Page 1

Medan 24-330C

P. Sidimpuan20-30 0C

R. Prapat 25-330C

Penyabungan 20-29 0C

Berastagi 18-280C

Sibolga 22-320C Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca

BMKG Polonia

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

MINGGU, Pahing, 29 Mei 2011/25 Jumadil Akhir 1432 H z No: 23521

Terbit 20 Halaman (A1-8, B1-12) z zHarga Eceran: Rp 2.500,-

Tahun Ke-65

BARCA BERPESTA

PEMAIN-pemain Barcelona merayakan keberhasilan mereka menjuarai Liga Champions dengan mengalahkan Manchester United di Wembley Stadium, Minggu (29/5) dinihari.

AP

LONDON (Waspada): Tampil superior sepanjang 90 menit, Barcelona melengkapi sukses musim ini dengan mengangkat trofi Liga Champions di Wembley Stadium, Minggu (29/5) dinihari. Di final, El Blaugrana meredam ambisi Manchester United 3-1. Sebelumnya, MU mengejutkan seisi stadion dan jutaan penggila bola di dunia dengan menekan Lionel Messi cs. Beberapa kali anak-anak Red Devils memaksa kiper Barcelona, Victor Valdes, ke luar dari sarangnya memotong peluang Wayne Rooney dan Javi Hernandez. Meski begitu, Barcelona lebih sering menguasai bola dan bermain cerdik seraya menunggu celah melancarkan serangan. Kebuntuan skuad besutan Pep Guardiola dijawab Pedro Rodriguez di menit 27. Memanfaatkan umpan terobosan Xavi, Pedro memperdayai Edwin Van der Sar yang dipastikan pensiun akhir musim ini. Selang tujuh menit, MU menyamakan skor. Kerjasama Rooney dengan Chicharito diakhiri tendangan keras striker timnas Inggris yang menghujam sudut kanan gawang Valdes. Setelah turun minum, Barcelona langsung mengambil inisiatif serangan. Keunggulan kembali dipegang tim Catalan tersebut di menit 53. Kali ini, tendangan kaki kiri Messi yang keras hanya bisa dipandang Van der Sar yang terlihat salah posisi. Kedigdayaan Barcelona makin menjadi di menit 69. Pasalnya, umpan pendek dari Sergio Busquets disambut baik oleh David Villa yang melepaskan tendangan melengkung nan indah ke sudut kanan gawang Setan Merah. Skor akhir 3-1 pun menambah derita MU yang kalah kedua kali di final Liga Champions dari tim raksasa asal Spanyol itu. Alhasil, Barcelona merayakan gelar jawara Eropa keempat kali sepanjang sejarah bersama Ajax Amsterdam dan Bayern Munich sekaligus menegaskan dominasi mereka di pentas Champions dekade ini. Sebaliknya, kekalahan ini menjadi kenangan pahit bagi Van der Sar yang memutuskan untuk gantung sepatu. (m33)

SMS Guncang SBY Dan Demokrat JAKARTA (Waspada): Heboh isi pesan SMS dari orang yang mengaku mantan bendahara umum Partai Demokrat M Nazaruddin di Singapura, Sabtu (28/5) mengguncang Presiden Susilo Bambang Yudhoyono (SBY ) dan elit partai Demokrat.

Isi Pesan SMS yang disebar dari nomor +65843939xx berbunyi, ‘’Demi Allah, saya M Nazaruddin telah dijebak, dikorbankan dan difitnah. Karakter, karir, masa depan saya dihancurkan. Dari Singapura saya akan membalas...” Isi SMS itu juga mengungkap tudingan-tudingan terhadap Presiden SBY dan politisi-politisi PD. Isinya bertekad akan bongkar skandal seks sesama jenis elit Demokrat, megakorupsi

Bank Century, korupsi Andi Mallarangeng dalam Wisma Atlet, Manipulasi data IT 18 juta suara dalam Pemilu oleh Anas Urbaningrum dan Andi Nurpati. Belakangan diketahui SMS tersebut palsu. Publik pun diminta tak menyebarluaskan informasi bohong tersebut. “Penyebarluasan info yang bohong dengan nomor yang juga tidak bisa dipertanggungjawabkan ini di samping tugas aparat hukum untuk segera

mengambil tindakan, ada baiknya juga untuk bersamabersama tidak menjadi penyebar informasi yang keliru tersebut,” kata staf khusus presiden, Andi Arief, lewat pesan singkat, Sabtu (28/5). Menurut Andi, SMS tersebut berasal dari nomor luar Indonesia. Banyak pihak dipojokkan dalam isinya, termasuk Presiden Susilo Bambang Yudhoyono (SBY). Lanjut ke hal A2 kol 1

Parpol Tempat Persembunyian Koruptor

BURUH

500 Bal Pakaian Bekas Diamankan TANJUNGBALAI (Waspada): Diperkirakan sekitar 500 bal pakaian bekas (Monza) diamankan petugas patroli Bea dan Cukai Tanjungbalai di perairan Asahan, Sabtu (28/5) pukul 18:00 WIB. Lanjut ke hal A2 kol 6

Palestina Tidak Terkucil Lagi Dari Dunia, Mesir Buka Rafah

AP

RAFAH, Jalur Gaza (AP): Mesir mencabut blokade selama empat tahun atas penghubung utama Jalur Gaza (Palestina) ke dunia luar Sabtu (28/5), yang membuka pintu bagi bantuan kepada 1,5 juta jiwa warga Palestina di daerah itu. Namun pembukaan lintasan perbatasan tersebut membuat hubungan Mesir dan Israel makin menurun sejak digulingkannya Presiden Hosni Mubarak beberapa bulan lalu. Langkah Mesir itu akan memungkinkan ribuan warga Gaza untuk bergerak dengan bebas keluar dan kedalam kawasan tersebut — sehingga meningkatkan kecemasan Israel bahwa militan dan senjata dapat dengan mudah sampai di depan pintunya.

SEORANG Palestina memegang paspor keluarganya di dinas paspor Mesir di pelabuhan perbatasan Rafah Sabtu (28/5). Mesir secara resmi membuka sepenuhnya penyeberangan penumpangnya dengan Gaza Lanjut ke hal A2 kol 1 di kota Rafah.

MENELUSURI QATAR SANG MUTIARA DARI TELUK

Perjalanan delapan jam harus ditempuh dari Jakarta untuk sampai di ibukota salah satu negara terkaya di dunia yakni Doha. Doha merupakan ibukota dari negara Qatar yang semakin tenar setelah resmi terpilih menjadi tuan rumah Piala Dunia pada 2022 mendatang. l A8

JAKARTA (Waspada): Saatnya partai politik lebih terbuka soal sumber pendanaan partai agar tidak dianggap sebagai tempat persembunyian para koruptor. Dengan adanya transparansi, publik akan memiliki akses untuk mengontrol dana yang dimiliki parpol. Pandangan tersebut dikemukakan pengamat politik

Universitas Padjadjaran, Dede Mariana, dalam Diskusi Polemik yang dilangsungkan Trijaya Network di Warung Daun, Cikini, Jakarta Pusat, Sabtu (28/5). “Parpol selama ini dianggap sebagai bungkernya koruptor, tempat persembunyian para koruptor,” ujar Dede. Dede beralasan, sejumlah

politisi parpol yang terjerat dalam kasus korupsi dan penyuapan kerap mendapat perlindungan politik dari pihak partai. Alhasil, publik menilai, dana-dana gelap tersebut berhubungan dengan kepentingan parpol atau bahkan menjadi sumber pendanaan bagi parpol. “Parpol perlu membuka

akses informasi sumber pendanaannya untuk publik atau melalui media data itu dibuka untuk masyarakat. Bisa juga melalui civil society sebagai sarana untuk mendapatkan informasi tersebut,” kata Dede. Selain memungkinkan kontrol publik, lanjutnya, sikap Lanjut ke hal A2 kol 7

Tol Belmera Tak Aman

Waspada/gito ap

JALUR tol Be lmera menuju Belawan dirasakan tidak aman bagi para sopir, terutama mereka yang membawa muatan minyak sawit mentah/crude palm oil (CPO). Beberapakali peristiwa pembajakan dan perampokan truk tanki bermuatan CPO terjadi di kawasan itu. Sopir disekap oleh pelaku bersenjata api dan diturunkan di jalanan, sementara muatannya dibajak. Lantas, bagaimana peran polisi ? Ditanya Waspada seperti itu, kemarin, Kepala Bidang Humas Polda Sumut Ajun Komisaris Besar Polisi Heru Prakoso mengatakan, begitu mendapat laporan kasus pembajakan itu polisi segera melakukan penyelidikan, meski sejauh ini belum dapat menangkap pelakunya. Karena itu

TRUK tanki bemuatan CPO masuk tol Tanjung Mulia menuju Belawan. Para sopir saat ini mengaku resah dengan kasus-kasus pembajakan dan perampokan yang dilakukan penjahat bersenjata api. Mereka berharap polisi melakukan tindak pengamanan. Lanjut ke hal A2 kol 3

LUPUS SERANG WANITA USIA PRODUKTIF Penyakit Lupus adalah penyakit baru yang mematikan setara dengan kanker. Tidak sedikit pengindap penyakit ini tidak tertolong lagi. Di dunia terdeteksi penyandang penyakit Lupus mencapai 5 juta orang, lebih dari 100 ribu kasus baru terjadi setiap tahunnya.

l B7

PASTEL BUAH DAN PASTEL ISI CHERRY

l B11

Istri Khadafi Kutuk NATO Bunuh Anaknya, Rumahnya Dibom Lagi TRIPOLI, Libya (Waspada): Seorang wanita yang diyakini istri pemimpin Libya Moammar Khadafi telah menyatakan kutukannya pada NATO dalam satu wawancara ekslusif dengan CNN, Jumat bahkan dia menyatakan putus asa atas nasib keluarga dan bangsanya. Dia mengatakan hidup “memiliki tidak ada nilainya sekarang.” Dari Brussels, kantor berita The Associated Press melaporkan, NATO mengatakan pihaknya telah menghantam satu komando dan pusat pengendali di mana pemimpin Libya Moammar Khadafi kadang-kadang berada, tetapi dia bukan merupakan sasaran dan tidak diketahui pasti apakah dia berada di sana pada saat serangan tersebut. Seorang jurubicara Sekutu mengatakan kompleks Bab al-Aziziyah di Tripoli telah terkena hantaman pada Sabtu (28/5) pagi. Kompleks yang sama telah mengalami Lanjut ke hal A2 kol 7

Model Cantik Ikut Perang Di Afghanistan

TERSENYUM sopan ke arah kamera, dia seperti gambaran ideal ‘mawar’ Inggris. Fotonya menghiasi halaman girls in pearls majalah Country Magazine. Model itu bernama Harr iet Haslam-Greene. Di balik penampilannya yang lembut dia ternyata memilih karir yang jauh dari kesan feminin: menjadi tentara. Hanya beberapa minggu setelah berpose di halaman tiga Country Magazine, perempuan 24 tahun itu maju ke garis depan perang Afghanistan. Letnan Dua itu kini telah dikirim ke wilayah Helmand di Afghanistan, bersama dengan The Highlanders — batalion keempat Resimen Lanjut ke hal A2 kol 7

KAKA: KORUPSI MEWABAH

Sebagai band yang mendukung Komisi Pemberantasan Korupsi (KPK) dan gerakan anti korupsi, Slank terus menggugah kesadaran masyarakat guna memerangi praktik haram tersebut. Sebab, mereka korupsi sudah mewabah di Indonesia.

l B12


Medan 24-330C

P. Sidimpuan20-30 0C

R. Prapat 25-330C

Penyabungan 20-29 0C

Berastagi 18-280C

Sibolga 22-320C BMKG Polonia

Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

MINGGU, Pahing, 29 Mei 2011/25 Jumadil Akhir 1432 H z No: 23521 * Tahun Ke-65

Terbit 20 Halaman (A1-8, B1-12) z zHarga Eceran: Rp 2.500,-

SMS Gelap Serang Elit Demokrat Dan Presiden JAKARTA (Waspada): Beredarnya SMS gelap dari nomor luar negeri dengan mengatasnamakan mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin ditanggapi Staf Khusus Presiden Bidang Bantuan Sosial dan Bencana Andi Arief. Dia mengatakan, ada pihak yang memanfaatkan situasi dengan mengirim pesan singkat yang mendiskreditkan banyak pihak, termasuk Presiden Susilo Bambang Yudhoyono. Metode penyebarluasan informasi semacam ini adalah kelanjutan dari berbagai cara yang selama ini digunakan untuk membuat berita bohong. “Penyebarluasan informasi yang bohong dengan nomor yang juga tidak bisa dipertanggungjawabkan ini di samping tugas aparat hukum untuk segera mengambil tindakan. Ada baiknya juga untuk bersama-sama tidak menjadi penyebar informasi yang keliru tersebut,” kata Andi kepada wartawan di Jakarta, Sabtu (28/5). Dia menambahkan, kemajuan teknologi memang sangat memungkinkan lahirnya informasii n f o r m a s i t i d a k s e h a t . Up a y a mendiskreditkan yang selama ini selalu digunakan menggunakan SMS, jejaring sosial, dan lain-lain sulit dicegah. “Tetapi, sangat mungkin ditemukan pelakunya oleh aparat hukum dan oleh media massa bisa difilter karena sumber pemberitaannya yang tidak jelas, dengan isi tanpa fakta. Kejadian seperti ini bisa terkena pada siapapun. Kita berharap tradisi buruk penggunaan teknologi bukan menjadi kebudayaan kita,” imbuhnya. Lanjut ke hal A2 kol 1

Menag Jamin Pelayanan Haji 2011 Lebih Baik

Antara

TARIAN TARIK PUKAT. Penari dari sanggar binaan pemerintah Kota Banda Aceh menarikan tarian “Tarik Pukat” di Banda Aceh, Jumat (27/5). Tarian Tarik pukat merupakan salah satu tarian tradisional Aceh yang menggambarkan aktifitas para nelayan yang sedang menangkap ikan di laut, tarian ini mengandung makna kebersamaan dan saling tolong menolong.

SERANG (Antara): Menteri Agama (Menag) Suryadharma Ali menjamin pelayanan ibadah haji tahun 2011 akan lebih baik dibanding tahun-tahun sebelumnya. “Mudah-mudahan pelayanan ibadah haji tahun ini lebih baik lagi dan ongkosnya diharapkan bisa lebih murah atau minimal sama dengan tahun 2010. Namun demikian belum ada keputusan mengenai biaya penyelenggaraan ibadah haji tahun ini,” kata Menag Suryadharma Ali usai menjadi pembicara “Seminar Nasional Memperingati 100 Tahun Mr Sjafrudin Prawiranegara” di Serang, Sabtu (28/5). Ia mengatakan, indikator mengenai kemungkinan pelayanan ibadah haji tahun ini lebih baik dibanding tahun sebelumnya, yakni bertambahnya jumlah jamaah calon haji asal Indonesia yang berada pada ring satu yakni menjadi 80 persen pada 2011. Sedangkan pada tahun 2009 jumlah pemondokan jamaah haji Indonesia yang berada di ring satu sebanyak 27 persen dan pada 2010 sebanyak 63 persen dengan jarak maksimal empat ribu meter dari pusat penyelenggaraan ibadah haji ke pemondokan. “Tahun ini jumlahnya bertambah menjadi 80 persen dengan jarak maksimal pemondokan 2.500 meter, itupun menggunakan kendaraan untuk pulang perginya,” kata Menag. Terkait dengan besaran biaya penyelenggaraan ibadah haji (BPIH/ONH) tahun 2011, pemerintah belum memutuskan karena belum ada pembahasan dengan DPR meskipun pihaknya Lanjut ke hal A2 kol 3

Parpol Tempat Persembunyian Koruptor JAKARTA (Waspada): Saatnya partai politik lebih terbuka soal sumber pendanaan partai agar tidak dianggap sebagai tempat persembunyian para koruptor. Dengan adanya transparansi, publik akan memiliki akses untuk mengontrol dana yang dimiliki parpol. Waspada/Rasudin Sihotang

BURUH pelabuhan tengah bekerja memindahkan ratusan bal pakaian bekas dari kapal KM Keluarga Sakinah ke truk untuk diamankan ke gudang Bea dan Cukai Tanjungbalai-Asahan, Sabtu (28/5).

500 Bal Pakaian Bekas Diamankan TANJUNGBALAI (Waspada): Diperkirakan sekitar 500 bal pakaian bekas (Monza) diamankan petugas patroli Bea dan Cukai Tanjungbalai di perairan Asahan, Sabtu (28/5) pukul 18:00. Lanjut ke hal A2 kol 6

Palestina Tidak Terkucil Lagi Dari Dunia, Mesir Buka Rafah

AP

RAFAH, Jalur Gaza (AP): Mesir mencabut blokade selama empat tahun atas penghubung utama Jalur Gaza (Palestina) ke dunia luar Sabtu (28/5), yang membuka pintu bagi bantuan kepada 1,5 juta jiwa warga Palestina di daerah itu. Namun pembukaan lintasan perbatasan tersebut membuat hubungan Mesir dan Israel makin menurun sejak digulingkannya Presiden Hosni Mubarak beberapa bulan lalu. Langkah Mesir itu akan memungkinkan ribuan warga Gaza untuk bergerak dengan bebas keluar dan kedalam kawasan tersebut — sehingga meningkatkan kecemasan Israel bahwa militan dan senjata dapat dengan mudah sampai di depan pintunya.

SEORANG Palestina memegang paspor keluarganya di dinas paspor Mesir di pelabuhan perbatasan Rafah Sabtu (28/5). Mesir secara resmi membuka sepenuhnya penyeberangan penumpangnya dengan Gaza Lanjut ke hal A2 kol 3 di kota Rafah.

MENELUSURI QATAR SANG MUTIARA DARI TELUK

Perjalanan delapan jam harus ditempuh dari Jakarta untuk sampai di ibukota salah satu negara terkaya di dunia yakni Doha. Doha merupakan ibukota dari negara Qatar yang semakin tenar setelah resmi terpilih menjadi tuan rumah Piala Dunia pada tahun 2022. l A8

Pandangan tersebut dikemukakan pengamat politik Universitas Padjadjaran, Dede Mariana, dalam Diskusi Polemik yang dilangsungkan Trijaya Network di Warung Daun, Cikini, Jakarta Pusat, Sabtu (28/5). “Parpol selama ini dianggap sebagai bungkernya koruptor, tempat persembunyian para koruptor,” ujar Dede. Dede beralasan, sejumlah politisi parpol yang terjerat dalam kasus korupsi dan

penyuapan kerap mendapat perlindungan politik dari pihak partai. Alhasil, publik menilai, dana-dana gelap tersebut berhubungan dengan kepentingan parpol atau bahkan menjadi sumber pendanaan bagi parpol. “Parpol perlu membuka akses informasi sumber pendanaannya untuk publik atau melalui media data itu dibuka untuk masyarakat. Bisa juga melalui civil society sebagai sarana untuk mendapatkan

informasi tersebut,” kata Dede. Selain memungkinkan kontrol publik, lanjutnya, sikap transparan dalam menjelaskan sumber dana akan mendatangkan penilaian positif publik atas parpol yang bersangkutan. Sikap tersebut selanjutnya akan berimbas pada apresiasi dan pilihan publik. Jika tidak, “Orang bisa tidak percaya pada parpol, padahal instrumen berpolitik Lanjut ke hal A2 kol 7

Semua Kasus Besar Diselingkuhkan YOGYAKARTA (Waspada): Ketua Mahkamah Konstitusi (MK) Mahfud MD mengingatkan tentang bahaya yang mengincar Indonesia saat ini bukan dari luar. Bahaya datang dari dalam, yakni dari proses penegakan hukum, keadilan dan kebenaran. Saat ini, kata Mahfud, penegakan hukum telah tersan-

dera. Maksudnya adalah seseorang diduga kuat melakukan tindak pidana, namun dia mengelak dengan mengancam akan membongkar tindak pidana orang lain karena dia juga mengetahuinya. “Kalau si A melakukan korupsi besar sulit diselesaikan secara hukum, karena si A sudah menyandera si B sebagai

orang yang menegakkan hukum,” kata Mahfud MD di Yogyakarta, Sabtu (28/5). “Sedangkan si B telah disuap juga. Ketika si B mau menyuruh si C hal tersebut juga tidak bisa karena si C juga telah disuap. Sehingga hampir tidak ada saat sekarang kekuatan yang dapat menggunting ini,” katanya.

Akibatnya, ketika ada kasus diributkan, pada akhirnya diambangkan sehingga tidak pernah sampai tuntas. Menurut Mahfud, tidak ada satupun kasus-kasus besar di Indonesia yang diselesaikan hingga ke ujungnya. Semua kasus yang besar diselingkuhkan secara Lanjut ke hal A2 kol 1

Tol Belmera Tak Aman

Waspada/gito ap

JALUR tol Belmera menuju Belawan dirasakan tidak aman bagi para sopir, terutama mereka yang membawa muatan minyak sawit mentah/crude palm oil (CPO). Beberapakali peristiwa pembajakan dan perampokan truk tanki bermuatan CPO terjadi di kawasan itu. Sopir disekap oleh pelaku bersenjata api dan diturunkan di jalanan, sementara muatannya dibajak. Lantas, bagaimana peran polisi ? Ditanya Waspada seperti itu, kemarin, Kepala Bidang Humas Polda Sumut Ajun Komisaris Besar Polisi Heru Prakoso mengatakan, begitu mendapat laporan kasus pembajakan itu polisi segera melakukan penyelidikan, meski sejauh ini belum dapat menangkap pelakunya. Karena itu

TRUK tanki bemuatan CPO masuk tol Tanjung Mulia menuju Belawan. Para sopir saat ini mengaku resah dengan kasus-kasus pembajakan dan perampokan yang dilakukan penjahat bersenjata api. Mereka berharap polisi melakukan tindak pengamanan. Lanjut ke hal A2 kol 3

LUPUS SERANG WANITA USIA PRODUKTIF Penyakit Lupus adalah penyakit baru yang mematikan setara dengan kanker. Tidak sedikit pengindap penyakit ini tidak tertolong lagi. Di dunia terdeteksi penyandang penyakit Lupus mencapai 5 juta orang, lebih dari 100 ribu kasus baru terjadi setiap tahunnya.

l B7

PASTEL BUAH DAN PASTEL ISI CHERRY

l B11

Istri Khadafi Kutuk NATO Bunuh Anaknya, Rumahnya Dibom Lagi TRIPOLI, Libya (Waspada): Seorang wanita yang diyakini istri pemimpin Libya Moammar Khadafi telah menyatakan kutukannya pada NATO dalam satu wawancara ekslusif dengan CNN, Jumat bahkan dia menyatakan putus asa atas nasib keluarga dan bangsanya. Dia mengatakan hidup “memiliki tidak ada nilainya sekarang.” Dari Brussels, kantor berita The Associated Press melaporkan, NATO mengatakan pihaknya telah menghantam satu komando dan pusat pengendali di mana pemimpin Libya Moammar Khadafi kadang-kadang berada, namun dia bukan merupakan sasaran dan tidak diketahui pasti apakah dia berada di sana pada saat serangan tersebut. Seorang jurubicara Sekutu mengatakan kompleks Bab al-Aziziyah di Tripoli telah terkena hantaman pada Sabtu (28/5) pagi. Kompleks yang sama telah mengalami Lanjut ke hal A2 kol 7

Model Cantik Ikut Perang Di Afghanistan

TERSENYUM sopan ke arah kamera, dia seperti gambaran ideal ‘mawar’ Inggris. Fotonya menghiasi halaman girls in pearls majalah Country Magazine. Model itu bernama Harr iet Haslam-Greene. Di balik penampilannya yang lembut dia ternyata memilih karir yang jauh dari kesan feminin: menjadi tentara. Hanya beberapa minggu setelah berpose di halaman tiga Country Magazine, perempuan 24 tahun itu maju ke garis depan perang Afghanistan. Letnan dua itu kini telah dikirim ke wilayah Helmand di Afghanistan, bersama dengan The Highlanders — batalion keempat Resimen Lanjut ke hal A2 kol 7

KAKA: KORUPSI MEWABAH

Sebagai band yang mendukung Komisi Pemberantasan Korupsi (KPK) dan gerakan anti korupsi, Slank terus menggugah kesadaran masyarakat guna memerangi praktik haram tersebut. Sebab, mereka korupsi sudah mewabah di Indonesia.

l B12


Berita Utama

A2 Polling Pemilihan Gubernur Aceh

5 Besar Hasil Sementara Berikan suara Anda dengan mengisi kupon polling Who Wants To Be Gubernur Aceh dan mengirimkannya ke Redaksi Harian Waspada Jl.Brig.Katamso No.1 Medan 20151 sebelum tanggal 10 Juni 2011. Setiap suara yang masuk akan dihitung setiap hari. Kupon akan diundi tanggal 1 Juli 2011, disediakan hadiah: (kupon polling di halaman B6)

Hari Ini, Din Syamsuddin Lantik PWM Dan Aisyiyah Sumut MEDAN (Waspada): Ketua Umum Pimpinan Pusat Muhammadiyah Din Syamsuddin (foto) menghadiri acara Ta’aruf Pimpinan Wilayah Muhammadiyah Sumatera dan Pimpinan Wilayah Aisyiyah, di Auditorium UMSU Jalan Kapt Muchtar Basri Medan hari ini, Minggu (29/5). RektorUMSUAgussanimenjelaskan Ketua Umum PP Muhammadiyah akan tiba di Medan pukul 08:00 dan langsung menghadiri acara ta’aruf atau pelantikan pengurus PWM-PW Aisyiyah Sumut pukul 09:00. “Selain melantik pengurus PWM dan PW Aisyiyah Sumut periode 2010-2015, Pak Din Syamsuddin berkesempatan memberikan ceramah umum,” ujarnya. Sebelumnya, Musywil PWM XI dan PW Aisyiyah yang berlangsung secara serentak di Asrama Haji 6-9 Januari lalu menetapkan Guru Besar IAIN Sumut Prof Dr Asmuni sebagai Ketua

PWM dan Hj Elinita sebagai Ketua PW Asiyiyah Sumut. Saat Musywil PWM menetapkan 13 nama dari 39 dari hasil musyawarah PWM yang diikuti utusan PWM, PDM se-Sumut dan ortom. Ke-13 nama tersebut yakni Asmuni, Agussani, Hasimsyah Nasution, Mario Kasduri, Ibrahim Gultom, Dalail Ahmad, Askolan Lubis, Sarwo Edi, Bahril Datuk, Irwan Syahputra, Suhrawardi K Lubis, M Nasir Wahab dan Shohibul Anshor. (m13)

Semua Kasus Besar ... politik sehingga macet dan saling sandera. Ketika kasus tersebut sudah parah maka dimunculkan lagi kasus yang baru sehingga kasus yang lama hilang. “Nah situasi ini menurut saya sangat berbahaya bagi kelangsungan bangsa dan negara kita. Karena saya meyakini berdasarkan fakta sejarah dan berdasarkan ajaran agama apapun, suatu negara yang tidak mampu menegakkan keadilan akan menunggu waktu untuk hancur,” kata Guru Besar Hukum Tata Negara Universitas Islam Indonesia itu. “Dahulu ada negara Majapahit, Demak, Mataram dan sebagainya hancur dimulai dengan ketidakadilan,” kata Mahfud. Untuk memberantas tindakan sandera-menyandera yang menyebabkan negara dalam kondisi bahaya adalah penegakan hukum tanpa pandang bulu dan itu hanya dapat dilakukan oleh pemimpin negara yang bersih. ”Kalau pemimpin-pemimpin negara tidak bersih maka diambil inisiatif agar pemimpin dapat bersih. Kalau pejabat dalam institusi tersebut tidak bersih maka pejabat yang paling tinggi harus mengambil tindakan agar diganti oleh orang-orang yang bersih dan tidak gentar diancam oleh orang lain karena ancaman masa lalunya,” katanya. Mahfud menyatakan pembangunan hukum terdapat tiga unsur yaitu substansi hukum, aparat penegak hukum dan budaya hukum. Di Indonesia aturan-aturan yang menyangkut isi hukum sudah bagus, namun demikian mental para penegak hukum yang harus dibenahi. Parahnya lagi ketika akan ada regenerasi orang-orang yang masuk adalah orang yang tidak bersih atau tersandera sehingga orang-orang melakukan sesuatu tidak benar akan selamat semuanya. ”Oleh sebab itu maka tindakan radikal harus dapat dilakukan mulai dari pucuk pimpinan seperti presiden, ketua MK, Jaksa Agung, Ketua MA dan yang lainnya,” ujarnya. Mahfud menegaskan pihak-pihak sekarang yang belum tersandera saat ini adalah pers dan lembaga swadaya masyarakat. Pers maupun LSM harus mengawal secara terus menerus bagaimana pembuatan UU Politik. ”Saya hanya berharap pada dua institusi yaitu pers dan LSM, sedangkan eksekutif, yudikatif dan legislatif tidak lagi dapat diharapkan lagi,” katanya. (vvn)

SMS Gelap Serang ... Adapun sebagian isi SMS tersebut adalah sebagai berikut: “Demi Alloh, Saya M Nazaruddin telah dijebak, dikorbankan dan difitnah. Karakter, karier, masa depan saya dihancurkan. Dari Singapore saya akan membalas.” Dalam pesan singkat itu yang mengaku Nazaruddin juga bertekad akan bongkar skandal seks sesama jenis elit Demokrat, megakorupsi Bank Century, korupsi Andi Mallarangeng dalam Wisma Atlet, Manipulasi data IT 18 juta suara dalam Pemilu oleh Anas Urbaningrum dan Andi Nurpati. Informasi di atas adalah SMS dari nomor +6584393907. Namun pesan yang sama juga masuk ke call center okezone dari nomor 001658443939307 dengan menyantumkan nomor panggil balik 006584393907, yang dikirim sekira pukul 00.25 WIB, Sabtu (28/5). Namun saat dihubungi nomor-nomor itu tidak aktif. Sementara itu terkait SMS tersebut, Nazaruddin belum bisa dihubungi. Sekretaris Divisi Komunikasi Publik Partai Demokrat, Hinca Panjaitan saat ditunjukan SMS itu, enggan berkomentar lebih lanjut. “Saya belum bisa berkomentar lebih lanjut tentang ini,” ujar Hinca usai diskusi Polemik Trijaya di Warung Daun Cikini Jakarta, Sabtu(28/5). Itu Fitnah Dan Pembunuhan Karakter Sementara Ketua DPP Partai Demokrat Bidang Informasi, Andi Nurpati menyesalkan pemberitaan soal pesan singkat atau SMS gelap yang mendiskreditkan partai dan elit PD. “Saya menyesalkan adanya pemberitaan soal SMS gelap tersebut, itu sudah fitnah. Fitnah itu lebih kejam dari pembunuhan,” jelasnya Sabtu (28/5). Andi menambahkan, tidak cuma itu adanya SMS gelap yang menyudutkan PD dan para petingginya dan marak terjadi belakangan ini sudah masuk pola pembunuhan karakter. “Ini sudah dipolitisasi untuk membunuh karakter Demokrat,” tandasnya. Menurur Andi, Nazaruddin sendiri sudah membantah peJawaban Problem Catur, san singkat tersebut. Itu hanya pihak-pihak yang mengakuDari Halaman Sport. ngaku Nazaruddin dengan mengirim SMS gelap dari luar negeri. Jawaban Problem Catur: Sebab itu, dia meminta pihak kepolisian untuk segera me1. ......, Be1+. nyelidiki siapa yang bertanggung jawab dalam penyebaran 2. Rh2, Bh1+. SMS fitnah tersebut. “Kami meminta polisi segera menyelidiki3. RxB, Mg1+mat. (Jika nya dari mana asalnya, dan siapa penyebarnya,” imbuh mantan 3. Rg3, Mf2+mat). anggota KPU ini.(okz)

WASPADA Minggu 29 Mei 2011

Aster Panglima TNI: Pesantren Sangat Relevan Bentuk Karakter Bangsa MEDAN (Waspada): Tantangan masa depan yang akan dihadapi Bangsa Indonesia akan semakin berat dan kompleks. Jika seluruh komponen bangsa tidak merasa terpanggil dan bertanggungjawab untuk bersatu secara bersama-sama menyelesaikan persoalan-persoalan yang terjadi, maka cita-cita Bangsa Indonesia yang telah dirumuskan dan diamanahkan sangat sulit diwujudkan. “Cita-cita yang telah diamanahkandandirumuskanparapendiri bangsa antara lain mencer-

daskan kehidupan bangsa, membentuk masyarakat adil dan makmur yang berdasarkan Pancasila dan UUD 1945, akan sangat sulit diwujudkan dalam kehidupan kita apabila masing-masing komponen berjalan sendiri-sendiri,” kata Asisten Teritorial Panglima TNI Mayjen TNI A.Y. Nasution saat temu pers dengan sejumlah wartawan di Medan, Sabtu (28/5). A.Y. Nasution menuturkan, persoalan-persoalan yang memprihatinkan saat ini sering terjadi ditengah kehidupan kita antara lain, rendahnya rasa kebersamaan, hilangnya sikap saling meng-

haragai dan rasa peduli dengan sesame, meningkatnya peredaran dan konsumsi narkoba di kalangan generasi muda, tawuran antar pelajar dan kampung. “Dan masih banyak lagi seperti kesenjangan antara si kaya dan si miskin, pornografi dan pornoaksi yang demikian terbuka, prilaku koruptif, yang ini sudah selayaknya mengkhawatirkan kita semua,” kata A.Y. Nasution. Menurutnya, kondisi lingkungan seperti hal-hal yang disebutkan tadi bukanlah iklim yang ramah untuk menumbuhkan karakter dan akhlakul karimah dalam diri generasi muda.

“Disadari atau tidak, lambat atau cepat, permasalahan social di atas akan menjadi ancaman terhadap ketentraman dan keamanan masyarakat, melemahkannasionalismedansendi-sendi persatuan dan kesatuan bangsa, yangpadaakhirnyaakanmenjadi ancaman bagi pertanahan dan eksistensi bangsa Indonesia,” ungkapnya. Peran Pesantren Dengan kondisi masyarakat yang seperti saat ini, menurutnya, pondok pesantren menjadi sangat relevan dalam pembentukan karakter bangsa yang didasari oleh nilai-nilai luhur pancasila.

Din: Kasus Nazaruddin Bukti Kegagalan Berantas Korupsi SURABAYA (Antara): Ketua Umum Pimpinan Pusat (PP) Muhammadiyah Din Syamsudin menyatakan bahwa kasus suap yang melibatkan Bendahara Umum Partai Demokrat Muhammad Nazaruddin membuktikan kegagalan pemberantasan korupsi. “Saat mencalonkan diri, Presiden Susilo Bambang Yudhoyono (SBY) siap berada di barisan terdepan memberantas korupsi, tapi nyatanya sekarang hampir tidak ada, karena kasus korupsi justru ada di lingkaran SBY. Itu artinya amanat reformasi tidak dipenuhi,” katanya di Surabaya, Sabtu (28/5).

Di sela peresmian gedung “Millenium Building” SD Muhammadiyah4,Pucang,Surabaya, Din mencontohkan kasus yang sekarang mengemuka di negeri ini, yakni keterlibatan Nazaruddin dalam kasus suap terhadapSekretarisMahkamahKonstitusi (MK). Nama Nazaruddin juga disebut-sebut terlibat dalam kasus suap proyekWisma Atlet SEA Games 2011. “Keterlibatan Nazaruddin yangmerupakanpimpinanpartai penguasa dan orang dekat presiden membuktikan bahwa upaya pemberantasan Korupsi, Kolusi dan Nepotisme (KKN) telah ga-

gal,” katanya. Tidak hanya itu saja, lanjut Din,kasus-kasusyangmelibatkan kementerian juga masih banyak yang mengambang. “Masih ingat kasus penyelewengan dana haji di Kementerian Agama? Dulu, kasus itu sangat mengemuka, tapi sekarang tidak ada kelanjutannya,” katanya. Contoh lain, kasus tentang kecelakaanpesawatMerpatiyang diduga ada indikasi serupa. “SekarangbahkanmelibatkanKementerianPemudadanOlahraga. Ini membuktikan pemerintah setengah-setengah memberantasnya,” katanya. Lulusan “University of Cali-

Obama Arogan, Sulut Perang Dengan Pakistan ISLAMABAD, Pakistan (AP): Presiden AS Barack Obama menunjukkan ‘sikap arogan’ setelah satu misi yang menewaskan pemimpin teror Osama bin Laden, kata mantan Presiden Pakistan Pervez Musharraf dalam satu wawancaranya yang telah diudarakan CNN. Musharraf lebih jauh menyebut serangan Mei itu suatu ‘tindakan perang.’ “Pastilah tidak ada negara yangpunyahakuntukmenyusup ke negara lain,” kata Musharraf kepada Piers Morgan. “Secara teknis atau secara hukum tampak itu adalah tindakan perang.” Presiden Amerika itu mengatakan pekan ini dalam satu wawancaranya dengan televisi Inggris bahwa, jika kesempatan memungkinkandiaakanmelakukan lagi tindakan yang serupa untuk menumpas teroris al Qaida. “Saya kira tindakan arogan seperti itu seharusnya tidak ditunjukkan secara terbuka kepada publik dunia,” kata Musharraf. “Saya pikir itu adalah kesom-

bongan bahwa: “Kami tidak peduli. Kami tidak peduli untuk menyatakan pendapat nasional Anda. Kami tidak peduli mengenai pendapat orang-orang Anda. Kami akan datang dan melakukan hal yang sama.’ Ini adalah kesombongan.” Musharraf mengakui bahwa peristiwa itu merupakan suatu “kecelakaan yang mengerikan, kegagalan mengerikan” bahwa intelijen Pakistan tampaknya tidak tahu lebih banyak tentang keberadaan bin Laden, katanya, mereka seharusnya tahu dia tinggal di sebuah kompleks di Abbottabad, jarak yang tidak terlalu jauh dari sebuah akademi militer Pakistan. Presiden AS Barack Obama dinilai berusaha menyulut perang dengan Pakistan karena memerintahkan pasukannya masuk negara tersebut tanpa izin dan membunuh Osama bin Laden. Hal ini dianggap sebagai sikap arogan pemimpin AS itu dan pelanggaran keras atas kedaulatan sebuah negara.

Pernyataan ini disampaikan oleh Mantan Presiden Pakistan Pervez Musharraf yang dilansir dari laman CNN Jumat (27/5). Musharraf mengatakan, penyerangan ke kediaman Osama di kota Abbottabad, Pakistan, 2 Mei lalu oleh pasukan NAVY SEAL AS seharusnya atas seizin pemerintah Pakistan. “Jelas tidak ada negara yang berhak melanggar kedaulatan negara lainnya. Jika secara teknis kau melihatnya, maka itu adalah tindakan penyulut perang,” ujar Musharraf. Sebelumnya pemerintah Pakistan telah menyatakan protesnya atas tindakan AS tersebut. Atas dasar pelanggaran kedaulatan itulah, Musharraf mengatakan pembunuhan Osama adalah tindakan ilegal. Musharraf juga menyayangkan kecerobohan intelijen Pakistan yang tidak mengetahui keberadaan Osama di Abbottabad yang berada dekat akademi militer Pakistan. (m10)

Palestina Tidak ...

untuk memperlemah Hamas, namun tindakan itu juga memperparah krisis ekonomi di wilayah berpenduduk padat itu. RatusanwargaGazaberkumpul Sabtu dinihari ketika bus pertama yang penuh penumpang menyeberang perbatasan pada pukul 09:00 pagi. Dua petugas Mesir berdiri berjaga-jaga di dekat

satu bendera Mesir berukuran besar yang dipasang di atas gerbang perbatasan pada saat kendaraan ramai melintasinya. Sampai Sabtu, terminal perbatasan Rafah hanya difungsikan terbatas. Hanya orang-orang tertentu yang bebas melintasinya seperti mahasiswa, pebisnis atau pasienmedis,yangberhakmelakukanperjalanandanmenyeberang. Sesuai dengan sistem baru, hampirsemuahambatandicabut dan lebih besar jumlah warga Palestina diharapkan akan dapat menyeberang setiap harinya. Di dalam terminal perbatasan itu Sabtu, suasana terlihat aman ketika polisi Hamas memanggil penumpang agar satu persatu mendaftarkan dokumen perjalanannya. (m10)

IsraeldanMesirmengenakan blokade di kawasan itu setelah Islam militan Hamas menguasai Gaza Juni 2007. Penutupan tersebut, yang juga mencakup hambatan ketat Israel terhadap pelintasan kargonya dengan Gaza dan blokade laut, yang dimaksudkan

Menag Jamin ... beberapa waktu lalu sudah mengajukan mengenai besaran BPIH 2011 tersebut. “Ongkos haji itu biasanya tergantung fluktuasi harga bahan bakar, karena pengaruhnya ke harga tiket pesawat. Jika harga tiket pesawat naik maka BPIH bisa naik, mudah-mudahan tidak

naik,” katanya. Menurutnya, pemerintah Indonesia juga sudah mengajukan tambahan kuota haji untuk tahun 2011 menjadi 238 ribu dari tahun 2010 yang hanya 2011 ribu orang. Namun demikian, belum ada kepastian disetujui atau tidaknyausulanpenambahankuota haji untuk Indonesia tersebut oleh pemerintah Arab Saudi.

Tol Belmera ... pula, kata dia, Polda telah membentuk tim untuk mengungkap kasus itu, dan sudah berjalan. Tim itu juga diharapkan dapat mencegah terjadinya peristiwa yang sama. “Ini merupakan perintah langsung Kapolda kepada satuan wilayah di Medan agar segera mengungkap pelaku pembajakan truk di jalan tol,” kata Heru, ditanya keseriusan Polda menangani kasus-kasus yang telah terjadi. Heru juga mengatakan, tim yang dibentuk melibatkan Brimobda Sumut. Mereka (Brimob) akan membantu melengkapi dan memperkut tim. “Fungsi dari tim yang dibentuk, melakukan patroli pengawasan pada jam-jam rawan di jalan tol, kemudian melakukan tindakan pengamanan. Bukan hanya kepada truk tanki bermuatan CPO, tetapi juga truk bermuatan lainnya,” jelasnya. Meski diakuinya belum satupun pelaku pembajak yang tertangkap, tetapi diharapkan tim terdiri dari berbagai fungsi di kepolisian itu dapat segera mengungkapnya, sekaligus mengantisipasi terulangnya kejadian serupa. “Kapolda sudah menyatakan, tim harus berhasil mengungkap pelaku pembajakan itu. Kepada seluruh tim, Kapolda juga mengingatkan untuk selalu berkoordinasi dan melakukan tindakan tegas kepada para pelaku pembajakan,” tandas Heru. Hasil kerja tim di lapangan, kata dia, akan dievaluasi Kapolda setiap minggu dan bulanan. “Dalam evaluasi diharapkan diketahui wilayah mana yang rawan pembajakan, dan pada jam berapa biasanya pelaku beraksi, sehingga memudahkan petugas membekuk pelaku,” jelasnya. Memalukan Karena kasus pembajakan itu, Sekretaris Asosiasi Pengusaha Indonesia (Apindo) Sumut Laksmana Adhyaksa berbicara. Dia mengatakan, peristiwa pembajakan tanki CPO telah menim-

fornia at Los Angeles (UCLA)” di Amerika Serikat tersebut berharap, pemerintah khususnya Presiden SBY bersikap tegas dan serius mengungkap kasus korupsi, sebab korupsi saat ini sudah sangat menggurita dan melibatkan siapa saja. “Muhammadiyahhanyabisa berharap dan mendorong pemerintah pusat untuk tidak mainmain dan tegas memberikan hukuman.Prosespengungkapannya pun tidak setengah-setengah dan diusut secara tuntas hingga dalang-dalangnya sekalian,” papar WakilKetuaUmumMajelisUlama Indonesia (MUI) Pusat tersebut.

