membangun pondasi demokrasi yang sangat baik melalui Pilkadasung yang pertama kalinya di Indonesia, calon independen, serta kehadiran partai politik lokal (parlok). Ironisnya, sebut Samsul, saat ini hal tersebut tak dapat dipertahankan. Jalur independen yang pada dasarnya merupakan hak konstitusional warga Negara malah dipolemikkan untuk dicabut. Hal ini tentunya menuai dampak negatif yang sangat besar. Pilkada Aceh 2011 ini dikwatirkan akan diwarnai oleh transaksional politik besar-besaran. “Karena itu butuh jalur independen untuk meminimalisir transaksional ter-sebut sehingga Pemerintahan Aceh yang baru terbebas dari kepentingan tertentu,” ujarnya. (b07)

Bireuen Miliki Delapan SMK Ketibaan (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 398 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *


Keberangkatan (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:15 JT 397 Medan/Jakarta 16:00 JT 307 Jakarta 19:50 JT 399 Medan/Jakarta

07:20 11:55 16:35

12:50 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *


FY 3401 Penang 13:50 FY 3400 Penang * Setiap Senin, Rabu, Jumat dan Sabtu.


BIREUEN (Waspada) : Sejak zaman revolusi 1945 Bireuen sudah dikenal sebagai kota pendidikan. Pendidikan yang lebih dikenal di masa itu yakni pendidikan agama ”Normal Islam” berlokasi di Simpang IV kota Bireuen didirikan PUSA (Persatuan Ulama Seluruh Aceh). Hanya dua Sekolah Normal Islam di Sumatera, satu diantaranya Normal Islam Bireuen dan satu lagi Normal Islam Padang (Sumbar) Para pelajar Normal Islam Bireuen berasal dari berbgai daerah di Aceh bahkan dari luar Aceh sekalipun. Meski tidak tersurat dala sejarah perkembangan pendidikan, Bireuen sudah dikenal sebagai kota pendidikan. Di zaman sekarang ini Bireuen terus

BANDA ACEH (Waspada): Konfercab Persatuan Wartawan Indonesia (PWI) Cabang Aceh X/2010 di Hotel Grand Nanggroe, Banda Aceh, Sabtu (25/9) dan Minggu (26/9) berakhir dengan terpilihnya Tarmilin Usman sebagai ketua, dengan mengalahkan dua rivalnya Imran Joni dan A. Dahlan TH. Namun di balik persaingan ketat pemilihan orang nomor satu dalam organisasi kewartawanan tertua di Indonesia tersebut, yang lebih mengharukan adalah seluruh peserta Konfercab mampu memanfaatkan momen tersebut mendamaikan mantan Ketua PWI Aceh A. Dahlan TH dengan anggota PWI Aceh Iranda, yang sebelumnya sempat berselisih paham. “Ini perdamaian adat yang sangat baik, dan menjadi contoh semua pihak. Semua pihak khususnya anggota PWI Aceh harus bangga dengan membaiknya hubungan mereka,” kata H. Adnan, NS yang bertindak sebagai ketua pimpinan sidang Konfercab PWI Aceh X. Dahlan yang dimintai keterangannya terkait konflik dengan Iranda mengatakan, sebenarnya secara pribadi dia tidak ada persoalan apa pun dengan Irndan, namun secara organisasi sebut Dahlan, pengurus PWIAcehyangkalaitudipimpinnyakecewadengantulisandanpernyataan Iranda yang dinilai kerap menjelek-jelekan organisasi PWI, sehingga para pengurus PWI Aceh memberi hukuman kepada yang bersangkutan. Senada dengan itu, Iranda juga mengatakan secara pribadi tidak ada persoalan apa pun dengan Dahlan TH. Ia malah selalu duduk bersama dan melaksanakan shalat jumat bersama di beberapa mesjid di kawasan Banda Aceh. Iranda mengatakan, akibat hukuman tersebut dirinya tidak dapat memberi hak suara pada Konfercab PWI Aceh X, karena kartu keanggotaannya tidak diperpanjang. Konfercab PWI X berlangsung alot dengan dua putaran. Putaran pertama tiga nama yaitu A. Dahlan, TH, Tarmilin Usman dan Imran Joni bersaing merebut posisi puncak. Tahap pertama Imran Joni harus menyerah karena hanya mengantongi 21 suara, sedangkan A. Dahlan, TH dan Tarmilin Usman yang sama –sama berhasil mengumpulkan suara 66 kembali melakukan pemilihan. Pada putaran ke dua, Tarmilin Usman unggul tipis dengan perolehan 77 dan Dahlan TH 76 suara. Kemenagan Tarmilin mendapat sambutan hangat dari puluhan pendukungnya.(b20)

berpacu dibidang pendidikan baik pendidikan umum, pendidikan agama dan khususnya pendidikan kejuruan. Saat ini Bireuen sudah memiliki delapan sekolah menengah kejuruan untuk mendidik membekali berbagai keahlian bagi puteraputeri Bireuen khususnya dan puteraputeri Aceh umumnya. Kadisdikpora Drs Asnawi MPd mengemukakan hal itu kepada Waspada di kantornya Jum’at (24/9). SMK tertua di Bireuen yakni SMKN-1 Bireuen didirikan sejak tahun 1975 atau 35 tahun silam. Sejak tahun 2007, SMKN-1 Bireuen suda ditunjuk sebagai satuan pendidikan untuk mengemangkan Rntisan Sekolah Bertaraf Internasional (RSBI) 6 progam studi keahlian dan 9 kompetensi keahlian.

Ke-9 kompetensi keahlian, teknik kontruksi kayu, teknik kontruksi batu dan beton, teknik gambar bangunan, teknik pemanfaatan tenaga listrik, teknik permesinan, teknik pengelasan, teknik kenderaan ringan (otomotif), teknik audio video, teknik komputer dan jaringan. Kemudian disusul pendirian SMK Rekayasa jurusan industri, SMK PGRI jurusan kimia, SMKN Peusangan jurusan kesekretariatan, SMKN-1 Jeunieb perikanan dan kelautan, SMKN Gandapura jurusan peternakan, SMK Keperawatan Muhammadiyah Bireuen jurusan kesehatan dan dilengkapi dengan SMK Pertanian untuk melahirkan ahli pertanian yang handal.(b16)

BANDA ACEH (Waspada): International Coastal Cleanup Day (ICC) atau Hari Bersih Pantai Internasional merupakan hari gerakan aksi pembersihan pantai sedunia. Hari aksi kerelawanan internasioal untuk pembersihan pantai ini awalnya bermula di California, Amerika Serikat sejak 1985. Aksi ini senantiasa diperingati pada Sabtu minggu ke-3 bulan September setiap tahunnya dan semangat gerakan ini terus menyebar ke seantero dunia, termasuk di Aceh, Indonesia. ICC yang ke-25 tahun ini jatuh pada tanggal 25 September 2010. Pada Sabtu (25/9) lalu, Aceh Coral Conservation (ACC) sebagai salah satu organisasi anggota Jaringan KuALA, serta didukung oleh seratusan relawan baik lokal maupun internasional melaksanakan ICC-Aceh di Sabang, Menurut informasi Mukhlis, salah seorang anggota Ocean Diving Club/ODC Unsyiah), kegiatan ICC di Sabang dimulai sekitar pukul 8.30 Wib dan dipusatkan di Iboih dengan melibatkan lebih kurang 100 relawan. ICC di Sabang dibagi kedalam dua jenis pembersihan. Pertama, Coastal Cleanup (pembersihan pantai) yang diikuti lebih kurang 60 orang relawan. Kedua, Underwater Cleanup (pembersihan bawah/dalam air) yang diikuti lebih kurang 40 relawan penyelam. Khusus untuk underwater cleanup, kata dia, tim penyelam turun kedalam air dalam 2 sesi, yakni sesi pagi dan sesi sore. Para relawan penyelam dibagi dalam tiga tim dan melakukan pembersihan diseputaran perairan pulau Rubiah, Iboih. Mukhlis menuturkan, kuantitas sampah yang terkumpul tergolong besar, hampir satu goni ukuran 30-50 liter. Sampah yang dijumpai umumnya adalah benang pancing, kantong plastik, bekas kemasan makanan ringan, bekas botol maupun kemasan minuman dari jenis plastik maupun kaleng. “Dari kegiatan ini, kita juga mendapat kabar gembira bahwa kondisi terumbu karang di titik-titik underwater cleanup berada dalam kondisi baik dan selamat dari ancaman kematian akibat pemutihan massal yang terjadi pada periode April-Juni 2010 lalu,” papar Mukhlis. Koordinator jaringan Koalisi untuk Advokasi Laut Aceh (KuALA), M. Arifsyah Nasution, S.Si., menyebutkan, penyelenggaraan ICCAceh 2010 yang dinisiasi dan digerakkan oleh Yayasan Lamjabat (YL)Aceh direncanakan akan dilakukan Minggu (17/10) di empat titik lokasi, yaitu Ujong Pancu; Pantai Lampuuk, Pantai Lhoknga dan Ujong Batee. Untuk kegiatan ini, kata dia, sejumlah persiapan telah dan terus dilakukan YL-Aceh bersama mitra lainnya untuk menyukseskan Peugleh Pasie Aceh 2010, baik dalam pemetaan detail timbulan sampah di berbagai lokasi pantai terpilih maupun kebutuhan administratif dan penyiapan material komunikasi seperti booklet, poster dan pamplet himbauan. Peugleh Pasie Aceh ini turut didukung oleh sejumlah mitra strategis maupun lembaga-lembaga anggota Jaringan KuALA lainnya, seperti: IKAPALA, Ocean Diving Club (ODC), Seuramoe Aneuk Keumaju Aceh (SAKA), Aceh Ocean Coral (AOC),Yayasan PUGAR, Lembaga Ekosistem Lahan Basah (LEBah), WWF Indonesia Aceh Progam, Wildlife Conservation Society (WCS) Indonesia Marine Program–Aceh dan WALHI Aceh. (b07)

Pedagang Buah Di Jeunib Tinggalkan Kios Relokasi BIREUEN (Waspada): Pedagang buah di pusat kota Kec. Jeunib, Bireuen meninggalkan kios yang dibangun pemerintah. Pasalnya, para pedagang tidak bersedia lagi berjualan di sana karena lokasinya tidak strategis dan mahalnya harga sewa. Mustafa, warga setempat, Selasa (28/9) mengatakan, sebelumnya pedagang menempati 20-an kios di kawasan depan Kantor Camat Jeunieb. “Sekarang mereka sudah kembali berjualan di lokasi semula sebelum direlokasi,” ucap Mustafa. “Kios itu sebelumnya atapnya rusak diterbangkan angin puting beliung, lalu pedagang berjualan di emperan kios. Tapi sekarang mereka kembali berjualan di kawasan pertokoan meski atap kios sudah diperbaiki,” jelas Mustafa. Kadis Perindagkop dan UKM Bireuen, melalui Kasie Bina Usaha dan Perdagangan, Yazuli mengatakan, untuk menangani hal itu pihaknya sedang melakukan pendekatan dan musyawarah dengan perwakilan pedagang di ruangan Asisten III Setdakab Bireuen. Disebutkan, sebelumnya pemerintah menetapkan harga sewa per kios sesuai hasil perhitungan dan mengacu kepada aturan yang ada adalah Rp1,5 juta per tahun. “Jumlah itu dinilai pedagang memberatkan, karenanya perlu dicari solusi,” jelas dia. Pemerintah, katanya, merencanakan sewa kios lebih rendah disesuaikan kemampuan pedagang yakni berkisar Rp700 ribu per tahun. Pihaknya sedang melakukan negosiasi dengan pedagang.(cb03)



WASPADA Rabu 29 September 2010

Ketua PPP Aceh Tengah:

“Polres Tebang Pilih Menerapkan Hukum”

Waspada/Muhammad H. Ishak

DIKEJAR GAJAH: KetikaWaspada mengabadikan gajah liar yang beraksi di Desa Buket Dendeng, Kec. Julok, Kab. Aceh Timur, Selasa (28/9), sekira pukul 11:00, seorang warga tampak bergegas lari karena gajah mengejarnya.

Gajah Mengganas, Petani Tak Berdaya Anggota Dewan Jangan Hanya Duduk Manis ACEH TIMUR (Waspada): Aksi gajah liar kembali mengancam dan meresahkan ratusan pemilik kebun beberapa desa di Kec. Julok— Kuta Binejei, Kab. Julok, Provinsi Aceh, Selasa (28/9) dinihari. Amukan gajah beberapa pekan terakhir telah melenyapkan lebih dari 700 hektar areal perkebunan. Selain 500 hektar areal perkebunan milik beberapa perusahaan di pedalaman Kec. Julok, 200 hektar areal kebun sawit milik petani di Desa Buket Dendeng juga diobrak-abrik kawanan gajah liar. Tidak hanya batang sawit yang menjadi target amukan gajah (Po Meurah—Aceh), namun tanaman pinang, coklat, pisang dan padi siap panen ikut menjadi sasaran binatang berbadan jumbo itu. Selama ini warga hanya pasrah melihat aksi gajah, sebab tidak ada daya untuk mengusir satwa liar itu ke habitatnya. Nanda, tokoh masyarakat setempat kepada Waspada kemarin mengatakan, aksi gajah mulai terjadi di Desa Buket Dendeng, sejak tahun 2003. Ketika itu, gajah yang kerap beraksi hanya beberapa ekor. Tapi akhir 2008 lalu aksi gajah kian menjadi-jadi, bahkan warga yang bekerja di perkebunan sempat dikejar sekelompok gajah liar yang kebetulan kepergok di perjalanan. Menurut Nanda, aksi gajah di sana sangat merugikan masyarakat, bahkan hasil yang diperoleh dari tandan sawit menurun hingga

mencapai 50 persen dari sebelumnya. Pasalnya, banyak tanaman sawit dikuras dan dilenyapkan kawanan satwa liar yang jumlahnya mencapai 11 ekor itu. Hal senada diutarakan masyarakat lainnya. Bahkan aksi gajah selama ini, kata mereka, membuat ekonomi masyarakat tidak stabil. Tidak hanya perkebunan yang jadi sasaran, tanaman lainnya juga diobrak-abrik. Hingga kini belasan ekor gajah liar masih bersarang di beberapa titik di Desa Buket Dendeng. Penyisiran yang dilakukan masyarakat bersama Waspada, melihat aktivitas gajah yang kian mengganas melenyapkan lebih 700 hektar areal perkebunan dan pertanian. Menurut Sekdes Buket Dendeng, Amri disela-sela penyisiran, gajah liar yang beraksi di Julok, khususnya di desa itu adalah pecahan kawanan gajah yang mengamuk di sejumlah kecamatan di Aceh Timur, seperti Indra Makmur, Idi Tunong, Banda Alam, Ranto Peureulak danPeunaronsertabeberapakecamatanlainnya. Karena itu warga mengharapkan Pemkab Aceh Timur dan Balai Konservasi Sumber Daya Alam (BKSDA) Wilayah Aceh mengambil langkah tepat untuk mengatasi amukan gajah yang kian menjadi-jadi itu. “Kita minta DPRK Aceh Timur tidak hanya duduk manis di kursi parlemen, tapi turun dan lihat betapa menderitanya masyarakat akibat imbas dari amukan gajah itu,” tandas Amri.(cmad)

