Page 1

WASPADA Demi Kebenaran Dan Keadilan

AP

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

Hoy Terbaik Inggris Raya LONDON (Waspada): Pebalap sepeda Inggris Raya, Sir Chris Hoy (foto), berhasil mendapat emas keenam sepanjang karier di Olimpiade setelah sukses memenangi nomor keirin Selasa (7/8). Alhasil, Hoy berhak dinobatkan sebagai atlet Olimpiade terbaik Inggris Raya. Koleksi enam emasnya itu melampau rekor lima emas milik atlet dayung legendaris Inggris, Sir Steve Redgrave. Ditambah satu medali perak pada Olimpiade Sydney 2000, maka Hoy total mengumpulkan tujuh medali dan menyamai rekor milik pebalap legendaris Inggris lainnya, Bradley Wiggins. “Saya terkejut. Anda coba menenangkan diri sendiri, tapi ini terasa tidak nyata. Saya hanya ingin memenangi medali emas di depan pendukung sendiri,” kata Hoy yang kini berusia 36 tahun kepada BBC, Rabu (8/8). “99,9 Persen saya mungkin tidak akan tampil di Rio de Janeiro pada Olimpiade 2016. Bagaimana Anda bisa mengalahkan ini? Commonwealth Games di

KAMIS, Kliwon, 9 Agustus 2012/20 Ramadhan 1433 H

No: 23951 Tahun Ke-66 Terbit 24 Halaman (A1-12, B1-12)

Harga Eceran: Rp2.500,-

Glasgow pada 2014 bakal menjadi penutup impian bagi saya,” ungkap Hoy. Bertanding di London Velodrome, Hoy berhasil mencatat waktu 10,366 detik.

Pesta Berbuka Di Tanah Suci

Lanjut ke hal A2 kol. 4

Perolehan Medali No. Negara Emas Perak Perunggu 1. China 34 2. AS 30 3. Inggris Raya 22 4. Korea Selatan 12 5. Russia 10 6. Prancis 8 7. Jerman 7 8. Italia 7 9. Hungaria 6 10. Kazakhstan 6 11. Australia 5 12. Belanda 5 13. Iran 4 14 . Korea Utara 4 15 . Kuba 3 16. Selandia Baru 3 17. Belarusia 3 18. Afrika Selatan 3 19. Ukraina 3 20. Jepang 2 .......... 50. Indonesia 0

21 19 13 5 18 9 15 6 2 0 12 4 3 0 3 2 2 1 0 13

19 22 13 6 20 11 10 4 3 2 9 6 1 1 1 5 4 0 6 14

1

1

Saudi Gazette

SUASANA menjelang maghrib di Masjidil Haram (Makkah), selalu dipadati hingga ratusan ribujamaah yang antusias menunggu waktu berbuka puasa selama bulan suci Ramadhan.

Pasca Kebakaran Jl. Gandhi

Lanjut ke hal A2 kol. 3

Hingga Pukul 00:00 WIB (bbc/rzl)

RATUSAN ribu umat Islam berkumpul di Masjidil Haram dan Masjid Nabawi untuk iftar (berbuka puasa) mereka setiap harinya selama bulan suci Ramadhan, terlihat bagaikan pesta besar. Warga dari berbagai belahan dunia, dari Indonesia sampai Afrika dan umat Islam dari Amerika sampai ke Finlandia duduk bersama dalam barisan yang rapat di dalam kedua masjid tersebut serta di halamannya yang luas untuk berbuka puasa dalam satu aksi elegan, solidaritas Islam. Mosleh Al-Mahmadi, pejabat di Masjidil Haram mengatakan: “Kami telah menata satu rencana khusus untuk menyelenggarakan iftar di halaman Masjidil Haram di Makkah.” Para dermawan dan

Lanjut ke hal A2 kol. 7

Dua Barang Mencurigakan Gatot: Stop Impor Jagung Ke Sumut MEDAN (Waspada): Pelaksana Tugas Gubernur Sumatera Utara H Gatot Pujo Nugroho meminta jajarannya untuk menyetop impor jagung ke Sumatera Utara untuk menjaga stabilitas harga jagung di tingkat petani. Hal itu dikatakannya menanggapi keluhan para petani

jagung yang merasa dirugikan dengan adanya kebijakan impor jagung pada saat panen raya berlangsung. ”Saya minta tidak ada lagi jagung dari luar masuk ke Sumatera Utara terutama pada saat musim panen jagung agar nilai jual panen jagung dapat lebih stabil,” pinta Gatot kepada jaja-

MEDAN ( Waspada): Tim Laboratorium dan Forensik (Labfor) Cabang Medan membawa dua barang mencurigakan dari rumah toko (ruko) yang terbakar milik Suwandi alias Ng Ting Kuang di Jalan Gandhi, Kelurahan Sei Rengas II, Kec Medan Area.

rannya saat menerima kedatangan Komunitas Petani Jagung Karo di Rumah Dinas Gubernur, kemarin. Hadir Ketua Komunitas Jagung Karo Tekad Brahmana dan pengurus lainnya yaitu Fredy Sibayang, Sapta Sibayang

Sisa barang dari hio (dupa) dan kabel listrik yang terbakar itu selanjutnya akan diteliti di Labfor guna mengetahui penyebab kebakaran yang menewaskan suami istri dan dua putranya itu. Pantauan Waspada, Rabu (8/8), rumah berlantai III itu masih

Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 6

Prof. Dr. H. Farid Wajdi Ibrahim, MA Rektor IAIN Ar-Raniry Aceh BULAN Suci Ramadhan merupakan bulan yang penuh dengan keberkahan, bulan yang sangat mulia, di dalamnya terdapat malam yang lebih baik dari seribu bulan, di dalamnya penuh dengan rahmat, ampunan dan pembebasan dari api neraka. Bulan itu dirindu-

Lanjut ke hal A7 kol. 1

Al Bayan Oleh Tgk H Ameer Hamzah MENURUT Alquran, manusia (pria) memang mencintai perempuan, anak, emas, perak dan kendaraan yang bagus. Itu kesenangan di dunia. Tetapi Alquran juga mngingatkan manusia supaya tidak lalai dengan anugerah Allah yang diberikan kepada mereka. Sebab seluruh kesenangan itu itu memiliki potensi ghurur (terpedaya).

Lanjut ke hal A2 kol. 3

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru Kompol M Budi Hendrawan, SH, SIK, (kanan) bersama personelnya dibantu satpam mengamankan pintu keluar dan masuk Sun Plaza Medan, Rabu (8/8) malam.

KPK Tetapkan Hartati Tersangka JAKARTA (Waspada): Anggota Dewan Pembina Partai Demokrat yang juga pengusaha wanita, Hartati Murdaya (HM) (foto) resmi dijadikan tersangka dalam kasus suap Rp3 miliar penerbitan HGU perkebunan kelapa sawit di Buol, Sulawesi Tengah oleh penyidik Komisi Pemberantasan Korupsi (KPK). Istri taipan Murdaya Poo itu ditetapkan menjadi tersangka

setelah pimpinan KPK menggelar ekspose (gelar perkara) pemberian suap kepada Bupati Buol, Amran Batalipu. “HM menjadi tersangka. HM diduga kuat sebagai orang yang memerintahkan pemberian uang suap kepada pejabat negara, yaitu Bupati Buol,” kata Lanjut ke hal A2 kol. 3

Berita terkait di hal. A7.

Gubsu Pilihan Pembaca 8 Agustus Sampai Pkl 16:30 60%

56%

50% 40% 30%

Medan dan sekitarnya Zuhur : 12:32 Isya : 19:52

Asar : 15:52 Imsak : 04:55

Magrib : 18:40 Subuh : 05:05

Aisyah r.a. berkata: “Apabila sudah memasuki sepuluh terakhir bulan Ramadhan, maka Rasulullah SAW selalu menghidupkan malam-malam itu (dengan ibadah) dan membangunkan keluarganya serta mengikatkan sarungnya (tidak menggauli istrinya). (HR. Bukhari dan Muslim)

Muslim di Amerika tetap mendapat perlindungan sesuai undang-undang yang berlaku di Amerika,” kata dubes kepada wartawan dalam acara buka puasa bersama tokoh masyarakat dan tokoh agama di kediaman dubes AS di Jakarta, Rabu (8/8). Dubes mengemukakan hal

itu menanggapi terbakarnya sebuah masjid di Joplin, Missouri, pada Senin (6/8) waktu setempat. Biro Investigasi Federal Amerika Serikat (FBI-The Federal Bureau of Investigation) saat ini terus siap menyelidiki apakah insiden ini disengaja atau tidak. Lanjut ke hal A2 kol. 3

Obyek Vital Dijaga

Ramadhan Tidak Sebatas Rutinitas Dan Kultural

Kesenangan

Dubes AS Tanggapi Pembakaran Masjid JAKARTA (Antara): Duta Besar Amerika Serikat untuk Indonesia Scot Marciel menegaskan, tidak ada ancaman bagi Muslim di Amerika Serikat untuk menjalankan ibadahnya, menyusul terbakarnya Masjid Arson di Joplin, negara bagian Missouri. “Tidak ada ancaman.Warga

20% 10% 0%

17%

16%

1%

2%

1%

1%

2%

4%

MEDAN (Waspada): Sesuai arahan dan instruksi Kapoldasu Irjen Pol Drs H Wisjnu Amat Sastro, SH, dan Kapolresta Medan Kombes Pol Drs Monang Situmorang, SH, MSi. Polsek Medan Baru melakukan pengamanan obyek vital di wilayah hukumnya dalam bulan Ramadhan, Rabu (8/8) malam. Dalam pengamanan obyek vital di pusat berlanjaan antara lain, Sun Plaza Jln. KH Zainul Airifin, Medan Plaza Jln. Iskandarmuda, Medan Fair, Plaza Jln. Gatot Subroto, Konsulat dan SPBU, kotak ATM. Polsek Medan Baru menurunkan 40 personel terdiri dari Reskrim, Intelkam, Sabhara, Binmas, Provost berpakaian dinas dan sipil dibantu dengan satpam yang bertugas di obyek vital.

Lanjut ke hal A2 kol. 7

Waspada/Rasudin Sihotang

RATUSAN bal pakaian bekas dimuat ke truk kontainer dibawa ke Medan untuk dimusnahkan, Rabu (8/8).

Hari Ini 600 Bal Pakaian Monza Dimusnahkan TANJUNGBALAI (Waspada): Kantor Bea dan Cukai Teluknibung mengirimkan sekaligus memusnahkan 600 bal pakaian bekas (monza-red) hasil sitaan di Kanwil BC Medan untuk mengantisipasi aksi penjarahan masyarakat, Rabu (8/8).

“Semua pakaian bekas hasil tangkapan sejak 2010 hingga 2011 dan itu sudah mendapat surat keputusan dari Menteri Keuangan RI. Rencananya akan dimusnahkan di Medan besok,

Lanjut ke hal A2 kol. 6

Ada-ada Saja Pura-pura Diculik net

Amri Rebut Posisi Gatot MEDAN (Waspada): ‘Ancaman’ dari pembaca Waspada yang menjadi basis pendukung Amri Tambunan ternyata bukan sekadar gertak sambal. Pada perhitungan kupon yang masuk kemarin, pendukung Amri Tambunan berhasil mendongkrak kandidatnya menjadi runner up dalam bursa Gubsu versi

Lanjut ke hal A2 kol. 1

GARA-gara tidak dibelikan sepeda motor, dua remaja berusia 14 tahun berpura-pura diculik dan minta tebusan 8.000 ringgit atau sekitar Rp24 juta. Kasus ini akhirnya terbongkar oleh polisi dan kedua remaja asal Malaysia tersebut ditangkap.

Lanjut ke hal A2 kol. 2

Serampang - I love monza - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

http://epaper.waspadamedan.com

KAMIS, Kliwon, 9 Agustus 2012/20 Ramadhan 1433 H z zNo: 23951 * Tahun Ke-66

Terbit 24 Halaman (A1-12, B1-12) z zHarga Eceran: Rp 2.500,-

Waspada/Mustafa Kamal

ADHAR, suami korban penebasan leher di Gampong Alue Manjron, Kecamatan Syamtalira Bayu, Aceh Utara, Selasa (7/8).

Hartati Murdaya Jadi Tersangka

Wanita Tewas Dengan Leher Nyaris Putus LHOKSEUMAWE (Waspada): Nurhayati, 26, alias Jauhari tewas dibunuh orang tak dikenal yang diduga perampok di Gampong Alue Majron, Kecamatan Syamtalira Bayu, Aceh Utara, Selasa (7/8) sore. Pantauan Waspada, Rabu (8/8), di Tempat Kejadian Perkara (TKP), tim penyidik Reskrim Polres Lhokseumawe sedang melakukan olah TKP di rumah korban. Sedangkan suami korban, Adhar terlihat terpukul atas kejadian itu. Sementara warga setempat menduga tiga pemuda warga desa ini diduga kuat pelakunya. Menurut Adhar, istrinya yang sehari-hari sebagai petani sawah, selama ini tak memiliki masalah pribadi dengan tetangga maupun warga lain. “Saya perkirakan kejadian antara pukul 13:00-17:00. Karena saya lihat di dalam kamar mukenanya belum dilipat rapi. Walaupun ia tergeletak di ruang tamu dengan bersimbah darah, karena ia ditebas di bagian leher sebelah kiri nyaris putus. Kemudian luka di bagian kepala dan punggung,” ujar Adhar. Menurut suami korban, saat dia pulang kerja bongkar sawit dari gudang, sampai di rumah sekitar pukul 18:30, dia melihat kondisi rumah gelap dengan pintu Lanjut ke hal A2 kol 5

Antara

TITIK RAWAN LONGSOR. Kendaraan melintas jalan pegunungan jalur Barat dan Selatan Propinsi Aceh, pada kilometer 32 Desa Bayeun, Lhoksudu, Kec. Leupung, Kab. Aceh Besar, Aceh, Rabu (8/8). Menjelang arus mudik lebaran, pengemudi harus berhati-hati, karena terdapat 682 titik rawan longsor di Aceh, sebanyak 162 titik itu terdapat di jalur pantai Barat dan Selatan Aceh dan sisanya Pantai Timur dan wilayah Tengah Aceh.

JAKARTA (Waspada): Anggota Dewan Pembina Partai Demokrat yang juga pengusaha wanita, Hartati Murdaya (HM) resmi dijadikan tersangka dalam kasus suap Rp3 miliar penerbitan HGU perkebunan kelapa sawit di Buol, Sulawesi Tengah oleh penyidik Komisi Pemberantasan Korupsi (KPK). Istri taipan Murdaya Poo itu ditetapkan menjadi tersangka setelah pimpinan KPK menggelar ekspose (gelar perkara) pemberian suap kepada Bupati Buol, Amran Batalipu. “HM menjadi tersangka. HM diduga kuat sebagai orang yang memerintahkan pemberian uang suap kepada pejabat negara, yaitu Bupati Buol,” kata Ketua KPK Abraham Samad dalam jumpa pers di gedung KPK, Jakarta, Rabu (8/8). Sebelumnya, KPK menetapkan tiga tersangka, yakni Bupati Buol Amran Batalipu dan dua petinggi PT HIP yaitu Gondo Sudjojo dan Anshori. Berdasarkan keterangan para tersangka, KPK melakukan pemeriksaan secara marathon, dua kali menjalani pemeriksaan hingga memakan waktu 12 jam itu kini ditetapkan menjadi tersangka suap penerbitan HGU perkebunan kelapa sawit di Sulawesi Tengah. Sejak awal, pemilik PT Hardaya Inti Plantation, Hartati berulang kali Lanjut ke hal A2 kol 2

Israel Kian Semena-mena 11 Dari 2.000 Penderita Jiwa Dipasung Di Aceh Utara LHOKSEUMAWE (Waspada): Wakil Bupati Aceh Utara Muhammad Jamil mengatakan saat ini di daera-hnya telah mengantongi 2.000-an lebih penderita gangguan jiwa dalam berbagai tingkatan dan 11 penderita harus dipasung. “Informasi dan data yang saya peroleh dari bagian gangguan jiwa ada sekitar 2.000-an lebih penderita gangguan jiwa di Aceh Utara. Begitupun bukan ke semua mereka menderita gangguan jiwa tingkat berat, tapi banyak dari mereka yang menderita gangguan jiwa ringan,” kata M Jamil. Dia mengatakan, bagi masyarakat penderita gangguan jiwa yang harus dirujuk ke Banda Aceh, maka Pemerintah Aceh Utara ke depan akan memberikan fasilitas transportasi untuk mengantar pasien ke Kuta Raja. Disebutkan, penyebab terjadinya gangguan kejiwaan akibat konflik yang berkepanjangan dan kondisi ekonomi. (b18)

JAKARTA (Waspada): Menteri Luar Negeri RI Marty M. Natalegawa menegaskan penolakan dirinya untuk memasuki kawasan Ramallah, Palestina oleh Israel menunjukkan semakin tegasnya siapa sesungguhnya negara Yahudi itu. Marty bahkan menyebut Israel sebagai negara atau entitas yang sebenarnya tidak berani menghadapi suatu kenyataan.

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 3

Oleh: H Ameer Hamzah

Aisyah r.a. berkata: “Apabila sudah memasuki sepuluh terakhir bulan Ramadhan, maka Rasulullah SAW selalu menghidupkan malam-malam itu (dengan ibadah) dan membangunkan keluarganya serta mengikatkan sarungnya (tidak menggauli istrinya). (HR. Bukhari dan Muslim)

pimpinan KPK dan Polri telah bertemu untuk melakukan koordinasi mengenai pemeriksaan kasus tersebut, namun belum mendapatkan hasil. “Mengenai ada tersangka yang sama itu yang akan dibicarakan dan dikoordinasikan, tapi sekali lagi KPK tidak terganggu, KPK akan terus melakukan penyidikan,” jelas Abraham. Terkait kemungkinan bahwa tersangka Irjen Polisi DS (Djoko Susilo) ditahan, Abraham mengatakan penahanan DS bukan di tempat yang luar biasa. Lanjut ke hal A2 kol 1

Rektor IAIN Ar-Raniry Aceh

Waspada/Zamzamy Surya

MAHASISWA Aceh Selatan menggalang dana (uang receh) secara sukarela kepada pengguna jalan raya, Rabu (8/8) di kawasan Jalan Sudirman Tapaktuan. Dana tersebut akan disumbangkan ke Pemkab karena APBK tahun 2012, minus Rp83 miliar.

Waspada/Rasudin Sihotang

: 15:52 Magrib : 18:40 : 04:55 Subuh : 05:05

JAKARTA (Antara): Penyidikan yang dilakukan Komisi Pemberantasan Korupsi (KPK) dalam kasus dugaan korupsi pengadaan alat simulasi mengemudi roda dua dan roda empat di Korps Lalu Lintas (Korlantas) tahun anggaran 2011, tidak terusik dengan kisruh kewenangan antara KPK dan Polri. “Memang belum ada kesepakatan final (antara KPK dan Polri), masih diperlukan koordinasi lagi tapi penyidikan KPK sama sekali tidak terusik,” kata Ketua KPK Abraham Samad di gedung KPK Jakarta, Rabu (8/8). Pada Senin (6/8) malam,

Prof. Dr. H. Farid Wajdi Ibrahim, MA

DOKTER Forensik, Dr Reinhard Hutahaean, SH, SpF, (tiga kanan) mengangkat jenazah Juanda Januari untuk selanjutnya dilakukan otopsi, Rabu (8/8). Medan dan sekitarnya

Samad: Simulator, KPK Maju Terus

Ramadhan Tidak Sebatas Rutinitas Dan Kultural

Polisi Periksa Mantan Bupati Bireuen

Zuhur : 12:32 Ashar Isya : 19:52 Imsak

Lanjut ke hal A2 kol 6

Mahasiswa Aksi Kumpul Uang

MENURUT Alquran, manusia (pria) memang mencintai perempuan, anak, emas, perak dan kendaraan yang bagus. Itu kesenangan di dunia. Tetapi Alquran juga mengingatkan manusia supaya tidak lalai dengan anugerah Allah yang diberikan kepada mereka. Sebab seluruh kesenangan itu itu memiliki potensi ghurur (terpedaya).

Kesenangan

ASEAN di Gedung Sekretariat ASEAN, Jakarta, Rabu (8/8). Menurut Marty, adanya penolakan tersebut justru menciptakan momentum baru bagi upaya mendorong agar adanya peningkatan s t a t u s Pa l e s t i n a d i P B B. “Karena penolakan tersebut

Pemkab Aceh Selatan Defisit

TAPAKTUAN (Waspada): Krisis keuangan yang melanda Pemkab Aceh Selatan tahun anggaran 2012 hingga minus Rp83 miliar telah mengundang keprihatinan mahasiswa di daerah penghasil pala tersebut. Puluhan mahasiswa yang tergabung dalam Aliansi Pemuda Peduli Aceh Selatan (AP2AS), Rabu (8/8), menggelar aksi keprihatinan dengan membuat Posko di Jalan Jenderal Sudirman, persis di depan SMAN 1 Kota Tapaktuan. Mereka meminta sumbangan uang receh secara sukarela kepada pengguna jalan guna diserahkan kepada pemerintah setempat.

Al Bayan

“Israel kembali menunjukkan occupation (pendudukan) terhadap Palestina. Karena ketika Palestina bermaksud untuk bisa berinteraksi dengan masyarakat internasional dalam kaitan ini adalah dengan GNB, Israel justru mempersulit interaksi tersebut,” tegas Marty usai menghadiri upacara HUT

Bayi Tewas Di Tangan Ibu Tiri Diautopsi TANJUNGBALAI (Waspada): Kuburan bayi diduga menjadi korban pembunuhan oleh ibu ibu tirinya di Desa Seiapung Jaya, Kec. Tanjungbalai, Kab. Asahan, dibongkar petugas, Rabu (8/8). Lanjut ke hal A2 kol 6

BIREUEN (Waspada): Polres Bireuen, Rabu (8/8), memeriksa mantan Bupati Bireuen Nurdin Abdul Rahman selama empat jam terkait dugaan korupsi pada masa jabatannya yang berakhir 25 Juli lalu. Polisi masih menetapkan Nurdin sebagai saksi terkait kasus dugaan korupsi di Dinas Kelautan Dan Perikanan (DKP) yang melibatkan mantan kadisnya, Syamsuar dan Kepala Perusahaan Daerah Pembangunan (PDP) Kesuma Fachrida, yang belum lama ini keduanya sempat ditahan. “Benar, ada kita panggil Tgk Nurdin dan dia dimintai keterangan selama empat Lanjut ke hal A2 kol 5

BULAN Suci Ramadhan merupakan bulan yang penuh dengan keberkahan, bulan yang sangat mulia, di dalamnya terdapat malam yang lebih baik dari seribu bulan, di dalamnya penuh dengan rahmat, ampunan dan pembebasan dari api neraka. Bulan itu dirinduLanjut ke hal A7 kol 1

Ada-ada Saja

Pura-pura Diculik

GARA-gara tidak dibelikan sepeda motor, dua remaja berusia 14 tahun berpura-pura diculik dan minta tebusan 8.000 ringgit atau sekitar Rp24 juta. Kasus ini akhirnya terbongkar oleh polisi dan kedua remaja asal Malaysia tersebut ditangkap. Lanjut ke hal A2 kol 5

Serampang - Maju tak gentar - He.... he....he....


Berita Utama

A2 Akbar: Isu Pemecatan JK Tidak Jelas BANDA ACEH (Waspada): Ketua Dewan Pertimbangan Pusat Partai Golkar Akbar Tanjung mengakui rekrutmen calon presiden (Capres) dari partainya terkesan tidak demokratis. “Kami sudah sampaikan pada DPP Golkar dalam hal rekrutmen presiden untuk dilakukan lebih terbuka, jangan tertutup seperti saat ini,” kata Akbar Tanjung saat menjadi keynote speaker pada diskusi dengan konstituen di Hermes Palace Hotel, Banda Aceh, Selasa (7/8) malam, dengan tema “Menjawab Persoalan Krisis Para Tokoh Nasional Untuk Membangun Bangsa”. Menurut Akbar, prinsipnya Dewan Pertimbangan Pusat Partai Golkar jauh-jauh hari sudah mengingatkan persoalan ini supaya dilakukan rekrutmen secara terbuka. “Berikan kesempatan pada seluruh DPD tingkat II untuk mengajukan nama-nama calonnya masing-masing di dalam Rapimnas.” Saat itu DPP mengatakan, kata Akbar, penetapan Aburizal Bakrie sebagai capres RI dari Partai Golkar sudah sesuai dengan prosedur dan demokratis. Memang, lanjutnya, riak-riak tersebut agar tidak muncul ke permukaan sehingga tidak dibicarakan pada Rapimnas. “Semua itu sudah bisa diselesaikan dengan baik.” Terkait isu pemecatan Jusuf Kalla sebagaimana diberitakan media massa, Akbar mengharapkan agar isu ini tidak dibesarbesarkan. Alasannya, isu tersebut sesuatu yang belum terjadi, alangkah baiknya tidak terlalu dipersoalkan.”Janganlah isu yang belum jelas dibesar-besarkan dan sebaiknya tidak lagi diperpanjang.” Isu yang beredar di media massa, petinggi Partai Golkar dibuat gerah dengan gebrakan Jusuf Kalla, menyusul mantan ketua umum partai berlambang pohon beringin itu disinyalir akan dicalonkan menjadi presiden oleh sejumlah partai politik lain sebagai ekses dari rekrutmen capres yang terkesan tidak demokratis. Gebrakan Jusuf Kalla membuat petinggi Partai Golkar mengancam akan memecat mantan Wakil Presiden R I itu. (b07/b09)

Amri Rebut Posisi Gatot

Waspada/Rasudin Sihotang

RATUSAN bal pakaian bekas dimuat ke truk kontainer dibawa ke Medan untuk dimusnahkan, Rabu (8/8).

Hari Ini 600 Bal Pakaian Monza Dimusnahkan TANJUNGBALAI (Waspada): Kantor Bea dan Cukai Teluknibung mengirimkan sekaligus memusnahkan 600 bal pakaian bekas (monza-red) hasil sitaan di Kanwil BC Medan untuk mengantisipasi aksi penjarahan masyarakat, Rabu (8/8). “Semua pakaian bekas hasil tangkapan sejak 2010 hingga 2011 dan itu sudah mendapat surat keputusan

dari Menteri Keuangan RI. Rencananya akan dimusnahkan di Medan besok, Kamis (8/8), karena di sini kondisinya belum memungkinkan,” kata Kakan BC Teluknibung Rahmady Effendi Hutahaean didampingi petugas Agus Yudha. Dikatakan, pakaian bekas impor dari Malaysia hasil penindakan itu merupakan barang tak bertuan, sehingga

Lima Rumah Musnah Terbakar TANJUNGBALAI (Waspada): Lima rumah yang dihuni tujuh kepala keluarga di Jalan Baganasahan, Dusun IV, Desa Seiapung Jaya, Kec. Tanjungbalai, Kab. Asahan musnah dilalap si jago merah, Rabu (8/8) sekira pukul 02.00. Tidak ada Korban jiwa dalam peristiwa itu, namun kerugian ditaksir ratusan juta ru-

piah. Penyebab api juga masih dalam penyelidikan namun dugaan sementara akibat korsleting listrik. Informasi dihimpun Waspada, kemarin, malam itu warga sedang tidur lelap. Namun salah seorang warga mencoba menyalakan listrik berniat hendak menonton televisi dan saat stop kontak diaktifkan,

Waspada/Rasudin Sihotang

PEMILIK rumah menjelaskan kronologis kebakaran yang menghanguskan lima rumah di Desa Seiapung Jaya, Rabu (8/8)

Samad: ....

“Di hukum ada namanya equity before the law, semua sama di depan hukum, tidak ada istilah “bintang”, jadi semua diperlakukan sama dan tidak ada hak khusus,” tambah Abraham. Pada gelar perkara 27 Juli lalu, KPK mengeluarkan surat perintah dimulainya penyidikan dengan tersangka Irjen Polisi DS (Djoko Susilo), mantan Kepala Korlantas yang juga menjabat Gubernur Akademi Kepolisian, dan tersangka lain berinisial BS, SB dan DP. DP adalah Brigadir Jenderal Polisi Didik Purnomo yaitu Wakil Kepala Korlantas, BS adalah Budi Susanto, Direktur

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. BxGd7+, MxB. 2. f6+, Kxf6. 3. Be1+, Ke4. 4. BxK+, Rf6. 5. MxM, Bfd8. 6. Mg4 (mengantisipasi Bd1+mat dan gerak lari Rg7). Hitam menyerah.

Jawaban TTS: TTS Topik

Santapan Ramadhan

2 5 7 9 6 4 1 3 8

3 9 1 8 7 5 6 4 2

6 4 8 3 2 1 9 5 7

1 8 9 4 5 2 3 7 6

7 3 4 1 8 6 2 9 5

5 2 6 7 3 9 8 1 4

9 7 2 6 4 3 5 8 1

4 6 3 5 1 8 7 2 9

8 1 5 2 9 7 4 6 3

sekililingnya. Kades mengatakan, warga yang menjadi korban adalah M. Yakub, 42, Effendi Sihombing, 65, Syahrial, 35, Ucok Becak, 48, Icik 28, Sangkot, 31, ijul Dina, 25 dan Yus Mama, 30. Mereka telah didata untuk mendapatkan bantuan dari Pemkab Asahan. Secara terpisah, Kepala BPBD Kota Tanjungbalai Mahdin Siregar melalui Kabid Rehabilitasi Dan Kontruksi atau Koordinator Pertolongan Pertama Kebakaran (P2K) Sofyan ST mengatakan, begitu mendapat kabar sekira pukul 02.00 Wib, pihaknya menurunkan lima unit mobil pemadan kebakaran dan api dapat dipadamkan sekitar pukul 03.00. Kapolres Asahan AKBP Yustan Alpiani melalui Kapolsek Air Joman AKP Heri Tambun mengatakan, pihaknya masih menyelidiki penyebab kebakaran. (a32)

Mahasiswa Aksi ....

Aksi Mahasiswa Politeknik Aceh Selatan (Poltas), Universitas Terbuka (UT) dan Sekolah Tinggi Agama Islam (STAI) Tapaktuan itu dimulai sekitar pukul 11:00 sempat memacetkan ruas jalan yang padat arus lalu lintas selama beberapa jam. Menurut koordinator aksi, Ismail Ismed, aksi keprihatinan dengan tema “Ayo.! menyumbang Rp1.000 ke Pemkab Aceh Selatan itu” direncanakan akan berlangsung selama sepekan ke depan. Selain meminta sumbangan uang receh, mereka juga membagi selebaran yang berisi tentang merosotnya pembangunan meski daerah ini telah melahirkan dua anak (Aceh Singkil dan Abdya) serta satu cucu (Pemko Subulussalam) dalam program pemekaran. Dalam selebaran yang ditandatangani Ketua AP2AS, Ismail Ismed dan sekretarisnya Mulyadi, disebutkan, kandungan sumber daya alamnya sangat melimpah ruah, ter-

utama sektor pertambangan serta sektor pertanian, perkebunan maupun kelautan yang seharusnya dimanfaatkan dan dikelola Pemkabnya demi kemakmuran dan kesejahteraan rakyatnya. “Kondisi saat ini semakin diperparah dengan amburadulnya sistem roda Pemerintahan Aceh Selatan akibat penempatan aparaturnya tidak sesuai bidang keahliannya. Pemerintahan terkesan sebagai daerah otonomi tak terpimpin, kondisi carut marut pemerintahan terus berlanjut tanpa berkesudahan sehingga mengakibatkan daerah dilanda defisit keuangan yang cukup besar,” paparnya. Menurut dia, dengan krisisnya keuangan ini, baik secara langsung maupun tidak langsung telah mengganggu stabilitas perekonomian rakyat dan pembangunan daerah. “Oleh karena itu, masyarakat juga mempunyai tanggungjawab moril mengatasi atau mencari solusi terhadap persoalan ini,” tuturnya. (b30)

Hartati ....

tahun 2002, dengan ancaman hukuman 5 tahun penjara. KPK sebelumnya sudah dua kali memeriksa Hartati yaitu pada Jumat (27/7) dan Selasa (31/7) dengan waktu pemeriksaan lebih dari 12 jam. Dalam pemeriksaan Hartati mengaku bahwa ia tidak mengetahui tentang bantuan dana kepada Bupati Buol Amran Batalipu pada pilkada Juni 2012 di kabupaten Buol. Ia juga mengungkapkan bahwa Bupati Buol Amran Batalipu yang meminta uang sebesar Rp3 miliar. “Amran minta Rp3 miliar, di telepon ada itu, setahu saya dikasih Rp1 miliar, tapi saya tidak kasih,” ungkap Hartati dan menambahkan bahwa ia

memiliki rekaman pembicaraan tersebut. Namun Hartati mengaku tidak pernah menelepon langsung Amran. “Saya tidak pernah telepon langsung, tapi ada orang yang menelepon dan teleponya diberikan ke saya, isi pembicaraan diplomatis saja, tidak ngomong apa-apa,” tambah Hartati. Menurut Hartati uang tersebut bukan digunakan untuk pilkada melainkan demi mengatasi masalah keamanan. Dengan demikian, ia juga membantah per nyataan pengacara Amran, Amat Ente Daim yang menyebutkan bahwa karyawan Hartati yang proaktif memberikan uang kepada Bupati Buol. (j02)

sudah menjadi perempuan tabaruj. Bila kamu izinkan istrimu memperdagangkan auratnya di depan umum, Allah akan mencabut kehangatan cinta antara dua hatimu. Istri akan membuat serong dan engkaupun akan melakukan yang serupa. Tinggallah engkau berdua seperti rumput hijau yang tumbuh di kotoran lembu, meski hijau tak enak rasanya. Bila Allah memberi kepadamu keturunan, cetaklah anak-anakmu itu menjadi anak yang saleh. Jangan biarkan anakmu menjadi musuhmu, musuh agamamu dan

musuh Allah karena dia tidak mewarisi keimanan. Wariskan iman dan takwa kepada anakanakmu. Jangan engkau wariskan kekufuran dan kemunafikan. Mungkin juga kamu dimudahkan rezeki sehingga kalian dapat membeli kendaraan yang bagus. Bersyukurlah kepada anugerah itu. dan jadikanlah kendaraan itu untuk mencari ridha Allah. Misalnya pergi ke masjid, membantu tetangga, pergi ke kantor, dan menyambung tali silaturahmi. Itulah kehidupan yang baik dan berguna. Karena itu perbudaklah mobilmu itu, jangan sebaliknya kamu menjadi budak mobilmu.