500 Bal Pakaian ... Ratusan bal pakaian bekas itu dikemas dalam karung berukuran besar warna putih yang terdiri dari selimut, pakaian anakanak, celana panjang, kemeja, kaos oblong, jaket, sepatu dan lainnya dibawa dari Malaysia menggunakan kapal kayu KM KeluargaSakinahGT14No.1464/ PPB dengan tujuan Kota Tanjungbalai. Petugas menangkap kapal itu di tengah laut saat berlayar menuju Baganasahan setelah mendapat informasi dari masyarakat. Saat diperiksa dokumen, nakhoda tidak dapat menunjukkan surat resmi pelayaran dan muatannya sehingga kapal berikut seluruh isinya dibawa menuju dermaga panton, Bagan Asahan, Kab. Asahan. Pantauan Waspada di lokasi, puluhan pekerja pelabuhan membongkar barang-barang ilegal itu dari kapal menuju truk jenisColtDieselkemudiandibawa ke pergudangan untuk diamankan. “Lumayan banyak ini bang, sekitar 500 bal mungkin ada, dari tadi saja sudah dua truk dipindahkan ke gudang ,” terang seorang pekerja bongkar muat di sela-sela kesibukannya. Kepala Kantor Bea dan Cukai Tanjungbalai-Asahan Charles Sirait dikonfirmasi Waspada melalui Kasi P2 Asep Ridwan membenarkan penangkapan itu. Namun, Asep belum dapat merincikan jumlah keseluruhan pakaian bekas termasuk pemilik serta nakhoda kapal kerena masih dalam pemeriksaan. Namunditegaskan,kasustersebut akan dilimpahkan secepatnyakekejaksaansetelahpemeriksaan dilakukan. Disaat bersamaan, Komandan Rayon Militer Pulau Buaya Kapt. Inf. Ruslan di lokasi mengaku khawatir penyelundupan barang bekas dari luar negeri dapat dijadikan modus operandi para penyelundup untuk memasukkansenjataapikeTanjungbalai. Ditegaskan, untuk melindungi danmenjagakeutuhanNKRI,TNI tidak akan mentolerir masuknya barang-barang ilegal itu termasuk perdagangan senjata api. (a32)

bulkan keresahan bagi kalangan pengusaha perkebunan. Pihaknya kemudian mempertanyakan tingkat keamanan di jalan tol yang dikelola PT Jasa Marga. Seharusnya Badan Usaha Milik Negara (BUMN) yang mengelola jalan tol di Sumut itu dapat menerapkan konsep pengamanan seperti di Jakarta dan Malaysia. Di dua tempat itu, kata dia, dipasang kamera pengawas memantau dan mengetahui keberadaan kendaraan yang melintas di jalan. “Jadi kalau dibajak atau dirampok, bisa diketahui ke arah mana dibawa,” sebutnya. Selain mengharapkan kasus itu diungkap, Apindo Sumut meminta pihak kepolisian meningkatkan keamanan transportasi di daerah itu. Apindo mengharapkan PT Jasa Marga dan Poldasu meningkatkan koordinasinya dalam pengamanan di jalan tol, termasuk menetapkan standar prosedur jika terjadi tindak pidana seperti perampokan. “Peningkatan koordinasi diperlukan agar keselamatan transportasi di jalan tol lebih terjamin dan menutup peluang kemungkinan terjadi hal-hal tidak diinginkan. Jadi, yang diantisipasi bukan hanya perampokan tanki CPO, tetapi juga keamanan bagi kendaraan lain,” kata Adhyaksa. Anggota DPRD Sumut Tengku Dirkhansyah Abu Subhan Ali bahkan mengatakan persitiwa pembajakan tanki CPO di kawasan tol Belawan memalukan dan dapat menyebabkan hilangnya kepercayaan investor terhadap Sumatera Utara. “Itu menjadi tanggung jawab dan ‘PR’ Kapolda untuk segera menuntaskannya,” tandas anggota Komisi B itu. Kata dia, dalam sebuah proses investasi, jaminan keamanan merupakan salah satu kebutuhan pokok bagi kalangan investor. Sumut, jelasnya, dikenal sebagai daerah yang kaya dengan potensi perkebunan yang menjadi salah satu aspek dalam penerimaan negara. Karena itu, peristiwa pembajakan CPO harus menjadi perhatian serius bagi jajaran kepolisian di Sumut. “Jika peristiwa serupa terulang, tentu akan mencoreng dan merusak

“Mengingat pesantren merupakan lembaga pendidikan yang secara operasional telah berhasil menerapkan perpaduan tiga lingkungan pendidikan sekaligus dalam proses pembelajarannya yaitu, lingkungan informal, formal dan non formal. Dengan tiga perpaduan itu, akan melahirkan alumni yang Insya Allah memiliki kecerdasan intelegensi, emosional dan spiritual,” imbuhnya. Dia menambahkan, sejarah bangsa Indonesia telah membuktikan bahwa melalui pondok-pondok pesantren telah lahir para pejuang bangsa yang

secara heroic membuktikan semangat nasionalisme dengan mengorbankan jiwa raga, harta benda untuk kemerdekaan RI. “Dalam lintasan sejarah berikutnya, tidak kita ragukan lagi bahwa alim ulama, cerdik dan pandai, para mubaligh ikut juga berperan memberikan konstribusi bagi kelangsungan hidup berbangsa dan bernegara,” katanya. Minggu (29/5) hari ini, MayjenTNI A.Y. Nasution akan menghadiri acara wisuda di Pesantren Raudhatul Hasanah Jl. Djamin Ginting Paya Bundung Medan. (h02)

Model Cantik Ikut ... Skotlandia, milik Kerajaan Inggris. Pengambilan gambar dia lakukan sebelum ke Afghanistan, di halaman Country Life yang sering dihiasi wajah para aristokrat Inggris. Haslam-Greene yang sering disapa dengan nama akrab Hattie oleh kawan-kawannya maupun sesama tentara menggerai rambut coklatnya dan memakai gaun konservatif dalam pemotretan. Dia juga menenakan sepasang anting mutiara, kukunya dirawat ala French manicure. Gayanya yang anggun sama sekali tak menunjukkan profesinya yang melelahkan. Haslam-Greene, yang berasal dari West Sussex, bersekolah di sekolah khusus perempuan, Newnham College di Cambridge University. Dia bergabung dengan militer 18 bulan lalu, meninggalkan Sandhurst pada bulan Agustus dan bergabung dengan Korps Intelijen. Kini dia berbasis di Lashkar Gah, Haslam-Greene bergabung dalam tim yang tugasnya membangun hubungan baik dengan perempuan Afghanistan. “Sangat mengagumkan melihat seorang gadis yang berprofesi tentara dan pergi berperang, menjadi model,” kata editor Country Life, Mark Hedges seperti dimuat Daily Mail, Kamis (26/5). “Dia nampak mengagumkan, baik saat duduk manis di rumah dengan pakaian sehari-hari, atau di Afghanistan,” tambah dia. Hedges menambahkan, majalahnya juga dikirim setiap bulannya ke Afghanistan. Jadi, para prajurit bakal melihat pose Haslam-Greene. Galaman girls in pearls pertama kali diadalah pada 1897. Ratusan perempuan darah biru pernah mejeng di halaman itu, termasuk adik Ratu Inggris, Putri Anne dan barubaru ini giliran putrinya, Zara Phillips yang fotonya terpampang di sana.(vvn)

Parpol Tempat ... itu adalah partai,” ujarnya. “Partai perlu transparan ke publik, terutama urusan uang, sebab ini juga berkaitan dengan problem etika,” kata Dede. Terkait jalur yang memungkinkan untuk menuntut keterbukaan parpol, publik atau civil society bisa memanfaatkan Undang-Undang Keterbukaan Informasi Publik. “Aksesnya bisa gunakan UU Parpol atau juga UU Nomor 14 Tahun 2008 tentang Keterbukaan untuk memperoleh informasi lembaga publik. Termasuk parpol, sebagai badan hukum, manakala diminta publik harus dibuka (sumber dananya),” tambah Dede. Persoalan sumber pendanaan parpol itu dibahas terkait tema Diskusi Polemik, yakni “Bola Panas Nazaruddin”. Permadi selaku mantan anggota Badan Kehormatan DPR menilai, mantan Bendahara Umum DPP Partai Demokrat Muhammad Nazaruddin yang diduga terlibat penyuapan dalam proyek pembangunan wisma atlet SEA GamesdiPalembangadalahorangsaktiyangditakutiorangsepartainya. Salah satu dugaan yang disampaikan Permadi adalah karena Nazaruddin menjadi salah satu orang penting yang menjadi sumber dana bagi Partai Demokrat. Berdasarkan pernyataan Partai Demokrat, Nazaruddin saat ini berada di Singapura untuk menjalani pengobatan. (kps)

Istri Khadafi Kutuk ... kerusakan berat akibat serangan sejumlah pesawat tempur AS 25 tahun lalu ketika serangan dilakukan AS sebagai respon terhadap pembunuhan dua anggota militer AS di satu disko Jerman. Serangan Sabtu itu dilakukan setelah para pemimpin kekuatan dunia di KTT G8 mengulangi kembali imbauan mereka agar Khadafi melepaskan kekuasaannya. Safia Farkash Khadafi, yang menikah dengan Moammar Khadafi tahun 1970, setahun setelah dia naik ke puncak kekuasaan di negara Afrika Utara, Libya. Dia diduga sebelumnya tidak tercatat pernah berbicara dengan anggota media Libya atau internasional. CNN tidak dapat membenarkan 100 persen bahwa dia adalah istri Moammar Khadafi karena pihak berwenang Libya melarang CNN menggunakan telefonnya karena khawatir akan dilacak. Namun wawancara itu diatur oleh seseorang yang dikenal CNN menejer kantor Safia Khadafi dan oleh kalangan pejabat di kementerian luar negeri Libya. Dalam wawancaranya, wanita itu mengutuk NATO karena menyebabkan kematian salah seorang anaknya, Saif al Arab Khadafi, yang menurut kalangan pejabat Libya terbunuh dalam satu serangan udara bulan lalu. Sekutu telah melancarkan serangan regular di Libya sejak beberapa bulan terakhir ini dalam usaha menjalankan misi penghentian pembunuhan atas warga sipil tak berdosa oleh pasukan Khadafi. Safia menceritakan ketika empat rudal NATO menghantam kediamannya di Tripoli sesaat setelah salat Maghrib, 1 Mei lalu. Beruntung, kala itu Safia dan Khadafi tidak ada di tempat, namun putra bungsunya, Saif al-Arab, 29, dan ketiga cucunya tewas. “Saya tidak di sana, tapi saya berharap ada di sana, saya lebih baik mati bersama anak saya (Saif al-Arab),” ujar Safia. Safia adalah istri kedua dan ibu dari enam anak Khadafi yang seluruhnya berjumlah delapan orang. Tiga orang putranya tewas dalam serangan NATO. Dua di antaranya, Khamis dan Saif al-Islam, diduga adalah komandan tempur pasukan penyerang Khadafi. Safia membantah hal ini, dia mengatakan anak-anaknya adalah warga sipil tidak berdosa. “Anak-anak saya adalah warga sipil, dan mereka juga diserang. Memangnya apa salah mereka?” ujar Safia. (m10) iklim investasi. Peristiwa kemarin itu saja sudah sangat memalukan,” kata wakil sekretaris Partai Demokrat Sumut itu. Dibawa ke penampungan Peristiwa pembajakan truk tanki bermuatan CPO terjadi pada Kamis (12/5) sekira pukul 00:30 WIB di tol simpang Kawasan Industri Medan (KIM) 2, Mabar. Korban Ropature Situmorang, 35, saat membuat laporan di Mapolsek Medan Labuhan menjelaskan bahwa pelaku enam orang pria bersenjata api. Korban mengaku disekap dan diikat kawanan perampok, kemudian diturunkan di kawasan Terminal Terpadu Amplas. Sedangkan truk tanki BK 9115 BE berisi 31 ton CPO dari Sosa, Kabupaten Padanglawas Selatan dibawa para pelaku. Truk kemudian ditemukan di sekitaran Asrama Haji, Medan, tetapi muatannya sudah kosong. Peristiwa itu mengakibatkan pemilik truk tanki mengganti kerugian sekira Rp310 juta, belum lagi uang tunai sopir Rp1,9 juta disikap para pelaku, termasuk suratsurat berharga. Kejadian itu pula yang menyebabkan sopir-sopir lainnya resah. Karena pelaku tidak segan-segan menganiaya jika para sopir tidak menurunkan sebagian muatan CPO yang mereka bawa ke lokasi penampungan para pembajak. Mereka mengatakan, peristiwa hampir sama juga terjadi pada Senin (23/5) dinihari di kawasan sama. Tetapi truk tanki berisi CPO itu berhasil lolos ketika hendak dihentikan para pembajak. Para sopir itu mengatakan, truk pengangkut beras asal Aceh milik PT BES juga pernah dibajak. “Kami menjadi was-was, dan berharap polisi tidak tutup mata, karena di daerah ini banyak lokasi atau gudang penampung CPO ilegal,” kata mereka. Informasi menyebutkan bahwa pembajakan truk tanki bermuatan CPO dilakukan kawanan penjahat terorganisir. Bos penadah CPO curian itu dikatakan satu sumber berinisial Al, dan dibeking sejumlah oknum aparat. (m27)


Berita Utama

A2 Polling Pemilihan Gubernur Aceh

5 Besar Hasil Sementara Berikan suara Anda dengan mengisi kupon polling Who Wants To Be Gubernur Aceh dan mengirimkannya ke Redaksi Harian Waspada Jl.Brig.Katamso No.1 Medan 20151 sebelum tanggal 10 Juni 2011. Setiap suara yang masuk akan dihitung setiap hari. Kupon akan diundi tanggal 1 Juli 2011, disediakan hadiah: (kupon polling di halaman B6)

Hari Ini, Din Syamsuddin Lantik PWM Dan Aisyiyah Sumut MEDAN (Waspada): Ketua Umum Pimpinan Pusat Muhammadiyah Din Syamsuddin (foto) menghadiri acara Ta’aruf Pimpinan Wilayah Muhammadiyah Sumatera dan Pimpinan Wilayah Aisyiyah, di Auditorium UMSU Jalan Kapt Muchtar Basri Medan hari ini, Minggu (29/5). RektorUMSUAgussanimenjelaskan Ketua Umum PP Muhammadiyah akan tiba di Medan pukul 08:00 dan langsung menghadiri acara ta’aruf atau pelantikan pengurus PWM-PW Aisyiyah Sumut pukul 09:00. “Selain melantik pengurus PWM dan PW Aisyiyah Sumut periode 2010-2015, Pak Din Syamsuddin berkesempatan memberikan ceramah umum,” ujarnya. Sebelumnya, Musywil PWM XI dan PW Aisyiyah yang berlangsung secara serentak di Asrama Haji 6-9 Januari lalu menetapkan Guru Besar IAIN Sumut Prof Dr Asmuni sebagai Ketua

PWM dan Hj Elinita sebagai Ketua PW Asiyiyah Sumut. Saat Musywil PWM menetapkan 13 nama dari 39 dari hasil musyawarah PWM yang diikuti utusan PWM, PDM se-Sumut dan ortom. Ke-13 nama tersebut yakni Asmuni, Agussani, Hasimsyah Nasution, Mario Kasduri, Ibrahim Gultom, Dalail Ahmad, Askolan Lubis, Sarwo Edi, Bahril Datuk, Irwan Syahputra, Suhrawardi K Lubis, M Nasir Wahab dan Shohibul Anshor. (m13)

Menag Jamin Pelayanan Haji 2011 Lebih Baik SERANG (Antara): Menteri Agama (Menag) Suryadharma Ali menjamin pelayanan ibadah haji tahun 2011 akan lebih baik dibandingtahun-tahunsebelumnya. “Mudah-mudahan pelayanan ibadah haji tahun ini lebih baik lagi dan ongkosnya diharapkanbisalebihmurahatauminimal samadengantahun2010.Namun demikian belum ada keputusan mengenaibiayapenyelenggaraan ibadahhajitahunini,”kataMenag Suryadharma Ali usai menjadi pembicara “Seminar Nasional Memperingati 100Tahun Mr Sjafrudin Prawiranegara” di Serang, Sabtu (28/5). Ia mengatakan, indikator mengenai kemungkinan pelayanan ibadah haji tahun ini lebih baik dibanding tahun sebelumnya, yakni bertambahnya jumlah jamaah calon haji asal Indonesia

yang berada pada ring satu yakni menjadi 80 persen pada 2011. “Tahun ini jumlahnya bertambah menjadi 80 persen dengan jarak maksimal pemondokan 2.500 meter, itupun menggunakankendaraanuntukpulang perginya,” kata Menag. Terkait dengan besaran biaya penyelenggaraan ibadah haji (BPIH/ONH) tahun 2011, pemerintah belum memutuskan karena belum ada pembahasan dengan DPR meskipun pihaknya beberapa waktu lalu sudah mengajukan mengenai besaran BPIH 2011 tersebut. “Ongkos haji itu biasanya tergantung fluktuasi harga bahan bakar, karena pengaruhnya ke harga tiket pesawat. Jika harga tiket pesawat naik maka BPIH bisa naik, mudah-mudahan tidak naik,” katanya.

Palestina Tidak ... Israel dan Mesir mengenakan blokade di kawasan itu setelah Islam militan Hamas menguasai Gaza Juni 2007. Penutupan tersebut, yang juga mencakup hambatan ketat Israel terhadap pelintasan kargonya dengan Gaza dan blokade laut, yang dimaksudkan untuk memperlemah Hamas, namun tindakan itu juga memperparah krisis ekonomi di wilayah berpenduduk padat itu. Ratusan warga Gaza berkumpul Sabtu dinihari ketika bus pertama yang penuh penumpang menyeberang perbatasan pada pukul 09:00 pagi. Dua petugas Mesir berdiri berjaga-jaga di dekat satu bendera Mesir berukuran besar yang dipasang di atas gerbang perbatasan pada saat kendaraan ramai melintasinya. (m10)

SMS Guncang SBY ... “Kami menilai ada yang memanfaatkan situasi. Metode penyebarluasan informasi semacam ini, adalah kelanjutan dari berbagai cara yang selama ini digunakan untuk membuat berita bohong,” jelasnya. Bagi Andi, kemajuan teknologi memang sangat memungkinkan lahirnya informasi-informasi yang tidak sehat. Upaya ini memang kerap dilakukan melalui SMS dan berbagai situs jejaring sosial. “Sulit dicegah tetapi sangat mungkin ditemukan pelakunya oleh aparat hukum dan oleh media massa bisa difilter karena sumber pemberitaannya yang tidak jelas, dengan isi tanpa fakta. Kejadian seperti ini bisa terkena pada siapapun. Kita berharap tradisi buruk penggunaan teknologi bukan menjadi kebudayaan kita,” pesannya. Nazaruddin sudah membantah telah mengirim SMS ancaman tersebut. “Ini fitnah, enggak benar sama sekali,” kata Nazaruddin saat dihubungi. Ke Cikeas Sementara itu Ketua Divisi Komunikasi Publik Partai Demokrat Andi Nurpati menyatakan salah satu pembicaraan dalam rapat yang digelar di Kantor DPP Partai Demokrat adalah soal pesan singkat berisi ancaman. Menurut Nurpati, Ketua Umum Demokrat Anas Urbaningrum meminta pengurus Demokrat untuk solid dan sabar. “Disampaikan Ketua Umum, saat ini bilang banyak cobaan yang dihadapi Demokrat,” kata Nurpati, Sabtu (28/5). “Karena itu semua kader dan pimpinan diminta untuk solid, sabar, hati-hati. Siap menghadapi serangan dari luar,” katanya. Soal SMS berisi ancaman, Nurpati menyatakan, itu adalah salah satu bentuk serangan dari luar. Demokrat akan mempelajari kasus ini. Sabtu malamnya, kata Nurpati, sejumlah pengurus teras Demokrat berangkat ke Cikeas menemui Ketua Dewan Pembina Partai Demokrat Susilo BambangYudhoyono. Bidang Hukum Partai Demokrat terutama yang disuruh berangkat. “Saya kira biasa dilaporkan ke sana,” kata Nurpati. Sebelumnya, pengurus Demokrat Soetan Bhatoegana menyatakan, Rapat barusan di DPP Demokrat ini konsolidasi saja agar kader Demokrat tidak saling sahut-menyahut yang tidak jelas. “Padahal kami kompak sebenarnya. Cuma ada split kata saja Jawaban Problem Catur, nanti jadi bahan perbincangan orang. Dibilang nggak kompak Dari Halaman Sport. lagi,” katanya. Soetan pun membantah rapat yang berlangsung hampir Jawaban Problem Catur: satu jam itu membahas kasus M Nazaruddin yang baru sepekan 1. ......, Be1+. lalu dipecat sebagai Bendahara Umum Partai Demokrat. Mereka 2. Rh2, Bh1+. puntakmembahasinformasiada SMS gelap yang memojokkan 3. RxB, Mg1+mat. (Jika kader Demokrat tertentu. “Biar aparat saja yang mengurus,” 3. Rg3, Mf2+mat). katanya. (vvn/m09)

WASPADA Minggu 29 Mei 2011

Aster Panglima TNI: Pesantren Sangat Relevan Bentuk Karakter Bangsa MEDAN (Waspada): Tantangan masa depan yang akan dihadapi Bangsa Indonesia akan semakin berat dan kompleks. Jika seluruh komponen bangsa tidak merasa terpanggil dan bertanggungjawab untuk bersatu secara bersama-sama menyelesaikan persoalan-persoalan yang terjadi, maka cita-cita Bangsa Indonesia yang telah dirumuskan dan diamanahkan sangat sulit diwujudkan. “Cita-cita yang telah diamanahkan dan dirumuskan para pendiri bangsa antara lain men-

cerdaskan kehidupan bangsa, membentuk masyarakat adil dan makmur yang berdasarkan Pancasila dan UUD 1945, akan sangat sulit diwujudkan dalam kehidupan kita apabila masingmasing komponen berjalan sendiri-sendiri,” kata Asisten Teritorial Panglima TNI Mayjen TNI A.Y. Nasution saat temu pers dengan sejumlah wartawan di Medan, Sabtu (28/5). A.Y. Nasution menuturkan, persoalan-persoalan yang memprihatinkan saat ini sering terjadi ditengah kehidupan kita antara lain, rendahnya rasa kebersamaan, hilangnya sikap saling meng-

haragai dan rasa peduli dengan sesame, meningkatnya peredaran dan konsumsi narkoba di kalangan generasi muda, tawuran antar pelajar dan kampung. “Dan masih banyak lagi seperti kesenjangan antara si kaya dan si miskin, pornografi dan pornoaksi yang demikian terbuka, prilaku koruptif, yang ini sudah selayaknya mengkhawatirkan kita semua,” kata A.Y. Nasution. Menurutnya, kondisi lingkungan seperti hal-hal yang disebutkan tadi bukanlah iklim yang ramah untuk menumbuhkan karakter dan akhlakul karimah dalam diri generasi muda.

“Disadari atau tidak, lambat atau cepat, permasalahan social di atas akan menjadi ancaman terhadap ketentraman dan keamanan masyarakat, melemahkannasionalismedansendi-sendi persatuan dan kesatuan bangsa, yangpadaakhirnyaakanmenjadi ancaman bagi pertanahan dan eksistensi bangsa Indonesia,” ungkapnya. Peran Pesantren Dengan kondisi masyarakat yang seperti saat ini, menurutnya, pondok pesantren menjadi sangat relevan dalam pembentukan karakter bangsa yang didasari oleh nilai-nilai luhur pancasila.

Din: Kasus Nazaruddin Bukti Kegagalan Berantas Korupsi SURABAYA (Antara): Ketua Umum Pimpinan Pusat (PP) Muhammadiyah Din Syamsudin menyatakan bahwa kasus suap yang melibatkan Bendahara Umum Partai Demokrat Muhammad Nazaruddin membuktikan kegagalan pemberantasan korupsi. “Saat mencalonkan diri, Presiden Susilo Bambang Yudhoyono (SBY) siap berada di barisan terdepan memberantas korupsi, tapi nyatanya sekarang hampir tidak ada, karena kasus korupsi justru ada di lingkaran SBY. Itu artinya amanat reformasi tidak dipenuhi,” katanya di Surabaya,

Sabtu (28/5). Di sela peresmian gedung “Millenium Building” SD Muhammadiyah4,Pucang,Surabaya, Din mencontohkan kasus yang sekarang mengemuka di negeri ini, yakni keterlibatan Nazaruddin dalam kasus suap terhadapSekretarisMahkamahKonstitusi(MK).NamaNazaruddinjuga disebut-sebutterlibatdalamkasus suap proyekWisma Atlet SEA Games 2011. “Keterlibatan Nazaruddin yangmerupakanpimpinanpartai penguasa dan orang dekat presiden membuktikan bahwa upaya pemberantasan Korupsi, Kolusi

dan Nepotisme (KKN) telah gagal,” katanya. Tidak hanya itu saja, lanjut Din,kasus-kasusyangmelibatkan kementerian juga masih banyak yang mengambang. “Masih ingat kasuspenyelewengandanahajidi KementerianAgama?Dulu,kasus itusangatmengemuka,tapisekarang tidakadakelanjutannya,”katanya. Contoh lain, kasus tentang kecelakaanpesawatMerpatiyang diduga ada indikasi serupa. “SekarangbahkanmelibatkanKementerianPemudadanOlahraga. Ini membuktikan pemerintah setengah-setengah memberantasnya,” katanya.

Obama Arogan, Sulut Perang Dengan Pakistan ISLAMABAD, Pakistan (AP): Presiden AS Barack Obama menunjukkan‘sikap arogan’ setelah satu misi yang menewaskan pemimpin teror Osama bin Laden, kata mantan Presiden Pakistan Pervez Musharraf dalam satu wawancaranya yang telah diudarakan CNN. Musharraf lebih jauh menyebut serangan Mei itu suatu ‘tindakan perang.’ “Pastilah tidak ada negara yangpunyahakuntukmenyusup ke negara lain,” kata Musharraf kepada Piers Morgan. “Secara teknis atau secara hukum tampak itu adalah tindakan perang.” Presiden Amerika itu mengatakan pekan ini dalam satu wawancaranya dengan televisi Inggris bahwa, jika kesempatan memungkinkandiaakanmelakukan lagi tindakan yang serupa untuk menumpas teroris al Qaida. “Saya kira tindakan arogan seperti itu seharusnya tidak ditunjukkan secara terbuka kepada publik dunia,” kata Musharraf. “Saya pikir itu adalah kesom-

bongan bahwa: “Kami tidak peduli. Kami tidak peduli untuk menyatakan pendapat nasional Anda. Kami tidak peduli mengenai pendapat orang-orang Anda. Kami akan datang dan melakukan hal yang sama.’ Ini adalah kesombongan.” Musharraf mengakui bahwa peristiwa itu merupakan suatu “kecelakaan yang mengerikan, kegagalan mengerikan” bahwa intelijen Pakistan tampaknya tidak tahu lebih banyak tentang keberadaan bin Laden, katanya, mereka seharusnya tahu dia tinggal di sebuah kompleks di Abbottabad, jarak yang tidak terlalu jauh dari sebuah akademi militer Pakistan. Presiden AS Barack Obama dinilai berusaha menyulut perang dengan Pakistan karena memerintahkan pasukannya masuk negara tersebut tanpa izin dan membunuh Osama bin Laden. Hal ini dianggap sebagai sikap arogan pemimpin AS itu dan pelanggaran keras atas kedaulatan sebuah negara.

tukmerumuskanlangkah-langkah guna menyelesaikan persoalan penempatan dan perlindungan tenagakerjaIndonesia(TKI).Tugas utamakomiteituantaralainmelakukan telaah terhadap berbagai permasalahan yang berhubungan dengan penempatan dan perlindungan TKI di Arab Saudi. Selain itu komite mempersiapkankerangkakerjasamayang berkaitan dengan penempatan dan perlindungan TKI dan selanjutnyamelakukanpenyiapannota kesepahaman (MoU) yang diharapkan selesai dalam enam bulan ke depan. Pernyataan itu juga menyebutkan perekrutan TKI akan terus berlangsungdalamkerangkapolis

Tol Belmera ... pula, kata dia, Polda telah membentuk tim untuk mengungkap kasus itu, dan sudah berjalan. Tim itu juga diharapkan dapat mencegah terjadinya peristiwa yang sama. “Ini merupakan perintah langsung Kapolda kepada satuan wilayah di Medan agar segera mengungkap pelaku pembajakan truk di jalan tol,” kata Heru, ditanya keseriusan Polda menangani kasus-kasus yang telah terjadi. Heru juga mengatakan, tim yang dibentuk melibatkan Brimobda Sumut. Mereka (Brimob) akan membantu melengkapi dan memperkut tim. “Fungsi dari tim yang dibentuk, melakukan patroli pengawasan pada jam-jam rawan di jalan tol, kemudian melakukan tindakan pengamanan. Bukan hanya kepada truk tanki bermuatan CPO, tetapi juga truk bermuatan lainnya,” jelasnya. Meski diakuinya belum satupun pelaku pembajak yang tertangkap, tetapi diharapkan tim terdiri dari berbagai fungsi di kepolisian itu dapat segera mengungkapnya, sekaligus mengantisipasi terulangnya kejadian serupa. “Kapolda sudah menyatakan, tim harus berhasil mengungkap pelaku pembajakan itu. Kepada seluruh tim, Kapolda juga mengingatkan untuk selalu berkoordinasi dan melakukan tindakan tegas kepada para pelaku pembajakan,” tandas Heru. Hasil kerja tim di lapangan, kata dia, akan dievaluasi Kapolda setiap minggu dan bulanan. “Dalam evaluasi diharapkan diketahui wilayah mana yang rawan pembajakan, dan pada jam berapa biasanya pelaku beraksi, sehingga memudahkan petugas membekuk pelaku,” jelasnya. Memalukan Karena kasus pembajakan itu, Sekretaris Asosiasi Pengusaha Indonesia (Apindo) Sumut Laksmana Adhyaksa berbicara. Dia mengatakan, peristiwa pembajakan tanki CPO telah menim-

roic membuktikan semangat nasionalisme dengan mengorbankan jiwa raga, harta benda untuk kemerdekaan RI. “Dalam lintasan sejarah berikutnya, tidak kita ragukan lagi bahwa alim ulama, cerdik dan pandai, para mubaligh ikut juga berperan memberikan konstribusi bagi kelangsungan hidup berbangsa dan bernegara,” katanya. Minggu (29/5) hari ini, MayjenTNI A.Y. Nasution akan menghadiri acara wisuda di Pesantren Raudhatul Hasanah Jl. Djamin Ginting Paya Bundung Medan. (h02)

Model Cantik Ikut ...

Lulusan “University of California at Los Angeles (UCLA)” di Amerika Serikat tersebut berharap, pemerintah khususnya Presiden SBY bersikap tegas dan serius mengungkap kasus korupsi, sebab korupsi saat ini sudah sangat menggurita dan melibatkan siapa saja. “Muhammadiyahhanyabisa berharap dan mendorong pemerintah pusat untuk tidak mainmain dan tegas memberikan hukuman.Prosespengungkapannya pun tidak setengah-setengah dan diusut secara tuntas hingga dalang-dalangnya sekalian,” papar WakilKetuaUmumMajelisUlama Indonesia (MUI) Pusat tersebut.

Skotlandia, milik Kerajaan Inggris. Pengambilan gambar dia lakukan sebelum ke Afghanistan, di halaman Country Life yang sering dihiasi wajah para aristokrat Inggris. Haslam-Greene yang sering disapa dengan nama akrab Hattie oleh kawan-kawannya maupun sesama tentara menggerai rambut coklatnya dan memakai gaun konservatif dalam pemotretan. Dia juga menenakan sepasang anting mutiara, kukunya dirawat ala French manicure. Gayanya yang anggun sama sekali tak menunjukkan profesinya yang melelahkan. Haslam-Greene, yang berasal dari West Sussex, bersekolah di sekolah khusus perempuan, Newnham College di Cambridge University. Dia bergabung dengan militer 18 bulan lalu, meninggalkan Sandhurst pada bulan Agustus dan bergabung dengan Korps Intelijen. Kini dia berbasis di Lashkar Gah, Haslam-Greene bergabung dalam tim yang tugasnya membangun hubungan baik dengan perempuan Afghanistan. “Sangat mengagumkan melihat seorang gadis yang berprofesi tentara dan pergi berperang, menjadi model,” kata editor Country Life, Mark Hedges seperti dimuat Daily Mail, Kamis (26/5). “Dia nampak mengagumkan, baik saat duduk manis di rumah dengan pakaian sehari-hari, atau di Afghanistan,” tambah dia. Hedges menambahkan, majalahnya juga dikirim setiap bulannya ke Afghanistan. Jadi, para prajurit bakal melihat pose HaslamGreene. Galaman girls in pearls pertama kali diadalah pada 1897. Ratusan perempuan darah biru pernah mejeng di halaman itu, termasuk adik Ratu Inggris, Putri Anne dan baru-baru ini giliran putrinya, Zara Phillips yang fotonya terpampang di sana.(vvn)

500 Bal Pakaian ...

Parpol Tempat ...

Ratusan bal pakaian bekas itu dikemas dalam karung berukuran besar warna putih yang terdiri dari selimut, pakaian anakanak, celana panjang, kemeja, kaos oblong, jaket, sepatu dan lainnya dibawa dari Malaysia menggunakan kapal kayu KM KeluargaSakinahGT14No.1464/ PPB dengan tujuan Kota Tanjungbalai. Petugas menangkap kapal itu di tengah laut saat berlayar menuju Baganasahan setelah mendapat informasi dari masyarakat. Saat diperiksa dokumen, nakhoda tidak dapat menunjukkan surat resmi pelayaran dan muatannya sehingga kapal berikut seluruh isinya dibawa menuju dermaga panton, Bagan Asahan, Kab. Asahan. Pantauan Waspada di lokasi, puluhan pekerja pelabuhan membongkar barang-barang ilegal itu dari kapal menuju truk jenisColtDieselkemudiandibawa ke pergudangan untuk diamankan. “Lumayan banyak ini bang, sekitar 500 bal mungkin ada, dari tadi saja sudah dua truk dipindahkan ke gudang ,” terang seorang pekerja bongkar muat di sela-sela kesibukannya. Kepala Kantor Bea dan Cukai Tanjungbalai-Asahan Charles Sirait dikonfirmasi Waspada melalui Kasi P2 Asep Ridwan membenarkan penangkapan itu. Namun, Asep belum dapat merincikan jumlah keseluruhan pakaian bekas termasuk pemilik serta nakhoda kapal kerena masih dalam pemeriksaan. Namunditegaskan,kasustersebut akan dilimpahkan secepatnyakekejaksaansetelahpemeriksaan dilakukan. Disaat bersamaan, Komandan Rayon Militer Pulau Buaya Kapt. Inf. Ruslan di lokasi mengaku khawatir penyelundupan barang bekas dari luar negeri dapat dijadikan modus operandi para penyelundup untuk memasukkansenjataapikeTanjungbalai. Ditegaskan, untuk melindungi danmenjagakeutuhanNKRI,TNI tidak akan mentolerir masuknya barang-barang ilegal itu termasuk perdagangan senjata api. (a32)

transparan dalam menjelaskan sumber dana akan mendatangkan penilaian positif publik atas parpol yang bersangkutan. Sikap tersebut selanjutnya akan berimbas pada apresiasi dan pilihan publik. Jika tidak, “Orang bisa tidak percaya pada parpol, padahal instrumen berpolitik itu adalah partai,” ujarnya. “Partai perlu transparan ke publik, terutama urusan uang, sebab ini juga berkaitan dengan problem etika,” kata Dede. Terkait jalur yang memungkinkan untuk menuntut keterbukaan parpol, publik atau civil society bisa memanfaatkan Undang-Undang Keterbukaan Informasi Publik. “Aksesnya bisa gunakan UU Parpol atau juga UU Nomor 14 Tahun 2008 tentang Keterbukaan untuk memperoleh informasi lembaga publik. Termasuk parpol, sebagai badan hukum, manakala diminta publik harus dibuka (sumber dananya),” tambah Dede. Persoalan sumber pendanaan parpol itu dibahas terkait tema Diskusi Polemik, yakni “Bola Panas Nazaruddin”. Permadi selaku mantan anggota Badan Kehormatan DPR menilai, mantan Bendahara Umum DPP Partai Demokrat Muhammad Nazaruddin yang diduga terlibat penyuapan dalam proyek pembangunan wisma atlet SEA GamesdiPalembangadalahorangsaktiyangditakutiorangsepartainya. Salah satu dugaan yang disampaikan Permadi adalah karena Nazaruddin menjadi salah satu orang penting yang menjadi sumber dana bagi Partai Demokrat. Berdasarkan pernyataan Partai Demokrat, Nazaruddin saat ini berada di Singapura untuk menjalani pengobatan. (kps)

bulkan keresahan bagi kalangan pengusaha perkebunan. Pihaknya kemudian mempertanyakan tingkat keamanan di jalan tol yang dikelola PT Jasa Marga. Seharusnya Badan Usaha Milik Negara (BUMN) yang mengelola jalan tol di Sumut itu dapat menerapkan konsep pengamanan seperti di Jakarta dan Malaysia. Di dua tempat itu, kata dia, dipasang kamera pengawas memantau dan mengetahui keberadaan kendaraan yang melintas di jalan. “Jadi kalau dibajak atau dirampok, bisa diketahui ke arah mana dibawa,” sebutnya. Selain mengharapkan kasus itu diungkap, Apindo Sumut meminta pihak kepolisian meningkatkan keamanan transportasi di daerah itu. Apindo mengharapkan PT Jasa Marga dan Poldasu meningkatkan koordinasinya dalam pengamanan di jalan tol, termasuk menetapkan standar prosedur jika terjadi tindak pidana seperti perampokan. “Peningkatan koordinasi diperlukan agar keselamatan transportasi di jalan tol lebih terjamin dan menutup peluang kemungkinan terjadi hal-hal tidak diinginkan. Jadi, yang diantisipasi bukan hanya perampokan tanki CPO, tetapi juga keamanan bagi kendaraan lain,” kata Adhyaksa. Anggota DPRD Sumut Tengku Dirkhansyah Abu Subhan Ali bahkan mengatakan persitiwa pembajakan tanki CPO di kawasan tol Belawan memalukan dan dapat menyebabkan hilangnya kepercayaan investor terhadap Sumatera Utara. “Itu menjadi tanggung jawab dan ‘PR’ Kapolda untuk segera menuntaskannya,” tandas anggota Komisi B itu. Kata dia, dalam sebuah proses investasi, jaminan keamanan merupakan salah satu kebutuhan pokok bagi kalangan investor. Sumut, jelasnya, dikenal sebagai daerah yang kaya dengan potensi perkebunan yang menjadi salah satu aspek dalam penerimaan negara. Karena itu, peristiwa pembajakan CPO harus menjadi perhatian serius bagi jajaran kepolisian di Sumut. “Jika peristiwa serupa terulang, tentu akan mencoreng dan merusak

iklim investasi. Peristiwa kemarin itu saja sudah sangat memalukan,” kata wakil sekretaris Partai Demokrat Sumut itu. Dibawa ke penampungan Peristiwa pembajakan truk tanki bermuatan CPO terjadi pada Kamis (12/5) sekira pukul 00:30 WIB di tol simpang Kawasan Industri Medan (KIM) 2, Mabar. Korban Ropature Situmorang, 35, saat membuat laporan di Mapolsek Medan Labuhan menjelaskan bahwa pelaku enam orang pria bersenjata api. Korban mengaku disekap dan diikat kawanan perampok, kemudian diturunkan di kawasan Terminal Terpadu Amplas. Sedangkan truk tanki BK 9115 BE berisi 31 ton CPO dari Sosa, Kabupaten Padanglawas Selatan dibawa para pelaku. Truk kemudian ditemukan di sekitaran Asrama Haji, Medan, tetapi muatannya sudah kosong. Peristiwa itu mengakibatkan pemilik truk tanki mengganti kerugian sekira Rp310 juta, belum lagi uang tunai sopir Rp1,9 juta disikap para pelaku, termasuk suratsurat berharga. Kejadian itu pula yang menyebabkan sopir-sopir lainnya resah. Karena pelaku tidak segan-segan menganiaya jika para sopir tidak menurunkan sebagian muatan CPO yang mereka bawa ke lokasi penampungan para pembajak. Mereka mengatakan, peristiwa hampir sama juga terjadi pada Senin (23/5) dinihari di kawasan sama. Tetapi truk tanki berisi CPO itu berhasil lolos ketika hendak dihentikan para pembajak. Para sopir itu mengatakan, truk pengangkut beras asal Aceh milik PT BES juga pernah dibajak. “Kami menjadi was-was, dan berharap polisi tidak tutup mata, karena di daerah ini banyak lokasi atau gudang penampung CPO ilegal,” kata mereka. Informasi menyebutkan bahwa pembajakan truk tanki bermuatan CPO dilakukan kawanan penjahat terorganisir. Bos penadah CPO curian itu dikatakan satu sumber berinisial Al, dan dibeking sejumlah oknum aparat. (m27)

Pernyataan ini disampaikan oleh Mantan Presiden Pakistan Pervez Musharraf yang dilansir dari laman CNN Jumat (27/5). Musharraf mengatakan, penyerangan ke kediaman Osama di kota Abbottabad, Pakistan, 2 Mei lalu oleh pasukan NAVY SEAL AS seharusnya atas seizin pemerintah Pakistan. “Jelas tidak ada negara yang berhak melanggar kedaulatan negara lainnya. Jika secara teknis kau melihatnya, maka itu adalah tindakan penyulut perang,” ujar Musharraf. Sebelumnya pemerintah Pakistan telah menyatakan protesnya atas tindakan AS tersebut. Atas dasar pelanggaran kedaulatan itulah, Musharraf mengatakan pembunuhan Osama adalah tindakan ilegal. Musharraf juga menyayangkan kecerobohan intelijen Pakistan yang tidak mengetahui keberadaan Osama di Abbottabad yang berada dekat akademi militer Pakistan. (m10)

Pertemuan RI-Saudi Hasilkan Pernyataan Kehendak Bersama JEDDAH (Antara): Pertemuan pejabat tinggi (SOM) pemerintah Republik Indonesia dan Arab Saudi soal tenaga kerja Indonesia di Jeddah, Sabtu (28/5) menghasilkanPernyataanKehendak Bersama (Statement of Intens). Pernyataan kehendak bersama itu ditandatangani Kepala BadanNasionalPenempatandan PerlindunganTenaga Kerja Indonesia (BNP2TKI) Moh Jumhur Hidayat selaku ketua delegasi RI dan Menteri Tenaga Kerja Arab Saudi Adel Mohammad Fakeih selaku ketua delegasi Arab Saudi. Dalam pernyataan itu disebutkankeduabelahpihaksepakat membentuk komite kerja bersama(jointworkingcommittee)un-

“Mengingat pesantren merupakan lembaga pendidikan yang secara operasional telah berhasil menerapkan perpaduan tiga lingkungan pendidikan sekaligus dalam proses pembelajarannya yaitu, lingkungan informal, formal dan non formal. Dengan tiga perpaduan itu, akan melahirkan alumni yang Isnya Allah memiliki kecerdasan intelegensi, emosional dan spiritual,” imbuhnya. Dia menambahkan, sejarah bangsa Indonesia telah membuktikan bahwa melalui pondokpondok pesantren telah lahir para pejuang bangsa yang secara he-

asuransi TKI yang menanggung hak-hak TKI dan pengguna jasa yang diusulkan oleh Komite Nasional Perekrutan Arab Saudi (Saudi Arabian National Recruitment Committee). “Ini takdir Allah, hasil terbaik yang bisa diputuskan. Kami sangat berbahagia atas hasil ini,” kata Jumhur. Ia sangat optimistis penempatan dan perlindungan TKI di Arab Saudi ke depan berjalan lebih baik. “Insya Allah kejadiankejadianmemilukanyangmenimpa TKI di Saudi tidak terjadi lagi,” katanya. Pernyataan kehendak bersama itu, katanya, merupakan kemenangan bersama Kerajaan ArabSaudidanbangsaIndonesia.

Istri Khadafi Kutuk ... kerusakan berat akibat serangan sejumlah pesawat tempur AS 25 tahun lalu ketika serangan dilakukan AS sebagai respon terhadap pembunuhan dua anggota militer AS di satu disko Jerman. Serangan Sabtu itu dilakukan setelah para pemimpin kekuatan dunia di KTT G8 mengulangi kembali imbauan mereka agar Khadafi melepaskan kekuasaannya. Safia Farkash Khadafi, yang menikah dengan Moammar Khadafi tahun 1970, setahun setelah dia naik ke puncak kekuasaan di negara Afrika Utara, Libya. Dia diduga sebelumnya tidak tercatat pernah berbicara dengan anggota media Libya atau internasional. CNN tidak dapat membenarkan 100 persen bahwa dia adalah istri Moammar Khadafi karena pihak berwenang Libya melarang CNN menggunakan telefonnya karena khawatir akan dilacak. Namun wawancara itu diatur oleh seseorang yang dikenal CNN menejer kantor Safia Khadafi dan oleh kalangan pejabat di kementerian luar negeri Libya. Dalam wawancaranya, wanita itu mengutuk NATO karena menyebabkan kematian salah seorang anaknya, Saif al Arab Khadafi, yang menurut kalangan pejabat Libya terbunuh dalam satu serangan udara bulan lalu. Sekutu telah melancarkan serangan regular di Libya sejak beberapa bulan terakhir ini dalam usaha menjalankan misi penghentian pembunuhan atas warga sipil tak berdosa oleh pasukan Khadafi. Safia menceritakan ketika empat rudal NATO menghantam kediamannya di Tripoli sesaat setelah salat Maghrib, 1 Mei lalu. Beruntung, kala itu Safia dan Khadafi tidak ada di tempat, namun putra bungsunya, Saif al-Arab, 29, dan ketiga cucunya tewas. “Saya tidak di sana, tapi saya berharap ada di sana, saya lebih baik mati bersama anak saya (Saif al-Arab),” ujar Safia. Safia adalah istri kedua dan ibu dari enam anak Khadafi yang seluruhnya berjumlah delapan orang. Tiga orang putranya tewas dalam serangan NATO. Dua di antaranya, Khamis dan Saif al-Islam, diduga adalah komandan tempur pasukan penyerang Khadafi. Safia membantah hal ini, dia mengatakan anak-anaknya adalah warga sipil tidak berdosa. “Anak-anak saya adalah warga sipil, dan mereka juga diserang. Memangnya apa salah mereka?” ujar Safia. (m10)


Sumut - Aceh

WASPADA Minggu 29 Mei 2011

AY Nasution Resmikan Pesantren Ar-Raudhatul Hasanah Di Lumut

WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini dan Artikel: Dedi Sahputra. Redaktur Edisi Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Kota Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Kalitbang: H. Akmal AZ. Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); H.T. Donny Paridi (Aceh); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga, Syahrial Siregar, Khairil Umri Batubara. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Asahan: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

A3

Waspada/Ist

ASISTEN Teritorial TNI Mayjen AY Nasution ketika melakukan peletakan batu pertama Pesantren Ar-Raudhatul Hasanah di Lumut, Tapanuli Tengah disaksikan masyarakat, Jumat (27/5).

Lakalantas Di Aceh Timur

IRT, Santri Dayah Meninggal, 2 Kritis ACEH TIMUR (Waspada): Kecelakaan kembali terjadi di dua titikdalamKab.AcehTimur,Sabtu (28/5). Seorang Ibu Rumah Tangga (IRT) dan santri dayah meninggal dunia di titik Simpang Paya Demam , Kec. Pantee Bidari, meninggal dunia sekira pukul 11:00. Sementara dua lainnya kritis dalam sebuah kecelakaan di BagokPanahSa,Kec.DarulAman sekira pukul 07:15. Kedua jenazah kini telah dikembalikan kepada keluarganya, sementara korban kritis sesaat setelah kejadian dilarikan ke RSUD Idi. Korban meninggal,Yusmiati,30,wargaDusun Lamkuta, Desa Groeng-Groeng, Kec. Pantee Bidari, Tgk. Saiful, warga Tanjong Meunjei, Kec. Madat. Korban kritis yakni, M. Jafar, 31, warga Lhoknibong dan Syarman, warga Simpang Ulim. Menurut informasi yang diperoleh Waspadakemarinmenyebutkan, lakalantas di titik lintasan jalan negara Medan – Banda Aceh, persisnya di Desa Bagok Panah Sa, Kec. Darul Aman, berawal ketika dua unit sepedamotor GL Pro masing-masing BL 6697 KU yang dikendarai M. Jafar melakui dengankecepatantinggibersamasama dengan Syarman yang mengendarai Honda GL Pro juga dengan BL 3016 DZ. Sesampai dititik kecelakaan keduanya yang melaju dari arah Simpang Ulim (barat) ke Kota Idi (timur) terjatuh, akibat terhimpitan keranjang ikan yang masih kosong itu. “Sepertinya keranjang ikan tersenggol dan terjatuh di tengah badan jalan,” kata warga setempat.Saatkeduanyaterjatuh, tiba-tiba dari arah berlawanan muncul satu unit mobil pick-up L300 yang membawa tiga ekor kerbau hendak ke Bireun, Aceh Jeumpa.

“Spontan, karena saya sudah hilang kendali mencoba mengelak, tapi sudah bisa dikendalikan dan mobil sayapun jungkir balik di tengah jalan hingga terjungkal ke parit jalan,” ujar Kasimin, sopir L300 menjawab Waspada, Sabtu (28/5) di lokasi. Setelah dia bersama kerneknya berhasil keluar dari mobil, di bagian lengan diketahui sedikit mengeluarkan darah dan kedua mugee eungkot bersimbah darah dan langsung dibantu warga dan dilarikan ke RSUD Idi denganmenggunakanambulans Puskesmas Darul Aman. Sementara itu, kecelakaan di Simpang Paya Demam, Kec. Pantee Bidari, berawal ketika satu unit Honda jenis Mio BL 4201 LG yang dikendarai Yusmiati yang diduga melaju dengan kecepatan tinggi dari arah Julok menuju Panton Labu. Setiba di Simpang Paya Demam, kendaraan yang dikendaraiYusmiatihilangkendali dan melebar ke kanan. Spontan

Siap Santap Mi Instan, Sekeluarga Keracunan ACEH TIMUR (Waspada): Usai menyantap mi instan, satu keluarga di Desa Cot Asan, Kec. Nurussalam—Bagok, Kab. Aceh Timur,keracunandanharusmendapatpengananseriusdarimedis, Jumat (27/4) sekira pukul 18:00. Satudiantaranyaadalahbayiyang baru berusia 17 bulan. Korban Nurul Afni, 28, Lindawati,20danbayinyaRadikaPratama yang baru berusia 17 bulan. Ketiga korban masih tercatat, warga Desa Cot Asan, Nurussalam, Aceh Timur. Menurut pengakuan Lindawati sore itu setelah dirinya menyantap mi instan yang dibeli dari kios di sekitar rumahnya,diadankakaknyaterasa kelainan dan sempat muntah-

Bawa Ganja Caleg Demokrat Ditangkap PANTONLABU, Aceh Utara (Waspada):Seorangoknumkader demokrat yang juga berstatus calegDPRKAcehUtaraDP-6pada Pemilu Legislatif 2009 lalu, ditangkap aparat Polsek Tanah Jambo Aye, Aceh Utara, terkait kasus ganja. Tersangka berinisial SYT Bin TYB, 39, warga Keude Pantonlabu, Kec. Tanah Jambo Aye. SYT ditangkap di lorong PLN Desa Rawang Iteik, Kec. Tanah Jambo Aye, Kamis (26/5) sekitar pukul 12:30. Guna mempertanggungjawabkan perbuatannya, SYT terpaksa mendekam di sel tahanan MapolsekTanah Jambo Aye. Bersamanya juga turut diamankan

menghantam Honda Supra Fit yang dikendarai Tgk. Saiful, santri Dayah,yangmelajudengankecapatansedangdariarahber-lawanan. Sehingga hantaman keras pun terjadi dan kedua korban terjatuh dan terseret hingga beberapa meter di atas badan jalan. Menurutpengakuanwargasetempat yang sempat melihat keduanya sebelum dilarikan ke RSUD Idi dan RS Graha Bunda Idi, kondisi Yusmiati sudah tidak bernyawa, sementara Tgk. Saiful dalam kondisi sekarat, tetapi santri dayah tersebut beberapa saat setelah tiba di RS Graha Bunda dikabarkan ikut menghembuskan nafas terakhir. Kini kedua korban sudah dijemput pihak keluarganya. Kapolres Aceh Timur AKBP Drs RidwanUsman melalui Kasat Lantas Iptu Hangga Utama saat dikomfirmasi Waspada membenarkan. Dalam dua kejadian itu, dua di antara korban meninggal dunia dan dua lagi kritis. (cmad/ cmus)

barangbuktisatupaketkecilganja siap hisap, seharga Rp20 ribu. “Awalnya kita dapat info, tersangka baru saja membeli ganja dari seorang pengedar. Setelah kita tangkap dan geledah, ternyata di saku celana tersangka memang ada satu paket ganja seharga Rp20 ribu,” kata Kapolres Aceh Utara AKBP Farid BE melalui Kapolsek Tanah Jambo Aye, Iptu Mardan P, Sabtu (28/5) kemarin. Kapolsek menambahkan, pihaknya akan terus mendalami dan mengembangkan kasus tersebut, termasuk mengungkap identitas tersangka pengedar serta tersangka lain yang patut diduga sebagai bandar.(cmus)

muntah. Selain muntah-muntah, bayi Nurul Afni yang masih berumur 17 bulan juga mengalami keracunan. Diperkirakan, bayinya keracunan akibat ibunya setelah makan mi instan tersebut langsung menyesui. Padahal, kondisi Nurul Afni diperkirakan dalam kondisi keracunan. Melihat ada kelainan dan muntah-muntah, setelah mereka menyantap mi instan lalu keluarga itu langsung diboyong wargakePuskesmasNurussalam, untuk mendapatkan perawatan pertama. Selanjutnya ketiga korban dirujuk ke RS Graha Bunda Idi,gunapenangananmedis lebih lanjut. “Ya benar, ketiga pasien mengalami keracunan,” ujar tenaga medis. (cmad)

TAPSEL (Waspada): Setelah melalui persiapan yang cukup lama dan matang, akhirnya perencanaan pembangunan Pesantren Ar-Raudhatul Hasanah, Kec. Lumut, Tapanuli Tengah diresmikan AsistenTeritorialTNI Mayjen AY Nasution di tandai dengan peletakan batu pertama, Jumat (27/5). Hadir pada kesempatan itu unsur Muspida Plus, pejabat TNI, kepolisian Kota Sibolga dan Kab. Tapanuli Tengah, tokoh agama dan masyarakat, pimpinanpondokpesantrendanmasyarakatsekitar. Mayjen AY Nasution dalam sambutannya menyatakan keyakinan yang kuat bahwa dengan niat, semangat dan keikhlasan para pewakif, sesuatu yangdimulaidenganbaikdapatdiselesaikandengan baik. Harus diingat bahwa tidak ada pekerjaan besar yang dapat diselesaikan secara individual. Ia mengajak semua pihak untuk dapat berpartisipasi penuh. “Saya sangat yakin, rencana besar ini dapat terwujud dimulai dari angan-angan dan cita-cita yang baik dan tidak lupa supaya memohon ridho dan inayah dari Allah SWT. Jangan pesimis dan harus yakin dan serahkan semua kepada Allah, pasti ada jalan keluar. Saya siap mengunjungi pesantren bila nanti telah terwujud kapanpun dan menyambutdenganbaiksertaakanberusahasekuat tenaga merealisasikan usulan MoU perekrutan siswa militer melalui pesantren,” ungkapnya. Mayjen AY. Nasution juga menyampaikan bantuannyauntukpesantrenberupa150zaksemen, 15 kubik batu dan 15 kubik pasir yang diserahkan secara simbolis agar pembangunan dapat segera dimulai pasca acara ini. Direktur Pesantren Ar-Raudhatul Hasanah Drs Rasyidin Bina mengucapkan terimakasih kepadapihakpewakifyangtelahmempercayakanwakafnya kepada pihak pesantren, begitu juga kepada seluruh masyarakat yang telah mendukung sepenuhnya atas terlaksananya acara. Drs. H. Abdul Amman Nasution mewakili seluruh anggota keluarga pewakif dalam sambutannya mengaku, awalnya menerima beberapa ide perihal pengelolaan harta yang akan diwakafkan pada saat menghadiri pertemuan Ikatan Keluarga Pondok Modern Sumut beberapa bulan yang lalu. SaatituDrs.H.RasyidinBina,MAselakuDirektur Pesantren Ar-Raudhatul Hasanah turut hadir dalam acara tersebut. Ide-ide tersebut antara lain mengajukan kerjasama dengan PB Al-Washliyah, IKPM Sumut dan terakhir adalah Pesantren Ar-Raudhatul

Hasanah. “Akhirnya, setelah melalui pertimbangan yang matang dan memohon petunjuk kepada Allah SWT, kami memutuskan menjalin kerjasama dengan Pesantren Ar-Raudhatul Hasanah sebagai pesantren yang juga menggunakan sistem Gontor.Tanah yang diwakafkan merupakan warisan dari ayah kami Alm H Abdul Hamid Nasution. Seluruh ahli waris sepakat untuk mewakafkan tanah seluas 1,5 ha ini untuk pendidikan,” jelas Abdul Amman Nasution. SetelahmelaluipembahasanpadatingkatBadan Wakaf Pesantren dan Kepala Bidang, terangnya lagi, akhirnya Ar-Raudhatul Hasanah menerima amanah besar ini. Jangka panjang dari pemberdayaan lahan wakaf ini adalah guna memenuhi kebutuhan masyarakat lokal khususnya dan luas pada umumnya akan sebuah lembaga pendidikan yang berasaskan agama guna mewujudkan khairu ummah, dan sebagai lahan pengabdian bagi para alumni Ar-Raudhatul Hasanah khususnya untuk mempersiapkan generasi ummat yang unggul. Prosespenandatangananikrarwakafiniberlangsung 18 Maret 2011 di Desa Lumut, Tapanuli Tengah. Menurut Amman Nasution, ada 3 alasan mengapa keluarga memilih Ar-Raudhatul Hasanah, pertama karena keikhlasan seluruh pewakif ArRaudhatul Hasanah Medan yang tidak mendapatkansedikitpundarihartawakafyangdikelola.Kedua, pengelolaan profesional yang telah teruji yang telah dijalankan oleh Ar-Raudhatul Hasanah. Ketiga, penyetaraan ijazah pesantren dengan sekolah menengah atas atau yang setara dengannya serta pengakuan beberapa Perguruan Tinggi Negeri luar negeri terhadap ijazah pesantren. Selainitu,iajugatelahmengajukanpermohonan kepada Mayjen AY Nasution untuk dapat membuat sebuah MoU dengan Mabes TNI agar dapat merekrut siswa baru militer minimal satu setiap tahunnya melalui Pesantren Ar-Raudhatul Hasanah. Camat Lumut mewakili BupatiTapanuliTengah menyampaikan apresiasi dan harapan yang besar kepada pihak pesantren untuk dapat memajukan pendidikan khususnya untuk daerah Tapanuli Tengah dan sekitarnya sebagai teladan bagi lembaga pendidikan Islam lainnya, seraya mengharapkan dukungan penuh dari masyarakat demi kemajuan lembaga pendidikan ini. Acara ditutup dengan doa oleh Kepala KUA Kecamatan Sibabangun. (a23)

Judi Merajalela Di Paluta MEDAN (Waspada): Wakil Ketua DPD Partai Golkar Paluta, M. Mursal Harahap, SH di Medan meminta agar Poldasu membebaskan Kabupaten Paluta dari perjudian jenis apapun. Dia juga menuntut agar Poldasu menempatkan aparat polisi yang pro terhadap pemberantasan judi di daerah Gunungtua dan Tapsel Dia menyatakan pejudian khususnya jenisToto Gelap (Togel) di wilayah hukum Polres Tapanuli Selatan dan Polsek Gunungtua semakin meraja lela. Sebab para BandarTogel yang kakapnya belum pernah terjamah aparat kepolisian. Kalaupun ada beberapa orang juru tulis (Jurtul) yang ditangkap. Akibatnya kini judi togel semakin menjadi jadi di Paluta. Keluhan seperti itu sudah sering disampaikan para tokoh masyarakat kepada aparat kepolisian dan instansi lainnya. ‘’Para Bandar judi di Paluta sudah tak bisa dikira jumlahnya bagaikan jamur tumbuh di musin hujan. Ini terjadi akibat tidak ada ketegasan dalam penanganannya,’’ ujar Mursal Harahhap.