Pemasangan Baliho Rampas Hak Pejalan Kaki Di Langsa LANGSA (Waspada): Pemasangan baliho atau papan reklame di Kota Langsa dinilai telah merampas hak pejalan kaki di kota tersebut. Pasalnya pemasangan sejumlah baliho dilakukan diatas badan jalan trotoar, seperti terpantau Senin (27/9). Pemasangan baliho itu terkesan amburadul, karena pemasangannya tidak sesuai tempatnya dan terkesan Pemerintah Kota Langsa hanya sekedar memberi izin tanpa memikirkan kelayakan tempat. Salah satunya seperti terlihat di seputar lapangan lapangan merdeka, di mana salah satu baliho yang memajang produk rokok tersebut terpasang di tengah-tengah trotoar yang selama ini diperuntukkan kepada pejalan kaki. Akibatnya, pejalan kaki menjadi terganggu ketika melintas di trotoar tersebut. “Jika pemasangan baliho tersebut telah memiliki izin, berarti benar Pemko Langsa hanya sekedar memberikan izin tanpa memikirkan kepentingan publib lainnya. Dan jika be-

lum memiliki izin, maka baliho dimaksud diminta untuk segera dibongkar,” sebut Edy salah seorang warga Kota Langsa. Diakuinya, pemasangan baliho ataupun spanduk akan menghasilkan Pendapatan Asli Daerah (PAD) bagi Kota Langsa. Akan tetapi, seharusnya sebelum diberikan izin maka terlebih dahulu dilihat lokasi mana yang tepat. ”Jangan hanya asal memberikan izin,” kata Edy. Selain akan menghasilkan PAD, maka jika penempatannya ditata dengan rapi, maka hal ini akan menambah keindahan bagi Kota Langsa. Begitu juga sebaliknya, jika tidak di tempatkan pada lokasi yang layak maka akan mengundang kesemrautan tata kota . Dirinya mengharapkan kepada Pemerintah Kota Langsa melalui instansi terkait untuk segera menertibkan baliho maupun spandukspanduk yang dipasang bukan pada tempatnya. Karena selain akan mengganggu kenyamanan hal layak ramai, tapi juga akan tampak semrautnya penataan tata ruang kota. (b25)

Bursa Calon Bupati-Cawabup Aceh Tamiang Mulai Mencuat KUALASIMPANG (Waspada): Meskipun pelaksanaan pesta demokrasi pemilihan kepala daerah (Pilkada) Bupati/Wakil Bupati Aceh Tamiang baru akan digelar pada tahun 2012 mendatang, namun kini sudah mulai muncul beredar sejumlah nama yang disebut-sebut akan maju bertarung dalam kancah Pilkada di Bumi Muda Sedia itu. Berdasarkan desas-desus yang kini kian mengkristal beredar, dan telah menjadi pembicaraan hangat di kalangan masyarakat di Kabupaten Aceh Tamiang, sejumlah nama yang akan maju sebagai calon Bupati Aceh Tamiang pada Pilkada mendatang antara lain , HT.Yusni atau akrab disapa Tengku Tam yang merupakan ketua Umum DPD Partai Golkar Aceh Tamiang, H. Awaluddin, SH, SPN, MH ( kiniWakil Bupati Aceh Tamiang), Drs Jamaluddin T. Meuku (kini anggota DPR Provinsi Aceh ), H. Hamdan Sati, ST (Pengusaha), HM Joni Evita, SE (Ketua Kadin Aceh Tamiang), dan H. Buyung Arifin, MBA dari PD Alwashliyah Tamiang. Selain itu masih berdasarkan desas-desus soal nama lain seperti Ir. Syahril (Sekretaris DPD Partai Amanat Nasional), Ir .T.Rusli (Ketua DPC PDIP Aceh Tamiang),T. Insyafuddin ,ST (Ketua PKS Aceh Tamiang), Drs. Syuaib Araby, US (Ka. Badan Pengelola Keuangan dan Aset Daerah), Drs Syuibun Anwar (Kadis Kebersihan, Lingkungan Hidup dan Pemadam Kebakaran Aceh Tamiang) dan dari kalangan perempuan disebut-sebut juga nama T. Marini (Pengusaha ), tetapi nama-nama tersebut hanya dijagokan untuk posisi sebagai Wakil Bupati. Selain itu, menurut rumor yang berkembang di warung-warung kopi yang ada di Kota Kualasimpang menyebutka,n tidak tertutup kemungkinan menjelang tahapan Pilkada nanti bisa saja muncul sejumlah nama lainnya untuk mencalonkan diri sebagai Bupati dan Wakil Bupati Aceh Tamiang.

Sementara itu juga disebut-sebut nama Drs Ahmad As’adi (Ka.Bappeda Aceh Tamiang) yang tidak bersedia untuk “dipinang” oleh pihak tertentu untuk dijadikan sebagai calon Wakil Bupati Aceh Tamiang pada Pilkada mendatang. Sedangkan T. Marini juga disebutsebut sedang “pikir-pikir” untuk maju, karena dirinya masih akan melihat situasi dan kondisi yang berkembang serta “peta” kekuatan calon lainnya dan “kekuatan” dukungan yang akan diberikan untuknya. Menurut informasi yang beredar pada saat ini, sejumlah nama yang ingin maju pada Pilkada Bupati/Cawabup Aceh Tamiang itu sedang sibuk melakukan lobi-lobi untuk mencari “sampan” sebagai kenderaan politik bagi pasangan calon Bupati/Cawabup Aceh Tamiang agar dapat mendaftarkan diri dan sekaligus untuk bertarung di arena Pilkada yang kian semakin dekat tahapan pelaksanaannya. Bahkan dari nama-nama tersebut sudah ada yang “bergerlya” sampai ke desa-desa untuk mencari dukungan simpati dari masyarakat Aceh Tamiang agar memilih mereka pada Pilkada mendatang pasca berakhirnya masa tugas Bupati Aceh Tamiang, Drs. H. Abdul Latief dan Wabup H. Awaluddin pada tahun 2012 yang akan dating. Salah seorang yang disebut-disebut akan ikut maju pada Pilkada mendatang sebagai Calon Bupati Aceh Tamiang, HT.Yusni atau Tengku Tam ketika dikonfirmasi Waspada kemarin menyatakan dirinya akan maju untuk mencalonkan diri pada Pilkada 2012 mendatang. “Saya memang benar akan maju pada Pilkada nanti sebagai calon Bupati, sedangkan yang menjadi calon wakil Bupati juga sudah ada namanya dalam kantong saya dan nanti jika sudah tiba waktunya akan saya sebutkan namanya. (b24)

TAKENGON (Waspada): Ketua Partai Persatuan Pembangunan (PPP) Aceh Tengah, Irfan Rasyid menilai penegakan hukum di Aceh Tengah masih pincang dan tebang pilih. Polres Aceh Tengah sudah membebaskan seorang oknum hakim dan beberapa orang yang diduga melakukan praktek judi sabung ayam. “Tim Buser Aceh Tengah berhasil melakukan operasi memberantas penyakit masyarakat dengan menangkap pelaku perjudian. Bahkan dalam operasi itu seorang oknum hakim dan beberapa tersangka lain diamankan. Namun entah mengapa, pihak Polres membebaskan mereka,?” sesal Irfan Rasyid melalui selulernya, Selasa (28/9) pagi. Padahal, katanya, seperti diketahui bersama dalam penyergapan oleh pihak Tim Buser Polres Aceh Tengah, Minggu (19/ 9), di rumah Dinas Kehakiman, Kute Lot, Kebayakan, bukan ha-

nya barang bukti 10 ekor ayam adu dan pisau yang diamankan sebagai barang bukti, namun juga satu paket ganja dan alat penghisap sabu. “Saya sangat khwatir ada kongkalikong pihak Polres dan para tersangka terkait kasus ini. Pasalnya para tersangka hanya ditahan dua hari. Namun disayangkan, setelah diproses dan dikaitkan ke pelanggaran qanun kemudian dibebaskan, padahal mereka tertangkap tangan dengan barang bukti lain berupa narkoba. Apa itu bukan kepincangan dalam penegakan hukum,” tanya mantan ketua KNPI Aceh Tengah ini. Tindakan pembebasan itu, sebut Irfan, akan menjadi citra yang buruk bagi kepolisian di Aceh Tengah, selaku salah satu penegak hukum di matamasyarakat. “Pembebasan tersangka oleh pihak kepolisian dimungkinkan karena tidak dapat dije-

rat KUHP karena para pelaku melanggar qanun Aceh. Namun apa pun alasannya, melanggar KUHP atau pun qanun yang seharusnya pelaku mendapat sanksi yang tepat. Sehingga dapat memberi efek jera, bukannya dilepaskan begitu saja,” sesalnya. Dikhawatirkan pelepasan para tersangka perjudian tersebut akan membuat praktek perjudian semakin meningkat di Aceh Tengah. “Karena tersangka tidak dapat dijerat dengan KUHP, seharusnya polisi menyerahkan kasus pelanggaran ini ke pihak penegak hukum qanun. Jadi tidak ada alasan pelaku judi itu dapat bebas tanpa mendapat sanksi,” jelas Irfan. “Seharusnya Polres memberi keterangan yang seluas-luas kepada masyarakat, terkait pembebasan oknum hakim dan pelaku perjudian itu. Karena bagaimana pun tindakan oknum hakim dan beberapa

tersangka perjudian telah menjadi sorotan dan kosumsi publik,” katanya. “Ada apa ini? Apa hukum hanya berlaku bagi orang-orang kecil, dan para pejabatnya (oknum hakim-red) kebal akan hukum?” tanya Irfan lagi. Sementara Kapolres Aceh Tengah, AKBP. Edwin Rachmat Adikusomo, melalui pesan singkatnya (SMS), menjawab Waspada menjelaskan, pembebasan itu dilakukan karena pelaku dikenakan qanun yang berlaku di Aceh. “Masalah sabung ayam dikenakan qanun. Pelaku tidak bisa kami tahan. Masalah sabu dan ganja ditemukan di dalam rumah, tidak memiliki bukti milik siapa. Tidak ditemukan di tangan siapa ketika dilakukan penangkapan. Untuk menguatkan bukti ganja dan sabu itu milik siapa dilakukan tes urine. Hasilnya negatif,” jelas Kapolres. “Kalau tidak ada bukti yang menyatakan seseorang bersalah, bagaimana polisi mau menahan seseorang. Apa dasar hukumnya polisi menahan seseorang. Kalau ditahan bisa dituntut balik, polisi yang tidak profesional. Tidak sembarangan polisi bisa main tangkap dan menahan seseorang, semua ada prosedur, ada aturan main,” sebut Edwin. Namun, sebut Edwin, bila masyarakat butuh informasi terkait persoalan ini, silahkan bertemu langsung. “Supaya jangan salah persepsi, bila ada yang perlu info terkait persolan pembebasan tersebut, silahkan bertemu dengan saya,” kata Kaplolres Aceh Tengah ini. Sementara LBH Banda Aceh Pos Takengon melalui releasenya menyebutkan, oknum hakim PN Takengon yang tertang-

kap tangan bermain judi sabung ayam harus diberi sanksi tegas dengan merujuk pada UU No. 49 Tahun 2009, perubahan kedua atas UU No. 2 tahun 1986 tentang peradilan umum. Moch. Ainul Yakin S.HI, Koordinator LBH Banda Aceh Pos Takengon itu menyebutkan, khusus pasal 20 Ayat 1 huruf B, D, dan F. Dan UU No. 48 tahun 2009 tentang kekuasaan kehakiman, yang menyebutkan bahwa hakim seharusnya memiliki kepribadian yang tidak tercela dengan mentaati kode etik dan pedoman perilaku hakim. “Hakim seharusnya bisa menghindari perbuatan yang tercela atau yang dapat menimbulkan kesan tercela karena hal tersebut pastinya merusak dirinya sendiri di mata masyarakat. Sikap, tingkah laku dan tindakannya, baik di dalam maupun di luar pengadilan seharusnya mencerminkan profesinya untuk menjaga dan meningkatkan kepercayaan masyarakat. Bukan sebaliknya yang menjadikan rumah dinasnya sebagai arena sabung ayam, bahkan juga ditemukan daun ganja dan alat penghisap sabu-sabu,” jelasnya. Dalam konteks Aceh yang menganut syari’at Islam, koordinator LSM ini menyinggung, hukuman cambuk juga layak diterapkan kepada oknum hakim PN Takengon tersebut. “Tentu dalam pelaksanan cambuk juga harus sama pelaksanaannya dilakukan di depan khalayak ramai sebagaimana kebiasaan pelaksanaan hukuman cambuk. Perbuatan yang dilakukan oknum Hakim PN Takengon tersebut merupakan perjudian, yang mana telah diatur dalam Qanun No. 13 Tahun 2003 tentang maisir (perjudian),” jelas Moch.Yakin.(b18/cir)

Calon Sekda Aceh Singkil Diseleksi Di Gubernuran Waspada/Muhammad H. Ishak

KRISIS AIR BERSIH: Nurmala, 52, warga Buket Dendeng, Kec. Julok, Kab. Aceh Timur, mencuci pakaian di sungai karena 700 jiwa di sana kesulitan mendapatkan air bersih. Foto diambil, Selasa (28/9).