Al Bayan ....

Jawaban Sudoku:

wayar yang berada di rumah warga mengeluarkan api. Pemilik yang mengetahui adanya kebakaran segera berteriak minta tolong, hingga membangunkan warga sekitar. Masyarakat pun bersama-sama berusaha memadamkan api dengan peralatan seadanya, disamping mencoba menghubungi unit pemadam kebakaran, baik Kota Tanjungbalai maupun Asahan. “Lima unit mobil pemadam kebakaran dari Tanjungbalai diturunkan, sementara tiga unit lainnya didatangkan dari Kabupaten Asahan,” terang Samsul Bahri, kepala desa Dusun IV, Desa Sei Apung Jaya. Menurutnya, api diduga berasal arus pendek, dari rumah yang dihuni Effendi Sihombing. Akibat angin bertiup cukup kencang dan rumah yang terbuat dari papan, api dengan cepat merembat ke rumah warga yang ada di

Utama PT Citra Mandiri Metalindo Abadi (CMMA) dan SB adalah Sukotjo S Bambang yaitu Direktur PT Inovasi Teknologi Indonesia yang menjadi perusahaan subkontraktor dari PT CMMA. Sedangkan pada 1 Agustus, Badan Reserse dan Kriminal (Bareskrim) Polri juga menetapkan lima tersangka dalam kasus tersebut, tiga diantaranya sama dengan tersangka versi KPK yaitu DP, BS dan SB. Sedangkan dua tersangka lain yang ditetapkan Bareskrim adalah Ajun Komisaris Besar Polisi (AKBP) TR (Teddy Rusmawan) selaku Ketua Panitia Pengadaan Barang dan Jasa Simulator dan Komisaris Polisi LGM sebagai Bendahara Korlantas. Bareskrim juga sudah menahan Brigjen DP, Kompol LGM, AKBP TR serta BS, sementara SB sudah menjadi terpidana di Rutan Kebon Waru, Bandung atas perkara penggelapan. KPK sendiri sudah menyelidiki kasus senilai Rp198,7 miliar tersebut sejak Januari 2012. membantah dirinya memberi suap. Namun, KPK masih menunggu waktu untuk melakukan penahanan terhadap Hartati, karena penyidik tengah merampungkan kasusnya. “Mengenai penahanan, apabila diperlukan oleh penyidik atau apabila kasusnya sudah dianggap mendekati rampung maka yang bersangkutan akan ditahan seperti dengan tersangka-tersangka lain yang disidik KPK,” terang Abraham. Hartati yang juga Ketua Umum Walubi itu dijerat dengan pasal 5 ayat 1 UU No 31 tahun 1999 sebagaimana diubah dengan UU No 30 Bila Anda berhasil mempersunting seorang gadis cantik nan elok parasnya, bersyukurlah kepada Allah SWT karena Allah telah menjodohkan Anda dengan makhluk ciptaan-Nya yang menyenangkan kamu. Bimbinglah istrimu itu supaya takwa kepada Allah SWT. Kecantikannya itu milikmu seutuhnya, jangan biarkan mereka menjual aurat dan farajnya kepada lelaki lain. Betapa banyak pasangan artis yang ganteng dan cantik, tetapi harus berpisah di tahun pertama perkawinan mereka. Tidak ada lagi kemanisan perkawinan, sebab sang istri

WASPADA Kamis 9 Agustus 2012

tak seorang pun yang ditetapkan jadi tersangka. “Tidak bisa diproses di pengadilan, karena tidak ada tersangkanya. Eksekusi barang ini berdasarkan surat keputusan Menkeu,” papar Agus. Diterangkan, seluruh pakaian bekas itu dibawa ke Medan menggunakan truk kontainer dengan pengawalan ketat dari polisi, Kodim dan TNI AL. Menurutnya, pihak BC tidak pernah memperbolehkan pakaian bekas masuk Indonesia. (a32)

Polisi Periksa ....

jam,” kata Kapolres Bireuen AKBP Yuri Karsono, melalui Kasat Reskrim Ipda Benny Cahyadi kepada Waspada, kemarin. Ditanya apakah ada kemungkinan mantan juru runding GAM tersebut ikut terlibat kasus proyek di DKP kabupaten setempat yang dapat merugikan negara, Kasat Reskrim Polres Bireuen mengatakan, dirinya belum bisa memprediksi, namun akan mengikuti prosedur yang berlaku. Polres Bireuen akhirnya menahan mantan Kadis Kelautan dan Perikanan (DKP) Bireuen Syamsuarsyah bersama Direktur PDP Bireuen Kesuma Fachrida, karena keduanya diduga terlibat kasus korupsi di DKP, khususnya proyek pengerukan Kuala Pante Rheng Samalanga dan Kuala Peudada 2010 lalu sehingga negara dirugikan miliaran rupiah. (cb02)

Ada-ada Saja ....

Kepala kepolisian setempat, ACP K. Manoharan sebagaimana dilaporkan Bernama menyatakan, drama penculikan yang terjadi pada akhir bulan lalu. Insiden ini berlatar belakang hal sepele hanya karena remaja tersebut kecewa karena tidak dibelikan sepeda motor oleh orang tuanya. Anak itu kemudian pergi dan tidak pulang-pulang. “Sang ayah melapor ke polisi karena anaknya tidak pulang.” Manoharan mengatakan, esoknya, sang ayah menerima telepon dari seseorang yang meminta tebusan untuk anaknya. Uang itu harus diserahkan dengan cara menyimpannya di belakang sebuah toko di Kuala Ibai. Sang ayah kemudian melakukan apa yang diperintah oleh penculik itu. Sang ayah lalu menemukan anaknya bersama seorang temannya di Kuala Ibai. Hasil penyelidikan polisi menemukan bahwa anaknya berpura-pura diculik supaya mendapatkan uang untuk membeli motor. (ini/rzl)

Wanita Tewas ....

depan terbuka. Padahal ada lampu di dalamnya. Saat masuk dia terkejut melihat istrinya tergeletak di ruang tamu dengan berlumuran darah. Adhar langsung menghubungi kepala dusun setempat. Menurut warga, rumah korban terbilang terasing di pinggiran sawah. Hanya satu rumah warga paling dekat yang terletak di jalan setapak menuju ke rumahnya. Di dekat korban ditemukan, juga ditemukan satu potong bambu ukuran sekitar 60 centimeter kini telah diamankan polisi. Diduga korban sempat dipukul terlebih dahulu, kemudian baru ditebas lehernya dengan parang. Sementara dugaan pelaku terlebih dahulu mengobrak abrik kain dan baju korban. “Namun tidak ada satu benda atau uang milik istri saya yang hilang, kalau perhiasan dia tidak memakainya,” katanya. Kini, Jasad korban langsung dimakamkan di Gampong Alue Seuneuron. Sementara itu, Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kepala Satuan Reserse Kriminal AKP Supriadi mengatakan, motif dari peristiwa ini belum diketahui secara pasti. Pihaknya mengetahui kejadian setelah mendapatkan laporan masyarakat. (cmk)

kupon Gubsu Pilihan Pembaca Waspada yang terdapat di halaman Politik dan Hukum, kemudian mengirimkan kupon itu ke Kantor Harian Waspada Jl. Brigjen Katamso no. 1 Medan. Pengiriman kupon sebaiknya segera dilakukan karena tenggang waktu tinggal 7 (tujuh) hari lagi. Isi kuponnya, naikkan poin kandidatnya dan raih hadiahnya. (tim)

MEDAN (Waspada): ‘Ancaman’ dari pembaca Waspada yang menjadi basis pendukung Amri Tambunan ternyata bukan sekadar gertak sambal. Pada perhitungan kupon yang masuk kemarin, pendukung Amri Tambunan berhasil mendongkrak kandidatnya menjadi runner up dalam bursa Gubsu versi pilihan pembaca Waspada. Amri Tambunan meraih poin 17% menyalip posisi Gatot Pujo Nugroho dengan poin 16%. Sedangkan posisi paling top tetap ada pada Gus Irawan Pasaribu dengan poin 56%, berkurang lagi 3% dibandingkan dengan hitungan kemarin. Sedangkan RE Nainggolan juga berhasil menaikkan poin menjadi 4%. Kehadiran nama Amri Tambunan dalam bursa pilihan pembaca membuat dinamika bursa menjadi lebih bergejolak. Ini tentunya tidak lepas dari partisipasi pembaca yang menjadi pendukung Amri Tambunan. Para pembaca yang menjadi pendukung kandidat lainnya harus mewaspadai pendukung Amri Tambunan jika tak mau disalip begitu saja.

Urutan selengkapnya poin persentase pilihan pembaca Waspada sbb: Gus Irawan 56%, Amri Tambunan 17%, Gatot Pujo Nugroho 16% RE Nainggolan 4%, Syah Afandin 2%, AY Nasution 2%, Chairuman Harahap 1%, Fadly Nurzal 1%, Cornel Simbolon 1%. Panitia kembali mengimbau pembaca yang ingin berpartisipasi dalam mengangkat nama calonnya dapat mengisi

Bayi Tewas ....

Dr Reinhard Hutahaean, SH, SpF, mengatakan pihaknya telah mengambil sampel jaringan tubuh korban. Selanjutnya akan dibawa ke Pematangsiantar untuk dilakukan patologi anatomi (pemeriksaan) dan hasilnya akan diberikan kepada penyidik. “Maaf, ya rekan-rekan, hari ini belum bisa dikonfirmasi hasilnya, karena masih ada tahapan yang harus kami lakukan seperti patologi anatomi dan itu hanya bisa dilakukan di rumah sakit,” terang Reinhard yang didampingi sejumlah dokter muda. Sementara, ayah korban, Azhar, 31, mengatakan pihaknya pasrah jika kuburan anaknya harus dibongkar dan dilakukan autopsi. Dia juga menyatakan ingin sekali mengetahui proses kematian anak kesayangannya itu, meski istrinya telah mengaku mencekik leher korban. “Kita serahkan saja ke penyidik, mudahmudahan kasus ini cepat selesai dan kematian anak saya dapat terungkap,” tutur Azhar. Pantauan Waspada, pagi itu sejumlah petugas dari Polres Asahan dan ratusan

warga meramaikan lokasi. Sebelum dibongkar, pemuka agama dan keluarga mengirimkan doa dan selanjutnya makam digali oleh sanak famili. Selanjutnya jenazah dibawa ke salah satu tenda yang telah disediakan untuk kemudian diautopsi oleh dokter forensik. Sebelumnya, Juanda, 1,7 tahun, ditemukan tak bernyawa di dekat tangga rumah panggung milik orangtuanya di DusunV, Desa Sungaiapung, Kec. Tanjungbalai, Kab. Asahan, Senin (16/7) pagi. Balita malang itu diduga dibunuh ibu tirinya karena dari tubuh korban ditemukan sejumlah bekas luka memar dan lecet. Seperti di bagian leher, punggung, tangan, kepala, wajah, paha, kaki, sekitar kelamin, mulut, dan lidah. Alasan pembunuhan itu akibat dibakar cemburu karena sang suami masih berhubungan dengan istri pertamanya melalui telepon seluler. “Dia mengaku tidak suka melihat suaminya menerim sms dari istri pertamanya,” kata Kapolsek Airjoman, AKP Heri Tambun beberapa waktu lalu. (a32)

Israel Kian ....

Biasa Tingkat Menteri Luar Negeri Gerakan Non-Blok mengenai Palestina (Extraordinary Ministerial Meeting of the Non-Aligned Movement Committee on Palestine). Akibat penolakan tersebut, pertemuan itu pun dibatalkan. Menlu Marty mengungkapkan rencana untuk membuka konsul kehormatan RI di Palestina. Bila terwujud tentunya makin mempererat hubungan Indonesia dan Palestina. “Masih menjadi komitmen kita untuk menunjuk konsul kehormatan ini, tentunya dengan bekerja sama dengan Palestina untuk mencari bentuk yang paling tepat dan pribadi yang paling cocok,” ujar Marty di Jakarta. Diharapkan pembukaan konsul kehormatan ini bisa meningkatkan kerja sama antara Indonesia dengan Palestina. Beberapa bantuan yang sudah berjalan dan

diberikan oleh Indonesia kepada Palestina adalah, bantuan capacity building. Kecewa dengan DK PBB Marty juga menyampaikan kekecewaan Indonesia terhadap Dewan Keamanan PBB. Menurut Marty, DK PBB tidak mampu menjalankan amanatnya untuk memelihara perdamaian dan keamanan internasional. Indonesia juga menyatakan, dukungan atas resolusi Majelis Umum PBB (MU PBB) yang mengecam aksi kekerasan di Syria serta mendorong terciptanya suatu proses politik di Syria. “Indonesia sangat kecewa dengan ketidakmampuan DK PBB untuk bisa memikul tanggung jawab di bawah Piagam PBB. DK PBB bertanggung jawab melaksanakan kewajibannya di bawah Piagam PBB untuk memelihara perdamaian dan keamanan internasional,” ujar Marty usai mengikuti upacara peringatan 45 tahun ASEAN. (ok/r-m10)

Pembongkaran makam almarhum Juanda Januari, berusia 1,7, bertujuan mengetahui kepastian penyebab kematian sebenarnya. Bukan hanya dibongkar, jenazah juga diautopsi oleh dokter forensik yang didatangkan dari Rumah Sakit Djasamen Saragih, Pematangsiantar. “Visum dari luar sudah ada, tetapi kita juga membutuhkan pemeriksaan dalam tubuh korban, sehingga dapat dipastikan penyebab kematiannya,” kata Kapolres Asahan Yustan Alpiani melalui Kanit Reserse Umum Iptu Triatno Pamungkas didampingi Aiptu Erwin. Dikatakan, tersangka pembunuh, MSL, 21, yang merupakan ibu tiri korban telah mengakui perbuatannya. Tersangka menghabisi nyawa bayi gempal itu dengan cara mencekik dan menganiayanya. “Dari hasil visum memang ada bekas luka lecet di leher, tapi hasil autopsi bagian dalam tubuh korban tetap kita butuhkan,” kata Erwin. Sementara, dokter forensik RSUD Djasamen Saragih,

semakin jelas menunjukkan betapa sikap Israel semakin s e m e n a - m e n a ,” u n g k a p Marty. Ketika disinggung terkait dengan bantuan Indonesia untuk Palestina, Menlu menambahkan, selama ini Indonesia terus mengupayakan pemberian bantuan bagi Palestina. “Selama bertahun-tahun kita sudah memberikan bantuan berupa capacity building (peningkatan kapasitas) bagi Palestina di berbagai bidang. Komitmen kita adalah untuk bisa melatih kurang lebih 1.000 orang Palestina pada 2013 mendatang (saat ini sendiri sudah 400 yang diberi pelatihan),” tegas Marty. Seperti diketahui sebelumnya Marty serta tiga menlu lainnya ditolak masuk ke wilayah Ramallah, Palestina oleh Israel. Para menlu ini bertolak ke Palestina untuk menghadiri Pertemuan Luar

Gubsu Pilihan Pembaca Waspada 8 Agustus 2012 Sampai Pukul 16:30


Berita Utama

A2

WASPADA Kamis 9 Agustus 2012

Presiden Pada Peringatan Nuzulul Quran:

Tingkatkan Kesetiakawanan Dengan Umat Islam Palestina Dan Rohingya

Antara

KEPALA Bareskrim Polri Komjen Pol Sutarman (kanan) berbincang dengan Ketua KPK Abraham Samad (kiri) di sela-sela menghadiri acara buka puasa bersama keluarga besar Kepolisian RI di Mabes Polri, Jakarta, Rabu (8/8).

Sutarman-Abraham Duduk Satu Meja JAKARTA (Waspada): Perseteruan Polri dengan Komisi Pemberantasan Korupsi (KPK) dalam penganan kasus penyidikan dugaan korupsi pada proyek driving simulator SIM untuk roda dua (R2) dan roda empat (R4) masih berjalan di tempat dan tidak ada perkembangan yang signifikan. “Belum ada perubahan, masih seperti kemarin,” kata Kabareskrim Polri Komjen Pol Sutarman usai melaksanakan shalat Maghrib kepada wartawan disela-sela acara buka puasa bersama dengan Presiden Susilo Bambang Yudhoyono di Mabes Polri, Rabu (8/8). Dalam acara buka puasa bersama yang juga dihadiriWapres Boediono dan para Menteri KIB II, pejabat tinggi negara dan para perwira tinggi Mabes Polri, tampak Sutarman duduk satu meja dengan Abraham Samad dan Jaksa Agung Basrief Arief. Menurut Sutarman dalam acara buka puasa itu sama sekali tidak ada pembicaraan soal kisruhnya penanganan kasus Korlantas Polri yang ditangani oleh KPK juga diklaim Polri telah melakukan penyelidikan dan penyidikan. “Tadi cerita-cerita masalah ringan saja, tidak ada menyangkut itu,” kata mantan Kapolda Metro Jaya ini.Polri lanjut Sutarman, sampai saati ini masih mencari solusi terbaik untuk menyelesaikan kisruh tersebut dengan KPK. Sementara, Ketua KPK Abraham Samad memilih diam soal kisruh penanganan kasus Simulator SIM dengan Mabes Polri. Meski dikerumuni wartawan usai melaksanakan shalat Maghrib, Abraham Samad sama sekali tidak mau memberikan komentar apapun. Bahkan, beberapa pertanyaan wartawan tidak dijawabnya, Abraham Samad memilih meninggalkan kerumuan wartawan kemudian bergegas masuk kembali ke Gedung Rupatama Mabes Polri tempat acara buka puasa berlangsung.(j02)

Oknum Polisi Diamankan MEDAN (Waspada): Seorang oknum anggota polisi yang bertugas di Polresta Medan mengamuk di Jalan Halat Gang Makmur Medan Area dan nyaris menjadi bulan-bulanan warga, Rabu (8/8) sore. Briptu DL yang bertugas di Intelkam Polresta Medan kemudian diamankan anggota polisi kemudian diboyong ke Polresta Medan. Rahman, 28, warga setempat mengatakan, peristiwa tersebut terjadi saat dirinya mendengar oknum polisi tersebut berkelahi dengan seorang wanita yang diduga pacarnya disalah satu rumah kos Jalan Halat Gang Makmur Medan Area. Melihat perkelahian itu, Rahman mencoba untuk melerai. Tapi oknum polisi ini justru balik memarahinya. “Saya melihat dia berantam dengan pacarnya. Jadi saya mencoba untuk melerai tapi dia justru marah-marah sama saya dan warga lainnya sambil mengaku polisi,” jelas Rahman. Karena ada keributan tersebut, warga pun semakin memadati lokasi. Diduga panik, oknum tersebut mencoba memanggil temannya seorang oknum berpakaian Brimob. Sejumlah petugas kepolisian yang mendapatkan informasi dengan adanya keributan itu turun ke lokasi dan membawa oknum itu. “Sudah dibawa ke Polresta Medan oknum polisi tadi,” kata Rahman. Kasat Intelkam Polresta Medan Kompol Ahyan yang dikonfirmasi Waspada , membenarkan oknum polisi iti anggotanya. “Yang bersangkutan telah kita serahkan ke Provost Polresta Medan untuk diperiksa,” jelasnya. (m39)

Amri Rebut Posisi Gatot ... dalam bursa Gubsu versi pilihan pembaca Waspada. Amri Tambunan meraih poin 17% menyalip posisi Gatot Pujo Nugroho dengan poin 16%. Sedangkan posisi paling top tetap ada pada Gus Irawan Pasaribu dengan poin 56%, berkurang lagi 3% dibandingkan dengan hitungan kemarin. Sedangkan RE Nainggolan juga berhasil menaikkan poin menjadi 4%. Kehadiran nama Amri Tambunan dalam bursa pilihan pembaca membuat dinamika bursa menjadi lebih bergejolak. Ini tentunya tidak lepas dari partisipasi pembaca yang menjadi pendukung Amri Tambunan. Para pembaca yang menjadi pendukung kandidat lainnya harus mewaspadai penduJawaban Problem Catur, kung Amri Tambunan jika tak mau disalip begitu saja. TTS Dan Sudoku Urutan selengkapnya poDari Halaman Sport. in persentase pilihan pembaca Waspada sbb: Gus Irawan 56%, Amri Tambunan 17%, Jawaban Problem Catur: Gatot Pujo Nugroho 16% RE Nainggolan 4%, Syah Afandin 1. BxGd7+, MxB. 2%, AY Nasution 2%, Chairuman Harahap 1%, Fadly Nur2. f6+, Kxf6. zal 1%, Cornel Simbolon 1%. 3. Be1+, Ke4. Panitia kembali mengimbau pembaca yang ingin ber4. BxK+, Rf6. partisipasi dalam mengang5. MxM, Bfd8. kat nama calonnya dapat mengisi kupon Gubsu Pilihan 6. Mg4 (mengantisipasi Pembaca Waspada yang terdapat di halaman Politik dan Bd1+mat dan Hukum, kemudian mengigerak lari Rg7). rimkan kupon itu ke Kantor Harian Waspada Jl. Brigjen Hitam menyerah. Katamso no. 1 Medan. Pengiriman kupon sebaiknya segera dilakukan karena tenggang Jawaban TTS: waktu tinggal 7 (tujuh) hari lagi. Isi kuponnya, naikkan poin TTS Topik Santapan Ramadhan kandidatnya dan raih hadiahnya. (tim)

Ada-ada Saja ...

Jawaban Sudoku: 2 5 7 9 6 4 1 3 8

3 9 1 8 7 5 6 4 2

6 4 8 3 2 1 9 5 7

1 8 9 4 5 2 3 7 6

7 3 4 1 8 6 2 9 5

5 2 6 7 3 9 8 1 4

9 7 2 6 4 3 5 8 1

4 6 3 5 1 8 7 2 9

8 1 5 2 9 7 4 6 3

Kepala kepolisian setempat, ACP K. Manoharan sebagaimana dilaporkan Bernama menyatakan, drama penculikan yang terjadi pada akhir bulan lalu. Insiden ini berlatar belakang hal sepele hanya karena remaja tersebut kecewa karena tidak dibelikan sepeda motor oleh orang tuanya. Anak itu kemudian pergi dan tidak pulang-pulang. “Sang ayah melapor ke polisi karena anaknya tidak pulang.” Manoharan mengatakan, esoknya, sang ayah menerima telepon dari seseorang yang meminta tebusan untuk anaknya. Uangituharusdiserahkandengan cara menyimpannya di belakang sebuah toko di Kuala Ibai. Sang ayah kemudian melakukan apa yang diperintah oleh penculik itu. Sang ayah lalu menemukan anaknya bersama seorang temannya di Kuala Ibai. Hasil penyelidikan polisi menemukan bahwa anaknya berpura-pura diculik supaya mendapatkan uang untuk membeli motor. (ini/rzl)

JAKARTA (Antara): Presiden Susilo BambangYudhoyono menyerukan umat Islam di Indonesia meningkatkan kesetiakawanan sosial dan kepedulian terhadap umat Islam di Palestina dan Rohingya di Myanmar yang saat ini tengah mengalami perikehidupan yang berat. Kepala Negara mengungkapkan hal itu saat memberikan sambutan dalam acara peringatan Nuzulul Quran tingkat nasional di Istana Negara, Selasa (7/8) malam. “Mari kita tingkatkan sikap sosial kesetiakawanan kita dan kepedulian kemanusiaan kepada kaum Muslimin yang sedang menjalani kehidupan yang berat di Palestina dan Rohingya di Myanmar dengan itu kita akan menjadi bangsa yang maju, terhormat dan bermartabat,” kata Presiden.

Presiden Yudhoyono juga menyerukan umat Islam untuk kembali kepada Alquran yang utuh, meningkatkan keimanan dan ketaqwaan dan menjauhkan diri dari kejahatan dan kemungkaran. Alquran tidak hanya berisi akidah, hikmah dan petunjuk antara yang hak dan batil, tetapi juga luasnya ilmu iptek, kata Presiden. Dalam kesempatan tersebut, Presiden juga kembali menyatakan perlunya untuk mengembangkan lima hal yang ia sampaikan sebelumnya dalam buka puasa bersama dengan kalangan pers. Kelima hal tersebut, pertama, perlunya mengembangkan daya pikir dan daya nalar. Kedua, pengembangan nilai-nilai demokrasi. Ketiga mengembangkan nilai kerukunan, kebersamaan dan toleransi. Keempat patriotisme dan nasionalisme yang

positif. Kelima kepatuhan kepada pranata hukum. Sementara itu, Menteri Agama Suryadharma Ali dalam sambutannya mengatakan, semangat Alquran harus memiliki nilai-nilai dalam kehidupan umat. “Dalam ekspresi keimanan, perlu didukung secara penuh oleh semua komponen bangsa yang semakin maju, modern dan bermartabat,” katanya. Dalam acara tersebut, Presiden Yudhoyono yang hadir tanpa Ibu Negara Ani Yudhoyono, didampingi oleh Wakil Presiden Boediono beserta istrinya Herawati Boediono. Sedangkan Rektor Universitas Islam negeri Maulana Malik Ibrahim, Malang, Imam Suprayogo menjadi penceramah dalam acara tersebut dengan tema Alquran membangun peradaban.

Kuburan Bayi Tewas Di Tangan Ibu Tiri Dibongkar TANJUNGBALAI (Waspada): Kuburan bayi diduga menjadi korban pembunuhan oleh ibu tirinya di Desa Seiapung Jaya, Kec. Tanjungbalai, Kab. Asahan, dibongkar petugas, Rabu (8/8). Pembongkaran makam almarhum Juanda Januari, berusia 1,7, bertujuan mengetahui kepastian penyebab kematian sebenarnya. Bukan hanya dibongkar, jenazah juga diautopsi oleh dokter forensik yang didatangkan dari Rumah Sakit Djasamen Saragih, Pematangsiantar. “Visum dari luar sudah ada, tetapi kita juga membutuhkan pemeriksaan dalam tubuh korban, sehingga dapat dipastikan penyebab kematiannya,” kata Kapolres Asahan Yustan Alpiani melalui Kanit Reserse Umum Iptu Triatno Pamungkas didampingi Aiptu Erwin. Dikatakan, tersangka pembunuh, MSL, 21, yang merupakan ibu tiri korban telah mengakui perbuatannya. Tersangka menghabisi nyawa bayi itu dengan cara mencekik dan menganiayanya. “Dari hasil visum memang ada bekas luka lecet di leher, tapi hasil autopsi bagian

Waspada/Rasudin Sihotang

DOKTER Forensik, Dr Reinhard Hutahaean, SH, SpF, (tiga kanan) mengangkat jenazah Juanda Januari untuk selanjutnya dilakukan otopsi, Rabu (8/8). dalam tubuh korban tetap kita butuhkan,” kata Erwin. Sementara, dokter forensik RSUD Djasamen Saragih, Dr Reinhard Hutahaean, SH, SpF, mengatakan pihaknya telah mengambil sampel jaringan tubuh korban. Selanjutnya akan dibawa ke Pematangsiantar untuk dilakukan patologi anatomi (peme-

JAKARTA (Antara): Polri mengatakan bahwa negara mengalami kerugian sebesar Rp300 miliar terkait proyek vaksin flu burung di Kementerian Kesehatan (Kemenkes). “Kerugian negara berdasarkan laporan BPK (Badan Pemeriksa Keuangan, red) kami akan kordinasi lebih lanjut dengan BPK terkait sekitar Rp300 miliar kerugian negara yang disampaikan kepada penyidik,” kata Kepa-

la Biro Penerangan Masyarakat Polri, Brigjen Pol Boy Rafli Amar di Jakarta, Rabu (8/8). “Sementara itu, dalam kasus ini penyidik Bareskrim Polri telah menetapkan tersangka berinisial TPS merupakan salah satu kepala di Ditjen Pengendalian Penyakit dan Penyehatan Lingkungan , “ katanya. Peran TPS sendiri selaku Pejabat Pembuat Komitmen (PPK) dalam proyek sebesar Rp718,8 miliar.

Dubes AS Tanggapi ...

yang berlaku. Pendapat Dubes Scot Marciel didukung oleh Sidney Jones, pengamat masalah Indonesia dari International Crisis Group (ICG). “Di Amerika masih ada sikap percaya yang kuat kalau pelaku kejahatan akan dihukum. termasuk dalam kasus pembakaran masjid di Missouri ini,” kata peneliti senior ICG itu dengan bahasa Indonesia yang fasih. Pembakaran Masjid Joplin diduga dapat menimbulkan kekhawatiran bagi komunitas muslim, menyusul sejumlah kekerasan terhadap tempat ibadah yang meningkat di Amerika Serikat akhir-akhir ini. Aksi pembakaran masjid dianggap merupakan bentuk dari prasangka negatif dan sikap fanatik yang berlebihan.

KPK Tetapkan ... Ketua KPK Abraham Samad dalam jumpa pers di gedung KPK, Jakarta, Rabu (8/8). Sebelumnya, KPK menetapkan tiga tersangka, yakni Bupati Buol Amran Batalipu dan dua petinggi PT HIP yaitu Gondo Sudjojo dan Anshori. Berdasarkan keterangan para tersangka, KPK melakukan pemeriksaan secara marathon, dua kali menjalani pemeriksaan hingga memakan waktu 12 jam itu kini ditetapkan menjadi tersangka suap penerbitan HGU perkebunan kelapa sawit di Sulawesi Tengah. Sejak awal, pemilik PT Hardaya Inti Plantation, Hartati berulang kali membantah dirinya memberi suap. Namun, KPK masih menunggu waktu untuk melakukan penahanan terhadap Hartati, karena penyidik tengah meram-pungkan kasusnya. “Mengenai penahanan, apabila diperlukan oleh penyidik atau apabila kasusnya sudah dianggap mendekati rampung maka yang bersangkutan akan ditahan seperti dengan tersangka-tersangka lain yang disidik KPK,” terang Abraham. (j02)

Gatot: Stop Impor ... dan Boby Ginting. Sementara jajaran Pemprovsu dihadiri Asisten Ekbang Provsu Hj Sabrina, Kadis Pertanian M Roem, Kadis Infokom Asren Nasution dan lainnya. Kebijakan tersebut menurut Gatot penting mengingat Sumut merupakan daerah surplus jagung nasional sehingga tidak membutuhkan impor jagung dari luar negeri maupun luar daerah. Dengan jumlah produksi 1,3 juta ton per tahun dan termasuk lima besar produsen jagung nasional, Sumut sangat mampu memenuhi kebutuhan lokal. Saat ini menurutnya terdapat sekitar delapan produsen pakan ternak unggas yang menggunakan jagung sebagai bahan pakan dengan kebutuhan jagung

Hari Ini 600 Bal ...

Proyek Flu Burung Rugikan Negara Rp300 Miliar

Dubes juga menolak bahwa hal itu merupakan bentuk ancamanterhadapkaumMuslimyang merupakan minoritas di AS. Menurut Dubes, pihak berwenang di AS akan terus berupaya untuk membongkar kasusnya dan jika tersangka pelaku pembakaran terhadap masjid tertangkap maka akan mendapat hukuman sesuai ketentuan undang-undang yang berlaku

Waspada/Amir Syarifuddin

PLT Gubsu Gatot Pujo Nugroho dan sejumlah stafnya foto bersama Komunitas Petani Jagung Karo yang beraudensi ke Rumah Dinas Gubernur, Selasa (7/8)

riksaan) dan hasilnya akan diberikan kepada penyidik. “Maaf,yarekan-rekan,hariini belum bisa dikonfirmasi hasilnya, karena masih ada tahapan yang harus kami lakukan seperti patologianatomidanituhanyabisa dilakukan di rumah sakit,” terang Reinhard yang didampingi sejumlah dokter muda. (a32)

5 Rumah Terbakar TANJUNGBALAI (Waspada): Lima rumah yang dihuni tujuh kepala keluarga di Jalan Baganasahan, Dusun IV, Desa Seiapung Jaya, Kec. Tanjungbalai, Kab. Asahan musnah dilalap si jago merah, Rabu (8/8) sekira pukul 02:00. Tidak ada korban jiwa dalam peristiwa itu, namun kerugian ditaksir ratusan juta rupiah. Penyebab api juga masih dalam penyelidikan namun dugaan sementara akibat korsleting listrik. “Lima unit mobil pemadam kebakaran dari Tanjungbalai diturunkan, sementara tiga unit lainnya didatangkan dari Kabupaten Asahan,” terang Samsul Bahri, kepala desa Dusun IV, Desa Sei Apung Jaya. Kades mengatakan, warga yang menjadi korban adalah M. Yakub, 42, Effendi Sihombing, 65, Syahrial, 35, Ucok Becak, 48, Icik 28, Sangkot, 31, ijul Dina, 25 dan Yus Mama, 30. Mereka telah didata untuk mendapatkan bantuan dari Pemkab Asahan. Kapolres Asahan AKBP Yustan Alpiani melalui Kapolsek Air Joman AKP Heri Tambun mengatakan, pihaknya masih menyelidiki penyebab kebakaran. (a32)

Hoy Terbaik Inggris ... Hoy, pemenang pada Olimpiade 2008 di Beijing, sukses mengalahkan Maximilian Levy (Jerman) dan Simon van Helthooven (Belanda). Kesuksesan Hoy ini seakan menjadi penutup yang manis dari kegemilangan atlet Inggris Raya di lintasan balap sepeda. Sepanjang enam hari perhelatan balap sepeda di London Velodrome, tuan rumah berhasil mendominasi dengan raihan tujuh emas, satu perak, dan satu perunggu. Sukses Roy juga seolah mempertegaskan euforia masyarakat Inggris Raya yang menyebut penyelenggaraan Olimpiade London sebagai musim panas emas. Dengan lima hari tersisa, Inggris Raya sudah mengumpulkan 22 medali emas dan total 48 medali dari 13 cabang. Tuan rumah mantap berada di posisi ketiga dan hanya kalah dari dua raksasa olahraga, China dan Amerika Serikat. “Ini sungguh menjadi musim panas emas bagi kontingen Inggris Raya dan seluruh negara kami,” kata Perdana Menteri Inggris, David Cameron. Itu merupakan raihan terbaik Inggris Raya sepanjang sejarah Olimpiade modern. Pada Olimpiade 1992 di Barcelona, Inggris merebut lima emas dan hanya satu pada Olimpiade 1996 di Atlanta. Pada Olimpiade 1908 di London, Inggris Raya mengumpulkan 56 emas dan menjadi juara umum. Namun kala itu pesta olahraga multievent ini belum semegah zaman sekarang karena hanya diikuti 22 negara. Akibat sukses Olimpiade 2012, Inggris Raya merencanakan parade akbar pada September mendatang. (m33/ap)

Al Bayan ... Bila Anda berhasil mempersunting seorang gadis cantik nan elok parasnya, bersyukurlah ke-pada Allah SWT karena Allah telah menjodohkan Anda dengan makhluk ciptaan-Nya yang menyenangkan kamu. Bimbinglah istrimu itu supaya takwa kepada Allah SWT. Kecantikannya itu milikmu seutuhnya, jangan biarkan mereka menjual aurat dan farajnya kepada lelaki lain. Betapa banyak pasangan artis yang ganteng dan cantik, tetapi harus berpisah di tahun pertama perkawinan mereka. Tidak ada lagi kemanisan perkawinan, sebab sang istri sudah menjadi perempuan tabaruj. Bila kamu izinkan istrimu memperdagangkan auratnya di depan umum, Allah akan mencabut kehangatan cinta antara dua hatimu. Istri akan membuat serong dan engkaupun akan

melakukan yang serupa. Tinggallah engkau berdua seperti rumput hijau yang tumbuh di kotoran lembu, meski hijau tak enak rasanya. Bila Allah memberi kepadamu keturunan, cetaklah anak-anakmu itu menjadi anak yang saleh. Jangan biarkan anakmu menjadi musuhmu, musuh agamamu dan musuh Allah karena dia tidak mewarisi keimanan. Wariskan iman dan takwa kepada anak-anakmu. Jangan engkau wariskan kekufuran dan kemunafikan. Mungkin juga kamu dimudahkan rezeki sehingga kalian dapat membeli kendaraan yang bagus. Bersyukurlah kepada anugerah itu. dan jadikanlah kendaraan itu untuk mencari ridha Allah. Misalnya pergi ke masjid, membantu tetangga, pergi ke kantor, dan menyambung tali silaturahmi. Itulah kehidupan yang baik dan berguna. Karena itu perbudaklah mobilmu itu, jangan sebaliknya kamu menjadi budak mobilmu.