Menurutnya di kedai kopi bahkan di berbagai tempat kini bahasan masyarakat nomor yang akan keluar. Tidak sedikit ibu rumah tangga pusing memikirkan suami atau anak mereka yang keranjingan beli kupon berhadiah. Mursal Harahap, SH yang juga Ketua Aliansi Pemuda Peduli Pembangunan Sumut, menduga terus berkembangnya pejudian di tengah masyarakat Paluta akibat adanya pembiaran. “Kalaupun aparattetaptenangseolahtidakadakejadia,’’katanya. Praktek penjualan judi Togel dan KIM ini tidak rahasia lagi bagi masyarakat khususnya di Padang Lawas Utara. Bahkan dikalangan anak di bawah umur saja sudah mengetahui judi Togel ini. Untuk itu Mursal Harahap mengharapkan kepada Poldasu untuk mengambil langkah-langkah bijaksana. ‘’Jangan sampai nanti masyarakat yang anti judi melakukan aksi lain. Kita ingin negara ini aman,tapikitajugatidakinginsekelompokkelompok bandar judi dibiarkan merajalela meresahkan,’’ katanya.(m07)

Kumpulkan Rekap Kim Ditangkap P. SIANTAR (Waspada): Pria pengangguran, LS, 30, warga Nagori Pematang Bandar, Kec. Pematang Bandar, Kab. Simalungun pengumpul rekap judi toto gelap (togel) jenis Kim ditangkap Polres Simalungun. Keterangan dihimpun dan informasi dari Sat Reskrim Polres Simalungun, Sabtu (28/5) menyebutkan, LS ditangkap ketika sedang mengumpulkan rekap angka-angka tebakan judi togel malam jenis Kim di jalan umum, Nagori Bandar Manis, Kec. Pematang Bandar, Jumat (27/5) pukul 22:00. Penangkapan terhadap LS dilakukan saat pihak

Sat Reskrim bersama Polsek setempat melakukan Operasi Pekat dan mendapat informasi dari masyarakat yang menyebutkan LS akan melakukan pengumpulan rekap angka-angka tebakan judi togel malam jenis kim dari para penulisnya. Kapolres Simalungun AKBP M. Agus Fajar H saat dikonfirmasi melalui Kasubbag Humas AKP Sulaiman Simanjuntak dan Kasat Reskrim AKP Nasrun Pasaribu, SIK menyebutkan LS diduga melakukan tindak pidana perjudian togel malam jenis Kim dan melanggar Pasal 303 KUH Pidana. (a30)

Drs Ahmad Syam MA

Perlunya Strategi Komunikasi KOMUNIKASI memerlukan strategi khusus agar apa yang ingin disampaikan kepada orang lain dapat tersampaikan dengan tepat dan benar. Utamanya, yang harus dilakukan oleh pemerintah kabupaten kota kepada masyarakatnya agar visinya dapat terwujud. Demikian antara lain dikatakan Kepala Bidang Pencegahan dan Kesiapsiagaan di Badan Penanggulangan Bencana, Kab. Sergai Drs Ahmad Syam MA yang baru saja di wisuda Program PascaSarjanaIAINProgramStudy Komunikasi, Selasa lalu bersama puluhan pasca sarjana IANSU. Ditemui usai mengikuti prosesi wisuda, lelaki yang lahir 1 Maret 1969 ini menyebutkan, apa yang ia raih saat ini tidak terlepasdariusahadankemauannya yang kuat untuk terus menimba ilmu dan bisa menjadi sangat bermanfaat bagi orang lain, utamanyabagikemajuanwilayahSergai. Karenanya, tesis yang dia lahirkan untuk melengkapi program S2 ini berbicara tentang startegi komunikasi Pemkan Serdangbedagaiuntukmewujudkan visi kepada masyarakat. Disebutkannya, Kab. Serdang Bedagai dengan Motto Tanah Bertuah Negeri Beradat adalahPemekarandariKabupaten Deliserdang berdasarkan Undang-UndangRepublikIndonesia Nomor 36Tahun 2003. Pada awal Pemekaran,wilayahKab.Serdang Bedagai terdiri dari 11 kecamatan

danpadatahun2006berdasarkan Peraturan Daerah No. 10 Tahun 2006 dimekarkan menjadi 17 Kecamatan. Wilayah Kabupaten Serdang Bedagai terdiri dari 17 kecamatan, 237desa,dan6kelurahan.Wilayah kabupaten ini merupakan bekas wilayah dua Kesultanan Melayu: Kesultanan Serdang dan Kesultanan Bedagai. Masyarakatnya pluralis antara lain, terdiri dari etnis Melayu, Jawa, Batak, Aceh, Nias, dan keenam agama resmi di Indonesia telah ada penganutnya di Kab. Serdang Bedagai yaitu: Islam, Kristen Protestan, Kristen Katolik, Budha, Hindu dan Kong Hu Chu. Ditembahkannya, Kab. Serdang Bedagai yang baru berusia 7 tahun pada tahun 2011 telah banyak meraih prestasi baik tingkat nasional maupun tingkat provinsi. Kabupaten ini dipimpin Bupati HT Erry Nuradi danWakil Bupati H Soekirman. Dalampandangannya,kedua pemimpin ini yaitu mampu menjaga kebersamaan dan kepercayaanmasyarakat,dimana pada Pilkada tahun 2010 keduanyatetapsatupaketuntukmelanjutkankepemimpinanmasabakti 2010-2015. Kebersamaan tetap satu paket dari periode pertama ke periode kedua merupakan satu-satunya di Indonesia. Pada daerah lain, lazimnya terjadi kebersamaan kepala daerah dan wakil kepala daerah terbatas pasa satu kali periode saja sedangkan pada periode berikutnya muncul dengan pasangan yang berbeda. Visi kepemimpinanDwiTunggaliniadalah menjadikanKab.SerdangBedagai sebagai salah satu Kabupaten

Waspada/Ist

KEPALA Bidang Pencegahan dan Kesiapsiagaan di Badan Penanggulangan Bencana Kabupaten Sergai Ahmad Syam, MA berpose dengan istrinya Asma Laila, SAg usai diwisuda. terbaik di Indonesia dengan masyarakat yang pancasilais, religius, modern dan kompetitif (visi periode 2005-2010), sedangkan pada periode 2010 - 2015 visi yang ditetapkan adalah menjadikan Kabupaten Sergai sebagai kabupaten terbaik di Indonesia dengan masyarakat yang pancasilais, religius, modern, kompetitif dan berwawasan lingkungan. “ Dalam pandangan saya strategi komunikasi pemerintah Kabupaten Serdangbedagai untuk mewujudkan visi kepada masyarakat yang sudah terlihat yakni, menerapkan good government, pembinaan sumber daya manusia yang berkualitas, membangun ekonomi daerah termasuk pengentasan kemiskinan, membangun sarana dan prasarana daerah dan membina masyarakat yang harmonis dengan rasa keadilan, kesetaraan,

rasa persatuan. Strategi komunikasi tersebut direalisasikan dalam dua bentuk yaitu: bentuk komunikasi formal dan non formal. Sementara pembangunan di bidang keagamaan, termasuk prioritas dalam salah satu Visi pemerintahKab.SerdangBedagai baik di kalangan PNS maupun masyarakat. Pembangunan tersebut direalisasikan dalam bentuk kuliah agama bagi PNS, peringatan hari besar keagamaan dan penetapan Pos Anggaran bantuan sosial keagamaan pada anggaran pengeluaran (APBD) setiap tahunnya serta dalam bentuk kegiatan lain di masyarakat yang bernuansa keagamaan,”kata suami Asma Laila, SAg dan sudah mendapatkan penghargaan sebagai PNS terbaik dalam rangka Hari Jadi ke-7 Sergai. Anum Saskia


Rileks

A4 Banyolan Beli Satu Dapat Dua Bedul jalan-jalan ke pasar. Ketika sampai pada seorang pedagang, dia melihat orang berkerubung menyaksikan pedagang yang tengah mempromosikan barang dagangannya. “Beli satu dapat dua, beli satu dapat dua,” teriak pedagang. Bedul penasaran. Akhirnya dia mendekat pada pedagang lalu bertanya. “Apa sih barangnya bang.” Sepatu, sambil menunjuk sepasang sepatu.”

Roket Buatan Ilham Beberapa negara maju tampaknya sudah mulai berani investasi di Indonesia. Mulailah wakil wakil negara itu mengirim Teknokrat dan Perdana Menterinya. Sampailah mereka pada pembahasan perusahaan-perusahaan milik negara (BUMN), yang seharusnya amat menguntungkan itu. Ketika pembahasan sampai kepada industri pesawat terbang (IPTN), tampillah sodara Ilham Habibie untuk presentasi. Ilham : “Suatu kehormatan bagi kami bisa presentasi di hadapan bapak23 Mahattir (Malaysia) : “To the Point aja, apa yg sodara banggakan dari IPTN?” Ilham :” Oke, ternyata kami tidak lagi memproduksi pesawatYang mulia,kami telah memproduksi roket “ (sambil dengan bangga memperlihatkan prototype yang masih anget). Tony Blair (Inggris) : “Trus, apa keunggulan roket IPTN ini ?” Ilham : “Kalo Amerika cuma bisa mendaratkan manusia pertama dibulan, maka Roket kami akan bisa mengantarkan manusia ke matahari” Hadirin : “ Wow……! Tony Blair : “Eh, eh… sebentar mas…,itu apakah Roket anda nggak kebakar, kalo mendarat di matahari. Khan disana panasss…” Ilham : “Lho, jangan khawatir pak, saya dan

Wajahmu memang MANGGIS, watakmu juga MELONkolis, tapi hatiku NANAS karena cemburu hingga SIRSAK nafasku, hatiku ANGGUR lebur. Ini memang sebuah DELIMA dalam hidupku, memang SALAKku, jarang APEL malam minggu. Ya Tuhan, mohon BELIMBINGANmu, kalau memang per-PISANG-an ini baik untukku, SEMANGKA kau bisa bahagia dengan yang lain TTD: SAWOnara.

team sudah dengan cermat memperthitungkan, sehingga Roket kita akan sampai Matahari pada malam hari….

Guru Pelit Nilai Paman Bedul mendatangi guru matematika sekolah dasar tempat anaknya menimba ilmu. Kepada guru itu, dia bertanya soal hasil ujian anaknya karena sudah diulang tiga kali tetapi belum juga lulus. “Bagaimana mau bisa lulus Pak, anak Bapak itu berat sekali,” ujar Pak Guru. Karena penasaran Paman Bedul meminta buktinya. “Coba lihat ini... 7 x 5 = 34,” kata guru. “Ya, ampun, Pak Guru,” kata Paman Bedul, “masa begitu saja harus gagal sih. Itu kan cuma kurang satu.”

6

Surat tersebut dapat balasan dari pacarnya yang ternyata seorang tukang sayur. Membalas KENTANG suratmu itu, BROKOLI sudah kubilang, jangan setiap aku datang rambutmu selalu KUCAI, JAGUNGmu gak pernah dicukur. Disuruh datang malam minggu, eh nongolnya LABU. Di tambah lagi kondisi keuanganmu makin hari makin PARE, kalau mau menelpon saja mesti ke WORTEL dulu...CABE deh.

TTS BERHADIAH

07.30 Behind The Scene : Batas 07.00 Survived A Japanese Game Show 08:00 Dora Emon 08.30 DAHSYAT 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 PR : Kristen 13.00 Kriwil 15.00 Seputar Indonesia 15.30 Silet 16.30 Master Chef Indonesia 18:30 Putri Yang Ditukar 20.15 Mega Sinetron Anugerah 22.30 Box Office Movie

Tukang Bohong Tono yang baru pertama kali akan pergi ke Jakarta diberi pesan oleh Bimo, teman sekampungnya yang telah bertahun-tahun tinggal di Jakarta. “Hati-hati di Jakarta, karena orang Jakarta banyak bohongnya, tukang tipu,” kata Bimo. Ketika hendak turun dari bis kota di Terminal Pulo Gadung menuju rumah kontrakan Bimo, sang kondektur bis berteriak memberi tahu, “Awas kaki kiri duluan, kaki kiri duluan.....!” Ingat akan pesan Bimo, Tono langsung berpikir, “Ah...pasti kondektur ini bohong.” Dan Tono pun melompat dari bus yang masih berjalan dengan kaki kanan lebih dahulu.Tentusajadiajatuhdanbabakbelur.Begitu berdiri, Tonton menyumpah-nyumpah. “Memang orang Jakarta tukang bohong. Dengan kaki kanan saja babak belur, apalagi dengan kaki kiri!”

A B

5

4

07:00 Bimbingan Rohani 07.30 Tom & Jerry 09.00 Upin & Ipin 10.00 Grebek Nusantara 11.00 JEndela Wisata 11:30 Sidik Kasus 12:00 Layar Kemilau 13.30 Cerita Siang 15:00 Indahnya Sore 16:00 Lintas Petang 16.30 Aksi Juara 18.00 Animasi Spesial 19.00 Chelsea vs Newcastle United 21.30 BPL 23.57 Kuis BPL

Nama: ..................................................

07:00 Inbox 09:00 Hot Shot 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14.30 Status Selebriti 15.30 Hip Hip Hura 17:00 Liputan 6 Petang 17:30 Islam KTP 21.00 Pesantren & Rock n Roll 22:30 Liputan 6 Terkini 22.33 Musik Spesial ; Harmoni

07.00 Morning Shock 08.00 Captain Tsubasa 08.30 Foody With Rudy 09.00 Mom Dad And I 10.30 Smart Mommy 11.30 Topik Siang 12.00 Klik! 13.00 Mantap 14.00 Kilau Emas 15.00 Djarum Super Indonesia 17.00 Topik Petang 18.35 Djarum Indonesia Super League 21.00 Penghuni Terakhir 22.00 Sinema Spesial 00.00 Topik Malam

Alamat: ................................................

S U DO K U P L US

7

Minggu 29 Mei 2011

Surat Patah Hati Penjual Rujak

Gunakan angka 0 sampai 9 ditambah dua abjad -- A dan B -- untuk mengisi kotak-kotak kosong. Tidak boleh ada pengulangan angka dan huruf pada lajur mendatar dan menurun, serta di dalam kotak 4x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Gunakan pensil dan penghapus pada awal pencarian angka pengisi kotak, sebelum menuliskan angka yang benar dengan pulpen. Tingkat kesulitan: sedang (***). Tersedia hadiah Rp. 50.000,- untuk seorang pemenang. Antar kupon yang sudah terisi angka yang anda yakini benar ke kantor Waspada Jalan Brigjen Katamso 1 Medan paling lambat Jumat. Peserta dari luar kota bisa mengirimnya melalui faksimile ke (061) 4510025. Jawaban dan pemenangnya dimuat pada edisi Minggu depan (29/5). ------------------------------------------- potong di sini ----------------------------------------------

5 1 A 4 A

WASPADA

9 6 2 A 7

2 9 3 5 4 6 9 0 0 1 2 7 6 5 B 7 7 5 1 2 7 4 6 A 0 B 5 8 4 3 2 1 5 6 1 8 6 4 B 3 4 9 A B 7 6 5 1

No. KTP/SIM/Kartu Pelajar: ..............................

gunting di sini TTS Berhadiah Jawab dan gunting TTS Berhadiah di atas kemudian kirimkan ke PT Harian Waspada Jalan Brigjen Katamso No.1 Medan/Jalan Letjend Suprapto No.1 Medan. Tulis nama dan alamat lengkap serta nomor pengenal. Jawaban paling lambat diterima Jumat 3 Juni 2011, pukul 16:00. Bagi pengirim yang dapat menjawab semua pertanyaan dengan tepat dan benar akan diberi hadiah berupa uang tunai sebesar Rp50.000,-untuk satu orang pemenang. Semua jawaban yang benar akan diundi. Pengumuman pemenang akan diumumkan pada Minggu 5 Juni 2011 beserta jawaban yang benar di halaman yang sama. Hadiah dapat diambil di kantor Harian Waspada bagian Sekretaris Redaksi (jam kerja), setelah tiga hari pengumuman pemenang diterbitkan. MENDATAR 1. Orang tua suami atau istri 4. Menggugurkan kandungan 6. Surat kecil berisi keterangan pengambilan barang,peminjaman uang, dsb 7. Tidak masuk akal,mustahil 10. Galak,liar,ganas 12. Cemburu 14. National Academy 15. Kulit ikan/ular 18. Daftar bea masuk, aturan pungutan 19. Pesan, perintah 20. Kepala fakultas 21. Panganan kering yang terbuat dari tepung kanji/ketan yang dicampur kelapa dan gula 24. Uap yang dapat terlihat yang dihasilkan dari pembakaran 26. Adik laki-laki ayah atau ibu 29. Bertebaran di mana-mana 30. Judul, kepala surat 32. Cermin 34. Nenek 35. Baru, diperbaharui 37. Manusia pertama 38. Ingin 39. Sedih (Inggris) 40. Duduk (Inggris) 41. Mahkamah Agung 42. Sesuatu yang menyusahkan yang ditanggung dalam hati

Pemenang Sudoku Berhadia Minggu Lalu

Pemenang TTS Berhadia Minggu Lalu

Muhammad Ihsan,Jl Mangaan VI Lk 15,G. Prayitno No. 45 Mabar, Medan

Alfiansyah, SMA Alfalah

JAWABAN SUDOKUMINGGU LALU

m14

Nama

:

.......................................................

Alamat

:

....................................................... ....................................................... Kode Pos . . . . . . . . .

No. KTP/SIM : . . . . . . . . . . . . . . . . . --------------------------------------------- potong di sini --------------------------------------------

MENURUN 1. Belut 2. Mawar 3. Pelayan, hamba 4. Tidak suka/senang 5. Taubat, berjanji tidak akan mengulangi kesalahan 8. Penjara 9. Dicoba, dites 10. Tindakan pengendalian diri (Hindu) 11. Hasrat dan keinginan, semangat untuk melakukan sesuatu 13. Gembira 15. Enak atau lezat 16. Kulit padi 17. Lawan kiri 18. Kemasan atau wadah biasanya bertali dipakai untuk menaruh, menyimpan atau membawa sesuatu 22. Jaminan atau tanggungan 23. Kapten kapal 25. Bau-bauan yang harum 27. Kekal 28. Rasa cuka 30. Tanda baca 31. Pendidikan Anak Usia Dini 32. Tempat menyimpan uang 33. Bahan pewarna 36. Makan (Inggris)

6 5 4 8 3 2 B A 7 9 1 0

8 A 2 4 7 9 1 0 0 B 3 7 B 5 4 3 A 0 7 1 1 6 9 8 2 4 8 9 6 3 5 B 9 1 0 2 4 2 A 5 5 6 B 8 3 7 8 A

3 8 A 6 9 7 0 4 5 B 2 1

5 2 9 0

1 0 9 7 B B 4 A 3 6

6 8 1 2 2 1 7 A B 5 2 8 6 4 A 5 B 0 A 3 7 6 5 1 7 9 2 8 6 8 3 4 B 7 0 6 3 1 3 4 A 0 9 8 9 B 5 4

5 9 4 3 1 0 A 8 7 2

JAWABAN TTS MINGGU LALU

07.30 Metal Fight 08.00 Pokemon 08.30 Ben 10 Alien Force 09.00 Power Rangers Jungle Fury 09.30 Dragon Ball 10.00 Arti Sahabat 12.00 FTV Siang 14.00 KiSS Minggu 15.00 Liga Premier Indonesia 17.00 Cintaku Melati 18.00 Dia Anakku 19.00 Nada CInta 20.00 Antara Cinta Dan Dusta 21.00 Cahaya CInta 22.00 Sinema Sinema 01.00 Fokus Malam

06.30 Apa Kabar Indonesia 08.30 The Riders 09.00 Property Agung Podomoro Group 10.30 Soccer One 12.00 Kabar Siang 13.00 Damai Indonesiaku 15.00 Power Cross 16.00 Dokumentary 17.00 Kabar Petang 19.00 Bukan Jalan Jalan Biasa 20.00 Apa Kabar Indonesia Malam 20.50 Nostalgia 21.50 Liga Spanyol (live) Real Madrid vs Barcelona

07.05 Dunia Kita 08.30 Agung Sedayu 09.30 Agung Sedayu 10.05 Showbizz 11.05 Oprah Winfrey 13.30 e Lifestyle 14.05 Rachael Ray Show 15.30 Kick Andy 16.05 Kick Andy 17.05 Metro Hari Ini 18.30 Metro This Week 19.05 Mario Teguh 20.05 Just Alvin! 21.05 Democrazy 22.05 Zona Memori 23.05 Journalist on Duty 23.30 Metro Sports

07.00 Menjamu Tamu 08.00 Jelajah 08.30 Celebrity On Vacation 09.00 Ceriwis 10.15 Ala Chef 11.00 Insert 12.00 Griya Unik 12.30 Ngulik 13.00 Online Weekend 14.00 Bosan Jadi Pegawai 15.00 Tarkam 16.30 Investigasi Selebriti 17.00 Reportase Minggu 18.40 Termehek Mehek 19:30 Super X – Tion 21.30 Bioskop TRANS TV 23.30 Bioskop TRANS TV 01.03 Sinema Dinihari

TRANS 7 07.30 U2 08.00 Tabir Sunnah 09.30 Masked Rider 10.30 Jalan Jalan Selebriti 11.00 Asli Enak 11.30 Redaksi Siang 12.00 Selebrita 13.30 Galeri Sepakbola 14.00 One Stop Football 15.00 Mancing Mania 16.30 Redaksi Sore 17.00 Paradiso 18.30 Wara Wiri 19.00 Gara gara Magic 21.00 Pas Mantab 22.00Mister Tukul 23.00 Kualifikasi MotoGP

08.00 Avatar 09.30 Mong 10.00 Airbud 12.00 Awas Ada Sule 13.00 Gadis PEtualang 13.30 Teenlicious 14.00 Saat Teduh 14.30 LOL 15.30 Fokus Selebritis 16.30 BErita Global 17.00 Spongebob 18.30 Jelang Balap 19:00 F1 Racing 21.00 LOL 21.30 Barclays Premier League 22.30 Big Movies **m31/G


Medan Metropolitan

WASPADA Minggu 29 Mei 2011

RSh Masih Terkendala Di Birokrasi Perizinan MEDAN (Waspada) : Pembangunan rumah sederhana sehat (RSh) masih terkendala didalam birokrasi perizinan, sertifikasi tanah, pengurusan pembayaran berupa BPHTB dan lainnya. “Kendala yang masih kental didalam pembangunan rumah sederhana sehat di daerah adalah birokrasi perizinan. Hal ini harus segera dituntaskan melalui pendekatan pengurus Real EstateIndonesia(REI)didae-rah,” ujar Ketua Umum DPP REI, Setyo Maharso kepada war-tawan, Jumat (27/5). Untuk itu, lanjutnya, dukungan dan dorongan secara moral terhadap pelaksanaan program REI Sumut dengan melakukan pendekatan terhadap pemerintah daerah adalah terpenting untuk menyukseskan program pembangunan RSh tersebut. “Halinitentunyaakansa-ngat membantu didalam pe-nguatan perekonomian masya-rakat di daerah khususnya Su-matera Utara,” ujarnya ketika melakukan silaturahmi dan per-temuan denganparapengurusREISumut di Medan. Hadir dalam pertemuan itu Ketua DPD REI Sumut Tomi Wistan, Humas Meryawati, Ketua Kelompok Kerja (Pokja) A, Viktor Marbun, Pokja B, Hendratno, Pokja C, NonaWahyuni SE, Ketua DPD Asosiasi Penge-lola Pusat Belanja Indonesia (APPBI) Sumut Ir Paulus Tamie MM, praktisihukumdariChowandAssociates, serta sejumlah pengurus

1 CM 2 CM

Rp. 12.000 Rp. 24.000

BURSA

TUKANG LAS DICARI

Yg berpengalaman, lokasi sekitar Jl. Aksara Yg berminat hub. 0852.7522.9990

MENCARI GURU

Tk, SD, MTs dan Tata usaha, Yayasan Pendd. Darul Hikmah

Telp. (061) 836.5626 HP. 0813.9796.0600

DICARI SUPIR PRIBADI

Syarat: Muslim, Photo copy SIM, KTP, K. Keluarga, Ijazah pasphoto 3x4 warna, Usia 25 - 40 thn Hub. BP. Haji A. Siregar Jl. Turi No. 89 Medan, 300m dari simpang UISU SM. Raja HP. 0852.9666.1418 - 0878.6711.5899

BURSA

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Feroza ‘94 Dijual. Warna biru, AC, VR, BR, DVD, Sound System, Ban Baru. Harga 45Jt (nego) Hub. 0813.6143.0619 DAIHATSU TAFT GTS 1986

AC, Velg Pantex, Ban Besar, Ada Sirine, Warna hitam, 45Jt/Nego. Hub. 061-6963 2468, 0853 6132 4294

DAIHATSU Espass Roling Door ‘97, W.Biru Met, AC double, VR, BR, BK 1 tahun lagi, Sangat mulus Hub. 0852.7786.8029

DAIHATSU TAFT ROCKY 1997

Lengkap, AC, VR, Disc Kenwood Hub. ACUAN JL. KIRANA 17 Cas kredit, Bisa tukar tambah 0811.635.101 0821.6035.8777 (Terawat)

Pimpinan Kardopa Gugat KPID Sumut MEDAN (Waspada): Pimpinan Radio Kardopa akan menggugat Ketua Komisi Penyiaran Indonesia Daerah (KPID) Sumut yang telah melakukan pencemaran nama baik dengan menyampaikan informasi bohong kepada public tentang radio Kardopa yang disebut tidak memiliki izin frekuensi. “Perbuatan Ketua KPID Sumutdenganmenyerbarkankebohongan publik jelas sangat merugikan dirinya sebagai pengusaha radio,”kataThioridaSimanjuntak, kepada wartawan, Jumat (27/5). Dijelaskannya, laporan tindak pidana penyiaran dan telekomunikasi yang bohong dan disampaikan kepada kepolisian membuat operasional radio Kardopaberhentisejenak,mengingat duaunitalatsiarmilikradioKardopa telah disita pihak kepolisian.. “Saya akan menggugat KPID Sumut. Bila perlu KPID Sumut harus dibubarkan karena sudah melakukan kezoliman

dan kebodohan yang melanggar peraturan dan menggangu kenyamanan masyarakat,” katanya. Lebih lanjut, tuduhan KPID Sumut yang menyatakan izin siar dari radio Kardopa tidak resmi dibantahnya dengan menunjukkan bukti-bukti lengkap izin resmi yang telah ditandatangani oleh Direktur Usaha Penyiaran Kementrian Komunikasi dan Informatika RI Bambang Subijantoro tertangal 12 Oktober 2010 lalu. “Semua bukti resmi yang ditandatangani Kominfo Pusat telah saya miliki, makanya saya heran, kenapa pula KPID yang mengurusi ijin, KPID sendiri kan bagian program bukan masalah periijinan siar,” jelasnya. Dalam surat yang ditunjukkannya tersebut, Direktur Usaha Penyiaran Kementrian Komunikasi dan Informatika RI Bambang Subijantoro menyetujui PT Radio Kardopa mengguna-

Departemen Ilmu Kedokteran Jiwa Gelar Seminar MEDAN (Waspada) : Departemen Ilmu Kedokteran Jiwa FK USU menggelar seminar untuk para guru dengan tema, solusitepatmeningkatkankualitas pengajar di Gedung Binagraha, Jl. Diponegoro, baru-baru ini. Acara dihadiri 380 orang guru SD, SMP, SMA, SMKK dan pengajar akademi baik negri maupun swasta yang tersebar di Kota Medan. Kegiatan dibuka

3 CM Rp. 36.000 4 CM Rp. 48.000

LOWONGAN

AC BR CL ND DB

REI lainnya. Penguatan itu diberikan Setyo setelah mendengarkan beberapa pemaparan dan problem dari setiap Ketua Pokja di tubuh REI Sumut. Kata owner PT Cakra Sarana Persada ini, semua cabang REI di berbagai daerah har us memiliki program organisasi bisa diimplementasikan ke masyarakat. Sebab, katanya, REI itu harus bisa dirasakan manfaatnya oleh masyarakat. Kata dia, jika ada problem dialami para pengembang tergabung dalam REI mengalami kerumitan ketika berhadapan dengan birokrasi perizinan, sertifikasi tanah, pengurusan pembayaran berupa BPHTB dan lainnya, maka REI secara keseluruhan harus bisa mengatasinya secara bersama. Kata dia, koordinasi dengan pemerintah setempat juga sangat diperlukan agar komunikasi dua arah soal pembangunan rumah bisa diimplementasikan dengan baik. (m38)

5 CM 6 CM

Dekan FK USU, Prof. dr. Gontar A Siregar, SpPD-KGEH. Menurut panitia penyelenggara dr. Silvy Agustina Hasibuan, SpKJ kepada wartawan, kegiatan ini bagian dari program peringatan Hari Pendidikan Nasional dengan mengusung semangatKebangkitanNasional,dalam rangkaian acara HUT ke-59 FK USU, kegiatan digelar dengan sistem gratis tetapi setiap peserta

HYUNDAI Accent Verna Over Kredit Th. 2004. Wrn silver met, Balik DP 50Jt. Sisa 2.715.000 x 10 bln. Ass. Allrisk Hrg. Kontan 75Jt. Hub. 0812 64777088

ISUZU Panther Grand Deluxe 95. merah metalik. P. Steering, P. Window, Alarm, jok, ban, BK, Tape, siap pakai. Mulus luar dalam. Harga 62,5Jt Nego. Hub. 0812 656 8818 / 7730 5875

TOYOTA Starlet 93-94 Dijual. AC, Tape, VR. Hub. 0812 6433 5222 TOYOTA Kijang Grand Extra ‘93, biru metalik, AC DB, PS, PW, Tape, VR, BR, CL, Remote, Alarm, mobil mulus, pajak panjang. Hub. 0813 9730 8787

7 CM 8 CM

Rp. 91.000 Rp. 104.000

BURSA

PROPERTY

Informasi Pembaca Bursa Property

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

LB LT RM RT

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH Dijual, Bertingkat mewah Uk. 14x28m², 7 Kmr tidur, 4 Kmr mandi Hub pemilik langsung HP. 0813.7627.2515 0811.635.642, Hrg nego

RUMAH DIJUAL MURAH DI DENAI

Jl. Jermal-3 No. 8 Ujung Lk. VII Kel. Denai Kec. Medan Denai, LT. 300m2 - LB. 150m², Kmr Tdr 4, Kmr Mandi 2, Harga 475 Jt/nego SHM + PLN + Air Pam + Telp HP. 0821.6752.0606

TOYOTA Kijang Commando Long ‘92/91 Dijual, Abu-abu Metalik, AC dingin, Tape lengkap, Sound system, Jok bagus, Velg racing, Ban lima baru, Mobil mulus, Mesin okey Peminat yg serius cari mobil bagus Hub. 0813.9665.6961

TOYOTA Avanza Dijual, Warna Hitam Thn 2006, Rp. 133.000.000 Hub. 0812.637.5685

MEDAN (Waspada): Asosiasi Institusi Pendidikan Kedokteran Indonesia (AIPKI) Wilayah I diharapkan mampu menyajikan sesuatu yang lebih komprehensif yaitu internship dan Uji Kompetensi Dokter Indonesia (UKDI) baik knowledge maupun skills dalam upaya menaikkan success rate UKDI semua Fakultas Kedokteran. “Selain itu membahas implementasi pendidikan kedokteran keluarga pada tahap pendidikan sarjana kedokteran dan tahap pendidikan profesi dokter,” jelas Ketua Korwil I AIPKI Sumatra yang juga Dekan Fakultas Kedokteran USU, Prof. Gontar Alamsyah Siregar, saat Rakor AIPKI Wilayah I dan Raker Badan Kerjasama Ilmu Kesehatan Masyarakat (IKM)/Ilmu Kedokteran Pencegahan (IKP) dan Ilmu Kedokteran Komunitas (IKK) di hotel JW Marriott, Medan, Sabtu (28/5). Rakor AIPKI bekerjasama dengan Fakultas Kedokteran USU, IUSU, Methodist, UMSU, HKBP Nomensen dan Prima Indonesia. Gontar kemudian menjelaskan, hasil UKDI XVI sekalipun bersifat fluktuatif namun bila dibandingkan dengan hasil UKDI periode yan sama memperlihatkan perbaikan hasil. “Insitusi pendidikan kedokteran berkomitmen mensukseskan pengembangan UKDI,” jelas Gontar. Kita juga jelasnya, sedang diminta masukan dan saran untuk RUU Pendidikan Kedokteran. Standard Kompetensi Dokter Indonesia (SKDI) juga telah disusun dengan memperhatikan pendekatan fondasi dan pilar, sehingga urutan SKDI mengikuti hal tersebut. “Saat ini kita sedang mempersiapkan Muktamar dan MIB Forum telah pada penyusunan draft substansi Muktamar. Keynote speech akan diberikan oleh Mendiknas,” jelas Gontar. Sedangkan Ketua AIPKIWilayah I, dr. Syahrul, SpS (K) mengatakan, berbagai upaya terus dilakukan bersama dalam meningkatkan kemampuan peserta didik sehingga dapat menghasilkan dokter yang memenuhi kompetensi melalui

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

DIJUAL (B.U)

DIJUAL

6 THN AHLI TOTOK SYARAF TANPA ALAT

AHLI SYARAF TERJEPIT: SAKIT LUTUT/ TAPAK KAKI TERKILIR: LUMPUH : KANKER: KEBATHINAN DLL PENGALAMAN DLM & LN: PAK HERY 0852.6114.7129

KUSUK LULUR MBAK SHERLY

DIJUAL KURSI PANGKAS

FULL SET: KACA 4 BH, LEMARI DAN ALAT² PERLENGKAPAN PANGKAS BUTUH DANA CEPAT BERMINAT HUB: (061) 7734.0340 - 0852.7014.1466

HUB: 0852.9780.1920 BERSEDIA DIPANGGIL

MITSUBISHI Kuda New Grandia 2004 merah silver. Mobil mulus, kaleng2, TV Double Deen, Jok baru, Ban BK 1 tangan, BK 1626 YH No. Hoki, Alarm Start, mobil tangguh. Pakai Harga 133Jt/Nego. Lihat dulu baru tawar. Hub. 0812 6568 818 / 77305875

HILANG Surat Notaris No. 12. Jual Beli dan Penyerahan Hak atas tanah a/n. Suparto Yang terletak di Percut Sei Tuan Kec. Deli Serdang. Luas 9.297m2 TELAH TERCECER Surat Sertifikat No. 2533. a/n. A. Kadir Muhammad Jl. Sakura I. Bagi yang menemukan mohon dihubungi M. Hidayat 0813 9735 4383. Kemuning 8 No. 157 Medan.

WASPADA

WASPADA TANAH

Media yang Tepat untuk Iklan Anda

Pasang Iklan Mini

“WASPADA” Telp: 061 - 4576602

IKLANKAN PRODUK ANDA

untuk Iklan Anda

TERAPI VITALITAS PRIA

Jadikan Pria Jadi Idaman Para Wanita

Jl. Setia/ Gaperta Ujung No. 2 T. Gusta

BURSA

Ingin Promosikan Produk Anda

Harian

WASPADA

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6057.6444

KESEHATAN KUSUK & LULUR

MBAK ALIN

CALL CENTER: (021) 9862000 0878 8200 0020

BERSEDIA DIPANGGIL HUB. 0813.7739.9508

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

H. UST. YUSUF/ H. ABIDIN

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat

Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan

A. Ust OTONG

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333

BALAI PENGOBATAN TRADISIONAL

ALAT VITAL

DITANGANI OLEH AHLINYA: M. SUHERDI

DARI PELABUHAN RATU SUKABUMI JABAR

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

MENANGANI KELUHAN: MENAMBAH UKURAN

-

Dengan H. TEJA SAEFUL

Cucu Asli Mak Erot Bersama

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222 - 0821.6655.1222

DIJUAL

Tanah Luas ± 4.200 M2. (Ukuran=16x267 Mtr /SHM). dan Rumah 8x8m² Terletak di: Jl. Tk. Amir Hamzah No. 251 (Pasar Satu Timbang Langkat). Binjai Utara, Kodya Binjai. Binjai - (Sumut). Hubungi HP. 0816 187 6259 0813.6246.6159

Ingin Promosikan Produk Anda Harian

MINI & EFEKTIF WASPADA Media yang Tepat

BURSA

HILANG/TERCECER

Ingin Promosikan Produk Anda Harian

L300 PICK UP THN 2007 L300 PICK UP THN 2008 HP. 0813.7587.5868 0853.7011.8666

perbaikan kurikulum, peningkatan fasilitas pembelajaran maupun peningkatan kemampuan staf pengajar. “Hal ini perlu dilakukan mengingat angka kelulusan UKDI anggota IPKI wilayah I masih rendah. UKDI mendatang yang hanya menguji knowledge namun juga skill dan akan dimulai program internship tahun 2011,” jelasnya. Untuk itu lanjutnya, perlu disiapkan dan upaya bersama juga dengan melihat pengalaman FK UNAND yang telah lebih dahulu melaksanakan internship. “Kami berharap seluruh anggota AIPKIWilayah I dapat ikut serta dan berperan aktif dalam kegiatan ini,” jelas Syahrul. Acara yang mengambil tema Optimalisasi kerjasama antar institusi pendidikan dokter, dalam upaya meningkatkan success rate UKDI seluruh institusi pendidikan di wilayah I dan implementasi pendidikan kedokteran keluarga dalam pendidikan, dibuka Gubernur Sumut diwakili Kadis Kesehatan Sumut Chandra Syafei. (m39)

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

BURSA

a. Akta Perjanjian bersama, tertanggal 24 Mei 2004 Nomor 10 b. Akta Pembubaran yayasan, tertanggal 22 Mei 2004, nomor 11 c. A k t a P e m b a g i a n H a k b e r s a m a , tertanggal 24 Mei 2004, nomor 02 d. Akta Pernyataan Kepemilikan, tertanggal 24 Mei 2004, nomor 08 Atas nama TUMPAL BONAR PASARIBU Dengan alamat: Jl. Garu II A No. 52 Medan Bagi yang menemukannya harap hubungi: 0812.6509.0839

T. Kijang Thn 2001, Solar, AC (double blower), Pakai kipas, Kaca belakang Hub. 0852.6235.6222

Waspada/Rudi Arman

Dekan Fakultas Kedokteran USU Gontar A Siregar bersama unsure panitia foto bersama di sela-sela Rakor AIPKI Wilayah I dan Raker Badan Kerjasama IKM/IKP/IKK, di hotel JW Marriott, Medan, Sabtu (28/5)

FAX.4561347

PERABOT

TELAH TERCECER/ HILANG

TOYOTA Kijang Grand Extra Thn ‘95/ 18” Hrg 70 Jt Hub. 0813.6101.8855

Harian

AIPKI Sajikan Uji Kompetensi Dokter Indonesia

WASPADA

Rp. 65.000 Rp. 78.000

SUZUKI Carry Alexander ‘87/88, W. Biru Met, VR, BR, BK 1 tahun lagi, Sgt mulus Hub. 0821.6604.1073

tetap diberikan sertifikat. Sebelumnya, Ketua Panitia dr. Elmeida Effendy, SpKJ didampingi Sekretaris, dr. M. Surya Husada, SpKJ dan dr. M. Surya Husada, SpKJ serta dr. Vita Camellia, SpKJ menyebutkan, gurumerupakankomponenyang sangat berperan dalam meningkatkan mutu pendidikan. (m37)

kan Izin Penyelenggaraan Penyiaran (IPP) pada kanal frekuensi FM 99.5 Mhz di wilayah Kota Medan. Selain itu, dalam bukti yang ditunjukkan Thiorida, Forum Rapat Bersama (FRB) 1 September 2010 diantara pemerintah Kominfo, KPI dan instansi terkait telah melakukan penggodokan untuk menentukan pemberian izin frekuensi sesuai dengan UU Penyiaran No.32 Tahun 2002. Dan, dari hasil FRB tersebut, permohonan ijin Kardopa untuk pindah atau migrasi ke kanal Frekuensi FM telah disetujui oleh Kominfo melalui surat SDKI No.222/ DJSKDI.3/Kominfo/10/2010 dengan frekuensi 99.5 FM. “Jadi semua bukti sudah jelas, makanya saya akan tempuh jalur hukum ini hingga ke Mabes Polri dan lembaga tinggi negara lainnya,sebabradioinihartasayadan adaorangyangtidakbertanggung jawab telah mengganggu dan mencemarinya,”tegasnya. Dirinya juga menyesalkan tindakan aparat kepolisian yang melakukan penyitaan secara brutaldenganmengerahkan50an personil kepolisian yang dibantu oleh pihak KPID dan kelurahan. “Kami ini bukan penjahat besar Negara yang harus dipaksa untuk bertekuk lutut, kami bayar pajak hingga Rp 500 juta kepada negara dan yang paling penting kami memiliki izin resmi,” katanya. (m39)

A5

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

KLINIK

PUTRA PASUNDAN RAJANYA PENGOBATAN ALAT VITAL ANDA GAGAL DITEMPAT LAIN...???

N

Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

PUSAT PENGOBATAN SPESIAL ALAT VITAL

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

DITANGANI LANGSUNG

BPK. HARYONO

ASLI DARI BANTEN IZIN DINKES 448/503/III/2008

Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663

NB. MOBIL BISA MASUK/ GARASI


Popular

WASPADA Minggu 29 Mei 2011

A6

Produk-Produk Cerdas

Di Mana Ditemukan Tulisan Tertua Di Eropa?

Coffee Joulies TERKADANG ketika kita melihat beberapa jenis produk, di dalam hati berkata ‘Ini karya yang cerdas! Seandainya saya sebelumnya terpikir untuk membuatnya’. Ya, terkadang produk tersebut hanya berupa bendabenda umum dan karena umumnya penciptanya bisa saja seorang anak-anak. Tapi, apa rahasia dibalik pembuatan produk tersebut sehingga meski umum tetap digemari banyak orang. Amilya Antonetti dari Lucky Napkin, satu perusahaan pendukung para pedagang kecil yang memberikan bimbingan mulai dari konsep sampai produk tersebut dilempar ke pasaran, mengatakan rumusnya sederhana: “Konsep produk tersebut mesti menghasilkan sesuatu yang orang ingin dapatkan kembali – baik itu slogan, logo atau produknya.” Jika orang-orang terus membeli benda tersebut, maka terbuka untuk mendapatkan uang,” kata Amilya Antonetti. Berikut adalah produkproduk yang sederhana dan unik ciptaan sejumlah insinyur, ibu-ibu bahkan anakanak. Dan sebagian besar di antara mereka berhasil mengumpulkan banyak uang dari ide sesederhana itu. Coffee Joulies Coffee Joulies ini adalah besi berbentuk kacang kedelai seukuran telur. Benda ini dimasukkan ke dalam kopi panas, maka seketika kopi akan mendingin ke suhu bisa

minum, dan kemudian mempertahankan suhunya tetap hangat sampai lima jam. Benda ini diciptakan oleh 20 insinyur mekanis. Mereka menawarkan ide tersebut ke situs Internet penggalang dana kalangan akar rumput Kickstarter.com, dengan prediksi akan mengantongi keuntungan sebesar 9.500 dolar. Tapi, begitu suksesnya produk ini di pasaran sampai saat ini mereka sudah menikmati keuntungan sebesar 300.000 dolar dan mereka sekarang tengah menggenjot produksi untuk memenuhi 10.000 pesa-

untuk mencurinya, alat ini tidak membuat orang tertarik melihatnya. Alat ini diciptakan oleh seorang perancang di Luckies of London tak lama setelah

menghasilkan es lucu dan menarik bagi anak-anak Anda. Harga Zoku Quick Pop Maker ini berkisar antara 40 sampai 50 dolar.

S2H Replay dan S2H Step

HP nya dicuri orang. Alat ini dijual di situs Internet mereka dan di ThinkGeek.com dengan harga sekitar 30 dolar. Produk ini laris manis. Ukurannya juga ada dalam ukuran HP (Undercover Mini) dan musim panas mendatang akan meluncurkan selubung untuk iPad.

tup laptop. Penampilannya mirip seperti amplop surat bia-sa, namun alat ini tahan lama dan empuk. Tidak seperti selubung laptop yang bagus yang membuat orang langsung tahu ada barang elektronik mahal di dalamnya dan bisa mendorong seseorang

Iklania

Laut Ionia E R O PA

YUNANI

Laut Hitam

Sebuah istana, teras berdinding, mural dan sistem drainase yang terencana dengan baik juga ditemukan di situs Iklania.

AFRIKA

Laut Tengah

P

Undercover Laptop Sleeve Undercover Laptop Sleeve adalah selubung untuk menu-

Zoku Quick Pop Maker

nan para investor Kickstarter. Harga Coffee Joulies ini dibandrol 50 dollar untuk satu set berisi 5 coffee joulies. Jumbo Garden Hands Jumbo Garden Hands adalah alat untuk memungut sampah. Alat ini membantu

YUNANI

Undercover Laptop Sleeve Anda memungut sampah berupa tumpukan daun, ranting pohon, rumput dua kali lipat dari yang bisa dikumpulkan tangan Anda. Selain membantu Anda menghemat waktu dalam bersih-bersih, alat ini juga membuat Anda terhindar dari bersentuhan langsung dengan sampah.

Christian Mundigler/AFP Getty Images Ima

Jumbo Garden Hands

Zoku Quick Pop Maker Anak Anda suka makan es? Dengan menggunakan Zoku Quick Pop Maker Anda hanya membutuhkan waktu 10 menit untuk menyajikan es bergizi bagi anak Anda. Anda tinggal menuangkan susu, jus buah atau minuman lain ke dalam alat ini, maka 10 menit kemudian Anda sudah bisa menikmatinya. Hasilnya sehat dan cepat, dan jika Anda ingin berkreasi, Anda bisa

S2H Replay dan S2H Step S2H Replay watch dan S2H Step pedometer. Produk ini diciptakan oleh sejumlah perancangnya karena frustasi melihat rata-rata kasus obesitas (kegemukan) di kalangan anak-anak dan orang dewasa. Jam tangan dan alat penghitung langkah ini diharapkan bisa memotivasi anakanak dan orang dewasa untuk banyak berolahraga. Uniknya, setiap kali olahraga selama 60 menit, alat tersebut akan memberitahu Anda mendapat kode yang bisa diganti dengan sertifikat hadiah yang bisa ditukarkan di sejumlah toko eceran seperti Best Buy dan Sears. Jam tangan dan alat penghitung langkah ini masing-masing dibandrol harga 19,95 dolar.Syafri/Yc

Kepingan itu berukuran 2,5 ada sepenggal kepingan tanah liat kuno yang 2 5 x 4 cm dan ditulisi dengan apa yang diduga sebagai daftar properti atau ditemukan dalam penggalian di tanah semacam catatan produksi. Catatan seperti itu pertanian zaitun di Yunani terdapat apa yang dituliskan pada tanah liat yang tidak diduga ilmuwan sebagai contoh tertua dibakar karena bukan untuk disimpan lama. tulisan di benua Eropa. Ditemukannya Tulisan paling Peneliti menduga kepingan itu dibuang kepingan itu dalam keadaan baik sama tua, ditemukan ke tempat sampah dan terbakar menjadi mencengangkannya dengan tulisan yang di Mesopotamia, keramik ketika sampahnya dibakar. Kalau tertoreh di permukannya. China, dan Mesir tidak, tak akan bisa bertahan lama. Ahli-ahli arkeologi memperkirakan berasal dari Teks pada lempengan dikenal sebagai kepingan itu berasal dari masa kira-kira tahun 3.000 SM. Linear B, bentuk kuno bahasa Yunani yang 1400 SM. Tulisan dan kepingan tanah liat terdiri dari 87 tanda mewakili suku kata. tersebut mengacu ke budaya Yunani kuno Keberadaannya di situs mungkin menunjukkan (Mycenaea) yang berkembang pada Zaman Perunggu. Benda itu ditemukan dekat desa Iklania di bahwa melek huruf dan perdagangan lebih tersebar luas pada era Mycenaea dibanding dugaan semula. Yunani barat, dekat Laut Ionia. Bill Pitzer - wmpitzer@infoartz.com • Copyright © 2011 The New York Times Syndicate

Fitur Kill Switch Lindungi Perangkat Teknologi Dari Serangan Software JahatFitur Kill Switch Lindungi Perangkat Teknologi Dari Serangan Software Jahat

Fitur Kill Switch Lindungi Perangkat Teknologi Dari Serangan Software Jahat SISTIM operasi ponsel seluler dan gadget elektronik lainnya memasukkan fitur ‘kill switch’ atau fitur tombol pembunuh pada perangkat elektronik mereka. Fitur ini memungkinkan perusahaan pembuat software operasi untuk mengirimkan perintah melalui fitur atau jaringan tanpa kabel yang merubah atau menggerakkan kembali aplikasi tertentu dari perangkat elektronik. Apple, Google dan Microsoft memasukkan fungsi ini pada platform mereka. Eksekutif Google dan Apple mengatakan fitur ini penting untuk melindungi software dari serangan software jahat, jelas CEO Apple Steve Jobs pada Wall Street Journal tahun 2008. Apple tidak muncul menggunakan fitur ini selama empat tahun sejak memperkenalkan iPhone pada masyarakat, namun jubir Apple menolak berkomentar mengenai isu ini. Andy Rubin, bos pengembangan Android mengatakan sesuatu yang sama dalam sebuah wawancara dengan reporter. Ia menjelaskan kill switch sebagai perangkat keamanan atau software yang dapat menghindari serangan software

jahat. Google menggunakan fitur ini pada ponsel Android Market. Google biasanya menggunakan prosedur keamanan dua kali yaitu ketika musim panas lalu peneliti keamanan independen menghilangkan program-program yang menyulitkan dan lagi pada bulan Maret setelah penyebaran software bagi pon-sel Android. Google membuat tombol selama 50 menit guna mempelajari tentang kesalahan, kata Rubin. Kedua insiden itu menjadi pelajaran bagi Google untuk menggunakan fungsi itu, begitu menurut seseorang yang sudah biasa dengan kasus-kasus yang terjadi. Jubir Google menolak untuk berkomentar. Google menghapus software dengan remot dari perangkat elektronik supaya bisa men-download aplikasi. Tidak jelas apakah produsen ponsel yang terkadang mainmain dengan software dapat menambahkan fitur ini pada produk mereka. Samsung Telecommunication, produsen handset top Android tidak merespon satu permintaan untuk mengomentari hal itu Blackberry Research in Motion dan Symbian Nokia tidak merekayasa fitur kill switch pada handset mereka. RIM tidak menunjukkan ke-

kurangan akses remot untuk Blackberry sebagai sebuah pertahanan untuk mengapa ponsel itu tidak dapat menyuguhkan dan memberikan akses di Uni Emirat Arab guna mengetahui data pelanggan. “ RIM tidak memiliki sebuah master key atau untuk mendapatkan akses yang tidak legal,” begitu menurut statemen perausahaan itu tahun lalu. Seperti banyak operator toko aplikasi lainnya, Nokia memiliki software untuk menghindari resiko keamanan. Namun sistim itu tidak memiliki kill switch,” jelas seorang juru bicara. Bagaimanapun Nokia yang memproduksi volume tertinggi ponsel cerdas di seluruh dunia berencana untuk memasarkan software ponsel utamanya untuk Windows Phone 7 Microsoft yang benar-benar memiliki kapabalitas semacam itu. Setiap sistim ponsel termasuk RIM dan Nokia mengizinkan kerjasama untuk mengubah data ponsel pekerja mereka. Perbedaannya adalah bahwa RIM dan Nokia secara aktif tidak menjaga keamanan penggunaaan pelanggan mereka. McAffie yang membuat software keamanan melihat pengaman perusahaan dalam industri mobile merupakan satu area per-

tumbuhan yang penting. “Sesuatu yang penting bagi perusahaan atau industri elektronik adalah bagaimana kita menanggulangi perangkat mobile dalam jaringan kita. Apakah ada atau tidak fitur keamanan dari Google atau fitur-fitur dari Apple pada perangkat itu, anda harus mengendalikan perangkat teknologi itu,” jelas David Dewalt, CEO McAffie dalam satu wawancara dengan majalah Forbes bulan lalu. Kill switch tidak hanya diperuntukkan bagi ponsel, Ninetendo baru-baru ini menawarkan konsumennya sistim tiga dimensi yaitu sistim game baru satu musik video bebas. Aplikasi dan banyak fitur digital lainnya tidak dapat dijual. Menurut pernyataan legal iTunes, pelanggan bahkan tidak memiliki musik dan video tertentu yang mereka beli. Namun meskipun membutuhkan lisensi untuk menggunakannya pada alat-alat elektronik tertentu. Bagi konsumer menerima ide kill switch merupakan suatu kepercayaan. “Kami harus selalu menjaga platform kepercayaan kami secara lengkap/ vendor sistim operasi,” ungkap Chris Palmer, direktur teknologi Electronic Frontier Foundation, satu group hak paten digital yang

menulis dalam sebuah email. Amazon.com menjaga kepercayaan penggemarnya dengan menggunakan kill switch pada tahun 2009 ketika perusahaan itu menghapus kopi-kopi ‘George Orwell’s 1984’ dan ‘Animal Farm ‘ dari pelanggan KindelNya. Buku-buku ini telah dijual secara salah pada e-Book store, begitu menurut perusahaan itu. Amazon menyelesaikan perkara hukum melalui isu itu dan setuju membatasi bagaimana perusahaan itu menggunakan penghapus jarak jauh untuk buku. Amazon CEO Jeff Bezos meminta maaf karena tidak menggunakan fitur kill switch. “ Ketika anda membeli barang-barang elektronik, anda sudah memilikinya,” kata Mark Frauntelder, seorang bloger Boing-Boing yang meliput kasus Amazon. Ia percaya bahwa kasus-kasus berbahaya dimana anda melihat beberapa sisi buruk banyak perangkat penyimpanan teknologi digital dan sistim tertentu dimana setiap orang kurang mengawasi segala sesuatu yang dimilikinya ,” tambahnya. Nurhayati Baheram-syah/cnn .