700 Jiwa Krisis Air Bersih ACEH TIMUR (Waspada): Sebanyak 700 jiwa di Dusun Leumak Muda dan Lhok Janeng, Desa Buket Dendeng, Kecamatan Julok, Kabupaten Aceh Timur, dalam tiga tahun terakhir mengkonsumsi air keruh, setelah 157 Kepala Keluarga (KK) di pedalaman Kuta Binjei itu, kesulitan dalam mendapatkan air bersih. Nurmala, 52, warga setempat yang dijumpai Waspada, Selasa (28/9) mengaku, dirinya sudah bertahun-tahun menggunakan air sungai setempat untuk kebutuhan Mandi, Cuci, dan Kakus (MCK). Selain kesulitan air bersih untuk kebutuhan minum sehari-hari, dia mengaku terpaksa mengambil air sumur yang berwarna kekuningkuningan. Dia juga mengaku, perjalanan ke sungai untuk MCK menghabiskan 1 jam perjalanan. Meski demikian, setiap hari dia

sama sekali tidak merasa letih untuk kebutuhan rumah tangga. “Daerah ini adalah di atas perbukitan, jadi jikapun digali sumur maka haru mencapai kedalaman di atas 30 meter,” ujar Nurmala. H. Hamid, tokoh masyarakat setempat ikut mengutarakan hal yang sama. Bahkan, dia menambahkan, untuk mendapatkan air bersih sudah bertahun-tahun masyarakat di sana harus membelinya Rp5.000 hingga Rp7.000 per galon. Masyarakat disana yang ekonominya diatas memang saban hari membelinya. Namun, bagi masyarakat yang ekonomi lemah terpaksa mengkonsumsi air keruh. Hamid meminta, dinas terkait segera membuka sumur bor dan tempat penampungan air umum di Desa Buket Dendeng, Kecamatan Julok, sehingga krisis air bersih yang selama ini di-

alami masyarakat dapat teratasi permanen. “Hanya melalui sumur bor kesulitan air bersih dapat diatasi, karena ini daratan tinggi, bahkan sudah termasuk daerah pengunungan,” ujarnya. Sekdes Buket Dendeng, Amri, ketika dimintai keterangan mengaku, pihaknya telah menyampaikan hal itu ke Pemkab Aceh Timur melalui Pemerintah Kecamatan Julok, beberapa waktu lalu. Tetapi hingga kini penderitaan 700 jiwa penduduk setempat belum berakhir, bahkan terus membeli air bersih. “Sumur disini ada, tapi air didalamnya mencapai 25 cincin, itupun jarak tempuh mencapai 5 kilometer. Karenanya, guna mengatasi kesulitan air bersih di sana, kita minta dinas pengairan segera menggali sumur bor,” kata Amri seraya menandaskan, pihaknya siap menggali jika dana tersedia. (cmad)

Jalan Dua Jalur Di Blangkejeren Masih Membahayakan BLANGKEJEREN (Waspada): Kendati telah berlapiskan aspal yang mulus, namun jalan dua jalur di Kota Blangkeren KabupatenGayoLues,masihmenyisakan kecemasan bagi warga. Rasa cemas penggunan jalan itu, menyusul masih adanya beberapa titik jalan dua jalur yang terputus dan tanpa dipasangi rambu-rambu lalu lintas, meski jalan dua jalur telah berusia dua sampai tiga tahun. Bagi warga yang kerap melintas dan masuk maupun mampir di Blangkejeren, yang akan menemui jalan putus dan berlubang hingga memotong jalur dua itu dan menyempit, memang tidak terlalu jadi masalah, karena sudah hafal dengan kondisi jalan nasional itu. “ Namun, bagi warga yang jarang ke Blangkejeren dan baru sekali atau dua kali ke Ibukota Gayo Lues itu, tentu akan jadi masalah besar. Masalahnya, sedikit saja si pengendara lalai, akibatnya akan fatal dan bisa menyebabkan terjadinya kecelakaan,” kata Hasbulah. Kekhawatiran pengguna jalan dari luar Gayo Lues, jelas sangat beralasan. Apalagi, ketika

berpergian di malam hari yang kondisinya gelap tanpa lampu penerangan jalan, ditambah tak adanya ram-bu lalu lintas di dekat lokasi jalan dua jalur yang terputus sepan-jang dua sampai tiga meter itu. Kekhawatiran yang sama disampaikan, Asbi, warga Penggalangan, Kecamatan Blangkejeren. Dia mengatakan, sejak masuk dari desa Palok dan desa Penggalangan hingga sampai ke pusat Kota, kecepatan kenderaan roda dua dan roda empat, biasanya sangat tinggi, karena jalan selain jalannya lebar, juga sangat mulus. Namun, masih dibiarkannya lubang yang menganga akibat jalan dua jalur yang belum selesai itu, jelas sangat membahayakan warga dan pengguna jalan yang melintas. “Apalagi bila tidak hafal dengan kondisi jalan nasional , terutama di kawasan desa Penggalangan tersebut,” sebutnya. Sebab itu, sebelum menimbulkan korban jiwa dan kerugian yang lebih besar lagi bagi pengguna jalan nasional tersebut, warga dan pengguna jalan, berharap agar Dinas terkait yang

menangani pembangunan dan pemeliharaan jalan tersebut segera membangun jembatan kecil, agar jalan dua jalur itu tidak terputus dan tidak membahayakan. “Sejak dua hingga tiga tahun terakhir, jalan dua jalur di Blangkejeren memang lebar dan mulus. Tetapi sayangnya, jalan putus yang rawan laka lantas itu dibiarkan saja sejak dua tahun terakhir,” tukas warga setempat. Ir.Said Anwar Fuadi, PPK Pembangunan jalan nasional ruas Blangkejeren-Lawe AunanKutacane ketika dikonfirmasi Waspada, Senin (27/9), membenarkan masih terputusnya beberapa meter jalan dua jalur di Ibukota Kabupaten Gayo Lues tersebut. Idealnya, memang harus dibangun jembatan kecil pada dua lokasi di jalan dua jalur itu, terutama di desa Penggalangan, Kecamatan Blangkejeren. “Usulan pembangunan dua jembatan kecil yang ditaksir senilai Rp.2 M itu sudah kita sampaikan. Tapi sampai sekarang belum terealisasi,” tukas pegawai Dinas Bina Marga Aceh tersebut. (b27)

BANDA ACEH (Waspada): Delapan pejabat eselon II Kabupaten Aceh Singkil mengikuti seleksi calon Sekretaris Daerah (Sekda) setempat, Senin (27/10) di Sekretariat Gubernuran, Banda Aceh Ke delapan nama pejabat tersebut masing-masing, Drs M Yakub KS, MM Asisiten Tata Praja Setdakab Aceh Singkil, Drs Rahmi Syukur, Kadis Sosial Tenaga kerja dan Transmigrasi, Syamsul Bahri, SH Kepala Bapedalda, H Nasjuddin, SH, MM Kadis Pengelola keuangan dan Kekayaan Daerah (DPKKD). Kemudian, A Aslym C, SH, Msi Kadis Budaya dan Pariwisata, H Sajali, SSos Sekretaris dewan, H Asmaudin, SE, Kadis Pertanian dan Ketahanan Pangan dan Ir Asmardin, Kepala Badan Perencana Pembangunan Daerah (Bappeda). Kabag Infokom Setdakab Aceh Singkil H Khaldum BK, SE yang dihubungi Waspada, Senin (27/10) membenarkan delapan pejabat eselon II Aceh Singkil sedang mengikuti seleksi uji kepatutan dan kelayakan calon Sekda di kantor Gubernur Aceh, Banda Aceh. Lebih lanjut Khaldum mengatakan, kegiatan itu merupakan tahapan mekanisme dan prosedur yang harus dilalui dalam seleksi calon Sekda, di mana mereka juga sebelumnya telah melengkapi syarat administrasi di Singkil. (b30)

Kasus KDRT Meningkat ACEH TIMUR (Waspada): Pasca MoU Helsinki 2005, kasus Kekerasan Dalam rumah Tangga (KDRT) dan kekerasan terhadap anak di Aceh Timur, meningkat tajam. Hal itu terlihat dari jumlah perkara yang ditangani kantor Pusat Pelayanan Perempuan dan Perlindungan Anak (P2TP2A) setempat. “Angka kasus KDRT meningkat tajam, namun yang kita sayangkan adalah yang menjadi korban, yakni anak-anak di bawah umur, padahal mereka masih butuh kasih sayang dari kedua orangtua,” ujar Ketua P2TP2A Aceh Timur, Jamaluddin, S.Sos, M.Si. Kepada Waspada, Senin (27/9) usai Seminar Jejering dan Sistem Rujukan Penanganan Korban Kekerasan Terhadap perempuan dan Anak di Aula P2TP2A Aceh Timur, Jamaluddin mengatakan, meningkatnya kasus KDRT di Aceh Timur, khususnya adalah akibat kurangnya ilmu dan pemahaman oleh suami-istri dalam membina sebuah rumah tangga. Selain itu, rata-rata fenomena yang terjadi hingga retaknya sebuah rumah tangga dan imbasnya adalah anak yakni akibat terjadi miskomunikasi antara suami-istri, “pengaruh hand phone yang berujung isu selingkuh juga kerap terjadi, sehingga sulit membangun sebuah rumah tangga yang mawaddah warahmah,” katanya. Dia yang ikut didampingi Koordinator LSM Pulih Area Aceh dan Ketua Kelompok kerja Transparansi Gender Aceh (KKTGA), Mariaty, SH, melanjutkan, jumlah kasus KDRT di Aceh Timur, terhitung Januari 2009 hingga Agustus 2010 mencapai 156 kasus, namun untuk proses penyelesaiannya bervariasi, mulai dari P2TP2A, Mahkamah Syariah, maupun di Unit Penanganan Perempuan dan Anak (UPPA) Polres Aceh Timur.(cmad)

Waspada/Muhammad H. Ishak

IKUTI SEMINAR: 100 Peserta dari berbagai elemen masyarakat dan instansi terkait mengikuti Seminar Penanggulangan Kasus KDRT di Kantor P2PT2A Aceh Timur, Senin (27/9).


WASPADA Rabu 29 September 2010


Hentikan “Penyunatan” Uang Lauk Pauk TNI JAKARTA (Waspada): Pimpinan DPR meminta Panglima TNI Laksamana Agus Suhartono yang baru dilantik dapat menghentikan dugaan praktik “penyunatan” tunjungan uang lauk pauk bagi prajurit TNI, khususnya yang bertugas di wilayah perbatasan. Kebijakan “penyunatan” itu sangat tidak manusiawi dan menyengsarakan prajurit yang bertugas di perbatasan. “Panglima TNI yang baru harus bisa meningkatkan anggaran kesejahteraan dan uang makan bagi prajurit di wilayah perbatasan. Mereka mengemban tugas negara yang berat,” ujar Wakil Ketua DPR, Taufik Kurniawan di DPR RI Jakarta, Selasa (28/9). Menurutnya, Panglima TNI Agus Suhartono justru harus bisa mengimbangi dengan sarana dan fasilitas yang dimiliki prajurit negara tetangga,

sehingga mental prajurit TNI tidak jatuh. “Kalau prajurit Malaysia di perbatasan makannya 4 sehat 5 sempurna, maka jangan samapai prajurit TNI hanya makan nasi dengan garam. Kalau demikian bagaimana mereka dapat bertugas dengan baik. Panglima TNI yang baru harus bisa memperbaiki kesejahteraaan prajurit saat ini,” tegas politikus PAN itu. Panglima TNI juga dituntut mengembalikan martabat dan kepercayaan diri prajurit, khususnya di perbatasan. Salah satu wujud menghindari prajurit “minder” dengan melengkapi persenjataannya. “Jangan sampai prajurit TNI merasa minder dan mentalnya jatuh karena selalu melihat prajurit negara tetangga memiliki persenjataan moderen, dan kita hanya menontonnya,” kata Taufik.(aya)

Presiden Kirim Nama Calon Kapolri 3 Oktober JAKARTA (Waspada): Ketua DPR RI Marzuki Alie memastikan Presiden Susilo Bambang Yudhoyono akan mengirimkan nama calon kapolri ke DPR RI, Minggu 3 Oktober 2010. Setelah menerima nama, pimpinan DPR, Senin (4/10) mengadakan rapat terkait surat presiden itu. “Saya tadi sudah bertemu Pak SBY di Istana Negara pada pelantikan Panglima TNI dan KSAL. Beliau menyampaikan akan mengirimkan nama calon Kapolri ke DPR 3 Oktober,” ujar Marzuki di DPR, Selasa (28/9). Dia juga memastikan bahwa Presiden hanya akan menaati peraturan dan prosedur yang ada, termasuk mengenai nama calon kapolri yang akan dikirimkan hanya satu nama. “SBY akan sampaikan satu nama saja dan itu sudah sesuai prosedur,” ujarnya. DPR kata Marzuki, memiliki waktu 20 hari

untuk menerima atau menolak calon yang diajukan Presiden. Marzuki juga menjelaskan bahwa waktu 20 hari cukup bagi DPR menentukan calon Kapolri baru. Ditanya apakah SBY yakin bahwa calon yang diajukannya akan diterima DPR, mengingat waktu yang mepet dengan batas waktu pensiun Kapolri Jendral Bambang Hendarso Danuri 30 Oktober nanti, Marzuki enggan menjelaskan. “Jangan pancing saya dengan pertanyaan seperti itu, kita ikuti saja dulu mekanismenya,” imbuhnya. Mengenai komentar Ketua Umum Partai Demokrat, Anas Urbaningrum mengatakan calon-calon Kapolri hendaknya tidak bersafari politik di DPR, Marzuki mengaku belum mengetahui komentar Anas. Namun kata dia, SBY tentunya bisa melihat siapa-siapa dari calon Kapolri yang melakukan safari politik.(aya)

Nama Calon Kapolri Masuk Pasar Taruhan JAKARTA (Waspada): Ketua Fraksi Partai Gerakan Indonesia Raya (F-Gerindra) MPR RI yang juga anggota Komisi III DPR RI membidangi kepolisian, Martin Hutabarat (foto) prihatin bursa nama calon Kapolri sudah masuk pasar taruhan di antara para pejudi. Karena itu, wakil rakyat daerah pemilihan Sumut itu menyarankan Presiden Susilo Bambang Yuhyono tidak berlama-lama menentukan nama calon Kapolri yang akan diajukan ke DPR RI. “Sebaiknya presiden tidak berlama-lama mengajukan nama calon kapolri, karena sekarang saja sudah jadi pasar taruhan di antara para pejudi di kota,” kata dia, kemarin. Namun dia yakin Presiden segera mengajukan calon Kapolri, dan tentunya sudah lama memonitor para kandidat yang dipersiapkannya. Terpenting, kata Martin, siapapun yang jadi Kapolri, diharapkan mampu membenahi internal kepolisian, meneruskan reformasi dan membangun citra kepolisian yang sekarang sangat rendah di mata masyarakat. Kapolri baru juga diharapkan dapat mendukung penyempurnaaan UU Kepolisian, seperti peningkatan peranan Komisi Kepolisian Nasional (Kompolnas) agar cita-cita reformasi dapat dilaksanakan secara utuh. Ketua Fraksi Partai Demokrat (FPD) DPR, M Jafar Hafsah mengisyaratkan adanya kemungkinan calon Kapolri alternatif,selainKomjen Imam Sudjarwo dan Komjen Nanan Soekarna. “Memang yang mengemuka dua calon ini, tapi

adakemungkinancalonalternatif,” ujarnya. Wakil Ketua Dewan Pertimbangan Partai Demokrat yang juga Ketua DPR, Marzuki Alie mengatakan, manuver fraksifraksi yang ada di DPR terhadap pemilihan Kapolri adalah biasa dalam berpolitik. Mereka menurut Marzuki, memang berusaha memengaruhi Presiden untuk memasukkan nama yang mereka usung dalam daftar nama yang akan dipilih DPR. Namun usaha itu diyakinkan Marzuki tidak akan memengaruhi pertimbangan SBY dalam menentukan nama yang akan diajukannya. Jangan di intervensi Pengamat politik dari Charta Politika,Yunarto Wijaya mengingatkan proses pengajuan calon Kapolri yang dilakukan Presiden tidak boleh di intervensi. Adanya pernyataan yang sudah melampaui kewenangan, seperti pendapat mengenai jumlah calon yang harus lebih dari satu, dan pernyataan keterpihakan kepada seorang calon harus dihentikan. Untuk itu, dia meminta SBY mewaspadai agar jangan sampai anggota dari Fraksi Partai Demokrat di DPR ikut-ikutan menginginkan agar SBY menyodorkan lebih dari satu nama. Hal sama disampaikan Koordinator Indonesian Police Watch, Netta S Pane. Dia mengharapkan agar tidak ada pihak melakukan manuver-manuver mendukung calon Kapolri tertentu, karena akan kontraproduktif untuk perbaikan institusi Polri.(aya)