Kamis (8/8), karena di sini kondisinya belum memungkinkan,” kata Kakan BC Teluknibung Rahmady Effendi Hutahaean didampingi petugas AgusYudha. Dikatakan, pakaian bekas impor dari Malaysia hasil penindakan itu merupakan barang tak bertuan, sehingga tak seorang pun yang ditetapkan jadi tersangka. “Tidak bisa diproses di pengadilan, karena tidak ada tersangkanya. Eksekusi barang ini berdasarkan surat keputusan Menkeu,” papar Agus. Diterangkan, seluruh pakaian bekas itu dibawa ke Medan menggunakan truk kontainer dengan pengawalan ketat dari polisi, Kodim dan TNI AL. Menurutnya, pihak BC tidak pernah memperbolehkan pakaian bekas masuk Indonesia. (a32)

sebesar 1 juta ton per tahun. Namun sebagaimana keluhan para petani, sering kali hasil panen jagung tidak diterima para produsen pakan ternak dengan alasan stok jagung impor mereka masih mencukupi. “Setiap panen pabrikan menolak jagung petani dengan alasan stok jagung impor di gudang masih cukup. Ini sungguh mengherankan, karena harga jagung impor justeru lebih mahal di banding harga jagung di tingkat lokal,” kataTekad Brahmana. Dengan adanya penolakan tersebut, menyebabkan produksi jagung petani tidak terse-

rap sehingga harganya juga menjadi turun. Saat ini harga jagung menurut petani Karo tersebut berada di kisaran Rp2.3002.500 per kilogram. Menurut Tekad, harga tersebut masih kurang menguntungkan para petani dan dia berharap harga jagung dapat bekisar di atas Rp3.000 per kilogram. Menanggapi hal tersebut, Gatot juga meminta agar dapat dijajaki kerjasama antara para petani dan produsen pakan ternak sehingga memutus rantai pemasaran dan dapat menguntungkan kedua belah pihak. (m28)

Pesta Berbuka ... organisasi amal harus mendapat izin dari departemen Al Mahmadi untuk membagi-bagikan makanan dan minuman untuk iftar di Masjidil Haram selama Ramadhan. Dia menambahkan: “Kami telah membentuk sejumlah komisi untuk menyelenggarakan iftar setiap harinya. “Kami telah menunjuk sejumlah pemantau untuk memeriksa makanan, terutama bagi makanan yang dimasak, sebelum dibagibagikan di antara para jamaah.” Lebih dari 500 pria dan pekerja wanita telah ditunjuk untuk melayani para Tamu Allah di Dua Masjid Suci selama Ramadhan, teristimerwa pada 10 hari terakhir bulan suci itu ketika jutaan orang memenuhi kedua masjid. AlMahmadi menyerukan kepada para jamaah agar bekerjasama dengan para pekerja dan pejabat masjid untuk memelihara kerapian dan kebersihan kedua masjid suci tersebut. (gn/an/mujo)

Obyek Vital ... Kapolresta Medan Kombes Pol Drs Monang Situmorang, SH, MSi, mengatakan, pengamanan itu dilakukan untuk mengantisipasi hal yang tidak diinginkan. Monang didampingi Kasat Narkoba Kompol Dony Alexander, SH, SIK, M.Hum, Kasat Reskrim Kompol M Yoris Marzuki, SH, SIK dan Kapolsek Medan Baru Kompol M Budi Hendrawan, SH, SIK, menyatakan, selain meningkatkan pengamanan obyek vital dan polisi meningkatkan patroli mengantisipasi aksi kejahatan jalanan dan geng kereta. Bahkan setiap Jumat malam, Sabtu malam dan Senin malam, dilakukan apel bersama yang diikuti personel Poldasu, Polresta Medan, Polsek, Brimob Poldasu, dan dibantu TNI dan Polisi Meliter (PM). Sedangkan, Pos Pengamanan (Pospam) sudah dirikan di sejumlah titik untuk mengantisipasi padat lalin dalam suasana hari Raya Idul Fitri. (m36)

Dua Barang Mencurigakan ... dipasangi garis polisi (police-line) dan polisi masih menjaga lokasi kebakaran tersebut. Sisa hio (dupa) perlengkapan sembahyang etnis Tionghoa ditemukan tim Labfor dari lantai II. Kapolsek Medan Area Kompol SonnyW Siregar kepada wartawan menyebutkan, api berasal dari lantai II. Di lantai II ruko milik korban terdapat dapur, tempat sembahyang serta beberapa barang elektronik. “Terlalu banyak barang elektronik termasuk genset di rumah milik korban di lantai dua dan jalur api juga berasal dari lantai dua. Indikasi kuat api berasal dari bara dupa (hio) dan kabel jaringan kabel listrik di lantai dua,” tutur Kompol Sonny. Sonny menjelaskan, tidak ada unsur kesengajaan dalam peristiwa kebakaran hingga merenggut empat nyawa penghuni rumah. “Hasil pemeriksaan kita bersama tim dari Labfor Polda dan tidak ada unsur kesengajaan. Saat ini pun saksi sudah dua orang yang kita mintai keterangannya. Sedangkan saksi dari keluarga korban belum bisa kita mintai keterangannya karena mereka masih dalam keadaan berduka,” ujar Sonny. Sebagaimana diberitakan sebelumnya, ruko berlantai III milik Suwandi alias Ng Ting Kuang ,63, yang terletak di Jalan Gandhi simpang Jalan Emas, Kel Sei Rengas II, Kec Medan Area, Selasa (7/8) sekira pk 04:15. Selain menewaskan Suwandi alias Ng Ting Kuang, kobaran asap tebal juga menewaskan istri korban bernama Poliana ,69, dan dua putranya Johan ,38, dan Johni 34. Mayat keempat penghuni rumah berkerangkeng besi itu, kini masih disemayamkan di ruang VIP Yayasan Sosial Angsapura Jalan Waja Medan. Korban Jiwa Rumah Kerangkeng Besi Peristiwa kebakaran dan ledakan yang terjadi dirumahberkerangkengbesiyangmayoritasdihuni etnis Tionghoa selalu menelan korban jiwa para penghuni rumah. Korban tewas umumnya karena terperangkap dan tidak bisa keluar menyelamatkan diri karena seluruh ruangan berterali besi, bahkan berlapis terali besi. Rumah kerangkeng besi yang terlalu over protektif yang justru membuat jebakan bagi penghuninya sendiri. Karena wilayah hukum Polsek Medan Area

mayoritas terdiri dari etnis Tionghoa, Kapolsek Medan Area Kompol Sonny W Siregar mengimbau, pemasangan alat keamanan yang terlalu over protektif itu sah saja, namun yang pasti penghuni rumah harus mempersiapkan hydrant, upayakan jalur evakuasi atau pintu darurat serta anggota keluarga harus dilatih dimana letak kunci pintu sehingga bisa keluar melalui pintu darurat. “Ketiga hal ini harus ada dalam sebuah rumah. Artinya, ketiga hal tersebut harus menjadi hal standart dalam sebuah rumah. Rumah milik Suandi alias Ng Ting Kuang sama sekali tidak memiliki ketiga hal itu. Akibatnya ya seperti inilah, isteri korban dan kedua puteranya tidak bisa menyelamatkan diri. Semua pintu dan jendela berterali besi,” terangnya. Selama 2012, beberapa rumah berkerangkeng besi yang mengalami kebakaran dan menelan korban jiwa sering terjadi di wilayah hukum Polresta Medan. Korban umumnya terperangkap tak bisa menyelamatkan diri lagi dan kemudian tewas sia-sia. Sebelum kebakaran di Jalan Gandhi yang menewaskan 4 orang itu, Minggu (1/1) sekira pk 04:00 kebakaran di Jalan Pukat V Gang Durian Kecamatan Medan Tembung. Dua orang penghuni rumah tewas luka bakar yakni ayah dari A Kien, Lim Kwek Kie serta seorang temannya dan dua orang mengalami luka bakar yaitu Sartoni dan Istrinya Dewi Nasution. Kemudian, dua bulan berikutnya, sekira pk 05:00 kebakaran maut berikutnya terjadi di Jalan Yos Sudarso, Pulo Brayan, Kec Medan Barat, tepatnya di toko elektronik Brayan Jaya. Tujuh penghuni rumah tewas terbakar dan seorang pembantunya selamat meski sempat trauma. Mereka yang tewas 7 orang yakni Ng Tji A Tju,80, Ana,39, Chelsea,14, Chelson,11, Chelster,8, serta Amei dan Yong Fan dua warga Rantau Parapat yang bekerja di Taiwan, dan satu korban kritis yakni Alfrin Boru Sitanggang ,22, yang tak lain pembantu rumah tangga (PRT) di ruko tersebut. Selanjutnya ledakan tabung gas juga terjadi di ruko Jalan Bambu I Kelurahan Durian, Kec Medan Timur pada Sabtu (24/4). Korban Ali alias Atong,32, yang menderita luka bakar dan sempat dilarikan ke rumah sakit di Malaysia. Beberapa hari dirawat, korban akhirnya meninggal dunia. (h04)


WASPADA Kamis 9 Agustus 2012

Medan Metropolitan

A3

JALUR KHUSUS KORBANKAN PENGGUNA JALAN

Ratusan kendaraan bermotor terjebak macat di ruas Jln. Jalan Thamrin Medan, Rabu (8/8) sore. Para pengguna jalan ini menjadi korban diskriminasi setelah Dinas Perhubungan memberikan keistimewaan berupa jalur khusus untuk pengantar atau penjemput siswa Perguruan Sutomo. Jalur khusus yang berada lajur kiri ruas Jln. Thamrin ini, telah dimanfaatkan para penjemput siswa Perguruan Sutomo untuk memarkirkan mobilnya hingga berlapis empat dan lima. Meski telah terjadi kemacatan lalulintas, namun tidak terlihat petugas Sat Lantas Polresta Medan dan Dinas Perhubungan Kota Medan berada di lokasi untuk membubarkan parkir berlapis tersebut.

Waspada/Hamdani

Mesin Pengolahan Semen Curah Harus Dibongkar Wali Kota: Sat Pol PP Bukan Hanya Mengawasi, Tapi Menutup Industri Itu MEDAN (Waspada): Meski Wali Kota Medan Rahudman Harahap telah menginstruksikan Kasat Pol PP dan Kadisperindag Kota Medan menutup industri pengolahan semen curah di Jln. Irian Barat/Jln. Jawa, Kecamatan Medan Timur, namun pihak pengusaha tetap membandel. Pantauan Waspada di lapangan, Kamis (8/8), industri pengolahan semen curah itu tetap beroperasi. Sedangkan puluhan anggota Sat Pol PP Pemko Medan yang diturunkan ke lokasi, tidak mampu meng-

hentikan aktivitas industri tersebut. Sejumlah truk pengangkut semen curah terlihat keluarmasuk lokasi industri tersebut. Alat berat jenis beko dan mesin pengolahan semen curah masih tetap melakukan aktivitasnya seperti biasa. Ini membuktikan bahwa pihak pengusaha telah mengabaikan instruksi Wali Kota Medan. Lemahnya kinerja Kasat Pol PP dan Kadisperindag yang tidak berani menutup industri pengolahan semen curah tersebut, membuatWali Kota Medan Rahudman Harahap hilang kesabaran. “Industri pengolahan

semen curah itu harus ditutup. Tidak ada alasan bagi mereka untuk beraktivitas lagi, karena tidak ada izinnya,” tegas Rahudman, Kamis (8/8). Menurut Rahudman, pihaknya sengaja mengerahkan puluhan anggota Sat Pol PP ke lokasi untuk menutup industri pengolahan semen curah tersebut. Jadi, keberadaan anggota Sat Pol PP bukan hanya mengawasi, tapi menutup industri itu dan membongkar seluruh mesin pengolahan semen curah. “Satpol PP ditugaskan berjaga-jaga di lokasi industri pengolahan semen curah pada siang dan malam hari. Tujuannya,

IPK Petisah Tengah Bantu Panti Asuhan MEDAN (Waspada): Ikatan Pemuda Karya (IPK) Ranting Petisah Tengah, Kec. Medan Petisah, salurkan bantuan ke Panti Asuhan Ade Irma Suryani Jln. Cik Ditiro, dan Panti Asuhan Terimakasih Jln. Danau Singkarak, Selasa (07/08). Bantuan paket sembako berupa beras dan mi instan masing-masing 350 kg beras dan 36 kotak indomie tersebut diserahkan langsung oleh Ketua IPK Ranting Petisah Tengah M Ali

Hanafi (Mohan) beserta unsur pimpinan seperti Sekretaris Agus Saragih, Bendahara Aris, Wakil Ketua Josep, Humas Fadjrinur ST, serta beberapa anggota. Turut hadir menyaksikan penyerahan tersebut unsur pengurus IPK PAC Petisah dan DPD IPK Medan. Ali Hanafi meminta kepada pengurus panti untuk menyalurkan bantuan tersebut kepada orang yang berhak menerimanya. Dia berharap agar anak-

anak yatim yang tinggal di panti asuhan untuk tetap tabah dan bersabar menerima cobaan hidup dari Tuhan Yang Maha Esa. “Orang boleh kehilangan orangtua dan keluarga, tapi kita tidak boleh kehilangan Allah, Tuhan Yang Maha Esa yang telah menjaga kita selama ini. Allah tidak boleh hilang dari kehidupan kita agar kita mendapat rahmat dan ridho Nya,” katanya.(m24)

agar industri pengolahan semen curah tersebut tidak bisa beroperasi lagi, termasuk pada malam hari. Jadi, anggota Sat Pol PP harus menutup total industri tersebut, bukan hanya sekadar mengawasinya,” tambah Rahudman. Sementara itu, Kasat Pol PP Kota Medan Sofyan ketika dikonfirmasi Waspada mengatakan, pihaknya sudah turun ke lokasi industri pengolahan semen curah sesuai perintah Wali Kota Medan Rahudman Harahap untuk melakukan pengawasan. “Industri itu tetap beroperasi, namun untuk kebutuhan pihak pengembang (Central Point),” katanya. Mengenai perintah wali kota agar menutup industri pengolahan semen curah tersebut, Sofyan tidak bisa memastikan kapan dilakukan penutupan. “Memang saat ke lokasi bersama Lurah setempat, kita menjumpai pihak manajemen perusahaan dan mempertanyakan legalitas industri tersebut. Namun mereka tidak bisa memperlihatkannya. Mereka berdalih izin industri tersebut menumpang pada pihak pengembang,” jelasnya. Mengenai kepastian ditutup atau tidak, silakan bertanya ke-

pada Asisten Pemerintahan (Aspem). “Pihak Pemko Medan melalui Aspem sudah mengundang pihak industri pengolahan semen curah. Jadi, untuk penindakkannya, beliau lebih paham,” kata Sofyan.

Di tempat terpisah, Aspem Daudta P Sinurat mengakui telah mengundang pihak manajemen industri pengolahan semen curah. Dalam pertemuan itu, Pemko Medan mempertanyakan izin operasi dan pro-

duksi semen curah. Namun pihak manajemen tidak bisa memperlihatkan izinya. “Pihak manajemen tidak bisa memperlihatkan izinnya. Kata mereka, izinnya sama dengan izin pembangunan

proyek yang berada di sebelah industri pengolahan semen curah itu. Hal ini tidak bisa dibenarkan karena izin proyek tidak sama dengan izin operasi industri pengolahan semen curah,” tegas Daudta.(m50)

Warga Rohingya Tamu Yang Harus Dilindungi MEDAN (Waspada): Suasana haru menyelimuti tempat penampungan pengungsi asal Rohingya, Myanmar di Jln. Pasar III, Medan, Senin (6/8). Saat kunjungan Ketua Umum Badan Koordinasi Kesejahteraan Sosial Sumatera Utara Sutiyas Handayani Gatot Pujo Nugroho, 156 warga muslim yang terusir dari negerinya itu tak sanggup menahan air mata. Di depan istri Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, warga Rohingya menuturkan penderitaan mereka. Mulai dari penyiksaan yang dialami saat di Myanmar, hingga susahnya memperoleh status pengungsi. Sebagian pengungsi tak kuasa menangis ketika salah seorang bercerita dan memanjatkan doa keselamatan untuk sau-

dara-saudaranya yang masih berada di Myanmar. Pada Senin petang kemarin, Sutyas hadir bersama anggota DPR RI Helrini Amran, Ketua DPD PKS Medan Azhar Arifin LC, dan Kepala Divisi Kumham Jumanter Lubis SH. Kepala Divisi Kumham Jumanter Lubis menjelaskan, saat ini di Sumatera Utara terdapat 156 pengungsi dan pencari suaka asal Rohingya, Myanmar. 130 orang di antaranya sudah berstatus sebagai pengungsi dan sedang menunggu diberangkatkan ke negara ketiga oleh UNHCR. Sementara 26 orang masih berstatus sebagai pencari suaka dan ditampung di Rudenim Belawan. Di antara para pengungsi dan pencari suaka itu terdapat 28 anak-anak. “Kita akan beri-

kan fasilitas sesuai kemampuan kami dan terus berkoordinasi dengan UNHCR dan IOM agar mereka dapat segera memperoleh statusnya,” kata Jumanter. Anggota DPR RI Helrini Amran menjelaskan, kedatangannya ke tempat penampungan pengungsi ini adalah untuk mengetahui apa yang sebenarnya terjadi. “Kami mengutuk keras pembantaian di Rohingya, Myanmar. Karena itu kami akan konsen untuk memperjuangkan masalah ini,” ujarnya. Sementara itu, Sutiyas di depan para pengungsi dan pencari suaka itu menuturkan, Pemerintah Provinsi Sumatera Utara, akan berusaha sekuat tenaga membantu dan menyediakan fasilitas sesuai kemampuan dan wewenang Pemprovsu sampai mereka memperoleh status dari

UNHCR. ”Warga Rohingya meski pengungsi dan pencari suaka pada dasarnya adalah tamu kami. Karenanya kita akan sekuat tenaga melayani dan memberikan bantuan juga perlindungan,” sebutnya. Pada kesempatan itu Sutiyas langsung menyalurkan bantuan untuk para pengungsi Rohingya. Bantuan yang diberikan berupa peralatan perawatan bayi, seperti selimut, pakaian, popok bayi, botol susu, dan perlak. Kegiatan kunjungan ini diakhiri dengan buka puasa bersama dan shalat Mahgrib berjamaah. Usai shalat Mahgrib, Sutiyas memberikan hadiah kejutan masing-masing sebesar Rp1 juta untuk tiga warga Rohingya yang sanggup menghafal Alquran 30 juz. (m28)

Waspada/Amir Syarifuddin

KETUA Umum Badan Koordinasi Kesejahteraan Sosial Sumut Hj Sutiyas Handayani Gatot Pujo Nugroho buka bersama warga Rohingya di pengungsian Jalan Pasar III Medan.


A4

Medan Metropolitan

WASPADA Kamis 9 Agustus 2012

Soal Tuduhan Jual-Beli Kursi Di Unimed

Rektor: Penzoliman Terhadap Lembaga Pendidikan MEDAN (Waspada): Rektor Universitas Negeri Medan (Unimed) Prof. Dr. Ibnu Hajar Damanik, Rabu (8/8), memberi penjelasan terkait kasus dugaan percaloan dalam Seleksi Lokal Masuk Perguruan Tinggi Negeri (SLMPTN) ke Unimed. “Informasi jual-beli kursi di Unimed merupakan fitnah dan sebuah penzoliman terhadap lembaga pendidikan,” kata Prof Ibnu Hajar Damanik kepada wartawan di Ruang Sidang Unimed. Didampingi, Pembantu Rektor I Unimed Prof Khairil Ansari, Pembantu Rektor II Chairul Azmi, Kabag Humas Tappil Rambe, rektor menegaskan, siapa saja yang memiliki bukti autentik terkait tuduhan jual-beli kursi itu, silahkan laporkan ke pihak terkait. “Kami siap menghadapi persoalan ini dalam bentuk apapun. Jika ada petinggi atau siapa saja pejabat Unimed terbukti melakukan percaloan, akan ditindak tegas secara internal dan diproses secara hukum, “ tegas rektor. Rektor mengatakan, pihaknya tidak pernah mendukung segala perbuatan yang merusak citra Unimed sebagai lembaga pendidikan. “Unimed ini bukan milik saya atau pejabat lainnya, tetapi milik masyarakat Sumut. Jadi jangan karena kepentingan pribadi atau golongan tertentu, Unimed dizolimi, “ ujarnya. Dalam kasus ini, rektor menegaskan, pihaknya akan menyampaikan klarifikasi atau hak jawab atas pemberitaan di sejumlah media massa. “Mengenai upaya hukum, kami akan melakukan koordinasi terlebih dahulu dengan penasehat hukum Unimed,” tambahnya. Terkait persoalan ini, lanjut rektor, sebelum ujian SLMPTN Unimed digelar, pihaknya telah menyampaikan kepada wartawan, tidak ada praktik percaloan atau sejenisnya .”Saat itu saya sampaikan, jika ada temuan oleh siapa saja tanpa terkecuali wartawan, segera sampaikan kepada kami dan pasti ditindaklanjuti serta diserahkan ke polisi,” tegasnya. (m49)

Tok Ai Telah Tiada

Waspada/ME Ginting

WALI Kota Medan Rahudman Harahap didampingi Wakil Wali Kota Medan Dzulmi Eldin saat memeriksa produk minuman kemasan di pusat perbelanjaan Carrefour, Rabu (8/8).

Awas Makanan Kadaluarsa Rahudman Sidak Ke Pusat Perbelanjaan MEDAN (Waspada): Menjelang perayaan Idul Fitri 1433 H, masyarakat Kota Medan diminta mewaspadai produk makanan dan minuman kadaluarsa yang diduga masih beredar di pasaran. Guna mengantisipasi adanya produk makanan dan minuman kadaluarsa yang dijual kepada masyarakat, Wali Kota Medan Rahudman Harahap bersama Tim Pengendali Inflasi Daerah (TPID) Kota Medan melakukan inspeksi mendadak (si-

dak) di pusat perbelanjaan Carrefour Jln. Jamin Ginting dan Irian Jln. Marelan Raya, Rabu (8/8). Dalam sidak tersebut, Rahudman langsung memeriksa kue kering dalam kemasan yang banyak diminati masyarakat untuk perayaan Idul Fitri. Setelah itu, Rahudman juga melihat proses pengemasan daging ayam dan sapi. Dilanjutkan dengan pemeriksaan sejumlah makanan dan minuman dalam kemasan kaleng. “Setelah kita lakukan pemeriksaan, ternyata seluruh maka-

nan dan minuman yang dijual layak dikonsumsi. Makanan dan minuman hasil produksi Usaha Mikro Kecil dan Menengah (UMKM) ini, saya lihat sudah cukup baik. Selain diberi kemasan, produk itu juga sudah diberi label halal dan memiliki tanggal kadaluarsanya sehingga benar-benar layak konsumsi. Begitu juga dengan daging dan ikan yang dijual, masih segarsegar,” kata Rahudman. Di sela-sela sidak, Wali Kota Medan menyempatkan diri berkomunikasi dengan sejumlah warga terkait harga dan kualitas

barang. Umumnya warga mengaku nyaman karena Pemerintah Kota Medan melakukan pengawasan secara ketat terhadap produk makanan dan minuman yang beredar di pasaran. Sebelum meninggalkan lokasi, Rahudman didampingi Wakil Wali Kota Medan Dzulmi Eldin, Dewan Kota Afifuddin Lubis serta sejumlah SKPD terkait, sempat membeli ubi bakar. Ketika melakukan transaksi pembayaran, orang nomor satu di Pemko Medan itu rela antri di belakang pengunjung lainnya.

Setelah itu,Wali Kota Medan beserta rombongan menuju Jln. Marelan Raya. Di kawasan itu, para pejabat Pemko Medan ini memeriksa produk makanan dan minuman yang dijual di pusat perbelanjaan Irian. Sebuah parsel yang dipajang dekat pintu masuk, langsung diperiksa guna memastikan produk makanan dan minuman di dalam bingkisan Lebaran itu, benar-benar layak konsumsi. Dari hasil pemeriksaan, produk makanan dan minuman dalam parsel tersebut dinyatakan layak konsumsi. Pemerik-

saan dilanjutkan terhadap makanan dan minuman kemasan. Hasilnya, tidak ditemukan adanya produk kadaluarsa. Rahudman mengatakan, pihaknya ingin membuktikan bahwa kehadiran pasar murah di 151 lokasi dan operasi pasar yang dilakukan Pemko Medan membuat harga bahan kebutuhan pokok di pasaran tetap stabil sehingga tidak meresahkan warga. Artinya, jika kebutuhan pokok masyarakat terjamin, maka hal itu sangat mempengaruhi kamtibmas di Kota Medan. (m50)

Ratusan Anggota Satpol PP Mengeluh Gaji Dipotong Rp100 Ribu MEDAN (Waspada): 340 Anggota Satpol PP yang bertugas di lingkungan Pemko Medan mengeluh karena gaji mereka pada bulan Juli 2012 dipotong sebesar Rp100 ribu. Pemotongan itu dengan dalih untuk kesejahteraan anggota dan membentuk koperasi. Yang membuat mereka resah, pemotongan itu dilakukan menjelang perayaan Idul Fitri. “Tadi saya mengambil gaji, ternyata langsung dipotong sebesar Rp100 ribu. Gaji kami hanya Rp1,3 juta, dipotong pula lagi. Bagaimana kami mau merayakan Idul Fitri ini,” kata seorang anggota Satpol PP yang bertugas di Pemko Medan

kepada Waspada, Rabu (8/8). Menurutnya, kebijakan pemotongan itu belum pernah disosialisasikan oleh Kasat Pol PP. Pemotongan itu baru diketahui setelah mereka mengambil gaji. “Kami sama sekali tidak tahu tentang rencana pembentukan koperasi. Bagaimana aturannya, tujuannya dan siapa pengurusnya, kami juga tidak tahu.Tiba-tiba saja dipotong Rp100 ribu oleh bendahara,” katanya. Anggota Satpol PP di Pemko Medan lainnya juga mengaku terkejut setelah mengetahui gajinya dipotong. “Saya terkejut sekali karena tidak ada pemberitahuan terlebih dahulu kepada kami tentang kebijakan pemo-

tongan gaji ini. Kami baru mengetahuinya saat mengambil gaji yang langsung dipotong tanpa ada pemberitahuan. Kata bendahara, pemotongan Rp100 ribu atas perintah Kasat Pol PP untuk pembentukan koperasi. Bahkan, pemotongan itu tanpa menyertakan kuitansi. Kami khawatiruangyangdipotongitutidak jelas penggunaannya,” ujarnya. Ketidakjelasan alasan pemotongan gaji mereka inilah yang membuat 340 anggota Satpol PP di lingkungan Pemko Medan menjadi resah. Apalagi, status mereka masih honorer semakin meresahkan. Jika mereka tidak bekerja lagi, maka kemana mereka menutut uang

pemotongan gaji tersebut. “Kami ini kan honorer. Kalau kami tidak bekerja lagi, maka gaji kami yang dipotong itu, mau kami tuntut ke mana? Sementara kuitansi apapun tidak ada,” katanya. Sementara itu, Kasat Pol PP Kota Medan M. Sofyan ketika dikonfirmasi Waspada mengakui adanya pemotongan gaji tersebut. “Itu saya lakukan untuk peningkatan kesejahteraan anggota. Caranya, dengan membentuk koperasi. Kita juga sudah mengundang Dinas Koperasi dan UKM. Saat ini, kita sedang mengurus badan hukumnya,” kata Sofyan. Dengan pembentukan ko-

perasi ini, menurut Sofyan, maka anggota Satpol PP yang meninggal dunia akan menda-patkan uang duka, anggota yang membutuhkan sembako dapat membelinya di koperasi dengan harga bersaing.Bahkanjikaadaanggota yangsangatmembutuhkanuang, dapat meminjam di koperasi. Di a m e n g a k u i b e l u m melakukan sosialisasi kepada seluruh anggota, terutama yang bertugas di luar kantor. “Saya mengakui sosialisasi masih kurang. Pemotongan itu sebesar Rp100 ribu, dengan rincian Rp50 ribu untuk uang pangkal koperasi dan Rp50 ribu untuk uang rutin koperasi. Selanjutnya, setiap anggota membayar

Rp50 ribu per bulan untuk uang rutin koperasi,” jelas Sofyan. Dengan pemotongan itu, saat ini sudah terkumpul sekitar Rp34 juta untuk dana awal pembentukan koperasi. “Dana yang sudah terkumpul ini kami gunakan untuk uang membentuk koperasi. Kalau koperasi sudah berjalan, tentu akan banyak pihak ketiga yang akan membantu,” tambahnya. Disinggung soal badan hukum koperasi itu, Sofyan mengatakan, saat ini sedang dalam proses. “Setiap anggota akan mengisi formulir. Nantinya akan ada AD/ART dan badan hukumnya yang sedang kita proses,” demikian Sofyan. (m50)

PRIA berperawakan kekar itu, kini telah tiada. Dia menghembuskan nafas terakhir di RSUP H. Adam Malik Medan pada Rabu (8/8) dinihari, setelah menjalani perawatan sekitar 17 hari. Dia adalah Dahri Uhum Nasution atau lebih dikenal masyarakat dengan sebutan Tok Ai. Almarhum merupakan sosok seniman, humoris serta jurnalis. Di masa lalu, lelaki kelahiran Kota Medan, 20 April 1951 ini mengawali karirnya dan mulai dikenal masyarakat ketika tampil di TVRI Stasiun Medan. Maklum, saat itu hanya satu stasiun televisi di Provinsi Sumatera Utara. Ternyata dari berbagai penuturan sahabat, kerabat dan sejawat almarhum, pria humoris yang mempunyai selera humor cukup aktif tersebut, selain dikenal sebagai seniman yang berkecimpung di Dewan Kesenian Sumatera Utara (DKSU) juga pernah berprofesi sebagai guru dan wartawan (jurnalis). Karena itu, tidak mengherankan jika almarhum memiliki kawan yang cukup banyak. Penuturan putra tertua almarhum, yakni Dahniel Umbara Nasution, ayah mereka sempat menderita penyakit komplikasi. Sebelumnya sempat dirawat di RS Bangkatan Binjai. Kemudian atas saran dokter, perawatannya dipindahkan ke RSUP H. Adam Malik Medan. ‘’Ternyata Allah berkehendak lain. Setelah ayah menjalani perawatan di RSUP H. Adam Malik, pada Rabu (8/8) dinihari, almarhum menghembuskan nafasnya yang terakhir. Dia meninggalkan ibu kami Umi Salmiwijaya, lima anak dan sembilan cucu,’’ papar Dahniel. Dalam pergaulan sehari-hari, semasa hidupnya Tok Ai dikenal sebagai sosok yang sangat sederhana namun cepat akrab dengan siapa saja. Meski baru kenal, namun almarhum menganggapnya sudah lama berkenalan sehingga terlihat akrab. Jenazah almarhum dibawa dari RSUP H. Adam Malik Medan ke rumah duka di Jln. Rakyat/Jln. Durung. Banyak rekan dan sahabat yang datang melayat. Jenazah almarhum dishalatkan di Masjid Ar-Rahman Jln. Rakyat dan dimakamkan di perkuburan Islam Jln. Mabar, Medan. Di antara pelayat yang sempat ditemui Waspada yakni mantan anggota DPRDSU Efendi Naibaho. Dia mengaku banyak mengetahui sepak terjang Tok Ai semasa hidupnya. ‘’Lebih 30 tahun aku mengenal Dahri Uhum alias Tok Ai. Dia adalah sosok pria yang enerjik, serius dan gigih. Namun masih banyak ide beliau yang belum terlaksana dan terwujud,’’ ujarnya. Naibaho pun mengenang almarhum yang sempat dijebloskan ke dalam penjara karena tulisan dan pemberitaan yang dibuatnya selaku wartawan. ‘’Seharusnya, Tok Ai itu tidak perlu sampai dijebloskan ke penjara karena cuma pemberitaan,’’ tambahnya. Beberapa waktu belakangan ini, Tok Ai aktif di Star Radio milik Star Grup. Almarhum pernah bertugas sebagai wartawan Harian Garuda. Dalam kehidupan sehari-harinya, almarhum dikenal sangat setia kawan, idealis dan tidak pernah mengeluh meski kehidupannya terbilang sederhana. Sedangkan mantan Ketua Umum DKSU Jose Rizal Firdaus yang turut melayat almarhum menuturkan kepada Waspada, Tok Ai pernah menjabat sebagai Sekretaris Umum DKSU. Almarhum memulai karirnya di dunia seni budaya pada Teater Nasional (Tena) Medan. Di Tena itu, dia bersama Burhan Piliang (almarhum), Sori Siregar dan lainnya. Almarhum meninggalkan lima anak, yakni Dahniel Umbara Nasution, Ramdevi Asih Nasution, Dien Citra Sani Nasution, Sahar Jana Fitri dan Indra Dafaldi Nasution. Sedangkan sang isteri yang ditinggalkan adalah Umi Salma Wijaya, berikut sembilan cucu. Selamat jalan abang kami…sahabat kami….sejawat kami. Semoga arwahmu diterima Allah disisiNya. Amin. Feirizal Purba

ALMARHUM Dahri Uhum Nasution alias Tok Ai, semasa hayatnya bersama sang istri.