Apple Usulkan SIM Card Lebih Tipis APPLE telah mengusulkan SIM card yang lebih tipis dari yang digunakan iPhone dan iPad saat ini sehingga bisa digunakan di gadget yang lebih tipis, demikian pejabat eksekutif Orange (salah satu operator telekomunikasi maju di dunia) menjelaskan kepada Reuters. Langkah yang diambil Apple untuk bekerjasama dengan beberapa operator merupakan tanda-tanda menghangatnya hubungan di saat Apple, tidak lagi berstatus sebagai jalan masuk pasaran baru, sekarang bergantung pada subsidi untuk mempertahankan tingginya penjualan iPhone. Seorang jubir lembaga standar telekom Eropa (ETSI) membenarkan bahwa Apple mengusulkan bagi pembuatan SIM card standar baru, namun keputusan tentang dimulainya standarisasi, yang bisa makan waktu lebih setahun, belum lagi dibuat. “Proses ini butuh waktu, setahun atau lebih, jika muncul ketidaksepakatan antara industri. Tapi, jika dicapai satu konsensus di antara perusahaanperusahaan yang berpartisipasi dalam komite standar, proses itu mungkin cuma hitungan bulan,” katanya. Orange mengatakan hal itu dan operator lain menyambut usul tersebut. “Kami senang minggu lalu Apple mengajukan permintaan baru kepada ETSI untuk membuat SIM

card yang lebih tipis – lebih tipis dari yang bisa digunakan di iPhone4 dan iPad,” kata Anne Bouverot, Kepala layanan mobil Orange. “Mereka sudah melewati rute standarisasi, lewat ETSI, dengan dukungan sejumlah operator besar, Orange adalah salah satu di antaranya,” kata Anne kepada Reuters. Anne mengatakan, gadget pertama yang menggunakan SIM card tipis tersebut kemungkinan keluar tahun depan. Jika SIM card yang lebih tipis distandarkan, maka perusahaan pembuat HP lainnya juga akan mengadopsi SIM card tersebut.“Perusahaan lain juga akan mengikut karena ukuran dan berat satu gadget akan sangat menentukan kualitas bagi dihasilkannya telepon cerdas,” kata analis Francisco Jeronimo dari perusahaan peneliti teknologi IDC. Apple menjadi kekuatan pemecah belah di industri telepon seluler ketika pertama kali meluncurkan iPhone di tahun 2007. Apple memasarkan gadget yang didambakan banyak orang hanya lewat rekan-rekan terpilih dan tindakan

Seiring dengan berlomba-lombanya perusahaan telekomunikasi dalam menghasilkan gadget lebih tipis, Apple pun mengusulkan SIM card lebih tipis. ini secara efektif memaksa operator untuk menawarkan data tak terbatas.Anne mengatakan “Selama Apple mendukung ketentuan yang kita punya bagi SIM card, yang merupakan aset sangat penting bagi operator telekomunikasi, yang tentu kami ingin terus dukung, maka kami akang menganggap ini sebagai sebuah perkembangan.” “Apple menunjukkan bahwa mereka siap bekerjasama dengan lembaga standarisasi dan dengan sejumlah operator, dan hal itu tentu kami sambut,” tambah Anne. “Saat ini kami tengah membahas bagaimana meningkatkan hubungan.” Syafri

Inilah game Halo yang lagi digemari.

Microsoft Rilis Seri Terbaru Game Laris Halo TIDAK mau kalah dengan Ninetendo, Microsoft merilis seri terbaru game laris ‘Halo’. Namun uniknya lagi developer yang menangani seri terbaru game itu adalah Bungie, satu studio yang membuat game blockbuster ‘Halo’. Padahal Bungie sudah pecah kongsi dengan Microsoft sejak tahun 2007, tidak berapa lama setelah perilisan game ‘Halo’ untuk Xbox 360 yang meraup sukses besar. Uniknya, Setelah pecah kongsi Bungie masih memproduksi dua game lagi untuk Microsoft. “Kerjasama selama ini dengan Microsoft telah menghasilkan kesuksesan dan ini sangat menyenangkan,” ujar Bungie dalam satu statemennya pada tahun 2007. Harold Ryan, bos Bungie juga menyebutkan dalam satu statemennya bahwa mengembangkan platform Microsoft merupakan fokus utama Bungie. Ironisnya, kerjasama itu kemudian pecah, tapi Microsoft akan berkompetisi secara langsung dengan game baru dari mantan patnernya itu. “ Bungie adalah developer yang fantastik. Mereka menciptakan sejumlah game sukses untuk kami,” kata Kevin Uangst, direktur senior Microsoft Game Studio. Microsoft sekarang mencoba untuk kembali membangkitkan masa keemasan game blockbuster ‘Halo’. Perusahaan raksasa komputer itu mempercayakan pekerjaaan itu pada Frank O’Connor, seorang eksekutif Bungie. Microsoft menempatkan O’Connor sebagai humas industri 343 yang karakternya ada pada game ‘Halo’. Sebagai direktur pengembangan, O’Connor sedang menyelesaikan tahap akhir novel larisnya ‘Halo Cryptum’ dan buku komik berseri ‘Marvel’. Beberapa laporan menyebutkan Microsoft berencana menghidupkan kembali debut seri ‘Halo: Combat Evolved’ untuk Xbox 360 yang dirilis pada liburan musim dingin mendatang ditambah visual high definition dan didukung televisi tiga dimensi. O’Connor, mantan jurnalis game yang memulai pekerjaannya di studio Bungie telah merampungkan penyelesian game ‘Halo bersama tim lainnya. “Seri game terbaru ini sangat menarik. Game ini lebih lengkap dari yang sebelumnya. Pada game ini dibutuhkan kecerdasan dan kecepatan orang-orang yang memainkan dan menyaksikannya. Selain itu langkah-langkah imajinatif juga sangat dibutuhkan konsumer game ini yang berguna untuk menyakinkan bahwa game ‘Halo’ belum terkalahkan. Untuk memuaskan pelanggan yang mengharapkan peluncuran game ‘Halo’ setiap tahun-

nya. O’Connor segera menyediakan satu disk untuk para gamer. O’Connor menyatakan perilisan game ‘Halo’ seri terbaru diumumkan dalam waktu dekat ini, namun ia menolak dalam satu wawancara baru-baru ini untuk mene-tapkan waktu perilisannya. Microsoft bulan lalu melakukan sesuatu yang sangat bersejarah ketika perusahaan itu menawarkan game yang tidak diproduksi Bungie yaitu game yang dapat didownload ‘Defiant Map Pack’ termasuk level baru dan dikembangkan oleh group Dallas yang disebut Certain Affinity. “Microsoft berharap transisi dibuat tanpa syarat dan tidak banyak menarik perhatian,” kata Microsoft dan wakil dari studio Bungie. Bungie akan menggerakkan kendali manajemen. Banyak aspek yang ditunjukkan dari seri game ‘Halo Reach’, namun Bungie tetap menjaga kualitas game produksinya ,” ujar Eric Osborne, jubir Bungie. Sebagai pekerja Bungie, O’Connor mengatakan ia telah mengkontribusikan ide-ide alur cerita game ‘Halo’. Bungie saat ini sedang mengerjakan seri game terbaru seperti penandatanganan kontrak dengan Activision Blizzard, kompetitor studio game Microsoft. Activision. Dengan mengumumkan Xbox eksklusif ‘Halo’ Microsoft, game terbaru ini cocok dengan berbagai sistim. Bungie selalu mencari patner untuk memasarkan inovasi dan ide mereka ke seluruh dunia. Activison tampaknya merupakan patner terbaik untuk melakukan ini. Terbukti Activision telah membuat popular seri ‘Call of Duty’,” jelas Ryan, eksekutif Bungie. Martin O’Donnel dari Bungie mengatakan game baru itu secara radikal telah berbeda dengan ‘Halo’. Namun bagaimanapun kami tetap menyuguhkan sesuatu yang terbaik. Yang terpenting sekarang adalah Bungie akan mendapatkan hak paten bagi karyakaryanya sendiri yang diajukannya ke pihak yang berwenang. Sejak tahun 2007,” tambah O’Donnel.Tanggal 7 Juli mendatang Bungie akan merayakan hari ulang tahunnya dimana studio itu akan memberi hadiah bagi fans ‘Halo’, begitu keterangan Osborne. Namun jubir studio itu menolak menerangkan rencana khususnya. Kemudian mulai Agustus, Microsoft menyelenggarkan tiga hari even Halo Fest sebagai bagian dari Penny Arcade Expo (Pax), festival gamer di Seattle. Nurhayati Baheramsyah/cnn


Sport

WASPADA Minggu

29 Mei 2011

Patriot Medan, Labura Sukses Perdana Piala Specs U-15 MEDAN (Waspada): SSB Patriot Medan mengemas hasil sempurna di laga perdananya dengan menaklukkan SSB Al Batros Medan 4-3 (2-2) pada turnamen antar SSB Piala Specs U-15 di Stadion Kebun Bunga Medan, Sabtu (28/5). Duel kedua tim berlangsung ketat. Sejak laga dimulai, anakanak Patriot langsung tampil menyerang. Sembilan menit pertandingan berjalan, Patriot sukses membobol gawang Al Batros lewat tendangan bebas M Abiyagi Panggabean dari luar kotak penalti. Tidak berselang lama, tepatnya menit 12, Al Batros menyamakan skor melalui gol tendangan bebas Iqbal. Bola yang mengarah ke gawang Patriot berhasil dijangkau kiper Dony Kurniawan, tetapi tangkapan Dony kurang sempurna sehingga bola terlepas dan gol. Menit 20, Abiyagi kembali membawa Patriot unggul lewat tendangan penalti setelah pemain bawah Al Batros tertangkap handsball. Al Batros kembali menyamakan skor lewat gol Dedi Sahputra di menit 33 setelah terjadi kemelut di depan gawang. Laga ketat berlanjut di babak kedua, Patriot yang memasukkan kiper pengganti, Lutfi, harus kebobolan lebih dahulu lewat gol Iqbal di menit 55. Tertinggal satu gol tak membuat anak-anak patriot patah semangat dengan terus meningkatkan serangan. Hasilnya, dua gol sukses dicetak tim asuhan pelatih Yuspan Hasibuan itu, masing-masing disumbangkan Romi Alamsyah dan pemain pengganti Fikri Husein untuk membawa Patriot unggul 4-3 sekaligus memimpin klasemen pool B. Pertandingan lainnya di pool A, SSB Labuhanbatu Utara yang penampilannya disaksikan langsung Bupati Labura, H Kharuddin Syah Sitorus, menaklukkan SSB Patriot Pantonlabu Aceh 2-0. Dual gol SSB Labura diborong Dicky Hidayat. Turnamen yang diikuti 16 tim itu dibuka resmi Plt Ketua PSSI Sumut, Idrus Djunaidi, yang ditandai dengan tendangan bola pertama. Pada kesempatan itu, Idrus memberikan apresiasi atas peran aktif Specs dalam menggelar turnamen tahunan secara rutin di Sumut. “Turnamen ini sangat mendukung pembinaan sepakbola usia muda di daerah ini,” katanya. (m42)

Inkanas Target Maksimal Di Kejurda Forki Sumut MEDAN (Waspada): Institut Karate-Do Nasional (Inkanas) Sumut berharap para karatekanya dapat tampil dan meraih prestasi maksimal pada Kejuaraan Daerah (Kejurda) Junior Forki Sumut di Gedung Serba Guna Unimed, 4-5 Juni mendatang. Untuk mewujudkan itu, Inkanas Sumut mengandalkan para mantan atlet nasionalnya yang pernah mengukir prestasi dalam berbagai event internasional untuk memaksimalkan persiapan atlet. “Ya, Inkanas Sumut ditangani para pelatih yang tidak lain adalah mantan atlet nasional, yakni Sandra Ariyani (peraih medali emas SEA Games 1993 dan 1997), dibantu Pulungan Sihombing, Ngadirun, Takashi Hadi, Sulaiman dan Indra Surya Tanjung,” ujar Wakil MSH Inkanas Sumut, shempay Uli Saut Purba, saat meninjau TC Inkanas Sumut di Aula Sat Brimob Poldasu, Jl KH Wahid Hasyim Medan, Sabtu (29/5). Dikatakan, ikutnya mantan atlet prestasi itu membesut tim Inkanas Sumut sangat diharapkan dapat membawa Inkanas meraih prestasi gemilang di Kejurda Forki yang sekaligus ajang menjaring atlet ke Piala Mendagri 2011 di Kalsel. “Para pelatih telah menurunkan tehnik dan pengalamannya kepada pada atlet yang akan turun di 44 kelas sehingga diharapkan mampu mendominasi Kejurda,” harap Uli. PadakesempatanituUlijugamengungkapkankegembiraannya atas keberhasilan atlet Inkanas Sumut menyapu bersih empat medali emas dalam kejuaraan karate O2SN Sumut tingkat SMP yang dilaksanakan di Asrama Haji Medan, Kamis (26/5) lalu. UKT Mundur Uli juga menginformasikan tentang dimundurkannya jadwal pelaksanaan Ujian Kenaikan Tingkat (UKT) Semester I Inkanas Sumut menjadi 18 Juni mendatang. “Penundaan ini sehubungan kegiatan yang semula dijadwalkan berlangsung 5 Juni ini bersamaan dengan Kejurda Forki Sumut. Kami harap semua dojo dapat memakluminya,” pungkasnya. (m42)

Puluhan Pembalap Uji Coba Sirkuit KUALASIMPANG (Waspada): Puluhan pembalap dari kabupaten/kota di Aceh dan Sumatera Utara yang akan tampil mengikuti Kejuaraan Motoprix Kapolres Aceh Tamiang Cup 2011 melakukan ujicoba sirkuit Pemkab Aceh Tamiang, Karang Baru, sebagai arena adu cepat, Sabtu (28/5). Kejuaraan sendiri akan digelar Minggu (29/5) ini. Ketua Panpel, Rahmat SE didampingi Pengawas Perlombaan, Awalulsahri, dan Pimpinan Lomba, Munawar Putra menyatakan sirkuit sangat layak digunakan. “Pengawas lomba dan pimpinan lomba sudah menyatakan sirkuit layak digunakan oleh peserta dan begitu juga kenderaan yang akan digunakan sudah mengikuti pemeriksaan teknis,” tegas Rahmat. Dikatakan, 170 nomor starter sudah diboking oleh pembalap dari Provinsi Aceh dan Sumatera Utara yang akan tampil dalam arena laga adu cepat sepeda motor di Kejuaraan Motoprix Arpa Yamaha Cup Seri Ke II memperebutkan tropi Kapolres Aceh Tamiang itu. “Event diadakan Korwil IMI Kabupaten Aceh Tamiang itu juga akan diikuti oleh pembalap yang sudah sangat berpengalaman di tingkat nasional seperti Reza Pahlevi dari Banda Aceh, Ivan Nando ( Medan), Agung (Alfa Scorpie Medan), Ivan F (Medan), Bobby Febrianda Putra (Aceh Tamiang) dan sejumlah pembalap lainnya,” ucapnya. “Semua persiapan untuk menggelar kejuaraan ini sudah beres, hanya menunggu aksi saja dari semua pembalap yang akan tampil menujukkan kemahiran mereka,” tandas Rahmat. (b24)

Problem Catur Hitam melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2.

A7 Aceh United Kemas Poin Penuh BANDA ACEH (Waspada): Meski dipindahkan ke daerah lain, duel tim Barat-Timur Indonesia, yakni Aceh United dan Cendrawasih Papua, tetap tak mematahkan semangat tuan rumah. Skuad asal tanah rencong itu sukses menusuk Cendrawasih dengan skor telak 4-1. Laga yang dipentaskan di Stadion Baharoeddin Siregar, Lubuk Pakam, Sabtu (28/5) sore berlangsung menarik. Duel akhir paruh musim ini memang layak dimenangkan Aceh United karena anak-anak asuhan pelatih Lionel Carbonnier itu mendominasi pertandingan.

Meski tak diperkuat dua pilarnya, Alain Nkong dan Riko Suprianto, akibat kartu merah yang diterima keduanya pekan lalu, tak membuat Aceh United pincang. Buktinya, empat gol mampu mereka lesakkan ke jala tim tamu. Empat gol Sidom Apui—

sebutan Aceh United, dicetak oleh Alvin Tehau (7’ dan 91’), Andika Yudhistira (38’), dan Zamroni (55’). Sedangkan satusatunya gol balasan Cendrawasih Papua dicetak oleh Yulianus Goo (84’). Yum dkk yang bermain di luar kandang, langsung menggebrak sejak awal babak pertama. Baru tujuh menit berjalan, gawang Cendrawasih Papua sudah bobol oleh sundulan gelandang asal Tahiti, Alvin Tehau. Pada menit ke-38, giliran penyerang lokal Andika Yudhistira yang membobol gawang tim

asal Papau ini untuk membawa Aceh United unggul 2-0. Memasuki babak kedua, dominasi permainan masih dikendalikan Aceh United. Serangan yang dilancarkan Laskar Rencong berbuah hasil gol ketiga ke gawang Cendrawasih Papua melalui Zamroni, pada menit ke-55. Ketinggalan tiga gol, membuat anak-anak asuhan pelatih asal Jerman, Uwe Erkebrecher, tersengat. Namun, baru pada menit ke-84, Yulianus Goo memperkecil ketinggalan dengan lesakkan satu golnya ke

gawang Aceh United. Namun saat injury time, AlvinTehau sukses menambah gol dan mengubah skor 4-1 bagi Aceh United. Manajer tim Cendrawasih Papua, Benyamin Jansenem mengakui keunggulan Aceh United. ”Hampir semua pemain asing mereka jadi adalan tim. Sedangkan kami lebih didominasi oleh pemain muda lokal yang kurang berpengalaman,” tukasnya seperti dilansir situs resmi LPI. Manajer Tim Aceh United, Taufik Julianto sudah sejak awal yakin bahwa timnya akan me-

nang. ”Materi pemain kami memang lebih baik, dan pertahanan mereka longgar sehingga para pemain depan kami dapat leluasa mengobrak-abrik daerah pertahanan mereka,” ulasnya. Taufik Julianto bersyukur timnya dapat memetik tiga poin dan bertahan di papan tengah sehingga menjadi modal yang manis untuk menyambut paruh musim kedua LPI. Putaran kedua sendiri belum jelas kapan mulai digulir. Ini terjadi sejak kisruh kongres PSSI beberapa waktu lalu. (b05)

Agum Berupaya Yakinkan FIFA JAKARTA: Ketua Komite Normalisasi (KN), Agum Gumelar, meminta semua pihak untuk bisa menahan diri dengan tidak lagi melakukan provokasi lewat media, seperti yang terjadi selama ini. Dengan begitu, tidak ada lagi caci maki dan saling menyalahkan, yang justru berakibat buruk pada nasib sepakbola nasional. Hal tersebut disampaikan Agum demi mendukung upaya dirinya dalam meyakinkan FIFA agar sepakbola Indonesia tidak dijatuhi sanksi berat, menyusul gagalnya Kongres PSSI yang digelar di Hotel The Sultan, Jakarta, beberapa waktu lalu, menetapkan Ketua Umum danWakil Ketua serta anggota Komite Eksekutif (Exco) PSSI periode 2011-2015. “Malam ini pukul 00.00WIB saya akan terbang ke Swiss untuk berupaya menemui presiden FIFA. Karena terkendala masalah visa, saudara Joko Dri-

yono tidak bisa bersama saya, namun akan menyusul besok (hari ini-red). Kami dijadwalkan bertemu dengan FIFA pada 29 Mei,” ujar Agum kepada wartawan dalam konfrensi pers di sekertariat PSSI, Senayan, Jakarta, Sabtu (28/5). Sayangnya, lanjut Agum, karena hingga saat ini belum ada kepastian jadwal untuk bertemu langsung dengan presiden FIFA Sept Blatter. “Tapi Thiery Regenass bersama timnya telah memastikan siap menerima kami. Sejauh ini, saya masih berupaya untuk bisa bertemu langsung dengan Blatter. Sebab saya ingin menjelaskan harapan dan keingian mayoritas masyarakat Indonesia,” tambah Agum. Masih kata Agum, karena KN sebagai bentukan FIFA telah bekerja maksimal sesuai dengan aturan yang diberikan, tidak ada alasan untuk menjatuhkan sanksi kepada sepakbola Indonesia. Hanya saja, ulah sebagian

orang yang tidak terpuji saat kongres berjalan membuat sanksi Itu besar kemungkinan akan dijatuhkan. “Karena itulah saya ingin menemui langsung presiden FIFA untuk menjelaskan semua ini. Tentunya dengan membawa surat dukungan dari sejumlah elemen masyarakat di tanah air,” kata Agum. Sanksi itu semakin dekat, imbuhnya, menyusul surat yang disampaikan asosiasi sepakbola Asia (AFC) kepada FIFA yang meminta kepada badan sepakbola dunia itu menjatuhkan sanksi untuk Indonesia, menyusul keributan yang terjadi di arena Kongres PSSI beberapa waktu lalu. “Inilah yang ingin kami jelaskan ke FIFA. Apa yang terjadi di kongres tersebut bukan refresentatif dari sikap masyarakat Indonesia terhadap FIFA. Sekitar 99 persen penduduk Indonesia sangat berharap tidak ada sanksi,” pungkas Agum (yuslan)

Christo Ditantang Becker JAKARTA (Waspada): Petenis putra terbaik Indonesia Christopher Rungkat ditantang pemain kualifikasi asal Jerman, Richard Becker, pada babal final Okeshop Men’s Future dan Women’s Circuit International Tennis Tournament di Stadion Tenis Gelora Bung Karno, Jakarta, Minggu (29/5). Christo yang merupakan unggulan pertama turnamen ini lolos ke babak final setelah menang straight set 6-3, 7-6 (5) atas unggulan ketiga dari Jepang, Arata Onozawa. Sedangkan Becker yang memiliki servis keras menyingkirkan unggulan ketujuh asal Taiwan, Kiang-Chi Huang 6-4, 7-6 (6). Menariknya, hingga ke babak final Christo belum pernah kehilangan satu set pun. Petenis peringkat 590 dunia ini menargetkan menjuarai turnamen ini. Maklum saja karena sejak Ja-

nuari lalu Christo belum pernah menjuarai satu turnamen pun dari tujuh turnamen yang dia ikuti. “Saya akan berusaha maksimal saja. Semoga saja penampilan saya di babak final bisa tetap stabil seperti pada gamegame sebelumnya,” ujar Christo penuh harap kepada wartawan ditemui usai laga kemarin. Mengenai calon lawan yang akan dihadapi, petenis andalan Indonesia ini enggan memberikan komentar. Sebab menurutnya, sukses melaju ke final sudah membuktikan jika saja pemain tersebut cukup berkualitas. Karena itu, dirinya harus bisa tampil maksimal sekiranya ingin juara. Pada tunggal putri, petenis unggulan pertama dari Indonesia, Jessy Rompies, gagal melaju ke babak final. Langkah Jessy dihentikan unggulan ketiga dari

China, Lin Zhu, 1-6, 6-4, 6-3, pada babak semifinal. Zhu di babak final menghadapi unggulan ketujuh dari Meksiko, Nadia Abdala. Petenis Meksiko peringkat 825 dunia ini lolos ke babak final setelah menyisihkan petenis Taiwan peringkat 933 dunia, Ting-Fei Juan, 7-5, 3-6, 6-4. Di sektor ganda putra, gelar juara direbut unggulan keempat dariTaiwan, Cheng-Peng Hsieh/ Hsin-Han Lee. PasanganTaiwan ini di babak final mengalahkan unggulanketigadariJepang,Yuichi Ito/Kento Takeuchi, 7-6 (5), 76 (4). Sementara itu gelar juara ganda putri direbut pasangan China unggulan ketiga, Kai-Lin Zhang/Jun-Yi Zheng. Pasangan unggulan ketiga ini di babak final mengalahkan ganda Indonesia bukan unggulan Bella Destriana/Nadya Syarifah 6-2, 64 (yuslan)

Polres P.Siantar Olahraga Bersama TNI

P. SIANTAR (Waspada): Guna menjalin kebersamaan dan komunikasi sesama instansi terutama dalam mengayomi masyarakat, Polres Pematangsiantar menggelar olahraga bersama dengan TNI dan Muspida plus setempat yang puncak acaranya berlangsung di halaman Polres, Jalan Jend. Sudirman Pematangsiantar Jumat (27/5). Kapolres Pematangsiantar AKBPAlberd TBSianipar,SIK,MH didampingiWakapolres Kompol Donald P Simanjuntak, SIK dan KasubbagHumasAKPAlturPasaribu dalam kesempatan bincangbincang mengatakansangatmerasa bangga dan gembira akan pelaksanaangelarolahragabersama itu, karenamendapat sambutan yang hangat daripeserta,termasukWalikota HulmanSitorus,SE bersama

unsur Muspidalainnyayangturut serta di dalamnya. Dalam kegembiraan yang yang terlihat lewat pancaran di wajah dan penuh senyum, Kapolres menyatakanmerasabangga,mengingat dampakdarikegiatan itu sangat besar manfaatnya, baik dari segi tugas dapat memupuk rasa kebersamaan di lapangan dalammenjalankantugas selaku pengayom masyarakat, terutama bermanfaat untuk kesehatan dan kebugaran tubuh. “Kegiatan yang positif ini diharapkan dapat berkesinambungan setidaknya sekali sebulan. Sebab, selain mengikuti kegiatan olahraga sekaligus saling curhat, tentunya menghasilkan ide-ide konkrit guna kekondusifan Pematangsiantar dan Kamtibmas yang mantap sesuai visi dan misi

Pematangsiantar mantap, maju dan jaya,” harap Kapolres. Pelaksanaan gelar olahraga bersama yang berlangsung cukup meriah itu, diawali dengan pelaksanaan gerak jalan santai mengitari kota Pematangsiantar sejauh 5 km yang diikuti ratusan para peserta, diantaranya sejumlah pejabat sepertiWalikota Hulman Sitorus, SE, Dandim 0207/Simalungun, Danyon 122/TS, mewakili Danrindam, Ketua Pengadilan Negeri, para anggota TNI, PNS dan para perwira, bintara dan lainnya. Sampai di garis finis di Mapolres, para peserta melanjutkan dengan melaksanakan senam aerobik dipimpin tim instruktur khusus di lokasi halaman dalam Mapolres Pematangsiantar.(a30)

Waspada/Munawardi Ismail

GELANDANG Aceh United,Yossi AP, sukses memuaskan pendukung meski tampil di luar kandang, Sabtu (28/5).

Nama Persiraja Aceh Oke Tolak Wacana Mawardi BIREUEN (Waspada):Rencana mengubah nama Persiraja Banda Aceh ke Persiraja Aceh yang diwacanakan Ketua Umumnya Mawardi Nurdin, pasca tim yang bermarkas di Banda Aceh itu, langsung ditanggapi sangat positif ide cemerlang itu oleh sebagian warga Bireuen dan sekitarnya. Bahkan, mereka dengan sigap menyatakan sangat mendukungnya. “Ide merobah nama dari Persirja Banda Aceh ke Persiraja Aceh, patut kita dukung, karena alasannya logis dan keacehan serta merakyat,” kata Sulaiman Djamil pengamat dan pecinta Persiraja di Bireuen kepada Waspada Jumat (26/5). Menurut Sulaiman, ide dari Ketua Umum Persiraja itu, sebenarnya sudah lama diharapkan masyarakat pencinta bola di Aceh, namun selama ini belum ada yang berani bicara karena mereka mengira namanya selama ini bernilai historisnya sangat tinggi dan tidak bisa diganggu gugat. Namun, setelah dilemparkan gagasan itu, nilai historis bila Persiraja Aceh namanya malahan lebih luas. Pasalnya, kata Sulaiman Djamil Persiraja yang kepanjangannya Persatuan Sepakbola Indonesia Kutaraja (Persiraja) mengandung makna yang mendalam bila embel-embel Aceh ditambah didepannya. Sehingga bisa ditafsirkan nantinya, Persiraja jiwa dan ruhnya masyarakat Tanah Rencong. Kecuali itu, sambung Sulaiman, nama Persiraja Aceh itu bisa diterima semua lapisan masyarakat Aceh, sehingga nantinya Persiraja merupakan guru atau orang tuanya klub yang ada di kabupaten/kota di provinsi ujung Sumatera itu. “Saya nilai historisnya bila Persiraja Aceh namanya lebih luas dan mendalam, dan saya kira ide Pak Mawardi itu akan disetujui Tgk Agam (panggilan akrab Gubernur Aceh, Irwandi Yusufred) yang juga banyak memiliki ide cemerlang itu, karena sesuai dengan idenya pemain ‘timnas’ Aceh yang selama ini berguru ke Paraguay akan mengutamakan jadi pemain Persiraja, apalagi mereka itu semua berasal dari kabupaten/kota yang ada di Aceh, dengan kata lain kalau nama Persiraja Aceh artinya mereka sama-sama membela Aceh, filsafatnya mereka adalah pejuangpejuang handal yang akan bertempur di Medan tempur sepakbola negeri ini,” jelas ayah satu anak kelahiran Punteut, Aceh Utara itu. Bila sudah seperti itu, lanjut Sulaiman, maka kloplah semuanya. “Bravo Persiraja Aceh, kibarkan semangatmu, aku tetap cinta dan sayang kamu, kiprahmu di ISL musim depan kami tunggu dan kami nanti-nantikan, kepada pemain dan manajernya Tgk Adli Tjalok mungkin saya atas nama rakyat Aceh kami ucapkan terimakasih, perjuanganmu akan akan dikenang dan akan dicatat dengan tinta emas sebagai bukti sejarah, ” pungkas Sulaiman Djamil bersemangat. Tolak Wacana Mawardi Sementara sejumlah pendukung Laskar Ren-

cong di Banda Aceh mengaku tidak sepakat dengan wacana yang dilontarkan Ketua Umum Persiraja Mawardi Nurdin. Walikota Banda Aceh ini ingin ‘menjual’ Persiraja Banda Aceh untuk pemerintah provinsi. Alasan Mawardi ingin ‘menyerahkan’ tim ini untuk pemerintah provinsi tak lain akibat terganjal dana. Apalagi musim depan Abdul Musawir dkk akan berlaga di Liga Super Indonesia. Untuk mengarungi ISL, Persiraja sedikitnya butuh Rp25 miliar. Menurut dia, begitu Persiraja menginjak kaki di Liga Super, itu bukan lagi milik masyarakat Kota Banda Aceh saja, tetapi sudah menjadi milik rakyat Aceh. Atas alasan itu, Mawardy berharap Persiraja ditangani pemerintah provinsi. “Mungkin namanya Persiraja Aceh,” sebutnya. Oleh karena itu, dia berharap Gubernur Aceh IrwandiYusuf mau membantu mendanai Persiraja agar bisa tampil di kompetisi elite sepakbola di Indonesia tersebut. Kata dia, yang dibutuhkan bukan cuma dana segar, tapi sarana penunjang seperti lapangan juga wajib memadai. Ketua Suporter Kutaraja untuk Lantak Laju (Skull), Teuku Iqbal Djohan, kepada Waspada, kemarin, menyatakan tak sependapat dengan keinginan tersebut. “Ini sudah menyalahi sejarah, jika sampai terjadi, karena tak ada lagi kebanggaan sebagai warga Banda Aceh,” tukasnya. Pun begitu, dia mengakui belum membahas langsung masalah ini dengan Walikota Banda Aceh yang dikenal kurang menggandrungi sepakbola ini. Bicara soal sponsor, Iqbal memberi contoh, tim Manchester United yang berasal dari Inggris saja masih tak mengubah namanya, meski pemilik modalnya dikuasai pengusaha Amerika Serikat. Menyambut kepulangan Persiraja Banda Aceh, Skull menyambut secara khusus Andrea dkk yang berhasil tembus Liga Super dan meraih predikat runner-up di kompentisi divisi Utama Liga Indonesia 2010/2011. Iqbal menambahkan, pihaknya akan mengarak Yudha Andika, Fahrizal Dillah dkk keliling Banda Aceh melewati sejumlah jalan protokol di ibukota Aceh itu. “Pemain-pemain Persiraja saat ini adalah pahlawan sepakbola Aceh,” sebutnya. Dia juga menambahkan, kepulangan tim Persiraja nanti penyambutannya pun dilakukan secara sederhana. Mereka sudah menyiapkan karangan bunga yang akan dikalungkan kepada kapten Persiraja Musawir dan tim pelatih. Selain itu, seluruh skuad Laskar Rencong juga diarak sambil berkonvoi keliling kota dengan menggunakan mobil terbuka. ”Kita berharap semua masyarakat di Banda Aceh datang untuk memberikan apresiasi kepada para pemain Persiraja Banda Aceh,” ungkap Mawardy kepada wartawan. (amh/b05)


Sport

A8

WASPADA Minggu 29 Mei 2011

Lagi, Indonesia Terhenti Di Semifinal QINGDAO, China (Waspada): Sama seperti 2009, tim Indonesia kembali terhenti di babak semifinal kejuaraan beregu campuran bulutangkis Piala Sudirman di Qingdao Sport Center Gymnasium Qingdao, China, Sabtu (28/5) malam, setelah dikandaskan Denmark 1-3. Pertandingan semifinal yang turut disiarkan langsung MNCTV, pemain muda Indonesia tampak kesulitan mengimbangi tim Denmark, di mana Indonesia sudah tertinggal 02 lebih dulu. Dengan hasil ini Denmark menantang unggulan pertama, China, pada partai puncak, Minggu (29/5). Sementara itu Indonesia dan Korea Selatan harus puas di posisi ketiga. Dalam semifinal antara Indonesia melawan Denmark, kemenangan Denmark ditentukan partai keempat tunggal putri Tine Baun setelah sebelumnya kedudukan 2-1 untuk Denmark. Tina Baun berhasil mengalahkan tunggal putri Indonesia Ardiyanti Firdasari dengan angka 21-13, 21-13 dalam waktu 34 menit. Pada partai pertama yang

memainkan nomor ganda campuran, pasangan Fran Kurniawan Teng/Pia Zebadiah dipaksa mengakui keunggulan pasangan Joachim Fischer Nielsen/Christinne Pedersen dengan rubber set, 21-15,11-21, dan 13-21 dalam waktu 63 menit. Pada set pertama pasangan Fran/Pia tanpa kesulitan mengumpulkan angka dengan memanfaatkan penampilan ganda campuran Denmark yang belum padu karena masih ada posisi yang kosong dan kejelian pemain Indonesia memenfaatkan ruang kosong. Pada set kedua dan ketiga Fran/Pia terlihat banyak melakukan kesalahan seperti menyangkut di net dan beberapa kali bola terbuang sia-sia. Pada pertandingan ini Fran Kurniawan sempat melancarkan protes pada wasit karena service

Tahun Tuan Rumah

Juara

Runner-up Skor Posisi Tiga

1989 1991 1993 1995 1997 1999 2001 2003 2005 2007 2009 2011

Indonesia Korsel Korsel China China China China Korsel China China China ——

Korsel Indonesia Indonesia Indonesia Korsel Denmark Indonesia China Indonesia Indonesia Korsel ———

Jakarta, Indonesia Kopenhagen, Denmark Birmingham, Inggris Lausanne, Swiss Glasgow, Skotlandia Kopenhagen, Denmark Sevilla, Spanyol Eindhoven, Belanda Beijing, China Glasgow, Skotlandia Guangzhou, China Gindao, China

3-2 3-2 3-2 3-0 5-0 3-1 3-1 3-1 3-0 3-0 3-0

Denmark dan China Denmark dan China Denmark dan China Denmark dan Korsel Denmark dan Indonesia Denmark dan Korsel Denmark dan Korsel Denmark dan Indonesia Denmark dan Korsel Inggris dan Korsel Indonesia dan Malaysia Indonesia dan Korsel

pemain Denmark yang dinilai salah dan terkesan melakukan gerakan tipuan tetapi tidak ditanggapi wasit. Partai kedua yang memainkan nomor tunggal putra, Simon Santoso gagal membendung perlawanan Peter Gade dan kalah dengan dua set langsung, 18-21 dan 16-21 dalam waktu 44 menit. Pada dua set tersebut memang awalnya saling kejarmengejar tetapi setelah itu Peter Gade terus melaju dan tidak memberi kesempatan pada Simon untuk mengembangkan permainan karena sering salah dalam mengembalikan bola, seperti bola terlalu tinggi dan keluar lapangan. Partai ketiga yang memainkan ganda putra, pasangan Alvent Yulianto/Mohammad Ahsan berhasil memperkecil ketertinggalannya menjadi 12 setelah mengalahkan Carsten Mogensen/Mathias Boe, 23-21 dan 21-17 dalam waktu 43 menit. Pada set pertama, pasangan Ahsan/Alvent tertinggal pada awal-awal set ini tetapi berhasil mengejar hingga posisi 14-14 kemudian 17-17 tetapi setelah itu tertinggal hingga posisi 1720. Tetapi Alvent/Ahsan berhasil mengejar dan menyamakan kedudukan menjadi 2020 sehingga terjadi douce hingga dua kali sebelum menyelesaikan dengan angka 23-21. Pada set kedua memang sempat terjadi angka imbang hingga 10-10 setelah itu Alvent/Ahsan terus memimpin dan menyelesaikan set ini dengan angka 21-17. (m18/ant)

Nadal Dan Murray BelumTerhadang PARIS (Waspada): Rafael Nadal memetik kemenangan mudah saat menghadapi Antonio Veic di babak ketiga Prancis Terbuka, Sabtu (28/5). Juga masih mulus melaju adalah Andy Murray meski dia dapat cedera di tengah laga. Nadal, yang sudah lima kali jadi juara di Roland Garros, tak memberi kesempatan pada lawannya untuk mengembangkan permainan. Dalam waktu satu jam dan 41 menit petenis asal Spanyol itu memetik kemenangan 6-1, 6-3 dan 6-0. Perbedaan 226 peringkat antara Nadal dan Veic terlihat

jelas di atas lapangan. Setelah sempat kesulitan di servis pertamanya, Nadal cuma memberi petenis babak kualifikasi itu tujuh poin di set pertama. Setelah menuntaskan set kedua hanya dalam 25 menit, banyaknya kesalahan yang dibuat Veic membuat langkah Nadal ke babak keempat semakin mudah. Nadal akan menghadapi pemenang antara Ivan Ljubicic kontra Fernando Verdasco di babak berikutnya. Sementara itu pada pertandingan lainnya Andy Murray juga sukses melaju ke babak keempat meski mengalami cedera

di tengah laga. Dia menang 62 6-3 6-2 atas Michael Berrer. Murray yang ditempatkan sebagai unggulan empat mendapat cedera pada pergelangan kakinya di set kedua saat mencoba mengejar bola pengembalian Berrer. Meski mendapat masalah dengan kakinya, petenis kelahiran Skotlandia itu tetap terlalu tangguh untuk lawannya yang asal Jerman itu. Jika cederanya tak parah dan bisa bermain di babak selajutnya, Murray akan menghadapi petenis unggulan 15 asal Serbia, Viktor Troicki. (dtc)

1920 Anak Medan Sekitarnya Tumpah Di Teladan MEDAN (Waspada): 1920 Anak Medan sekitarnya dari 128 tim yang ikutserta, Sabtu (28/ 5), tumpah di Stadion Teladan mengikuti Biskuat Tiger Cup 2011 yang merupakan program kompetisi pertama kalinya diadakan untuk anak-anak sekolah dasar berusia di bawah 13 tahun. Kegiatan yang berakhir, Minggu (29/5) sore ini, mendapat sambutan kalangan siswa SD dan orang tua siswa. Namun, kegiatan ini tidak melibatkan sekolah sepakbola. “Kalau ke-giatan sekolah

sepakbola sudah rutin, kali ini mengatasnamakan sekolah,” kata Novita Indosary, Brand Manager Biskuat PT Kraft Indonesia kepada wartawan kemarin. Medan dipilih sebagai salah satu kota perdana selain Makassar untuk menggelarkan program ini, karena merupakan dua kota yang potensial di bidang olahraga sepakbola. Tahun ini ada enam kota yang digelar, yakni Medan dan Makassar pada tanggal yang sama, 28 dan 29 Mei, kemudian di Bandung dan Surabaya pada

4 dan 5 Juni, Solo dan Jakarta pada 11 dan 12 Juni. “Secara total menargetkan tidak kurang dari 10.000 anak dapat berpartisipasi dari seluruh kota,” katanya. Kompetisi ini mencari enam tim dari enam kota untuk dipertandingkan pada putaran final di Bali, 23 Juni mendatang. Juara nasional nantinya akan mendapatkan trofi dan berhak atas program latihan selama delapan hari (25 Juni-3 Juli) di Bali bersama Cesc Fabregas dan Bambang Pamungkas. (m18)

Antara

PEMAIN ganda campuran Indonesia Fran Kurniawan (kanan) yang berpasangan dengan Pia Zebadiah, mengembalikan bola pasangan Denmark, Joacchim Fischer Nielsen dan Christina Pedersen dalam babak semi final Piala Sudirman di Qingdao Sport Center, Sabtu (28/5).

China Ke Final Piala Sudirman

QINGDAO (Waspada): Tuan rumah memastikan tampil pada partai final perebutan Piala Sudirman di Qingdao Sport Center Gymnasium Qingdao, China, Sabtu (28/5). Pada babak semifinal China yang diunggulkan di tempat pertama berhasil menghentikan perlawanan Korea Selatan dengan angka 3-1. Pada partai puncak yang dimainkan di tempat yang sama pada Minggu (29/ 5), Lin Dan dan kawan-kawan bakal bertemu pemenang antara Denmark melawan Indonesia yang baru dimulai pukul

19.00 waktu setempat. Partai pertama antara China melawan Korea yang memainkan nomor ganda campuran, pasangan Xu Chen/Ma Jin harus berjuang keras untuk mengalahkan pasangan Korea, Ko Sunghyun/Ha Jungeun. Pasangan China berhasil mengalahkan ganda campuran dengan tiga set yaitu 21-23,2114, dan 24-22 dalam waktu satu jam 12 menit sehingga menjadikan juara bertahan unggul 10. China memperbesar kemenangan menjadi 2-0 setelah tunggal putranya, Lin Dan ber-

hasil menghentikan Park Sung Hwan dengan dua set langsung, 21-16 dan 21-10 dalam waktu 42 menit. China yang tinggal satu angka untuk meraih kemenangan akhirnya tertunda karena pada partai ketiga yang memainkan nomor ganda putra, pasangan Cai Yun/Fu Haifeng kalah dari pasangan Jung Jaesung/Lee Yong Dee dengan angka 2119,16-21, dan 14-21 dalam waktu satu jam dua menit. Pada partai keempat yang memainkan nomor tunggal putri, tunggal putri peringkat

satu dunia Wang Shixian menumbangkan perlawanan Bae Yeonju dengan dua set langsung, 21-15 dan 21-12 dalam waktu 50 menit. Pelatih Kepala Tim China, Li Yongbo mengatakan, sebenarnya timnya bisa menang dengan angka 3-0 langsung dari Korea tetapi ternyata nomor ganda putranya kalah. Tetapi, kata mantan pebulutangkis ganda putra China (berpasangan dengan Tian Bingyi) tersebut, dirinya beruntung ada Wang Shixian yang menjadi penentu kemenangan timnya atas Korea.Wang Shixian

sempat tidak dimainkan dalam beberpa pertandingan setelah kalah dari Juliane Schenk (Jerman) pada pertandingan penyisihan Grup A dengan angka 19-21 dan 16-21. Saat menghadapi Jepang pada penyisihan grup, mereka menurunkan Wang Xin di tunggal putri dan menang atas Sayako Sato dengan angka 21-12 dan 21-11. Tetapi saat menghadapi India pada babak perempat final, Wang Xin dikalahkan tunggal putri, Saina Nehwal dengan dua set langsung, 15-21 dan 1121. (m18/ant)

Perez Celaka, Pole Milik Vettel MONTECARLO (Waspada): Sergio Perez mengalami kecelakaan di akhir-akhir sesi kualifikasi GP Monaco. Sementara, pole position untuk lomba berhasil jadi milik Sebastian Vettel. Sesi kualifikasi yang berlangsung di Sirkuit jalan raya Monte Carlo, Sabtu (28/5), tinggal tersisa dua menit ketika Perez mengalami nasib naas itu. Mobil Sauber Perez dua kali melabrak pembatas. Perez kemudian ditandu keluar dari mobilnya dan dibawa dengan ambulans. Walau Perez dilaporkan sadar dan bisa bicara setelahnya, belum diketahui secara pasti kondisi pembalap Meksiko itu dan apakah dia bisa membalap besok. Di saat kualifi-

kasi terhenti tersebut, Vettel sudah bercokol di posisi teratas. Meski kualifikasi kemudian digelar lagi, catatan 1 menit 13,556 detik milik Vettel tidak tergoyahkan. Mengekor di tempat kedua adalah pembalap McLaren Mercedes, Jenson Button, yang membukukan waktu. Dengan waktu 1 menit 13,997 detik, rekan setim Vettel, Mark Webber, berada di posisi ketiga. Berturut-turut, posisi keempat hingga kesepuluh dihuni oleh Fernando Alonso, Michael Schumacher, Felipe Massa, Lewis Hamilton, Nico Rosberg, Pastor Maldonado dan Perez. Namun andai Perez tidak bisa berlomba, maka pemilik grid

ke-11 yaitu Vitaly Petrov bakal maju mengisi posisi 10 dan demikian juga para pembalap di belakangnya. Hasil kualifikasi GP Monako: 1. Sebastian Vettel, 2. Jenson Button, 3. Mark Webber, 4. Fernando Alonso, 5. Michael Schumacher, 6. Felipe Massa, 7. Lewis Hamilton, 8. Nico Rosberg, 9. Pastor Maldonado, 10. Sergio Perez, 11. Vitaly Petrov, 12. Rubens Barrichello, 13. Kamui Kobayashi, 14. Paul di Resta, 15. Adrian Sutil, 16. Nick Heidfeld, 17. Sebastien Buemi, 18. Heikki Kovalainen, 19. Jarno Trulli, 20. Jaime Alguersuari, 21. Timo Glock, 22. Jerome d’Ambrosio, 23. Narain Karthikeyan, 24. Vitantonio Liuzzi. (m18/dtc)

Reuter

PEMBALAP F-1 yang menunggangi Ferrari Fernando Alonso (Spanyol) berhasil memuncaki latihan bebas III GP Monaco di sirkuit jalan raya Monte Carlo, Sabtu (28/5).

Sebelum Laga MU Vs El Barca:

Rachel Hunter Bantah Jadi Selingkuhan Giggs RUMOR perselingkuhan antara gelandang Manchester United Ryan Giggs (foto)

dengan Imogen Thomas mulai berkembang ke isu adanya perempuan selingkuhan lain.