Pencapaian MDGs Hadapi Kendala KULONPROGO (Waspada): Pencapaian sasaran tujuan pembangunan Milenium Development Goals/MDGs) di Indonesia masih menghadapi tantangan berat. Sedikitnya ada tiga persoalan yang mungkin tidak tercapai pada 2015. Tiga persoalan itu, penurunan Angka Kematian Ibu (AKI), masalah lingkungan, dan pemberantasan penyakit HIV/AIDS. Demikian disam-paikan Kepala Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN), Sugiri Syarief di Kulon Progo, DIY, Selasa (28/9). Jumlah AKI tetap pada angka 307/100 ribu kelahiran hidup. Sementara program penanaman pohon banyak terkendala iklim dan angka penularan HIV/AIDS yang mencapai lebih dari 2 juta orang. Persoalan kependudukan, kata Sugiri, mendapat perhatian cukup besar dari dunia Internasional. Dalam pertemuan di New York terkait pencapaian MDG’s beberapa waktu lalu, seluruh kepala negara sepakat mempercepat pencapaian sasaran MDGs. Sugiri mengatakan, dalam menurunkan AKI serta meningkatkan kesehatan ibu dan anak,

pihaknya terus berupaya meningkatkan kesertaan KB. “Dengan perencanaan kapan ibu hamil dan mengatur jarak melahirkan akan membuat ibu lebih sehat dan mengurangi risiko kematian saat melahirkan,” kata dia menekankan tiga hal penting yang menjadi fokus penggarapan program KB yakni, harus bisa melayani seluruh keluarga yang ingin ber-KB, jangan sampai ada yang ketinggalan alias tidak terlayani. Disamping itu, penduduk Indonesia yang berada grey area atau antara miskin dan pra sejahtera menjadi perhatian khusus, karena jumlahnya semakin banyak. 30 Persen dari 43 juta keluarga Indonesia atau sekitar 13 juta sampai 15 juta keluarga seluruhnya digratiskan atau ditanggung pemerintah dalam pelayanan KB. Pihaknya juga memfokuskan pada generasi muda. Sebab membangun keluarga sejahtera dimulai dari generasi muda dengan rencana matang, seperti kapan pasangan muda siap menikah, merencanakan kapan ingin punya anak, berapa anak yang diinginkan, dan mengatur jarak kelahiran anak yang ideal.(dianw)

Bisnis Kosmetik Palsu Capai Rp 4,41 T BERITA ini penting bagi kaum wanita. Kini kosmetik palsu kian menjamur di pasaran. Repotnya, kosmetik jenis palsu ini mirip betul dengan yang asli. Susah membedakannya. Bukan cuma berbahaya bagi kesehatan, ramainya kosmetik palsu itu sudah merugikan masyarakat hingga Rp4,41 triliun. Angka kerugian semenjulang itu bukan jatuh dari langit, tapi berdasarkan hasil survei dilakukan Masyarakat Indonesia Anti Pemalsuan (MIAP). Bekerjasama dengan sejumlah lembaga independen, MIAP melakukan survei, dan hasilnya mengejutkan bahwa dari 12 industri yang gemar melakukan pemalsuan, industri kosmetik ini menduduki posisi paling top, nomor satu. Dari hasil survei itu, “secara keseluruhan dampak kerugian dari pemalsuan hingga tahun ini meningkat 9 kali lipat atau mencapai Rp4.41 triliun,” kata Bambang Sumaryanto, Ketua Bidang Hukum dan Hubungan Pemerintahan MIAP dalam Diskusi Edukasi Konsumen untuk Menimalisasi Pemalsuan dan DampaknyaTerhadap Kehidupan (Studi kasus; Pemberantasan praktek pemalsuan kosmetik), di Universitas Atmajaya, Selasa (28/9). Menghentikan menjamurnya barang palsu itu, kata dia, perlu ada usaha bersifat preventif. Masyarakat sebagai konsumen perlu disadarkan agar lebih waspada terhadap kosmetik palsu. Karena selain soal kerugian yang besar itu, dampaknya sangat negatif bagi kesehatan. Jangan terbuai hanya karena murah. Ini kunci

pemalsuan mematikan kosmetik,” jelasnya. Dirjen HKI (Hak Kekayaan Inteletual) Departemen Hukum dan Ham, Andi Noorsaman Someng menuturkan, selama Januari - Juni 2010 sudah terjadi 79 kasus pemalsuan merek, sedangkan pada 2009 sebanyak 125 kasus masalah merek, belum hak cipta dan paten. “Tentunya hal ini sangat serius, dan petugas kepolisian juga harus serius memproses pelaku baik produsen dan penjual produk palsu,” katanya. Hal senada diungkapkan Kepala Bagian Peraturan dan Perundang-undangan, Badan Pengawas Obat dan Makanan (BPOM), Budi Djanu Purwanto. Menurutnya, menyelesaikan masalah praktek pemalsuan tentunya bukan masalah mudah. Perlu sinergi terpadu dari berbagai pihak secara berkesinambungan, baik pemerintah, penegak hukum, produsen serta konsumen. Berdasarkan data BPOM, pada tahun 2007 terdapat 21 kasus penjualan kosmetik tanpa izin edar. Jumlah ini meningkat sebanyak 54 kasus pada 2008, sedangkan tahun 2009 sebanyak 64 kasus (62 kasus penjualan kosmetik tanpa ijin edar dan 2 kasus penjualan kosmetik mengadung bahan berbahaya). Memang untuk penjualan produk kosmetik palsu menjanjikan keuntungan besar.“Tidak heran dalam satu tahun kerugian masyarakat dan negera mencapai Rp4.41 triliun,” kata Ketua Yayasan Lembaga Konsumen Indonesia, Tulus Abadi.(viva)


SALAM KOMANDO: Kepala Staf Angkatan Darat (KSAD), Jenderal TNI George Toisutta (tengah) melakukan salam komando dengan pejabat baru gubernur Akademi Militer (Akmil) Brigjen TNI Suharsono SIP (kanan) dan pejabat lama Mayjen TNI Gatot Nurmantyo (kiri) pada upacara Sertijab gubernur Akmil di Lapangan Sapta Marga komplek Akmil, Magelang, Jateng, Selasa (28/9). Mayjen TNI Gatot Nurmantyo selanjutnya menduduki jabatan baru sebagai Panglima Kodam v/Brawijaya.

Kerusuhan Buol

222 Polisi Diperiksa PALU (Antara): Kepolisian Daerah Sulawesi Tengah telah memeriksa 222 anggota polisi terkait kasus kerusuhan di Biau, Kabupaten Buol yang mengakibatkan delapan orang tewas tertembak dan puluhan lainnya luka-luka. “Pemeriksaan sampai saat ini masih berlangsung, jumlahnya sudah mencapai 222 orang polisi,” ujar Pelaksana Harian Kepala Bidang Humas Polda Sulawesi Tengah, Kompol Kahar Muzakkir dihubungi Antara dari Palu, Selasa (28/9). Dia menuturkan, 222 anggota polisi itu diperiksa petugas gabungan dari Bidang Profesi dan Pengamanan (Bidpropam)

Polda Sulteng dan tim Mabes Polri. Kompol Kahar menjelaskan, pemeriksaan terhadap ratusan anggota polisi itu dilakukan di dua tempat berbeda yakni, Mapolda Sulteng di Palu dan sebagian lagi di Mapolres Buol. Menurut dia, pemeriksaan tim gabungan itu masih difokuskan di tempat kejadian, mulai dari digelarnya razia balapan liar, meninggalnya Kasmir Timumun, seorang tahanan di sel Polsek Biau hingga terjadinya penembakan saat bentrok warga dengan polisi. “Dari 222 polisi yang diperiksa, sejauh ini belum satupun yang ditetapkan sebagai tersangka,”

sebut Kahar. Namun kata dia, 25 dari 222 polisi itu telah berstatus sebagai terperiksa dan dalam waktu dekat akan menjalani sidang disiplin Polri, terkait kasus kerusuhan berdarah itu. “Insya Allah, Kapolda Sulteng Brigjen Polisi Muhammad Amin Saleh yang akan memimpin langsung pelaksanaan sidang disiplin itu,” tandasnya. Meski tidak menghafal identitas seluruh terperiksa kasus Buol, namun dari informasi dihimpun menyebutkan, ke-25 polisi terperiksa dan akan menjalani sidang disiplin Polri itu di antaranya, AKBP Amin Litarso (Kapolres Buol), Kompol Ali Hadi Nur (Wakapolres

Buol), Iptu Zakir Butudoka (Kapolsek Biau), Iptu Jefry Pantouw (Kasat Lantas). Selanjutnya, Bripka Sukri Saini, Briptu Suryani, Bripda Aris Raga, Briptu Ismanto, Briptu Sudirman, Briptu Ilham Tri Yoana Putra, Briptu Andi Oktavianto, Briptu Basrun, Briptu Yulianto, Brigadir James Jhon, Aipda Rustanto, Bripka H Idham Tomagola, Brigadir Amirullah, AKP Nugroho, dan Ipda Tilong. Enam Warga Jadi Saksi Sementara, tim gabungan Mabes Polri dan Bidang Profesi dan Pengamanan Polda Sulteng memeriksa enam warga sipil sebagai saksi. Mereka diperikas di Mapolres Buol.

Kahar mengatakan, pemeriksaan seputar awal dan akhir terjadinya kasus kerusuhan Buol, termasuk terjadinya bentrokan warga dengan polisi. “Belum ada warga yang ditetapkan sebagai tersangka, karena sampai saat ini pemeriksaan masih dilakukan,” ujarnya. Sebelumnya, Kapolda Sulteng Brigjen Muhammad Amin Saleh menyatakan, ada tiga polisi berpeluang menjadi tersangka terkait kerusuhan di Buol. Dalam kasus itu, Kapolda juga telah mencopot tiga perwira. Ketiganya, Wakapolres Kompol Ali Hadi Nur dan Kasat Lantas Buol Iptu Jefry Pantouw serta Kapolsek Biau Iptu Zakir Butudoka.

Ketua Tim Teknis Dicopot JAKARTA (Waspada): Pimpinan DPR telah menyepakati dilakukannya reposisi di jajaran kesekjenan DPR. Untuk itu pimpinan DPR telah meminta Setjen DPR merombak tim teknis pembangunan gedung baru yang telah menimbulkan opini negatif publik terhadap DPR. “Tadi membahas usia staf kesekjenan yang lebih dari 58 tahun agar diganti, terutama dalam kaitan pemeliharaan gedung harus benar-benar spesialisasinya,” ujar Wakil Ketua DPR DPR, Taufik Kurniawan usai rapat pimpinan di Gedung DPR Jakarta, kemarin, Perombokan ini kata Taufik, akan memberi penyegaran di Setjen DPR, dan diharapkan pegawai yang baru dapat memberikan keterangan lebih baik kepada publik terkait rencana pembangunan gedung baru DPR. “Bu Sekjen Nining Indrasaleh sudah menyampaikan akan segera melakukan evaluasi,” terangnya. Ketua DPR RI Marzuki Alie mengakui rapat pimpinan DPR telah menyepakati dilakukannya reposisi jajaran kesekjenan. “Kami (pimpinan DPR) telah menyetujui adanya reposisi, untuk kemudian diserahkan ke Badan Pertimbangan Jabatan dan Pangkat atau Baperjakat. Reposisi ini terutama untuk mengatasi berbagai permasalahan sumber daya manusia di jajaran Sekjen dan juga hal rutin lainnya,” ujar Marzuki. Ditanyakan apakah nama Kepala Biro Pemeliharaan Bangunan dan Instalasi yang juga Ketua Tim Teknis Pembangunan Gedung DPR baru, Mardian Umar yang salah satunya akan diganti karena kemungkinan terlibat permainan proyek, Marzuki enggan menjelaskannya. “Nanti saja dijelaskan,” ujarnya. Begitupun, kata Marzuki, rencana pembangunan gedung tetap diteruskan. Pimpinan DPR telah meminta konsultan dan BURT untuk kembali menjelaskan rencana pembangunan, termasuk hasil evaluasi rencana pembangunan yang sudah dilakukan mengenai harga bangunan yang kelewat tinggi.(aya)

SIMULASI KOPASSUS-SAS: Dua prajurit antiteror menjinakkan bom dengan bantuan robot dalam simulasi gabungan Kopassus-SAS Australia dalam penanggulangan terorisme di Bandara Ngurah Rai, Bali, Selasa (28/9). Simulasi dengan sandi “Down Komodo” itu melibatkan sekitar 300 personel dari kedua pihak untuk melatih kesigapan dalam mengatasi teror di bandara internasional tersebut.

Indonesia Tuan Rumah Forum Zakat Dunia

Peserta Jamsostek Non Aktif Agar Segera Cairkan JHT

JAKARTA (Antara): Indonesia menjadi tuan rumah pertemuan Forum Zakat Dunia (World Zakat Forum) 28 September hingga 2 Oktober di Yogyakarta. Ketua Umum Badan Amil Zakat Nasional (BAZNAS) yang menjadi ketua panitia pengarah kegiatan, Didin Hafidhuddin di Jakarta, Selasa (28/9) menyatakan bahwa World Zakat Forum digagas untuk memperbincangkan kemungkinan kerjasama zakat lintas negara. Hasil akhir pertemuan diharapkan dapat mengatasi kemiskinan yang dialami kaum muslimin di berbagai dunia. Saat ini jumlah penduduk miskin di seluruh dunia mencapai 830 juta jiwa, yang perlu dibantu dengan dana zakat. Ketua Umum Asosiasi Organisasi Pengelola Zakat (Forum Zakat) yang juga Pengarah Deklarasi kegiatan itu, Ahmad Juwaini menyebutkan bahwa kegiatan World Zakat Forum akan mendeklarasikan lahirnya forum pertemuan reguler pelaku zakat dunia. Forum ini diharapkan dapat bersidang minimal tiga tahun sekali dengan tuan rumah berganti-ganti di berbagai negara, juga akan membicarakan pembentukan World Zakat Fund, yaitu sebuah Pooling Fund dana zakat dunia untuk mengatasi bencana internasional, terutama yang dialami oleh negara-negara muslim. Dia juga mengatakan, potensi zakat di seluruh negara muslim saat ini mencapai tidak kurang dari 600 Miliar dolar AS.