Medan Metropolitan Jalur Udara, Laut Dan Darat Aman Dilintasi Mudik Lebaran

A5

WASPADA Kamis 9 Agustus 2012

Waspadai Sejumlah Lokasi Rawan Longsor MEDAN (Waspada): Walau kondisi cuaca, iklim dan gempa bumi tidak dapat terdeteksi di luar teori dan kajian ilmiah serta perkiraan manusia, namun secara umum disimpulkan jalur udara, laut maupun darat aman untuk dilintasi pada saat mudik Lebaran yang mulai berlangsung sejak pekan ini. Kepala Balai Besar Meteorologi, Klimatologi dan Geofisika (BBMKG) Wilayah I Drs Herry Saroso melalui Kepala Sub Bidang Pelayanan Bidang Jasa Heron Tarigan mengatakan, sifat hujan bervariasi mulai dari normal hingga atas normal di Agustus 2012. ”Sifat normal dan atas normal antara lain terjadi di sebagian besar wilayah Asahan, Deliserdang, Langkat, Binjai, Sergai, Simalungun, Pematangsiantar, Medan, Taput, Tapsel, Tapteng, Labuhan Batu, Madina, Dairi

dan Nias, Tanjung Balai, Asahan, Karo,” katanya didampingi Denni Simamora mewakili Kadis Kominfo Dr H Asren Nasution dalam temu pers di Kantor Dinas Kominfo Sumut, Selasa (7/8). Sementara untuk prakiraan cuaca lautan, diprediksi perairan Nias-Mentawai mengalami gelombang tinggi mencapai sekitar 2,5 m ke arah Tenggara hingga Barat Laut. Kondisi cuaca laut menurut pihaknya buruk dan agak buruk. Sementara pasang surut air Belawan mencapai ketinggian sekitar 2,5 m, Gunung Sitoli 1,3 m dan Sibolga 1,3 m. Sementara Lhokseumawe sekitar 1,25 m. ”Di Agustus ini harus tetap ditingkatkan kewaspadaan untuk kegiatan pelayaran laut khususnya kapal-kapal kecil dan tongkang di Perairan Nias Mentawai, Perairan Aceh, Samudra Hindia Barat Sumatera karena tinggi gelombang sekitar 3 m,” ujarnya. Namun, lanjut Heron, pe-

Terkait Klaim JPKMS

DPRD Medan Minta 12 Rumah Sakit Diaudit MEDAN (Waspada): Wakil Ketua DPRD Medan, Senin (6/8), menyetujui pembentukan panitia khusus (Pansus) untuk menangani berbagai persoalan pelayanan dan penggunaan anggaran oleh Dinas Kesehatan Kota Medan. Langkah Wakil Ketua DPRD Medan Ikrimah Hamidy, ST, MT ini diambil terkait kecurigaan anggota DPRD Medan terhadap klaim dana Jaminan Pemeliharaan Kesehatan Medan Sehat (JPKMS) senilai Rp 25 miliar pada tahun 2011. KomisiBDPRDMedanmemintaagar12rumahsakityangmenjadi provider JPKMS yang mengajukan klaim sebesar Rp 25 miliar melalui Dinas Kesehatan Kota Medan, diaudit secara independen. Sebelumnya, Ketua Fraksi PDI Perjuangan Hasyim, SE yang melontarkan kecurigaan terhadap besaran klaim JPKMS tersebut. Kecurigaan yang sama juga dilontarkan Komisi B DPRD Kota Medan. “Klaim JPKMS itu patut dipertanyakan. Karena jumlah provider JPKMS hanya 12 rumah sakit, sementara jumlah diklaim sangat besar dan tidak sesuai dengan tingkat pelayanan. Hal ini yang patut dipertanyakan,” kata anggota Komisi BDPRD MedanT Bachrumsyah. Bachrumsyah meminta agar ada pihak berkompeten melakukan audit atau pemeriksaan terhadap klaim 12 rumah sakit yang menjadi provider JPKMS. Munculnya klaim JPKMS berawal dari klaim rumah sakit ke Dinas Kesehatan Kota Medan.(m30)

ringatan dini banjir direkomendasikan pihaknya untuk semua daerah aliran sungai (DAS). Khusus untuk DAS Batang Natal, Blumai, Percut, Belawan, Wampu dan Taput masuk dalam kategori tingkat bahaya banjir tinggi. “Memang kita semua harus tetap waspada,” katanya. Peringatan dini longsor, juga dikeluarkan pihaknya, terutama untuk kategori bahaya tingkat tinggi yakni meliputi Tapanuli Utara (Pahae Julu, Pahae Jae, Sibrongborong dan Adian Koting), Humbahas (Lintong Ni Huta), Tobasa (Porsea dan

Silaen), Samosir (Onan Runggu, Palipi), Tapsel (Dolok, Batang Angkola), Dairi (Sumbul, Parbuluan, Pegangan Hilir, Siempat Nempuh Hulu, Siempat Nempuh, Tiga Lingga Pinem dan Silima Punggapungga). Kemudian Simalungun (Girsang Sipangan Bolon, Sidamanik, Dolok Pardamean dan Purba), Karo (Mardinding), Nias (Hiliduho, Gunung Sitoli dan Mandrehe), Nias Selatan (Lahusa, Lolowu dan Teluk Dalam), Deliserdang (Bangun Purba, Sibirubiru, Sibolangit, STM Hilir dan STM Hulu), Pakpak Bharat (Kerajaan dan Salak).

Ditambahkannya, angin kencang selama Agustus ini berada pada kecepatan sekitar 30 knots dan diprediksi berpeluang terjadi di Asahan, Simalungun, Labuhan Batu, Tobasa, Medan, Deliserdang, Langkat, Tebingtinggi, Pematangsiantar, Tapsel, Taput dan Humbahas. Selain itu, suhu udara maksimum untuk wilayah pesisir mencapai 34 derajat, terutama di daerah perkotaan. Kondisi ini membuat udara terasa gerah. Kemudian di wilayah pegunungan, suhu udara maksimku 28 derajat pada pada umumnya terasa aman.(m28)

Pemain Judi Poker Zynga Dituntut 7 Bulan Penjara MEDAN (Waspada): Sebelas terdakwa perkara perjudian lewat Facebook dituntut masing-masing 7 bulan penjara pada persidangan di Pengadilan Negeri (PN) Medan, Rabu (8/ 8). Tujuh di antaranya merupakan pemain game poker di jejaring sosial itu, empat lainnya operator dan kasir yang menjualbelikan chip permainan. Ketujuh pemain poker via Facebook yang dituntut dalam persidangan ini masing-masing KesumaWijaya Sidauruk, M Nasir alias Aldo, Eman alias Liang Sun, Hendry alias A Hen, Haris Pratama Putra, A Seng alias A Sen alias M Ikhsan, dan M Zulfikar. Empat lainnya adalah kasir warnet, yaitu Edi alias A Wi dan tiga operator pentransfer chip yaitu Bun Seng alias A Seng, Herwin alias A Cong, dan Deni Anggriawan. Mereka ditangkap Polda Sumut di Warnet Supernet milik The Tjong alias Tony

di Kompleks Asia Mega Mas Medan, pada 9 April 2012. Jaksa Penuntut Umum (JPU) Sani Sianturi dan Juliana Tarihoran menyatakan, 11 terdakwa bersalah melanggar pasal 303 ayat (1) ke-1 KUHPidana. “Meminta majelis hakim menjatuhkan pidana tujuh bulan penjara dipotong masa tahanan kepada masing-masing terdakwa,” kata Juliana saat membacakan tuntutannya di hadapan majelis hakim yang dipimpin Agus Setiawan. Jaksa meminta agar barang bukti uang tunai Rp7 juta disita negara. Sedangkan 33 unit komputer, catatan, dan kartu perdana yang turut diamankan dari Warnet Supernet dimusnahkan. Setelah mendengarkan tuntutan JPU, Hakim Agus Setiawan memberi kesempatan kepada terdakwa menyampaikan pendapatnya. Para terdakwa yang hampir empat bulan dita-

han di Rutan Tanjung Gusta ini, langsung berdiri dan serentak memohon agar diberi keringanan hukuman. Mendengar permohonan ini, Hakim Agus bertanya, “Semua minta keringanan, tidak ada yang minta dibebaskan? Kalau minta keringanan berarti mengaku bersalah atau semua ini mengaku bersalah. Yang merasa tidak bersalah angkat tangan,” pintanya. Mendengar perintah itu, para terdakwa hanya diam. Hakim Agus Setiawan langsung menasehati mereka agar tidak lagi mengulangi perbuatannya. Selanjutnya sidang ditunda dan menjadwalkan sidang pembacaan putusan pada Senin (13/8). Sementara itu, pemilik Warnet Supernet The Tjong alias Tony belum ditemukan. Polisi sudah memasukkannya dalam daftar pencarian orang (DPO). (m38)

IMI AMIK MPB Buka Puasa Bersama MEDAN (Waspada): Ikatan Mahasiswa Islam (IMI) AMIK MBP, Selasa (7/8), menggelar acara buka puasa bersama yang dihadiri Direktur, Pembantu Direktur serta mahasiswa lintas agama. Grup musik yang dibentuk IMI, tampil pada acara itu membawakan lagu-lagu bernafaskan Islam. Direktur AMIK MBP Ny. Nursiah, SE, MSi menyatakan bangga karena mahasiswa yang tergabung dalam Ikatan Mahasiswa Islam ini, turut menyemarakkan bulan suci Ramadhan dengan menggelar buka puasa bersama. Dia berharap agar kegiatan yang menyemarakkan Ramadhan ini bisa lebih ditingkatkan lagi pada tahuntahun mendatang. Ketua Pembina AMIK MBP dalam sambutan tertulis mengatakan, perguruan tinggi itu tidak membedakan antara satu agama dengan lainnya. Pembentukan Ikatan Mahasiswa Islam (IMI) di AMIK MBP membuktikan kampus itu terbuka untuk semua agama dan saling menghormati. “Kita bangga pada bulan suci Ramadhan ini keluarga besar IMI AMIK MBP menggelar acara buka puasa bersama. Nantinya kita ingatkan agar tidak lupa menggelar acara halal bihalal pada perayaan Idul Fitri,” katanya. Sementara Armansyah Harahap, M.Pd yang tampil sebagai penceramah tunggal pada acara itu mengingatkan para mahasiswa bahwa melaksanakan ibadah puasa itu akan lebih baik lagi, jika kita memahami artinya. Puasa, sebenarnya bukan hanya diperuntukkan bagi umat Muslim, tetapi juga umat lain dan tidak salah melaksanakannya. Dia mencontohkan, keharusan puasa bagi seseorang tatkala hendak menjalani tindakan operasi medis atau periksa kesehatan. “Jadi, puasa itu berlaku bagi siapa saja. Namun pada bulan suci Ramadhan lebih difokuskan kepada umat Islam,” katanya. Turut hadir Pembantu Direktur III Iswanto Sembiring, ST, M.Pd, Humas Drs.Romanus Sipayung serta sejumlah dosen. (m22)

Univa Buka Puasa Bersama MEDAN (Waspada): Buka puasa bersama merupakan salah satu momentum untuk membangun kebersamaan dalam mewujudkan Universitas Al Washliyah (Univa) Medan ke arah yang lebih baik. Demikian dikatakan Rektor Univa Medan Ir H Aliman Saragih M.Si, di hadapan para dosen, guru, mahasiswa, dan para undangan pada acara buka puasa bersama di Aula Univa Medan, baru-baru ini. Sementara itu, Direktur Smart Life Drs H Syamsul Bahri S.Ag, yang hadir dalam acara buka bersama itu menuturkan, Smart Life membantu umat Islam khususnya warga Univa Medan untuk lebih mudah dan biaya murah berangkat haji dan umroh. Sedangkan Al Ustadz Drs H Hafiz Ismail dalam tausiyah mengatakan, ada tiga alasan mengapa orang yang berpuasa itu sehat. Dia mencontohkan Rasulullah SAW, pertama, Rasul bangun sebelum subuh, kedua aktif menjaga kebersihan, dan ketiga Nabi Muhammad mampu mengendalikan amarahnya. Sebelumnya dilakukan pembacaan ayat suci Alquran oleh Al Ustadz Muhammad Rahim, dosen Univa Medan yang juga qori terbaik I Provinsi Sumatera Utara. (cwan)

Waspada/Ist

REKTOR Univa Medan H Aliman Saragih (kanan), Zainal Abidin (tengah), HM Idris MP (kiri), bersama para undangan mendengarkan tausiyah Ramadhan dalam acara buka puasa bersama.

Waspada/ Rustam Effendi

MANAGER Pabrik PT IPI Calvin Harco beserta stafnya foto bersama sebelum memberikan bantuan kepada seorang janda kurang mampu.

IPI Bantu Puluhan Janda Kurang Mampu BELAWAN (Waspada): Sebanyak 32 janda kurang mampu warga Kelurahan Mabar, Kec. Medan Deli, mendapat santunan dari PT Industri Pembungkus Internasional (IPI) dalam acara berbuka puasa di perusahaan itu, Kamis (2/8). Bantuan berupa beras dan mi instant merupakan bingkisan lebaran 1433 H yang diserahkan secara simbolis oleh Manager Pabrik PT IPI Calvin Harco. Menurut Calvin, bantuan

tersebut merupakan bentuk kepedulian sosial IPI yang tiap tahun dilaksanakan pada bulan suci Ramadhan. Hal itu dilakukan sebagai upaya menjalin hubungan industrial yang baik antara masyarakat, karyawan, dan pimpinan perusahaan. Pada kesempatan itu, M Yakub selaku tokoh masyarakat sekaligus penceramah dalam kultum berbuka menyampaikan, lewat kepedulian sosial ini tercipta hubungan harmonis dengan masyarakat yang ber-

ada di sekitar lokasi perusahaan. “Bingkisan itu dinilai dapat membantu masyarakat kurang mampu dalam memenuhi kebutuhan pokok sehari-hari selama bulan Ramadhan,” ujarnya. Sementara itu, Technical Advisor for Production Mary Ann mengatakan, dalam menyambut Idul Fitri 1433 H ini pihaknya juga memberikan paket lebaran kepada sejumlah kepling di Kec. Medan Deli dan ratusan karyawannya. (h03)

Masalah Rohingya Harus Jadi Perhatian Dunia MEDAN(Waspada): Direktur Lembaga Bantuan Hukum Masyarakat Pancasila Indonesia (LBH MPI) Anaitullah SH mengatakan, masalah yang menimpa etnis Rohingya di Myanmar, harus menjadi perhatian dunia internasional, sebab pemerintah Myanmar telah melanggar hak azasi manusia (HAM). “Pelanggaran HAM terhadap etnis Rohingya itu disebabkan mereka tidak diakui sebagai warga negara di negaranya,” ujar Anaitullah yang juga Dekan Fakultas Hukum Universitas Islam Sumatera Utara (UISU) di selasela acara buka puasa bersama LBH MPI dan LBH Fakultas Hukum UISU, di Hotel Garuda Citra, Selasa (7/8). Hadir dalam acara itu advokat H Abdul Hadi Lubis SH, MH, Zulkifli AR SH, M Hum, Marah Muda Harahap SH, dan Hj Erma S Tarigan SH, MH. Menurut Anaitullah, meskipun etnis Rohingya itu penda-

tang dari Bangladesh, sebagai orang asing pun mereka berhak mendapat perlindungan sesuai hukum internasional. Sebaliknya bagi negara-negara yang kedatangan pengungsi Rohingya, seharusnya menerima mereka atas dasar kemanusiaan dan cinta perdamaian. Apalagi sebagian besar di antara mereka masuk ke satu negara dengan membawa surat atau kartu pengenal dari UNH CR (United Nations High Crisis for Refeduse/Komisi Tinggi PBB untuk Urusan Pengungsi). Mereka tidak boleh disebut sebagai pendatang ilegal karena mereka melarikan diri dari negerinya karena tidak aman. “Tokoh negeri itu yakni Aung San Suky yang sudah mendapat hadiah nobel perdamaian harus memberi perhatian, sebab di negerinya sendiri terjadi penindasan, kekerasan yang cenderung sebagai kejahatan genocide

yaitu pemusnahan suatu etnis secara sistematis atas dasar kebencian,” ujar Anaitullah. Kata dia, dari sisi hukum internasional, bahwa Pemerintah Myanmar sudah melakukan dua bentuk pelanggaran yaitu melanggar Universal Declaration of Human Right dan melanggar Konvensi PBB tentang genocide. Sementara sekaitan buka puasa bersama itu, Anaitullah mengatakan, acara tersebut bertujuan untuk menumbuhkembangkan ukhuwah islamiyah yang akhir-akhir ini terlihat persaudaraan umat Islam mengalami permusuhan. “Padahal, orang Islam bagai suatu bangunan yang saling mendukung, sesungguhnya orang Islam itu bersaudara. Oleh karena itu perlu meningkatkan kepedulian sesama umat Islam, dan dia menyarankan memberi bantuan pada pengungsi Rohingya,” sebutnya.(m20)

Waspada/Ismanto Ismail

PETUGAS Juper Reskrim Polsek Medan Baru Bripka Usman S Darma SH, sedang memeriksa DS yang kepergok ngintip orang mandi.

Ngintip Orang Mandi Ditangkap Nenek-nenek MEDAN (Waspada): Garagara ngintip orang mandi dari sela-sela lubang angin kamar mandi, seorang pria berinisial DS, 22, ditangkap nenek-nenek di Jln. Mawar, Medan Polonia, Rabu (8/8) pukul 05:30. Informasi Waspada peroleh di lapangan mengatakan, DS, warga Jln. Cinta Karya, Kel. Karangsari, Kec. Medan Polonia, pagi itu keluar rumah terus menuju ke salah satu kamar mandi milik warga di Jln. Mawar Medan. Rumah yang ditujunya itu dihuni wanita cantik yang memiliki body montok. Karena rumah tersebut berpagar tembok setinggi hampir tiga meter, DS mengambil sebatang kayu broti

untuk digunakan memanjat tembok tersebut. Selanjutnya DS mengintip dari sela-sela kamar mandi, namun setelah menunggu beberapa lama, tak satupun wanita yang masuk kamar mandi. DS yang tidak tahan lagi memijak kayu broti itu lansung turun. Namun, saat bersamaan seorang nenek berusia 65 tahun yang tinggal di lokasi itu melihat DS dan langsung menangkapnya. Kemudian nenek itu marahmarah sehingga mengundang massa berdatangan ke lokasi. Petugas Reskrim Polsek Medan Baru yang mendapat informasi dan turun ke lokasi langsung mengamankan DS dari

kerumunan massa. Kapolsek Medan Baru Kompol M Budi Hendrawan SH, SIK, mengatakan, DS masih menjalani pemeriksaan. “Kita belum tahu sudah beberapa kali yang bersangkutan melakukan perbuatan yang sama. Untuk lebih jelas, tunggu saja hasil pemeriksaan agar mengetahui dia sudah berapakali melakukan aksi yang sama,” ujarnya. Sementara itu, usai menjalani pemeriksaan, DS mengatakan, dirinya ingin ngintip wanita cantik dan montok yang masuk ke kamar mandi tersebut. “Saya ngintip karena di rumah itu ada wanita cantik dan montok,” katanya. (m36)

Medan Butuh 3.000 Kantong Darah Setiap Bulan MEDAN (Waspada): Kota Medan membutuhkan sebanyak 3.000 kantong darah setiap bulannya. Saat ini, kebutuhan itu mulai dapat terpenuhi, sebab setiap harinya Palang Merah Indonesia (PMI) Kota Medan, berhasil mengumpulkan 100 kantong darah. Namun, berhubung saat ini bulan puasa, perolehan kantong darah itu drastis berkurang. “Alhamdulillah, setiap harinya kita berhasil mendapatkan 100 kantong darah. Hanya saja berhubung saat ini bulan Ramadhan, perolehan kantong darah drastis menurun,” kata Ketua Pergantian Antar Waktu (PAW) PMI Kota Medan periode 2008-2015 Musa Rajekshah alias Ijeck bersama pengurus lainnya saat beraudiensi dengan Wali Kota Medan Rahudman Harahap di Balai Kota Medan, Senin (6/8). Dikatakan Ijeck, selain bersilaturahmi dengan Wali Kota Medan, kunjungan ini juga dilakukan untuk memperkenalkan kepengurusan yang baru sekaligus memaparkan program kerja ke depannya. Menurut dia, kepengurusan PAW PMI Kota Medan baru Mei lalu menerima Surat Keputusan (SK). Walaupun berstatus PAW

sampai 2013, namun mereka sudah bekerja. Salah satunya melakukan audiensi dengan Wali Kota Medan seraya menyampaikan program-program kerja yang akan dilakukan. Di samping itu terus mensosialisasikan kepada masyarakat manfaat donor darah bagi kesehatan maupun orang lain. Berkat sosialisasi yang dilakukan itu, kebutuhan 3.000 kantong darah setiap bulannya mulai terpenuhi. Untuk terus memenuhi kebutuhan akan darah itu, Ijeck mengaku pihaknya akan memasuki kecamatan, sekolah sampai perguruan tinggi. Hal itu dilakukan untuk membantu PMI mensosialisasikan kepada masyarakat akan manfaat donor darah maupun kepada oranglain.Dengansosialisasiyang dilakukan, masyarakat dengan suka rela dan penuh keikhlasan mendonorkan darahnya. Dalam kesempatan itu, Ijeck juga meminta dukungan Wali Kota Medan dalam membentuk pengurus PMI di masing-masing kecamatan. Rencana itu akan direalisasikannya usai lebaran. Sebelum pelantikan pengurus PMI kecamatan dilakukan, seluruh pengurus akan dikumpulkan terlebih

dahulu untuk diberi pelatihan. “Untuk itu kami minta dukungan wali kota,” harapnya. Wali Kota Medan Rahudman Harahap didampingi Asisten Kesejahteraan Masyarakat (Askesmas) Darusalam Pohan dan Kadis Kesehatan Edwin Effendi menyampaikan apresiasi dengan kepengurusan PAW PMI Kota Medan di bawah kepemimpinan Ijeck. Dengan terbentuknya kepengurusan yang baru ini, Wali Kota berharap persoalan terkait kekurangan darah yang selama ini dikeluhkan dapat teratasi. Terutama bagi masyarakat kurang mampu, terkadang sulit mendapatkan kantong darang. Rahudman mengingatkan seluruh pegawai di lingkungan Pemko Medan, untuk ikut menjadi anggota tetap donor darah PMI Kota Medan. “Sebagai wali kota, saya merupakan pendonor darah tetap di PMI Kota Medan. Hampir tiga bulan sekali, saya pasti mendonorkan darah. Jadi tidak hanya pegawai, saya juga mengharapkan agar masyarakat mau mendonorkan darahnya. Ini merupakan amal bagi kita, sebab membantu orang yang sangat membutuhkannya,” katanya. (m50)

Dualisme Kepemimpinan SPSI Berakhir MEDAN (Waspada): Serikat Pekerja Seluruh Indonesia (SPSI) akhirnya melakukan rekonsiliasi setelah lima tahun diterpa dualisme kepemimpinan antara SPSI kubuYorrys Raweyai dan Syukur Sarto. Penandatangan rekonsiliasi KSPSI disepakati kedua pihak disaksikan langsung Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar dan Ketua DPD Asosiasi Pengusaha Indonesia (Apindo) Sofyan Wanadi, di Hotel Borobudur, Jakarta, 1 Agustus 2012 lalu. Menanggapi berakhirnya dualisme kepemimpinan tersebut, Ketua SPSI Sumut Sugianto Situmeang SH, memberi mengapresiasi setinggi-tingginya. Oleh sebab itu, dia meminta kepada senioren dan para sesepuh menindaklanjuti rekonsiliasi itu sampai ke tingkat daerah. “Dimana dalam kurun tiga bulan ini DPP akan mengeluarkan Juklas dan Juklis sebagai acuan untuk penyatuan DPD Konfederasi se-Indonesia,” katanya. Sugianto yang turut hadir pada acara itu menyambut baik penandatanganan rekonsiliasi. Sebab kesalahan-kesalahan yang terjadi waktu lalu tidak terulang kembali sehingga mitra kerja KSPSI dapat bekerjasama dan tidak bingung dalam melakukan perundingan dengan organisasi ini. “Marilah kita mengambil hal positif dari rekonsiliasi ini dan meninggalkan konflikkonflik terdahulu yang melibatkan kesengsaraan bagi pekerja,”

sebutnya.

Rekonsiliasi Sementara itu, Wakil Ketua Rekonsiliasi H Rizaldi Mavie MBA, di gedung DPD F.SPTI Provsu Jln. P. Denai Medan, Rabu (8/8) mengatakan hal serupa. Dia didampingi wakil ketua lainnya Keswari, Aldiansyah ST, P Maratua Hutagalung SH, sekretaris rekonsiliasi Surya Kalfin, Anton Purba SH, Ismet Hasan SH, Soekatno SH, Syaifullah, Amal Faisal, ketua LPPH F.SPTI Junstar Ritonga SH, wakil bendahara rekonsiliasi Edi Susanto dan Suriadi mengatakan, kedua kepengurusan yang digabungkan ini melaksanakan rekonsiliasi dan bertindak secara kolektif dalam menjalankan roda organisasi dengan tugas dan tujuan sebagai berikut: melaksanakan rekonsiliasi mulai tingkat DPD Provsu, tingkat DPC F.SPTI di kabupaten/kota serta tingkat PUK. DPD Rekonsiliasi F.SPTIK.SPSI Provsu bertugas mengadakan rekonsiliasi atau menyatukan DPC di kabupaten/kota di jajaran Provsu, yang mana jika didalam satu kabupaten/kota tersebut, terdapat lebih dari satu kepengurusan DPC F.SPTI, selanjutnya mengantarkan kepada pelaksanaan musyawarah cabang di daerah/kabupaten kota masing-masing. Kemudian boleh membentuk DPC F.SPTI di kabupaten/ kota. Jika di daerah tersebut belum ada terbentuk satu pun DPC F.SPTI, yang mekanisme

pembentukannya mengacu kepada AD/ART F.SPTI. Membawa dan mengantar serta melaksanakan forum musyawarah daerah (Musda) Federasi Serikat Pekerja Transport Seluruh Indonesia (F.SPTI) di tingkat Provsu paling lambat 3 bulan setelah surat keputusan dikeluarkan, untuk menyusun program kerja dan memilih kepengurusan DPD F.SPTI Provsu yang definitif, dan ini sesuai dengan surat keputusan DPP Konfederasi Serikat Pekerja Seluruh Indonesia Nomor:Kep.61/SK/DPP KSPI/V/2012. Dan bukan tugas DPD Rekonsiliasi F.SPTI Provsu untuk membentuk, membekukan atau mengangkat kepengurusan dewan pimpinan cabang yang baru secara definitif di setiap kabupaten/kota. Apalagi jika di kabupaten/kota tersebut sudah terbentuk sebelumnya DPC F.SPTI. Untuk itu diimbau kepada seluruh pengurus dan kader F.SPTI dari tingkat DPD, DPC serta PUK untuk berhati-hati dan tidak terpancing dalam menerima informasi yang menjurus kepada teori pembodohan secara organisasi, sehingga dapat menganggu pelaksanaan rekonsiliasi yang sedang dilaksanakan oleh DPP, DPD secara terpadu sampai ke tingkat basis. Yang mana nanti akhirnya dapat mengganggu stabilitas keamanan secara eksternal dan suasana yang kondusif secara internal organisasi.(m27/m24)


A6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

CHEVROLET BLAZER MONTERA ’04 W. Hitam, 1 Tangan dari baru, Lengkap, AC, PW, PS, CL, Ban besar, Mobil mulus Mesin terawat, Siap pakai (Cash - Kredit) Hub. 0813 7011 2188 - 0819 9611 2188

DAIHATSU READI STOCK !!!

XENIA, TERIOS, GRANDMAX, LUXIO, DAPATKAN POTONGAN, HARGA SPESIAL UNTUK PEMESAN DI BULAN INI. TERIMA TUKAR TAMBAH Hub. AFJANI 0812 653 1129

DAIHATSU Feroza Thn ’97 W. Silver, BK Mdn, (Ex mutasi) Mobil mulus, Original, BOdy kaleng², H. nego Jl. Krakatau Ujung No. 65J HP. 0812 6009 667

DIJUAL CEPAT

Terios 2007 Akhir hitam. Cat Orisinal. Ada TV, Full Sound System. BK Asli Medan satu nama 138Jt. Hub. 0813 6269 6789

DAIHATSU Zebra Astra MB Thn. 91. Mulus, siap pakai. H. 18,5 Juta Nego. Hub. 0813 6100 2488 Jl. Ayahanda 69 A Mdan

DAIHATSU BARU

DP Mulai 15”%, Kredit s/d 5 Tahun. Terima Tukar Tambah Segala Merk Info Dan Pemesanan: Andika 0852 7074 7744

5 CM 6 CM

Rp. 65.000 Rp. 78.000

DICARI MOBIL OVER KREDIT LAND CRUISER/ FORTUNER/ CRV INNOVA/ AVANZA/ APV H. SAIFUL 0811 613 107 NISSAN GRAND LIVINA XV 1.5 MATIC THN 2008

W. Hitam sgt mulus, Original/ Sehat, BK Medan, Jok 3 garis, AC DB, Lengkap, TIngkap pakai, Harga 152 Jt/damai, NB. Bs tukar mobil dgn harga dibawahnya Hub. 0853 7015 9068

HARI INI # NISSAN #NewTERMURAH All Nissan Evalia, G. Livina, Juke, March, Xtrail Diskon Serta hadiah menarik dalam minggu ini BARU Dapatkan Hub. LAMASI PAKPAHAN 0853 5980 3295 - 0821 6150 1118

OPEL Blazer LT Injection Biru met Th. 96. Sgt mulus, siap pakai, Hrg. 44Jt Nego. Hub. 0812 6949 9450 Mobil OPEL BLAZER thn. 97 Dijual. W. Biru Mica Lengkap, Siap pakai. H. 35 Jt. Sambung Kredit 11 x 1.146.000. Hub. 0853 6010 8884

DIJUAL CEPAT

SUZUKI Carry Minibus Tahun 1987 warna merah. siap pakai. Harga Rp. 17 Juta. Bisa Nego. Hubungi HP. 0821 6302 1795. Jalan Brigjend. Katamso Gg. Nasti 158 B. Kp. Baru Medan

DAIHATSU PAKET LEBARAN

SUZUKI Escudo Nomade Th. 99 W. Merahymetalic. AC, Tape, VR, BR, PS, PW, CL, Jok kulit, Body kaleng mulus, BK H. Nego. Hub. 0813 6233 0595

“DAIHATSU PAKET MURAH”

SUZUKI Futura Th. 93 W. Biru metalik, Tape, VR, BR, Jok kulit Baru, Body lempang. Mulus. H. Nego. Hub. 0852 6129 5788

Ready Stock Daihatsu Baru Diskon Ok, Bunga ringan Hub. 0813 6237 8733 SITORUS ASTRA

Gran Max Pick Up DP 7 Jt-an Angs. 2 Jt-an Gran Max Minibus DP 18 Jt-an Angs. 4 Jt-an Luxio D DP 16 Jt-an Angs. 5 Jt-an Xenia M. Deluxe DP 21 Jt-an Angs. 4 Jt-an Terios TS Xtra DP 21 Jt-an Angs. 4 Jt-an Hub. ERWIN HP. 0812 6315 4132 061 77402067

DAIHATSU PROMO LEBARAN XENIA Terios Ready Stock, Disc. Jutaan Hubungi: HASIBUAN ASTRA 0812.6362.4634 DAIHATSU BARU

SUZUKI Futura Realvan Thn ’97 W. Biru Metalic, Tape, VR, BR, BK, Jok kulit, Body lempang mulus, H. nego Hub. (061) 7760 9041 SUZUKI Carry Realvan 1.3 BIru Met THn 2002 Sgt orisinil dan mulus, VR, BR, RTP, AC dingin, Hrg 58 Jt/nego abis Hub. 0852 7688 3371

DP Mulai 15% Kredit s/d 5 Thn. Ready stock Proses Cepat

Info Dan Pemesanan PAIREN 0812 6305 0708

SUZUKI MOBIL BARU Ertiga, APV Arena, Carry PU Hub. Liwan 0852 6111 7724

DAIHATSU Grandmax PickUp THn ’10. W. Hitam, Pakai Penutup. Mobil siap pakai, RP. 74 Jt. 0815 337 33688/ 785 1402

SUZUKI Carry Futura Dijual. 1.3 Mini bus Thn. 92. BK Mdn AC/Double, Siap pakai. Harga 33 Jt. Nego. Hub. 0812 639 3235 DICARI

HYUNDAI Atoz Hitam met Th. 2000. BPKB 1 nama dari baru, sgt mulus, Hrg. 63Jt. Nego. Hub. 0813 7025 7908

1 Mobil antara lain Carry / Daihatsu/ Panther / Kijang / Pick Up. BK Medan Like, Min 13ccN Thn. 93 Rp. 14 27Jt. SMS ke 0853 7272 3211

HARI INI HONDA BungaTERMURAH 0%, Ready Stock CRV, Jazz, Freed City, Full Diskon + Cashback, Bs Tkr. Tmbh. BARU Civic, Hub. BATUBARA HP. 0852 6134 7557

SUZUKI Realvan DRV Thn. 2003 Akhir. AC Dingin, Tape, VR, Hijau, BK Mdn, Mobil 1 tangan Kaleng2 Cat Asli. HP. 0812 6424 995

HONDA Civic Wonder 87. AC, Tape, Velg Rac. 17 inci. Hub. 0812 6303 9956 Jual Cepat

SUZUKI Baleno THn ’97 W. Hijau metalik, Plat Medan (asli), Velg racing, TV + CD Mobil siap pakai. Hub. 0813 7026 0113

ISUZU Panther Touring THn ’01 Matic. W. Hitam Metalic, MObil siap pakai Rp. 105 Jt depan Kampus UISU No. 200 0821 6767 7000 - 785 1402 ISUZU Panther Capsul (LV) Thn. 2001. BK Asli Medan (Pjk panjang) W. Biru tua met, Fas: AC, CD, VR, BR, CL, PS, Jok lapis. 90% mulus/orisinil. Terawat luar / dalam. Hub. 0812 6013 966 (Asen). Hrg. Rp. 106Jt. NB: Mbl sgt bagus / Siap pakai.