Kali ini nama perempuan yang dikaitkan memiliki hubungan asmara dengan Giggs adalah model asal Selandia Baru, Rachel Hunter (foto). Hunter yang pernah berpose bugil untuk majalah Playboy di tahun 2004 dilaporkan pernah dikejar oleh Giggs di tahun 2001. Saat itu Hunter baru saja berpisah dari suaminya Rod Stewart yang merupakan musisi kawakan asal Inggris. Ketertarikan Giggs ini dilansir The Sun yang menyebut kalau dia ‘sangat menyukai Hunter’. Namun, Hunter menepis rumor ini. Menurutnya tidak ada apa pun yang terjadi antara dirinya dengan Giggs yang sudah menikah dan memiliki dua anak. “Saya tidak pernah tidur dengan Ryan Giggs. Rumor ini dimulai di Monaco sejak setahun lalu. Saya memang pernah bertemu dengannya, tapi sudah hanya itu saja,” kata Hunter seperti dilansir NZHerald, Jumat (27/5). Tudingan selingkuh Giggs ini berkembang dari mulut anggota Parlemen Inggris John Hemming. Menurut Hemming, dia hanya menyuarakan rumor dari 75 ribu orang yang sudah menyebar di jejaring mikroblog twitter. Isu ini membuat Giggs menjadi sasaran media Inggris terutama jelang final Liga

Champions melawan Barcelona, Minggi dinihari WIB. Manajer MU Sir Alex Ferguson bahkan sampai harus mencekal seorang wartawan yang menanyakan status Giggs di tim asuhannya. Dirahasiakan Skandal asmara yang ditutup rapat bahkan dengan tameng hukum dan perintah pengadilan pun jebol juga. Itulah skandal yang menimpa bintang senior Manchester United. Nama bintang MU Ryan Giggs menghiasi halaman berbagai surat kabar dan situs internet Inggris. Kali ini publikasi luas pemain berusia 37 tahun itu tidak ada hubungannya dengan kiprahnya menyumbangkan gelar ke-19 Piala Liga Primer Inggris bagi MU musim ini yang baru saja usai. Publikasi itu justru nadanya sumbang, yakni pemain asal Wales itu diduga terlibat skandal asmara dengan bekas kontestan Big Brother. Dugaan skandal itu secara “resmi” terungkap setelah seorang anggota Parlemen Inggris dari Partai Liberal Demokrat John Hemming menyebutnyebut nama Ryan Giggs perdebatan di DPR Inggris itu, Senin (23/5). Perdebatan itu sebenarnya menyangkut perlunya merevisi undang-undang tentang privasi di media massa terkait dengan mun-

culnya media sosial semacam twitter atau facebook dan portal berita internet. “Pemimpin Sidang, dengan sekitar 75.000 orang telah menyebut nama Ryan Giggs di Twitter, akan merepotkan memenjarakan mereka semua,” ujar Hemming. Beberapa jam setelah penyebutan nama Ryan Giggs itu, Hakim Pengadilan Tinggi Tugendhat mengeluarkan putusan yang melarang surat kabar The Sun menyebutkan nama bintang sepakbola asal Wales yang dituding berselingkuh itu sebagaimana diatur dalam UU tentang privasi. “Jelaslah bahwa jika tujuan (UU privasi) untuk melindungi rahasia (agar tidak terbongkar) itu telah gagal. Tetapi, tujuannya ialah melindungi sang pemain sepakbola itu dari pelecehan,” kata Tugendhat sebagaimana dikutip The Guardian. Sebenarnya, perselingkuhan Imogen dengan Giggs sudah ramai menjadi topik terhangat di Twitter jauh sebelum terkuaknya kasus ini. Keduanya disebutkan sudah berhubungan selama enam bulan. Mereka sering bertemu secara diam-diam di berbagai hotel mewah. Giggs sudah menikah dengan Stacey Cooke. Pernikahan mereka membuahkan dua anak, yakni Liberty dan Zach

Giggs. Pengungkapan dugaan perselingkuhan Giggs di parlemen itu terjadi selang kurang dari 24 jam setelah pemain tengah MU itu tampil bersama istri dan dua mereka itu di hadapan kerumuman sekitar 76.000 fans MU di Old Trafford dalam euforia perayaan juara Liga Primer. Pada kesempatan tersebut, Giggs bahkan menggendong dua anaknya itu seolah ingin menunjukkan ke para pendukung Setan Merah bahwa dia seorang ayah yang cinta keluarga. Giggs disebut-sebut menghabiskan sedikitnya 150.000 poundsterling (sekitar Rp2,1 miliar) guna membayar pengacara agar perselingkuhannya tetap menjadi rahasia pribadi yang tidak boleh diungkap ke publik oleh surat kabar. Pekan lalu, pengadilan tinggi di London mengeluarkan putusan yang melindungi privasi Ryan Giggs dari pengungkapan namanya ke publik. Hakim Eady mengeluarkan putusan tersebut lantaran yakin bintang MU itu dalam posisi diperas oleh Imogen Thomas. Perempuan itu diduga memeras Giggs dengan meminta uang sekitar 50.000 poundsterling (sekitar Rp700 juta) dan kemudian 100.000 poundsterling (Rp1,4 miliar) sebagai kompensasi agar dia tidak berkoar-koar mengenai

perselingkuhan dirinya dengan bintang sepakbola tersebut. “Itu sudah menjadi alasan

yang memadai untuk tidak memercayai Thomas” ujar Hakim Eady. (m18/ini)


Mode & Masakan

WASPADA Minggu 29 Mei 2011

Kota Medan Kirim Wakilnya Di Ajang TChef Series By Tupperware SETELAH lolos audisi dan mengikuti program lomba di ajang TChef Series by Tupperware yang berlangsung selama tiga hari 20 s/d 22 di Medan, para peserta akhirnya memasak bersama Sisca di Flaza Medan Fair Minggu lalu. Gelaran acara memasak bersama ini sekaligus untuk mendapatkan pemenang lomba. Kegiatan dipadati pengunjung plaza yang nampak sangat antusias melihat program lomba. Bahkan sebelum acara dimulai, Sisca Soewitomo yang berpasangan dengan Irfan Hakim membuatkan masakan sup ala Sisca yang menggunakan bahan asli Medan. “Saya akan siapkan sup ikan. Bahan pelengkap lainnya asli dari Medan yang dikenal mempunyai bermacam-macam aneka sayur dan bumbu pilihan,”kata Sisca penuh semangat ditimpali Irfan Hakim dengan berbagai gaya bicara tentang aneka bumbu sebagai pelengkap masakan. Pengunjung juga dimanjakan oleh Sisca dan Irfan lewat masakannya, sup buatan Sisca yang mengandalkan ikan dipadu dengan sayur mayur diberikan kepada pengunjung yang bisa menjawab pertanyaan dari presenter ternama Irfan Hakim. Banyak pengunjung yang ingin

mencicipi masakan Sisca, tetapi panitia membatasi hanya beberapa orang saja, karena waktu perlombaan akan dimulai. Usai dewan juri memberikan penilaian, maka peserta yang berhak mengikuti kegiatan selanjutnya di Jakarta adalah, Lycku sebagai Top 1. Dia seorang binaragawan asal Jakarta berumur 30-an. Dia lahir dan besar di Lampung lalu memutuskan ke Jakarta untuk mengembangkan karir dan dirinya. Dari kecil dia dilarang oleh orang tuanya menjadi binaragawan namun ia membuktikan bahwa ia bisa. Sejak kecil suka sekali memasak masakan apapun.. Dia tidak bisa ikut kontes Like a Chef di Jakarta krn kebetulan bentrok dengan lomba olahraga yg sedang diikuti, oleh karena itu Lycku bela-belain datang dr Jakarta ke Medan, untuk membuktikan kemampuannya sebagai ahli olah masakan. Sebagai Top 2 : Gherdy H. Putra Pria berpostur tubuh besar, berumur 25 tahun, menjalani pendidikan di bidang perhotelan dan belajar banyak mengenai pastry. Namun, kreativitasnya tak hanya sebatas masakan pastry, dia sangat hobby/ suka pada masakan western, baik main dish ataupun pastry. Gherdy sudah mengikuti kontes Like a Chef

B1

Pastel Buah

Pastel Isi Apel

Bahan : 2 lembar fillo pastry berukuran 60 x 40 cm 3 sdm mentega, lelehkan 250 gr apel hijau cincang 50 gr kismis 100 gr gula pasir 1/2 sdt kayumanis es krim vanila

Gaya Sisca dan Irfan Hakim dan pengunjung yang mencicipi sup ikan sebelum lomba dimulai. di kota audisi Jakarta namun masuk di kategori Top 3 atas putrinya. Pembawaannya tenang dan sangat keibuan nama Lies Nurhayati. hanya berhasil masuk ke 20 dan mengikuti Like a Chef Seorang Ibu cantik umur 44 besar. ini, dia ingin menjadi tahun yang berdomisili di Optimis bisa memberi terkenal dan hasil yang lebih, Gherdy pun Medan ini memang cinta mengembangkan hobby sekali memasak. tak ragu terbang ke Medan memasaknya. Dia memiliki restoran dan akhirnya dia berhasil! ayam di Medan dan Gelar TOP 2 (juara 2) pun Naskah dan foto : berjuang sendiri (single diraihnya. Sementara Anum Saskia fighter) membiayai kedua peserta dari Medan hanya

Cara Membuat : Buat isi apel: campur apel cincang, gula pasir, kismis, kayumanis, masak hingga semua bahan lunak dan matang. Olesi 1 lembar fillo pastry dengan mentega leleh hingga rata, tumpuk dengan 1 lembar fillo pastry, olesi kembali dengan mentega , lakukan hal yang sama hingga habis.3. Potong – potong fillo ber u k u r a n 1 0 x 1 0 c m , letakkan dalam loyang muffin berdiameter 7 cm yang sudah diolesi mentega, tekan hingga terbentuk seperti mangkuk. Panggang dalam oven panas bersuhu 180 derajat celcius selama 20 menit, angkat sisihkan. Isi mangkuk fillo pastry dengan adonan isi apel dan es krim.

Pastel Isi Cherry Bahan: 1/2 cangkir jus buah murni 2 sdk. mkn, selai cherry 1/2 buah apel hijau (kupas dan parut)

Pastel Isi Apel

1 sdk. mkn almond 2 sdk. mkn gula pasir 1/4 sdk. teh serbuk kayu manis 1 btr telur, kocok lepas Pastel 150g mentega, dinginkan dan cincang 2 cangkir tepung terigu 1/4 cangkir gula icing 1 btr telur (ambil kuningnya) 2 sdk. mkn. air es Cara membuatnya: Panaskan oven hingga 200°C/ 180°C Alasi loyang yang lebar dengan kertas roti. Buat Pastel: kocok mentega, tepung dan gula icing sampai berbutir-butir. Tambahkan kuning telur dan air. Proses hingga tercampur rata. Ratakan dan tutup dengan plastik. Dinginkan selama 20 menit hingga lembut.

Campurkan adonan buah, selai dan apel di dalam mangkuk. Gilas pastel hingga setebal 3 mm. Cetak menjadi lingkaran berdiameter 9cm. Buat 16 pastel Taburi masing masing kulit pastel dengan almond panggang . Topping dengan 1 sendok teh adonan buah. Olesi pinggiran kulit pastel dengan air. Lipat sedemikian rupa. Dengan menggunakan garpu tekan ujung ujung pastel. Susun diatas loyang. Campurkan gula dan serbuk kayu manis dalam mangkuk. Olesi permukaan pastel dengan telur. Taburi dengan campuran gula dan kayu manis. Panggang selama 15 menit. Setelah kecoklatan keluarkan. Siap disajikan. * Tri /Taste

Pastel Isi Cherry

Irfan Hakim bersama pengunjung yang diminta komentar dan pertanyaan untuk juru masak Sisca .

Pemenang bersama para juri.


Keluarga

B2

WASPADA

Minggu 29 Mei 2011

Hj Ariany Sinulingga SE

Alirkan Dana Pribadi Demi Kebersihan Lingkungan

Sungai yang dibersihkan bersebelahan dengan tempat tinggal Ariany

Relief yang menggambarkan kisah kehidupan masa lalu hingga meraih sukses

ANDAI saja ada sepuluh atau seratus warga Medan yang tinggal tak jauh dari bantaran s u n g a i d a n p e rd u l i a t a s kebersihan sungai, pastilah tidak ada sampah yang menghambat aliran air sebagai pemicu banjir. Inilah kesan pertama yang ditemui saat bertandang ke kediaman pemerhati lingkungan dan seorang pengusaha di Jalan Murni Medan. Sungai yang dulunya sangat kotor dan menjadi lahan pembuangan sampah ,kini nampak sangat bersih. Meski aliran airnya tidak jernih, namun tidak ada sampah didalamanya. Bahkan, bantarannyapun ditanami berbagai sayuran dan pohon buah-buahan termasuk mangga yang sedang berbuah lebat. Adalah Hj Ariany Sinulingga SE, perempuan yang dikenal sebagai pengusaha dan memiliki biro perjalanan umroh di Medan yang menggagas pembersihan aliran sungai di kawasan Jalan Murni yang tak jauh dari kediamannya. Aliran sungai di bersihkan, pinggirannya dihiasi aneka tanaman bermanfaat dan sayur mayur termasuk padi. Pohon buah seperti mangga, nangka, jeruk nipis,durian dan yang lainnya nampak sedang berbuah di antara pinggiran sungai yang nampak sangat bersih dan asri. Meski awalnya dianggap aneh oleh banyak orang, atas usahanya membersihkan sungai itu, namun dia tetap bersikukuh agar sungai bisa bersih dan bebas dari sampah. Tidak perduli harus mengeluarkan uang berapapun, yang penting ada usaha agar sampah tidak lagi berada dalam sungai dan tidak ada bau menyengat dari aliran sungai ke jalan dan kediamannya. “Sebetulnya, kalau saya berpikir ringkas saja, tentu cukup dengan membuat tembok ting-

gi di samping rumah, pasti sampah di sungai tidak terlihat dan baunya tidak masuk rumah. Tapi sebagai orang yang diberi kelebihan oleh Allah, utamanya rezeki yang berkecukupan dan saya harus memikirkan bagaimana orang lain juga merasa nyaman berjalan di antara bantaran sungai ini, kemudian harus ada manfaat dari lahan bantaran sungai ini, makanya saya harus berbuat sesuatu. Bukankah hidup ini lebih berbahagia jika kita bisa memberikan sesuatu pada yang lain dengan cara kita sendiri dan kita bisa memberi kehidupan bagi apa yang diciptakan Allah. Karena itu sayapun harus berbuat. Caranya, membersihkan sungai itu,” tuturnya. Dia mengakui jika usahanya cukup lama untuk membersihkan sungai ini dari tumpukan sampah. Dulu, sampah menjadi musuh menakutkan baginya dan keluarga, karena banyak lalat dan nyamuk yang sangat mengganggu. Akhirnya dia meminta pekerja khusus agar mau membersihkan sungai meskipun resikonya harus mengeluarkan dana yang tidak sedikit. “Setelah itu, sayapun membeli bibit serai mencapai satu juta rupiah, lalu menanamnya di pinggiran sungai. Pekerjaan itu belum selesai, karena pengirim sampah terus datang dan membuang sampah ke sungai. Tapi saya tidak kehabisan akal, hingga sampah yang dibersihkan itu akhirnya dibuat pupuk dan saya terus menanam berbagai macam tanaman yang menghasilkan,” kata perempuan yang mengaku 10 bersaudara ini. Disebutkannya, usaha membersihkan lingkungan dan aliran sungai agar bebas sampah memang tidak mudah. Namun dia tetap optimis bahwa usahanya ini akan berhasil, se-

perti tekadnya meraih impian sebagai pengusaha sukses. Saat ini, kata Ariany, setelah sungai di sebelah rumahnya bersih, tanaman aneka sayur dan buahbuahan mulai panen, ia merasa sangat bahagia melihat hasil tanaman meskipun harus mengeluarkan dana yang tidak sedikit dalam sistem perawatan, karena dikerjakan oleh beberapa orang. “Bahagia sekali, saya bisa memberikan kehidupan bagi para pekerja yang tugasnya membersihkan sungai dan bercocok tanam. Mereka datang pagi hari dan pulang sore hari, makan siang bersama di pondok teras samping rumah saya dan menikmati hasil tanaman sayur mayur yang mereka petik. Kalau dipikir-pikir berapa harga bayam atau kangkung satu ikat, atau daun singkong dan terong yang enaknya digulai. Tapi nikmatnya hasil panen sendiri menambah poin kebahagiaan yang tidak bisa digantikan dengan uang,” papar perempuan yang mengaku ingin terus berkiprah di lingkungan ini. Disebutkannya, membersihkan lingkungan dan memberi peluang pekerjaan kepada orang yang membutuhkan pekerjaan mendatangkan banyak manfaat untuk dirinya. Salah satunya pendorong semangat hidup dan lebih terbukanya pintu rezeki dan setiap usahanya selalu mendapatkan kemudahan. “Mungkin ini rahasia Allah. Saya divonis dokter mengidap penyakit jantung dan sudah melewati operasi jantung, serta penyakit lainnya. Tapi setelah saya aktif dalam penanganan lingkungan, utamanya membersihkan sungai dan lahan terlantar di dekat kediaman saya, sepertinya penyakit saya hilang. Saat bangun pagi hari saya langsung berpikir, bagaimana kondisi aliran sungai hari

Hj Ariany Sinulingga ini, apa kabar tanaman sayur mayur dan yang mana kangkung serta bayam yang bisa dipetik hari ini. Bersamaan dengan kegembiraan hati saya, relasi bisnis juga memberikan kabar bahwa program bisnis hari ini lancar dan dapat keuntungan. Plong rasanya hati. Ini rahasia Allah. Saya selalu bilang begitu,” kata ibu yang dikenal sebagai motivator dalam bisnis multi level marketing ini. Selain sungai, Ariany juga membersihkan lahan yang kurang terurus di dekat kediamannya. Untuk itu, diapun harus merogoh kantong pribadinya agar semua lahan itu nampak bersih dari tanaman yang kurang bermanfaat.”Saya pikir lebih baik ditumbuhi aneka tanaman bermanfaat. Mungkin saja, padi atau jagung. Kalau panen, bisa diberikan pada karyawan atau siapa saja yang ingin merasakan hasil kebun,” katanya sembari memperlihatkan bangunan taman hias dilengkapi air mancur dan patung hewan di depan rumahnya. Dia juga memperlihatkan halamannya yang luas, dileng-

kapi dengan taman dan air mancur serta air terjun yang menempel di tembok pagar rumahnya. Di antara deretan tembok dinding terlihat relief berwarna keemasan yang menceritakan perjalanan hidup Ariany sejak ia kanak-kanak hingga meraih sukses sebagai seorang pengusaha. Digambarkan pula bagaimana ia mulai belajar usaha dengan membuat peyek yang dijual ke warungwarung, hasilnya dipergunakan untuk sekolah. Bersama saudaranya sejumlah 10 orang, kehidupannya nampak penuh perjuangan. “Sekarang saya ingin menikmati hari-hari bahagia di kediaman saya yang bersih dan asri, banyak pohon dan sesekali tetangga datang sambil berolah raga serta menikmati keasrian lingkungan saya. Mereka mengaku lebih sehat dengan menikmati suasana pekarangan tempat tinggal saya. Alhamdulillah, jika apa yang saya lakukan bisa memberikan manfaat bagi orang-orang di sekitar saya, utamanya pada anak dan cucu-cucu saya,” ujarnya. Naskah dan foto : Anum Saskia

Wanita Penyandang Cacat Miliki Peluang Untuk Mandiri

Kediamannya yang megah dan asri

Ibu Hamil Jangan Lupa Garam Dapur UNTUK urusan masak memasak, siapapun tidak akan lupa pada garam. Khususnya kaum ibu, tidak akan bisa terpisahkan dengan garam di dapur, sebagai kewajiban menyajikan makanan bergizi bagi seluruh anggota keluarga. Tapi lebih dari fungsinya sebagai pelengkap rasa, ternyata garam, khususnya yang mengandung zat iodium adalah penangkal paling mudah dari gangguan fungsi kelenjar tiroid yang sangat berbahaya kesehatan tubuh. Kelenjar tiroid adalah salah satu organ tubuh yang kecil, tapi memiliki peran penting bagi perkembangan tubuh manusia sejak dalam kandungan. Letaknya di pangkal tenggorokan, berfungsi sebagai pengumpul iodium dari darah untuk diproduksi menjadi hormon tiroid. Hormon tiroid inilah yang sangat berperan dalam membantu penyerapan gizi dalam tubuh. Manusia yang kurang hormone tiroid (hipotiroid) karena kekurangan iodium akan terganggu perkembangan fisik dan mentalnya. Saat ini penderita gangguan tiroid di dunia sudah mencapai 300 juta orang. Dari jumlah itu, 5 sampai 8 kalinya di dominasi kaum hawa, khususnya ibu hamil. Gawatnya, ibu hamil yang kekurangan zat iodium bisa melahirkan anak dengan kualitas kesehatan yang rendah. Bayi yang lahir bisa terganggu juga hormone tiroidnya, sebagaimana yang diderita sang ibu. “Anak yang dilahirkan bisa jadi menderita gangguan per-

kembangan. Mereka bisa jadi bertubuh pendek bahkan cebol. Sementara bagi otaknya pun akan sulit berpikir dan akibatnya tidak bisa menangkap pelajaran di sekolahnya dengan baik. Jadi di sinilah benang merah pentingnya garam iodium di dapur dengan ibu hamil. Ibu yang kekurangan iodium bisa melahirkan generasi yang lemah ,” kata Imam Subekti, ahli penyakit dalam yang juga mengepalai Divisi Metabolik Endokrin Departemen Ilmu Penyakit Dalam FKUI-RS Cipto Mangunkusumo, dalam jumpa pers pekan kesadaran tiroid internasional 2011 bekerja sama dengan PT Merck Serono di ruang kuliah penyakit dalam RSCM, Jakarta, Jumat lalu. Saat ditanya mengapa wanita lebih mudah terkena gangguan fungsi tiroid, dr Risa Anwar dari medical direkctor Merck mengatakan disebabkan secara kodrat wanita mengalami siklus haid, hamil, melahirkan dan menyusui. Semua itu memerlukan tenaga lebih dan karenanya butuh asupan gizi lebih. Selain banyak wanita dan ibu hamil kekurangan gizi, banyak juga diantaranya yang tidak sadar bahwa mereka juga mengalami kekurangan zat iodium yang bisa menganggu proses pencernaan makanan. “Para ahli endokrin di dunia setuju bahwa gangguan kelenjar tiroid adalah penyebab utama kekurangan nutrisi bagi manusia. Hal ini sangat besar dirasakan hambatannya

bagi upaya peningkatan kualitas manusia, karena asupan gizi yang terganggu bisa menyebabkan anak-anak tidaak cerdas dan tidak bersemangat. Sementara bagi orang dewasa, gangguan funsi kelenjar tiroid ini akn sangat berpengaruh pada produktivitas kerja,” kata Risa sembari menganjurkan para wanita dan ibu hamil untuk seimbang dalam menggunakan garam dapur yang beriodium itu. Artinya, tidak boleh kurang tapi jangan terlalu berlebihan. Secara kasat mata, ibu hamil yang kekurangan hormon tiroid akan lebih lemah dari biasanya, bahkan hingga melewati masamasa ‘ngidam’ di tiga bulan pertama. Kalau sudah demikian, suami harus cepat-cepat membawa istrinya ke klinik atau puskesmas terdekat. Ibu hamil akan diberi terapi hormon berupa pemberian pil tiroid. Sebaliknya, kalau ibu hamil sering marahmarah, mudah berkeringat dan jantungnya mudcah berdebardebar, bisa jadi dia kelebihan hormone tiroid (hipertiroid) dan harus menjalani terapi dengan minum pil anti tiroid. “Jadi penting mengenali gejala gangguan hormone tiroid ini. Tapi paling mudah mencegah gangguan hormon tiroid ini dengan bijaksana menggunakan garam dapur beriodium. Perempuan yang sadar dan tahu pentingnya iodium bagi kesehatan dan perkembangan kecerdasan putra-putrinya sudah harus memulainya sejak dia memutuskan untuk hamil,” tandas Risa. (dianw)

FORUM Jurnalis Perempuan Indonesia (FJPI) mememberikan peluang bagi penyandang cacat, melalui program pelatihan membuat kerajinan selama 2 hari, Selasa dan Rabu bersamaan dengan kegiatan Pekan Raya Lingkungan Hidup di Lapangan Benteng Medan. Kegiatan didukung Lembaga Kemanusiaan Nasional Program Kemanusiaan Pemberdayaan Umat (PKPU), Bank Sumut, Pelabuhan Indonesia I (Pelindo I) dan Yayasan Bait Al-Hikmah. Menurut Ketua FJPI, Khairiah Lubis, pelatihan kerajinan yang diberikan adalah pelatihan kerajinan daur ulang dari perca menjadi produk yang bernilai jual. “Selama ini yang kita ketahui, banyak penyandang cacat, khususnya wanita yang bekerja sebagai penjahit. Dan mereka memiliki sisa-sisa kain perca yang sangat banyak dan selama ini selalu terbuang dengan sia-sia. Padahal, kain perca tersebut bisa dimanfaatkan untuk menjadi produk bernilai jual,” tuturnya sembari menyebutkan selama ini kesempatan bekerja di perusahaan bagai para penyandang cacat masih tergolong kecil. Padahal Un-

dang-undang No 4 Tahun 1997 mengatur bahwa perusahaan yang memiliki 100 orang karyawan wajib memberikan jatah satu posisi untuk penyandang cacat. Disebutkannya dengan pelatihan ini, diharapkan dapat menjadi bekal penyandang cacat dalam meningkatkan perekonomian keluarga. “Ada 10 wanita penyandang cacat perharinya dan dilakukan selama dua haripameran. Sedangkan untuk hari ke tiga, pelatihan diberikan kepada anggota dan pengurus FJPI,” katanya. Dijelaskannya, bersamaan dengan kegiatan pameran digelar juga foto-foto sebagai bentuk informasi kepada warga agar lebih mencintai lingkungan. “Karena ancaman kerusakan lingkungan kian waktu kian bertambah. Kerusakan lingkungan ini lebih banyak disebabkan oleh pola hidup yang tidak ramah lingkungan dari manusia. Penyebab ini diyakini memiliki andil yang paling besar dalam kerusakan lingkungan hidup. Sebagai organisasi jurnalis perempuan yang independen juga perduli dengan lingkungan, FJPI turut

Waspada/Ist Wanita dengan kebutuhan khusus yang sudah dilatih beragam keterampilan bersama pengurus FJPI usai kegiatan pelatihan. mencoba memberikan pemahaman akan pentingnya menjaga hutan danlingkungan hidup ini terutama untuk perempuan. Sementara itu, Evi Amroeni dari Yayasan Bait Al-Hikmah

mengatakan dalam dua hari, pelatihan diisi dengan pelatihan kerajinan daur ulang yang berbeda setiap harinya. “Hari pertama mereka dilatih menghias toples bekas permen dengan menggunakan

kain perca. Kemudian di hari kedua dengan menggunakan kain perca juga, wanita cacat dilatih membuat aksesori atau souvenir pernikahan,” tuturnya. (m37)

Dapatkan Informasi Yang Benar Tentang Kesehatan Reproduksi KAUM perempuan perlu mendapatkan informasi yang benar tentang kesehatan dan hak-hak alat reproduksinya. Hal ini sebagai bentuk kepedulian terhadap pemeliharaan dan perencanaan terkait alat reproduksi itu sendiri, termasuk usia yang tepat untuk melahirkan. Sebab kesehatan reproduksi itu tidak bukan semata bergantung pada program keluarga berencana saja. Demikian antara lain terungkap dalam workshop tentang perempuan perlu dapatkan akses yang benar tentang kesehatan reproduksi dilaksanakan PKBI bersama Amnesty Internasional Senin lalu di Hotel Dharma Deli Medan. Pembicara Roy Tjong dari PKBI Pusat menyebutkan, mengetahui dengan benar tentang kesehatan reproduksi seperti yang tertuang dalam Hak Kesehatan Reproduksi dikemukakan ICPD 1994, bahwa setiap pasangan berhak untuk menikmati standar pelayanan kesehatan reproduksi yang

optimal dan setiap pasangan berhak menentukan fungsi reproduksinya terbebas dari paksaan, kekerasan dan diskriminasi. “Untuk itu sangat perlu didapatkan informasi yang benar bagaimana seharusnya pasangan itu menentukan kapan mereka membuat perencanaan mempunyai anak. Karena saat kehamilan dan persalinan itu banyak hal yang harus dipersiapkan. Setidaknya ada 30 persen ibu hamil belum menerima asuhan persalinan oleh tenaga terlatih. Bahkan 50 persen persalinan belum dilakukan di fasilitas kesehatan, kemudian 70 persen tidak menerima pelayanan nifas oleh tenaga kesehatan terlatih dalam 1 sampai 6 minggu pasca persalinan,”kata Roy Tjong. Sedangkan Josef Roy Benedict dari Amnesty Internasional yang berorientasi pada pemenuhan komitmen HAM Indonesia terhadap kesehatan reproduksi menyebutkan hak seksual dan reproduksi antara lain pentingnya akses pendidikan kesehatan

Pembicara bersama moderator Rahmadani Hidayatin PKBI Sumut saat kegiatan workshop berlangsung. seksual termasuk untuk anak dan para remaja. Karena itu akses terhadap layanan kesehatan seksual dan reproduksi bukan hanya diberikan kepada pasangan yang akan menikah, tetapi perlu secara keseluruhan. Peran Keluarga Peran keluarga sangat besar dalam penyampaian akses yang benar kepada setiap anak dan remaja untuk mendapatkan akses yang benar tentang kesehatan reproduksi. Hal ini

sebagai antisipasi bagi anak utamanya kaum remaja agar tidak menyalahgunakan alat reproduksinya. “Orang tua harus bertanya pada anak perempuannya apakah dia sudah menstruasi kemudian menceritakan bahwa saat ini dia sudah mempunyai alat reproduksi aktif dan bila dibuahi oleh sperma maka dia akan hamil. Demikian juga pada anak laki-laki, jika dia sudah mimpi basah, maka alat reproduksinya sudah berfungsi.

Karena itu harus dijaga dengan baik hingga dia boleh menggunakannya, yakni saat sudah berumah tangga atau menikah. Jika penjelasan seperti ini disampaikan secara gamblang pada anak, mudah-mudahan mereka bisa menjaga alat reproduksinya,”kata Dr Cristofel sebagai peserta diskusi menjawab kehawatiran orang tua terhadap anak remaja yang rentan terjerumus pada prilaku kehamilan tidak diinginkan. (m37)


Cemerlang

WASPADA Minggu 29 Mei 2011

B3 Puisi Puisi

Langitku (1) Cerpen

Karya: Yuliani

Salahkah Aku

Rahimah, SAg

Kebisuanmu menimbulkan kegelisahan hatiku Tatapan mata tajammu menyudutkan diriku Salahkah aku.... Tak ada jawaban darimu Hanya wajah kesalmu yang ku lihat Tak mengerti diriku dengan sikapmu Sungguh.... Engkau membinggungkanku

LANGIT masih merah ketika aku menepi di pinggir sawah, turun dari Bus yang telah membawaku dari perjalanan panjang yang memuakkan. Kuhela napas panjang, semua masih sama ketika ku tinggalkan kampungku, sawah, langit, surau di sudut sawah yang masih remangremang karena listrik yang kurang arus dan udara yang dingin jika malam menjelang, panas ketika siang meradang. Kutarik napas sepenuh dada, kunikmati sebentar dan kuhempaskan seperti membuang luka yang tengah kubawa. Kulangkahkan kaki, kubayangkan Nyak… orangtua itu pasti akan terperanjat melihatku, duhai… indahnya melihat mata ibuku yang berbinar bahagia, menyambut aneuk agam semata wayangnya pulang dari perantauan nun jauh di sana. Tak sabar aku untuk segera melihat ibuku, perempuan paling cantik yang pernah kukenal sebelum aku mengenal Andini. Langkah kaki yang panjang mengantarku ke depan Nyak, Ibuku.. “Nyak…,” kusapa perempuan yang masih dalam balutan mukena duduk bersimpuh memegang tasbih. Dia berpaling kearahku dan ya Allah… aku melihat wanita yang masih cantik itu berbinar… terbelalak.. dan sangat bahagia. Tangannya terbentang menyambutku, memelukku dengan kuat dan hangat, menyiumku dari segala arah, ah Nyak… aku sudah dewasa. Desisku dalam hati sambil menikmati momen itu. “Ka lheuh semayang Zar?” Tegur Nyak yang mengingatkanku bahwa Magrib akan segera beranjak dari langit. Aku menggeleng mengisaratkan pada Nyak bahwa aku belum melaksanakan kewajibanku. “Jak tueng ie semayang ajuleh…bek ka tinggai semayang dak kajak ue nangroe gob.” Itulah nasehat Nyak yang tak pernah kulupa kemanapun aku pergi, jangan meninggalkan sholat kemanapun aku pergi. Duhai Ibu… pancaran cantikmu benar-benar dari dalam, indahnya. Aku, adalah bungsu dari empat orang anak Ibu dan Ayahku. Tiga kakakku adalah perempuan, sudah berkeluarga, punya anak dan tinggal tersebar dikota negeri ini. Ayah, yang biasa kami panggil Abu telah enam tahun wafat sementara Ibu yang biasa kami panggil Nyak tinggal bersama Rukiah, seorang wanita berusia empat puluh tahun yang kehilangan seluruh anggota keluarganya saat tsunami meluluh lantakkan semua yang dimilikinya. Ketika aku meninggalkan kampungku, Nyak adalah wanita paling hebat dan kuat melepasku, walau aku tahu gemuruh pedih berkecamuk di dadanya. Dulu, aku selalu diwanti-wanti Abu untuk meneruskan usaha di kampong,

mencari istri shalehah, mengurus Nyak sampai ajal menjemputnya. Tapi.. apa yang bisa dilakukan usaha yang hampir tidak lagi dibutuhkan orang? Kilang padi bukanlah menjadi kebutuhan petani di kampong kami lagi. Sekarang, pengusaha lebih inovatif, ada penggiling yang bisa mampir di pekarangan rumah penduduk, menggiling padi sesuai kebutuhan, menjadi tontonan yang mengasyikkan plus tak perlu repotrepot memanggul goni ke kilang, nikmat bukan? Kini, kilang padi di samping rumah kami yang besar hanyalah seonggok gudang, menyimpan aneka besi berkarat. Aku ingin bangkit, tapi Nyak dan ketiga kakakku lebih menyetujui jika aku pergi keluar kampong, menuntut ilmu, yang kata mereka lebih berharga daripada harta. Ilmu yang dapat mengangkat harkat dan martabat, ilmu yang membuat kita punya derajat di mata Tuhan. Betapa bersyukurnya aku, hidup dalam keluarga yang menjunjung pendidikan. Dua kakakku sudah menjadi dokter dan yang satu guru. Mereka adalah contoh luar biasa untukku, punya suami saleh dan berkecukupan, punya anak sehat dan menggemaskan. Ah…. Betapa rindunya hati ini pada ponakan. “Zar… , kapan sampe kampong?” Terkejut aku mendengar sapaan seseorang di telingaku, sangat dekat sehingga aku dapat merasakan desis nafasnya, aku menoleh dan sangat terkejut. Sahabat kecilku Badrudin cengar-cengir, menunjukkan giginya yang khas dan bahasa Indonesianya yang totok Aceh. Ku tonjok bahunya, balas tersenyum. “Kemarin…,” jawabku ringan sambil menggeser duduknya, memberinya tempat untuk duduk. “Libur kuliah…?” “Enggak….” “Tak ada libur, napa pulang…,” Badrudin menatapku penuh selidik, mimiknya sangat lucu tapi aku tak ingin tertawa. Haruskah aku menceritakan semua pada sahabatku yang sudah berkarat di kampong ini? Tak pernah keluar dan tak punya pendidikan? Bayangan Andini menari-nari dipelupuk mataku, dia mencibirku… pedih sekali. “Aku sakit hati Din…,” katakata itu keluar dari mulutku, meluncur begitu saja.

Malaikat Kecil Desir suara air begitu menenangkan hati Tiupan angin membisikkan telinga Tatapan mata yang berbinar bagai panah menembus hati Lemparan senyum tak mampu ku tepis Dirimu bagai malaikat kecilku Yang membawaku dalam suasana hati bahagia Karya: Elprida Br Ginting

Usai Sajak-sajak dipintal oleh mulut rindu Tertangkap bayang-bayang menerawang Libaskan siksa Meluapkan asa dari balik kekuatan jiwa Kerinduan yang tak sempat ku kabarkan lewat angin Ku ukir di tubuh jati rimbun di ladang kita Agar esok dapat kau jadikan pondasi gubuk cinta Karena ku merasa waktuku t’lah habis Dan bila nanti kau t’lah tiba Berkunjunglah kepusaran ku Sekedar melihat guratan cinta di setiap bulir-bulir tanah merah

Malu “Sama siapa?... Dosenmu?” “Perempuan Din… Namanya Andini,” kujawab dengan pedih, suaraku bergetar. Badrudin terbahak-bahak sampai air matanya keluar, dia tertungging-tungging menertawakan aku, melihat mukanya aku mau muntah. “Apanya yang lucu dodol!!,” intonasi suaraku naik beberapa oktaf, panggilan olok-olok Badrudin adalah dodol, dia tak pernah marah, aku tak pernah melihatnya marah. Benar, tawanya tambah keras.. aku tambah meradang, aku benarbenar muntah. “Bodoh kali kau, gara-gara inong kau pulang, libur kemaren kau tak pulang. Zar.. Zar, ngapain kau jauh-jauh kuliah kalau masih bodoh ha?? Piker pakai otak…,” Badrudin menuding-nuding aku, matanya melotot, giginya tambah tampak keluar seakan-akan dialah orang yang paling pintar. “Maaf Zar….maksudku… kenapa sakit hati?” Syukurlah Badrudin menyadari itu. “Dia putuskan aku, dia gak mau jadi pacar aku lagi..,” aku tertunduk lesu, tubuh sahabatku terasa berguncang, aku sadar betul dia sedang menahan tawa, dasar lajang karat tak pernah kenal perempuan, desisku. “Kau cinta sama dia?” Suara sahabatku terasa sangat halus, serius dan penuh selidik. “Iya… cinta mati,” tak ada yang perlu kusembuyikan. “Cinta karena apanya…?” Berondong Badrudin, sahabat-

Apa Yang Salah? Cerpen

“HAHAHA … yang benar saja, hahaha … lihatin tuh gayanya persis bintang Bollywood.” “Emang tak boleh apa? Wajar aja kan Bang seseorang itu punya selera musik Bollywood!?” “Hahaha … wajar? Luculah dan malu-maluin … aku udah kekeh sampai sakit perut gara-gara video

Elpi Sinaga

itu.” “Yeah … Abang juga berhak kan punya selera musik apa pun. Apapun aliran musiknya ya tergantung kita mengapresiasikannya. Tak ada musik rendahan atau murahan yang ada itu manusia yang menilainya saja yang memiliki nilai rendah terhadap apresiasi

musik bukan musiknya!” “Alahhh … Man, tak usah sok lah. Bilang aja kau juga suka Bollywood accaacca-acca, nehi-nehi-nehi, Huahahaha … ada-ada aja kau ini bah!” “Ya emang kenapa kalau suka musik Bollywood Bang, apa salahnya? Musik untuk diapresiasi kan!”

ku itu. Aku terdiam… bingung untuk menjawab, ya.. apanya? Melihatku diam, Badrudin bangkit dan merasa menang. “Pikirkan dulu kau cinta dia karena apa, aku mau pulang sholat maghrib, besok pagi kita jumpa di la’ot, kau boleh cerita apa saja oke…!!” Badrudin menepuk-nepuk bahuku yang dianggapnya pesakitan, la’ot yang dimaksudnya adalah laut. Badrudin suka mencampur bahasa Indonesia dan bahasa daerah, tapi siapa peduli. Langit memerah, hatiku merah, mataku merah, darahku tambah merah. Aku bangkit meninggalkan sawah yang dihiasi padi berwarna keemasan kemilau ditimpa matahari menjelang gelap. Keindahan yang tak pernah kusadari sebelum aku kuliah di Kota Medan. Perempuan itu Andini , putih, tinggi semampai, rambut panjang dan punya senyum menawan. Andini adalah tipikal perempuan kota yang sangat menjaga penampilan, rajin perawatan ke salon dan sangat mengikuti fashion. Aku paham betul akan kebiasaannya selalu menyikat gigi setelah makan karena takut senyumnya cacat karena ada sesuatu yang menempel di gigi bagusnya. Singkat kata, Andini layaknya seorang model. Sebenarnya, aku sering jengah pergi bersama Andini karena penampilannya yang fashionable itu. Jika aku protes, dia cuma tertawa memperlihatkan giginya yang cantik, mencubit pipiku

dan menggandeng tanganku pergi. Aaah.. Andini. Aku pernah bertanya, mengapa dia memilih aku menjadi pacarnya dari sekian banyak lelaki? Dia menjawab ringan karena aku adalah lelaki Aceh yang ganteng, gagah, punya kulit coklat laksana tembaga, hidung tinggi menjulang dan mata tajam bagai elang dan katanya lagi.. lelaki Aceh tangguh dan pantang menyerah, hehe.. cuping hidungku kembang kempis senang. Belakangan, Andini sering bertanya mengapa aku tidak memilih kuliah di kedokteran saja seperti dua kakakku. Andini heran mengapa aku justru memilih kuliah di Pendidikan dan bercita-cita menjadi guru. Hampir setiap hari aku diteror Andini, setiap hari sudah kujelaskan bahwa aku suka menjadi guru, setiap hari Andini tak pernah mengerti. Andini semakin menjauh, senyumnya tak lagi indah, tawanya tak lagi renyah, matanya tak lagi teduh . Akhirnya Andini menjumpaiku dan hanya berkata. “Zar… kita putus ya!!!” Aku terdiam bodoh diantara temanteman yang lagi makan siang di kantin kampus. Andini menyalamiku sambil tersenyum datar, mengangkat tangan bye…melenggok pergi. Utoyo temankuyanglagimakanbangkit dengan marah sambil teriak “Kuntilanaaaakkkkkk….” dibantingnya sedotan yang ada di gelasnya, syukur bukan gelas. Utoyo merepet-repet seperti ibu

merepet pada anaknya yang nakal, tulangku terasa copot dari sendinya. Tuhan… aku baru ini mengenal perempuan, itu adalah Andini. Mengapa jadi gini?... mataku terasa panas, mengapa aku jadi cengeng dan berada pada posisi yang kalah? Aku kan lelaki, seharusnya aku yang menang, bukan dia!!! “Tenang fren…nanti kita buat pembalasan sama kuntilanak itu…,” betapa marahnya Utoyo. “Enggak usah.. biar aja,” kujawab tenang mencoba untuk kuat. “Dia enggak cocok sama kau Zar… kesing aja yang bagus, isinya rongsokan semua!!”, timpal Manalu dengan kasar. “Bersyukur Zar.. kau diputusin sama dia, kalau diterusin bangkrut kau belanjain dia. Mati bediri Mamakmu di kampong,” balas Rendi. Aku merinding... kalau teman-teman benar, betapa bodohnya aku. Seburuk itukah Andini di mata mereka? Atau butakah aku selama ini? Itu adalah hari terburukku setelah kematian Abu, ayahku. Malam setelah itu aku tak bisa tidur, paginya aku langsung pulang kampong, hape ku non aktifkan. Aku tak dapat membayangkan betapa cemasnya sahabatsahabat baikku. Biarlah… aku perlu waktu untuk menenangkan diri. Betul kata orang, cinta dapat membuat orang buta dan gila, aku adalah satu korbannya, peuhhhhhh. (Bersambung…)

“Dari tadi ngomongmu apresiasi, apresiasi, dan apresiasi. Tahu apa sih kau tentang musik? Oke, oke sekarang aku tak mempermasalahkan musiknya tapi kita ke objeknya, seorang polisi, Man. Seorang polisi, nyanyi lagu Bollywood bah sambil nari pula … huahaha… benar-benar hmmmm … pokoknya … hanya aku lah yang tahu …!” “Mau presiden, raja, perdana menteri, hakim, jaksa, panglima perang, algojo, pencopet, pembunuh, pelacur, penjilat dan apapun itu, ya sah-sah saja kan punya selera musik apapun juga. Ya … ga usah terlalu merendahkan!” “Bah … mana ada aku merendahkan siapa-siapa! Hati-hati kau bicara!” “Ah … Abang jangan membentak begitulah, takut aku Abang buat!” “Kau ini sok musisi kelas dunia kulihat, dari tadi ceramah apresiasi, bosan aku dengarnya. Kau lihat dulu, dia itu abdi negara tapi malu-maluin huahahaha… atau janganjangan kau ini Man tak punya selera humor ya? Kau tak ketawa kulihat!” “Bukan tak punya selera humor Bang, aku malah memberikan apresiasi yang bagus untuk dia, gara-gara dia setidaknya kesan wajah garang polisi sedikit berkurang!” “Bah, terus apresiasi aja yang kau bilang dari tadi!” “Ya … Abang jangan begitulah!” “Ketawa dulu kau kulihat, biar yakin aku

kalau kau punya selera humor. Apa pulalah apresiasi itu? Belum pernah aku jumpa sama si apresiasi itu. Kenalkan dulu aku sama si apresiasi itu, siapa tahu kami jodoh!” “Hahaha … Tak mungkinlah abang ketemu si apresiasi!” “Bah bisanya kau ketawa rupanya. Udah yakin aku, kau pasti ketawa garagara video itu kan! Kau tak usahlah malu-malu.” “Bukan video itu yang aku tertawakan Bang, tapi Abang!” “Menghina kali kau ini bah sama aku. Apaku yang lucu, kukampak sekali bisa mati kau, tapi tak jadilah nanti masuk penjara pula aku!” “Abang ini tak bisa diajak becanda tapi ngakunya punya selera humor tinggi!” “Tapi jangan aku yang kau buat bahan humormu!” “Jadi, kenapa Abang buat polisi yang lips sing Bollywood jadi bahan humor?” “Yang itu lain ceritanya, tapi itu memang benarbenar lucu dan memalukan!” “Memalukan? Abang saja barusan bilang mau jumpa sama si apresiasi, bawa-bawa kalau jodoh pulalah Abang ini!” “Kudengar namanya cantik, kurasa orangnya juga cantik itu!” “Huahaha …! Si apresiasi itu bukan manusia Bang!” “Jangan nakutnakutinlah kau ini.”

“Bukan nakut-nakutin Bang, tapi si apresiasi itu benar-benar bukan manusia.” “Betul-betulanlah aku ambil kampak kalau kau tak mau terus terang. Ayo bilang! Siapa si apresiasi itu? Kau kira aku takut ha! Biarpun dia bukan manusia aku akan hadapi dengan jantan!” “Abang, Abang, apresiasi itu Bang artinya penghargaan atau penilaian kita terhadap sesuatu, ya termasuk musik Bollywood tentunya!” “Bah itunya, kukiranya tadi perempuan cantik apresiasi itu.” “Makanya Bang, belajarlah menghargai apapun itu, tak terkecuali orang dalam video itu Bang. Wajar aja dia suka Bollywood. Polisi kan juga manusia Bang. Sama kayak Abang yang suka musik rock metal.” “Betul kali kau ini bah, apa bedanya Bollywood dengan rock metal dan musik lainnya? Sama-sama diciptakan dengan nilai seni yang tinggi!” “Gitulah Bang pintar kali Abang! jadi tak salah kan polisi suka Bollywood!” “Betul kau ini Man, tiap orang berhak punya selera musik apapun!” “Nah … kalau Abang bilang gitu, akupun setuju kali sama Abang.” “Ayolah kita lanjutkan main kartu , Tiur kau pasanglah lagu India, biar menang Abang kau ini, kalau uangnya cukup jalanjalanlah kita ke Tajh Mahal.”

Aku malu pada cermin saat mata ku beradu pada mata kosongnya Aku malu pada genangan air yang tiada henti menatap bayangku Aku malu pada mentari yang senantiasa menyorot perih hidupku Aku malu pada bumi saat kaki menghentak jantung harapku Karya: Sri Utari

Sajak Hitam Ketika sajak hitam ditulis Hari-hari selalu diselingi rasa pilu Air mata…. Seakan silih berganti mengalir Selaras dengan luka di hati Ketika sajak hitam ditulis Tak ada lagi suka dalam sepi Mengejar mentari Bagaikan merangkak Seribu kaki

Bawalah Keluhku Oh angin… Bawalah keluhku bersamamu Melewati pegunungan biru Menyebrangi lautan sendu Bawalah ia.. Agar menjadi butiran embun Di talas yang naif Yang eloknya tertutupi kabut pagi Yang masih suci Karya: Nurwidasari Lubis

Sang Pujangga Sang pujangga langsirkan gelisah, canda dan tawa Dengan pena cair berlapis emas Dia menari-nari di atas kekosongan lembaran-lembaran hati Mengukir segala yang tersirat dan tersurat Berharap Tuhan menjawab ukiran itu dengan limpahan kasih dan ridha-Nya

Cahaya Cahaya itu membias sudut kornea mataku Menyilaukan namun begitu hangat Hingga menembus kediaman hatiku yang mulai membeku Cahaya apakah yang mampu melunturkan kebekuan hatiku ini Cahaya keimanan saudara-saudarakulah yang ternyata mampu menyihirku Dan mampu memancingku memancarkan cahayaku Karya: Liandi Prassetiyadi

Pelangi Bila saja aku bisa menghitung warna pelangi di langit sana dengan deret barisan sigma akan kupenuhi segala ingin hatimu agar kisah tak lagi membeku cukup nantikan setelah aku kembali dari singgasana awan

Qadar Tak bisa kuhindari hari yang berganti lagi mungkin hanya sampai di sini aku menjelma sebagai sepi sebagai sunyi aku harus menguak tabir sebelum waktuku dikutuk takdir Karya: Kholilah Amriani Harahap

Tutup Senyummu! Percuma mentari bersinar Jikalau petir menghentak Gelap membendung pikiran Teriris dan robek dalam kalbu Mungkin kau tak tahu Kalau petir itu menyentuh kalbuku Mungkin kau tak mengerti Detik berjalan seolah menghajar keadaanku Tutup Senyummu! Takkan merubah pahamku Buang jauh kesalahan itu Sebelum ku injak dan remukkan hatimu


Pelangi

B4

WASPADA Minggu, 29 Mei 2011

PG-TK Diamond Kids School YPSA Terapkan Pembelajaran Berbasis Sentra Kepala TK Riau Berkunjung UNTUK melihat keberhasilan PG-TK Diamonds Kids School, kelompok kerja kepala taman kanak-kanak Kec. Tualang, Kab. Siak, Riau kunjungi PG-TK Diamond Kids School YPSA, Kamis lalu. Kunjungan diawali dengan penyambutan oleh Ketua Harian Dra Nunuk Priyani, MSc, Kepsek PG-TK Diamonds Kids School YPSA Indah Indah Permata Sari, ST, SPd, Kaur Umum & Humas dan PKS 3. Kemudian dilanjutkan dengan penjelasan dari Pengawas Taman Kanak-Kanak Yuliar S.Pd mengenai tujuan kunjungan mereka yaitu ingin melakukan studi banding tentang penerapan “Pembelajaran Berbasis Sentra”sekaligus menyambung tali silaturahmi. Menurut Kepsek PG-TK Diamonds Kids School YPSA, para kepala sekolah sangat antusias dengan pembelajaran dan sarana & prasarana di PG-TK YPSA. Dilanjutkan dengan keingintahuan mereka tentang penerapan kurikulum (lokal, nasional, Depag, internasional) sehari-hari. “Guru-guru di setiap sentra tak luput dari rasa ingin tahu para kepala sekolah yang juga ikut menjelaskan tentang kegiatan di sentra masing-masing. Sepertinya para kepala sekolah itu sangat ingin menerapkan pembelajaran berbasis sentra di sekolah mereka masing-masing,” kata Indah. Menurut Indah, selama ini kekurangan jumlah kelas adalah salah satu kendala dalam penerapan pembelajaran berbasis sentra.Dengan kunjungan ke PG-TK Diamond Kids School YPSA para kepala sekolah mendapatkan gambaran tentang apa-apa saja yang harus disiapkan untuk menerapkan pembelajaran berbasis sentra, karena kegiatan sentra tidak hanya harus dilakukan di dalam kelas, tetapi juga dia luar kelas. Kunjungan juga berlanjut pada kunjungan para peserta rombongan ke Raz Gallery yang juga disambut dengan sangat antusias.(m43)

Waspada/dede

PARA Kepala TK tampak sedang berbaur dengan para siswa PGTK Diamonds Kids School ketika melakukan kunjungan ke YPSA, Kamis lalu.