JAKARTA (Waspada): Direktur Utama PT Jamsostek Hotbonar Sinaga meminta para pekerja peserta non aktif Jamsostek yang berusia 55 tahun untuk segera mencairkan dana Jaminan Hari Tua (JHT) nya. Sebab rekening mereka masih ada dan memiliki saldo, namun hingga saat ini belum pernah dicairkan. “Rekening para pekerja peserta non aktif itu masih ada. Kami mengimbau agar mereka segera mencairkan atau mengklaim dananya di seluruh kantor cabang jamsostek,” kata dia saat konferensi pers di Jakarta, kemarin. Kemungkinan para pekerja itu menjadi status non aktif karena tidak mengetahui dirinya pernah di daftarkan sebagai peserta jamsostek oleh perusahaannya. Kemudian tidak pernah memegang kartu peserta Jamsostek karena disimpan


manajemen perusahaan sampai ke luar dari pekerjaannya. Selain itu, juga disebabkan pindah kerja atau pekerja tersebut memiliki kartu peserta jamsostek lebih dari satu. Atau ada juga kemungkinan pekerja itu sudah meninggal dunia tanpa ada laporan dari ahli waris atau kerabatnya. “Saat ini ada 3,3 juta pekerja memiliki kartu ganda. Untuk itu kami sedang melaksanakan pendaftaran ulang agar dapat menghilangkan kartu ganda. Jadi peserta Jamsostek nantinya akan memiliki nomor identitas tunggal,” sebutnya. Hotbonar juga menepis dana sebesar Rp4,9 triliun milik 4 juta pekerja peserta non aktif itu tidak bertuan. Dana itu ada tuannya, hanya saja kesulitan mencari alamat pekerja. Untuk menemukan alamat para pekerja yang sudah tidak

aktif, pihaknya berupaya mencari informasi melalui data perusahaan tempat pekerja itu bekerja. Kemudian melibatkan ketua rukun tetangga dan rukun warga, serta melalui data formulir 1A, yakni, formulir awal saat pekerja itu mendaftar menjadi peserta Jamsostek. Dia mengatakan, belum dapat menargetkan kapan pemberian dana itu akan tuntas, namun jika dalam waktu dekat tidak ada pekerja yang mengklaim JHT nya maka paling lambat akhir tahun ini akan dibuat pengumuman besar-besaran, namun tidak menyertakan nama pekerja karena rawan pemalsuan data seperti KTP dan kartu peserta jamsostek. “Intinya dana itu harus dikembalikan kepada orang yang berhak menerimanya. Jadi kami harus ekstra hati-hati mengumumkan itu,” katanya.(j04)

B10 1 CM 2 CM

Rp. 12.000 Rp. 24.000



AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 3181 97

Hijau metalic, BK Medan asli (PIL). BPKB Satu Nama, Full Original (TP). Hub. 0813 61138 100


Grand Max Minibus DP 13 Jt-an/Angs. 3 Juta-an Gran Max Pick-Up DP 7 Jt-an/Angs. 2 Jt-an Xenia Terios Murah. Hub. 0813 6177 3589/77943677

DAIHATSU Rocky Th. 94. BK Mdn, AC, Tape, VR, BR, PS, Mulus, siap pakai. Harga 66Jt.damai. Hub. 0812 650 8819 # PAKET MURAH ASTRA DAIHATSU # New Pick Up DP 5 Jt-an Angs. 2 Jt-an 4 Thn. New Pick Up DP 7 Jt-an Angs. 2 Jtan 3 Thn Xenia VVTI DP 11 Jt-an Angs 3 Jt-an Ready Stock !! Hubungi: Ahmad Arif Astra Daihatsu 0812 6005 2465/061 7627 7692 (24jam)

DAIHATSU Prima 21 MB Thn. 94. Asli Medan, Tape, VR, BR, Mulus, siap pakai. Harga 21Jt damai. Hub. 0812 650 8819 DAIHATSU 100% BARU PAKET MURAH...!! Xenia Li.........DP 11 Jt-an.........Angs 3 Jt-an Terios ............DP 14 Jt-an.........Angs 4 Jt-an Pick Up..........DP 9 Jt-an...........Angs 2Jt-an Hub. JOSUA. 061-77004944/0812 6311 0820

DAIHATSU Taft GTS Thn. 94. AC, TV + DVD + P + Sub, VR Cobra, Ban 31, Hitam, BK. Hub.9114 4382 DAIHATSU Grand Max 1.5, Thn. 2008. AC, Tape, VR, PS, CL, Hitam, Plat B Rp. 85 Jt. Hub. 91327433. Jl. Biduk 57 (Bantu Kredit) DAIHATSU Rocky Thn. 93 Dijual. Hitam metalik, BK Medan, Body lempang, AC Dingin, DVD MP4, Sound System. P. Window, Vlac Cobra. Ban Baru. Mulus dan bagus. Peminat Serius Hub. 0813 9665 6961, TP.

- Daihatsu Xenia Type Xi Thn. 2004 W. Merah - Suzuki Carry Minibus Thn. 1996 W. Hitam - Daihatsu Zebra Minibus Thn. 1995 W. Merah - Daihatsu Espass Minibus Thn. 2004 W. Silver Hub. Jl. Helvetia Raya Pasar 7 (Manunggal) Telp. 061-77256868 HONDA Accord prestige ‘86 dijual. AC, PS, PW, Plag Radial, kondisi mulus, siap pakai. Harga 32Jt Nego. Hub. 0812 6572 0788

HONDA Civic 79/80. AC, Tape, Mesin bagus. Hrg. 17Jt/ Nego. Hub. 68701168 HONDA Civic - Wonder Thn. 87. Warna merah marun. BK Medan, Pajak panjang, lengkap. Harga 24Jt Nego. HP. 061-76222579


Silver, Masih satu nama. H. 58Jt. Hub. 0852 6211 2160


DP 10 Jt-an (Pick Up)* REA STO DY CK

Rp. 36.000 Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000


HYUNDAI Atoz LGS Th. 2000, warna hitam, asli BK, cantik mulus, siap pakai. Balik DP 25Jt. Angsuran Tinggal 24x lagi dari 3 Th. @ Rp. 1.824.000. Dan Timor Th. 98 Kabulator, warna hitam yang berminat Hub. segera T.P Ke 0813 6203 4488 Jl. Gaperta No. 126 A Samping Antonio Salon

ASTRA INTERNATIONAL KRAKATAU Jl. Gunung Krakatau No. 9 NN-00 061-6639009

Rp. 91.000 Rp. 104.000

TOYOTA Avanza Type G VVT-I Dijual. Thn. 2006 Akhir, Warna hitam, BK Medan asli, satu tangan, mesin sangat halus. Body mulus. Seperti Baru. Harga Rp. 135Juta/ Nego. Hub. 0812 6038 561


AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + Bunga Ringan. Hub. 0813 7512 7297 - (061) 7795 1428

# ISUZU 100% BARU (ASTRA) # Panther Pick Up Turbo.................DP 5 Jt Panther LM, LV, LS, Touring..........DP 25Jt Hub. SUPRAPTO 061-77860168 / 0813 7507 0088

TOYOTA Kijang Capsul Model LGX Bensin 1,8 Thn. 2002, mulus, full sound system, VR, BR, PS, PW, CL, Rmt, E. Miror, AC DB, TV. Hrg. 118Jt. Nego. Hub. 061.6967 9753

ISUZU Panther Hi-Sporty 25, Hijau ‘97, BK AC DB, PW CL, Jok Sm. Kulit, DP 20Jt. Angsuran: 2,14rb. Sisa 35x. Hub. AISYAH: 0813 7728 0512

TOYOTA Corolla All New ‘96. Merah, AC, R/T. PS, PW, CL, VR, BK Mdn. Hub. 0813 6130 9083 TOYOTA Kijang Grand Rover Diesel. Thn. 98. Biru, BK Ex Mutasi Rp. 75 Jt. Hub. 0812 6594 2789

ISUZU Panther Grand Royal Plus Dijual Thn. 96/97. BR, CL, PW, Alarm. PS, Harga Nego. Hub. 77789366 DIJUAL CEPAT BU

- ISUZU Panther Royal 93 Complete 53Jt - Mitsubishi Kuda 2002 77Jt - Escudo Th. 2000 76Jt - HP. 0813 6061 5466 - HP. 0813 7622 9466 DRS. BUDI

ISUZU Panther 2.5 Grand Royal Plus 1997. Biru metalik, AC Denso Double Blower, PW, CL, Jok Kulit. Hub. 0812 6035 729/ 061-30086796 KIA PICANTO ‘10 GARANSI 5 TH.

bbm 1=23km DP 10 Jt/cicilan 2,8Jt (Limited Edition) Syarat mudah, proses cepat dan ramah. Data dijemput Hubungi: Roy 0813 7080 8770

MITSUBISHI T. 120SS Pick Up Thn. 2005. W. Hitam, mobil satu tangan, original. 0819 886 560 MITSUBISHI Kuda Diamond Diesel Thn. 2003 Merah Maron Met, BK Ex Mutasi Rp. 105Jt. Hub. 0816 3113 953 MITSUBISHI L300 MB Sparta Thn 2005, Warna Biru, BK Medan, Velak Racing, BR, VCD, Power sub wofer, Mobil cantik, Siap pakai Hub. 0813.6150.3449 MERCEDES Benz E230 New Eyes, 97/ 98. BK Mdn Tgn-2. BK 2 Angka, 4 A. Bag, ABS, Cool Box, DP 25Jt. Angsuran: 4,1Jtx35. Hub. AISYAH: 0813 7728 0512

SUZUKI Carry 1.0 Minibus thn. 96. Alexander pintu Blk. VR, BR. Hub. 0813 7067 9800 SUZUKI Carry 1.0 Tahun ‘85 (Pjk Pjg). Ban 95 %, Sound DVD, MP3, VCD (remote). Lampu modif Mk blkg. Hrg 16,3 (nego dikit). Hub. 0812 644 7070-0813 7694 8338 DEALER RESMI SUZUKI MOBIL.

PU 1.5 DP 10 Jt-an. Angs. 2 .946.300,APV DP 12 Jt-an Angs. 4.830.000,NB: Proses mudah & cepat data dijemput Hub. 0812 654 0809 / (061) 77722121

SUZUKI Karimun GX Thn. 2003 Hitam. BK Mdn Rp. 74Jt. Hub. 0813 7508 8798 SUZUKI Futura Pick Up 96 Dijual. Warna hitam, kondisi bagus. Harga 37 Nego. HP. 0813 6121 9195 - 77043436 SUZUKI Carry 03 MB 1,5 Warna Hijau metalic Dluxe. AC, BR, VR, RD/Tape. BK Asli. Lanjut Kredit 35 x Rp. 1.859.000. Kembalikan DP 17,5Jt/Nego. Hub. 0813 7043 0346 Maaf TP

*) Syarat & Ketentuan Berlaku

7 CM 8 CM

TOYOTA Avanza Thn. 2010, Type G, Balik DP Rp. 52Jt. Sdh bayar 7 jali per bulan 4.444.200. Wrn. Hitam, mobil cantik, KEMBAR PONSEL Jl. SM. Raja No. 200 (Dpn UISU) 0812 6524 3555 / 7851402


Ready: Avanza, Innova, Fortuner, Rush, Yaris, Vios. Bersedia Tukar Tambah dengan mobil lama Anda. Proses Cepat Data Diambil. Hub.: TOMMY 0813 7043 7766 - (061) 7650 4588

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang ATI-HA TI-HATI mengatas namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli produk anda, TI-HA TI apabila anda ingin dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih

TOYOTA Innova 05 Bensin, Tipe G, Warna Hitam Mls. Hrg. Nego. BK Mdn Asli. Jl. Jermal I Mdn Denai. HP. 0813 7504 4940 / 76566611 TOYOTA Starlet Th. 95 W. Biru met, 1,3 SEG. Tipe lengkap. Kondisi mulus, PS, Miror, Remot, PW, MP3. Harga 60Juta (BU). Hub. 0813 7051 3271

TOYOTA Kijang Commando Thn. 90. Short, Biru metalik, VR, Ban Baru, Jok kulit, Tape, Mobil mulus, a/n. Sendiri. BK Medan asli. Harga Nego. Hub. 0852 6268 2022 Jenis Mobil Thn. Harga Mits. L300 03.07.08 Daihatsu GTS 89 43Jt Kijang PU Solar 03 89Jt Hub. Kembar Mobil Jl. Tritura No.9 0812 6058 6666 (Bs bantu Kredit)



KREDIT SP. MOTOR HONDA BARU DP Murah langsung antar. Hub. 0813 9613 8218


RENTAL MOBIL RENTAL MOBIL MURAH Rp. 250.000/Hari Mobil: Avanza, Xenia. HP. 061.66477734, 0813 9779 1077 Maaf TP.


HUB. 0816.314.5371 - (061) 9102.7176






Jaminan BPKB Mobil sepeda motor, Becak. Bunga 1,5%. BPKB Aman, Data Dijemput, Proses Cepat. HP. 061.66477734, 0813 9779 1077 Maaf TP


Gratis Iuran Seumur Hidup Khusus Karyawan: * PT. PLN * PT. KAI * PT. Jamsostek * PT. Telkomsel * PT. Pertamina 0813 5777 1138 - 061.69911174


Jaminan Apa Saja, Sertifikat Tanah. Spd. Motor, Take Over Mobil. Hub. 061-8222774, HP. 0816 314 1807


Jaminan BPKB, Mobil, Sp. Motor, Betor dan Taksi semua tahun, syarat ringan, Proses Cepat. Hub. 061-7633 6525 - 0812 6081 3010

SINAR MAS MULTI FINANCE BUTUH PT. Jaminkan Khusus BPKB Sepeda Motor Bervariasi, Discount 1 x Cicilan. DANA Bunga Hub. 0813 6101 7444

DANA EXPRESS SHM, SK Camat 1 Hari Clear 0813 6229 0001 0812 6095 5531 (Henrik)




SEWA FLOOR STANDING HUB: 3 Pk Jln. Sutomo No. 139 C. & 5 Pk

BPKB Mob Beban Mitsubishi BK 8543 BS a/n. Anas Mukhtar alamat Jl. Durung no. 18 Lk. VIII Medan yang menemukan mohon dikembalikan


ELEKTRONIK KARYA TEKNIK Service: AC, Kulkas, M. Cuci, TV, B. Pasang, Instalasi Listrik. Bergaransi. Hub. 061-77913537 / 0813 7553 3375 CUCI AC, ISI FREON, BONGKAR PASANG. REPARASI, KULKAS, MESIN CUCI Hub. DIFA SERVIS 0813 9735 7061 061-69644786

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat






Simp. Gandho



Carrefour, Plaza Medan Fair Lt. 4

(samping Kalasan masuk sebelah Oke Shop)

Dapatkan kelebihan beli handphone di AVISTEL

- Garansi Resmi 2 Tahun RIM - Jaminan handphone baru gress 100% - Kemasan original Original battrey, Hansfree, charger, cabel data, leathen case - Dihargai lebih tinggi pada saat jual kembali - Pelayanan fungsi/ fitur handphone, pemindahan phone book dll DEALER RESMI


Free: Install Aplikasi BB selama Pakai Harga Promo 3 Hari Plus Free Upgrade Versi 05

SINAR MAS MULTIFINANCE. BUTUH PT. Jaminan Khusus BPKB sepeda motor bunga 1,5%, Discon, 1x cicilan Hub. DANA 0812.656.8635 - 0852 6211 3390

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

Melayani Grosir dan eceran - Bisa tukar tambah - Pembayaran bisa dengan kartu kredit NB: Harga tersebut tanpa syarat !!

Rp. 395 Nokia C5 Rp. 1.600Nego i 160 Rp. 495 Tersedia: Nokia 2700, 5130, X10 T 169 Rp. 495 6303i, 5330, C3, dll T 699 Rp. 545 Gratis Screen Protector Bagi Pemegang Kartu ATM / Kartu Kredit MANDIRI



Jl. Karya No.68 Sei Agul Medan Telp. 061-663 9308, 7700 9000 HP. 0813 70900 400, 0852 6144 8000 0816 301 761



WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 081361718158, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja



Hub. 8219951 Jl. Setia Budi No. 2 Jl. Brayan Medan

Tumpat Sedot

8442246 WC 08126427 1725 ADI Telp.:



TERCECER BPKB Sp. Motor Yamaha BK 6861 IW a/n. SURYANINGSIH Alamat Jl. Kawat 3 L k . 1 3 T g . M u l i a M e d a n . Ya n g menemukan mohon dikembalikan.