SUZUKI DRAG 1 THN ’97 Warna Hijau Metalik BK Medan Hub. 0813 7026 0113

Dijual Innova G Solar Thn. 2008 (Okt) Matik. Hitam, BK Medan. Terawat, Lengkap. Ada TV. Hub. 0852 7566 7596

M - Eterna - 90. BK Asli Medan, warna silver, kondisi mulus sekali (Original). Hub. 0821 6399 3022

W. Hitam, AC DB, Tape, CD/TV, BK Mdn, Sehat, Original, Jok 3 Baris, Jarang pakai. Harga 165Jt/damai. Hub. 0823 6720 8151

MITSUBISHI T 120 SS MINIBUS, Thn. 94 Dijual. Hijau, BK Jan. 2013, 1300cc. Hrg. 35Jt/ Nego. Boleh T.T Dgn Mobil sedan. Serius Hub: 0821 6149 9949 (Maaf No. Agen !!!)

TOYOTA Kijang Capsul model LGX New Bensin 1.8 THn 2003. Hijau kehitaman, Sgt mulus, VR, BR, PS, PW, CL, Rmt, E. Miror, AC double, FUll sound pake TV 3 unit, Hrg 132 Jt/ nego. Hub. 0812 6063 7823

TOYOTA RUSH THN. ‘07/’08

7 CM 8 CM

Rp. 91.000 Rp. 104.000

TOYOTA BARU !!! PAKET SPECIAL LEBARAN

Dapatkan Paket Menarik Utk Setiap pembelian Toyota Avanza G 1.5, Rush, Innova, Yaris, Fortune. Info Lanjut. Batubara (0811 6021220 TOYOTA NEW VIOS Type G Thn. 2006 W. Silver Met, Sehat, AC, Tape/CD/TV (Sound), BK Medan, Sgt Mulus, Jok kulit, Pemakai Hub. (061) 77731399

TOYOTA Rush 2007 / 2008 Hitam, Km. 57 ribu, BK Medan. Hub. 061 77870485 TOYOTA STARLET 1.0 THN ’86

W. Hitam Mulus, Jok kulit baru, AC, Tape, VR BR, (Baru), BK Mdn asli Pjg 7/2013 Hub. 0821 6407 4388 (Maaf TP)

TOYOTA Kijang Super Commando Thn. 96 W. biru metalik, AC, Tape, TV, CD, VR, BR, Jok kulit. body kaleng, Mulus. H. Nego. Hub. 0852 7599 6758 TOYOTA Kijang Capsul Diesel LGX Th. 99 W. Merah AC, DBL, Tape, VR, BR, PS, PW, CL, body lempang. Mulus H. Nego. Hub. 0813 7582 3555 TOYOTA Kijang Commando Short Biru met 6 Speed Th. 89. Mulus, siap pakai. VR, BR, RTP, AC Dingin, mesin sehat. Hrg. 45Jt. Nego. Hub. 0823 6635 9858

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Kamis, 9 Agustus 2012

FAX.4561347 HARGA BELUM TERMASUK PPN 10%

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk TI-HA TI apabila membeli produk anda, dan HA HATI-HA TI-HATI anda ingin melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA.

Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602

Terimakasih

BURSA

PHOTO COPY

BURSA

PERCETAKAN

DIJUAL SALAH SATU AVANZA THN. 2007 W. Silver Tipe G. 1300cc, Rp. 128Jt. atau LGX Diesel Thn. 2001 W. Biru Met, Rp. 124Jt. Dua2nya BK Medan. Harga Nego. Hub. 0813 6227 1115 TOYOTA Kijang Super G Dijual Segera. Thn. 95/96 Abu Abu met Long, AC, Tape, PS, CL, Remot, VR, BR, Mobil mulus. Hrg. 68Jt Damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90 Sei Agul 20 Mtr Dari Simpang (4|) Lampu Merah

# TOYOTA BARU #

Ready: Innova, Avanza, Yaris, Rush. Vios, DP 20%. Bunga 3.85%. Hub. 0812 6009 252/ 061 7632 6555

TOYOTA BARU 100%

Ready Stock Avanza Veloz. Innova G. Diesel / Bensin Rush, Fortuner, Hilux Yaris, Diskon, Besar. Bunga 0% Bisa Tukar Tambah Hub. 0813 6120 1719 / 6878 3325 No Merk/Type Thn. Wrn DP Angsuran 1. Toyota Avanza, S1.300cc A/T 06 HTM 25Jt 3,3Jt 2. Daihatsu Taruna FL+, 1.500CC 01/00 Biru/Met 17Jt 2,7Jt Hitam 30Jt 3,1Jt 3. Daihatsu Xenia Li + PS, CL, BR, AL, EM 08 4. Daihatsu Xenia Li PS, CL, VR, BR, AL 05 Silver 22Jt 2,7Jt 5. Opel Blazer DOHC 2.200CC Montera 01/00 Hitam 25Jt 1,6Jt 6. Peugeot 406 2000CC Sedan 00/99 Blue Met 25Jt 1,6Jt 7. Peugeot 306 1800cc sedan 97 Red 20Jt 995Rb Hub.MOSSEC MOTOR Jl. Tritura / AH. Nasution 18, 0853 6127 8860 / 0813 7518 7811

TOYOTA STARLET THN ’88 DIJUAL Warna Hijau, BK Mdn/panjang SIap pakai, Terawat, Harga nego Hub. 0853 7151 8289 (TP) TOYOTA Starlet 86 Dijual Kondisi mulus. Velg Racing, AC, BR. Harga 28 Jt/Neg. Hub. 0852 9642 8382 TOYOTA INNOVA BENSIN 2005/2006 Tipe G. SIlver Met, BK Medan asli Atas nama Sendiri. Pajak Baru Bln 08-2017, Sangat mulus. Hrg 155 Jt/nego. Hub. 0812 653 7645 Komp. Jasa Marga Krakatau Ujung

TOYOTA Kijang LSX THn ’02, 1800cc, Bensin, BK Medan Rp. 97 Jt/B.U Hub. 0813 6089 4043

BURSA BUTUH DANA BUTUH DANA/LEASING

Jaminan BPKB Mobil, Pick Up Truk (Colt Fuso) th. 95 Keatas. Multi Finance: 0877 6857 8318

BU T U H DA NA

Jaminan apa saja Sertifikat Tanah mobil & Sp. Motor. Segala tahun. Hub. 061-8222774 HP. 0853 6199 1500

BURSA MESIN

MESIN BATAKO/ PAVING

Jual mesin Batako dinding, Paving Blok, Mixer, Msn batu bata & Macam² cetakan Manual Hub. 0813 7582 6430 - 0823 6824 9106

DIJUAL

1.1(Satu) Unit Beko / Excavator Hitachi Zaxis 200. Thn. 2006 Pinggang pendek. 2.1 (Satu) Unit Dozer DGD - HP. Thn. 1997. Kondisi: Siap kerja Hub. Pak Pendy Saputra HP. 0852 7565 2777

Ingin Promosikan Produk Anda

BURSA

DIJUAL 2nd Power Beta 3 1000W, 2000W, 3600W. Sound Standard 1000Wm 3600W, EQ dod, 60ch, 30ch USA, dbx 60ch, spk BMB 8, 10, 12, DTS Kenwood, Pioneer, Terima Visa 0%. Jl. Indragiri 25 061.7345487

BURSA

BPKB BK 1518 HZ, A/n. Wina Saymara Ginting, Alamat Jl. Puskesmas I Gg. 06.48 Sunggal Medan 20128. Mobil minibus. Hilang Jl. KH. Zainal Arifin Stabat, Kel. Stabat Baru Kab. Langkat

BURSA

PHOTO COPY

KOMPUTER

ASIVITRONIK

Satu Chip Untuk Semua Operator Melayani Untuk seluruh Indoensia Transaksi 24 Jam Bisa Transaksi melalui Yahoo Messenger Harga Stabil dan Stok selalu ada Customer Service dari Jam 8.00 - 23.00 Dijamin Puas, Bila kecewa Sisa Deposit Bisa dikembalikan Harga Termurah, Silahkan dibuktikan Banyak Hadiah Langsung tanpa diundi Tersedia MKios Area Kecamatan Medan Kota/ Area/Denai/Amplas/Tembung Tersedia Internet Three 1 GB= 25 Ribu/ 2GB=40Ribu/AON 12 Bulan =12 Ribu Hubungi: Vidisi Selular Jl. Denai No. 94 C Medan Telp. : 0823 65664400 PIN BB: 28F83335 ID YM : ASIVITRONIK EMAIL: ASIVITRONIK@YAHOO.CO.ID FACEBOOK: ASIVITRONIK

PROMO MERDEKA LAPTOP

- Tablet 5,3 ‘ - Tablet 7’ - Samsung RV 413 - Acer E1 - Acer VS - Acer D270 - Compaq CQ45

: Rp. 1,95Jt : Rp. 1,5Jt : Rp. 3.250Jt : Rp. 3.650Jt : Rp. 3,7 Jt : Rp. 2,6Jt : Rp. 3, 250Jt.

DIJUAL MESIN BORDIR KOMPUTER

1.Merk Yamata, 2 Kepala/ Jarum, 9 Warna Benang, Mampu mengerjakan Bordir Bendera Pataka, Panjang Meja 6M, Thn. 2009. 2.Merk Song, 12 Kepala/ Jarum, 9 warna benang, panjang meja 10M, Thn. 2010. Untuk Info/Harga Hub. 0811 617 621 : 0823 6706 1996

WASPADA MINI & EFEKTIF Harian

Media yang Tepat untuk Iklan Anda

HILANG

ALAT MUSIK

IKLANKAN PRODUK ANDA

TERCECER

Sertifikat Hak Milik No. 173, A/n. Tamat Tarigan Yg terletak di Kab. Langkat Kec. Sungai Bingai Desa Telagah Luas 122m². Bagi yang menemukan Hub. 0852 9620 3005

MINI & EFEKTIF IKLANKAN PRODUK ANDA

HILANG / TERCECER

BURSA

Hilang / Tercecer Surat atas tanah yang terletak di Jl. Sei Kera, Kelurahan Sei Kera Hulu, Kecamatan Medan Perjuangan, Kota Medan berupa: 1. Gran Sultan No. 60 (1948) 2. Surat Hibah No. 61 SK Notaris (1954) 3. Surat Jual Beli Tanah No. 119 SK Notaris (1954) 4. Surat Hibah No. 54 SK Notaris (1955) 5. Surat Jual Beli Tanah No. 35 SK Notaris (1958) Bagi yang menemukan mohon hubungi: 0813 6145 1274.

PENDIDIKAN VIDYA ENGLISH INSTITUTE DIBUKA KELAS BARU TOEFL CLASS 1. TOEFL INTRODUCTORY CLASS 2. TOEFL PREPARATION CLASS START BELAJAR TGL. 10-09-2012 INSTRUKTUR: M R . S U R Y A K U M A R , S S MR. AJMEE SINGH, SS HUB. INFORMASI 456 8208

TERCECER HILANG

STUK BK 9336 BY. A/n. IR. YANDRA INDRAYANI BERUTU. Alamat Jl. MA. Selatan Gg. Puri No. 12 Medan. No. Speksi AB O1. 000 207 HILANG STUK BK 8504 BO. a/n. Meliana Siregar. Alamat Jl. Halmahera No. Speksi : TJP 00405 TELAH TERCECER

BPKB Sepeda Motor Honda Supra / NF 100: BK 6067 UU. Atas nama: Mhd. Syafril. Alamat Jl. Pimpinan Gg. Amal No. 10 Medan. Tercecer disekitar Jl. Mahkamah, Jl. Perjuangan, Jl. Gurilla. Bagi yang menemukannya kami mohon kesediaannya untuk mengembalikannya ke alamat kami di Jl. Mahkamah No. 60 B terima kasih.

HILANG SURAT TANAH SK Bupati Deli Serdang No. 27689/A/1/9, Tanggal 15 Desember 1973, A/n Rellus Pardede dengan alamat Kampung Tanjung Gusta, Kec. Sunggal, Kab. Deli Serdang Seluas 4550m2

HILANG

BPKB spd. motor Honda BK 5060 HF. a/n. RANTO PARDEDE DRS. Alamat: Jl. Vanili I No. 5 Kel. Mangga Medan Tuntungan. No. Rangka: MHI HB 211 X4 KO 94439 No. Mesin: HB 21E - 1094927 TERCECER/ HILANG

Surat Tanah asli, SK Camat, Atas nama Adi Kliwon dengan luas ±108m² Terletak di Jl. Pengilar IV No. 43 Lk. II Kel. Amplas Kec. Medan Amplas Medan

HILANG

STUK BK 9180 LO. A/n. Arifin. No. LGK 5420. Alamat Jl. SEKIP G Suropati No. 1 HILANG

STUK BK 1814 LH. a/n. Monang Tampubolon. No. STUK PBR 28889. Alamat Jl. Cemara Gg. Dame No. 6 TELAH HILANG 5 (lima) bh SHM, No. 2428, 2429, 2430, 2431 dan 2136 A/n. Achmad Daud Pos Pos, Desa Bandar Khalifah Kec. Percut Sei TUan Kab. Deli Serdang Hub. 0812 654 0507

MINI & EFEKTIF IKLANKAN PRODUK ANDA


Nusantara

WASPADA Kamis 9 Agustus 2012

Hartati Murdaya: Saya Taat Kepada KPK JAKARTA (Waspada): Siti Hartati Murdaya akhirnya angkat bicara setelah resmi ditetapkan sebagai tersangka oleh KPK. Pengusaha yang juga anggota Dewan Pembina Partai Demokrat itu menghormati proses hukum KPK. “Saya menghormati KPK. Apa yang menjadi keputusan KPK akan saya taati dan saya hormati,” kata Hartati Murdaya di kediamannya, Jalan Teuku Umar, Menteng, Jakarta Pusat, Rabu (8/8). Hartati akan mengikuti semua proses hukum dan tahapan yang berlangsung di KPK. Hartati yakin akan segera ada bukti yang meringankan dirinya. “Saya akan ikuti dengan harapan KPK nanti bisa menemukan bukti-bukti yang riil,” kata Hartati. KPK menetapkan Hartati sebagai tersangka dalam kasus suap Hak Guna Usaha (HGU) lahan perkebunan sawit di Buol, Sulawesi Tengah. Hartati diduga menyuap Bupati Buol Amran Batalipu sebesar Rp3 miliar. “Bagi saya, apa yang dilakukan KPK itu sudah betul,” ujar Hartati. Pengacara Siti Hartati Murdaya Poo, Patra M Zen membantah perusahaan milik anggota Dewan Pembina Partai Demokrat itu menyuap Bupati Buol, Amran Batalipu. “PT HIP tidak pernah berupaya menyuap Bupati Buol Amran Batalipu terkait dengan keberadaaan perusahaan di Kabupaten Buol,” kata Patra dalam keterangan yang diterima Rabu. (vvn)

Pilkada Serentak Efesienkan Waktu Dan Biaya JAKARTA (Waspada): Ketua DPRRI Marzuki Alie berpendapat wacana penyelenggaraan pemilihan umum kepala daerah (pemilukada) secara serentak tidak akan menyibukkan masyarakat dan tentu mengefisienkan waktu serta biaya. “Saya pikir satu hal yang baik agar masyarakat tidak disibukkan. Jadi hari ini memilih bupati dan hari berikutnya memilih gubernur,” kata Marzuki Alie di gedung DPR, Jakarta, Rabu (8/8). Menurutnya, jika disosialisasikan dengan baik sehingga dapat meyakinkan masyarakat, maka pemilukada serentak akan mendongkrak partisipasi pemilih. “ Saya kira tingkat partisipasi pemilih akan meningkat, sebab pemilihcukupdatangsekaliuntukmemberikanhakpilihnya,”tuturnya Dia juga mengakui, pelaksanaan pemilukada secara berulangulang, sebagaimana selama ini sudah dilaksanakan, cenderung hanya menghabiskan anggaran negara. “Enggak produktif . Saya sarankan sebaiknya dilakukan secara serentak, itu lebih baik,” tandasnya sembari menekankan bahwa apa yang dilontarkannya sebagai pandangan pribadi. (aya)

Ramadhan.... rindukankedatangannyadanditangisikepergiannya oleh orang-orang yang shalih, dengan tidak terasa, hari demi hari, waktu demi waktu, sampai saat ini kita sudah memasuki pertengahan Ramadhan. Kehabisan kata-kata bagi kita untuk berucap tentang keagungan dan keistimewaan bulan Ramadhan,namuntakadasalahnya,kitamereview ulang memory-memory keagungan bulan suci Ramadhan dan itulah sifat manusia, yang memang perlu di tinjau kembali, diingatkan kembali, untuk mengabdi kepada Allah SWT. Kita sebagai orang beriman dan bertaqwa, hendaklah terus meningkatkan amalan-amalan yang baik dalam memperkuat ketaqwaan kita kepada Allah di bulan Ramadhan ini. Barangkali dalam kehidupan kita sering ramadhan itu dimaknai hanyalah sebagai bagian dari rutinitas dan kultural saja, namun sebenar-nya tidaklah demikian. Jauh lebih dari itu dan sangat dalam makna dan hakikat dari Ramadhan itu sendiri jika kita dapat memaknainya dari banyak aspek. Sekilas kita melihat seolah-olah puasa Ramadhan yang diwajibkan kepada kita umat muslim hari ini hanyalah sebagai rutinitas dan budaya, banyak di antara kita telah melewati Ramadhan sejak dari usia kanak-kanak sampai dewasa tanpa menghayati aspek filosofi dari pelaksanaan ibadah tersebut. Hampir setiap tahun kita menjalani ibadah Ramadhan itu dengan berpuasadanmelaksanakanibadah-ibadahlainnya yang dianjurkan hanyalah sebagai suatu kebiasaan, malah kebanyakan umat Islam telah melewatkan momentum Ramadhan de-ngan kebiasaan dan budaya yang tidak diajarkan oleh Rasulullah Saw. Ketika Ramadhan datang silih berganti dari tahun ke tahun yang kita selalu disibukkan dengan menyiapkan hidangan berbuka puasa yang berlebihan, menyiapkan kue buat lebaran, menyibukkan diri dengan membeli baju-baju baru, menghiasrumahdankegiatantetekbengeklainnya, yang terkadang membuat kita lupa terhadap ibadah yang semes-tinya kita lakukan di bulan yang mulia ini. Sementara pada sisi lain, di kalangan para pejabatataupolitisikita,bulanRamadhandijadikan sebagai ajang promosi untuk mem-perkenalkan diri melalui ucapan-ucapan selamat menunaikan ibadah puasa yang dipajang lewat spanduk dan baliho, lengkap dengan fotonya. Hal itu bisa dilihat di pinggir-pinggir jalan umum, di persimpangan jalan, baik melalui brosur yang bertamengkan imsyakiah Ramadhan maupun dalam bentukbentuk lain. Kenyataannya selama ini Ramadhan terus berganti setiap tahunnya, namun perilaku masyarakat tersebut atau sejumlah pihak tidak jugamenunjukkanperubahan,padahalRamadhan merupakan bulan penempatan diri untuk menjadi lebih baik, sehingga ramadhan tidak menjadi kehilangan makna. Ramadhan dapat memberi format dan membentuk karakter seseorang, malah dapat membalikkan kebiasaan-kebiasaan buruk seseorang itu menjadi lebih baik. Dengan ibadah puasa dapat merubah seseorang yang berwatak kejam, rakus dan serakah menjadi manusia yang arif, tawaddhu’ dan zuhud. Di samping dengan ibadah itu sese-orang menjadi sangat dekat dengan Allah SWT. Ramadhan hadir memberikan aura yang penuh dengan kebaikan-kebaikan. Ketenangan, kedamaian,kemaafanmewarnaisikapdanperilaku manusia. Bahkan manusia seakan-akan terpicu untuk menampilkan eksistensi dirinya yang sejati sebagai makhluk suci, pengusung nilai-nilai kebajikan, cinta kasih, dan juga berbagai macam rahmat kasih sayang yang diperoleh sesama manusia. Dengan bulan ramadhan, manusia mampu menampilkan citra positif dirinya sebagai penghuni surga yang berjalan di muka bumi. Hal ini selaras dengan apa yang disabdakan Rasulullah SAW, “Hendaknya engkau menjadikan orang yang mampu membangun citra positif dalam kehidupan. Sesungguhnya citra positif akan menghantar kepada kebaikan. Sesungguhnya kebaikan menghantar seseorang masuk pada jannah. Jika seseorang senantiasa menampilkan citra positif dirinya sehingga ia akan dicatat di sisi Allah swt sebagai orang yang mampu membangun dan menampilkan citra positif.” (Hadis) Satu dari manifestasi keindahan bulan Ramadhanadalahmembangkitkanrasasolidaritas, persatuan dan gotong royong sesama muslim. Berpuasa dapat membantu member-sihkan

A7

Hartati Tersangka, PD Prihatin JAKARTA (Antara): Partai Demokrat prihatin dengan ditetapkannya anggota Dewan Pembina PD, Hartati Murdaya sebagai tersangka oleh Komisi Pemberantasan Korupsi (KPK). “Kami prihatin atas penetapan tersebut. Kami menghormati dan menghargai proses dan mekanisme hukum yang sedang ditempuh oleh KPK,” kataWakil Sekretaris Jenderal DPP Partai Demokrat Saan Mustopa di Jakarta, Rabu (8/8). Sementara itu, Ketua DPP Partai Demokrat, I Gede Pasek Suardika mengatakan, pene-tapan Hartati sebagai tersangka tak mempengaruhi elektabilitas PD. Bahkan, kata Pasek, elektabilitasPDterusmeningkatse-iiring dengan“bersih-bersih”diinternal partai. “Tidak ada pengaruhnya ditetapkan Hartati sebagai tersangka dikaitkan elektabilitas Partai Demokrat. Sekarang elektabilitas PD sudah naik kok, yang kemarin memang turun, tapi kini sudah mulai naik lagi,” kata Pasek. Dia menambahkan, rakyat sudah mulai melihat ternyata ada kader partai lain yang lebih parah lagi korupsinya. “Dan kami jauh lebih sungguh-sungguh untuk memproses kader-kader yang terlibat kasus korupsi,” kata Ketua Komisi III DPR RI itu. Meskipun elektabilitas Partai Demokrat naik, tapi tetap akan selalu melakukan bersih-bersih di internal partai.

spiritual masyarakat, menciptakan keseimbangan, solidaritas dan persaudaraan. Umat Islam dengan penuh kegembiraan dan penghormatan menyambut bulan ini dan bersama-sama merasa dekat satu dengan lainnya. Perasaan ini semakin tampak bila mengamati umat Islam di negaranegara Barat yang menjadi minoritas. Puasa bukan hanya sekedar menahan diri dari pada makan dan minum, nafsu seksual, puasa juga menahan perbuatan-perbuatan yang dapat merugikan pihak-pihak lain yang menyimpang dan dilarang oleh agama. Sebagaimana Rasulullah SAW bersabda: “Barang siapa yang tidak meninggalkan dusta dan perbuatan menyimpang, Allah tidak berhajat kepada puasanya”. Kemudian pada hadist lain Rasul juga mengatakan: “berapa banyak orang yang berpuasa tetapi ia tidak mendapatkan dari puasanya itu kecuali lapar dan dahaga”. Oleh karena itu, pertanyaan yang perlu kita cerdasi adalah sudahkah kita benar-benar mampu menjadikan bulan Ramadhan itu sebagai kesempatan bagi kita untuk mengerjakan amal saleh yang dapat dijadikan jalan untuk mencapai keridhaan Allah SWT? Sudahkah puasa terkesan dalam jiwa kita sehingga teraplikasi dalam kehidupan sehari-hari? Berkaitan dengan itu hendaknya kita jadikan ibadah puasa dan ibadah-ibadah lainnya di bulan suci ini tidak hanya sekedar rutinitas, tetapi harus dilandasi dengan pemahaman yang benar tentang ibadah-ibadah tersebut. Misalnya kita harus memahami bagaimana tata cara berpuasa, mulai dari hukum-hukum yang mewajibkannya atau sunah-sunahnya dan yang dibolehkannya sampai yang diharamkan atau yang makruh dalam berpuasa. Berikut hendaklah kita jadikan segala ibadah di bulan suci ini dengan landasan keimanan.Tanpa adanya keimanan kepada Allah SWT. ibadah seseorang akan menjadi sia-sia. Maksudnya adalah yang kita lakukan harus disadari, semua itu adalah perintah Allah SWT, bukan sekedar ikut-ikutan atau tradisi dari nenek moyang. Kita mengerjakan ibadah itu senantiasa berada dalam suasana keimanan, yaitu selalu sadar, kita adalah makhluk Allah dan hanya karena Allahlah kita melaksanakan perintah-Nya. Dengan kata lain ibadah itu dilaksanakan dengan penuh keikhlasan, yang senantiasa hadir selalu dalam benak kita. Bulan Ramadhan sangat jauh berbeda dengan bulan lainnya, bulan ini terkenal dengan bulan “bursa pahala” (reward). Segala amal ibadah hamba Allah akan dilipatgandakan, sebagaimana sabda Nabi saw yang artinya: “Setiap amal anak Adam (manusia) diberi ganjaran 700 kali lipat (di bulan Ramadhan), kecuali puasa. Sesungguhnya puasa untuk-Ku dan Akulah yang memberi ganjarannya” (H.R. Muttafaqun ‘alaih). Bulan ramdhan penuh dengan bulan keampunan, hal ini sejalan dengan hadis Nabi yang disampaikan oleh Abu Abdillah bin al-Hafiz dan Muhammad bin Musa yang artinya: “Barangsiapa yang berpuasa dengan penuh keimanan dan keikhlasan, maka akan diampuni dosa-dosanya yang telah lalu. dan barang siapa yang beribadah di malam bulan Ramadhan dengan penuh keimanan dan keikhlasan maka akan diampuni dosa-dosanya yang telah lalu (H.R. Muttafaqun‘alaih).DemikianlahAllahmemberikan sugestidandorongankepadahambanyaagarselalu melaksanakan ibadah di bulan Ramadhan dengan penuh keimanan dan keikhlasan kepada Allah SWT. Penuh keimanan yang disebutkan dalam hadis di atas, sangat erat kaitannya dengan apa yang terdapat dalam surah al-Baqarah ayat 183, dimana dalam ayat itu yang diwajibkan untuk berpuasa Ramadhan adalah orang yang beriman. Selajutnya setelahtuntutanberimandipenuhibarudiwajibkan berpuasa dengan penuh keikhlasan, karena nilai puasa yang dipersembahkan hanya untuk Allah Swt semata. Oleh karena itu, di bulan yang penuh dengan rahmah dan ma’firah ini, kita seharusnya memperbanyak amal ibadah, di antaranya seperti, shalat tarawih, shalat witir, shalat malam atau tahajjud, tadarusan Alquran atau membaca Alquran, memperbanyak sedekah, iktikaf dan amalan lainnya yang dikategorikan kepada amal yang shaleh. Mari tingkatkan amal ibadah lebih baik dari tahun yang lalu, sebab kehadiran bulan Ramadhan sekali dalam setahun. Bekalilah hidup untukkehidupanyanghakiki,gunakanlahhidupmu sebelum datang matimu agar tidak terjadi penyesalan yang tidak berarti.

“Oo rumah kita sudah paling bersih tuh. Kita akan terus bersih guna lebih meningkatkan elektabilitas partai,” kata Pasek. KasusHartati,katapolitisiasal Bali itu, harus dipisahkan antara urusan pribadi dan partai. “Rakyat bisa membedakan mana masalah pribadi dan mana masalah partai dan SBY sudah jelas tegak lurus dalam penegakanhukum,”pungkasPasek. KPK menetapkan pemilik Hardaya Inti Plantation, Hartati Mudaya sebagai tersangka dalam kasus suap Bupati Buol, Sulawesi Tengah, Amran Batalipu. Fenomena Gunung ES WakilKetuaDewanPem-bina Partai Demokrat Marzuki Alie menyoroti maslah perizi-nan di negeriini.Pasalnyasudahmenjadi rahasia umum bahwa kepala daerah kerap memper-sulit perizinan. Pernyataan ini dilontarkan Marzuki menjawab wartawan di gedung DPR, Jakarta, Rabu (8/ 8), terkait ditetapkannya Hartati Murdaya sebagai ter-sangka kasus suap Bupati Buol, Sulawesi Tengah, Amran Batalipu. Menurutnya, masalah perizinan yang mejeret Hartati merupakan fenomenagununges.Sebabkasus serupa sesung-guhnya banyak sekali. Pengusaha tidak bisa menghindar untuk meng-

eluarkan uang dalam soal perizinan . “Boleh dicek. Saya kira semua pengusaha mengalami hal yang sama. Kalau nggak memberi ya gak akan pernah keluar izinnya dan saya kan mantan pengusaha juga merasakan betul kekuasaan kepala daerah dengan otonomi di daerah, ujarnya. Nonaktif Sementara anggota Dewan Pembina Partai Demokrat Hayono Isman mengakui terkejut dengan penetapan anggota Dewan Pembina Partai Demokrat Hartati Murdaya sebagai tersangka kasus penyuapan Bupati Buol Amran Batalipu. Walaupun demikian, kata Hayono, Demokrat sepenuhnya menyerahkan kasus itu pada KPK untuk menuntaskan. “Tentu saja terkejut. Saya sangat prihatin sebagai dewan pembinadanikutsedih.Dan,kalau sudah tersangka secara otomatis beliau harus nonaktif dari Demokrat karena hal itu sudah peraturan partai. Karena itu KPK harus mempercepat proses hukumnya,” tandasnya Pengusaha Hartati Murdaya resmi ditetapkan menjadi tersangka oleh KPK karena terbuktimelakukandugaantindak pidana suap atas Bupati Buol Amran Batalipu. Hartati diduga

kuat sebagai orang yang memerintahkan pemberian uang suap kepada Bupati Buol tersebut. Sebelumnya,dalamkasusini,KPK menetapkan tiga tersangka, yakni Bupati Buol dan dua petinggi PT HIP yaitu Gondo Sudjojo dan Anshori. Anas Sedih “Yang pertama kami rasakan saat ini adalah sangat sedih dan prihatin dengan nasib Bu Hartati,”kataKetuaUmumDPPPartai Demokrat Anas Urba-ningrum di sela safari Ramadan di Yogyakarta, Rabu (8/8). Anas memberikan dukungan moril kepada Hartati yang disebutnya sebagai salah satu politisi senior terbaik yang dimiliki Demokrat. Anas berharap Hartati kuat menjalani proses hukum yang berlaku dan mendapatkan keadilan. Namun, kata Anas, Partai Demokrat tetap menghormati proses hukum yang berlaku. “kami akan tetap tegak dan dukung untuk hormati proses hukum,” ujar Anas yang didampingi Sekretaris Jenderal Edhie BaskoroYudhoyono dalam safari Ramadan ini. Partai Demokrat hingga kini belum menyediakan bantuan hukum bagi Hartati. Alasannya, karena memang belum diminta oleh yang bersangkutan. (ant/j02/aya/vvn)

Penyelenggaraan PAUD Akan Diperketat JAKARTA (Waspada): Pada 2015, Kementerian Pendidikan dan Kebudayaan (Kemdikbud) akan memperketat penyelenggaraanlembagaPendidikanAnak Usia Dini (PAUD). Hal itu ditandai dengan segera diterbit-kannya Peraturan Mendikbud tentang penyelenggaraan PAUD. “Sekarang sedang dalam tahap uji publik,” kata Direktur Jenderal Pendidikan Anak Usia Dini Non Formal dan Informal (PAUDNI) Kementerian Pendidikan dan Kebudayaan (Kemdikbud), Lidya Freyani Hawadi di Jakarta, Rabu (8/8). Nantinya, lanjut Lidya, Permen ini akan terbit sebagai penguat Permendiknas Nomor 58/ 2009 yang mengatur standar

PAUD. Ditambahkan Lidya, 2015 adalahbataswaktuterakhiruntuk penyesuaian semua Paud setelah tiga tahun masa perco-baan. Disampaikan Lidya, dalam Peremendikbuditunantinyaakan diatur mengenai syarat minimal menjadi guru TK, yakni memiliki ijazah S1 dengan program studi PAUD. Diakui-nya, saat ini masih banyak guru TK yang belum memenuhi kua-lifikasi tersebut, tapi sanksi tidak bisa diberikan karena belum ada aturan yang mengaturnya. Selainitu,syaratlainyangharus dipenu hi untuk meny eleggarakan PAUD adalah sarana dan prasarana yang disediakan harus berada dalam area seluas minimal 300 meter persegi.

Tentunya juga akan ada evaluasi dan monitoring yang mengacu pada peraturan tersebut. Selain itu, PAUD juga tidak boleh menyelenggarakan kurikulum membaca, menulis dan berhitung (calistung). “Calistung tidak jadi ukuran utama. Hanya perkenalan huruf atau angka boleh saja. Makanya untuk pendidikan tingkat SD seharusnya tidak boleh menyelenggarakan tes masuk,” kata Lidya. Dia mengatakan, permendikbud ini nantinya seperti kitab sucinya penyelenggaraan PAUD. “Termasuk memuat sanksisanksi bagi pelanggarnya,”kata Lisya tegas.(dianw)

RUKO DIJUAL

Jl. Denai No. 12A, 3 Tingkat, 4 KT, 3 KM. ±100m dari Pajak Sukaramai Hub. 0812.6346.1822 - 0813.6207.7776

RUMAH DIJUAL

Tanah/ Rumah: Desa Bandar Setia Dsn. VI Kec. Percut Sei Tuan Deli Serdang (Surat Camat), LT. 406m², Rumah 6x10m, PErmanen, 2 KT, Keramik, Gang 2m Harga Rp. 130 Jt/nego Hub HP. 0813 7065 0099

Waspada/Ist

WAKIL rakyat dari FPAN, Dapil Sumut II Yahdil Abdi Harahap saat meberi sembako kepada konstituennya.