Camping Mandiri TK An Nadhif Melatih Anak Berani Dan Mandiri JIKA melihat anak kita mandiri dan berani di ajang pertunjukkan kreativitas atau berani pergi sekolah tanpa di tungguin orang tua, tentu kita akan senang. Memang mandiri dan berani bukan hanya bermanfaat sesaat tetapi akan bermanfaat juga ketika si kecil menginjak dewasa. “Anak yang mandiri biasanya berani dan anak yang berani tidak semuanya mandiri. Manfaat melatih mandiri dan berani memangbanyakkeuntunganseperti mereka dapat menganalisa, bertanggungjawab, mengembangkan daya tahan mental, life skill, dan mengembangkan pikiran kritis,” Muliana ketika menggelar Camping Mandiri di TK An-Nadhif Jl. Madio Santoso, No. 115 Medan, kemarin. Dengan keuntungan demikian besar tersebut, lanjutnya, pihak yayasan menggelar Camping Mandiri bagi siswa taman kanan-kanakBpadaakhirsemester. “Acra ini diikuti sebanyak 31 murid kelas B untuk menanamkan pemahaman kemandirian,”

ujarnya. “Melatih keberanian dan kemandirian itu harus berjalan secara simultan antara sekolah/ gurudanorangtuasebagaipatner didik dan semuanya harus dilakukan secara bertahap tidak bisainstansehinggamemerlukan proses dan waktu,” lanjutnya. Kali ini, lanjutnya, anak-anak akan terjun langsung melakukan perkebun, shalat berjamaah bersama, makan sendiri, dan cuci piring sendiri, serta berbagai kegiatan lainnya yang bertujuan untuk menumbuhkan kepercayaandiri,melatihtanggungjawab, member contoh yang nyata, dan pengalaman. “Kedepan kita berharap

mereka akan tumbuh menjadi anak yang cerdas, kreatif, dan beriman, serta hormat kepada orang tua, guru, dan saying terhadap teman-temannya,” ujarnya. Karena dengan mereka mandiri, lanjutnya, mereka akan belajar menganalisa dimana mereka terbiasa untuk mandiri dan berani, dia akan berkembang kemampuan untuk menganalisa suatu kejadian. Dia akan memahami sesuatu dari akibat, sebabakibat, aksi reaksi, dan sebagainya.Meskipundidalampemikiran yang sederhana. “Bertanggungjawab dimana sifat untuk lebih bertanggungjawab terhadap apa yang dilakukannya . Serta mengembangkan daya tahan mental karena terlahir mereka memiliki insting untuk berekplorasi, seperti ketika dia melihat sesuatu atau seperti mencari sesuatu. Tetapi kadangkadang kita membatasi‘kegiatan’ itu , jika kita bisa mema-haminya, si anak dapat mandiri dan berani sertadapatmeningkatdayatahan mentalnya,” lanjutnya kembali. * Hamzah

Menghubungkan Titik

Adik-adik, berikut Redaksi memuat cerita-cerita berkaitan tentang malaikat. Malaikat adalah makhlukAllah yang taat dan setia kepada Nya. Semoga bisa menambah wawasan dan menambah keimanan kita pada kekuasaan Allah SWT.

Jibril Mengabarkan Tentang Siksa Allah KETIKA Nabi Yahya as mendengar cerita ayahnya tentang siksaan itu, maka beliau pun dengan cepat bangkit berlari keluar sambil menangis dengan berkata :”Aduh Sakraana” aduh “Ghadhbaan.” Begitu Nabi Zakaria melihat anaknya lari keluar maka beliau melompat mengejar NAbi Yahya as diikuti isterinya. Setelah Nabi Zakaria dan istrinya gagal mencari Nabi Yahya as maka Nabi Zakaria as pun bertanya kepada penggembala kambing yang berada di dekatnya. “Apakah kamu melihat seorang anak muda yang wajahnya seperti ini dan begini?” Penggembala kambing berkata : Apakah kalian berdua mencari Yahya?” Nabi Zakaria : “Ya, memang benar kami mencari Yahya.” Berkata penggembala kambing lagi : “ Sebenarnya Yahya ada dekat gunung itu, tetapi saya dengar Yahya sedang berkata dia tidak akan makan dan minum sampai dia ditunjukkan tempat tinggalnya di surga atau neraka.” MAka pergilah Nabi Zakaria bersama istrinya ke atas gunung yang ditunjukkan dan dilihatnya Nabi Yahya sedang berdoa. Lalu Nabi Yahya as berkata :”Wahai anakku, demi sesuatu yang perutku mengandungkanmu sekian bulan dan demi sesuatu yangbuah dadaku menyusuimu sekian lama marilah kita pulang ke rumah bersama.”.

Kupon Seri

Bersambung**m31/Darul Nu’man

V Tempel DiAmplop

Sayembara Mewarnai Berhadiah Hadiah I : Rp75.000 + Hadiah II : Rp50.000 + Hadiah III : Rp25.000 + Untuk harapan I s/d mendapatkan bingkisan dan sertifikat.

sertifikat sertifikat sertifikat III akan

Syarat-syarat peserta 1. Peserta bebas menggunakan alat pewarna apa saja. 2. Peserta terbatas hingga kelas VI SD, menyantumkan nama, alamat yang jelas 3. Sudah sampai di meja redaksi selamat-lambatnya tanggal 31 Mai 2011 Nama Sekolah Alamat

Mengisi Kotak

: .............................................................................. : .............................................................................. : ..............................................................................

Isilah kotak-kotak ini dik dan adik telah dibantu dengan satu huruf, jangan salah mengisi ya. Silahkan dicoba.


Potret

WASPADA Minggu 29 Mei 2011

B5

Waspada/Surya Efendi

Civitas akademika Universitas Al-Azhar Medan menyambut kedatangan Aster Panglima TNI, Mayjen AY. Nasution beserta istri Hj. Hanum Siregar di kampus Al-Azhar Medan.

Waspada/Hang Tuah Jasa Said

Aster Panglima TNI, Mayjen TNI A.Y. Nasution didampingi istri, Hj. Hanum Siregar ramah tamah dengan masyarakat di lokasi Pencanangan Bakti Sosial KB Kes Percepatan Pelaksanaan Revitalisasi Program KB Kerjasama TNI dengan BKKBN di kota Sibolga.

Ketika Sang Jenderal Pulang Kampung Asisten Teritorial Panglima TNI, Mayjend TNI AY Nasution sejak Rabu (25/5) hingga Minggu (29/5) hari ini, keliling sejumlah daerah di Sumatera Utara dengan banyak kegiatan.

Waspada/Surya Efendi

Aster Panglima TNI, Mayjen AY. Nasution dikenakan pakaian adat Melayu oleh Wakil Bupati Deli Serdang Zainuddin Mars.

Jenderal bintang dua ini pulang kampung mengunjungi berbagaidaerah.DimulaidariUniversitas Al Azhar Medan pada hari Rabu (25/5). Mantan Danrem Lilawangsa, Lhokseumawe, Aceh ini meng-gelar kuliah umum dihadapan para mahasiswa. Beliaujugamenyerahkanbantuan sarana kontak untuk kampus ini. Usai dari Al Azhar, AY Nasution dan rombongan menuju Kab.Batu Bara. Disini beliau meletakkan batu pertama pembangunan panti asuhan AlWashliyah. Lalu berangkat ke Sibolga dan kemudian menuju Deli Serdangdalamrangkaiankegiatan dan bakti sosialnya diantaranya Pencanangan Bakti Sosial KB Kes Percepatan Pelaksanaan Revitalisasi Program KB Kerjasama TNI dengan BKKBN. Hari ini, Minggu (29/5), AY Nasution direncanakan kembali untuk melakukan bakti sosial di Kota Medan. “Kunjungankebeberapadaerah ini hanya merupakan bentuk melepas rindu akan tanah kampung halaman yakni di Kota Medansekaligusprogrambaktisosial TNI. Mudah-mudahan kami nantinya akan datang ke daerah-daerah lain di Sumatera Utara yang belum sempat dikunjungi,’’ tuturnya. Jenderal beristrikan Hj Ha-

num Siregar dengan dua puteri ini juga mengatakan hilangnya rasa kepedulian dan kesetiakawanan sosial di tengah masyarakat saat ini, sesungguhnya merupakan kehilangan jati diri dan karakter bangsa yang memiliki falsafah hidup Pancasila. Mengingat perkembangan globalisasi, kemajuan teknologi dan informasi yang semakin terbukadanbebas,sesungguhnya selain berdampak positif, juga berdampak negatif yang dapat mengikis jati diri dan merusak karakter bangsa kita. Hendaknya kita sadari bersama, kehilangan jati diri dan karakter bangsa sangat berbahaya bagi eksistensi kita sebagai suatu bangsa yang bermartabat dan berdaulat. “Sebagaimana kita liat bersama-sama melalui media masa maupun yang langsung terjadi di tengah-tengah kehidupan kita, rendahnya rasa kebersamaan, hilangnya sikap saling menghargai dan rasa pedulian dengan sesama, meningkatnya peredaran dan konsumsi narkoba di kalangangenerasimuda,tawuran antar pelajar, tawuran antar kampung, mengakibatkan rusaknya mental dan karakter bangsa. Walaupunkitaberbeda-beda, hidup dalam kebersamaan dan berkesetiakawanan sosial itu sangat indah,” tuturnya.(m46

Waspada/Surya Efendi

Aster Panglima TNI, Mayjen AY. Nasution meletakkan batu pertama pembangunan panti asuhan Al Washliyah Batu Bara.

Waspada/Surya Efendi

Aster Panglima TNI, Mayjen AY. Nasution berbicara dengan seorang ibu yang mengikuti program KB di Akper Medistra Deli Serdang.

Waspada/Hang Tuah Jasa Said

Aster Panglima TNI, Mayjen TNI A.Y. Nasution bersama istri, Hj. Hanum Siregar melihat bangku sekolah yang pernah digunakan TB.Silalahi di museum TB. Silalahi Center di Balige.

Waspada/Surya Efendi

Aster Panglima TNI, Mayjen TNI A.Y. Nasution didampingi pengurus Al-Washliyah Sumatera Utara memberikan apresiasi terhadap tim drum band Al-Washliyah Tanjung Tiram, Batu Bara.

Waspada/Surya Efendi

Aster Panglima TNI, Mayjen AY. Nasution menyerahkan bantunan sarana kontak di Universitas Al Azhar Medan.


Curhat

B6

Konsultasi Teknologi Informasi Diasuh oleh Network And Open System Community

From : 08527694**** Saya siswa SMK di R.Prapat. Jika komputer sering restart saat beroperasi, apakah kemungkinan yang bermasalah itu di hardware atau di softwarenya. Jawab : Masalah komputer sering restart dapat disebabkan oleh kedua hal tersebut, bisa karena hardware mengalami gangguan atau kerusakan dan bisa juga karena software yang mengalami crash atau terserang virus. Untuk itu, harus dilakukan pengecekan terlebih dahulu agar dapat diketahui penyebab restart komputer tersebut berasal dari hardware atau software atau bahkan kedua-duanya. Apakah

Minggu 29 Mei 2011

Bantuin Aku, Dong?! BUAT yang punya problem, khusus remaja atau pelajar tapi susah buat dipecahkan, seperti masalah sekolah, pacar, ortu yang suka ngomel atau teman yang nyebelin, jangan bingung dulu. Tim Remaja Waspada dan Mbak Fifi yang nama lengkapnya Fidia Rizki, S.Psi, psikolog lulusan Universitas Medan Area akan mencoba membantu kamu mencari jalan solusinya. Silahkan kirim pertanyaan melalui SMS ke

From : 08136135**** Halo Nos, sudah 10 tahun lebih saya mengajar secara konvensional menggunakan papan tulis. Kini, saya ingin menggunakan laptop dan infokus agar membantu saya menyajikan pelajaran lebih mudah. Saya ingin laptop yang sederhana dan murah, tapi dapat digunakan untuk mengajar. Sebaiknya tipe apa yang saya beli? Terima kasih atas sarannya. Jawab : Salut kami buat bapak yang hendak selangkah lebih maju dalam dunia pengajaran di Indonesia. Pengajaran berbasis multimedia dengan sarana komputer memang sudah seharusnya diterapkan di dalam dunia pendidikan sehingga dapat meningkatkan kemampuan daya serap siswa dalam menerima pelajaran. Untuk spesifikasi laptop yang murah dan sederhana, kami menyarankan mencari laptop yang memiliki spesifikasi seperti processor intel Celeron, atau yang lebih baik lagi seperti processor AMD Turion atau Intel Dual Core, RAM minimal DDR2 512MB, dengan Graphic Card intel/ATI. Spesifikasi tersebut di atas sudah mencukupi dan cukup murah apabila bapak hendak menggunakan sarana multimedia dalam metode pengajaran. Ada pun harga dari laptop dengan spesifikasi di atas bervariasi, tergantung merek laptop, jenis sistem operasi yang digunakan dan fasilitas lain yang ditawarkan. Jangan langsung tertarik untuk membeli laptop yang menawarkan harga terlalu murah di luar harga pasar, karena biasanya tidak disertai kualitas barang yang bagus. Carilah vendor laptop yang telah terpercaya, memiliki outlet yang resmi, dan klaim garansi yang baik. Semoga dapat membantu. Terima Kasih.

WASPADA

No 082161353595,

Jawaban akan dibalas melalui Harian Waspada, jadi dimohon sabar menunggu.

Tanya: Gadiez – Hp 6285270433xxx Dear mbak Fifi yang baik… Aku lagi sedih mbak.. Kenapa sih ortuku melarang pacaran.. mereka seperti engga pernah muda aja… usiaku 14 tahun.. jadinya aku pacaran backstreet.. gimana supaya dapat izin pacaran? Tanya: Cinta – Hp 6281543326xxx Assalamualaikum. Mbak Fifi yang baik.. Bantuin donk.. Cinta mau curhat… kenapa ya mbak mamaku ngelarang pacaran…?

komputer sudah sering restart sejak pertama kali diinstall (baru saja dirakit/dibeli dan dipasang OS)? Apakah komputer pernah mengalami benturan sebelum mulai sering restart sendiri? Apakah komputer mulai restart sendiri setelah kita mentransfer file dari media lain seperti flash disk, cd/dvd, atau media removable lainnya? Atau apakah komputer sering restart apabila cpu komputer panas? Masih banyak lagi hal yang dapat menyebabkan komputer restart. Mengetahui penyebab utama komputer restart menjadi dasar acuan untuk menyelesaikan problem tersebut. From : 0852604**** Saya mau tanya ketika saya menginstall aplikasi microsoft Office, komputer saya masih lancar, ketika saya matikan dan beberapa saat kemudian tidak dapat hidup lagi! dan ada tulisan NTLDR is missing press ctrl+alt+del=restart! lalu saya mencoba menekannya dan cpu saya terestart tapi ada tulisan itu lagi! Pertanyaan saya, bagaimana cara menghidupkan kembali cpu saya? Mohon bantuannya! Trim’s. Jawab : Pada sistem operasi windows permasalahan ini memang sering terjadi dan sangat

PEMBERITAHUAN : Website NOS Community sudah dapat diakses dari internet pada alamat http://www.noscommunity.org, saat ini fasilitas yang disediakan hanya forum untuk sharing ilmu pengetahuan dan tanya jawab.Website dan repository artikel segera menyusul. Segera daftarkan diri anda sekarang pada website noscommunity dan mari bersama-sama majukan IT Indonesia. Kirimkan permasalahan komputer dan jaringan yang anda kelola ke noscommunity@gmail.com atau SMS ke nomor 081370311355. SMS dan email yang anda kirim akan kami jawab sesuai giliran masuk hanya pada SKH Minggu Waspada.

merepotkan para penggunanya. Sayang anda tidak memberi tahu jenis windows yang anda gunakan. Untuk itu, kami berasumsi windows yang anda gunakan adalah windows XP. Untuk dapat menggunakan komputer anda kembali, copy file NTLDR dari cd windows sesuai dengan spesifikasi yang anda gunakan (bila OS anda Windows XP SP1 maka gunakan cd Windows XP SP1 juga). Langkah-langkahnya adalah sebagai berikut : - Setting bios anda agar booting pertama kali dari drive CD/ DVD. - Setelah disetting, masukkan cd windows anda ke drive dan booting melalui cd agar masuk ke instalasi windows XP. - Pada menu instalasi windows XP, tekan R untuk merepair windows anda melalui recovery console. Jangan tekan apapun hingga masuk ke menu recovery console agar komputer tidak terestart. - Anda akan diminta untuk memilih sistem yang akan diperbaiki, apabila anda hanya memiliki satu sistem operasi windows saja, tekan angka 1 dan enter, apabila sistem yang anda miliki lebih dari satu, pilih nomor sistem yang hendak diperbaiki. - Anda akan diminta memasukkan password administrator, apabila ada, masukkan password-nya dan tekan enter. Apabila anda tidak mengeset password administrator, cukup tekan enter saja. - Apabila sudah, langkah selanjutnya copy file NTLDR dari cd windows ke drive anda menginstall windows. -Caranya, dengan mengetikkan “copy e:\i386\ntldr c:\ copy e:\i386\ntdetect.com c:\” pada recovery console anda. - Apabila sudah, akan ada konfirmasi yang mengatakan bahwa ada file yang di copy ke windows.

- Bila sudah tercopy, ketikkan exit agar keluar dari recovery console dan komputer akan terestart untuk kemudian bisa digunakan kembali. - Jangan lupa untuk mengeset boot order anda kembali ke hard disk dari bios. Selamat mencoba. From : 08529793**** Selamat pagi. Saya mau tanya bagaimana caranya kalau kita baru masang telepon rumah yang baru yaitu Flexi, kemudian kita ingin menghubungkan komputer kita ke telepon tersebut supaya kita dapat main internet apakah kita harus terlebih dahulu mendaftarkan diri ke Telkom untuk berlangganan Speedy atau langsung kita hubungkan saja komputer kita ke telepon Flexi tersebut. Dan tarifnya menggunakan internet berapa ya? Apakah lebih murah yang berlangganan atau lebih mahal warnet. Thanks before.

Jawab: Dear Gadiez dan Cinta.. Jangan sedih… kalau belum dapat izin pacaran. . percayalah… bukannya papa mama jahat dan engga ngertiin kemauan anak. Mbak jadi ingat masa remaja dulu.. kenapa ya orang tua kita ngelarang? Kenapa beliau kurang memahami.. Pertanyaan seperti itu pasti banyak difikiran para remaja. Tapi sekarang mbak jadi ngerti.. kalau larangan orang tua pacaran semata karena besarnya rasa kasih mereka pada buah hatinya. Karena mereka tahu persis.. usia remaja.. badannya aja yang kelihatan gede tapi kadang mereka belum mampu mengontrol hasrat emosi dan seksualnya.. karena kemampuan berfikirnya belum berkembang seperti orang dewasa (tapi engga semua loh). Nah daripada takut anaknya kenapa-napa .. beliau cenderung melarang. Coba kalau bawaannya pengen pacaran sampai engga mikirin pelajaran.. apalagi kalau kebablasan.. waduuh bisa merusak masa depan dan impianmu. Jalan ke depan masih panjang… kesempatan masih terbentang buat meraih cita-cita. Jadi kalau pengen punya teman dekat special dari awal niatnya engga boleh macam-macam sekedar pengen mengenal makhluk mars (pria). Kamu bisa yakinkan orang tua.. dengan cara yang lebih bijak.. katakan kamu cewe masa kini yang punya cita-cita tinggi.. bisa jaga diri dan tetap focus pada sekolah. Tentunya engga suka ngambek dan marah.. kalau dilarang.. Kalau sudah bisa mengendalikan diri.. dengan sikap yang dewasa tentu papa mama bisa memahami anaknya. Tapi kalau belum dapat lampu hijau.. sabar ya… jangan kecewa suatu saat para ortu bisa member izin koq.. salam Tanya: Dodi – Hp 08527843xxx Mbak Fifi yang manis… Help me. Kenalin aku Dodi pelajar SMA. Aku bingung nih mbak.. kenapa ya aku suka teringat sama satu temanku… selalu kefikiran dia, walau aku tidak tahu perasaannya. Dan ini sudah hampir tiga tahun tidak ketemu.. tapi koq sulit buat ngelupainnya. Aku kadang menelponnya.. ingin mendengar suaranya… tapi kalau sms jarang dibalas.

Konsultasi Remaja

Apa yang salah pada diriku mbak? Jawab: Dodi yang cakep… Sebenarnya engga ada yang salah pada dirimu.. namanya suka… pasti pengennya dekat terus, dengar suaranya atau ketemuan. Masalahnya kamu dan dia udah lama banget enggak ketemuan.. jadi belum tentu dia masih ingat ke kamu. Maklum tiga tahun waktu yang cukup lama bisa bikin orang berubah. Bayangan yang ada di fikranmu tentang dia belum tentu sama dengan kenyataan.. siapa tahu dia sudah berubah. Khayalan kadang lebih indah lho dari kenyataan. Dodi.. kalau masih penasaran kenapa tidak ketemu langsung dengan orangnya.. jalin pertemanan baik sampai kamu bisa menen-tukan kapan saat yang tepat untuk bilang perasaanmu ke dia. Tapi kalau kenyataannya dia tidak seperti yang kamu harapkan mending kamu tidak usah berharap terlalu banyak darinya. Biasanya kalau sudah menemukan jawaban dari rasa pena-saranmu.. kamu dapat menentukan sikap dan perasaanmu pada seseorang. Salam Tanya: Dhela – Hp 085276548xxx Assalamualaikum.. Mbak Fi mau curhat niii.. Mbak aku naksir sama sahabatnya abangku.. Dan kayanya perasaanku berbalas..sepertinya dia juga naksir. Masalahnya.. apakah salah aku menyukai teman dekat my brother.. please bantuin.. makasih sebelumnya. Tanya: Raysha – Hp 6281376534xxx Assalamualaikum.. Salam kenal buat kak Fifi. Kak.. aku lagi bingung nih. Aku lagi fall in dengan kakak kelasku.. kebetulan dia sepupu sahabatku. Aku jadi takut kalau aku jadian dengannya.. bisa merusak persahabatanku. Gimana donk… bantuin ya kak… makasih. Jawab: Waalaikumsalam.. Dear Dhela dan Raysha. Waduuh yang lagi jatuh cinta... rasanya selangit. Dhela dan Raysha.. engga ada yang salah koq jika kamu jadian dengan teman dekat abang atau sepupunya sahabatmu.. malah asyik kan kalian jadi bisa dapat gambaran yang lebih dari abang dan sahabatmu tentang gebetan. Masalahnya kalian belum merasa yakin tentang perasaannya dan perasaanmu. Jadi kenapa tidak mencoba menjalin pendekatan dulu sambil meminta saran dari orang terdekatmu yaitu abang dan sahabat. Bila kemudian kalian merasa yakin… kenapa enggak diterusin.? Oke kenali lebih dekat gebetan biar lebih memahami seseorang.. sukses ya.

Jawab : Untuk dapat menggunakan Speedy, kita harus punya modem ADSL yang biasanya diberikan dan diinstalasi oleh pihak Telkom setelah kita melakukan registrasi terlebih dahulu. Untuk Flexi, koneksi ke internet dapat dilakukan apabila menggunakan handphone Flexi yang memiliki koneksi 3G atau GPRS. Tarif internet yang ditawarkan oleh Telkom Speedy bervariasi, sehingga untuk membandingkan dengan warnet sulit untuk dilakukan. Yang perlu diperhatikan adalah, apabila kita menggunakan Speedy untuk pribadi, maka kita dapat menggunakan keseluruhan bandwith yang dialokasikan untuk kita secara full, sedangkan apabila di warnet, kita harus berbagi bandwith dengan para user lain yang ada pada warnet tersebut. Jelas lebih lambat.***

Konsultasi Sumber Daya Manusia Diasuh oleh Thoga Sitorus

Mencari Pekerjaan Selamat pagi, Pak Thoga. 1. Saya, Said usia 27 tahun, pendidikan terakhir tamat SMA, cacat fisik karena polio, mengharapkan pekerjaan apa saja yang bisa. Tolong bantu saya jika ada kesempatan kerja untuk saya. 2. Saya bernama Ayu ingin menanyakan tentang pekerjaan pembuatan cerpen sesuai dengan bakat/ hobi saya, di mana ada lowongan untuk saya. Terima kasih. Jawab: Selamat pagi Sdr Said dan Sdri Ayu. Atas pertanyaan Sdr tentang kesempatan kerja, disini saya hanya dapat memberi petunjuk bagi Sdr yaitu Sdr dapat menghubungi Balai Besar Latihan Kerja Industri (BBLKI) yang berfungsi dan bertugas melaksanakan pelatihan kerja untuk menjadi seorang yang memiliki skill/keterampilan dan lowongan kerja yang tersedia. Bila Sdr ingin mengikuti pelatihan keterampilan, Sdr dapat mendaftar ke BBLKI

Medan, melaksanakan 8 (delapan) kejuruan pokok yang masing-masing memiliki sub kejuruan, yaitu: a. Teknologi Mekanik Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang teknologi mekanik yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Teknologi Mekanik terdiri atas empat sub kejuruan: 1. Fabrikasi/Plumbing; 2. Mesin Logam; 3. Las; 4. Programmer Pneumatic. b. Listrik Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang listrik yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Listrik terdiri atas tujuh sub kejuruan: 1. Instalasi Penerangan; 2. Instalasi Tenaga; 3. PLC; 4. Elektronika, Teknisi HP; 5. Elektronika, Audio Video; 6. Elektronika, Digital dan

Industri; 7. Teknik Pendingin. c. Otomotif Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang otomotif yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Otomotif terdiri atas tiga sub kejuruan: 1. Sepeda Motor; 2. Mobil Bensin; 3. Mobil Diesel. d. Tata Niaga Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang administrasi dan bahasa inggris yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Tata Niaga terdiri atas empat sub kejuruan: 1. Administrasi Perkantoran; 2. Komputer Perkantoran; 3. Akuntansi; 4. Bahasa Inggris. e. Teknologi Informasi Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang teknologi informasi yang profesional dan didukung

dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Teknologi Informasi terdiri atas tiga sub kejuruan: 1. Teknisi Komputer; 2. Teknisi Jaringan Komputer; 3. Programming. f. Aneka Kejuruan/Industri Kreativitas Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di aneka kejuruan yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Aneka Kejuruan terdiri atas enam sub kejuruan: 1. Menjahit Pakaian; 2. Bordir; 3. Packaging; 4. Video Editing; 5. Sablon; 6. Handycraft. g. Agroindustri Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang budidaya jamur dan processing yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan

berdaya saing tinggi. Kejuruan Agroindustri terdiri atas dua sub kejuruan: 1. Budidaya Jamur; 2. Processing. h. Konstruksi Kejuruan ini bertujuan untuk mewujudkan peserta pelatihan di bidang konstruksi yang profesional dan didukung dengan standar pelatihan yang berkualitas serta mendorong tersedianya tenaga kerja yang profesional dan berdaya saing tinggi. Kejuruan Konstruksi terdiri atas lima sub kejuruan: 1. Design Autocad; 2. Meuble/ Furniture; 3. Konstruksi Kayu; 4. Konstruksi Batu; 5. Konstruksi Besi. Sesuai dengan kejuruan di atas, para pencari kerja dapat memilih sesuai dengan bakat yang dimiliki dan lowongan kerja yang tersedia, dapat menghubungi atau mendaftar ke Jl. Jend. Gatot Subroto km 7,8. Telp. 8451520 atau email : headoffice@bblkimedan.net website: www.bblkimedan.net

Pensiun Rumah Sakit Selamat pagi, Pak Thoga. Saya Riswan, pegawai di

sebuah Rumah Sakit di Medan ingin menanyakan kepada Bapak tentang hak pensiun saya. Sekarang saya berumur 55 tahun dan memasuki usia pensiun. Di tempat saya bekerja tidak ada Serikat Pekerja dan peraturan Rumah Sakit. Sesuai dengan ketentuan Undang-Undang Ketenagakerjaan apakah saya mendapat hak pensiun dan bagaimana ketentuannya. Mohon penjelasan dari Bapak dan saya ucapkan terima kasih. Jawab: Selamat pagi, Sdr Riswan. Mengenai hak pensiun di Rumah Sakit sama juga dengan peraturan di perusahaan-perusahaan dan bila hak pensiun tidak ada diatur dalam peraturan Rumah Sakit, maka yang berlaku adalah ketentuan yang diatur dalam UndangUndang No.13 Tahun 2003 tentang Ketenagakerjaan Ps.167, yaitu : (1) Pengusaha/ Pimpinan Rumah Sakit dapat melakukan pemutusan hubungan kerja

terhadap pekerja/buruh karena memasuki usia pensiun dan apabila pengusaha telah mengikutkan pekerja/buruh pada program pensiun yang iurannya dibayar penuh oleh pengusaha, maka pekerja/buruh tidak berhak mendapatkan uang pesangon sesuai ketentuan Pasal 156 ayat (2), uang penghargaan masa kerja sesuai ketentuan Pasal 156 ayat (3), tetapi tetap berhak atas uang penggantian hak sesuai ketentuan Pasal 156 ayat (4). (2) Dalam hal besarnya jaminan atau manfaat pensiun yang diterima sekaligus dalam program pensiun sebagaimana dimaksud pada ayat (1) ternyata lebih kecil daripada jumlah uang pesangon 2 (dua) kali ketentuan Pasal 156 ayat (2) dan uang penghargaan masa kerja 1 (satu) kali ketentuan Pasal 156 ayat (3) dan uang penggantian hak sesuai ketentuan Pasal 156 ayat (4), maka selisihnya dibayar oleh pengusaha. (3) Dalam hal

Bagi para pembaca yang ingin menanyakan seputar tentang ketenagakerjaan dapat mengirimkan pertanyaan melalui Email:thogasitorus@yahoo.co.id, HP:0811632554

pengusaha telah mengikutsertakan pekerja/ buruh dalam program pensiun yang iurannya/ preminya dibayar oleh pengusaha dan pekerja/ buruh, maka yang diperhitungkan dengan uang pesangon yaitu uang pensiun yang premi/ iurannya dibayar oleh pengusaha. (4) Ketentuan sebagaimana dimaksud pada ayat (1), ayat(2), dan ayat (3) dapat diatur lain dalam perjanjian kerja, peraturan perusahaan, atau perjanjian kerja bersama. (5) Dalam hal pengusaha tidak mengikutsertakan pekerja/ buruh yang mengalami pemutusan hubungan kerja karena usia pensiun pada program pensiun maka pengusaha wajib memberikan kepada pekerja/buruh uang pesangon sebesar 2(dua) kali ketentuan Pasal 156 ayat (2), uang penghargaan masa kerja 1 (satu) kali ketentuan Pasal 156 ayat (3) dan uang penggantian hak sesuai ketentuan Pasal 156 ayat (4).

Kupon Konsultasi


Kesehatan

WASPADA Minggu 29 Mei 2011

B7

Lupus Serang Wanita Usia Produktif PENYAKIT Lupus adalah penyakit baru yang mematikan setara dengan kanker. Tidak sedikit pengindap penyakit ini tidak tertolong lagi. Di dunia terdeteksi penyandang penyakit Lupus mencapai 5 juta orang, lebih dari 100 ribu kasus baru terjadi setiap tahunnya. Arti kata lupus sendiri dalam bahasa Latin berarti “anjing hutan”. Istilah ini mulai dikenal sekitar satu abad lalu. Awalnya, penderita penyakit ini dikira mempunyai kelainan kulit, berupa kemerahan di sekitar hidung dan pipi . Bercak-bercak merah di bagian wajah dan lengan, panas dan rasa lelah berkepanjangan , rambutnya rontok, persendian kerap bengkak dan timbul sariawan. Penyakit ini tidak hanya menyerang kulit, tetapi juga dapat menyerang hampir seluruh organ yang ada di dalam tubuh.

Gejala-gejala penyakit dikenal sebagai Lupus Eritomatosus Sistemik (LES) alias Lupus. Eritomatosus artinya kemerahan. sedangkan sistemik bermakna menyebar luas keberbagai organ tubuh. Istilahnya disebut LES atau Lupus. Gejala-gejala yang umum dijumpai adalah kulit yang mudah gosong akibat sinar matahari serta timbulnya gangguan pencernaan. Gejala umumnya penderita sering merasa lemah, kelelahan yang berlebihan, demam dan pegal-pegal. Gejala ini terutama didapatkan pada masa aktif, sedangkan pada masa remisi (nonaktif) menghilang. Pada kulit akan muncul ruam merah yang membentang di kedua pipi, mirip kupu-kupu. Kadang disebut (butterfly rash). Namun ruam merah menyerupai cakram bisa muncul di kulit seluruh tubuh,

menonjol dan kadang-kadang bersisik. Melihat banyaknya gejala penyakit ini maka wanita yang sudah terserang dua atau lebih gejala saja harus dicurigai mengidap Lupus. Anemia yang diakibatkan oleh sel-sel darah merah yang dihancurkan oleh penyakit lupus ini. Rambut yang sering rontok dan rasa lelah yang berlebihan. Menurut Dr Rahmat Gu0nadi dari Fak. Kedokteran Unpad/RSHS, penyakit Lupus adalah penyakit sistem imunitas di mana jaringan dalam tubuh dianggap benda asing. Reaksi sistem imunitas bisa mengenai berbagai sistem organ tubuh seperti jaringan kulit, otot, tulang, ginjal, sistem saraf, sistem kardiovaskuler, paru-paru, lapisan pada paru-paru, hati, sistem pencernaan, mata, otak, maupun pembuluh darah dan selsel darah.

“Penyakit ini dapat mengenai semua lapisan masyarakat, 1-5 orang di antara 100.000 penduduk, bersifat genetik, dapat diturunkan. Wanita lebih sering 6-10 kali daripada pria, terutama pada usia 15-40 tahun. Bangsa Afrika dan Asia lebih rentan dibandingkan kulit putih. Dan tentu saja, keluarga Odapus. Timbulnya penyakit ini karena adanya faktor kepekaan dan faktor pencetus yaitu adanya infeksi, pemakaian obatobatan, terkena paparan sinar matahari, pemakaian pil KB, dan stres,” ujarnya. Penyakit ini justru kebanyakaan diderita wanita usia produktif sampai usia 50 tahun sekalipun ada juga pria yang mengalaminya. Oleh karena itu dianggap diduga penyakit ini berhubungan dengan hormon estrogen. Pada kehamilan dari perempuan yang menderita

Masalah Takut Menjadi Tua Dan Takut Mati Pada sebahagian orang, dengan semakin bertambahnya usianya dapat terjadi masalah takut menjadi tua (gerontophobia) dan takut pula mati. Kematian merupakan akhir dari perjalanan kehidupan seseorang. Pada kenyataannya, banyak orang yang ingin menolaknya tetapi tidak kuasa untuk menghindarinya, karena harapan manusia pada umumnya adalah mencapai usia yang selama mungkin. Tidak dapat disangkal bahwa sejalan dengan proses menua maka manusia akan mengalami perubahan-perubahan menuju suatu ketergantungan fisik dan mental. Keluhan fisik dan mental yang menyertai proses menua menjadi tandatanda adanya suatu penyakit, yang biasanya disertai dengan perasaan-perasaan tertentu seperti cemas, depresi atau bahkan mengingkari penyakitnya. Apalagi, penyakit pada stadium terminal atau tahap akhir yang dalam prediksi secara ilmu kedokteran sering diartikan bahwa penderita tidak lama lagi akan meninggal dunia dan keadaan inilah yang menyebabkan seseorang mengalami kecemasan terhadap kematian. Menurut seorang ahli yang bernama May bahwa kematian itu dipandangnya sebagai suatu hal yang menyebabkan individu itu benar-benar merasa eksis, selain daripada itu, kematian juga menggambarkan ancaman menjadi “tiada”, dan kondisi inilah yang menyebabkan timbulnya kecemasan. Reaksi Terhadap Kematian Menurut Kubler-Ross bahwa ada beberapa tahap kematian yang dialami oleh penderita, antara lain : 1. Tahap menyangkal (denial) : yaitu ketika penderita mengetahui bahwa penyakit- nya tidak dapat disembuhkan maka penderita berharap bahwa dokter salah di dalam menentukan penyakitnya (menegakkan diagnosis), sehingga penderita akan mengunjungi banyak dokter untuk memperoleh banyak pendapat untuk menguatkan penyangkalannya, yang sering dapat merugikan penderita dengan menolak pengobatan. Fungsi penyangkalan disini adalah sebagai penahan atau penghibur dirinya setelah berita yang mengejutkan tadi didengarnya. 2. Tahap kemarahan (anger) : yaitu ketika penderita mengetahui bahwa kesehatannya semakin memburuk maka emosinya sulit untuk dikendalikan serta marah-marah terhadap lingkungannya. Pada tahap ini penyangkalan atau penolakan tidak dapat dipertahankan lagi, maka akan timbul pertanyaan “ mengapa penyakit seperti ini harus terjadi pada saya ? “ Maka timbullah perasaan marah, gusar, cemburu dan benci. Ia dapat mengeluh bahwa dokter maupun perawatnya bahkan keluarganya tidak beres, berkata-kata kasar, menolak makan/minum, memukul, melempar ben da-benda yang ada padanya dan lain-lain. Perasaan ini diproyeksikan kepada lingkungannya bahkan marah kepada siapa saja pada saat yang tak terduga. Dalam hal ini, tingkah laku yang sering terlihat adalah menolak minum dan makan serta pengobatan. 3. Tahap tawar menawar (bargaining) : yaitu ketika penderita berusaha merubah perilakunya. Tahap ini tidak terlalu jelas, atau tidak terlalu dikenal meskipun terjadi kadang-kadang hanya beberapa saat namun dapat menolong penderita yaitu penderita berharap kematiannya dapat ditunda dan dapat hidup lebih lama sehingga ia menuruti dan melakukan segala sesuatu yang diminta atau diharuskan dokter dan orang-orang yang menasehatinya dengan harapan dapat sehat kembali. Misalnya penderita berharap kematiannya dapat ditunda sampai anak/cucunya berkeluarga, sehingga ia sangat bergantung sekali kepada yang merawatnya serta menuruti segala sesuatu yang diharuskan oleh yang merawatnya. 4. Tahap depresi /jiwa yang tertekan: yaitu ketika penderita semakin menyadari bahwa penyakitnya tidak dapat berkurang sehingga ia mengalami depresi, yang dapat terlihat dari tingkah lakunya yang sering diam dan mulai menolak ajakan orang lain, juga tidak mau melakukan aktivitas, menghabiskan waktu dengan bersedih dan sering menangis, tidak mau menerima tamu, tidak mau makan/minum, tidak dapat memusatkan pikiran bahkan timbul ide mau bunuh diri. Pada tahap ini, penderita telah menyadari bahwa semua yang dilakukannya menjadi sia-sia, janji-janji yang telah dibuatnya ternyata tak dapat diajak kompromi lagi. Tingkah laku demikian, ada yang memandangnya sebagai tingkah laku yang normal, sebab sebenarnya pasien secara tidak sadar berusaha untuk melepaskan semua obyek yang dicintainya, baik terhadap benda-benda maupun teman dan saudarasaudara yang dimilikinya. 5. Tahap penerimaan (acceptance) : ditandai dengan penderita merasa tenang, da mai dan mau menerima keadaannya atau segala sesuatu yang terjadi pada dirinya, walaupun merasa sakit dan tidak berdaya. Penderita sudah terlalu lelah untuk marah dan sudah mulai terbiasa dengan menghadapi kematian yang akan tiba padanya. Penderita dalam hal ini akan lebih memperhatikan hal-hal yang bersifat praktis, seperti menulis wasiat dan lain-lain. Menurut Erickson bahwa seseorang yang telah mencapai integritas ego yang menetap akan tidak terlalu cemas di dalam menghadapi kematian, sebab di dalam per -kem-bangannya individu dihadapkan pada dua kutub, yaitu pe-rasaan integritas dan yang berlawanan dengannya adalah perasaan putus asa. Pada tahap penerimaan, menurut teori tadi bahwa penderita telah sampai pada tahap terakhir dalam pencapaian integritas ego, jika telah memahami makna dari kehidupannya, sedangkan jika sebaliknya terjadi, berarti belum tercapai integritas ego dan penderita merasa hidupnya sia-sia, merasa terlalu singkat dan terlambat untuk memulai kehidupan yang akan datang. Tahapan-tahapan ini tidak selalu dialami penderita secara berurutan, kadang-kadang dialami secara Bersamaan Atau Kembali Pada Tahap Yang Sebelumnya. Kecemasan Di dalam menghadapi kematian dapat terjadi kecemasan

yang dipengaruhi oleh hal-hal sebagai berikut : 1. Ketidakpastian tentang adanya kehidupan setelah kematian, yang menyebabkan timbulnya rasa cemas. 2. Hubungan keluarga, hubungan antara orang tua dan anak yang harmonis, dan du kungan emosional seperti rasa simpati dan pengertian orang lain akan mengurangi kecemasan menghadapi kematian. 3. Perasaan sejahtera : orang yang merasa sejahtera dan mampu menikmati hidup ma ka kecemasan menghadapi kematian tidak terlalu tinggi. 4. Religiusitas : orang yang memiliki tingkat religiusitas/keimanan yang tinggi tidak terlalu cemas di dalam menghadapi kematian. 5. Penjelasan tentang kematian : dengan melakukan hal seperti ini akan menambah pengetahuan atau wawasannya serta mendiskusikannya secara realistis, sehingga dapat lebih realistis dalam menghadapi kematian. UPAYA : Upaya yang dilakukan dapat berupa mendampingi penderita yang sedang menghadapi kematian, sesuai dengan tahaptahap yang dialami penderita dalam menghadapi kematian. Menurut Kubler dan Ross (1998) bahwa upaya yang perlu dilakukan adalah : 1. Pada tahap penyangkalan : upaya yang dilakukan oleh pendamping ataupun orang yang merawatnya adalah dengan membiarkan terlebih dahulu penderita melakukan penyangkalan selama beberapa waktu, setelah itu, penderita diharapkan dapat secara bertahap meninggalkan penyangkalannya. Keadaan ini juga tergan tung pada cara yang dilakukan oleh dokter atau yang merawatnya pada waktu memberitahukan keadaan penyakit atau kesehatan penderita. Perlu juga diberikan pengertian kepada penderita mengenai masalah keuangan, urusan-urusan yang belum selesai atau kekhawatiran akan kelangsungan kehidupan keluarganya. 2. Pada tahap kemarahan : pendamping atau yang merawatnya menemani dan mendengar secara aktif dan berusaha bersama penderita mengendalikan emosinya, sehingga memungkinkan penderita dapat bertindak tidak terlalu emosional dalam kemarahannya, dengan demikian tidak terlalu merugikan penderita dengan bertambah beratnya penyakitnya. Pada tahap ini, biasanya apapun yang dilihat oleh penderita akan menimbulkan keluhan baginya, dan oleh karena itu, dengan mendampingi penderita maka ia akan diarahkan kepada tingkah laku yang lebih positif. 3. Pada tahap tawar menawar : upaya yang dilakukan adalah dengan menemani dan mendengar secara aktif, berdiskusi dan berusaha diarahkan pada tingkah laku yang lebih positif, seperti menolong sesama manusia dan beribadah. 4. Pada tahap depresi : upaya yang perlu dilakukan adalah mendampingi penderita, tidak perlu diberikan penghiburan secara verbal yang berlebihan, karena penderita perlu diarahkan dan penderita perlu merenungkan kematiannya yang sudah dekat. 5. Pada tahap penerimaan : upaya yang perlu dilakukan adalah dengan mendampingi penderita dan dengan bimbingan rohani. Untuk pendampingan yang bersifat keagamaan dapat bekerja sama dengan lembaga keagamaan sesuai dengan agama atau kepercayaan yang diimani oleh masing-masing penderita (dr.Pirma Siburian Sp PD, K Ger, spesialis penyakit dalam dan penyakit lansia, dokter pada klinik lansia Klinik Spesialis Bunda dan RS Permata Bunda Medan).