TERCECER BPKB BK 6140 IZ a/n. Desi Siburian. No. Mesin JB8IE - 1289061. No. Rangka MHIJB81128 K293379. Jl. Kapt. M. Jamil Lbs Blok I Aspol - 9 Medan. TELAH TERCECER

1 Berkas Asli Surat Tanah Akte Camat Medan Labuhan No. 592.2.170/1988 a/ n. SYARIFUDDIN JALI seluas 479,50m2. Letak tanah di lingk. 32 Rgs. Pulau yang sekarang menjadi lingk. 19 Rengas Pulau Kec. Medan Marelan. Hilang disekitar Jalan Marelan Raya Sampai Medan pada tgl. 15 Agustus 2010. Belum ditemukan.

TERCECER BPKB No. A-9902138-B a/n. Manna Sirait. Jl. Mesjid Taufik Lk. 7 Medan TERCECER

BPKB No. BK 8022 BY a/n. P.J. GUJATI LIMA PULUH SEMBILAN UTAMA. Jl. Maphilindo No. 53 Medan.



1 Buah Surat Tanah atas nama: LISTIWATI. SK Camat Uk. PxL 5x20M. Bagi yang menemukan Hub. 0813 7067 1944 TERCECER Telah tercecer satu buah surat Tanah (segel) Tahun 1964 a/n. Djarim. Dengan alamat Jalan Bangun Sari I Medan. Ukuran 20x20 (400m2). Tercecer disekitar jalan Datuk Kabu. Bagi yang menemukan mohon dikembalikan kepada Agus Salim. Alamat Jalan Datuk Kabu Gg. Sahabat No. 4. Tidak dituntut dan akan diberikan hadiah sepantasnya.


- Surat Akta Pelepasan Hak dengan Ganti Rugi No. 338/3/APH/MTT/1983 - Surat Penyerahan Tanah Garapan A/n. Balendina br Purba, yg terletak di Lorong IV Kp. Sidomulyo Kec. Medan Sunggal, Luas ±1500m² - Surat Kepala Kelurahan Pd. Bulan Selayang II No. 39/3/Sel-I/1984 A/n. Sahun Meliala yg terletak di Lingkungan XII Desa P.B. Selayang II, Luas 8.793.43m² Hilang/ tercecer disekitar Jl. Mangkubumi s/d Sembada XVI


Bergaransi/ Setia Luhur 160 F


845.8996 0812.631.6631



TERCECER BPKB No. 6764 896-B. a/n. LELI LUSIANA Br. SARAGIH. Dsn. I Pertambatan Dolok Masihol

Ingin Promosikan Produk Anda

Ada Garansi




Tosiba (Co2D/cor2/1Gb/120dvrw+wcam? Cpu P4=499rb (warnet/ruma) Pr.co2=590 Tosiba Co3=cal/compaq P4/14”=1.893rb Hd/ram/dvdcrw/monitor/cas=mura

Laptop baru/bks (bisa Tt+) Projector=2.459rb

TEL. 061-7347810 - 7360741 TEL. 77982281 medan INSTALASI & PEMASANGAN SERVICE, REPARASI AC - KULKAS

TV, 14”, 20”=300rb s/d =800rb, 29”=1Jt s/d=1,9Jt, 34” Sony=2,5Jt. Photo Frame 10”=800rb, PS1=400rb, PS2=850rb, PS HD=1,3Jt, DVD=200rb. Ampli, Spk: BMB, Kenwod, ADC, AC: 1/2, 1,1 1/2, 2 Pk=1,3Jt s/d=1,9Jt. Kulkas: 1 pt=500rb s/d=950rb, 2 Pt=800rb s/d=1,3Jt, 2 Pt. Jumbo=2Jt. M. Cuci: 1 tb=600rb, 2 tb=800rb s/d=1,3Jt, Laptop: P.3=1,5Jt, 2core=2,5Jt. P. Jector=3Jt, H. Dicam, Sony, JVC, Mini DV=1,8Jt, DVD=2,3Jt. Camera 4 Mp s/d 10MP=500rb s/d=1,3Jt, Hub. UD. Senang Hati: 4517509-77073637. Jl. Sekip 67 A (Jual/Beli)


HILANG/TERCECER 1 (Satu) buah BPKB Asli STNK BK 5254 IT a/n. SABARITA Br. Sembiring. Alamat Citarum Dsn. II Kec. Sunggal D/S.



Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

Jago Servis: Latop-Projctor-Lcd-Prin (Jual-beli-Gadai-TT)- 0812.636.1967.Jl. Rantang


BB Onyx Black + 2 Gb........ Rp. 4.070 Nego BB Bold Black + 2 GB........... Rp. 3.430 Nego BB Pearl + 2 GB.................... Rp.3.490 Nego Tersedia: BB 9500, O Din, Curve 9300 (Keppler 3G), Gemini, Torch 9800, Javeline LG NOKIA Nokia X6 Rp. 3.185 Nego LG C100 New Rp. 740 Nego Nokie E72 Rp. 3.195 Nego (Qwerty, Facebook) IMO Nokia 5800 Rp. 2.420 Nego


Latop? (Mesin Fotocopy color=699rb) Lcd Tv 950rb











Avanza, Innova, Fortuner, Rush, Vios, Yaris, Camry. Bisa Kredit dna Cash. Data Dijemput / Dan Bisa Tukar Tambah. Hub. 0813 6120 1719 / 6878 3325

Rabu, 29 September 2010

Media yang Tepat untuk Iklan Anda

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347




Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)


WASPADA, Rabu, 29 September 2010


Tak Bayar Setelan Nikah, Rod Stewart Digugat Penyanyi Rod Stewart digugat ke pengadilan dengan tuduhan tidak mau membayar setelan nikahnya tiga tahun lalu. Desainer Karen Matthews telah mendaftarkan gugatan yang menyebut Rod berutang 5 ribu pound. Gugatan itu didaftarkan di pengadilan perdata di Los Angeles dan sidang akan berlangsung bulan November.

07.30 Sinema Pagi 09.00 Dahsyat 11.00 Silet 12.00 Seputar Indonesia Siang 12.30 Sergap 1 3 . 0 0 Si D o e l A n a k Sekolah 15.30 Cek & Ricek 17.00 Seputar Indonesia 17.30 Who Wants To Be Millionaire 18.00 Putri Yang DItukar 19.00 Kemilau Cinta Kamila 20.30 Mertua Dan Menantu 22.00 BOM : Indonesia : Liar 24.00 When Animals Attack 01.00 Seputar Indonesia Malam


07.30 Inbox 09.30 Halo Selebriti 10.00 SCTV FTV Pagi 12:00 Liputan 6 Siang 12.30 SCTV FTV 14.30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Sensasi Artis 17.00 Liputan 6 Petang 17.30 Cinta Juga Kuya 18.00 Sinema Spesial 19.00 Taxi 20.30 Cinta Fitri Season 6 22.00 Barometer 23.00 Sigi Investigasi 23.30 Potret Menembus Batas

dan mereka menikah di atas perahu pesiar bernama Lady Ann Magee. Juru bicara Stewart mengatakan bahwa gugatan Matthews tak berdasar dan dia tidak tepat waktu menyerahkan setelan tersebut. “Setelan itu tidak tepat waktu dan tak nyaman serta tak bisa dipakai. Stewart terpaksa membeli setelan lain pada saat terakhir,”

kata juru bicara itu. Stewart memang dikenal pelit oleh kawan-kawannya. Bekas rekan satu grupnya di Two Faces, Ronnie Wood, pernah menyebut Stewart pelit sekali. Tapi, Stewart membela diri “saya berhati-hati dengan uang, sedangkan Ronnie tidak. Dia tidak mengawasi keuangannya seperti saya. Dia tak punya darah Scotlandia.”(ant)

07.00 Pororo The Little Penguin 07.30 Kartun Animal Mechanicals 08.30 Espresso 09.30 Sinema Religi 11.30 Topik Siang 12.00 Musik : Klik 13.00 Espresso 14.00 Tawa Sutra XL 15.00 Djarum Indonesia 17.30 Topik Petang 18.00 Dapet Deh 18.30 Super Family 19.30 Super Deal 2 Milyar 20.30 Tawa Sutra 22.00 Sinema Legenda 00.00 Topik Malam 00.30 Lensa Olahraga Malam

07.00 Disney Club 07.30 Cerita Pagi 08.30 Layar Pagi 10.00 Cerita Siang 11.00 Sidik 11.30 Lintas Siang 12.00 Layar Kemilau 13.30 Cerita Sore 14.30 Starlite 16.30 Lintas 5 17.00 Zona Juara 18.00 Animasi Spesial 19.00 Upin & Ipin 21.00 Dangdut Never Die 23.30 Premier Highlights 00.00 Lintas Malam

07.00 Dive Olly Dive 07.30 The Price Is Right 08.30 Surga Untukmu 09.30 FTV Drama 11.30 Patroli 12.00 Happy Song 14.00 KiSS 15.00 Fokus 15.30 Cinderella 17.00 Arti Sahabat 18.00 Surga Untukmu 19.00 1 Lawan 100 20.30 Take Him Out 23.00 Sinema Asia 01.00 Fokus Malam

Rod Stewart/

07:05 Editorial Media Indonesia 08:05 Healthy Life 09:30 Market Review 10:30 Metro Xin Wen 11:05 Green Lifestyle 13:30 Jakarta Jakarta 14:05 Sports Club 14:30 Metro Sore 15:30 Public Corner 16:05 Discover Indonesia 16:30 Inside 19:05 Suara Anda 20:30 Newsmaker 21.05 Top Nine News 21.30 Otoblitz 22:05 Mata Najwa 23:05 Metro Realitas 23:30 WIB Metro Sports

TAO Toba Star akan memeriahkan Perayaan Pesta Danau Toba 2010 digelar 20-24 Oktober, sebagai ajang untuk mencari talenta berbakat di bidang seni khususnya lagu Batak. “Kita mengetahui Sumatera Ut a ra m e r u p a k a n g u d a n g penyanyi, misalnya Panbers, The Mercy’s, Christine Panjaitan, Diana Nasution dan lainnya. Ajang Tao Toba Star digelar untuk mencari

07.30 Rangking 1 08.30 Derings 10.00 Suami Suami Takut Istri 12.00 Reportase Siang 12.30 Jelang Siang 13.30 Online (Olga & Jeng Kellin) 14.30 Jail Fresh 15.00 Missing Lyrics 15.30 Kejar Tayang 16.00 Investigasi Selebriti 16.30 Reportase Sore 18.30 Sketsa 19.00 Sinden Gosip 20.00 Realigi 21.00 Bioskop TRANS TV 23.00 Bioskop TRANS TV 01.30 Reportase Malam

bibit terbaik untuk go nasional,” kata General Manager Visi Production, Andra Hasibuan. Andra menyebutkan, gawean tersebut dibagi tiga kategori yakni solo, trio dan vokal grup yang bisa diikuti kalangan umum. “Peserta bisa membawakan lagu siapapun, atau ciptaan sendiri,” jelasnya. Audisi digelar di delapan kota/ kabupaten yakni Medan, Tebing

06.30 Apa Kabar Indonesia 11.00 Backpacker 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Opini 14.30 Wisata 15.00 Kabar 15 15.30 Kabar Pasar 16.00 Menyingkap Tabir 16.30 Yang Terlupakan 17.00 Renungan Hari Ini 17.30 Kabar Petang 19.30 Suara Keadilan 20.30 Apa Kabar Indonesia 22.30 Hot Impor Night 23.00 Jejak Malam 23.30 Kabar Arena

08:00 The Backyardigans 09:00 Monchows 09:45 Obsesi 10:30 Bukan Sinetron 12:00 Abdel & Temon Bukan Superstar 13:00 Global Siang 14:30 Spongebob Squarepants 15:00 Petualangan Panji 15:30 Berita Global 17:00 Kapten Tsubasa 22:00 Big Movies 00.30 FIFA World 01.00 MTV Insomnia

Tinggi, P. Siantar, Balige, Tarutung, Panguruan, Sidikalang dan Dolok Sanggul. Peserta bisa mendaftar diri diVisi FM Jalan Iskandar Muda Medan dan radio-radio terdekat di kota masing-masing. Pemenang setiap kota/kabupaten akan dihadirkan di panggung utama Pesta Danau Toba serta hadiah puluhan juta rupiah juga tiga unit sepeda motor.(rel/m09)

07:30 Selebriti Pagi 08:00 CAWAN 09:00 Inspirasi Dorce 10:00 Rahasia 11:30 Redaksi Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Ayo Menyanyi 14:00 Kuas Ajaib 14:30 Dunia Binatang 15:00 Koki Cilik 15:30 Jejak Petualang 16:00 Redaksi Sore 18:00 Wara Wiri 18.30 On The Spot 19.00 Mendadak Dangdut 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Berburu 01:00 Redaksi Malam **m30/B

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan



Setelan nikah tersebut dibuat untuk pernikahan Stewart dengan Penny Lancaster di Portofino, Italia. Juru bicara Matthews kepada mengemukakan “Pakaian itu belum dibayar penuh dan Rod masih menyimpan tanpa mengembalikan barang yang belum dia bayar.” Stewart (65) sudah lama berpacaran dengan Lancaster (39)

Tao Toba Star Meriahkan Pesta Danau Toba


Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap 350 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) Desain Grafis + iNTERNET....................... 600 Rb (1 bulan) Aplikasi kantor + Internet....................... 450 Rb (1 bulan)

Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 BULAN PROMO DISCOUNT 20% TUNAI



Menerima Mahasiswa/I Baru T.A. 2010/ 2011

Pendaftaran dimulai dari sekarang s/d September 2010 Informasi/ Pendaftaran: 1. KAMPUS A Jl. H. Adam Malik, No. 140-142 Telp. (061) 661.4941 2. KAMPUS B Jl. H. Sutan Oloan No. 1 Pondok Surya Telp. 846.4282 08.00-15.30 Wib Setiap Hari kerja

LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Ditambah uang kerajinan 50rb/bln Hub. “Cahaya” (061) 453.1124/ 0852.755.23457 Jl. Ayahanda 73C Medan


Gadis/ Janda, Jaga anak, Perawat orang sakit, Gaji Rp. 600 - Rp. 1,2 Jt Hub “YACA” 0852.6207.9555 Jl. G. Subroto/ Ayahanda 44E Mdn


Mekanik Alat Berat (Doser, Beko, Grader, Loader), Pengalaman diatas 5 tahun

Lamaran lengkap dibawa ke: Jl. Dame No. 30 (Mdn Tj. Morawa Km. 10) Telp. (061) 786.3106


Kantor baru membutuhkan beberapa Staff Of fice, Bagian Gudang, Recepsionis (berpenampilan menarik), usia dibatasi max 27 thn dan min. pendidikan SMU/ sederajat

Lamaran langsung diantar ke:

Jl. Serdang Gg. Belimbing No. 2 Blok E Telp. (061) 4522.018 Paling lambat lamaran diantar mulai Tgl. 28-09-2010 s/d 09-10-2010


Hub. 0812.659.3934 - (061) 786.8559 Harga 410 Jt/nego


LT. 148m², LB. 200m² Bertingkat, KT 4, KM 3, Garasi 2 buah, AC + Air panas Jl. Damai No. 48A/ STM Kampung Baru, Sertifikat Hak Milik, Rumah terawat, Harga 525 Jt/ nego Hub. (061) 7786.0664