Yahdil Beri Sembako Pada Konstitituennya JAKARTA (Waspada): Dalam suasana menyosong lebaran, wakil rakyat dari Fraksi Partai Amanat Nasional (FPAN ) daerah pemilihan Sumut II, yang kini duduk di Komisi III DPRRI membidangi Hukum dan Kepolisian, Yahdil Abdi Harahap, SH, MH, kembali mengunjungi konstituennya. Kunjungan kali ini ke Tapanuli Selatan, bukan hanya kunjungan biasa, tetapi Yahdil berbagi sembako kepada konstituennya. Yahdil mengatakan kegiatan yang dilakukannya merupakan bagian dari ucapan terimakasihnya kepada konstituennya yang sudah memberikan kepercayaan kepada dirinya sebagai wakil rakyat. “ Saya sekaligus ingin berbagi dengan konstituen yang tentu sangat membutuhkan sembako menghadapi lebaran. Paling tidak sembako yang tidak seberapa ini dapat merinngankan konstituen saya, “ ujar Yahdil Abdi Harahap, kepada Waspada di Jakarta, Rabu (8/8) menjelaskan kegiatannya pada masa reses di Dapilnya. Yahdil juga mengakui, kegiatan membagi sembako ini untuk menunjukkan bahwa kader PAN yang mendapat kepercayaan rakyat, tetap tidak jauh dari rakyat. Sebaliknya kader PAN yang dipercaya duduk di DPR harus selalu dekat dengan rakyat. “Saya yakin jika tetap dekat dan rajin silaturahmi dengan rakyat, mendengar dan memperjuangkan rakyat, Insya Allah antara PAN, khususnya saya, makin seperti satu keluarga. Kalau enak dirasakan bersama, kalau sakit juga dirasakan bersama. Jadi, wakil rakyat dari PAN harus menyatu secara lahiriah dan batiniah dengan masyarakat, ujarnya. Sebagai Wakil Sekjen PAN, Yahdil kepada konstituennya juga mensosialisasikan Ketua Umum PAN, Hatta Rajasa menjadi RI1. “ Ya, kita terus mesosialisasikan Ketum PAN menjadi presiden,” tandasnya. Namun, yang utama makna dari kegiatan memberi sembako ini, adalah sebagai bentuk silaturahmi saya sebagai wakil rakyat dengan konstituen saya di dapil Sumu II ini, kata Yahdil Abdi Harahap.(aya)

BURSA

BURSA

DIKONTRAKKAN

PROPERTY

2 K. Tdr. 1 Km, 1 Dpr. 1 R. Kel. Perumahan Palem Kencana Blok H/6 Harga 6 Jt/Thn. Maaf T. Perantara Hub. 0821 6320 9777

Informasi Pembaca Bursa Property

RUMAH & VILLA DIJUAL

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

RUMAH Dijual - 2 Tkt. Mode Villa Jl. Kelapa. Luas Tanah 192 M. Hub. 0813 7663 331. Harga Rp. 700Juta. Bisa Nego. DIKONTRAKKAN

1 bh Rumah Jl. Dr. Mansur Gg. Berdikari Komp. PLN No. 5 Medan, KT 4 bh, Garasi 1 bh, KM 2 bh, Air PDAM, Listrik, PLN Hub HP. 0821 6849 1533

- Rumah Villa Gading Mas I Blok No.20 Uk. 7,5 x 21,7 M² (SHM) - Villa Brastagi Indah Blok C-16 (Complek Tebu Manis) Luas 604 M² (SHM) Hub. HP. 0816 334204 Flexi: 061. 77788085

TANAH TANAH Dijual Uk. 13,50x45,50m², SHM di Jl. Sei Bengawan No. 104 Mdn Sunggal, Harga nego Hub. 0812.640.8316

TANAH DAN BANGUNAN DIJUAL Uk. 26x78m (Sertifikat) Jl. Sunggal No. 140 Simp. Perkampungan Kodam Medan. Diatasnya terdiri dari - Rumah tempat tinggal = 1 Rumah, - Rumah sewa permanen = 21 Rumah, - Rumah sewa semi permanen = 5 Rumah Hub HP: 0813 7589 0144

DIJUAL CEPAT

KEBUN SAWIT DAN KOLAM Luas Tanah 39000m², SK Camat Buah pasir, Rumah 14x14, Listrik 1200 Watt Sumur bor, Alamat Jl. Baharu Hamparan Perak, Harga Rp. 800 Jt/nego Hub. 0813 7514 1239 Maaf T. Perantara

BURSA

KESEHATAN

PIJAT CAPEK² Lulur dan Terapi Alat Vital. Hubungi: Mbak SHIFA 0821 6397 7499

BURSA

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

SPRING BED DIJUAL MURAH

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

MINI & EFEKTIF IKLANKAN PRODUK ANDA

PELUANG BISNIS

DICARI GURU TK/SD/MTs/SMP YAYASAN DARUL HIKMAH

Jl. Karet Raya No. 1 A P. Simalingkar Medan Telp. (061) 836.5626 HP. 0813.9796.0600

PELUANG USAHA

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

RUMAH DIJUAL

- RUMAH Jl. Sakti Lubis No. 20 Uk. 23,25 x 47,25 M2 (Luas 1.080 M²) Sertifikat Hak Milik - R u m a h J l . R a m l i Ya t i m No. 3-AA. (Blkng Madani Hotel). Uk. 14,75 x 23,75 (SHM) Hub. HP. 0816 334204 - Flexi: 061.77788085

BURSA

LOWONGAN

UD. RIZKY ABADI JAYA

Traksi Assistant

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.3334 HP. 0813.7580.8866

Recuitment

• Pria, 35 tahun • D3 - S1 Teknik Mesin/ Otomotif/ Transportasi • Memiliki Pengalaman minimum 3 tahun sebagai Traksi Assistant Pada Perusahaan Perkebunan Kelapa Sawit • Memiliki pemahaman terkait mesin dumptruck/ alat berat dan transportasi • Bersedia ditempatkan diseluruh di wilayah operasional perusahaan Surat lamaran dapat dikirim ke alamat kami di bawah ini dengan kode “ ASS-TRAK” paling lambat tanggal 16 Agustus 2012. Hanya kandidat yang memenuhi kualifikasi yang akan di proses. The Human Resources Department – Prima Group Jl. Walikota No. 3 Medan – Indonesia (20152). E-mail : subroto.toh@spr.co.id

DIBUTUHKAN

Guru Komputer untuk SMK Berijazah S-1 Jurusan Teknik Informatika Hubungi 0823 6707 0774 Atau antar lamaran ke: Jl. Eka Prasetya No. 1 Medan Helvetia #LOWONGAN KERJA#

(BARUBUKA)

Dibutuhkan Segera P/W. Usia 17 - 39 tahun untuk ditempatkan di kantor sebagai Mitra Kerja 100% bukan Sales. Pend. Min. SMU Sederajat. Penghasilan : 1.300.000 s/d 2.500.000 / bulan + Bonus harian. HUB: IBU TARI, Amd HP: 0821.6378.2724 / 0852.7765.2184 Alamat: Jl. Orion No. 55 (Samping Medan Plaza) Medan. NB: Terbuka bagi Mahasiswa, semua kalangan. 10 Pelamar pertama langsung diterima kerja

BURSA

BUSANA/ ACCESORIES

PECI MAHKOTA

MENJUALPECITEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

PECI MURNI

TEMPAHAN ISTIMEWA H. ADAM AKIL HSB Jl. Setia Budi No. 49A 8223975

SERVICE

AC

ELEKTRONIK JAYA TEKNIK

TV, AC, KULKAS, MSN CUCI, BNGKR PASANG, SOUND SYSTEM, BERGARANSI.

HUB: 061 7791 3537, 0852 967 55537

AC

KHUSUS REPARASI /SERVICE Kulkas, M. Cuci, Sanyo Air, Dispenser, Bongkar Pasang AC Hub. PRATAMA ELECTRIC GARANSI Telp. 7343789

AC

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat

AC

PRATAMA TEKHNIK

REPARASI SERVICE AC SPLIT, WINDOW/CENTRAL, DISPENSER, MENGECAT KULKAS/JUAL BELI AC BEKAS, DLL

HP. 0812 635 99957 7352833

SERVICE

WC WC

KONSTRUKSI

TUMPAT/ SEDOT

77442112

0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi

Jl. P. BRAYAN MEDAN

HP. 0813 7035 7291 Ada Garansi

WC TUMPAT / SEDOT Hub. 0813 6151 3698 0853 7276 7755

Harian WASPADA


Politik & Hukum

A8

WASPADA Kamis 9 Agustus 2012

Syamsul ‘Restui’ Duet Gatot – Fadly

Waspada/Armin Nasution

PENGURUS asosiasi ternak dari Langkat saat memberikan dukungan kepada Gus Irawan Pasaribu di Gus Center.

Peternak Langkat Siap Dukung Gus MEDAN (Waspada): Asosiasi Peternak Langkat mengaku siap memenangkan Gus Irawan Pasaribu dalam pemilihan gubernur tahun depan. Mereka juga akan membentuk tim pemenangan Gus di daerah itu. Hal tersebut terungkap dari 11 pengurus asosiasi peternak Langkat yang datang ke Gus Center di Jl. Pattimura kemarin dan diterima langsung Gus Irawan. Mereka yang hadir adalah Santoso, Aminuddin, Armanila, Dar Ikhsan Daulay, Idham, Ponidi, Supriadi, Sartono Amnas, Untung S, Syabrama Bugis, Satiman dan Agus Manan. Dalam pertemuan yang digelar di ruang utama itu para peternak menyampaikan kondisi dan persoalan yang mereka hadapi kepada Gus Irawan. Sartono Amnas, misalnya, mengungkapkan selama ini kepedulian terhadap peternak masih rendah. “Kita ini berusaha sendiri. Pemerintah hampir tak pernah tahu kondisi kita yang sesungguhnya itu seperti apa. Kita besar ya besar sendiri. Padahal kesulitan peternak ini banyak,” jelasnya. Para peternak itu memanfaatkan kesempatan bertanya lebih banyak dengan Gus Irawan tentang bagaimana sikapnya dan pandangannya memberdayakan peternak. Gus Irawan Pasaribu menjawab pertanyaanpertanyaan itu kemudian menegaskan keinginannya maju jadi gubernur. “Pada prinsipnya saya itu mengusung visi Sumut Sejahtera. Atau lengkapnya perubahan menuju Sumut Sejahtera.” Dia mengatakan selama 12 tahun berkecimpung di dunia perbankan setidaknya sudah faham benar bagaimana memberdayakan ekonomi. “Bicara ternak itu bicara ekonomi, membahas sawit itu juga berhubungan dengan ekonomi.

Bahkan soal zakat sekali pun kaitannya dengan ekonomi.” Menurut Gus Irawan, ekonomi kerakyatan dan Sumut Sejahtera itu tidak bisa sekadar wacana. “Bayangkan seperti ini kalau misalnya kita minum teh dan kopi di restoran besar kita keluarkan Rp500 ribu. Ternyata kalau uang itu dimanfaatkan menjadi dana bergulir sudah bisa membantu menjadi modal.” “Kita rasa minum di restoran dan hotel bintang lima dengan uang sebanyak itu murah. Padahal kalau itu disalurkan sudah bisa mensejahterakan,” tuturnya. Gus Irawan juga menyinggung soal kesejahteraan peternak yang akan menjadi perhatiannya. “Bagaimana pun itu bicara ekonomi. Kita harus fikirkan ke arah mana peternak ini mau dibawa. Jangan mereka sulit-sulit sendiri tanpa bantuan pemerintah,” jelas Gus Irawan. Dia juga mengaitkan kesulitan modal para peternak dengan dana bantuan sosial. “Gambarannya begini ya. Kita itu setidaknya ada dana bansos Rp1,2 triliun. Saya mau tanya sudah seberapa besar dana itu bisa menyejahterakan masyarakat. Pasti belum.” Padahal dana seperti itu harusnya tidak bisa dibagikan gratis kepada masyarakat coba kalau itu dijadikan dana bergulir. “Makanya waktu ditanya Golkar berapa tahun bisa mengentaskan kemiskinan saya jawab tiga tahun saja,” jawabnya. Usai berdialog para peternak dan Gus Irawan membahas berbagai hal tentang mekanisme penguatan dukungan. Termasuk juga beritaberita black campaign yang menyerang Gus dan tersebar di Langkat. Setelah diskusi, Gus dan rombongan peternak itu foto bersama di Gus Center.(m06)

MEDAN (Waspada): Duet H. Gatot Pujo Nugroho, ST dengan H. Fadly Nurzal, S.Ag akhirnya memperoleh ‘restu’ dari Gubsu nonaktif H. Syamsul Arifin, SE untuk dipasangkan dalam Pilgubsu tahun depan. Ratusan orang yang hadir dalam acara berbuka puasa diselenggarakan DPW PPP Sumut menyambut gembira ‘’bocoran politik’’ itu dengan tepuk tangan, bahkan terdengar ucapan ‘’alhamdulillah’’ di Panti Asuhan Perguruan Muhammadiyah Jl. Demak Medan, Selasa (7/8). Awalnya, Ketua Dewan Pimpinan Wilayah Partai Persatuan Pembangunan Sumut Fadly Nurzal dalam sambutannya mengatakan, sudah menjadi tradisi partainya sejak dulu, setidaknya dalam 6-7 tahun terakhir ini mengadakan berbagai kegiatan partai apalagi dalam kaitan berbuka puasa selalu di panti asuhan. ‘’Kami ingin dekat dengan umat, khususnya anakanak yatim-piatu, menjadi sahabat anak yatim, mengurus mereka sehingga kelak bisa menjadi anak yang berguna bagi masyarakat, bangsa, dan negara,’’ ujar Fadly. PPP Sumut, lanjut Fadly Nurzal, sudah lama komitmen berupaya memberdayakan anak yatim piatu di panti-panti asuhan. Itu sebabnya jarang kami melakukan kegiatan di hotel karena sangat tidak familiar dengan masyarakat, khususnya umat Islam, terlebih lagi anakanak panti asuhan. Kalau diselenggarakan di hotel, banyak yang canggung, bingung. Nggak tahu bagaimana cara naik lift, mau buang air ke toilet dll. Justru itulah PPP Sumut memilih mengadakan acara di panti asuhan, membuat kami dekat dengan berbagai kalangan umat Islam yang juga punya kepedulian terhadap anak yatim. ‘’Kami merasa senang bisa membahagiakan anakanak yatim, dan merasa lebih membumi di panti asuhan ini,’’ ujar Fadly, mantan aktivis Islam yang peduli akan nasib Muslim di Rohingya. Alasan lain mengapa PPP Sumut memilih membaur dengan anak-anak yatim di panti asuhan, menurut Fadly Nurzal yang juga anggota DPRD Sumut disebabkan sangat sedikit orang yang peduli mengurus anakanak yatim-piatu. Kalau meng-

H. Gatot Pujo Nugroho, ST

H. Fadly Nurzal, S.Ag

urus hal-hal yang terkait orang kaya sudah banyak yang mau mengurusnya. Adapun niat kita peduli anak yatim-piatu semata-mata karena Allah SWT, di mana kita diminta peduli akan nasib anak-anak yatim-piatu yang kehidupannya kurang beruntung. Restu Syamsul Menurut Ketua DPW PPP Sumut dalam pidatonya kemudian, tadi menjelang acara berbuka puasa ini pihaknya sempat berkomunikasi telefon dengan Gubsu non-aktif H. Syamsul Arifin, SE. ‘’Saya tadi ditelefon Pak Syamsul. Dia tanya siapa yang datang di acara berbuka puasa sore ini, saya jelaskan mas Gatot hadir… Syamsul mengatakan, Ya sudah, betul, bagus itu,’’ ujar Fadly menirukan suara Syamsul Arifin di mana selama ini jalinan komunikasi pihaknya dengan ‘’Datuk’’ tetap berjalan lancar. Para undangan yang hadir pun ikut bertepuk tangan dengan adanya informasi terbaru berupa ‘’restu’’ Syamsul Arifin untuk pasangan Gatot Pujo Nugroho – Fadly Nurzal sebagai bakal calon Gubsu periode 2013-2018. Selama ini, komunikasi pengurus DPW PPP Sumut maupun DPP PPP dengan Plt Gubsu Gatot Pujo Nugroho selalu diberitakan kurang ‘’mesra’’. Salah seorang Ketua DPP PPP Drs H Hasrul Azwar, MM saat ditemui Waspada di Hotel Pangeran, Pekanbaru, bulan lalu, situasinya masih sama, sudah putus komunikasi sehingga kami menunggu saja. Keyakinan Waspada situasi akan mencair datang dari jawaban Abdul Hakim Siagian, SH, M.Hum, penasihat hukum

Syamsul Arifin. ‘’Tidak ada dendam, tidak betul isu Datuk dendam pada Gatot. Soal tidak diangkat-angkatnya dia menjadi Gubsu definitif hal itu urusan Depdagri,’’ ujar Siagian saat bertemu Waspada dalam satu acara di RRI Medan. Adapun isu Datuk ‘’dendam’’ pada Gatot bermula dari berlarutnya proses hukum Syamsul yang mengajukan banding, kasasi hingga PK sehingga periode jabatan Gatot terhambat, diperkirakan tak cukup lagi menjabat Gubsu definitif. Gayung bersambut Plt Gatot Pujo Nugroho dalam sambutan singkatnya mengajak anak-anak yatim-piatu tetap bersemangat belajar guna mengejar cita-cita. Ketahuilah, Rasulullah juga anak yatim-piatu, Ketua DPW PPP Sumut juga yatim-piatu, saya sendiri anak piatu. Yang penting belajar dengan giat, jangan patah semangat, tetap optimis untuk maju ke depan. Gatot menambahkan, saat ini saudara kita Muslim Rohingya, Myanmar, dalam penderitaan hebat. Kehidupan mereka kucar-kacir dizalimi, sebagian mengungsi ke Indonesia, dan ada yang sampai di Medan sehingga menjadi perhatian kita membantu mereka saat ini dalam penampungan. Menyambut kemungkinan dirinya berpasangan dengan Ketua DPW PPP Sumut Fadly Nurzal dalam Pilgubsu mendatang, menurut Gatot sangat memungkinkan bisa mendulang suara dari masyarakat Sumut, khususnya umat Islam. Sebab, Fadly Nurzal mewakili PPP, saya sendiri PKS, ditambah denghan PKB dll bisa menjadi satu kekuatan pasangan Islam dalam Pilgub tahun depan.(m03)

Penerimaan Tersangka, Barang Bukti Di Kejari Medan Perlu Dievaluasi MEDAN (Waspada): Masyarakat Peduli Polri merasa prihatin terhadap kinerja Kejaksaan Negeri (Kejari) Medan tentang tata cara penerimaan tersangka dan barang bukti dari kepolisian yang terkesan berbelit-belit. “Peraturan sepihak yang

dilakukan Kejari Medan, perlu dievaluasi tentang penerimaan tersangka dan barang bukti,” kata seorang masyarakat Peduli Polri kepada Waspada, Rabu (8/ 8) sore. Menurutnya, pengiriman tersangka dan barang bukti dari kepolisian kepada Kejaksaan

Negeri Medan, tidak sesuai prosedur. Sebab, ditentukan Kejari Medan hanya menerima tersangka dan barang bukti pada hari Senin dan Rabu. Sedangkan batas waktu penerimaan tersangka dan barang bukti hanya sampai pukul 10:00. Apabila pengiriman lewat

Partai Nasdem Siap Diverifikasi MEDAN (Waspada): Setelah melengkapi seluruh syarat administrasi, Partai Nasional Demokrat (Nasdem) siap diverifikasi oleh Komisi Pemilihan Umum (KPU). Keberadaannya di tingkat provinsi, kabupaten/kota, kecamatan hingga ranting, diklaim sudah mencapai 100 persen. Ketua DPP Partai Nasdem H. Patrice Rio Capella, SH mengatakan, Sumatera Utara merupakan provinsi ke-32 dalam penyerahan verifikasi ke KPU. Penyerahan terakhir nanti di Jakarta. Penyerahan verifikasi ini dihadiri ketua DPW dan DPD seluruh Indonesia. “Pada 10 Agustus nanti, semua kepengurusan mulai dari pusat, provinsi dan kabupaten akan didaftarkan ke KPU, termasuk keanggotaan sesuai persyaratan,” ujar Patrice kepada wartawan di Medan, Rabu (8/8). Setelah mendaftarkan diri ke KPU, lanjut Patrice, pihaknya segera menyiapkan calon anggota legislatif tingkat provinsi dan kabupate/kota untuk bertarung pada pemilihan umum 2014. “Kita sudah siap maju pada pemilihan umum 2014. Kita optimis, Partai Nasdem akan diterima masyarakat. Soal verifikasi, 100 persen keanggotaan sudah siap,”ujarnya. Sementara itu, Ketua DPW Partai Nasdem

Ali Umri, SH, MKn juga mengaku optimis. Setelah diverifikasi oleh KPU, pihaknya sudah menyiapkan calon anggota legislatif yang akan diikutsertakan pada pemilihan umum 2014. “Sampai hari ini, kelengkapan yang menjadi persyaratan keberadaan DPW Partai Nasdem Provinsi Sumut, 33 DPD kabupaten/kota dan 416 DPC kecamatan telah rampung baik susunan kepengurusan serta jumlah kader sebagai anggota partai,” ujar Ali Umri. Apalagi Partai Nasdem sudah diakui keberadaannya sebagai partai politik oleh Menteri Hukum dan HAM sesuai surat keputusan No: M.HH16.AH.11.01.2011. Sebelumnya dilaksanakan Rakorwil yang diakhiri dengan berbuka puasa bersama pengurus DPP, DPW dan DPD Partai Nasdem dengan keluarga besar ormas Nasional Demokrat, tokoh masyarakat serta kader partai. Pada kesempatan itu, diserahkan santunan kepada 100 anak yatim. Ketua Panitia Rakorwil Persiapan Verifikasi KPU Provinsi Sumut Tetty Juliaty, SE, MSi menambahkan, Rakorwil dihadiri Ketua dan Sekretaris DPD Partai Nasdem dari 33 kabupaten/kota di Sumut.(m25)

dari pukul 10:00, maka anggota Polri yang mengirim tersangka dan barang bukti harus terkena cash (harus berikan upeti di bagian tahanan). Selain itu, tata cara pengiriman harus melalui beberapa tahapan yang menyulitkan. Di antaranya kepolisian yang membawa tersangka dan barang bukti ke bagian tahanan Kejari Negeri Medan, dilakukan regestrasi dan surat pengantar pengiriman harus ditandangani oleh Kepala Tahti berinisial A. Oknum A sering tidak berada di tempat, sehingga pihak kepolisian yang mengantar tersangka dan barang bukti dibuatnya kelabakan dan bingung karena mau tanda tangan saja harus mencari keberadaan oknum A. “Apabila anggota kepolisian melakukan pengiriman lewat pukul 10:00, disinilah oknum A mulai bertingkah, sehingga anggota kepolisian itu harus memberi upeti (uang),” ujarnya. Selain itu, berkas perkara harus diterima langsung oleh jaksa yang menanganinya dan disini selalu terjadi kendala, sebab sering jaksa tersebut tidak ada di tempat. Apalagi kalau jaksa yang menanganinya dari Kejati sehingga harus ditunggu sampai datang.

“Kita prihatin melihat anggota kepolisian yang mengirimkan tersangka dan barang bukti tersebut, sebab mereka harus berada di kejaksaan itu mulai dari pukul 09:00 sampai pukul 15:00 baru selesai. Padahal, banyak tugas lainnya yang harus diselesaikan anggota kepolisian itu,” katanya. Paling prihatin lagi dengan adanya peraturan yang diberlakukan Kejari Medan yakni dalam rangka hari raya Idul Fitri, Kejari Medan menentukan menerima tersangka dan barang bukti paling akhir hanya sampai pada 3 Agustus 2012. Selanjutnya, kembali menerima tersangka dan barang bukti pada 27 Agustus 2012. “Padahal, dalam rangka hari raya Idul Fitri, Polri tidak ada liburnya sama sekali,” ungkapnya. Hindari habisnya masa tahanan Sementara itu, Kejaksaan Negeri (Kejari) Medan segera melengkapi berkas seluruh perkara terkait menyambut Hari Raya Idul Fitri dan cuti bersama mendatang. “Memang tidak ada jangka waktu pengiriman berkas dari kepolisian ke Kejari Medan. Tapi jangan karena adanya cuti bersama seseorang yang ditahan habis masa tahanannya. Begi-

tupun kami paham, kepolisian juga tengah menyusun pemberkasan tahap awal untuk dilimpahkan menjadi tahap dua kepada kami,” ujar Kasipidum Kejari Medan Riki Septa Tarigan, Selasa (7/8). Untuk itu, lanjutnya, saat ini pihaknya tengah melakukan koordinasi dengan kepolisian terutama Polresta Medan, agar segera melimpahkan berkas perkara untuk selanjutnya disusun administrasinya di Kejari Medan. “Kita terus koordinasi dengan kepolisian,” sebutnya. Disebutkan Riki, dikejarnya pemberkasan di Kejari Medan untuk menghindari habisnya masa tahanan seorang tersangka. Untuk itu diperkirakan pada tanggal 9 - 10 Agustus mendatang seluruh administrasi pemberkasan yang dilimpahkan kepolisian ke Kejari Medan sudah rampung. Disinggung prihal pelimpahan berkas perkara ke Pengadilan Negeri (PN) Medan apakah tetap diserahkan seluruhnya, Riki mengaku akan memilah-milah. Perkara-perkara yang urgent, akan menjadi prioritas pihaknya untuk langsung dilimpahkan ke PN Medan agar segera disidangkan, selebihnya dipending sampai usai lebaran. (m36/m38)

Pencuri Tas Dihajar Massa

Waspada/ist

KETUA DPP Partai Nasdem H. Patrice Rio Capella, SH menyerahkan data persiapan verifikasi kepada Ketua DPW Partai Nasdem Sumut M. Ali Umri, SH, Mkn.

MEDAN (Waspada): Mantan narapidana yang baru bebas dari Lembaga Pemasyarakatan Tanjung Gusta berinisial NP, 38, warga Desa Sigara-gara, Patumbak, babakbelur dihajar massa karena mencuri tas dari dalam mobil Innova BK 1004 HI milik Ratno, 40, di Jln. Pemuda, Selasa (7/8) sore. Akibat amuk massa itu, wajah Nelson lebam-lebam serta dari hidung dan pelipisnya mengeluarkan darah. Saat diboyong ke Mapolsek Medan Kota kondisi tersangka masih lemah. Berdasarkan keterangan di kepolisian, sore itu tersangka dan rekannya bermarga Butarbutar mengendarai sepedamotor melintasdiJln.Pegadaian.Mereka kemudian berhenti di dekat mobil Innova yang terparkir, dan melihat tas di kursi kiri depan. Tersangka NP yang berada di boncengan turun kemudian

memecah kaca mobil menggunakan batu. Namun aksinya tidak berjalan mulus karena tiba-tiba alarm mobil berbunyi. Beberapa warga yang curiga kemudian mendekati pelaku. Sadar aksinya diketahui, NP segera melarikan diri, sementara Butarbutar yang menunggu di sepedamotor juga lari meninggalkan temannya. Upaya NP kabur tidak berhasil. Di Jln. Pemuda warga dibantu personel Polsek Medan Kota berhasil meringkusnya. Namun warga yang sudah kalap langsung memukuli dan menendangnya bertubi-tubi, meski coba diredam polisi. Namun akhirnya aksi main hakim itu bisa dihentikan. Kemudian tersangka dibawa ke Mapolsek Medan Kota. Menurut korban, dia baru 30 menit masuk ke kantor Pegadaian, dan mendengar bunyi

alarm mobilnya, sehingga dia keluar dan mendapati kaca mobil bagian depan sebelah kiri sudah pecah. “Begitu keluar sudah ramai orang, dan kaca depan sudah pecah,” katanya. Sedangkan tersangka mengaku bekerja sebagai sopir serap MPU mengatakan, semula tidak berniat melakukan pencurian. “Saya gak ada niat, tapi saat kami lewat kulihat ada tas di bangku depan. Kemudian aku turun lalu kuambil batu langsung kupecahkan kaca mobilnya. Ternyata alarmnya bunyi,” kata NP. Kapolsek Medan Kota Sandy Sinurat mengatakan, pihaknya masih menyelidiki kasus itu dan mengejar rekan tersangka. “Karena tidak tertutup kemungkinan keduanya yang kerap melakukan pencurian dengan cara yang sama di wilayah hukum kita,” ujarnya.(m27)

Kosgoro 57: Partai Golkar Jangan Semena-mena Tetapkan Cagubsu MEDAN(Waspada):SalahsatuOrmasyangikutmendirikanGolkar yakni Kesatuan Organisasi Serba Guna Gotong Royong 1957 (Kosgoro 57) Sumut mengingatkan Partai Golkar, untuk tidak semena-mena menetapkan calon Gubsu yang akan diusung dalam Pilkada 2013. “Jangan karena punya kewenangan, maka semena-mena menetapkan calon,” kata Ketua Kosgoro 57 Sumut H. Irwansyah Nasution usai berbuka puasa bersama dengan Keluarga Besar Kosgoro 57 dan anak yatim di kediamannya Jl. Yayasan/Gaperta Ujung Medan, Sabtu (4/8). Menurutnya, Golkar harus bercermin pada pengalamanpengalaman Pilkada lima tahun lalu. Saat itu, calon yang ditetapkan Golkar menduduki urutan kelima dari lima calon yang maju. “Kita sudah buktikan pada Pilgubsu lima tahun lalu, tanpa kerja keras pun nomor lima itu pasti diraih. Ini peringatan besar buat Golkar agar tidak semena-mena,” tegasnya. Kata Irwansyah, jika Golkar tetap menggunakan kesombongan kekuatan untuk menentukan calon Gubsu tanpa memandang elektabilitas hasilnya akan sia-sia. “Ke depan Golkar harus berpikir ke arah itu. Golkar ini partai besar yang memiliki jaringan luas serta pengalaman yang cukup lama dan modern, maka dalam memilih calon yang akan diusung harus memandang elektabilitas dan harus menang,” terangnya. (h02)

Rumah Dibobol Maling Rp100 Juta Raib BELAWAN (Waspada): Kawanan maling menggasak uang Rp100 juta dan sejumlah perhiasan berupa cincin, gelang, dan kalung emas milik staf PLN Gardu Induk Marelan, Mangasa Tua Nainggolan, 55, di Jalan Marelan Raya, Pasar II Barat Gang Pertama, Kel. Rengas Pulau, Kec. Medan Marelan, Minggu (5/8) malam. Keterangan dari lapangan menyebutkan, pelaku diperkirakan berjumlah lima orang mengendarai dua sepedamotor dan kejadian itu terjadi pada saat korban tidak berada di rumahnya. Diperkirakan kawanan maling masuk ke dalam rumah korban melalui pintu depan yang dirusak menggunakan linggis. Kondisi pemukiman yang ketika itu sunyi memungkinkan pelaku dengan leluasa mengacak-acak dan menguras harta berharga korban. Kejadian itu baru diketahui korban yang pulang ke rumahnya sekitar pukul 20:30. Dia melihat pintu rumahnya telah rusak. Ketika memeriksa dalam rumah, korban melihat pintu ruang tamu dan pintu kamarnya juga rusak serta acak-acakkan. Selanjutnya korban melaporkan kejadian itu ke Polsek Medan Labuhan. Mendapat laporan itu, polisi datang ke rumah korban melakukan cek TKP. “Kata saksi sore memang ada yang masuk, tapi tetanggannya mengira tamu kami, makanya mereka tidak curiga,” kata Mangasi di Mapolsek Medan Labuhan. Belum ada orang yang dicurigai sebagai pelaku pencurian itu dan polisi masih melakukan penyelidikan. “Kita masih melakukan penyelidikan,” kata Kanit Reskrim Polsek Medan Labuhan AKP Oktapianus saat dikonfirmasi. (h03)

Kepling Tolak Warga Ambil Raskin MEDAN (Waspada): Sejumlah warga Lingkungan XIV, Kel. Kenangan Baru, Perumnas Mandala, Kec. Percut Seituan, Sabtu (4/8), mengeluh karena kepala lingkungannya menolak memberikan jatah beras miskin (raskin) kepada mereka. Ironisnya, jatah raskin diberikan kepada orang-orang yang dekat dengan oknum kepling tersebut. Mereka yang tak diberi jatah raskin, dua di antaranya yang bermukim di Jalan Penguin XVI. Dua ibu rumahtangga masing-masing Santi, 37, dan Dian, 30. Selama ini, keduanya membeli raskin melalui ‘kaki tangan’ oknum kepala lingkungan seharga Rp6 ribu per kilogram. Saat kedua ibu rumahtangga itu hendak mengambil jatah raskin di rumah oknum Kepala Lingkungan XIV, keduanya ditolak, dengan alasan belum ada izin dari Lurah Kenangan Baru, meskipun nama keduanya sudah terdaftar dalam daftar penerima raskin. “Saat kami datang ke rumah kepling, kami malah diusir. Alasannya, kami tidak terdaftar sebagai warga Lingkungan XIV, padahal kartu keluarga kami ada. Kami proteslah, tapi dibilang Kepling, kalau kami mau minta, pergilah sana ke kantor lurah. Kalau pak lurah ngasih, barulah kami bisa dapat. Sementara yang lain udah dibaginya. Gak adil kali kek gitu,” sebut Santi. Kepala Lingkungan XIV Penguin Amhar Siregar yang dikonfirmasi di rumahnya membenarkan pihaknya tidak memberi jatah raskin pada Santi dan Nita. Dia beralasan tidak mengenal kedua wanita itu, meskipun nama keduanya terdaftar sebagai penerima jatah raskin. “Siapa mereka rupanya? Saya gak kenal. Ngapain saya kasih,” kata Amhar. Amhar Siregar mengaku hanya membagikan jatah raskin kepada orang-orang yang dikenalnya saja. Kepling tersebut juga mengaku bingung membagikannya, lantaran ada nama beberapa warga yang tak ia kenal di daftar penerima raskin. Dengan alasan itu, kepling tersebut tidak membagikan kepada orang-orang seperti Santi dan Nita. “Jatah kami kali ini hanya 215 kg. Biasanya dapat lebih. Apalagi yang mau dibagi, soalnya sekarang cuma tinggal satu goni lagi. Untuk apa saya makan beras ini,” sebutnya sembari menambahkan akan meminta persetujuan dari lurah. Jika diizinkan, maka orangorang seperti Santi dan Nita akan diberikan beras. Camat Percut Seituan Darwin SSos yang dikonfirmasiWaspada mengatakan, warga yang terdaftar namanya penerima raskin wajib diberikan. “Mereka yang namanya sudah tertera dalam daftar penerima raskin harus diberikan jatah berasnya,” tutur Darwin seraya berjanji akan memanggil oknum kepling dan Lurah Kenangan Baru. (h04)