KLA Berikan Perlindungan Hak Kesehatan Anak

Kota Layak Anak (KLA) merupakan sistem pembangunan suatu wilayah adminstrasi yang mengintegrasikan komitmen dan sumber daya pemerintah, masyarakat dan dunia usaha. Dalam rangka memenuhi hak kesehatan anak yang terencana secara menyeluruh dan berkelanjutan melalui pengarusutamaan hak anak (PUHA). Hal tersebut dikatakan Walikota Medan diwakili Kepala Badan PP dan KB Kota Medan, Abdul Muluk Dalimunthe, SH dalam sosialisasi KLA di Hotel Asean Internasional Jalan Adam Malik Medan. Muluk mengatakan kewajiban dan hak anak harus dipentingkan sejak dini, sehingga Kota Medan dapat menjadi contoh bagi kabupaten/kota lainnya di Sumut. “Ini sudah menjadi target pemerintah dan seluruh elemen masyarakat untuk mementingkan kewajiban dan hak kesehatan anak,” ujar Muluk. Tujuan umum dari KLA tersebut, lanjut Muluk, mengarah pada transformasi konvensi PBB tentang hak anak dari kerangka hukum kedalam defenisi, strategi dan intervensi pembangunan seperti kebijakan, kelembagaan, program dan kegiatan yang peduli anak.“Tujuan kita bagaimana mentransformasikan hak anak demi kelangsungan masa depan mereka,” katanya. Sementara itu Ketua KPAID Provinsi Sumut M. Zahrin Piliang mengatakan prinsip KLA ditekankan pada non-diskrimanasi, menghentikan eksploitasi anak, dan kekerasan dalam anak. “Banyak sekali di lapangan kita lihat kecurangan yang dialami oleh anak. Ini harus menjadi tanggung jawab kita bersama,” ujar Zahrin. Zahrin mengatakan, proporsi anak atau kepadatan penduduk menjadi kendala besar. Selain itu masih banyak anak yang tinggal di perkotaan berada dibawah ancaman kondisi lalu lintas yang tidak ramah, penuh kekerasan dan polusi yang ekstrim.“Prasyarat KLA harus melibatakan semua unsur dan elemen pemerintah dan swasta. Demi membasmi hal yang merugikan anak,” urainya. (m30)

Lupus sering diduga berkaitan dengan kehamilan yang menyebabkan abortus, gangguan perkembangan janin atau pun bayi meninggal saat lahir. Tetapi hal yang berkebalikan juga mungkin atau bahkan memperburuk gejala Lupus. Sering dijumpai gejala Lupus muncul sewaktu hamil atau setelah melahirkan. Tubuh memiliki kekebalan untuk menyerang penyakit dan menjaga tetap sehat. Namun dalam penyakit ini kekebalan tubuh justru menyerang organ tubuh yang sehat. Penyakit Lupus diduga berkaitan dengan sistem imunologi yang berlebih. Dalam tubuh seseorang terdapat antibodi yang berfungsi menyerang sumber penyakit yang akan masuk dalam tubuh. Uniknya, penyakit Lupus ini antibodi yang terbentuk dalam tubuh muncul berlebihan. Hasilnya, antibodi justru menyerang sel-sel jaringan organ tubuh yang sehat. Kelainan ini disebut autoimunitas. Antibodi yang berlebihan ini bisa masuk ke seluruh jari-ngan dengan dua cara yaitu pertama, antibodi aneh ini bisa langsung menyerang

jaringan sel tubuh, seperti pada sel-sel darah merah yang menyebabkan selnya akan hancur. Inilah yang mengakibatkan penderitanya kekurangan sel darah merah atau anemia. Kedua, antibodi bisa bergabung dengan antigen (zat perangsang pembentukan antibodi), membentuk ikatan

yang diseenzim, yang menimbulkan peradangan di sekitar kompleks. Hasilnya, proses peradangan akan berkepanjangan dan akan merusak organ tubuh dan mengganggu fungsinya. Selanjutnya, hal ini akan terlihat sebagai gejala penyakit. Kalau hal ini terjadi, maka dalam jangka panjang

fungsi organ tubuh akan terganggu. Kesembuhan total dari penyakit ini, tampaknya sulit. Dokter lebih berfokus pada pengobatan yang sifatnya sementara.Lebih difokuskan untuk mencegah meluasnya penyakit dan tidak menyerang organ vital tubuh. *dr Linda

Yayasan Indah Medan Khitan Ratusan Anak Kurang Mampu Yayasan Indah Medan yang membidangi Akademi Keperawatan (Akper), Akademi Kebidanan (Akbid) dan Akademi Farmasi (Akfar) dalam waktu dekat mengadakan khitanan massal secara gratis kepada anak-anak warga kurang mampu khususnya di sekitar kampus Yayasan Indah Medan Jalan Jaya II/jalan Saudara No.24, Simpang Limun, Medan. Ketua Yayasan Indah Medan, H.Abdul Harris Sy Hasibuan, SE kepada wartawan, kemarin mengatakan, khitanan gratis ini akan dilaksanakan pada 26 Juni 2011 mendatang di kampus Yayasan Indah Medan dan peserta khitanan dibatasi sebanyak-banyaknya 300 orang. “Kegiatan ini semata-mata dilakukan untuk kepentingan amal dan mengharap ridho Allah SWT,” ujar Abdul Harris Hasibuan. Menurut Abdul Harris Hasibuan, dalam pelaksanaannya nanti lima puluhan tenaga medis baik dari Yayasan Indah akan dikerahkan, mengingat ratusan anak akan dikhitan. Selain tidak ada biaya, peserta khitan yang merupakan anak berumur 9 sampai 14 tahun ini akan diberikan bingkisan berupa kain sarung dan lobe serta uang kasih sayang berikut berobat lanjutan sampai sembuh secara gratis. Kata Abdul Harris, kepada peserta khitanan massal yang dikoordinir oleh sekolah atau organisasi perwiritan/STM atau pengajian, jika pesertanya lebih 15 orang akan diberikan subsidi biaya traportasi sebesar Rp.100 ribu untuk pulang pergi. Bagi peserta yang diantar jemput oleh pihak yayasan tidak diberikan lagi uang transport. “Bagi peserta khitanan harus dalam keadaan sehat dan dapat mendaftar langsung ke kampus Yayasan Indah Medan

di jalan Jaya II atau jalan Saudara Ujung, Simpang Limun Medan, atau menghubungi H.Ambali Azwar Siregar di 081370612546, kemudian Andilala di 081310508061 dan Zulpan Hrp di 081370872060,” jelasnya. Kegiatan khitanan massal yang melibatkan para mahasiswa Yayasan Indah ini, akan dihibur Medical Band yang juga merupakan binaan Yayasan Indah Medan. Bahkan para personel Medical Band yang merupakan ahli medis ini ikut ambil bagian dalam kegiatan khitanan tersebut. Dalam aksinya nanti Medical Band yang rencananya akan tampil di Inbox-SCTV pada 28 Mei pukul 07.00 WIB dan di acara Mantap ANTV pada 29 Mei 2011 pukul 13.00 WIB, akan menghibur para peserta khitanan dengan lagulagu hasil ciptaan sendiri. “Yang jelas Medical Band akan mengerahkan semua kemampuan menghibur peserta khitanan,” kata Elman Munthe, manager Medical Band.sembari menambahkan dapat menghubungi 08163115114 atau di 081375862771, jika ingin mengundangi Medical Band. Menjawab pertanyaan wartawan, Elman Munthe tidak menampik kegiatan amal ini selalu dilaksanakan Yayasan Indah Medan yang masih membuka pendaftaran bagi mahasiswa baru baik untuk Akper, Akbid dan Akfar. “Setiap tahun kegiatan amal dilaksanakan Yayasan Indah Medan, dan selalu mendapat antusias dari warga masyarakat,” ujarnya. Disinggung soal Medical Band, Elman mengaku kehadiran dan kesuksesan Medical Band tidak terlepas dari peran H.Abdul Harris Hasibuan selaku Pembina. (m30)

Road Show Hari Keluarga Dihadiri Isteri Mendagri Plt.Gubsu Prihatin Angka Kelahiran di Sumut Cukup Tinggi Plt.Gubernur Sumatera Utara H.Gatot Pujo Nugroho ST prihatin dengan tingginya angka kelahiran di Sumatera Utara. Berdasarkan sensus penduduk tahun 2010 penduduk Sumatera Utara berjumlah 12,98 juta jiwa dengan pertumbuhan penduduk rata rata 1,1% setiap tahunnya. Persoalan kependudukan yang di hadapi Sumut dalam satu dekade terakhir adalah masih tingginya angka kelahiran total yakni sebesar 3,8 per wanita usia subur, penduduk miskin sebesar 11,31% atau 1,41 juta jiwa,angka pengangguran terbuka sebesar 7,43%. Sementara angka kematian bayi berdasarkan riset, kesehatan dasar 2010 adalah sebesar 22 per 1000 kelahiran, sementara kematian ibu hamil dan bersalin sebesar 249 per 100.000 kelahiran.Ini adalah tantangan prograam keluarga berencana untuk segera di percepat di semua wilayah dan lini lapangan. Gatot mengatakan hal itu dalam sambutan acara Road Show Hari Keluarga ke XVIII di alun-alun Pemkab Deli Serdang. Acara tersebut di hadiri juga oleh Ketua Umum Tim Penggerak (TP) PKK Gamawan Fauzi, Ketua Solidaritas Istri Kabinet Indonesia Ratna Sari Joko Suyanto, Kepala BKKBN Pusat Dr.Sugiri Syarief,MPA, Ketua Tim Penggerak PKK Sumut Hj Sutias Handayani Gatot Pudjo Nugroho, Bupati Deli Serdang Drs Amri Tambunan, Kepala BKKBN Sumut H.Nofrijal SP MA dan sejumlah SKPD di Sumut. Gatot menambahkan kegiatan ini bertujuan untuk memotivasi segenap stake holders dan para kader kader PKK dalam meningkatkan kepedulian dan partisipasi masyarakat dalam membangun keluarga yang sejahtera secara merata dan berkesinambungan. Dengan kegiatan road show semarak KB ke XVIII, Gatot menghimbau segenap stake holders dan para kader PKK lebih meningkatkan kepedulian dan partisipasi masyarakat dalam membangun keluarga sejahtera dalam membangun keluarga sejahtera secara mereta dan berkesinambungan dan dapat memacu pembangunan SDM dan memberi kontribusi bagi peningkatan indeks pembangunan manusia di Sumut. Sementara itu Ketua TP PKK Pusat Ny Gemawan

Fauzi mengatakan, keluarga merupakan wahana pertama dan utama bagi seorang anak untuk belajar mengenal lingku-ngan juga memperoleh pendiidkan, pembentukan dan pe-ngembangan karakter, kepribadian, etika, moral, dan sopan santun. Sehingga fungsi keluarga berjalan dengan baik dan mendorong terbentuknya keluarga yang harmonis. Sedang Bupati Deliserdang Drs Amri Tambunan mengatakan Kabupaten Deliserdang memiliki luas wilayah 2.497,72 KM dengan jumlah penduuduk 1,7 juta jiwa dan memiliki 22 kecamatan, 380 desa, dan 14 kelurahan, sekarang kabupaten Deliserdang berpacu melaksanakan pembangunan khususnya program KB. Bahkan dalam pelaksanaannya menunjukan hasil yang mengembirakan ditandai dengan terwujudnya norma keluarga kecil sebagai bagian dari tata kehidupan masyarakat. Ini tercermin dari meningkatnya angka kepesertaan KB, mengecilnya jumlah anak-anak yang dimiliki keluarga, menurunnya angka kematian ibu dan bayi, disamping menurunnya angka pertumbuhan penduduk “Tingkat kematian ibu pertahun menjadi 20, dari 36,743 angka kelahiran hidup 2010. Sedangkan angka kematian bayi menurun menjadi 2,67 / 1000 pada 2010, usia harapan hidup meningkat dari 69,8 tahun menjadi 70.8 tahun,” kata Ambri Tambunan. Sebelumnya Ketua Tim Penggerak PKK Sumut Hj Sutias Handayani Gatot Pudjo Nugroho mengatakan acara road show ini dimaksudkan sebagai upaya untuk menggebyarkan kembali program KB dan sepuluh program PKK .Sutias berharap keluarga sejahtera yang berwawasan kependudukan dapat segera terwujud. Dalam Acara tersebut juga diserahkan sejumlah bantuan dan penghargaan.di antaranya Laparascopy kepada RSU.Lubuk Pakam,IUD-KIT kepada kelompok PIK remaja Deli Serdang,paket buku buku KB kepada perpustakaan desa binaan TP-PKK Kabupaten.Deli Serdang. Bantuan ini diserahkan langsung oleh Ny Gamawan Fauzi di dampingi oleh ketua PKK Sumut Ny Sutias Handayani Gatot Pudjo Nugroho,Ketua dewan penyantun PKK yang juga Plt. Gubsu H.Gatot Pudjo Nugroho,ST. (m30)

Gatot Buka Jambore Posyandu 2011 Plt Gubernur Sumatera Utara Gatot Pudjo Nugroho ST membuka penyelenggaraan Jambore Kader Posyandu tahun 2011 tingkat Propinsi Sumatera Utara yang berlangsung selama tiga hari di Asrama Haji Pangkalan Mansyur Medan. Menurut Gator, tenaga penyuluh kesehatan di Sumatea Utara belum menyebar secara merata. Sehingga mengakibatkan perkembangan penyakit menular di Sumatera Utara belum dapat secara tuntas diatasi bahkan posisinya semakin tinggi. Oleh karenanya Posyandu (pos pelayanan kesehatan terpadu) bernilai strategis untuk mensosialisasikan pentingnya pelayanan kesehatan di sejumlah daerah demi menekan perkembangan penyakit menular tersebut. Untuk mengatasi penyebaran itu diharapkan Gatot peranserta dari semua pihak tak terkecuali para ibu yang tergabung dalam Tim Penggerak PKK propinsi hingga kabupaten/kota dalam mensosialisasikan pentingnya menjaga kesehatan. Sementara itu Ketua Panitia Jambore Kader Posyandu Tahun 2011 Hj Sucihati Candra Syafei melaporkan kegiatan

ini terselenggara berkat kerjasama antara TP PKK dan Dinas Kesehatan Propinsi Sumut. “Kegiatan yang mengambil tema ‘Upaya Meningkatkan dan Menciptakan Kader yang Berprestasi’ berlangsung selama 3 hari mulai pada tanggal 23 s/d 25 Mei 2011 di Asrama Haji Pangkalan Mansyur Medan dengan peserta dari kader-kader Posyandu dari 33 kabupaten/kota di Sumatera Utara. Jambore Kader Posyandu ini juga dimeriahkan dengan kegiatan lomba penulisan makalah, lomba cerdas cermat dan mengisi KMS. “Jambore ini juga diisi dengan kegiatan pengobatan pemeriksanaan kesehatan secara gratis bagi masyarakat, paparnya. Turut hadir dalam Jambore Kader Posyansu Tahun 2010 di antaranya Ketua Umum Tim Penggerak (TP) PKK Hj Gamawan Fauzi, Ketua Solidaritas Istri Kabinet Indonesia Ratna Sari Joko Suyanto, Kepala BKKBN Pusat DR dr Sugiri Syarief MPA, Ketua Tim Penggerak PKK Sumut Sutias Handayani Gatot Pudjo Nugroho, Bupati Deli Serdang Drs Amri Tambunan, Kepala BKKBN Sumut H Nofrijal SP MA dan sejumlah SKPD di Sumut. (m30)


Remaja

B8 40 Siswa SMA Reguler Al Azhar Diterima Di Universitas Terkemuka SEBANYAK 40 Siswa SMA Reguler Al-Azhar Medan berhasil lulus di berbagai perguruan tinggi negeri terkemuka di Indonesia melalui jalur Panduan Minat dan Prestasi (PMP) dan undangan. Hal itu diungkapkan Kepala SMA Reguler Drs. Syafruddin Lubis ketika pelaksanaan wisuda SMA Reguler Al Azhar di sekolahnya, Sabtu lalu. Menurut Syarifudddin, 40 siswa itu yakni; Ummu Khairah (Fak. Kedokteran USU), Rizka Ayunda (Fak. KedokteranGigiUSU),LestariRamadani(Fak. Kesehatan Masyarakat USU), Sevia Anjani (Fak. Farmasi USU), Dwi Alfiani (Fak. Farmasi USU), Alamanda Cathartica (Fak. Ilmu Politik USU),Yunisda Damanik (Fak. Ekonomi/Manajemen USU), IndiraWijaya Putri (Fak. Ekonomi/Manajemen USU),Tri Halisa Zahra (Fak. Ekonomi/Akuntansi USU), Nova Husein Aziz (Fak. Ekonomi Akuntansi USU), Novia Larasati (Fak. Ekonomi/ Akuntansi), Keumala Meutia (Fak. Ilmu Hukum USU), Titia Pamuktia (Fak. Ekonomi/Manajemen USU), Cut Yunita (Fak. Agribisnis USU), Islahati Batubara (Fak. Psikologi USU), Ahmad Shalihin (Fak. Teknik Industri USU). Kemudian, Rosiana Azmi (Fak. Sastra Inggris Unbraw), Kusma Mayangsari (Fak. Sastra Jepang Unbraw), Fahrizal Kreshna (Fak. Agro Ekoteknologi Unbraw), M. Rizki Ikhwan (Fak. Manajemen Sumber Daya Perairan Unbraw), T. Dara Malinda (Fak. Ilmu Komunikasi Unand), Rizki Mawaddah Fak. Ekonomi/Manajemen Unand), Puji Sari Ambriyana (Administrasi Niaga IT Telkom), Zuhri Juang Dapot (Administrasi Niaga IT Telkom), Eva Zaliha Satiati (Teknik Industri IT Tel-

WASPADA Minggu 29 Mei 2011

Karya Busana Spektakuler 2011 Ala SMKN 10 Medan PAGELARAN hasilkarya siswa SMKN 10 yang berlangsung disela sosialisasi program keahlian di sekolah itu belum lama ini berlangsung meriah.

Waspada/dede

PEMBINA Yayasan Hajjah Rachmah Nasution H. Abdul Manan Muis didampingi Sekretaris Yayasan Ir. Riza Novida dan Kepala SMA Reguler Al Azhar ketika mewisuda siswa, Sabtu lalu di sekolahnya. kom), BagusWicaksono (Teknik Informatika IT Telkom), M. Yunus (Komputer Akuntansi IT Telkom). Salmah Abdullah (Administrasi Niaga Polmed), Fakhrul Luthfi (Fak. Ekonomi/Akunatsni Caltex Riau), Anggada Prakarsa (Meka Tronika Caltex Riau), Erawati (Fak. Ilmu Komputer Caltex Riau),Yenni Syafitri (Fak. Ekonomi/Manajemen USU), Nurlaila Hasanah (Fak. Teknologi Perikanan Unbraw), Reza Fahlevi (Fak. FISIP Adm Niaga USU), Rio Pratama (Budidaya Perkebunan STIPAP), Muhammad Ishak Sigit (Budidaya Perkebunan STIPAP), Abd. Karim (Budidaya Perkebunan STIPAP), Ahmad Arifin Nasution (Budidaya Perkebunan STIPAP),

SMAN 1 Langsa Catat Prestasi Olimpiade Sains Dan O2SN LANGSA (Waspada) : SMA Negeri 1 Langsa kembali mencatat prestasi mengembirakan dalam Olimpiade Sains tahun 2011 yang memperlombakan delapan bidang studi utama. Seperti dalam lombalomba tahun lalu, anak didikan Drs H. A. Samad Hasan, MBA (Kepsek) ini juga menggondol sejumlah gelar juara dalam lomba yang diikuti seluruh SMA Negeri dan Swasta di Kota Langsa baru-baru ini. Selain memboyong 9 gelar juara dari 24 gelar yang diperebutkan dalam Olimpiade Sains, siswa SMA Negeri 1 Langsa juga berhasil pada Olimpiade Olahraga Siswa Nasional (O2SN) Kota Langsa tahun 2011, setelah menyabet 5 gelar dari 15 nomor juara pertama cabang atletik, karate, pencak silat, bulutangkis dan tenis meja. Keberhasilan kedua event olimpiade tersebut seiring dengan tampilnya SMAN 1 sebagai juara-I dalam turnamen sepakbola memperebutkan Piala Walikota awal Mei lalu. Dalam Olimpiade Sains, sembilan gelar yang diraih anak-anak SMAN-1 adalah lima gelar juara-I bidang studi matematika, fisika, computer, astronomi dan ekonomi. Tiga gelar juara-II meliputi kimia, astronomi dan kebumian serta satu gelar juara-III bidang studi kimia. Sedangkan lima juara pertama dalam O2SN terdiri dari pencak silat tunggal putra, pencak silat tanding kelas-F putri, bulu tangkis tunggal putri serta tenis meja putra dan putri. Menurut Kepala Dinas Pendidikan Kota Langsa Drs Abdullah Gade, M.Pd, kelima juara-I dari SMAN-I Langsa bersama 10 juara-I dari SMA lainnya, akan dikirim untuk mengikuti O2SN tingkat Provinsi Aceh di Banda Aceh bulan depan. Sedangkan para juara (I sampai III) hasil Olimpiade Sains juga akan dikirim ke provinsi. “Jika berhasil di tingkat provinsi mareka akan mengikuti tingkat nasional,” katanya. Dominasi siswa SMAN-1 dalam setiap event lomba termasuk Olimpiade Sains, cukup kuat dan sulit tertandingi oleh sekolah lain. Salah satu sekolah yang menjadi saingan dekat selama ini adalah Madrasah Aliyah Ulumul Quran (MUQ). Namun tahun ini MUQ tidak ikut serta dalam perlombaan tersebut. Menurut Abdullah Gade, mareka tidak dipanggil karena dalam lomba provinsi maupun tingkat nasional, para pesertanya hanya dari siswa lembaga pendidikan dibawah Kepmendiknas. Sedangkan MUQ dibawah Kementerian Agama. (b26)

Terusan Motif Print TAHUN ini adalah saatnya untuk bereksprimen dengan motif print. Aneka motif print semarak banyak diterapkan pada aneka terusan yang bikin tampilan beda. **Neneng KZ/AP

Rini Anggraini (Teknik Industri UII), Agung Hidayatullah (Teknik Industri UII), Ayu Lestari Sinaga (Fak. Ekonomi/ Akutansi USU). Berkat prestasi itu Syafruddin mengaku bersyukur kepada Allah SWT. Inisemuaberkatkerjakerasparadewan guru dalam membina siswa untuk bisa lolos ke berbagai perguruan tinggi. “Ke depan, untuk meningkatkan lulusan yang terbaik SMA Reguler Al Azhar TA 2011-2012 telah membuka kelas unggulan untuk kelas X dan XI untuk jurusan IPA dan IPS,” katanya. Sementara untuk siswa berprestasi kelas IPA meliputi, Anggia Ayu Lanzar, Fakhrizal KreshnaYudha Chandra,Tia Nahara Hendrati, Ahmad Muzani dan Nurjannah Khairani. Sedangkan IPS, Nova Husein, Yunisda Damanik, Rosiana Azmi Ritonga, Alamanda Cathartica dan Titia Pamukti. Atas prestasi itu PembinaYayasan Hajjah Rachmah Nasution H. Abdul Manan menyambut gembira dan bersyukur atas prestasi siswa SMA Reguler Al-Azhar Medan tersebut. “Prestasi itu tentu akan mengharumkan nama SMA Reguler Al-Azhar Medan,” katanya. Untuk itu, Abdul Manan Muis mengimbau agar para siswa yang mendapat kehormatan diterima tanpa testing atau dengan testing, untuk tetap menjaga konsistensi semangat belajar dantidakmenyia-nyiakankesempatan yang lebih diperoleh sehingga dapat terus meningkatkan prestasinya. Kepada guru-guru, H. Abdul Manan Muis meminta agar terus meningkatkankinerjasehinggasemakinbanyak undanganyangdisampaikanuniversitas favorit baik dalam dan luar negeri kepada anak-anak kita. Kepercayaan yangdiberikanitumerupakancambuk bagi kita agar terus meningkatkan kualitas kelulusan melalui peningkatan pelayanan pendidikan kepada anakanak kita. **m43

Para siswa di program keahlian busana yang memamerkan karya busana dengan beragam perpaduan pernik dengan motif pilihan, membuat hadirin merasa kagum atas karya ini. “Hasil karya siswa di program keahlian busana , selalu ditampilkan saat ajang promo sekolah seperti saat ini. Kegiatan ini turut mendukung mereka untuk lebih kreatif lagi dengan imu yang didapatkan dari para guru di sekolah dan bisa mengkombinasikan dengan ilmu yang mereka dapatkan secara otodidak,”kata Kepala SMKN 10 Dra Dahlia Puba di sela kegiatan berlangsung. Dahlia menyebutkan, program keahlian busana di sekolah ini termasuk jurusan pilihan yang pavorit. Peserta didiknya semakin berlomba dalam menciptakan beragam hasil karya dengan motif dan bahan pilihan yang sedang tred di tengah masyarakat. Ada juga yang sengaja melahirkan inovasi tersendiri untuk karyanya. “Banyak siswa yang lebih kreatif setelah mendapatkan ilmu dari guru mereka. Seperti tampilan siswa kali ini yang mengadopsi tentang alam, sehingga menonjolkan perpaduan warna hijau. Bahkan yang terlihat sangat etnik dengan kombinasi antara busana dan hiasan rambut yang cukup menonjolkan keahlian dalam penataan dan pewarnaan rambut, sehingga hasil karyanya itu membuktikan sisi kreatifnya,” kata Dahlia. Tampilan para model yang mengenakan aneka busana karya siswa di jurusan keahlian tata busana ini mendapat respon dari pengunjung bazar dan pameran, utamanya Kepala Dinas Pendidikan Kota Medan Drs Hasan Basri yang datang bersama isteri selaku Ketua Dharma Wanita Persatuan Dinas Pendidikan Kota Medan dan kepala sekolah SMKN dan Swasta serta para pengawas yang melihat

Siswa SMKN 10 dengan tampilan trend busana karya siswa di program keahlian tata busana yang tampil dalam kegiatan bazar dan pameran kreativitas siswa.

Waspada/Anum Saskia

kegiatan ini. Pengunjung pameran busana mengaku kagum atas tampilan siswa ini, demikian juga Ketua Dharma Wanita Persatuan Dinas Pendidikan Kota Medan, Ny Bahriah Hasan Basri yang memperhatikan tampilan siswa

YPSA Raih Dua Piala Amuk X Teater LKK Unimed Se Sumut YAYASAN Pendidikan Shafiyyatul Amaliyyah berhasil mendapat juara I Cipta Puisi dan juara II Musikalisasi Puisi se Sumatera Utara pada Amuk X Teater LKK Unimed yang diadakan di gedung Auditorium Universitas Negeri Medan (UNIMED) Rabu-Sabtu (18-21/5) lalu. Menurut Pelatih Musikalisasi Puisi YPSA Kurnia Syahputra, SS, kegiatan ini merupakan gelaran tahunan yang diadakan mahasiswaTeater LKK Unimed ini merupakan ajang asah seni, asah rasa dan asah kreativitas siswa Sumatera Utara. Untuk itu, Kurnia berharap kepada siswa untuk terus berkarya, jangan pernah mengharap untuk jadi pemenang, tapi jadikanlah diri kalian tuk menjadi juara sejati. Sebab, juara sejati takkan pernah mati untuk terus berkarya. “Pemenang I Cipta Puisi diraih Winnie Andhini Koeswito yang kelas XI YPSAdenganjudulpuisi“NilaiKehidupan”.Sedangkanuntukpemainmusikalisasi puisi, Erysa Alifah Maharamis,Toni Nurrahman, Maulida Zhalwa Asfia Sebayang, Tania Alamsari, Nazla Adila, Rahmawaty Putri, Dimas Arief, taufiq Athwinsa, Ahmad Nazri Adlani. Judul puisi wajib Musikalisasi Puisi yang dibawakan yakni “ DI Titi Gantung Kuasah Rindu” karya A. Rahim Kahar dan puisi pilihan “ Ganbaro” karya Kurnia Syahputra. ** m43

Bimtek GAN Dan Lomba Perkuat Tekad Siswa Jauhi Narkoba RATUSAN pelajar dari berbagai SMA di Medan mendapatkan Bimbingan Pelaksanaan Teknis (Bimtek) Gerakan Anti Narkoba (GAN) serta perlombaan karya tulis serta karikatur. Acara dilaksanakan Dinas Pendidikan Kota Medan 18 s/d 20 Mei lalu di BPLT Sumut Jalan Karya Dalam Sei Agul Medan, memperkuat tekad dan mental siswa menjauhi penyalahgunaannarkoba.Acarainimenghadirkan nara sumber Drs Zulkarnain Nasution dari Gerakan Anti Narkoba dan Pimansu,Kadis Pendidikan Kota Medan, Drs Hasan Basri MM dan Kepala Bidang Menengah Umum dan Kejuruan Marasutan Siregar MPd. H Marasutan menyebutkan program bimbingan teknis ini bertujuan untukmelatihsiswaSMAsebagaicalon pendidiksebayaantinarkobadisekolah mereka, dengan pembekalan ilmu yang disampaikan nara sumber. Ilmu yangmerekadapatkan,kataMarasutan seputar narkoba, bentuk dan dampak buruk penggunaannya dan masalah HIVAIDS. Dari kegiatan ini diharapkan, siswa mampu menjadi teman sebaya yang memberikan pendidikan dan berbagai informasi kepada teman sekolahnya agar tidak terpengaruh pada penyalahgunaan narkoba yang sangat berbahaya. Mereka akan membentuk kelompok teman sebaya dengan binaan kepala sekolah dan guru fasilitator yang sudah dilatih oleh tim pusat. “Usai kegiatan ini, mereka akan dikukuhkan sebagai anggota satuan tugas (satgas) anti narkoba di sekolahnya masing-masing. Sedangkan tugas merekamembantukepalasekolahdan guru mengawasi para siswa agar tidak terlibat dalam penyalahgunaan narkoba,”kata Marasutan sembari menyebutkankegiataninibertemakan ceramah, diskusi,tanya jawab, simulasi dan action perencanaan. Marasutan yang juga menyampaikan paparan tentang strategi dan kiat penanggulangan narkoba dan HIV/ AIDS di sekolah menyebutkan, penyebaran wilayah penyalahgunaan narkoba di Indonesia telah merambah luas bahkan pada kelompok pelajar, bahkan dari data yang ada setidaknya ada3,9persenatau4dari100penyalahguna narkoba adalah pelajar dan mahasiswa. Bahkan data yang dihimpun Badan Narkotika Nasional tahun 2008 lalu, kasus narkoba di lingkungan pendidikan di Indonesia, setidaknya ada 13.708 siswa di Sekolah Dasar. 110.627 di tingkat SMP dan SMA serta di Perguruan Tinggi ada 5.075 orang. Kemudian data dari Dit.IV narkoba

dengan busa kombinasi yang sangat serasi. “Hasil karya yang bisa dibanggakan. Mempermudah mereka mendapatkan lapangan pekerjaan usai mengikuti pendidikan,”kata Bahriah. Anum Saskia

Waspada/dede

KEPALA Bagian Pendidikan Bagoes Maulana, S. Kom (dua dari kiri) didampingi pelatih musikalisasi puisi Kurnia Syahputra, SS foto bersama dengan para siswa usai menerima hadiah.

Zodiak Kamu Minggu Ini TAURUS (20 AApr pr – 20 M ei) Mei) ADA banyak kejutan di bulan ini. Pastinya akan menjadi pengalaman yang bikin kita lebih pede. Pergeseran Merkurius juga turut member kesempatan untuk bertemu orang baru. ASyik, kita bisa lebih berkembang. CINTA : Seseorang dari masa lalu datang lagi. Semuanya tergantung kita apakah kita membiarkan dia menetap atau pergi. KESEHATAN : Jangan biasakan tidur larut malam. LIST TO DO : Makan sayur itu penting! GEMINI (21 Mei – 21 Jun) BANY AK waktu kosong yang bisa kita manfaatkan bareng teman-teman lama. Bertemu ANYAK teman-teman lama bisa membuat energy kita jadi lebih positif. CINTA : Ada urusan yang belum terselesaikan. Sebelum memulai hubungan baru lagi, pastikan hati kita udah lebih siap. KESEHATAN : Kurangi makan makanan berminyak. LIST TO DO :Weekend ini, rapikan barangbarang yang berserakan di kamar. CANCER (22 Jun – 23 Jul) AKTIVIT AS kita memang lagi padat banget . Jangan panic, kita pasti bisa melakukan semuanya. AKTIVITAS CINTA : Hmm, kita bakal bertemu dengan seseorang yang selama ini kita inginkan. Aura cinta udah benar-benar terasa banget. KESEHATAN : Jangan lupa minum air putih.LIST TO DO : Sesibuk apa pun, jalan bareng keluarga tetap penting.

Waspada/Anum Saskia

RATUSAN siswa yang diberikan bekal dampak buruk penyalahgunaan narkoba oleh nara sumber Zulkarnain Nasution dalam kegiatan Bimtek GAN digelar Dinas Pendidikan Medan. dan KT Bareskrim Polri ditahun yang sama, juga mencatat untuk Sumatera Utara menduduki pringkat III dengan 2.366 kasus. “Disamping pendidikan praktis seperti BimbinganTeknis (Bimtek) dan Gerakan Anti Narkoba (GAN) diperlukan peningkatan dan membentuk prilaku hidup sehat dan bertanggung jawab serta meningkatkan kecakapan hidup,”kata Marasutan bersama Pejabat pelaksana teknis kegiatan Drs Sugerno. Sedangkan nara sumber, Zulkarnain menyebutkan, menjadi teman sebaya sebagai pemberi informasi bahaya penyalahgunaan narkoba di sekolah,diberikanpengetahuantentang jenis dan bentuk narkoba serta berbagai peralatan yang digunakan untuk konsumsi narkoba, kalimat lain yang meyertai penyebaran narkoba dalam berbagai versi. Di samping itu, mengetahui pula ciri pengguna secara fisik maupun mental serta perubahan bicara yang tiba-tiba gugup atau suara berubah jadi celat. Peserta kegiatan dari SMAN 4 MedanbernamaMarnimenyebutkan, kegiatan ini sangat memberikan manfaat untuk dirinya, kelak setelah kegiatan usai, dia akan menyampaikan berbagai pengetahuan yang dia dapatkanuntuktemandisekolahnya.“Biasanya para remaja lebih suka bercerita dengan teman sebayanya. Karena itu, Bimtek ini menjadi salah satu cara agar kami sebagai siswa atau digolongan remaja punya bekal ilmu untuk disampaikan pada teman di sekolah. Pokok-

nya senanglah dapat ilmu dan kenal teman dari sekolah lain,”kata Marni. Pemenang Lomba Pejabat pelaksana tekni, Drs Sugerno menyebutkan kegiatan ini akan diakhiri perlombaan yang bisa diikuti peserta. Lomba cipta lagu tentang bahaya narkoba untuk perorangan, penulisan artikel, karikatur dan cipta bacapuisi.Kegiatanlombabertemakan antara lain melalui gerakan anti narkoba di sekolah, kita cegah penyalahgunaan, berkarya untuk mencegah penyalahgunaan narkoba dan melalui gerakan anti narkoba di sekolah kita jadikan peserta didik yang sehat, bugar dan cerdas. Lomba Cipta Lagu juara I s/d III: Ari Sinaga SMA Santo Paulus, Haidar Habib SMA Muhammadiyah 1 Medan. Masaderita Gea SMA Swasta Parulian 2 Medan. Lomba Cipta dan Baca Puisi juara I s/d III : Ratih Ayu Qomariah SMAN 13 Medan, Rizky AmeliaYasminSMASwastaPancaBudi Medan, Henny Hikmaya S, SMA Swasta Mulia Medan. Lomba mengarang/pidato juara I s/d III : Theresia SMAN 14 Medan, Citra I.M.Laili SMAN 16 Medan dan Floranda Cherissa SMA SwastaJosuaMedan.Lombapenulisan artikel, juara I s/d III : Rudi Hartono SMAN 20 Medan, Nurul HD. SMAN 3 Medan, Erik SMA Amir Hamzah Medan. Lomba karikatur, juara I s/ d III : Faisal Rahman Hanafiah SMA Kemala Bhayangkara, Dwigi Amelia Lamora SMA Sutomo-1 Medan dan Wahyu Syahpurta,SMAN 9 Medan. Anum Saskia

LEO (24 Jul – 23 Ags) INI saatnya liburan. Ajak teman atau saudara pergi ke tempat-tempat unik yang selama ini belum pernah kita kunjungi. CINTA : Kalau memang suka, enggak usah malu untuk menunjukkan tasa suka. Jangan sampai dia kabur, lho. KESEHATAN : Hati-hati gejala masuk angin mendera. LIST TO DO : Lebih banyak jalan membuat badan ‘gerak’. VIRGO (24 Gas – 23 Sep) AWAL baru membuat kita lebih semangat. Kita benar-benar sedang dilimpahkan energy positif. Manfaatkan waktu ini semaksimal mungkin. CINTA : Jatuh cinta sejuta rasanya. KESEHATAN: Sakit kepala membuat aktivitas terhambat. LIST TO DO :Tidur cukup membuat tubuh lebih segar. LIBRA (24 Sep – 23 Okt) LAKUKAN apa yang selama ini kita mau. Plus, kerjakan semua pekerjaan yang tertunda. CINTA : Sepertinya dia udah mulai serius tuh. Dengarkan apa kata hati kita. KESEHATAN : Gejala PMS datang lebih cepat. LIST TO DO : Saatnya ganti gaya rambut. SCORPIO (24 Okt – 22 Nov) MINGGU sibuk banget, nih.Tetap tenang, biarkan semua berjalan sesuai rencana. CINTA : Putus cinta enggak berarti dunia hancur. Live your life! KESEHATAN : Kondisi badan lagi drop. Maksimalkan waktu istirahat. LIST TO DO : Selesaikan PR dan tugas yang tertunda. SA GIT ARIUS (23 N es) SAGIT GITARIUS Noov – 21 DDes) JANGAN patah semangat dong.Yakin aja deh, kita pasti bisa melakukan semuanya. CINTA : Sepertinya dia diam-diam naksir tuh.Tapi, jangan GR dulu ya… KESEHATAN : Ada gangguan kecil pada perut. LIST TO DO : Ayo dong katanya mau menabung. CAPRICORN (22 Des – 20 Jan) MUMPUNG semangat lagi tinggi, ikut kegiatan positif dan cari teman lebih banyak lagi. CINTA : Perlahan, dia mulai cari cara untuk PDKT.Jangan terlihat terlalu agresif ya. KESEHATAN : Flu, kembali menyerang. LIST TO DO : Bantu mama di rumah biar mama lebih happy. AQUARIUS (21 Jan – 19 Feb) KIT A bakal dipercaya sebagai pemimpin dalam sebuah panitia. Manfaatkan kesempatan ini KITA untuk menunjukkan potensi kita. CINTA : Ada orang baru yang bakal datang dalam kehidupan kita. Kalau kita memang suka boleh juga tuh. KESEHATAN : Sesibuk apa pun, makan tetap penting. LIST TO DO : Sesekali shopping enggak masalah kok. PISCES (20 Feb – 20 Mar) JANGAN terlalu terburu-buru.Tenang aja, semuanya pasti beres pada waktunya. CINTA : Posesif hanya membuat pacar gerah. BErikan dia waktu untuk diri sendiri. KESEHATAN : Kurangi berat badan sedikit. LIS TO DO :Tepati janji. ARIES (21 Mar – 19 Apr) PER ERCCAYA aja sama kemampuan kita, enggak ada yang lebih hebat dari diri kita sendiri. Beneran deh. CINTA : Pesona kita memang enggak diragukan. Ada beberapa cowok yang diamdiam menaruh hati. KESEHATAN : Pijat badan bisa jadi solusi jitu untuk pegal-pegal. LIST TO DO : Barang-barang di kamar udah menumpuk tuh. Rapikan dong. **m31/ KW


Remaja Remaja Harus Ikut Serta Menjaga Lingkungan

B9

WASPADA Minggu 29 Mei 2011

REMAJA merupakan sosok yang memiliki usia masih tergolong sangat muda serta mempunyai masa depan yang masih panjang. Sebuah usia yang potensial dalam membangun dan menjaga lingkungan hidup yang kini semakin rusak. “Dengan usia yang masih muda tersebut, sebenarnya penglibatan remaja dalam menjaga kelestarian alam dan lingkunganhidupsangatlahideal. Hal itulah mengapa dalam pagelaran Peringatan Hari Lingkungan Hidup 2011 dan CSR Expo ke-4 di Lapangan Benteng Medan ini dunia pendidikan diikutsertakan mulai tingkat SD hingga SMA,” ujar Kepala Badan Lingkungan Hidup (BLH) Sumatera Utara, Hidayati. Oleh karena itu, lanjutnya, perlu disadari dan menjadi catatan bersama bahwa penglibatan remaja dalam melestarikan alam sejak masa remaja sangatlah penting dan sangat besar pengaruhnya bagi perkembangan lingkungan, sekarang dan yang akan datang. “Agar remaja bisa terlibat aktif dalam menjaga kelestarian alam dan lingkungan yang baik, remaja harus dibekali secara cukup tentang pengetahuan, kesadaran

Waspada/Hamzah

Kepala Badan Lingkungan Hidup (BLH) Sumatera Utara, Hidayati memberikan penghargaan terhadap pelajar yang menang dalam Peringatan Hari Lingkungan Hidup 2011 dan CSR Expo ke-4 di Lapangan Benteng Medan. dan ketrampilan tentang bagaimana menjaga kelesatrian alam. Bila ini dilakukan sejak dini, kita yakinmasadepanlingkungandan kondisi alam bisa lebih baik ke depan,” ujarnya. Dengan usianya yang masih mudah ini, lanjutnya, tentunya dapat member contoh yang baik dalam upaya penjagaan kebersihan dan kelestarian lingkungan. Dengan memulai dari suatu hal yang paling kecil, seperti membuang sampah pada tempatnya. Hal ini akan menciptakan lingkungan yang bersih. Apabila setiap

remaja memiliki kesadaran diri dan rasa tanggung jawab pribadi untuk menjaga kebersihan lingkungan, kita yakin bahwa lingkungan hidup kita akan baik. Hidayati menyatakan kegiatan yang akan diagendakan setahun sekali pada bulan akhir Mei initidakhanyaakandiikutsertakan dari pemerintah daerah, pemerintah kota Medan, BUMN, LSM, dan dunia pendidikan melainkan lebih lagi. “Banyak cara yang bisa ditempuh dengan melibatkan remaja dalam kegiatan sosialisasi

tentang pentingnya menjaga kebersihanlingkungan.Mulaidari langkah-langkah untuk menjaga kebersihan, tata cara pelestarian serta manfaat-manfaat dari lingkungan yang bersih,” terangnya. Para remaja yang memiliki kepedulian akan kebersihan dan kelestarian lingkungan, selalu berusaha menjaga dan merawat lingkungan sekitarnya. Namun satu hal yang sangat disayangkan pengaruh kebiasaan yang sudah membudaya di lingkungan sosial kita, membuat remaja enggan melakukan hal-hal kecil.

“Melibatkan remaja dalam mengelola sampah sebenarnya bisa menjadi contoh yang baik. Bila sejak remaja cerdas dalam mengelola sampah dan limbah, maka lingkungan hidup kita akan bisa lebih baik,” ujarnya. Remaja sangat perlu dibekali dengan sikap kreatif dalam mengelola lingkungan. Sebab remaja yang kreatif akan bisa mengelola sampah dan limbah menjadi berkah. Adapun remaja yang memiliki kreatifitas tinggi, dapat memanfaatkan sampah yang dianggap sebagai limbah serta pencemaran lingkungan itu menjadi suatu produk yang bermutu dan berguna atau bermanfaat bagi orang lain. “Begitupun banyak pelajar di tingkat kabupaten kota di Sumatera Utara memenangkan pagelaran ini. Semoga kedepan para remaja akan meningkatkan kembali kreatifitasnya,” lanjutnya kembali. Tentunya, lanjut Hidayati kembali, kiranya untuk dapat melaksanakan semua kegiatan dalam upaya pelestarian lingkungan itu ada tiga hal yang menjadicatatanuntukkitasemua, yakni 3D - Dimulai dari yang kecil, Dimulai dari diri sendiri, Dimulai dari sekarang. Pada perlom-baan itu untuk lomba daur ulang kategori pelajar dimenangkan siswa SMA Negeri 3 Rantau Prapat, SMP Negeri 9 Binjai, SMK Negeri 2Tebingtinggi, SMP Negeri 2 Simalungun dan SMK Negeri 1 PGGS. ** Hamzah

SMA Pilihan SEKARANGkitasudahduduk di kelas tiga SMP atau 9 SMP. Saatnya memilih SMA yang akan menentukan nasib kita tiga tahun ke depan. Tapi, jangan sembarangan pilih biar enggak menyesal nantinya. SMA Unggulan Punya alumni yang pernah jadi juara olimpiade, pelajaran dan guru-gurunya terkenal berbobot, serta memiliki ekskul-ekskul keren yang beredar di manamana. Sebuah sekolah unggulan setidaknyapastimemilikisatudari tiga hal di atas. Dengan memilih sekolah yang masuk kategori unggulan, kemungkinan besar kita akan mendapatkan ilmu dengan cara lebih baik. Selain itu, kesempatan masuk universitas ternama di dalam dan luar negeri pun terbuka lebih lebar. Ekstrakurikuler Bervariasi SMA yang punya banyak variasi ekskul selain memudahkan

kita mengali bakat yang dimiliki juga bisa memberi banyak pengalaman. Bahkan kalau bisa, kita ikutan ekskul yang selama ini enggak ada di SMP. Misal, memasak atau tat arias. Habis itu, kita bisa cari pemasukan tambahan dari kue bikinan kita atau jadi make up assistant teman yang mau pergi pesta. Kurikulum Bervariasi Bukan rahasia umum kalau sekarang ada beberapa sekolah yang punya kurikulum beda. COntoh, SMA Internasional yang memakaikurikulumluar.Dengan begitu, kita bisa dapat pelajaran baru yang enggak ada di SMA biasa. Bahkan, bukan enggak mungkin jadi lebih lancar menggunakan bahasa Inggris atau bahasa lain. Guru Berbobot Siapasihyangmaudiajaroleh guru yang otoriter dan enggak jelas cara mengajarnya? Makanya

sebelum masuk ke satu SMA, jangan lupa cari tahu juga soal kemampuan guru-guru di sana. Soalnya mereka lho yang bakal mentransfer banyak ilmu ke kita. Jangan Ikut-Ikutan Jangankecewakalaunantinya sekolah ternyata enggak seperti yang kita harapkan. Habis, kita sekolah di situ Cuma karena ikutikutan teman, sih. Bakal tambah bête kalau tiba-tiba teman menjauh karena bertemu teman baru. Dekat Rumah Kalau alasannya gara-gara mau irit ongkos, dijamin nanti kitapastiakanmenyesalinya.Kan, enggaksemuasekolahyangdekat rumah punya kualitas bagus.. Banyak Cowok Cakep Enggak banget, kalau alasan utamakitamemilih suatusekolah karena di sana ada banyak cowok cakep yang bisa digebet. Cowok cakep enggak menjamin sekolah itu jadi yang bagus, kan? **m31

Resepsi Perpisahan SMP Muhammadiyah 1 Meriah

Waspada/dede

Para juara lomba pidato akbar berfoto bersama Wakil Pimpinan Ponpes setelah pembagian hadiah.

Lomba Pidato Akbar Tiga Bahasa Di Ponpes Mawaridussalam SALAH satu kemahiran santri ponpes yang diinginkan masyarakat adalah memiliki kemampuan berpidato atau berceramah. Image ini begitu mengakar, sehingga setiap ada kesempatan, kebanyakan masyarakat menyuruhsantriuntukmengisiceramah bagi mereka. Ponpes Mawaridussalam Batangkuis sebagai miniatur kehidupan bermasyarakat membentuk santri dididik kehidupan, termasuk kemahiran berpidato atau berceramah. Demikian dikatakan Wakil Pimpinan Ponpes Ustadz Drs Junaidi saat membuka lomba pidato akbar tiga bahasa, Selasa (17/5) di mushollah Ponpes. “Latihan pidato di sini tidak hanyauntukmelatihseniretorika, tapi lebih untuk membangun karakter dan menumbuh kembangkanmentalitas,sehingga santri kelak berani tampil dalam menghadapi persaingan hidup,” tambahnya. Di Ponpes Mawaridussalam pembinaan pidato diadakan dua kali dalam seminggu, yaitu hari Minggu malam dan Kamis malam, dalam tiga bahasa, Indonesia, Arab dan Inggris. Santri

secara bergiliran mendapatkan tugas berpidato dalam ketiga bahasa tersebut di depan temanteman sekelompoknya.Tentunya denganpersiapanteksyangharus dikoreksikan kepada guru pembimbing. Di tengah banyak santri di ponpes lain yang takut terhadap agenda latihan pidato, bahkan menjadi salah satu sebab tidak betahnya santri di Ponpes Mawaridussalam santri justru terhibur dan sangat menikmatinya. “Karena latihan pidato di sini dibuat semenarik mungkin, sehingga santri tidak merasa terbebani dan takut”, tukas M Arifinsantrikelasempatyangbaru pindah dua bulan lalu dari salah satu ponpes di Medan. Sebelum perlombaan pidato akbar ini, guru pembimbing mengadakan seleksi sejak 14 April lalu untuk mendapatkan enam finalis di setiap bahasa. Lomba pidato bahasa Arab diadakan tanggal Selasa (17/5), bahasa Indonesia, Rabu (18/5) dan bahasa Inggris, Kamis (19/5). Sebelum mengumumkan hasil lomba, Rajuddin Saragih, SHI salah satu juri menyampaikankegembiraannyaataspenam-

pilan para finalis yang semangat danbersaingketatdalamperolehan nilai. “Ini karena setiap finalis benar-benar mempersiapkan dengan matang. Mereka adalah singa-singa podium teladan kita saat ini,” ungkapnya disambut aplaus santri yang tidak sabar menunggu diumumkannya hasil lomba. Adapun pemenang lomba pidato akbar ini, bahasa Arab: Elsi Efrina Ginting juara I dengan judulBinâuMustaqbalal-Ummah bi Shahwah al-Syabâb al-Islamiyah, Hartati Varadifa runner up I dengan judul Fadhîlat alQur’ân dan Haulia Husna runner up II dengan judul Arkân al-Islâm. Bahasa Inggris, Dicky Zulkarnaen Tamy juara I dengan judul How is the Condition of Moslem GenerationToday, Novi Aryanti runner up I dengan judul Be A True Moslem dan Astar Sentosa Nasution runner up II dengan judul The Dead. Bahasa Indonesia, Hardiansyah juara I dengan judul Beriman kepada Allah, Bina Lestari runner up I dengan judul Pemuda Generasi Bangsa dan Rizki Amelia runner up II dengan judul Kunci Menuju Kesuksesan. ** m43

RESEPSI pelepasan siswa/i kelas IX SMP Muhammadiyah 1 MedanJl.DemakMedanyangdigelar,Sabtulaludihalamansekolahnya berlangsung meriah dan diwarnai dengan berbagai atraksi kreativitas siswa. Kreativitas siswa/i itu antara lain: drumband, atraksi tapak suci, pameran hasil kerja siswa, pidato B. Inggris, B. Indonesia, B. Arab, drama, sentra tari, musikalisasi Asmaul Husnah, pop song, baca puisi dan lain-lain. Namun yang membuat decak kagum para orangtua dan undangan, penampilan atraksi tapak suci yang menampilkan adegan lompat harimau dengan 10 orang, lompat api, memecahkan genteng dan bertarung menggunakan benda tajam. Sontak, aksi ini mendapat sorotan para pengunjung yang ingin mengabadikan momentum luar biasa itu. Ka. SMP Muhammadiyah 1 Paiman, SPd dalam sambutannya mengaku bangga dengan potensi yang dimiliki siswa. “Ke semua ini sebagai wujud nyata dari proses pengaplikasian pengembangan bakat diri siswa yang terus kita bina di sekolah,” tuturnya. Tujuannya, selain sebagai evaluasi bagi pihak sekolah, juga sudah sejauhmana kemampuan mereka menyerap bidang-bidang keterampilan di X-kul tersebut yang telah kita bina hampir setahun ini. “Alhamdulillah, hasilnya cukup memuaskan,” ujar Paiman. Lebih lanjut Paiman berharap anak diasuhnya mampu mencapai kelulusan 100 persen pada pengumuman ujian nasional (UN) Juni mendatang. “Insya Allah, siswa kita dapat lulus 100 persen,” katanya. Selanjutnya acara diisi dengan penyerahan selempang alumni kepada siswa/i kelas IX terpadu, unggul dan reguler didampingi wali kelasnya masing-masing. Pada kesempatan itu dilakukan penyerahan sumbangan dari siswa dan alumni masing-masing 175 paket sembako untuk fakir miskin di lingkungan sekolah, disamping itu penyerahan satu unit televisi oleh wali murid untuk SMP Muhammadiyah 1 dan bantuan dari Bank Sumut. Hadir dalam acara perpisahan itu PCM Medan Kota Ir. Zubaidi, Ketua Majelis Dikdasmen Drs. Zulkifli Amin, MSi, Sekretaris Umum Pimpinan MuhammadiyahWil Sumut HM. NasirWahab, SE, MBA, Pimpinan Muhammadiyah Kota Medan H. Ali Rajab Chaniago, para guru dan orangtua. **m43

Waspada/dede

Salah satu atraksi tapak suci yang ditampilkan para siswa SMP Muhammadiyah 1 Medan saat mengikuti resepsi perpisahan di sekolahnya, Sabtu lalu.

Profil Guru

Drs H Ilyas

Penguatan Nilai Agama Adalah Utama BERTUGAS sebagai guru agama sejak beberapa tahun silam membuat Drs H Ilyas selalu memberi motivsi dan penguatan nilai-nilai keagamaan pada siswa. Dengan cara ini, dia mengaku mampu mendongkrak semangat siswa untuk lebih giat belajar dan mengubah pandangan mereka untuk bertekadagarmenjadisiswayangterbaik.Demikian dikatakannya di sela kesibukannya sebagai Kepala Sekolah SMAN 20 di Belawan belum lama ini. Menutur Ilyas, dengan motivasi, siswa merasa mendapatkan dukungan penuh terhadap apa yang akan mereka kerjakan menyangkut tugas pelajarannya. “Memberikan motivasi pada siswa terkait dengan tugas yang harus mereka kerjakan dan kewajiban yang harus mereka laksanakan sebagai pelajar sangat diperlukan untuk membangun semangat mereka dalam belajar. Berikan mereka gambaran atau contoh siapa saja yang sukses dengan giat belajar, salah satu motivasi yang sangat berharga, agar mereka melakukan hal yang sama,” kata Ilyas. Disebutkannya, umumnya siswa ingin sukses dengan apa yang dia cita-citakan. Karena itu dukungan penuh dari para guru maupun kepala sekolah sangat berarti pada siswa.“Apalagi pelajar di kawasan Belawan ini, mereka sangat perlu motivasi, karena lingkungan sekolah yang sering banjir karena datangnya air pasang. Mereka tidak boleh menyerah dan berusaha memperkuat kemauannya untuk bertahan di sekolah sambil mengerjakan tugas sekolah atau membuat diskusi kelompok menanti air surut sebelum pulang ke rumahnya. Walausekolahdankediamanmerekadipinggir laut tidak jadi alasan mengurangi semangat belajar. Mereka bisa memposisikan kemampuannya setara dengan siswa yang berada di jantung kota Medan. Yang penting kemauan dan kerja keras agar sukses,” paparnya sembari menyebutkan terkait genangan air pasang laut, ia sempat berjalan kaki keluar dari sekolah itu untuk mencapai jalan

raya untuk mengantarkan naskah LJK UN ke Dinas Pendidikan Jalan Pelita IV Medan. Hal lain yang selalu dia tekankan pada siswa untuk disiplin dalam menjalankan ibadah keagamaan. Hal ini bagian dari penguatan nilai keagamaan sekaligus sebagai sarana bersyukur kepada Allah atas apa yang mereka dapatkan, baik kemudahan dalam belajar maupun kesempatan mempunyai orag tua yang berusaha memberikan berbagai keperluan sekolah mereka untuk menggapai cita-citanya. “Karena itu di SMAN 20 ini ada musholla sebagai sarana ibadah wajib dan sunnah yang bisa mereka laksanakan setiap waktu shalat tiba. Dengan melaksanakan ibadah kita telah berbakti kepada Allah dan bersyukur dengan apa yang didapatkan. Sekolah mereka sudah cantik dan bagus sekarang, kalau banjir akibat pasang tidak seluruhnya air masuk kekelas,inikan pantas disyukuri. Apalagi tahun ini tingkat kelulusan siswa di sekolah ini juga meningkat,”papar Ilyas yang mengaku selalu memberikan contoh pada siswa terkait kedisiplinan dan pelaksanaan kegagamaan di sekolah itu. ** Anum Saskia

52 Sekolah Ikuti Olimpiade Departemen Sosiologi FISIP USU SEBANYAK 52 sekolah SMA/ MA/SMK di wilayah Medan, Binjai dan Deliserdang (Mebidang) mengikuti kegiatan Olimpiade Sosiologi tingkat SMA sederajat yang digelar DepartemenSosiologiFakultasIlmuSosial danIlmuPolitik(FISIP)Universitas Sumatera Utara (USU). Kegiatan tersebut digelar untuk yang kelima kalinya oleh Ikatan Mahasiswa Sosiologi (IMASI) di aula kampus FISIP USU, sejak 18 Mei hingga 23 Mei 2011 lalu. Ketua Panitia Olimpiade EvieraMichaltaBangunmengatakan, tahun ini tercatat 52 sekolah yang mengikuti olimpiade tersebut. Dari jumlah tersebut tersaring 6 sekolah untuk memperebutkan juara I sampai harapan III. Keenam sekolah yakni , MAN 1 Medan, Budi Murni 1 Medan, SMA RK Serdang Murni Lubuk Pakam, SMA Harapan 3 DeliTua, dan SMA 1 Lubuk Pakam. Dalam olimpiade itu, lanjutnya,terdapatempatbabakseperti babak benar salah, menjawab, analisis, dan rebutan. Soal yang diujikan seputaran pelajaran sosiologi kelas 1 dan 2, dengan penilaian dilakukan oleh tiga orang juri yaitu Drs. T Ilham Saladin, Dra. Lina Sudarwati, MSi dan Dra. Ria Manurung, MSi. Sebagai pemenang dalam olimpiade sosiologi tersebut yaitu Juara I SMA Negeri 1 Lubuk Pakam dengan nilai 781,5, Juara

Waspada/Sugiarto

Salah seorang siswi peserta Olimpiade menjawab pertanyaan yang dilontarkan pembawa acara dalam Final Olimpiade Sosiologi yang digelar Departemen Sosiologi FISIP USU, Senin (23/5). IISMABudiMurni1Medan(755), JuaraIIIMAN1Medan(579).Juara HarapanIdiraihSMARKSerdang Murni Lubuk Pakam (560), Harapan II SMA Harapan 3 Delitua (340) dan Harapan III diraih SMA Negeri 3 Medan (330). Ketua Departemen Sosiologi FISIP USU Dra. Lina Sudarwati, MSi menyebutkan, kegiatan ini dilaksanakan agar siswa/siswi SMA sederajat menyadari betapa pentingnya ilmu sosial, terutama sosiologi sebagai ilmu yang dapat diterapkan untuk memecahkan berbagai permasalahan-permasalahan sosial yang terjadi saat ini. Selain itu, juga untuk men-

ciptakan generasi yang cerdas baik secara intelektual dan sosial, Lina mengatakan, siswa SMA/ MA/SMKdituntutharusmemiliki jiwa sosial yang tinggi serta mampu menginterpretasikan masalah-masalah sosial yang ada di kalangan masyarakat. “Diera saat ini, mencari manusia yang berijiwa sosial sangatsulit.Adapaunbisadihitung dengan jari. Pelajaran sosiologi sangat penting dipahami sejak siswa duduk di SMA sederajat,” katanya, seraya berharap melalui kegiatanolimpiadetersebutdapat meningkatkan pengetahuan dan jiwa sosial kepada siswa. **m41

Waspada/dede

Rombongan prosesi wisuda YPI Miftahussalam saat memasuki ruang siding di Balai Raya Aceh Sepakat Jalan Mangkara Medan, Selala lalu.