Di Jl. STM Gg. Arifin No. 5B Medan, 2 KT, 1 KM, LT. 4,5x22m, Keramik, Pagar Hub. 0813.7069.8937 Harga nego/ T. Perantara

TANAH Uk. 12x40m Jl. T. Fakinah No. 6 Di depan bekas Kantor Koperasi Kota Langsa - Aceh Hub. 0812.640.6481

Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik


: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH Dijual 2 Tkt di Jl. Jermal III No. 19A Denai, Uk. 9,5x19m, 3 KT, 3 KM, SHM, Siap huni Hub. 0811.602.1321 PEKANBARU

Dijual Rmh 36/ 121m², Perum. Andalas Raya, Harga 100 Jt/nego Hub. 0813.9612.0562 - (0761) 7773.423


Di Jl. Marelan Raya Gg. Manggis B No. 20 3 KT, 2 KM, LT. 195m², LB. 120m², SHM, Full keramik, Garasi 2 mobil, Pagar Hub. 7664.0123


3 KT, 2 KM Garasi, Listrik 1.300, Telpon, PAM, AC, Harga 205 Jt Jl. Sidomulyo Gg. Rambutan Pasar IX Tembung Hub. 0852.6203.8582




Membutuhkan 159 Pengemudi, Komisi, Bonus, Insentif, Mbl baru Syrt: 23 - 45 thn, Copy SIM/ KTP, Ijazah, Tdk bertato/ Bks Tatto Jl. Kapt. Muslim 92 Sei Kambing Medan 7637.5840 - 844.2345

3 Tkt Cocok untuk usaha inti kota, DP 100 Jt Sedang dibangun 4 pintu, Ruko Jl.Senam No. 1 Simp Jl. Halat (samping Sekolah Negeri),LB. 4x16, LT. 4x29m), Row depan 10m, Row belakang 3m, Fas. SHM, PLN, PDAM, Pintu plat besi, Cocok utk usaha perhotelan, Fotocopy, Praktek dokter, kost²an, Hospital, Warnet, Kantor NB: 300 meter dari Jl. Juanda dan Bandara Polonia, bisa bantu KPR, KPR per bulan 5 Juta, Harga 525 Jt, Sisa 3 unit, Full keramik, Siap huni ±80 Jt

Hub: 7772 2123 / 7759 8123 HP. 0811 65 1123


Uk. 173m di Jl. Marindal Gg. Tower, Hrg permeter Rp. 250 Rb/nego Hub. 0852.8811.9564


Jl. Gaperta Ujung Uk. 14,5x25m (Samping Komp. Tosiro, SHM) Hub. 0812.6493.9492





1. Tenda 2. Pentas keyboard 3. Tenda cafe + meja hiadan kain 4. Pondok buah + meja hiasan kain 5. Kursi 6. Meja hidangan + meja gelas 7. Pan nikel 8. Piring, gelas, sendok 9. Peralatan masak memasak lengkap Hub. 061.77384399 - 8464593 Kami juga melayani pemesanan: K. Undangn, Photo, Video, Pelaminan, PhotoPrewedding, Keyboard, Flooring, Genset, Lampu, Janur, AC, Perlengkapan masak, dll.

Sofa, Jepara, K. kantor, Ganti kulit/ kain + Busa cat ulang perabotan, Murah dan garansi. NB. Tempahan sofa minimalis Hub. 7740.5997 (Anto)

Anda Butuh Perabot Jepara Asli?





Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347






Menjual Tiket Pesawat Dalam dan Luar Negri


SMS KE: 061-76 700 700 KAMI CARIKAN TERMURAH Luar Medan bisa Transfer



Jl. Sei Wampu 88 Medan TELP: (061) 4511.700

Garansi 10 Hari Sembuh Tanpa Operasi Hubungi Spesialist Wasir



Model Terbaru



Jl. Brigjend. Katamso No. 683C Medan ( ± 50m dari Simpang Pelangi) HP. 0852.9751.4253 - 0812.6050.0881



Madu Murni Asli (Exer Pure Honey) satu-satunya madu yang BERSERTIFIKAT ANTI MIKROBA DI INDONESIA

PELUANG BISNIS 1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro Rp. 22 Jt s/d 38Jt 2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki Menyediakan Mesin RO dan Yamaha Hubungi:

DIJAMIN ASLI !!! BUKTIKAN SENDIRI KHASIAT DAN BEDANYA DENGAN MADU YANG LAIN Tersedia juga Golden Nutrition, ExerTea, Mavera, Biovit, NigeHone (habatussauda), Dactylivera (sari kurma), dll


Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410

Pemesanan hub:

Ibu Dian 0813.7551.9394 (061) 6993.1396 Endang 0857.6120.4740 EXER CENETER FADILLAH Jl. Gatot Subroto Km. 8,5 Komplek Makro BIsnis Center Blok C3 Pinang Baris Medan





Spesialis Pengisian Air Raksa (Mercury): Multi Fungsi, Meramal dengan Media Kartu Tarrot Pemasangan : Susuk Jaran Goyang Susuk Penakluk Susuk Gandasari Susuk Kejantanan dan lain-lain Hubungi ke alamat: Jl. Garu 6 Gg. Belibis No. 25E (Sisingamangaraja) Medan HP. 0815.333.20450

Untuk keluhan dan pengaduan silahkan hubungi langsung:



TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188


Media yang Tepat untuk Iklan Anda

Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan kekerasan, tambah kuat dan tahan lama dalam berhubungan




Pengobatan Alat Vital H. Suhendar



Ingin Promosikan Produk Anda Harian

Pengobatan Alat Vital H. Suhendar


a. 30 orang Pria/ wanita sebagai Staff Passenger Handling Airport b. 20 orang Pria sebagai Staf GSE Operator Airport

* Format: JPG - TIFF (Photoshop)




PERSYARATAN: - Pria/ wanita max. 24 tahun dan belum menikah (a) - Pria max 29 tahun dan belum menikah (b) - Tinggi minimal pria 170cm, wanita 160cm (a), pria 165cm (b) - Sehat jasmani/ rohani (a dan b) - Tidak buta warna (a dan b) - Berat badan proporsional (a dan b) - Pendidikan formal minimall SMU/ sederajat, D3, S1 (a dan b) - Mempunyai SIM A (b) - Bahasa Inggris minimal pasif (a dan b) - Bersedia mengikuti pelatihan terlebih dahulu (a dan b) - Bersedia ditempatkan di Bandara Soekarno Hatta Jakarta (a dan b) Test dan wawancara dilakukan pada: Gelombang I : 27 Sept s/d 01 Oct 2010 jam 09.00 s/d 15.00 Gelombang II : 04 Oct s/d 08 Oct 2010 jam 09.00 s/d 15.00 Alamat: Jl. Gedung Arca No. 38B Medan Kesempatan dan Tempat terbatas

BANTU DENGAR ? HUB. MELTRA HEARING AID JL. KEDIRI NO. 36 MEDAN TELP. 451.6161 mandiri power buy cicilan 0%



Harga Ter Murah

Rp .15 JT Rp. 21 JT Rp. 23 JT Rp. 25 JT Rp. 26 JT




Ruko Ukuran Tanah 5x30m, Status Sertifikat (SHM), terletak di Jl. Niaga No. 26 di Kota Transit Batang Kuis, Harga Rp. 450 Jt/nego Hubungi 0819.866.311/ 0812.643.4127




Rumah 1½ Tkt Uk. Tanah 210m,Siap huni, SHM, Uk. Rumah ±200m, KT 4, KM 3,AC 3 bh (90%), KM 3, Listrik 2200 W, Telp, PAM Jl. Selamat Gg. Subrah 3 - No. 3 (Gg 4 meter/ Aspal beton)

Permanen, Siap huni, Luas Tanah 305m, Bangunan 7x13m, 3 K. Tidur, 2 K. Mandi, R. Keluarga di Jl. Letda Sujono/ Titi Sewa Benteng Hilir Hub. 0852.6254.6946 Yetno, TP





CP: 0812.6445.0973 - 0852.9725.2579 0813.6220.5812


Di Jl. Laksana No. 1A/ 62 Medan, Sangat cocok untuk travel, kantor, spare parts, internet mini market, distro salon spa, dll Harga nego Hub HP. 0813.9611.3753 Flexi 7741.0530

(izin Kejaksaan No. B.170/DSP5/12/2009) Cara terapi pengobatan di totok dibagian syarafsyarafnya dan diberikan ramuan/ jamu, mengobati segala keluhan pria/ wanita MENGOBATI PRIA Tambah besar: 4, 5, 5.5, 6 Tambah panjang: 14, 15, 16, 17, 18, 19, 20 Impotensi Ejakulasi dini, Kurang ereksi Tahan lama/ Tidak punya keturunan Hernia, Penyakit Gula Pengobatan ini Alami 100% tanpa efek samping, bebas untuk semua Agama, Tanpa pantangan (reaksi ditempat) Praktek menetap: Jl. Pelangi (± 100 meter dari Simpang UISU SM. Raja) No. 42 Medan HP. 0812.6350.4441

Mahar Rp. 500 ribu

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhatihati terhadap pengobatan sejenis yang mengakungaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan Telp. (061) 663.4220 Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB



Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

Ekonomi & Bisnis


WASPADA Rabu 29 September 2010

Menkeu: TDL Naik 15 Persen Hingga 2013 JAKARTA (Waspada): Menteri Keuangan Agus Martowardojo tetap menginginkan adanya kenaikan tarif dasar listrik (TDL) sebesar 15 persen hingga 2013. Alasannya, jika TDL tidak naik maka anggaran tidak akan efektif dan terbakar begitu saja untuk subsidi. “Meskipun komisi VII tidak setuju (kenaikan TDL), kita akan tetap berusaha untuk meyakinkan Badan Anggaran DPR. Kalau TDL tidak dinaikkan maka anggaran akan meningkat subsidinya dan memberikan risiko fiskal,” katanya di Jakarta, Selasa (28/9). Semula pemerintah memang berencana menaikkan TDL sebesar 15 persen mulai Januari 2011. Ini dilakukan supaya subsidi dihemat. Karena

pemerintah menilai subsidi listrik dinikmati oleh semua orang, termasuk mereka yang sebenarnya mampu untuk tidak di subsidi. Namun Menko Perekonomian Hatta Rajasa mengatakan, pemerintah tidak tidak jadi menaikkan tarif dasar listrik ( TDL) tahun depan (2011) sebesar 5,4 persen. Pasalnya opsi menaikkan TDL adalah pilihan terakhir, disamping opsi lain yang bisa dilakukan seperti menurunkan Biaya Pokok Penyediaan (BPP) dengan menggunakan bahan bakar selain BBM, seperti gas dan batubara. “TDL itu opsi terakhir dari sekian pilihan. Seperti mengurangi BBM dan menggunakan bahan bakar primer berupa gas. Dengan cara ini, efisiensi terjadi sehingga BPP bisa turun,” tutur Hatta. Jika rencana kenaikan TDL ini digagalkan oleh DPR, maka pemerintah terpaksa menekan anggaran dan juga menaikkan losses (kehilangan) listrik. Bahkan pemerintah tak segan untuk memangkas anggaran

Kementerian/Lembaga yang dianggap tak perlu untuk menutupi subsidi listrik. “Kita akan tetap memperhatikan rakyat yang perlu perhatian dengan cara bantuan langsung, BOS (bantuan operasional sekolah), PNPM (program nasional pemberdayaan masyarakat), dan raskin (beras miskin),” imbuh Agus. Untuk keluar dari permasalahan energi listrik yang terus berlarut-larut, pemerintah berencana menaikkan tarif dasar listrik (TDL) selama 4 tahun berturut-turut hingga 2013 dengan rata-rata kenaikan 15 persen. “Dalam 4 tahun ini kita harus keluar dari permasalahan energi listrik. Semua koordinasi baik TDL dinaikkan 4 tahun terus-menerus, lalu setelah itu tidak. Kalau 15 persen selama 4 tahun ini kita punya alternatif, maka kita tidak perlu menaikkan TDL, itu pun kalau kita punya sumber dana untuk PLN,” paparnya. Agus mengatakan kenaikan TDL ini harus dilakukan sejalan dengan keinginan pemerintah untuk bisa mengelola anggaran

yang sehat. Anggaran sehat yang dimaksud tidak hanya jumlah defisit yang kecil dan jumlah utang yang menurun, tapi juga keefektifannya. “Untuk subsidi dan bunga utang, kita menghabiskan 30 persen dari total anggaran, karena itu kita harus bisa keluar dari permasalahan energi listrik dalam 4 tahun ini,” ucapnya. Menurut Agus, jika TDL tidak dinaikkan maka risiko fiskal dalam anggaran pemerintah akan naik terus, karena habis untuk menutupi subsidi listrik. Sementara subsidi listrik ini dinikmati seluruh masyarakat termasuk yang berpenghasilan tinggi. Sebelumnya Bank Dunia menyarankan pemerintah Indonesia untuk menaikkan TDL di 2011. Pasalnya, menurut Ekonom Senior Bank Dunia untuk lndonesia Enrique Blanco Armas, saat ini Indonesia menjadi negara kedua yang menjual listrik paling murah, sekitar 7 sen dolar AS per kwh. Posisi pertama listrik murah dipegang oleh India sebesar 6 sen dolar AS per kwh. (j03)

BI Targetkan 1 Juta Tabunganku Awal 2011 JIMBARAN (Antara): Deputi Gubernur Bank Indonesia Muliaman D Hadad menargetkan program Tabunganku bisa mencapai 1 juta rekening pada awal 2011 mendatang. “Sampai Agustus pemegang rekening Tabunganku sudah 500 ribu orang dengan nilai simpanan Rp880 miliar,” kata Muliaman di sela-sela acara AFI Global Policy Forum di Jimbaran Bali, Selasa (28/9). Menurut Muliaman, 20 persen dari 500 ribu pemegang Tabunganku berada di Jawa Timur dan kebanyakan berasal dari daerah miskin.

Program Tabunganku diluncurkan BI pada Februari tahun ini dimaksudkan untuk meningkatkan akses masyarakat kecil terhadap lembaga keuangan seperti perbankan dengan menciptakan tabungan tidak dikenai biaya administrasi. “Selain untuk membuka akses masyarakat terhadap financial services juga untuk menaikkan rasio tabungan terhadap PDB,” katanya. Peningkatan finansial inklusi ini, kata Muliaman diharapkan bisa mendorong intermediasi perbankan sehingga kesejahteraan bisa meningkat.

Untuk mendorong program ini, BI akan membuat inisiatif lokal bekerjasama dengan para pemimpin kepala daerah seperti menciptakan program Jatim Menabung. Terkait finansial inklusi, BI juga telah melakukan pilot project di sembilan kabupaten di Jawa untuk melihat kemampuan rakyat miskin mendapatkan akses kredit dari perbankan. Peneliti senior BI Pungky Purnomo mengatakan, kabupaten menjadi proyek percontohan antara lain Banyumas, Madura, dan dua kabupaten

lain di Jateng dan Jabar. Pe n d a t a a n k e u a n g a n kepada masyarakat dilakukan melalui kelompok-kelompok masyarakat seperti arisan sembako dan lain-lain untuk merekam kemampuan dana mereka. “D a r i s e k i t a r 1 2 r i b u masyarakat yang di data, sekitar 4.000 bisa dinyatakan valid untuk mendapat akses kredit. Ini yang kita sebut program productive poor untuk melihat kemampuan tabungan masyarakat untuk mendapat kredit,” kata Pungky.