Luar Negeri Arab Saudi Tuduh Myanmar Lakukan Pembersihan Etnis

A9

WASPADA

Kamis 9 Agustus 2012

RIYADH (AP/CNN/Antara/Reuters): Pemerintah Arab Saudi menuduh Myanmar telah melakukan pembersihan etnis. Tuduhan ini dilayangkan terkait peristiwa pembantaian yang terjadi terhadap etnis Rohingya. “Kami mengecam kampanye pembersihan etnis dan serangan brutal terhadap warga etnis Rohingya yang dilakukan Myanmar. Mereka telah melakukan pelanggaran HAM, dengan memaksa etnis Rohingnya meninggalkan kampung halamannya,” pernyataan Kabinet Pemerintahan Arab Saudi, seperti dikutip Kantor Berita SPA, Rabu (8/8). Selama ini, etnis Rohingya yang mayoritasnya beragama Islam, kerap mendapatkan perlakuan diskriminatif dari Pemerintah Myanmar. Meskipun mereka sudah berada di Myanmar ratusan tahun lalu, etnis Rohingya tetap tidak dianggap sebagai warga negara Myanmar dan kerap mengalami tindakan kekerasan. “Atas insiden yang terjadi di Myanmar, Pemerintah Arab Saudi mendesak dunia internasional melakukan tanggung jawabnya

dengan memberikan perlindungan dan menyediakan kebutuhan bagi etnis Rohingya di Myanmar. Ini harus dilakukan agar tidak ada lagi korban jiwa,” imbuh pernyataan tersebut. Juni lalu, terjadi kerusuhan antara etnis Rohingya dengan etnis Rakhine di wilayah barat Rakhine.Insideninimenyebabkan 80 orang dinyatakan tewas, dimana sebagian besar korban tewas adalah warga etnis Rohingya. Pemerintah Myanmar selama ini tidak pernah mau mengakui keberadaan etnis Rohingya. Bahkan, Presiden Myanmar Thein Sein lebih memilih untuk melakukan deportasi atau bahkanmemindahkanetnisRohingya ke tempat penampungan. ASEAN bantu Rohingya SekjenASEANSurinPitsuwan mengatakan, ASEAN akan ikut ambilbagiandalammenemukan

solusi atas setiap yang muncul dinegara-negaraanggotanya.Hal ini ditegaskan Surin ketika disinggung sikap ASEAN atas pembantaian etnis Rohingya di Myanmar. “Kita tidak ingin memperluas masalah ini. Setiap negara anggota ASEAN juga telah mengupayakan kontribusi mereka masingmasing untuk membantu meringankan penderitaan dan rasa sakit rakyat Myanmar,” tegas Surinketikaditemuiusaimemimpin upacara HUT ASEAN ke-45 di Gedung Sekretariat ASEAN, Jakarta, Rabu. “Kami juga telah mendengar dari sejumlah organisasi internasionalsepertiPBBdanOKIbahwa mereka bersedia mendukung demi menyelesaikan masalah ini. Sementara ASEAN sekali lagi harus menyalurkan bantuan kemanusiaan seperti yang telah kita lakukan empat tahun yang lalu,” beber Surin. Sementara itu ketika dising-

gung join komunike ASEAN terkaitisuLautChinaSelatanyang tidak kunjung muncul , Surin menyatakanharapannyaagarjoin komunikeASEANtersebutsegera rampung. “Kami berharap komunike bersama ini segera muncul,” ujar Surin. PBB desak bantuan segera PBB yang mengurus pengungsi, mendesak agar Bangladesh mengizinkan bantuan kemanusiaan kembali masuk ke Myanmar. PBB menginginkan warga etnis Rohingya bisa mendapatkan bantuan secepatnya. “Badan Pengungsi PBB meminta Pemerintah Bangladesh untuk menjamin bantuan dari organisasi non-pemerintah, bisa tersalurkan kepada sekira 40 ribu warga etnis Rohingya yang keluar dari Myanmar. Mereka adalah warga Rohingya yang terdaftar keluar dari wilayah Rakhine,” ujar jurubicara Sekjen PBB, Martin Nesirky, seperti dikutip Xinhua,

Rabu. “KamimengharapkanPemerintah Bangladesh bisa mempertimbangkan keputusannya, sejalan dengan tradisi mereka yang bersikap ramah terhadap mereka yang lari dari Myanmar sejak beberapa tahun lalu,” imbuhnya. Sementara itu, Presiden Pakistan Asif Ali Zardari mengungkapkankekhawatirannyaatas kondisi yang dialami oleh etnis Rohingya di Myanmar. Zardari pun sempat menyurati Presiden Myanmar Thein Sein terkait masalah ini. Dalam suratnya kepada Presiden Thein, Zardari meminta agarPemerintahMyanmaruntuk merehabilitasi status etnis Rohingya. Ini harus dilakukan agar etnis Rohingya bisa kembali ke rumahnya dan menjalani kehidupan yang aman. “Rakyat dan Pemerintah Pakistan menyesalkan peristiwa yang menewaskan etnis Rohing-

Seputar ASEAN

ya. Kami amat khawatir dengan kondisi yang dialami warga etnis Rohingya,” pernyataan Presiden Zardari, seperti dikutip The News, Rabu. Setelah sempat melakukan pertemuandenganMenluMyanmar, Menlu RI Marty Natalegawa memperingatkan pentingnya transparansi dalam penyelesaian masalah Rohingnya. Peringatan itu disampaikan langsung oleh MenluNatalegawakepadaMenlu Myanmar. Sebelumnya Presiden Susilo BambangYudhoyono telah mengirimkan surat kepada Presiden Myanmar Thien Sien terkait dengan persoalan Rohingya. Menurut Marty, Myanmar telah menerimasurattersebutdanmenyampaikan apresiasinya. “Saat ini Myanmar tengah dalam proses untuk membalas surat tersebut,” ujar Marty di Gedung Sekretariat ASEAN, Jakarta Rabu.(ok/vn/m10)

BEIJING, China (CNN): Badai tropis Haikui telah menerjang provinsi Zhejiang pada Rabu (8/8) pagi, semua warga diminta untuk tidak keluar rumah. “Badai ini akan berdampak buruk bagi warga,” kata ahli meteorologi CNNI ,Taylor Ward, yang mencatat bahwa badai Haikui telah berkurang dari status angin topan sebelum menyentuh tanah di sekitar 225 km selatan Shanghai. “Kami telah memiliki 8 pendeteksi yang disebar di beberapa lokasi.” Ward mengatakan bahwa hujan yang akan turun diperkirakan sangat lebat. Badai Haikui bergerak dari barat laut dengan kecepatan 20 km per jam, diharapkan badai ini akan menjauh pada dua hari mendatang, katanya. Para tentara China telah mengevakuasi sekitar 374.000 orang dari kota Shanghai dan 250.000 dari provinsi Zhejiang, menurut China Daily. Badai Haikui yang telah berubah menjadi angin topan pada Selasa (7/8) adalah badai tropis ketiga yang menerjang pantai timur China dalam waktu kurang dari seminggu.

Muslim AS Tuntut Tingkatkan Keamanan Rumah Ibadah

Ibunegara Korut Hidup Mewah SEOUL (Waspada): Ibunegara Korea Utara (Korut) Ri Solju terlihat sedang mengenakan tas mewah bermerk Christian Dior. Harga tas itu sendiri mencapai AS$1.594 atau sekira Rp15 juta. Kondisi ini tentunya menjadi sebuah ironi, mengingat warga Korut masih dilanda wabah kelaparan. Bencana banjir yang melanda juga turut membuat hidup warga dilanda kesusahan. Ri Sol-ju terlihat membawa tas mewah tersebut ketika menemani suaminya, Kim Jong-un yang sedang mengunjungi fasilitas militer. Media nasional Korut mempublikasikan foto itu, bersama dengan televisi nasional. Istri Jong-un itu mengenakan gaun berwarna putih dan membawa tas kecil dengan logo ‘D.’ Hingga saat ini, belum diketahui apakah tas itu benar-benar asli Christian Dior atau hanya imitasi, demikian diberitakan AFP, Rabu (8/8). Belakangan ini, negeri komunis itu seringkali mempublikasikan foto-foto Jong-un bersama istrinya di tempat-tempat umum. Pasangan itu difoto dalam keadaan tersenyum dan berjalan berdampingan. Hal itu membuat media mulai mempertanyakan identitas Ri yang sesungguhnya. Pernikahan Ri dan Jong-un juga masih menjadi misteri.

KUALA LUMPUR (Antara): Sebanyak 1.436 wanita Malaysia menjadi korban penipuan sindikat “ ‘Awang Hitam’ dalam tiga tahun terakhir, yang merayu mereka melalui laman sosial dan kemudian membujuk korban untuk mengirimkan sejumlah uang. Jumlah kerugian akibat aksi sindikat Awang Hitam, sebutan untuk komplotan warga Afrika, itu mencapai 87,6 juta ringgit. Wakil Ketua II Jabatan Siasatan Jenayah Komersial (JSJK) Bukit Aman, Mohd Rodwan Mohd Yusof seperti dikutip sebuah media massa terbitan Kuala Lumpur, Rabu (8/8) mengatakan, jumlah wanita Malaysia yang menjadi korban sindikat tersebut meningkat dari 514 pada 2010 menjadi 671 pada 2011. Sepanjang Januari hingga Mei 2012, jumlah korban sindikat tercatat 251 orang dan diperkirakan terus meningkat. Kerugian akibat ulah komplotan tersebut tercatat mencapai 20 juta ringgit pada 2010, 50 juta ringgit pada 2011, dan dalam lima bulan pertama 2012 tercatat 17,6 juta ringgit. Data JSJK juga mencatat 834 kasus penipuan yang melibatkan warga Afrika itu pada 2010, 1.117 kasus pada 2011, dan 417 kasus sepanjang Januari-Mei 2012. Menurut hasil penyelidikan, sindikat tersebut menyamar sebagai mahasiswa universitas swasta dan menjaring mangsanya melalui laman sosial Facebook, Twitter, dan Tagged. Sindikatitujugamenggunakanberbagaicarapendekatan,termasuk penipuan dengan modus pengantaran barang, serta memampang fotoberparasrupawanuntukmengecohkorban.Tersangkabiasanya memperkenalkan diri sebagai lelaki tampan berkulit putih serta berpangkat tinggi dan berasal dari Inggris.

Belarusia Usir Semua Diplomat Swedia

Badai Tropis Haikui Terjang Pantai Provinsi Zhejiang, China

JOPLIN (Waspada): Setelah insiden dibakarnya sebuah rumah ibadahumatMuslimdiJoplin,AmerikaSerikat(AS),sebuahkelompok HAM Muslim AS menuntut peningkatan keamanan dari tiap-tiap rumah ibadah yang ada di Negeri Paman Sam. Insiden terakhir makin membuat khawatir umat muslim yang ada di AS. Direktur Dewan Hubungan Islam-Amerika (CAIR) Ibrahim Hoopermengatakan,dibakarnyasebuahmasjiddiJoplinmembuatnya khawatir mengenai keamanan bagi tiap umat beragama untuk berdoa di bulan Ramadan. Sebelumnya bukan tempat ibadah umat Muslim saja yang dipenuhi insiden. Senin sebuah kuil Sikh di Wisconsin ditembaki oleh seorang pria AS dan menyebabkan tujuh orang, termasuk pelaku itu sendiri. Sementara kasus pembakaran rumah ibadah di Joplin, terjadi setelah lima pekan lalu seorang pria sempat mencoba menyulut api di tengah malam. Upaya pembakaran itu sempat terekam di video keamananmasjid,namunpihakkeamanangagalmenangkappelaku. Kini, masjid yang biasa didatangi oleh sekira 50 keluarga di sekitar wilayah tersebut, hangus terbakar Selasa. Insiden tersebut dianggap telah mengancam kebebasan beragama di Negeri Paman Sam. Selama ini, Amerika menilai dirinya sendiri sebagai negara yang menjami kebebasan beragama dari warganya. “Semua sikap panas harus bisa didinginkan. Tetapi ini semua harus dilakukan oleh pemimpin Amerika. Mereka tidak bisa membiarkan kebencian dan sikap intoleransi berkembang di masyarakat,” ujar Akbar Ahmed, Ketua Kajian Islam American University’s School of International Service, seperti dikutip The Associated Press, Rabu (8/8). (ok/m10)

Ribuan Wanita Malaysia Jadi Korban ‘Awang Hitam’

The Associated Press

BADAI LANDA CHINA. Dalam foto yang disiarkan oleh kantor berita Xinhua dari China menunjukkan satu papan tanda jalanan

tumbang di Kabupaten Xiangshan, provinsi Zhejiang, China Timur, Rabu (8/8). Topan Haikui menyapu provinsi di China Timur itu Rabu dinihari, dengan angin berkecepatan 150 km per jam dan menyebabkan terjadinya banjir.

Jenderal Rusia Tewas Di Tangan Oposisi Syria DAMASKUS (Waspada): Oposisi Syria mengumumkan seorang Jenderal RusiaVladimir Petrovich Kodjayev tewas terbunuh dalam kekerasan yang terjadi di negara itu. Selama ini Kodjayev diketahui bertugas sebagai penasihat Menteri Pertahanan Syria. Selain Kodjayev, penerjemah Kordjayev, Ahmed AIG diketahui juga ikut tewas bersamanya. Pihak oposisi mengakui beberapa dokumen penting dan peta milik tentara Syria berhasil ditemukan dalam sebuah operasi khusus yang menewaskan petinggi militer Rusia tersebut. Demikian seperti dilansir Al Arabiya dan dikutip Trend, Rabu (8/8). SelamainiRusiadikenalsebagai sekutu dari rezim Syria yang terus menunjukkan dukungannya kendati berada di tengah tekananBarat.Rusiasendiribahkan telah tiga kali memveto resolusi Dewan Keamanan PBB yang memungkinkandijatuhkannyasanksi atas Syria. Rusia bahkan tidak bergeming ketika Menteri Luar Negeri Amerika serikat (AS) Hillary Clin-

The Associated Press

ANTI CHINA DI TAIWAN. Puluhan anggota pro-kemerdekaan Serikat Solidaritas Taiwan (TSU) melakukan protes menentang China dan rencana perundingan seberang selat di depan Yayasan Pertukaran Selat (SEF) di Taipeh, Taiwan, Rabu (8/8). Protes tersebut timbul ketika Chen Yunlin, kepala Asosiasi untuk Hubungan Seberang Selat Taiwan dari China,tiba di Taiwan untuk melanjutkan perundingan seberang selat dengan rekan sejawatnya dari Taiwan Chiang Pin-kung, ketuaYayasan Pertukaran Selat (SEF) dari Taiwan.

ton mengeluarkan pernyataan mengancam.SaatituClintonmenyebutkan, Rusia dan China akan membayar harga yang mahal karena memanfaatkan hak veto mereka untuk menghalau sanksi atas Syria. Sikap Rusia itu sekaligus menunjukkan besarnya kepentingan Moskow terhadap Damaskus. Bagi Moskow, peran Damaskus sangat besar dalam menjaga pengaruhnya di kawasan Timur TengahmengingatRusiamemiliki basis logistik di Tartous, Syria. Tinggalkan Aleppo PemberontakSyria,yangmemerangi pasukan Presiden Bashar Assad di kota Aleppo, meninggalkan pangkalan mereka di distrik garis depan pertempuran dalam beberapa hari belakangan. “Kami mundur, keluar dari sini,”katapetempurpemberontak ketika mereka tiba Rabu di distrik Salaheddine. Satu pos pemerik-

saan ditangani pemberontak pada pekan lalu kini tidak ada lagi, dengan lokasi hanya ditandai dengan satu bendera oposisi. Ledakan terdengar ketika tembakan menghantam gedung di daerah itu. Seorang sumber keamanan pemerintah Syria mengemukakankepadastasiuntelevisi Lebanon Al-Manar pasukan Syria kini menguasai distrik Salaheddine. Helikopter terbang di atas kantor polisi yang masih berada ditangan pemberontak sekitar satu kilometer dari Salaheddine. Seorang komandan pemberontak yang mengaku bernama Abu Ali mengatakan dia menerima informasi bahwa tank-tank tentara memasuki Salaheddine dan menam-bahkan dia tidak banyak memiliki informasi karena komunikasi buruk. Dari Amman kantor berita The Associated Press melaporkan, pemerintah Jordania mene-

gaskan bahwa PM Syria yang membelot, Riyad Hijab, memangberadadinegeriitu.Pernyataan Sameeh Maaytah kepada kantor berita Petra Rabu itu mengakhiri spekulasi mengenai keberadaan Hijab selama ini. Ketegangan meningkat di Timur Tengah Selasa karena Iran memuji“porosperlawanan”Syria, dan Amerika Serikat mengingatkansoalutusandanaktivitasteror. SaeedJalili,dalampertemuan pejabat tinggi Iran dengan Assad, dikutip oleh media resmi Syria mengatakanbahwadiatidakakan mengizinkan‘musuh’ memecah belah apa yang disebut ‘poros perlawanan di mana Syria merupakan bagian penting.’ “Apa yang terjadi di Syria bukanlah masalah internal tetapi lebih merupakan konflik antar porosperlawanan,dengantujuan untuk menyerang pertahanan Syria,” Jalili menjelaskan.(cnn/ m10)

STOKHOLM (AP/Antara/AFP): Swedia Rabu (8/8) mengatakan Belarusia telah mengusir seluruh diplomatnya, lima hari setelah negara bekas Uni Soviet itu mengusir dutabesar Swedia sehubungan dengan tindakan Stokholm membela hak asasi manusianya. “Presiden Aleaxander Lukashenko mengusir semua diplomat Swedia dari Belarusia. Kekhawati-rannya menyangkut hak asasi manusia mencapai titik tinggi,” kata Menlu Carl Bildt di Twitter, yang dipastikan oleh kementerian luar negeri. “Kami mengetahui hal itu pagi ini,” kata jurubicara kemlu Anders Joerle. Bildt pekan lalu mengatakan Dubes Stefan Eriksson, yang memegang jabatan itu di Minsk tahun 2008, diusir karena pertemuan yang diselenggarakannya dengan kelompok oposisi Belarus. Stokholm segera membalas dengan mengatakan pihaknya tidak menyambut baik seorang dubes baru yang ditunjuk untuk menggantikan seorang utusan yang meninggalkan pos itu beberapa pekan lalu, dan mencabut izin tinggal bagi dua diplomat Belarus yang diminta meninggalkan negara Skandinavia itu. JurubicaraKemluBelarusAndreiSavinykhpekanlalumembantah bahwa Stefan Erikson diusir, dengan mengatakan dalam bahasa yang lebih diplomatis bahwa “satu keputusan telah dibuat untuk tidak memperpanjang surat-surat kepercayaannya.” Sementara itu, Belarusia Rabu mengatakan menarik staf kedutaanbesarnya, yang masih ada, di Swedia dalam perselisihan menyangkut demokrasi dan mengharapkan Stokholm melakukan tindakan serupa terhadap diplomatnya. Pernyataan kementerian luar negeri mengatakan Minsk tidak memutuskan hubungan dengan Swedia, tapi tindakan itu menandakan peningkatan sengketa dan dapat memperburuk hubungan tegang antara negara Uni Eropa tersebut. Belarus mengusir dubes Swedia 3 Agustus setelah 4 Juli mengirim boneka beruang yang membawa pesan-pesan pro-demokrasi dengan parasut ke bekas republik Soviet dari sebuah pesawat ringan yang dicarter oleh satu perusahaan hubungan masyarakat. Dubes Belarus untuk Swedia juga ditarik. Kemlu mengatakan Minsk kini telah menarik staf kedubesnya yang masih tinggal karena Swedia memperburuk situasi dengan mengusir dua diplomat lagi dan menolak mengizinkan seorang dubes baru Belarus untuk mengambil alih jabatan itu. (m10)

Tiga Pasukan NATO Tewas Di Afghanistan KABUL(AP):Duapengebombunuhdirimengarahkanserangannya pada satu patroli NATO di timur Afghanistan Rabu (8/8) yang menewaskan tiga pasukan sekutu itu, demikian menurut pihak berwenang Afghanistan dan pasukan militer internasional itu. Talibandengancepatmenyatakanbertanggungjawabatasserangan itu di provinsi Kunar. Serangan tersebut mempertegas bahwa para pemberontakmasihmampumelanjutkanaksiperlawanannyameski berbagaiusahaolehpemerintahAfghanistandanpasukaninternasional untuk menyapu semua kepemimpinan militan. Dua penyerang meledakkan jaket bom bunuhdiri mereka ketika patroli jalan kaki NATO melintasi markasbesar pemerintah provinsi di Kunar, demikian menurut kepala polisi provinsi Ewas Mohammad Naziri. NATOmembenarkanbahwatigadarianggotapasukannyatewas dalam satu serangan bunuhdiri , namun tidak memberikan rincian lebih lanjut, termasuk kebangsaan pasukan yang tewas itu. Sekurangkurangnya satu warga sipil Afghanistan tewas dan tiga lainnya cedera dalamdualedakanyangterjadikira-kirapukul10:00pagi,kataWasifullah Wasify, seorang jurubicara gubernur Kunar. Sehari sebelumnya, seorang prajurit NATO yang ditembak mati SelasadiAfghanistanolehorang-orangyangberseragammiliteradalah wargaAmerika,kataseorangpejabatpertahananAS,setelahpersekutuan Barat itu mengumumkan kematian seorang prajuritnya. Menurutpejabatitu,korbanterakhirdalamserangkaianserangan ‘hijauterhadapbiru’ituadalahprajuritAngkatanDaratAS.Duatersangka penembak yang memakai seragam Tentara Nasional Afghanistan telahditahan,danpenyelidikandilakukanuntukmenetapkanapakah mereka penyusup Taliban, kata pejabat itu.(m10)

Gema Internasional

Kasus AS: Kepemilikan Senjata Api Perlu Dibatasi LAGI-LAGI dunia dikagetkan terjadinya penembakan membabibuta yang dilakukan seorang mahasiswa tingkat doktoral suatu universitas yang prestisius di Amerika Serikat. Holms sang mahasiswa, telah memberondong penonton yang sedang menyaksikan film Batman seri terbaru di salah satu bioskop di Aurora, Colorado. Diberitakan 12 orangtewasdanpuluhanlainnya luka-luka, di antaranya terdapat tiga orang (ayah, ibu dan anak) warga-negara Indonesia. Melihat tindak kekerasan oleh warga sipil dengan menggunakan senjata bermesiu sebagaimana terjadi di Aurora, Colorado, berulangkali peristiwa pemberondongan ini terjadi. Nampaknya penggunaan senjata api telah membudaya bagi masyarakat sipil Amerika. Penggunaan senjata api oleh masyarakat Amerika telah memunculkan inspirasi seorang Gaston Glock warganegara Austria. Gaston Glock yang memang

perusahaannya memasok senjata ringan untuk militer Austria. Dia mendisain senjata tangan kecil, ringan dan mematikan. Dia melihat peluang ekspor jenis senjata api ini ke Amerika Serikat. Penjualan senjata buatan Glock ini terbilang sukses. Pasar Amerika dimasuki oleh senjata produksi Gaston Glock mengingat adanya kebebasan warga sipil memiliki senjata. Tahun 2010 perusahaan Glock mengekspor senjata kecil (handgun) sebanyak 431.118 pucuk (menurut Bureau of Alcohol, Tobacco, Firearms and Explosive). Mayoritas senjata tangan yang beredar dan polisi AS pun memakai senjata buatan Glock. Senjata Glock telah menggantikan model revolver dan pistol buatan AS. Menurut Paul M. Barrett yang eedan menurut perkiraan Barrett bahwa penjualan senjata buatan Glock sekitar AS$100 juta per tahun. Pengguna senjata buatan Glock tidak hanya termasuk Hol-

mes di Aurora, Colorado tetapi juga Jared Lee Loughner pada 11 Januari 2011 dikenal sebagai Tucsonmassacre enamorangtewas dan beberapa orang luka parah termasuk Gabrielle Giffords seorang anggota Kongres AS. Rasanya tidak fair di sini kalau hanya senjata ringan buatan Glock yang cenderung digunakan secara brutal oleh masyarakat sipil AS. Di Amerika juga beredar senjata ringan seperti Walter P22 yang digunakan untuk membunuh oleh Seung Hui Cho di Virginia Tech atau juga jenis senjata buatan Sig Sauer P232 yang digunakan oleh Steven Karmierczak ketika menembak mati lima orang di Illinois University tahun 2008. Kedua tipe yang saya sebut di atas adalah buatan Jerman. Jerman sendiri pada tahun 2010 telah mengekspor 230.447 senjata tangan ke AS. Tiga besar pengekspor senjata tangan ke AS sampai saat ini ialah Austria, Jerman, dan Itali (sekitar negara-

negara Eropa telah mengapalkan sedikitnya satu juta pucuk senjata ringan ke AS. Mengapa mereka memilih Amerika? Karena pasar domestik terbatas terutama ketatnya pengawasan oleh pemerintah masing-masing. Perusahan-perusahaan kecil yang bergerak dalam produksi senjata ringan masih memperoleh keuntungan besar karena AS adalah lahan menjanjikan bagi produksi mereka. Menjadi pertanyaan pula, mengapa begitu banyak gelombang pasokan senjata buatan Eropa yang semi otomatis (pistol) yang membombardir pasar Amerika.Yang jelas peluang pasar AS sangatmenarikuntukmemperoleh keuntungan besar, sedangkan pabrikanmembayarrendahupah kerja. Selain itu, menjadikan ekonomi sebagian negara-negara Eropa semakin meningkat, membuka lapangan kerja baru dan menimalisir pengangguran. Di sini berbicara masalah freetrade,konsumenmemperoleh

barang paling baik dengan harga yang terjangkau. Tetapi masalahnya barang produksi ini lebih menonjol digunakan untuk membunuh orang. Jadi, apakah “free trade that can kill people” dapat diterima begitu saja? Mungkin bagi AS penggunaan senjata oleh warga sipil memiliki sejarah panjang sebagaimana sering terlihat dalam sajian film-film Amerika yang menampilkan masa-masa lalu negeri ini pada era permulaan kemerdekaannya. Oleh karena itu, AS sudah harus berpikir mengurangi impor senjata ringan serta membatasi izin kepemilikan senjata api bagiwargasipilnya.Namunpembatasan penggunaan senjata api oleh warga sipil bukan jaminan bahwa sikap bringas warga sipil menggunakan senjata api bisa dihentikan, setidaknya mengurangi risiko yang timbul. Diperlukan sekali proteksionisme dari negara dan pengawasan senjata api dengan ketat. (Kosky)


Olimpiade London 2012

A10

WASPADA Kamis 9 Agustus 2012

LONDON (Waspada): Brazil selangkah lagi mewujudkan impian buat kali pertama menjuarai sepakbola Olimpiade, setelah menyingkirkan Korea Selatan dengan kemenangan telak 3-0. Pada pertandingan semifinal London 2012 di Stadion Old Trafford, Manchester, Selasa (Rabu WIB), Selecao tampil efektif dan mengorbitkan striker Leandro Damiao sebagai bintang kemenangan. “Saya ingin menjaga Damiao dalam tim ini sampai dia mencetak gol dan rencana kami telah bekerja. Dia pemain yang sangat penting bagi kami, tetapi tentu tim lebih penting daripada individu,” tukas Mano Menezes, pelatih Brazil, seperti dikutip dari AFP, Rabu (8/8). Di final 11 Agustus menda-

Hasil Semifinal, 7 Agustus Korsel vs Brazil Jepang vs Mexico

0-3 1-3

Jumat, 10 Agustus (GMT) Korsel vs Jepang

18:45

Sabtu, 11 Agustus (GMT) Brazil vs Mexico 14:00 *RCTI live pkl 21:00 WIB

AP

BINTANG kemenangan Brazil, Leandro Damiao (kanan), membobol gawang Korea Selatan yang dikawal kiper Lee Bum-young (kiri) di Stadion Old Trafford, Manchester, Inggris, Rabu (8/8) dinihari WIB. tang, Brazil akan ditantang Mexico yang pada semifinal lainnya bangkit dari ketinggalan untuk menghentikan sepak terjang Jepang dengan skor 3-1. Bila melihat isi skuad Menezes, tak salah kiranya menempatkan Selecao sebagai favorit

merebut medali emas London 2012. Bahkan ketika menggunduli Ginseng, Menezes menyimpan Lucas Moura dan Paulo Ganso, sedangkan Hulk dan Alexandre Pato baru dimasukkan menit 78. “Ketika kami melakukan

seleksi, Pato hampir tidak bermain sama sekali, sehingga Damiao sudah menjadi bagian yang sangat penting dari skuad ini,’’ jelas Menezes kepada Socceramerica. Brazil, peraih medali perunggu Beijing 2008, mulus me-

nembus final berkat dua gol Damiao ditambah satu gol Romulo. Korsel yang sebelumnya menyingkirkan tuan rumah Inggris Raya melalui adu penalti, hampir tidak pernah mengancam gawang Samba Muda. “Saya sangat senang. Kami

telah membuat upaya besar untuk mencapai final. Kami di sini untuk memenangkan medali emas,” ujar Damiao, yang tengah diincar Tottenham Hotspur. “Itu pertandingan yang sulit, tetapi kami adalah tim yang

hebat. Kami adalah Brazil, kami di sini untuk emas,” katanya menambahkan. Gol pertama wakil Amerika Selatan itu lahir menit 38 lewat Romulo, bek Vasco da Gama. Damiao membuat Selecao unggul 2-0 berkat umpan matang

Oscar menit 57. Damiao kembali membobol gawang kiper Lee Bum Young menit 64, memanfaatkan kreasi Neymar dos Santos. “Setelah kemenangan atas Korea Selatan, kami akan beristirahat sehingga siap menghadapi laga selanjutnya. Dengan izin Tuhan, kami akan meraih medali emas, semua warga Brazil menginginkannya,” papar Neymar kepada TV Record. “Kami semua berpengalaman. Meskipun beberapa pemain kami masih muda, kami telah main bersama dalam waktu yang lama,” pungkas bintang yang sedang diburu Barcelona dan Real Madrid tersebut. (m15/ant/afp/rtr)

El Tricolor Rawan Tanpa Dos Santos

AP

Salimi Manusia Terkuat London 2012 Steiner Tertimpa Barbel LONDON (Waspada): Lifter Iran, Behdad Salimikordasiabi alias Salimi (foto), menobatkan diri sebagai manusia terkuat Olimpiade London 2012 pasca mendulang medali emas angkat besi kelas berat super. Atlet berusia 22 tahun itu melakukan angkatan total 455kg pada kelas di atas 105kg (+105kg), Selasa (RabuWIB), terdiri atas angkatan snatch 208kg dan clean and jerk 247kg. Angkatan itu membuat Salimi unggul enam kilogram dari peraih medali perak dan rekan senegaranya Sajjad Anoushiravani Hamlabad, yang gabung bersama sang juara ketika melambaikan bendera Iran diiringi sorakan gembira para pendukung mereka. “Tujuan pertama saya merebut medali emas. Saya datang

ke sini untuk meraih emas dan mungkin di masa depan saya akan memecahkan rekor yang ada,” ungkakp Salimi, seperti dilansir Eurosport, Rabu (8/8). Lifter Rusia Ruslan Albegov meraih perunggu dengan total angkatan 448kg. Juara bertahan Matthias Steiner gagal menyelesaikan pertandingan, karena atlet Jerman itu mengalami insiden tertimpa barbel saat hendak melakukan angkatan pertama 196 kg snatch. Namun Steiner tidak mengalami luka apapun. Dia meninggalkan arena pertandingan, mengangkat tangan dan mendapat sambutan hangat dari penonton. “Dia baik-baik saja, tapi tak bisa meneruskan perebutan medali karena alasan kesehatan. Saya pikir itu tidak terlalu serius,

10 Besar Kelas Berat Super Snatch 1. Behdad Salimikordasiabi (Iran) 2. Sajjad Anoushiravani (Iran) 3. Ruslan Albegov (Rusia) 4. Jeon Sang-Guen (Korsel) 5. Irakli Turmanidze (Georgia) 6. Ihor Shymechko (Ukraina) 7. Jiri Orsag (Republik Ceko) 8. Almir Velagic (Jerman) 9. Yauheni Zharnasek (Belarus) 10. Chen Shih-Chieh (Taiwan) kini dia dalam penanganan dokter,” ungkap Chief de Mission Jerman, Michael Vesp. Salimi pun jadi tak terhadang. Penonton bersorak memberikan semangat saat dia Salimi berusaha melakukan angkatan clean and jerk seberat 264kg. Bila berhasil, dia akan memecahkan rekor dunia dari atlet dua kali juara Olimpiade, Hossein Rezazadeh, yang kini men-

208 204 208 190 201 197 187 192 196 182

Clean&Jerk Overall 247 245 240 246 232 232 239 234 230 236

455 449 448 436 433 429 426 426 426 418

jadi Ketua Federasi Angkat Besi Iran. Tapi angkatan itu terlalu berat bagi Salimi. Setelah gagal pada angkatan pertama namun sudah pasti meraih emas, dia membuka ikat pinggangnya dan tetap berada di pentas. Salimi langsung mendapat sambutan hangat dari para kontingen Iran yang menyaksikan dari tribun. (m15/ant/rtr/es)

Tabloit Murdoch Bikin Berang Korut SYDNEY (Antara/AFP): Tabloid Australia yang dikendalikan Rupert Murdoch, Rabu (8/8), memancing kemarahan pihak Korea Utara setelah menyebut negara itu sebagai “Korea yang nakal (Naughty Korea)” dalam klasemen perolehan medali. Dikutip dari kantor berita Korea Utara, KCNA, kubu Pyongyang menuding tabloid mX yang mereka sangka “Brisbane Metro” telah melakukan tindakan kotor. Pihak Korut menyebutnya, telah “menarik

perhatian dunia karena merendahkan diri mereka sendiri.” “Ini merupakan tindakan intimidasi yang melecehkan semangat Olimpiade terhadap solidaritas, persahabatan, kemajuan dan politisasi olahraga,” klaim KCNA. Mereka kemudian mengatakan tabloid bodoh itu telah merendahkan diri sendiri dengan menyebut Korut sebagai “Korea yang nakal” sedangkan Republik Korea Selatan disebut sebagai “Korea yang baik.” “Betapa memalukannya hal itu. Brisbane Metro akan tetap menjadi simbol koran yang jahat, untuk sikap buruk yang

akan dikenang dalam sejarah Olimpiade,” tambah KCNA. Namun mX, tabloid cumacuma yang dipublikasikan oleh Murdoch’s News Limited di Brisbane, Sydney, dan Melbourne, melancarkan serangan balik dengan mencantumkan tulisan “Korea Utara melayangkan surat resmi” pada semua edisinya. “Korea Utara memerhatikan mX,” kata tabloid itu di edisi Rabu petang, yang ditambahi foto pemimpin Korut, Kim Jong-Un, dipenuhi lelucon seputar ambisi-ambisi nuklir rezim tersebut. Ketiga editor tabloid, yang semuanya menampilkan kla-

semen perolehan medali yang sama, mengatakan Pyongyang telah melakukan hal balistik terhadap apa yang mereka yakini dipahami para pembaca sebagai “sedikit sifat gembira.” “mX dikenal luas kurang sopan dalam menyajikan berita dan Olimpiade London 2012 didekati dengan perspektif itu dalam benak kami,” demikian pernyataan mereka. Para editor mengatakan klasemen perolehan medali itu mendapat berbagai respon di dunia maya, dan lelucon itu sama sekali tidak bermaksud untuk menyerang para atlet maupun penduduk, baik Korsel maupun Korut.