310 Siswa YPI Miftahussalam Diwisuda SEBANYAK310siswaYayasan Pe n d i d i k a n I s l a m ( Y P I ) Miftahussalam Medan terdiri dari 150 siswa SMP, 67 siswa SMA, 13 siswa Aliyah, 44 siswa MTs dan 36 siswa Diniyah diwisuda Ketua IYPIMifahussalamProf.Dr.Abdul Mukti, MA di Balai Raya Aceh Sepakat Jalan Mangkara Medan, Selasa lalu. Acara yang dikemas mirip pelaksanaan wisuda perguruan tinggi ini dibuka melalui prosesi rombongan Pengurus YPI Miftahussalam, Pimpinan Unit SMA, SMP, Aliyah, MTs, Diniyah dan fungsionaris guru-guru. Prof. Dr. Abdul Mukti, MA dalam sambutannya mengatakan, wisuda ini hendaknya menjadi catatan penting bagi dari perjalananpendidikanparasiswa.

Untuk itu kepada siswa, Abdul Mukti mengatakan, wisuda ini bukan berarti para siswa sudah menyelesaikan pendidikannya, tapi wisuda ini menjadi sebuah catatan perjalanan hidup siswa untukterusmelangkahmenapaki pendidikan yang lebih tinggi dan baik lagi. Dikatakannya, wisuda ini merupakan salah satu bentuk dari pertanggunggungjawaban sekolah terhadap amanah yang disampaikan para orangtua murid.Tigaatauenamtahunyang lalu para orangtua murid datang ke sekolah ini untuk menyerahkan anak-anak mereka untuk dididik secara Islami sesuai denganvisidanmisiYPIMiftahussalam. Ketua Pelaksana Rahimah,

SAg didampingi Sekretaris Zulheri, ST dan Bendahara Ana Bara, SE menambahkan, menyangkutpelaksanaanwisuda ini biasanya kita setiap tahunnya melaksanakan wisuda di sekolah. Namun sebagai lembaga pendidikan kita berkeinginan memberikan sesuatu yang bermakna bagi anak didik kita. Dengan adanya acara wisuda ini, para lulusan memiliki momentum kenangan yang tidak akan bisa mereka lupakan selama hidup mereka. Pada acara ini para siswa melalui kepala sekolah masingmasing melantik para siswa sekaligus menyerahkan mendali alumni.Acarainijugadiisidengan berbagaikreativitassiswameliputi tari-tarian, volk song dan lainlain. ** m43


Budaya

B10

WASPADA Minggu 29 Mei 2011

Amuk Teater LKK Unimed

Setelah 10 Tahun... Oleh: Hasan Al Banna

SANGGAR Rumput Hijau (SMA 2 Binjai), salah satu peserta sekaligus pemenang Lomba Musikalisasi Puisi pada “Amuk Teater” di Unimed (Foto: Hasan Al Banna)

Candi Padanglawas Yang Terabaikan Oleh: Erviana Aisyah Lubis MUNGKIN selama ini masyarakat mengira kalau candi hanya ada di Pulau Jawa. Padahal kalau kita melihat situs-situs sejarah yang ada di Sumatera Utara, ada terdapat candi yang merupakan peninggalan bersejarah masa Hindu-Buddha. Sumatera Utara banyak memiliki situs peninggalan sejarah yang sangat perlu dan penting dilestarikan. Salah satu situs peninggalan Hindu-Buddha berupa candi yang terdapat di Sumatera Utara bagian Selatan, tepatnya di Kabupaten Padanglawas. Di sana terdapat sebuah situs percandian yang dinamakan situs Padanglawas. Situs ini merupakan salah satu situs penting dari masa pengaruh HinduBuddha (Klasik) di Indonesia yang berada di Pulau Sumatera. Areal situs ini secara administratif terletak di wilayah tiga kecamatan, yakni Kecamatan Batang Pane, Kecamatan Lubuk Barumun, dan Kecamatan Padang Bolak, Kabupaten Padanglawas Utara. Candi-candi di Sumatera Utara memiliki perbedaan yang khas dengan candi-candi di Pulau Jawa dalam hal bahan pembuatannya. Terlebih Sumatera tidak tersedia cukup banyak batu gunung, maka candi-candi yang ditemukan di daerah ini terbuat dari bata merah. Ini pula sebabnya candicandi di Sumatera lebih rapuh daripada candi-candi di Jawa sehingga kondisinya hampir rusak total saat ditemukan. Na-

mun yang disayangkan, keberadaan situs peninggalan bernilai sejarah itu kian terpuruk kelestariannya. Semua bekas peninggalan tambang kuno tersebut, kini hanya jadi onggokan puing yang terabaikan hingga. Padahal, berdasarkan fakta sejarah yang ada, candi-candi ini merupakan catatan sejarah kebudayaan yang pernah singgah di sini. Konon, candi itu dibangun oleh orang-orang kebudayaan Hindia Belakang yang hidup berabad-abad lalu. Berdasarkan penelitian yang pernah dilakukan, candi-candi atau situs ini menunjukkan sejarah kebudayaan agama Hindu yang pernah berkembang lama di Sumatera. Tidak adanya upaya melestarikan candi-candi tersebut membuat masyarakat Sumatera Utara tidak mengetahui keberadaan candi di Padanglawas itu. Padahal, jika dirawat dengan baik, candi-candi ini dapat dijadikan sebagai objek wisata sejarah yang dapat memberikan pendapatan bagi Pemerintah Sumatera Utara. Selama ini wisata yang terkenal di Sumatera Utara hanyalah Danau Toba, padahal adanya Candi Portibi di Padanglawas dapat dikembangkan

Tidak adanya upaya melestarikan candi-candi tersebut membuat masyarakat Sumatera Utara tidak mengetahui keberadaan candi di Padang Lawas itu.

menjadi objek wisata nasional. Keberadaan candi di Padanglawas dapat pula dijadikan pemerintah daerah atau pun pusat sebagai kekayaan sejarah Indonesia. Kurangnya perhatian pemerintah terhadap peninggalan-peninggalan bersejarah menjadikan situs-situs sejarah terbengkalai. Padahal, dengan pelestarian situs-situs sejarah khususnya candi yang ada di Padanglawas ini, dapat menjadikan suatu aset kekayaan bangsa. Kepurbakalaan yang terdapat pada situs sejarah di Padanglawas tersebar di sepanjang aliran Sungai Batang Pane, Sirumambe, dan Sungai Barumun, yang setidaknya terdiri dari 16 kompleks percandian atau dalam bahasa setempat lebih dikenal sebagai biaro atau biara yang merupakan adopsi dari kata dalam Bahasa Sansekerta, vihara yang berarti tempat belajar mengajar dan ibadah khususnya bagi penganut agama Buddha (Ing. monastery). Nama lain yang dikenal

oleh masyarakat adalah Portibi, yang dalam bahasa setempat berarti dunia. Nama-nama biaro itu antara lain adalah: Sipamutung, Bara, Bahal (I,II, dan III), Sijoreng, Pulo, Sangkilon, Sitopayan, dan Sisoldop. Berdasarkan sejumlah temuan yang didapatkan di situs ini, secara relatif biaro-biaro di Padanglawas (Portibi) diperkirakan sudah eksis sejak abad ke-11 M. Data yang dijadikan acuan terutama adalah tulisantulisan kuno pada prasastiprasasti yang ditemukan di situs ini. Salah satu dari beberapa prasasti itu adalah prasasti Gunung Tua, merupakan prasasti tertua yang ditemukan dan ditulis dalam aksara Jawa Kuno, yang dipahatkan pada bagian belakang landasan sebuah patung yang diapit terbuat dari perunggu. Saat ini sisa-sisa kejayaan kerajaan Panai itu masih dapat dilihat di situs Padanglawas. Beberapa di antara biaro-biaro itu sudah dipugar seperti Biaro Bahal I dan Biaro Bahal II, Biaro

Bahal III dan Biaro Sipamutung, sementara biaro-biaro lainnya yang kondisinya sudah teramat rusak saat ini belum dapat dipugar. Untuk itu, diperlukan peran pemerintah dan dukungan kita semua untuk melestarikan situs sejarah di Padanglawas, mengingat kondisi sebagian candi juga sudah sangat memprihatinkan dan beberapa di antaranya sudah hampir hancur karena tidak ada upaya pemugaran atau pun penanggulangan. Dapat dipastikan jika kita tidak peduli dengan keadaan tersebut maka dalam waktu dekat situs sejarah bernilai penting terhadap daerah Padanglawas khususnya dan Indonesia pada umumnya akan hilang ditelan zaman. Selain sebagai warisan sejarah, candi tersebut juga dapat dijadikan sebagai objek wisata sejarah Sumatera Utara. Semoga! *Penulis adalah mahasiswi Unimed jurusan pendidikan sejarah dan anggota kepenulisan sastra kompensasi.

Waspada/Ist

Salah satu situs candi atau Biaro Bahal di Kabupaten Padang Lawas dalam kondisi yang terabaikan.

Kritik Tajam Lewat Lakon Komedi BERBAGAI macam cara penyampaian kritik dapat dilakukan sedemikian rupa, tidak hanya dengan demonstrasi dan orasi besar-besaran di jalan raya, tapi juga bisa lewat pertunjukan opera dan lakon komedi. Ya, komedi! Teater GelanggangKreasiSeniIndonesia(Generasi) bekerjasama denganRumah Kata mempertegas anggapan tersebut. Lewat Opera “Raja dan Ratu Air”,Teater Generasi mencoba ikut mengkritisi pola tingkah para petinggi dan pemegang kekuasaan yang cenderung serakah,egois,licikdanmenggunakan segala cara dalam mengolah dan mendayagunakan sumberdaya alam yang tersedia demi kemakmuran pribadi. Berlangsung di Gedung Utama Taman Budaya Sumatera Utara (TBSU), Jalan Perintis Kemerdekaan, Jumat (13/5) lalu, opera menampilkan beberapa aktor dan aktris muda yang tergabung dalam Sanggar Generasi MedandiantaranyaNienaWinata, S. Yadhie, Cut Aida, Sutriono, SyahdiAzharidanlain-lain.Opera diawali dengan musikalisasi puisi

yang dibawakan siswa SMP dan dilanjutkan dengan mahasiswa FKIP UISU. Tiga buah puisi dimusikalisasikansebagaipembuka pertunjukan. Opera “Raja dan Ratu Air” yang ditulis oleh Idris Siregar dan disutradarai Suyadi San mengangkat cerita beralatar dua kerajaan yang saling memperebutkan sumber mata air yang terletak pada kerajaan Sang Ratu, tetapi diklaim juga sebagai milik Sang Raja. Perseteruan kian rumit sebab masing-masing utusan yang dikirim kedua belah pihak sebagai pencari informasi pihak lawan justru saling jatuh hati. Dimulai dengan sebuah lagu yang dibawakan para pelakon. Sayang,diawalpertunjukan,kelemahan pada bagian suara sudah terasa.Tak terelakkan, suara para pelakon yang bernyanyi terdengar sayup-sayup di antara bunyi alat musik yang mendominasi. Tampaknya para pelakon telah benar-benar berusaha menampilkan performa suara terbaik dengan artikulasi yang jelas, namun tak mengimbangi deru alat musik dan riuh penonton yang

*Penulis adalah alumni Teater LKK Unimed, sastrawan, staf Balai Bahasa Medan dan dosen luar biasa di FBS Unimed.

Catatan Budaya

Sinergi Oleh S. Satya Dharma

Pementasan Opera “Raja dan Ratu Air”

Oleh: Yosi Abdian Tindaon

“AMUK Teater” yang digelar LKK Universitas Negeri Medan (Unimed) telah usai. Ya, selama empat hari (18-21 Mei), “Amuk Teater” berlangsung meriah di gedung dan pelataran auditorium Unimed. Para pemenang telah didaulat ke panggung kesuksesan. Peserta yang belum beruntung, ditantang lagi untuk datang tahun depan. Lantas, hiruk-pikuk festival (baca: kompetisi kesenian) yang masih menggema di telinga, adakah menguap begitu saja? Apakah sebuah ajang festival, terlebih festival kesenian digelar tidak lebih dari sekadar memperebutkan prestasi sekaligus prestise? Benar, festival dapat diposisikan sebagai salah satu alat ukur kualitas produk kesenian. Lantas, alat ukur tersebut akan ‘menuding’ siapa yang menjadi terbaik, dan kemudian bebas merayakan kemenangannya. Demikiankah? Sesungguhnya, bagi peserta festival, ada hal yang lebih penting dari deretan trofi, piagam penghargaan, bingkisan hadiah, bahkan giuran uang tunai. Substansi festival kesenian lebih terfokus pada bagaimana ‘jantung kreativitas’ tetap berdenyut, senantiasa sehat wal’afiat. Inilah idealnya tugas yang diemban Teater LKK Unimed setiap menggelar“Amuk Teater”. Hakikatnya, iming-iming hadiah hanya aksesori, penyemarak bagi peristiwa silang produk kesenian. Memang, jika menoleh ke lembaran awal kelahiran “Amuk Teater”, semangat festival yang diusung lebih kepada menyuburkan tanah apresiasi. Embrio ajang ini semula bertajuk “Festival DKOKUK”. “DKOKUK” yang menjadi semboyan Teater LKK Unimed merupakan singkatan“Dari Kita Oleh Kita Untuk Kita”. Semula, “Festival DKOKUK” berlangsung sebagai kompetisi internal saja. Festival ini digelar bagi calon anggota Taeter LKK semata. Begini cara kerjanya. Setiap tahun, Teater LKK menerima anggota baru. Setelah melewati seleksi awal, calon anggota menjalani pemagangan sampai hitungan bulan. Dalam proses magang, calon anggota akan memperoleh pengetahuan dasar dalam berteater. Selanjutnya mereka dipecah menjadi beberapa kelompok, dan masing-masing kelompok diberi ‘tugas’ menyiapkan sebuah garapan teater. Lantas, “Festival DKOKUK” menjadi puncak magang calon anggota sebelum ‘diwisuda’. Nah, untuk menyemarakkan festival, dipilih dan diberilah hadiah bagi aktor, aktris, sutradara dan kelompok terbaik! Sepadan waktu yang menggelinding, “Festival DKOKUK” pun dikembangkan. Namanya ditukar menjadi “Amuk Teater”. Selain anggota baru, target utamanya yang lain adalah para pelajar di kota Medan (Sumut). Dewan juri bukan saja para alumni yang berkompeten di bidangnya, tetapi juga diundang dari ‘luar’. Maka, dengan ajang “Amuk Teater”, digelar pula festival teater

untuk pelajar. Selanjutnya, “Amuk Teater” tidak semata untuk produk kesenian bernama teater. Secara perlahan, “Amuk Teater” mengundang para mahasiswa dan pelajar (dari tingkat TK sampai SLTA) untuk berpesta kreativitas dalam bidang baca puisi, cipta puisi/cerpen/naskah drama, tari, musikalisasi puisi, bahkan seni lukis. Ya, kadang, tidak semua cabang lomba yang disebutkan di atas digelar tiap tahun, khususnya naskah drama, tari dan seni lukis. Namun, pengayaan peserta dan cabang lomba merupakan jawaban Teater LKK atas kekeringan wadah festival kesenian yang melanda Medan (Sumut). Teater LKK memang bukan satu-satunya kelompok kesenian yang menggelar festival. Namun, tidak banyak yang mampu melakukannya secara kontiniu. “Amuk Teater” yang baru saja digelar itu tercatat sebagai ajang yang kesepuluh. Pendek kata, “Amuk Teater” sudah berlangsung selama 10 tahun. Tidak dapat dipungkiri, ajang ini menjadi kelender tahunan incaran para peserta. Imbasnya, proses—katakanlah—berkesenian para pelajar lewat sanggar sekolah masing-masing seolah ‘terbantu’ oleh keberlangsungan “Amuk Teater”. Oleh karena itu, sekali, tanpa menafikan persitiwa festival yang lain, “Amuk Teater” hadir bukan hanya sebagai seorang dermawan pembagi-bagi trofi, piagam, bingkisan, uang tunai bagi para pemenang. Namun lebih dari itu, festival “Amuk Teater” ditegakkan demi keberlangsungan semangat berkesenian, terkhusus generasi dini. Harapan utamanya, bagaimana dengan kesetiaan “Amuk Teater”, sekolah-sekolah tergerak membuka sanggar/kelompok kesenian atau mengaktifkan kembali sanggar/kelompok keseniannya. Lantas, sanggar/kelompok kesenian sekolah itu dengan tekun menelurkan karyakaryanya untuk ‘dipamerkan’ ke khalayak, baik di pangung festival atau di panggung apresiasi. Bayangkan kalau peristiwa memproduksi semacam ini berlangsung secara terus-menerus. Peristiwa memproduksi—dalam hal kesenian tentunya, akan menggiring generasi dini percaya diri dan lepas dari label ‘manusia pasif’. Inilah sesungguhnya proyek jangka panjang yang coba dipertahankan Teater LKK Unimed. Disadari atau tidak, Teater LKK sedang berada pada titik penting dalam membangun karakter generasi muda (mahasiswa/pelajar). Generasi yang tidak hanya pandai menadahkan tangan, tetapi mengelebatkan tangannya untuk melahirkan sesuatu yang berfaedah bagi orang banyak. Apalagi produk kesenian yang yang hakikatnya tidak bisa dilepaskan dari kemaslahatan manusia. Oleh karena itu, hai Teater LKK Unimed: Ini pekerjaan mulia sekaligus berat. Maka jangan pernah main-main setiap menggelar “Amuk Teater”! Bukankah sebentar lagi usiamu menyentuh angka 23?

didominasipelajarSMPdanSMA. Dijadwalkan sebagai opera yang mengusung komedi pada cerita yang ditampilkan, Teater Generasinampaknyatidakbegitu berhasil. Seumpama kendaraan yangngadat,lajunyajaditersendat. Penonton sesekali tertawa gelak karena dialog atau pola dan gerak pelakon yang bertingkah lucu di atas panggung.Tapi sayang, gelak tawa penonton tidak mendominasi opera. Sebagian besar penonton bahkan merasakan jenuh disebabkan dialog yang monoton dan pelakon asyik sendiri di atas panggung pertunjukan. Harapan penonton untuk menyaksikan lakon komedi yang menghibur tak dapat terpenuhi. Niat utuk menampilkan kesegaran dalam kancah teater Medan –yang kerap kali mementaskan teater dengan “keseriusan” dan “kerumitan” – , Opera “Raja dan Ratu Air” diibaratkan hidangan yang perlu ditanak lebih lama lagi agar benar-benar menghasilkan cita rasa yang nikmatnya tidak setengah-setengah. Kemegahan biasanya tak lepas dan selalu bersinggungan dengan sebuah kerajaan. Demikian juga tata panggung Opera “Raja dan Ratu Air” memperli-

hatkan dengan jelas keanggunan singgasana yang menawan, juga penuh warna-warna ceria. Pun begitu, tak menggambarkan konsep kerajaan secara detail. Ya, dengan menilik tata panggungdankostumyangdikenakan para pelakon, penonton merasa disuguhi dengan Kerajaan antah berantah. Bagaimana tidak? Tak ada keseragaman kostum pelakon yang menunjukkan satu ciri khas tertentu. Pada kerajaan, Sang Raja mengenakan pakaian dengan nuansa China, namun sang Penasehat Raja mengenakan kostum bernuansa Melayu. Tak jauh berbeda dengan Kerajaan lainnya, Sang Ratu tampil cantik dengan kostum kerajaan Barat (victoria), sedangkan Sang Penasehat mengenakan kostum bernuansa China. Terlihat mencolokkemudian,ketikasangWakil Panglima Kerajaan mengenakan kostum menyerupai kostum petugas keamanan dan jelas tak senada. Ataukah mungkin Opera “Raja dan Ratu Air” berniat menampilkan penggabungan unsur dari beragam kebudayaan dan tampilan? Bisa jadi. Selain itu, totalitas pada segi cerita dirasa kurang kentara. Dengan mengangkat kritik ter-

hadap pemerintah yang semenamena mengolah sumberdaya alam dan menaikkan harga semaunya, alangkah lebih baik apabila Opera “Raja dan Ratu Air” juga menampilkan lakon rakyat yang menderita dan kesusahan sebagai wujud kontadiksi dengan kemewahan yang ditampilkan kedua Kerajaan. Juga sebagai penegasan akan keserakahan para pemegang kekuasaan yang berdampakburukbagirakyatnya. Sayang, Opera “Raja dan Ratu Air”takmenampilkanlakonselain keanggunan serta kemewahan singgasana kedua kerajaan. Dengan berbagai hal yang perlu menjadi catatan pada pertunjukan kali ini, Teater Generasi diharapkan dapat terus menghadirkan kesegaran dan inovasi dalam kancah teater Medan yang didominasitema-temaseriusdan “rumit”dalammengisipanggung. Opera “Raja dan Ratu Air” adalah salahsatupembelajarandananak tanggademipencapainyanglebih baik dan pertunjukan yang lebih menghibur namun “tajam” selanjutnya. Semoga! * Penulis adalah mahasiswa FBS Universitas Negeri Medan dan penikmat seni pertujukan.

DALAM beberapa tahun terakhir, hampir takpernahadaharidinegeriiniyangtidakdiwarnai dengan pemberitaan tentang bencana. Banjir bandang, tanah longsor, kebakaran hutan, erupsi gunung berapi dan lain sebagainya. Bahkan di Medan, Bandara Polonia yang dulu tak pernah tergenang air, beberapa waktu lalu diserbu banjir. Mengapa hal itu bisa terjadi? Mengapa banjir dan longsor tak henti-hentinya terjadi di berbagai belahan negeri ini? Jawaban atas pertanyaan itu bisa jadi karena dalam hidup kita tak lagi mementingkan harmonisasi. Kita syur sendiri dan tak peduli. Padahal sejatinya alam, manusia dan lingkungan adalah satu kesatuan yang niscaya dalam kehidupan umat manusia di bumi ini. Sampai kapan pun hubungan alam, manusia dan lingkungan merupakan satu kesatuan yang bersinergi dan saling menegasikan. Jika salah satunya saja berjalan timpang, tidak baik dan terdegradasi, maka rusaklah seluruh tatanan kehidupan di jagat raya ini. Oleh karena itu,terjaganyaharmonisasidalamhubunganalam, manusia dan lingkungan menjadi satu keharusan yang semestinya tidak bisa ditawar-tawar. Tapi saya percaya, semua bencana yang terjadi di republik ini tidak semata ekses dari penyelenggaraan pembangunan yang mengabaikan sinergi itu, tapi juga karena menafikan nilai-nilai budaya, realitas sosial dan daya tahan alam yang dimiliki. Padahal pembangunan tidak boleh dilepaskan dari aspek sosial dan budaya dalam semua sisinya.Terutama karena aspek sosial budaya itulah sisi mata uang yang mempertegas kemajuan peradaban sebuah bangsa. Pembangunan politik, ekonomi dan hukum tidak akan berjalan sebagai sebuah proses yang bermartabat manakala pembangunan sosial dan budaya diabaikan. Kebudayaan adalah wujud cita rasa, cipta dan karsa yang merupakan upaya keseluruhan manusia dalam mengembangkan harkat dan martabatnya sebagai warga suatu bangsa. Itulah sebabnyapembangunanberbasisbudayamenjadi penting dan harus diarahkan untuk memberi perluasan wawasan dan sekaligus pemaknaan yang lebih dalam terhadap arah dan tujuan pembangunan yang dijalankan bangsa ini. Di samping, tentu saja, agar masyarakat dapat lebih memahami realitas kehidupan berbangsa yang heterogen dan plural. Dalam konteks inilah pemahaman atas pembangunan berbasis budaya harus kembali memperoleh prioritasnya di negeri ini. Apalagi bangsa ini sesungguhnya memiliki warisan tradisi dan nilai-nilai budaya yang unik dan luhur dari sejarah masa lalunya. Nilai-nilai itu seharusnya kita rawat dan tak boleh kita biarkan digerus oleh peradaban“materialistis”yangsepenuhnyamemuja

kebendaan, seperti yang terjadi saat ini. Harusdiakui,diabadmulticulturalsekarang ini, di mana pengakuan terhadap keragaman, kesederajatan dan hak azasi manusia begitu menonjol, peradaban global telah memainkan perannya yang sangat ekspansif dan menyerbu bagaikanwabahpenyakithinggakeruangtamu, dapur dan kamar tidur setiap rumahtangga di negeri ini. Peradaban global itu masuk ke ruang-ruang peradaban kita hingga seringkali membuat tidak sedikit warga bangsa yang tercerabut dari akar dan nilai-nilai sosial budayanya. Namun untuk membangun masyarakat berkebudayaan itu, menurut Prof. Usman Pelly, tidak boleh ada dominasi kelompok masyarakat atau budaya tertentu terhadap masyarakat atau budaya yang lain. Dalam suasana keragaman (pluralitas), kesederajatan dan keadilan, puncak-puncak budaya daerah harus dirajut dan dirangkai, dan itulah yang harus menjadi cikal bakal budaya nasional. Tapi yang terjadi sejak proklamasi kemerdekaan di republik ini justru sebaliknya. Kecuali adanya dominasi kelompok masyarakat budaya tertentu kepada yang lain, serbuan budaya global (baca: barat), yang sesungguhnya sangat bertentagan dengan nilai-nilai budaya masyarakat kita, yang masuk melalui media massa, pun semakin mendominasi. Di sisi lain, secara politis dan ekonomis terjadi pula proses marginalisasi terhadap kelompok-kelompok masyarakat yang secara potensial dianggap akan menjadi ancaman terhadap kekuasaan rezim pemerintah yang sedang berkuasa. Akibat lebih lanjut dari situasi ini adalah matinya kebebasan berekspresi. Tragisnya, sementara kesejahteraan belum sepenuhnya tercapai, kesinambungan pembangunan pun tidak berjalan sesuai harapan. Situasi inilah yang membuat bangsa Indonesia menjadi sangat rapuh ketika goncangan moneter terjadi pada pertengahan tahun 1997. Yang terjadi kemudian adalah ironisme. Setelah sepuluh tahun lebih orde reformasi berjalan, bangsa Indonesia tetap saja tidak mampu ke luar dari krisis. Korupsi makin menggila. Kolui dan neotisme makin merajalela. Bangsa ini tidak saja masih harus menghadapi tantangan besar dalam membangun Republik Indonesia menjadi negara yang besar dan jaya, tapi masih saja suka terbuai dengan permainan logika dan kata-kata. Sinergi tak pernah terwujud dan realitas kehidupan tak juga menjadi lebih baik. Duh! (*) *Penulis adalah Sekretaris Jenderal Multuculture Society


Pariwisata

WASPADA Minggu 29 Mei 2011

B11

Perahu nelayan yang dahulu digunakan oleh masyarakat Arab setempat untuk mencari ikan dimana saat ini digunakan sekedar untuk sarana hiburan dan olahraga air maupun untuk objek sejarah dalam mengenang kehidupan masa lampau.

Menelusuri Qatar Sang Mutiara Dari Teluk

Penulis berpose di dekat ikon negara Qatar, kerang penghasil mutiara. PERJALANAN delapan jam harus ditempuh dari Jakarta untuk sampai di ibukota salah satu negara terkaya di dunia yakni Doha. Doha merupakan ibukota dari negara Qatar yang semakin tenar setelah resmi

terpilih menjadi tuan rumah Piala Dunia pada tahun 2022. Pesawat Qatar Airways milik pemerintah Qatar yang saya tumpangi mendarat dengan mulus di pagi hari. Walaupun jam masih menunjukkan pukul

05:00 pagi waktu setempat namun matahari sudah cukup menyengat menyinari daratan negara itu. Tak heran memang, karena saat saya berkesempatan mengunjungi negara tersebut bertepatan pula musim panas

berlangsung mulai Mei hingga Agustus tiap tahunnya. Setelah menyelesaikan proses imigrasi yang relatif singkat saya pun diajak untuk melihat peternakan unta yang terletak di pinggiran kota. Tidak

ada yang istimewa memang dari peternakan unta ini dan sama seperti peternakan unta pada umumnya yang sudah banyak dikunjungi terutama oleh jamaah haji maupun umrah yang terdapat di Negara Arab Saudi. Setelah mengunjungi peternakan unta tersebut perjalanan saya kemudian dilanjutkan dengan mengunjungi salah satu souq (dalam Bahasa Indonesia berarti pasar). Di souq tersebut saya mendapat gambaran bahwa walaupun Negara Qatar khususnya ibukotanya Doha dikelilingi hamparan padang pasir akan tetapi impor sayuran dan buah–buahan dari negara lain khususnya negara beriklim tropis cukup banyak terdapat di negara ini. Buah–buahan serta sayur– mayur tersebut dijual dalam keadaan segar sehingga ketika di dalam pasar tersebut tidak ada kesan bahwa sebenarnya kita sedang berada di negeri padang pasir nan tandus. Setelah puas mengelilingi pasar tersebut saya kemudian dibawa ke salah satu stadion megah yang berada di Doha. Stadion tersebut dibangun saat Qatar menjadi negara tuan rumah Asian Games pada tahun 2006 yang lalu. Stadion ini sempat dipersiapkan menjadi salah satu venue untuk Olimpiade, walaupun kemudian Qatar gagal menjadi tuan rumahnya. Berselang beberapa waktu, akhirnya negara ini terpilih sebagai tuan rumah Piala Dunia atau

lebih dikenal dengan istilah World Cup yang bakal diselenggarakan pada tahun 2022. Ada yang menarik dari bangunan ini. Sebelum kita mencapai stadion tersebut dari kejauhan akan terlihat sebuah bangunan yang menjulang tinggi layaknya menara. Bangunan itu ternyata adalah obor yang digunakan saat Asian Games 2006 lalu. Konon, api yang dinyalakan di atas obor yang tinggi menjulang tersebut dapat terlihat oleh seluruh penduduk ibukota negara tersebut dari seluruh penjuru sudut kota. Yang menariknya lagi, bentuknya yang unik membuat obor ini kemudian menjadi salah satu ikon Doha maupun Negara Qatar itu sendiri. Dari stadion ini saya pun melanjutkan perjalanan menuju ke salah satu tempat yang sangat terkenal di Doha. Namanya dikenal dengan istilah Corniche. Corniche ini sebenarnya dapat diartikan sebagai pinggiran pantai/tepi pantai. Corniche ini sangat terkenal di beberapa negara kawasan teluk. Beberapa corniche yang terkenal antara lain Jeddah Corniche, Abu Dhabi Corniche, Medinat Kuwait Corniche. Dari beberapa corniche tersebut yang dianggap terbaik dan terindah adalah Doha Corniche. Dari Doha Corniche ini kita dapat melihat seluruh bangunan yang menjulang tinggi yang berada di kawasan barat pantai. Dari Corniche ini pula kita dapat melihat kapal – kapal milik ne-

layan yang pada zaman dahulu digunakan oleh masyarakat Arab setempat untuk mencari ikan. Walaupun saat ini masyarakat Arab setempat telah banyak yang menjadi jutawan bahkan milyuner sejak ditemukannya cadangan minyak bumi di negara tersebut, akan tetapi tradisi berlayar menggunakan kapal–kapal tersebut tidak pernah hilang. Tradisi ini diubah menjadi salah satu kegiatan dalam mengisi waktu luang di akhir pekan atau sekedar untuk mengenang kehidupan masa lalunya. Selain itu, kita dapat pula melihat National Museum Of Islamic Art (Museum Nasional Kebudayaan Islam) yang di dalamnya terdapat beragam benda bersejarah warisan kekayaan budaya Islam yang hingga saat ini masih terawat dan menjadi koleksi di dalam museum tersebut. Sayangnya, saat saya berada di sana museum tersebut dalam keadaan tertutup sehingga saya harus mengurungkan niat untuk masuk melihat koleksi yang dipamerkan. Padahal, seperti apa yang saya lihat dalam iklan yang ditayangkan oleh maskapai penerbangan milik negara tersebut, museum tersebut konon memiliki koleksi yang cukup banyak dan menjadi destinasi yang harus dikunjungi bila datang ke negara tersebut. Puas memandang di sekitar tepi pantai Corniche, saya pun memutuskan untuk berjalan

agak sedikit ke depan dimana terdapat sebuah ikon kota yang sudah mahsyur sejak dahulu. Ikon kota ini berbentuk mutiara yang berada di dalam kerang. Qatar dahulu kala dikenal sebagai negeri penghasil salah satu mutiara terbaik di dunia sehingga untuk mengenangnya dibuatlah monumen yang sekarang menjadi ikon sekaligus objek wisata yang menghiasi salah satu sudut kota ini. Di depan monumen tersebut banyak orang yang mengabadikannya dalam bentuk foto sebagai bukti telah mengunjungi Ibukota Doha dan Negara Qatar. Karena itulah, negara ini kerap dijuluki Mutiara dari Teluk. Pertama, karena memang dahulu negeri ini sebagai penghasil salah satu mutiara terbaik di dunia dan kedua, karena Qatar memiliki berbagai keunggulan sehingga diumpamakan seperti mutiara yang bernilai tinggi. Di tempat ini pulalah terdapat taman luas tempat berbagai aktivitas yang biasa dilakukan di sore hari sehingga kita dengan mudah menemui orang yang sedang berjogging, bersepeda, anak–anak yang bermain ayunan atau bahkan melakukan camping keluarga di akhir pekan. Jadi tunggu apa lagi, jika anda memiliki waktu luang tak salah rasanya jika Qatar menjadi salah satu destinasi tujuan anda selanjutnya. M Sutan A Aziz Nasution SH, alumni Fakultas Hukum UGM Yogyakarta.

Lima Tempat Wajib Kunjung Bagi Pecinta Coklat MENGUNJUNGI tempattempat yang indah sebenarnya sudah menyenangkan, namun perjalanan tersebut akan lebih berkesan jika Anda menenggelamkan diri dalam kenikmatan coklat. Sekarang ini, wisatawan berkunjung ke suatu tempat bukan hanya untuk menikmati pemandangannya, tapi juga untuk menikmati cita khas coklat di tempat tersebut. Jika Hershey, Pennsylvania dan Ghirardelli Square di San Francisco selama ini sudah terkenal sebagai surga bagi penikmat coklat, berikut ini ada lima tempat lainnya di Eropa yang mesti Anda coba. Festival Eurochocolate dan Casa Del Cioccolato di Perugia, Italia Datanglah ke Perugia untuk ikut merayakan tradisi coklat dengan cara heboh. Festival Eurochocolate yang diadakan tiap tahunnya di pusat kota bersejarah itu tahun ini dijadwalkan berlangsung 14 sampai 23 Oktober. Di festival ini Anda bisa menikmati pasta coklat, salami coklat (semacam sosis) dan kreasi aneh lainnya dari para ahli masak dan pembuat manisan. “Festival ini surganya para pecinta coklat. Event ini diselenggarakan untuk memuaskan orang-orang yang sangat candu pada coklat.” Di festival ini juga Anda bisa mengagumi ukiran batangan

coklat – sebelumnya festival tersebut memamerkan igloo (rumah suku Eskimo) terbuat dari coklat. Para pengunjung festival tersebut bisa menikmati potongan-potongan coklat bekas ukiran tersebut. Perugia juga rumah bagi Perugina – pembuat coklat Baci – naik taxi sekejap saja dari jantung kota Perugia, Anda sudah sampai di Perugina Casa Del Cioccolato (Rumah Coklat). Di sana Anda bisa menyusuri Museum Perugina dan berkunjung ke pabrik di mana coklat Baci dibuat. Perugina mengijinkan para pengunjung untuk menjadi pembuat coklat selama sehari dengan mengikuti kursus yang ditawarkan Sekolah Coklat-nya. Lengkapi pengalaman Anda dengan menginap di Etruscan Chocohotel, yang mendaulat dirinya sebagai hotel pertama di dunia yang sangat mendukung kelestarian coklat. Tur Coklat di Brussels, Belgia Anda tidak bisa menghindari coklat di sini – kemana pun kaki melangkah, Anda akan menemukan coklat di tiap penjuru negeri ini. Statistik tentang permen mengatakan: Belgia memproduksi 172.000 ton coklat setiap tahunnya dan merupakan tempat di mana terdapat lebih 200

toko coklat. Banyak toko-toko tersebut terdapat di Brussels – di kota inilah coklat Godiva bermula – dan para wisatawan bisa memilih sejumlah tur yang akan membawa mereka ke tempat di mana diperlihatkan cara pembuatan coklat, dan tempat untuk menikmatinya. Untuk memilih tur yang Anda inginkan, Anda bisa menemukan daftar lengkap di visitbelgium.com.

Bukti pertama keberadaan coklat di Eropa muncul tahun 1544. Level ketiga seluruhnya memperlihatkan produk coklat, termasuk nama-nama besar industri coklat, iklan coklat yang berkesan dan film tentang permen coklat berjudul ‘chocolate cinema’. Akhiri tur Anda dengan menikmati hidangan di kafe museum itu, yang menyajikan cake dan minuman coklat.

Museum Coklat di Cologne, Jerman Semua yang ingin Anda ketahui tentang coklat terdapat di dalam gedung unik yang terdapat di kota Old Town, Cologne. Ada tiga level pameran yang bisa dinikmati para pecandu coklat di sana. Level pertama memperlihatkan rumah kaca di mana pohon-pohon coklat tumbuh (tumbuhan ini membutuhkan lingkungan lembab dan rata-rata suhunya antara 77 dan 82 derajat Fahrenheit) dan satu pabrik coklat memperlihatkan kepada para pengunjung bagaimana batangan dan permen coklat dibuat. Level kedua menjelaskan sejarah coklat, yang bermula dari budaya kuno Amerika 3.000 tahun lalu. Peradaban Maya dan Aztec menggunakan coklat sebagai bahan medis dan alat pembayaran, kata museum itu.

Kereta Api Coklat di Swiss Keju, coklat dan pemandangan indah – mana yang tidak Anda sukai? Naiklah kereta api di Montreaux, Swiss, kemudian berkunjung ke Gruyeres, tempat pembuatan keju yang terkenal yang biasa digunakan dalam sup bawang Perancis. Dalam perjalanan ini Anda bisa mengunjungi pabrik pembuatan keju dan menyusuri Istana Gruyeres. Persinggahan berikutnya: kota Broc dan kunjungan ke pabrik coklat Cailler-Nestle, di mana Anda bisa mencicipi co-klat dan menikmati peman-dangan mempesona Danau Gruyeres dan pegunungan Alpen. Pabrik ini dibuka tahun 1989 oleh cucu Francois-Louis Cailler, yang membawa resep coklat pertama ke Swiss tahun 1819, begitu penjelasan perusahaan itu. Kereta api ini beroperasi

/CNN Puaskan hasratmu pada coklat dengan menghadiri festival coklat, mengunjungi museum dan bar khusus coklat di Eropa. dari Senin sampai Jumat selama bulan Juli dan Agustus, dan Senin, Rabu dan Kamis di bulan Juni, September dan Oktober. Bar Coklat Harrods di London

Toko serba ada yang terkenal ini disebut sebagai ‘fantasi coklat yang jadi nyata’. Di sini, para pengunjung akan mendapati air mancur coklat dan aneka pilihan minuman coklat panas

dan dingin. Lapar? Di tempat ini banyak menu pilihan mulai dari cake, muffin, crepe, brownies dan hidangan pencuci mulut yang menggugah selera lainnya

terbuat dari coklat termasuk molten lava chocolate cake dan hot chocolate topping. Setelah itu, nikmatilah tidur siang. Dan mimpi indah. Syafri/CNN


Infotainmen

B12

WASPADA Minggu 29 Mei 2011

Kaka: Korupsi Mewabah SEBAGAI band yang mendukung Komisi Pemberantasan Korupsi (KPK) dan gerakan anti korupsi, Slank terus menggugah kesadaran masyarakat guna memerangi praktik haram tersebut. Sebab, mereka korupsi sudah mewabah di Indonesia.

Anggun Dapat Platinum PENYANYI Anggun C. Sasmi dapat penghargaan platinum dari pihak label. Pasalnya, album Echoes yang baru rilis dua pekan, sudah terjual hingga 10 ribu kopi. Anggun tidak mengira mendapat penghargaan secepat itu. “Alhamdulliah dapat platinum. Saya benar-benar nggak menyangka. Pastinya berterima kasih buat Sony Music dan para fans,” ujar Anggun di Hotel Mandarin Oriental, Jakarta Pusat, Jumat (27/5). Penyanyi yang sudah menetap di Prancis selama lebih 13 tahun ini menjelaskan, albumnya berisi tentang kisah kehidupan. “Echoes itu gema atau gaung. Jadi, seluruh lirik kesannya seperti gema dari semua kehidupan, baik di hidup aku dan temen aku,” paparnya.

Salah satu wujud memerangi korupsi tersebut, Slank membuat album “Jurus Tandur 18” yang merekam jejak fenomena sosial dalam kurun waktu 2008-2010. “Dalam album itu, kita angkat fenomena sosial yang berkembang di masyarakat, salah satunya soal korupsi,” ujar vokalis Slank, Kaka di Denpasar, Bali, Jumat (27/5). Tidak hanya itu, dalam waktu dekat Slank akan meluncurkan album baru khusus bertemakan korupsi. “Sedang kita pikirkan. Semoga dalam waktu dekat ini bisa diluncurkan,” tambah Kaka. Mengapa Slank gemar membuat album bertema korupsi? Kaka menilai, korupsi sudah mewabah di kalangan masyarakat. Pasalnya, fenomena korupsi bukan hanya menjerat kalangan atas. “Korupsi ini kan nyata di masyarakat,” tambahnya. Ditanya soal isu korupsi mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin, Kaka langsung menyergahnya. “Isu? Itu bukan isu lagi. Itu memang benarbenar ada,” tegasnya.(vvn)

Kelaparan Saat ini, Anggun tidak hanya berkiprah di bidang tarik suara. Dia didaulat menjadi duta Organisasi Pangan Dunia (FAO) sejak beberapa tahun lalu. Di tengah kesibukannya sebagai seorang penyanyi, Anggun menyempatkan diri menjadi pembicara di China dalam waktu dekat. “Masih banyak kelaparan di dunia. Bulan November, saya akan ke China dan di situ jadi pembicara tentang kelaparan ini,” ujar Anggun. Seperti diketahui Anggun adalah seorang penyanyi yang sangat aktif dalam kegiatan sosial dan kemanusiaan. Dia tercatat pernah terlibat dalam banyak proyek album amal, seperti ‘le Concert pour la Paix’, dan single kampanye melawan AIDS bertajuk ‘L’or de nos vies’. Wanita kelahiran 29 April 1974 itu juga terlibat dalam sejumlah konser amal bersama musisi Eropa. Soal popularitas yang sudah diraihnya saat ini, Anggun mengaku hal tersebut hanya sebuah bonus. “Sekadar populer tapi nggak ngapa-ngapain kayanya picik banget. Aku bangga kalau dengan popularitas aku bisa bantu hal yang positif,” demikian Anggun.(inc/vvn)

facebook

FILM The Hangover Part II meraih pendapatan hingga AS$10,4 juta pada pekan ini. Film itu mengungguli film terlaris dunia Pirates of the Caribbean: On Stranger Tides yang memperoleh AS$4,7 juta. Sebagaimana dilansir variety.com, Kamis (26/5), The Hangover Part II yang sukses meraup AS$10,4 juta ini, diprediksi mampu menambah keuntungan total sekitar AS$25 juta. Prediksi itu sangat realistis, mengingat film tersebut masih sebatas diputar di 5.000 bioskop Perancis, Italia dan Australia serta 37 negara lainnya. (inc/m25)

Shah Rukh Khan Pemarah AKTOR Bollywood Shah Rukh Khan ternyata mempunyai sifat buruk. Ketidakmampuan Shah Rukh Khan (SRK) mengendalikan amarah membuat banyak orang di industri hiburan menjadi takut dengan sifatnya . Hal itu diungkapkan Roshan Abbas, seorang sutradara di industri perfilman Bollywood. Roshan, yang mengawali debutnya sebagai sutradara melalui film Always Kabhi Kabhi mengaku pernah melihat kemarahan SRK. Namun Roshan berharap SRK mengurangi sifat pemarahnya itu. “SRK adalah nama yang besar di industri perfilman Bollywood dan memiliki pribadi sangat pintar. Namun aku rasa dia harus belajar untuk mengontrol kemarahannya,” ujar Roshan. Kendati timnya tidak pernah menjadi sasaran kemarahan SRK, namun Roshan pernah melihat dia kehilangan kesabarannya secara tiba-tiba yang membuat orang lain takut kepada SRK. “Aku rasa seorang yang memiliki kesempurnaan dan kepribadian seperti SRK, harus menghindari kemarahan seperti itu,” ujar Roshan.(ant)

Ingin Lupakan Masa Lalu AKTOR Charlie Sheen terpaksa menjual rumah mewahnya di Beverly Hills, Los Angeles, AS seharga AS$7,2 juta. Sebagaimana dilansir femalefirst, Jumat (27/5), Sheen mencoba melupakan masa lalunya yang bermasalah saat tinggal di istana tersebut. Du l u , Sh ee n k e ra p menggelar pesta minuman keras dan obat-obatan terlarang. Alasan itulah, yang membuat Sheen ingin menjual rumahnya. Sebelumnya, Sheen telah berbagi dengan mantan istrinya, Brooke Mueller terkait rumah itu. Mereka

HINGGA kini, polisi terus mengusut kasus beredarnya foto-foto syur penyanyi Syahrini. Bahkan, kasus tersebut ditangani satuan cyber crime Polda Metro Jaya sejak pekan lalu. “Saat ini, kasusnya sudah dilimpahkan ke Cyber Crime Polda Metro Jaya,” kata Kabag Humas Polres Jakarta Selatan, AKP Aswin, Kamis (26/5). Menurut Aswin, kasus foto syur Syahrini ditangani Polda Metro Jaya karena terkait kejahatan di dunia maya. Namun polisi belum menetapkan tersangka penyebar foto-foto pribadi mantan teman duet Anang Hermansyah itu. “Karena memang Polda yang berhak menangani kasus itu. Kan Polda yang punya Unit Cyber Crime, makanya dari Polres dilimpahkan ke Polda,” jelasnya. Seperti diketahui, foto-foto syur Syahrini dengan beragam pose seksi beredar di dunia maya. Syahrini juga tampak berpose dengan beberapa artis seperti Daniel Mananta dan Glenn Fredly. Namun yang paling menghebohkan adalah foto ciuman wanita mirip dengan Aisyahrani (Rani), adik Syahrini. Dalam foto itu, Rani berciuman dengan seorang pria di atas kasur. Syahrini langsung bereaksi dan melaporkan kejadian itu ke polisi.(ok/tv)

Syahrini

lyric

Sandra Tolak Foto Seksi

Charlie Sheen fire

dunia

Cyber Crime Polda Tangani Kasus Foto Syur Syahrini

The Hangover Ungguli Pirates of the Caribbean

Shah Rukh Khan

Kaka

sepakat menjual rumah dalam upaya menyembuhkan ketergantungan narkoba dan minuman keras, serta demi memulihkan reputasi Sheen yang sudah terlanjur hancur. Sober Valley Ranch milik

Sheen dilepas ke pasar properti dengan harga AS$7,2 juta. Properti mewah itu memiliki fasiltas lima kamar tidur, halaman dan taman, kolam renang dan spa, serta fasilitas lainnya.(inc/m25)

Charlie Sheen guardian

MISS Indonesia 2008 Sandra Angelia mengaku pernah ditawari berpose seksi di sebuah majalah dewasa. Namun tawaran itu ditolaknya dengan tegas. “Aku pernah ditawari sebuah majalah dewasa dalam negeri, tapi aku nolak,” ungkapnya saat ditemui di Jakarta Barat, Jumat (27/5). Sandra khawatir foto seksinya disalahgunakan di dunia maya. Seperti dialami Agni Pratistha, Syahrini, dan Nadila Ernesta yang foto seksinya banyak beredar akibat ulah iseng pengguna internet. “Namanya manusia bisa bikin kejahatan apa saja. Malah kadang, foto biasa bisa dibikin yang syur banget. Jadi yah tergantung orang-orangnya saja,” ujarnya. Tersebarnya foto pribadi artis membuat Sandra lebih hati-hati dalam bersikap. Apalagi, Sandra tidak mau merusak reputasi sebagai mantan Miss Indonesia. “Pokoknya, tahu dirilah. Kalau lagi hura-hura jangan sampai segitunya. Wartawan itu kan dimana-mana. Kamera juga dimana-mana. Kalau sekarang, buat aku kesadaran diri saja. Walaupun sudah lepas kontrak, yang penting aku tetap jaga diri saja,” tekadnya.(ok)

Sandra Angelia

blog

Waspada, Minggu 29 Mei 2011  

Waspada, Minggu 29 Mei 2011

Read more
Read more
Similar to
Popular now
Just for you