Medan Green And Clean

Kelurahan PB Selayang II Siap Menang M E D A N ( Wa s pada): Kelurahan PB Selayang II siap menang dalam kompetisi MDGC 2010. Hal ini dikatakan Lurah PB Selayang II, Salamuddin, di kantornya, Senin (27/09). Salamuddin menyatakan wilayahnya siap memenagkan kompetisi MDGC untuk yang kedua kalinya dan optimis akan mampu merebut kembali juara lingkungan berkembang terbaik. Mengingat dia dan Kepling serta kelompok sadar lingkungan (Darling), dan Komunitas Pemuda Peduli Lingkungan (Koppling) setempat telah melakukan bedah lingkungan untuk wilayah yang dikompetisiskan sesuai persyaratan - persyaratan yang diterapkan oleh para inisiator MDGC yaitu PT Harian waspada, PT Unilever Indonesia,Yayasan Bumi Hijau Lestari, dan Pemko Medan. Salamuddin mengaku diirnya dan Kepala Lingkungan setempat telah menerapkan program – program MDGC yakni syarat - syarat seperti trotoar berbunga (Toba), kemudian bank sampah,

Sepatu ‘Made In’ Binjai Tembus Pasar Aceh Hingga Papua PERGOLAKAN ekonomi Indonesia yang belum stabil merupakan tantangan bagi industri dalam negeri. Terutama home industri. Jika pengusaha tidak gigih dan ulet mencari pangsa pasar akan mengalami kerugian. Selain itu persaingan pasar yang sangat ketat, sehingga kualitas harus dinomorsatukan. Perkembangan usaha kecil dan menengah dewasa ini banyak dihadapi tantangan pasar. Berbeda dengan pengusaha sepatu AB Shoes di Binjai. Pengalamannya menjadi sales sepatu selama dua tahun merupakan modal mencari pasar ditambah kepercayaan konsumen yang mengutamakan kualitas dan enak dipakai. Dengan kepercayaan diri, Mulyadi yang sudah mengenal pasar sepatu selama dua tahun akhirnya beralih menjadi pengusaha dan kini sudah mendidik keponakannya Dodi Iskandar mengelola usaha home industri sepatu dengan merk AB Shoes yang berlamat di Jalan Padangsidimpuan Binjai. Selaku pengusaha muda, Dodi banyak belajar dari pamannya guna memperoleh pasar. Walau tidak punya kios dan outlet, AB Shoes mampu menempus pasar di Aceh sampai Papua.

Menurut Dodi, usaha home industri miliknya menghasilkan produksi 600 pasang sepatu setiap bulan. Sepatu AB Shoes juga sudah masuk Istana Wakil Presiden. Ada lima pasang sepatu buatan Binjai itu dipakai staf di Istana Wakil Presiden. Dan itu hanya promosi orang per orang. Selain itu sepatu AB Shoes ternyata banyak dipakai anggota Polri. Hal itu, menurut Dodi, diawali saatWakapolres Kompol Hary Baizuri SIK menjabat Kapolsek Labuhan Deli, Hary mencoba sepatu made in AB Shoes. Ternyata enak dipakai. Setelah itu banyak anggotanya memesan. Promosi dari mulut ke mulut itu merambah ke Aceh hingga Papua. Bahkan beberapa anggota Polri yang bertugas di Kalimantan, NTT, Sulawesi, Papua, Irian Jaya. Bahkan beberapa anggota Polri di Mabes Polri banyak memesan sepatu dari AB Shoes. Kemudian karyawan PT IKA. Sampai kini anggota Polres Binjai banyak memesan termasuk Kapolres Binjai AKBP Rina Sari Ginting. Anggota Paskibraka Binjai juga sudah dua tahun menempah sepatu di AB Shoes. Tahun ini ditempat 70 pasang. Dody mengakui, pemasaran sepatu AB Shoes masih langsung kepada konsumen,

Petani Cabai Di Tanjungmorawa Resah TANJUNGMORAWA (Waspada): Petani cabai merah di Kecamatan Tanjungmorawa, Kabupaten Deliserdang merasa resah akibat anjloknya harga cabai merah. Dua pekan pasca Idul Fitri harga cabai merah di Tanjungmorawa terus turun. Jika sebelumnya cabai merah dijual Rp15 ribu per Kg kini terus merosot. “Hingga Selasa (28/9) cabai merah didistribusikan para petani kepada pedagang dengan harga Rp4.500 per kg,” ucap Juned, salah seorang petani cabai merah di Desa Limau Manis, Kecamatan Tanjungmorawa. Dikatakannya, bila harga cabai merah terus merosot, bagaimana petani menanam kembali karena harga pupuk dan bibitnya mahal. “Bagaimana kehidupan petani bisa sejahtera bila harga cabai terus merosot,” keluhnya. Kendati demikian para petani cabai merah berharap agar harga merah kembali stabil. Sementara, saat ini di sejumlah pasar tradisional di Kecamatan Tanjungmorawa menyebutkan harga cabai merah berada pada taraf Rp8.000 per Kg. (csn)

majalah dinding (Mading), serta kreatifitas warga (Kwarga), yang telah dilakukan untuk membenahi lingkungan.

Dia menilai bahwa program MDGC ini telah memacu semangat Kepling dan warga di wilayah itu untuk secara bersungguh - sungguh membenahi lingkungan tempat tinggal mereka. Salamuddin berharap semoga program MDGC tetap berkelanjutan agar setiap tahunnya wilayahnya dapat mengikuti program ini. “Alhamdulillah adanya program MDGC ini, dapat memotivasi kesadaran warga untuk lebih giat dalam membersihkan lingkungan. Dampaknya juga terlihat kepada warga yakni kelompok-kelompok sadar lingkungan serta Kop-pling lebih semangat dalam bergotong royong setiap minggunya,” ujarnya. Dalam kesempatan itu, Salamuddin juga menyatakan bahwa Walikota Medan telah menugaskan kepada setiap lurah untuk membuat wilayah percontohan ataupun jalan - jalan percontohan minimal satu di tiap kelurahan. Di kesempatan lain, tim relawan MDGC melakukan pendataan secara keseluruhan serta akan melakukan penjurian dalam waktu dekat ke 151 kelurahan yang mengikuti program MDGC 2010 kali ini. Tim relawan berharap kepada setiap lurah yang telah mendapatkan spanduk MDGC agar memasangnya di setiap wilayah yang dikompetisikan untuk memudahkan tim juri yang nantinya menilai wilayah mana yang dikompetisikan.

MENJELANG PENJURIAN:Wilayah yang ikut serta dalam kompetisi MDGC 2010, yang terdiri dari 151 kelurahan saat ini membenahi lingkungannya. Usai memberikan arahan tentang program MDGC, Lurah PB Selayang II Salamuddin, beserta Kepala Lingkungan IX Sariman, dan Kepling XI Sri Ratna Purwati, foto bersama warga dan Tokoh Masyarakat lingkungan.

Waspada/Riswan Rika

SEPATU: Dua orang pekerja sedang mengerjakan permintaan sepatu made in AB Shoes.

disebabkan tidak punya kios. Begitupun pesanan tetap ada. Setiap bulan sepatu pria bisa mencapai 600 pasang dan sepatu perempuan 100 pasang. Pengusaha AB Shoes yang menjadi binaan Telkom. Ketika dibawa mengikuti Sumut Expo di Jakarta mampu menjual ratusan pasang sepatu. Beberapa pameran diikuti seperti PRSU di Medan dan pameran di Binjai. AB Shoes tetap aktif. Walau belum pernah mengikuti expo di luar negeri. Tapi sepatu AB Shoes sudah sampai juga di Malaysia. Hal itu saat askar dari Malaysia itu ke Belawan dan dilihat sepatu buatan AB Shoes ternyata enak dipakai, sehingga mereka sampai sekarang tetap memesan langsung ke pengusaha. AB Shoes di Binjai kini sudah

memperkajakan 15 tenaga kerja yang sekaligus dilatih untuk mampu mandiri. Menurut Dody, tenaga kerja dilatih oleh pamannya selaku instruktur. Menurut Mulyadi selaku pelatih,ia terus mengembangkan usaha sepatu, walau dengan sistEm home industri. Walau berjalan dengan promosi dari orang perorang.AB Shoes tetap eksis. Kini AB Shoes ingin mengembangkan usaha, namun masih terkendala permodalan yang cukup besar. Bukan tidak mungkin kepeloporan AB Shoes di bidang sepatu membawa nama baik kota Binjai. Dody dan pamannya Mulyadi juga siap melatih pemuda-pemuda yang ingin mandiri. ● Riswan Rika

50 Juta Orang Berpenghasilan 2 Dolar AS Per Hari BALI (Waspada): Ternyata, lebih dari 50 juta orang di dunia penghasilannya hanya sebesar 2 dolar AS per harinya atau setara dengan Rp17.902 ribu (Rp8.951 per dolar AS). Potensi orang sebanyak inilah yang ditargetkan untuk memiliki akses layanan keuangan formal di 2012. Hal itu dikatakan Gubernur Bank Sentral Kenya Njuguna Ndung’u, dalam acara The 2010 AFI Global Policy Forum, di Jimbaran, Bali, Selasa (28/9). Menurutnya, ini menjadi target AFI untuk menyejahterakan sejumlah orang tersebut dan merupakan platform AFI dalam menunjukkan kekuatan untuk menghasilkan sinergi yang mampu membawa inklusi keuangan di negara-negara berkembang ke tahapan selanjutnya. “Di negara saya, Kenya, munculnya teknologi telepon selular telah membuka layanan transfer uang ke lebih dari sepuluh juta penduduk Kenya, di mana sebelumnya sebagian dari mereka tidak mengenal layanan keuangan formal,” tandasnya.

Dikatakannya, mengingat pentingnya meningkatkan inklusi keuangan di Kenya, negaranya mengadopsi kebijakan reformasi dan model inovatif untuk meningkatkan inklusi keuangan termasuk agen perbankan, pertukaran informasi kredit, dan perizinan, serta Lembaga Pengambilan Deposit Keuangan Mikro dan Koperasi Simpan Pinjam. “Selain itu, kami telah meningkatkan layanan transfer uang melalui telepon seluler menggunakan rekening mikro, kredit mikro, dan asuransi mikro yang dioperasikan pada platf o r m t e l e p o n s e l u l a r, ” ungkapnya. Inisiatif tersebut berpedoman pada tekad pihaknya sebagai regulator untuk memberikan rekomendasi, membentuk kemitraan, mengembangkan, dan mengatur pasar. Pendekatan dari empat hal inilah merupakan satu-satunya cara untuk membangun sebuah sistem keuangan yang inklusif, y bertindak sebagai jembatan menuju pertumbuhan dan kemakmuran, terutama bagi masyarakat miskin. (okz)

Harga Bahan Pokok Di Madina Berangsur Stabil PANYABUNGAN ( Waspada): Harga kebutuhan pokok masyarakat di berbagai pasar tradisional Kab. Mandailing Natal (Madina) berangsur stabil seusai Lebaran 1431 H karena pasokan dan stok lancar dan normal. Kebutuhan pokok itu antara lain, beras, minyak goreng, cabai merah, tomat, bawang merah, kol dan wortel. Menurut sejumlah pedagang kepada Waspada Sabtu ( 25/9) harga beberapa komoditas pasca lebaran relatif mengalami perubahan jika dibanding dengan H-14 dan H-7. Harga rata-rata beras pada 10 hari setelah lebaran mengalami penurunan 0,79 persen jika dibandingkan dengan H-7, yakni Rp6.682 dari Rp6.735 per kg. Sementara, jika dibandingkan dengan dua minggu sebelum lebaran harga beras naik

1,59 persen dari Rp6.578. Gula pasir juga mengalami penurunan 1,83 persen dari Rp10.538 pada H-7 menjadi Rp10.519. Jika dibandingkan dengan H-14 penurunannya 2,02 persen dari Rp10.736 per kg. Minyak goreng, turun 0,48 persen menjadi Rp9.953 jika dibandingkan dengan H-7 Rp10.011. Namun demikian, harga tersebut telah mengalami kenaikan 5,18 persen dari Rp9.518 pada H-14. Berbeda dengan komoditas lainnya, terigu mengalami kenaikan 0,37 persen dan 0,53 persen jika dibandingkan dengan satu dan dua minggu sebelum lebaran yaitu menjadi Rp7.544 per kg dari Rp7.533 per kg dan Rp7.504 per kg. Usman Nasution, 56, salah seorang pedagang bahan pokok di Pasar Panyabungan mengatakan, omset pedagang usai

lebaran belum mengalami pemulihan. Sebagian besar pelanggan di antaranya rumah makan dan lainnya belum beraktivitas. Akibatnya, omset pedagang saat ini juga masih turun dibanding hari biasa, sehingga pasokan bahan pokok tetap stabil. Diperkirakan omset kembali normal pekan depan atau awal Oktober 2010. Sementara, Nisma boru Lubis, pedagang sayur-mayur di Pusat Pasar Kotanopan mengatakan, harga sayur-mayur masih stabil, bahkan turun di antaranya bawang merah menjadi Rp11 ribu per kg dari sebelumnya Rp12 ribu per kg. Sedangkan harga cabai merah cabai merah saat ini masih dijual Rp10 ribu per kg akibat menumpuknya pasokan seusai lebaran karena banyak rumah makan dan usaha lain belum

Harga Emas Di Medan Jenis


Valuta Asing Di Medan


London Murni






24 Karat

90 s/d 93%


Emas Putih

75 %


22 Karat




20 s/d 35%


beraktivitas. Sementara, para ibu rumah tangga masih memiliki persediaan. Berdasarkan data diperoleh di pasar tradisional Kotano-pan, harga beras jongkong/C4 Rp7.600 per kg, jongkong/64 Rp7 ribu per kg, gula pasir impor putih Rp10.200 per kg, dalam negeri kuning Rp9.600 per kg, garam yodium Rp 2.200 per kg, tepung terigu segitiga biru Rp8.000 per kg. Jenis komoditas sayuran buncis Rp7.000 per kg, wortel Rp8.000 per kg, kol Rp4.000 per kg,minyak goreng kuning curah Rp9.000 per kg, kelapa per butir Rp1.500, cabai merah Rp 36 ribu per kg, bawang merah Rp1.800 per kg, bawang putih Rp 25 ribu per kg, tomat Rp5 ribu per kg, kol /kubis Rp4 ribu per kg, kentang Rp 6 ribu per kg, gula merah Rp13 ribu per kg dan ubi kayu Rp3 ribu per kg.(a24)


Mata Uang



Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

8.957 8.226 8.620 14.068 1.169 104,50 6.679 11.825 2.870

8.937 8.054 8.454 13.783 1.148 101,50 6.445 11.063 2.800

Waspada, Rabu 29 September 2010  

Waspada, Rabu 29 September 2010

Waspada, Rabu 29 September 2010  

Waspada, Rabu 29 September 2010