Pearson Sumbang Emas Atletik Pertama Australia LONDON (Waspada): Juara dunia Sally Pearson, Selasa (Rabu WIB), menjuarai lari gawang 100m putri Olimpiade London 2012 sekaligus mempersembahkan medali emas pertama Australia dari cabang ateltik. Sprinter yang mendominasi nomor itu dalam dua tahun terakhir, memimpin sejak awal. Namun saingannya dari Amerika Serikat, Dawn Harper dan Kellie Wells, terus melakukan tekanan. Pearson (foto) akhirnya menyentuh garis finis dengan catatan 12, 35 detik sekaligus mencatatkan rekor baru Olimpiade. Wanita berusia 25 tahun itu menunggu dengan grogi sebelum nama pemenang muncul di papan hasil perlombaan. Ketika namanya berada paling atas, Pearson langsung tumbang ke tanah karena gembiranya. Juara bertahan Harper me-

raih perak dengan waktu 12,37 danWells berhak atas perunggu setelah membukukan waktu 12,48 detik, yang merupakan waktu pribadi terbaiknya. Atlet Aljazair Untuk nomor 1.500 meter putra, atlet Aljazair Taoufik Makhloufi, tampil sebagai juara. Medali emas Makhloufi itu diraihnya tepat sehari setelah dia keluar dari arena lomba karena tidak turun di nomor heat 800m dan kemudian dokter mengatakan dirinya sedang cedera. Bila benar cedera, maka fia mengalami pemulihan luar biasa dalam semalam. Makhloufi dengan cepat melepaskan diri dari grup pelari dan menyentuh batas akhir perlombaan dengan waktu tiga menit 34, 08 detik. Atlet Amerika Serikat, Leo-

AP

nel Manzano, mendulang perak dan medali perunggu jatuh pada atlet Maroko Abdalaati Iguider. Juara bertahan Asbel Kiprop dari Kenya, yang berharap

di London 2012 dapat menyamai rekor unik Sebastian Coe yang juara dua kali, tercecer di urutan belakang. (m15/ant/rtr)

LONDON (Waspada): Sukses Mexico melaju ke final Olimpiade untuk pertama kalinya sepanjang sejarah, harus dibayar mahal dengan cederanya Giovani dos Santos (foto). Mantan pemain Barcelona yang kini membela Tottenham Hotspur itu akibatnya rawan absen pada partai perebutan medali emas menghadapi Brazil di StadionWembley, 11 Agustus mendatang. “Dia mengalami cedera otot. Kami belum tahu seberapa parah cederanya,” jelas pelatih Mexico, Luis Fernando Tena, seperti dilansir Reuters, Rabu (8/8). Dos Santos salah seorang kunci sukses El Tricolor melaju ke partai puncak, bahkan telah menyumbangkan 3 gol selama

London 2012. “Kami masih menunggu dan menjalankan serangkaian tes. Saat ini kondisinya diragukan, kami mesti mencari tahu,” tutur Tena, setelah skuadnya mengatasi Jepang 3-1 pada semifinal di Stadion Wembley. Jepang yang berperan besar menyingkirkan tim unggulan Spanyol di babak penyisihan grup, sempat mengejutkan lawan ketika unggul lebih dulu menit 12 melalui gol tendangan jitu Yuki Otsu. Menit 28 El Tricolor berhasil menyamakan kedudukan berkat gol Marco Fabian. Pada pertengahan babak kedua, Dos Santos cs berbalik unggul 2-1 melalui gol Oribe Peralta. Jelang bubaran laga, pemain pengganti Javier Cortes mem-

AP

perbesar keunggulan Mexico menjadi 3-1 setelah mendapat umpan dari Peralta. “Para pemain memiliki mentalitas baru. Mereka ingin bermain di luar negeri sekarang, mereka tak memiliki masalah dan ingin meraih kesuksesan,”

klaim Tena. Samurai Biru asuhan pelatih Takashi Sekizuka, terpaksa memperebutkan medali perunggu menghadapi tetangganya Korea Selatan besok malam di Stadion Mellenium, Cardiff. (m15/okz/rtr)


Sport

WASPADA Kamis 9 Agustus 2012

A11

Rekor Penonton Final Sepakbola Putri Olimpiade

AP

LONDON (Waspada): Laga final sepakbola putri London 2012 antara Amerika Serikat melawan Jepang dinihari WIB nanti di Stadion Wembley, dipastikan memecahkan rekor kehadiran penonton untuk pertandingan Olimpiade. Setidaknya 83.000 penonton dijamin akan memenuhi stadion, setelah sebanyak 5.000 tiket final langsung habis terjual pasca kemenangan dramatis 4-3 yang didapat sang juara bertahan AS melalui babak tambahan waktu atas Kanada. Juga atas keberhasilan Jepang menang 2-1 melawan Prancis pada semifinal lainnya. Rekor jumlah penonton terbanyak pada sepakbola putri Olimpiade terjadi pada 1996, ketika 76.489 penonton menyaksikan final antara AS melawan China di Stadion Sanford, Athena. Kehadiran dalam jumlah yang sama tercatat secara resmi oleh FIFA pada pertandingan perebutan medali perunggu antara Norwegia melawan Brazil di stadion yang sama pagi harinya. FIFA mengonfirmasi melalui akun Twitter mereka, bahwa

5.000 tiket telah terjual pada Rabu (8/8). Sehingga duel nanti juga akan menarik minat sebagian besar penggemar sepakbola untuk menyaksikan pertandingan tim putri di Inggris. Rekor kehadiran penonton terbanyak sebelumnya adalah 70.584 orang yang terjadi menjelang Olimpiade London ini, ketika Inggris Raya bermain melawan Brazil di Wembley pada 31 Juli. Itu adalah jumlah terbanyak sejak 53.000 penonton menyaksikan pertandingan pada 1920. Juru bicara FIFA mengatakan, “Kami tentu saja gembira dengan banyaknya penonton di turnamen, baik di bagian putra maupun putri, khususnya pada pertandingan-pertandingan putri. Ini membuktikan bahwa sepakbola memainkan peran kuat dan vital pada Olimpiade, selalu seperti itu.” Tapi berbagai kritik telah mengiringi perjalanan cabang olahraga sepakbola di Olimpiade, karena medali emasnya dianggap kurang bernilai dibandingkan kejayaan di Piala Dunia. Rekor untuk kehadiran jumlah penonton pada final Piala

AP

Dunia Putri terukir di Los Angeles pada 1999, ketika 90.185 penonton menyaksikan Putri Paman Sam mengalahkan China di Rosebowl. Untuk final nanti yang dimulai pkl 18:45 GMT, Abby Wambach dan kawan-kawan akan berupaya meraih medali emas ketiganya secara berturut-turut. Namun ini ulangan final Piala Dunia 2011, yang dimenangkan Yuki Ogimi cs melalui adu penalti di depan 48.817 penonton di Frankfurt. Meski sebagian tiket turnamen sepakbola London 2012 tidak dijual pada fase-fase awal, total akumulasi penjualan tiket untuk kategori putra dan putri mencapai 1.951.707 tiket, 569.014 di antaranya menyaksikan permainan para srikandi si kulit bundar. Rekor total sepakbola Beijing 2008 adalah 740.014 penonton. Dengan final dan pertandingan perebutan medali perunggu antara Prancis dan Kanada di Coventry yang masih akan dimainkan, total penonton sepakbola putri di Olimpiade London akan mencapai 660.000 penonton. (m15/ant/rtr/fifa)

Randiman, Ijeck, Amiruddin Mencuat

Bursa Ketum PSMS Memanas

Abby Wambach (AS)

MEDAN (Waspada): Ketua DPRD Medan, Drs H Amiruddin, ikut memanaskan bursa Ketua Umum PSMS Medan menggantikan Drs H Rahudman Harahap MM. Demikian dikatakan Ketua Umum Posindo anggota klub PSMS, Idris SE, Rabu (8/8). Amiruddin bersedia menjadi Ketum PSMS, karena kecintaannya terhadap cabang olahraga paling digemari masyarakat itu sekaligus bertekad mengembalikan nama besar Ayam Kinantan seperti tahuntahun sebelumnya. Bahkan Amiruddin kerap terlihat di stadion saat-saat PSMS bertanding di pentas Indonesian Super League (ISL). Sebelumnya, dua nama juga mencuat yakni Drs H Randiman Tarigan MAP dan Drs H Musa Rajekshah MHum alias Ijeck. Kedua nama tersebut diusung klub-klub anggota PSMS seperti PS Deli Putra, Bintang Utara, Bintang Selatan, Kesawan Putra, Posindo, Dharma Putra PTPN IV, dan PTPN Wil I. Pengamatan Waspada dalam sepekan terakhir, Randiman dan Ijeck cukup santer disebut sebagai calon kuat, karena sama-sama memiliki dedikasi tinggi untuk meningkatkan prestasi olahraga di Sumut, khu-

susnya di Medan. Randiman sendiri telah memperlihatkan kemauannya memajukan PSMS ketika menjadi Sekretaris Umum dan Manajer Tim PSMS saat menjadi runner-up Liga Indonesia 2007. Sebaliknya, Ijeck yang juga Ketua Umum IMI Sumut rutin memperjuangkan kemajuan olahraga otomotif dan lainnya, seperti menembak. “Keduanya jelas sudah memperlihatkan dedikasinya di masing-masing cabang olahraga yang mereka pimpin. Kalau masalah uang, keduanya selalu siap mengulurkannya demi olahraga seperti yang telah mereka lakukan selama ini,” kata pengurus klub anggota PSMS, Drs Azam Nasution MAP, Rabu (8/8). Sekretaris PS Deli Putra itu menilai satu di antara keduanya pantas menjadi Ketua Umum PSMS di masa mendatang menggantikan Rahudman Harahap, karena Wali Kota Medan

Pengurus Akan Pidanakan Idris Gunakan Kop Surat Dan Stempel PSMS

Waspada/Austin Antariksa

MANTAN Sekum dan Manajer Tim PSMS Drs H Randiman Tarigan MAP (kiri) dan Ketua DPRD Medan Drs H Amiruddin (kanan) sama-sama mencintai Ayam Kinantan, sehingga pantas menggantikan Rahudman Harahap (tengah). tersebut tidak bisa lagi menjabat sesuai surat edaran Mendagri No 800/148/SJ. Ketua Umum Pesindo, Idris SE, mengakui 50 persen klub yang menghadiri RULB ilegal gelaran H Martius Latuperissa

cs baru-baru ini mengaku nama klubnya sudah dicatut oleh pihak penyelenggara untuk melengkapi jumlah qorum peserta. Menurut Idris, klub-klub juga akan mengadukan hal perbuatan dari penyelenggara

Gulo Bertahan Di China Demi Emas PON LAJANG berusia 26 tahun ini mengaku kesepian di Guangzhou, China, dalam persiapan menghadapi PON XVIII di Riau 9-20 September 2012. Pasalnya, dari 10 atlet yang dikirim mengikuti pelatihan di Guangzhou, tinggal Gulo (foto) yang bertahan di Negeri Tirai Bambu itu. “Sepilah. Jauh dari keluarga dan teman-teman.Tapi ini harus saya hadapi demi medali emas di PON,” kata Mari Yusuf Gulo, atlet atletik jarak jauh andalan Sumut kepada Waspada dalam komunikasi via jejaring sosial, Rabu (8/8) malam. Dia pun tidak menampik kalau dunia maya menjadi salah satu permainan mengisi waktu luang.

Dok.Waspada

Gulo kelahiran Nias 21 Maret 1986 sudah empat bulan berada di Guangzhou. “Saya

setiap hari berlatih besama atletatlet yang berasal dari China. Saya dilatih mantan pelari juara China, Zou Meng yang berusia 29 tahun,” ucapnya seraya mengatakan selama berlatih di Guangzhou mengalami peningkatan. Waktu terbaik Gulo saat ini pada nomor maraton 42 km adalah 2 jam, 34 menit. Perolehan waktu ini lebih baik saat dia memperoleh medali perunggu pada PON XVII di Kalimantan Timur 2008, yakni 2:40:50.00. Bahkan peraih medali emas, Yahuza asal Kalimantan Timur mencatat waktu 2:35:37.00 dan peraih perak Faizin (Jawa Tengah) 2:37:41.00. Rekor nasional

maraton masih digenggam Eduard Nabunome asal Nusa Tenggara Timur dengan catatan waktu, 2:19:18.00. Namun demikian, Gulo tidak mau sesumbar atas catatan waktu terbaik yang sudah diperolehnya di Guangzhou. “Pelatih menginginkan saya bisa mencatat waktu 2 jam 20 menit untuk bisa merebut medali emas di PON dengan berlatih selama 4 jam sehari,” ujarnya. Gulo di PON XVIII bermain di dua nomor, yakni 10.000 meter dan lari maraton. Dari kedua nomor yang lolos kualifikasi, pelatih Zou Meng lebih fokus kepada lari maraton. *Setia Budi Siregar

PSSI Pastikan Bela Pemain Timnas KENDARI (Waspada): Ketua Umum PSSI, Djohar Arifin Husin, menegaskann pihaknya akan memberi pembelaan kepada semua pemain timnas dari ancaman pemecatan yang saat ini dilontarkan klubnya. Hal tersebut terkait dengan keputusan mereka ikut memperkuat Timnas Indonesia yang tengah melakukan persiapan jelang tampil di ajang Piala AFF pada November mendatang, meski tidak mendapat persetujuan dari klubnya. “Sangat mengherankan adanya oknum atau kelompok yang tidak ingin para pemainnya

berjuang membela‘Merah Putih’, dan malah ada yang mengancam sekiranya pemain membela bangsa,” ujar Djohar kepada Waspada beberapa saat sebelum melantik Pengurus PSSI Sultra di Kendari, Rabu (8/8). “Sungguh mengerikan dan perlu dipertanyakan nasionalisme dan kewarganegaraannya. PSSI tentu akan membela para pemain sebagai pejuang bangsa dari ancaman para pengacau,” tambah Djohar. Masih kata Djohar, pihaknya memberikan apresiasi tinggi kepada semua pemain yang membela nama bangsa dan

Problem Catur Jawaban di halaman A2 8

7

6

5

4

3

2

1 A

B

C

D

E

negara, membela Merah Putih, membela Garuda sebagai lambang negara. Apresiasi itu diberikan, imbuh Djohar, karena sikap ksatria dan terpuji pemain dengan mendahulukan kepentingan bangsa dari pada kepentingan pribadi atau lainnya. “Saat ini pemain dan ofsial sedang melakukan persiapan serius dengan menjalani pemusatan latihan, meski tengah menjalankan ibadah puasa. Ini dilakukan demi tekad mereka memberikan yang terbaik untuk bangsa,” papar Djohar. Untuk memenuhi harapan

TTS TOPIK

Putih melangkah, apakah bisa menang dengan melangkahkan BxGd7+?

F

G

H

Yuki Ogimi (Jepang)

pemain dan warga masyarakat Indonesia di ajang AFF nanti, PSSI, kata Djohar, akan mempersiapakan segala kebutuhan pemain. Termasuk memberi perlindungan kepada mereka yang terancam kehilangan klub, akibat mendapat sanksi karena membela timnas. “Kita belum sekali pun meraih juara. Oleh karena itu, kami pengurus PSSI sebagai pelayan sepakbola Indonesia mempersiapkan apa saja yang diperlukan untuk keberhasilan tim,” pungkas Djohar. (yuslan)

yang telah memalsukan tandatangan ketua umum dari beberapa klub anggota PSMS ke polisi. Dari klub Kesawan Putra, Fauzi Hasbalah, menyatakan akan menarik kembali dukungannya terhadap Indra Sakti Harahap di RLUB tersebut, karena berlangsung tidak sesuai aturan. “Kami sendiri datang untuk menghadiri rapat forum klub

anggota, bukan memilih Ketua Umum PSMS. Makanya kami sekarang menarik dukungan kami,” katanya. Menanggapi nama Randiman dan Ijeck yang diusung oleh beberapa klub anggota PSMS, Fauzi menilai hal tersebut tidak masalah karena lebih banyak figur yang muncul akan lebih baik dan menganut proses demokrasi. (m17)

MEDAN (Waspada): Pengurus PSMS Medan periode 20122016 pimpinan Indra Sakti Harahap, Kamis (9/8) siang ini, akan melaporkan Idris SE ke Poltabes Medan, terkait penggunaan kop surat dan stempel berlogo PSMS. “Besok (hari ini-red) kami laporkan Idris ke Poltabes. Kami adalah pengurus yang sah hasil Rapat Umum Luar Biasa (RULB) Klub Anggota PSMS. Kami harus menghentikan tindakan Idris yang di luar ketentuan,” ujar Sekum PSMS, H Martius Latuperissa, di Gedung Mantan Pemain PSMS, Kompleks Stadion Kebun Bunga Medan, Rabu (8/8). Didampingi sejumlah pengurus, Martius menilai perbuatan Idris yang mempergunakan kop surat dan stempel PSMS telah merugikan pihaknya . Menurutnya, hal itu adalah tindak pidana murni dan Kapolresta harus mengambil tindakan secara hukum dengan menangkap Idris. Selain mempidanakan Idris yang memakai kop surat dan stempel PSMS, pengurus periode 2012-2016 juga akan mengadukan Idris soal pertanggungjawaban keuangan selama mengelola PSMS. “Idris tidak pernah mempertanggungjawabkan kinerjanya kepada klub-klub selaku pemilik PSMS. Ada indikasi kecurangan dan ini harus diselidiki polisi,” ujar Martius sambil memperlihatkan surat yang dibuat Idris dengan menggunakan kop surat PSMS kepada klub-klub. Disinggung soal surat bernomor 259/B/PSMS/VII/2012 perihal verifikasi pengurus klub tertanggal 4 Agustus 2012 yang ditandatangani Idris, Martius menegaskan bahwa yang berwenang melakukan verifikasi klub adalah pengurus PSMS hasil RULB. “Kami akan melakukan verifikasi 40 klub anggota PSMS untuk kepentingan kompetisi. Untuk itu kepada pengurus klub yang tidak ikut pada RULB untuk bergabung di bawah bendera pengurus Ayam Kinantan periode 2012-2016,” pungkasnya. (m33)

IMI Sumut, PMI Medan Bantu Pengungsi MEDAN (Waspada): Pengprov Ikatan Motor Indonesia (IMI) Sumut dan Palang Merah Indonesia (PMI) Medan menggelar kegiatan bakti sosial (Baksos) dengan mengunjungi dan memberi bantuan kepada pengungsi luar negeri yang ditampung di Rudenim Medan, Kanwil Kumham Sumut di Belawan, Rabu (8/8). Kunjungan dan penyerahan bantuan untuk pengungsi ke Rumah Detensi Imigrasi (Rudenim) Medan yang berlokasi di Jl Celebes Gg Pekong ini, dihadiri langsung Ketua Pengprov IMI Sumut, Ijeck, yang juga Ketua PMI Medan didampingi pengurus PMI Medan, antara lain Millie Desky, Prihatin Kasiman, dan pengurus IMI Sumut lain. Penyerahan bantuan kepada setiap pengungsi, berupa perlengkapan shalat dan uang tunai ikut didampingi Kasi Keamanan dan Ketertiban Rudenim Medan,Yusuf Umardhani. Para pengungsi terlihat antusias dan haru saat satu per satu berbaris bergiliran menerima bantuan. Ijeck mengatakan penyerahan bantuan dari IMI Sumut dan PMI Medan merupakan wujud kepedulian antar-sesama, di mana IMI Sumut dan PMI

Waspada/Armansyah Th

KETUA IMI Sumut, Ijeck (kanan), menyerahkan bantuan kepada pengungsi di Belawan.

Rohingya. Sisanya berasal dari Afganistan, Irak, Srilanka, Bangladesh, dan pengungsi Myanmar bukan Rohingya. “Status mereka masih sebagai pencari suaka, menunggu status sebagai pengungsi dari badan PBB UNHCR. Kalau sudah mendapat status pengungsi, mereka dapat tinggal di negara ketiga yang mau menampungnya seperti Australia, Selandia Baru atau Kanada,” ungkap Umardhani. (m47)

Medan ingin berbagi di bulan Ramadhan ini. “Seperti kita ketahui, di Rudenim Medan ini merupakan salah satu tempat penampungan pengungsi Muslim Rohingya asal Myanmar. Namun, bantuan yang kita berikan tidak hanya terbatas kepada pengungsi Rohingya saja, tetapi juga kepada semua pengungsi asal negara lain yang ditampung di sini,” sebut Ijeck. “Kita berharap dengan ban-

tuan yang diberikan dapat membantu sedikit beban yang diderita para pengungsi. Semoga bagi yang muslim benar-benar merasakan berkah pada bulan suci Ramadhan ini,” pungkas Ijeck. Kasi Keamanan dan Ketertiban Rudenim Medan,Yusuf Umardhani, mengatakan ada sekira 120 pengungsi dari negara lain yang ditampung di Rudenim Medan. Dari jumlah tersebut tercatat 26 pengungsi

MENURUN

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu 15 menit. Jawabannya lihat di halaman A2 kolom 1.

SANTAPAN RAMADHAN

Sudoku MENDATAR

1. Ucapan syukur kepada Allah. 5. Salah satu nama pria yang disenangi Allah. 8. Arah ke Ka’bah untuk shalat. 10. Orang yang tidak percaya kepada Allah dan rasulNya, terdiri dari harbi, muahid dan zimi. 11. Shalat fardhu malam. 12. Salah satu perang yang menurut hadis, Nabi Muhammad SAW meminjam 30 baju besi. 13. Maha suci yang tidak pernah tidur. 15. Hadis firman Allah yang disampaikan kepada Nabi Muhammad SAW dan beliau menerangkannya dengan susunan katanya sendiri. 18. Adduyutsu yaitu suami yang membiarkan istrinya berbuat _____. 20. Menempelkan kening ke tanah. 21. Masa persiapan untuk memasuki madrasah. 24. Hadis yang cukup sanadnya dari awal sampai akhir dan oleh orangorang yang sempurna hafalannya. 25. Nama nabi. 26. Bunga uang. 27. Panggilan untuk shalat. 29. Hadiah beramal. 30. At-____, buah surga, surat ke-95 Al Quran.

2. Nabi kaum ‘ad. 3. Mahluk bersayap. 4. Empat puluh; Shalat fardhu 8 hari di Masjid Nabawi. 6. Periwayat hadis Nabi SAW, gurunya Muslim. 7. _____ ar-Rasyid, nama khalifah ke-5 Abbasiah. 8. Buku; Wahyu Tuhan yang dibukukan. 9. Uzur; Penyakit yang tidak ada obatnya. 14. Ad-______, artinya kabut, surat ke-44 Al Quran. 16. Singkatan Universitas Islam Indonesia. 17. Berlari-lari kecil dari Safa ke Marwa. 18. Salah satu harta yang tak ternilai harganya, lebih utama dari jihad, kata hadis. 19. Istri Nabi Muhammad yang pernah difitnah. 20. Pertolongan; Perlindungan (pada hari kiamat). 21. Dikenal sebagai Ummu Misthoh. 22. Zakat yang dilakukan menjelang Idulfitri. 23. Tempat shalat Rasulullah di masjid Nabawi. 28. Huruf ke 18 abjad Arab.

7 5 4 8 3 6 2 3 8 9 5 3 6 7 1 9 7 5 3 6 9 3 5 9 1 8 3 9 6 5 3

****203


Sport

A12

WASPADA Kamis 9 Agustus 2012

AP

AP

GUARD Becky Hammon (9) akan menjadi motor serangan Rusia saat meladeni tantangan Prancis di semifinal bola basket Olimpiade 2012 di London, setelah menang atas Turki, Rabu (8/8).

CENTER Australia, Belinda Snell (2 kiri), dibantu Lauren Jackson (15) berebut rebound dengan Zengyu Ma (kiri) dan Xiaoli Chen asal China dalam laga perempatfinal bola basket Olimpiade 2012 di London, Rabu (8/8).

Negeri Kangguru Siap Ladeni AS

LONDON (Waspada): Tim bola basket putri Australia sukses mengalahkan China 75-60, Rabu (8/8), dan siap meladeni ketangguhan Amerika Serikat (AS) pada semifinal Olimpiade 2012 di London. Kesempatan ini akan digunakan Australia untuk revans kekalahan final pada tiga Olimpiade sebelumnya.

Australia, kehilangan tiga medali emas pada Olimpiade sebelumnya, akan bertemu dengan AS yang berhasil mengandaskan Kanada 91-48 di babak delapan besar sebelumnya. Di semifinal lain, Rusia akan ditantang Prancis. Center Liz Cambage membuat Australia memimpin 17 poin, sedangkan Lauren Jackson menambah 12 poin sekali-

gus melewati rekor Janeth Arcain (Brazil) sebagai pencetak angka terbanyak putri Olimpiade sepanjang masa dengan 536 poin dalam kariernya. Dari China, Ma Zengyu. AS sendiri mengukir kemenangan ke-39 di Olimpiade kala mengungguli Kanada yang notabene tetangganya. Sepanjang permainan, AS terlihat unggul di segala kategori

dengan mencatat 47 persen tembakan berhasil di lapangan. Dari segi rebound, Diana Taurasi cs juga unggul 48 berbanding 31. Top skor pasukan pelatih Geno Auriemma disandang Diana Taurasi yang menoreh total 15 angka disusul Candace Parker dan Sylvia Fowles masing-masing 12 poin. Selanjutnya, Maya Moore dan Angel

McCoughtry ikut menyumbang 11 angka. Di laga lain, tim Rusia mengalahkan Turki 66-63 sekaligus memastikan diri lolos ke semifinal untuk bertemu Prancis. Rusia, juara Eropa dan peraih medali perunggu, berhasil unggul 12 poin di awal

kuarter kedua. Namun, Turki tidak semudah itu dikalahkan dan memaksa pertandingan berlangsung ketat. Kuarter terakhir, Turki berhasil mengejar lewat tembakan dua angka Birsel Vardarli tepat 28 detik sebelum laga berakhir untuk menjadi skor

62-62. Beruntung Rusia memiliki Becky Hammon karena lay-up guard lincah asal AS ini membuat Rusia unggul di sisa 13 detik. Sementara itu, Prancis mengalahkan Republik Ceko 71-68. (m33/ap)

Bintang NBA Dukung Kampanye Obama

AP

WASHINGTON (Waspada): Sejumlah pemain bintang NBA termasuk legenda hidup Michael Jordan (foto) akan terlibat dalam acara pengumpulan dana untuk kampanye Presiden Amerika Serikat (AS), Barack Obama. Rencananya, pengumpulan dana kampanye itu akan digelar di New York pada 22 Agustus mendatang. Paketnya adalah “permainan singkat” di lapangan dengan para pemain NBA serta santap malam bersama sang presiden. Untuk sesi shoot around, sejumlah pemain yang akan terlibat adalah Carmelo Anthony, Rajon Rondo, John Wall, Paul Pierce, Kyrie Irving, dan Joe Johnson. Selain itu juga hadir mantan pemain seperti Patrick Ewing (New York Knicks) dan Alonzo Mourning (Miami Heat) plus bintang NBA, Sheryl Swoopes dan Dawn Staley.

Tarif untuk sesi shoot around skills adalah 5.000 dolar atau sekira Rp47 juta untuk dua orang atau orangtua plus satu anaknya. Kalau hanya ingin foto bersama para bintang NBA itu, donatur dipasangkan tarif 250 dolar atau Rp2,3 juta. Untuk sesi makan malam bareng Obama, acara ini nantinya akan dipandu oleh Michael Jordan dan Komisioner NBA David Stern di mana setiap peminat yang ingin berpartisipasi dikenakan donasi 20 ribu dolar atau hampir Rp190 juta. Obama sendiri adalah penggemar berat NBA dengan Chicago Bulls sebagai klub favoritnya. Seperti diketahui, Obama juga akan kembali mencalonkan diri sebagai presiden periode 2013-2017, setelah terpilih pada 2009 lalu. (m33/nba)

Mercedes Ingin Schumi Bertahan BRACKLEY, Inggris (Waspada): Mercedes GP tampaknya tertarik untuk mempertahankan pebalap veteran mereka, Michael Schumacher (foto) di kursi balap Mercedes untuk musim 2013 mendatang. Bila Mercedes GP benar-benar menawarkan kontrak tambahan kepada Schumacher, berarti pebalap berkebangsaan Jerman tersebut bakal menjalani musim keempatnya bersama pabrikan Jerman itu, sejak comeback pada awal tahun 2010. Ketua Tim Mercedes GP, Ross Brawn, mengaku pihaknya bisa saja mengambil keputusan tersebut, karena dirinya tidak melihat adanya alasan untuk menyudahi kerjasama dengan driver berusia 43 tahun itu. Brawn menilai Schumi maish punya kemampuan untuk memenangkan balapan Formula One (F1). “Sangat profesional, sangat berkomitmen, sikap yang baik, kecepatan, bekerja sangat baik dalam tim, bekerja sama dengan baik sebagai rekan setim yang tidak selalu mudah sebagai driver,” jelas Brawn, Rabu (8/8). “Saya percaya keduanya (Schumi dan Nico Rosberg) lebih dari mampu memenangkan balapan, jika kami menyediakan peralatan yang mendukung mereka Yang dapat Anda minta dari driver, mereka memilikinya,” tutupnya. Pada GPEropa di Sirkuit Valencia enam pekan lalu, Schumacher berhasil meraih podium pertamanya sejak terakhir kali memenangkan GP China bersama Ferrari pada Oktober 2006 silam. Saat itu, Schumi finish ketiga di belakang Kimi Raikkonen (Lotus) dan Fernando Alonso (Ferrari) yang menjadi pebalap tercepat di Valencia. (m33/auto)

zimbio

Isu Rossi Gabung Yamaha Menguat ROMA (Waspada): Rumor mengenai masa depan Valentino Rossi (foto) terus berhembus. Disebutkan, di akhir musim Rossi akan hijrah dari Ducati untuk kembali ke Yamaha dan menandatangani kontrak berdurasi dua tahun sebagai jembatan menuju Superbike. Kontrak Rossi dengan Ducati akan habis akhir musim nanti. Menilik prestasinya yang kurang maksimal selama mengendarai motor Ducati, Rossi pun digadang-gadang akan memutuskan pindah. Rossi mengakui dirinya saat ini tengah berpikir mengenai masa depan. Ia pun menyebut sementara ini ada tiga opsi buatnya, yakni bertahan di Ducati, kembali ke Yamaha yang ia bela periode 2004-2010, atau bergabung dengan sebuah tim non-pabrikan yang tidak disebut namanya. Kabarnya, Rossi akan mengeluarkan

f1live

Pasang Iklan

pengumuman sebelum MotoGP Indianapolis mendatang. Sumber dari UltimateMotorCycling.com meyakini bahwa Rossi kemudian akan menandatangani kontrak dua tahun dengan tim pabrikan Yamaha dengan nilai sebesar 10 juta dolar AS. Sumber juga mengungkapkan bahwa setelah kontrak dua tahunnya habis dengan tim MotoGP Yamaha, Rossi akan bergabung dengan WSBK yang masih di bawah naungan Yamaha pada tahun 2015 mendatang. Ini dilakukan karena The Doctor ingin menjadi juara di semua kelas sebelum pensiun. Hal serupa dihembuskan oleh Gazzetta dello Sport yang menyebut Rossi sudah memutuskan untuk meninggalkan Ducati dan bergabung dengan Yamaha di akhir musim. Rossi disebut akan mengumumkan keputusan tersebut pada 15 Agustus nanti. (m33/auto)

HP. 081370328259 Email:

iklan_waspada@yahoo.co.id


Sumatera Utara

WASPADA Kamis 9 Agustus 2012

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:33 12:46 12:33 12:40 12:40 12:37 12:33 12:29 12:36 12:35

‘Ashar 15:53 16:05 15:53 16:00 15:59 15:58 15:54 15:49 15:56 15:55

Magrib 18:41 18:56 18:42 18:51 18:50 18:42 18:41 18:37 18:44 18:45

‘Isya

Imsak

Shubuh Syuruq

Kota

19:52 20:08 19:53 20:02 20:01 19:53 19:52 19:48 19:55 19:56

04:55 05:05 04:55 05:00 05:01 05:02 04:56 04:52 04:58 04:56

05:05 05:15 05:05 05:10 05:11 05:12 05:06 05:02 05:08 05:06

L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:31 Meulaboh 12:43 P.Sidimpuan12:30 P. Siantar 12:31 Balige 12:31 R. Prapat 12:28 Sabang 12:46 Pandan 12:32

06:22 06:33 06:23 06:28 06:28 06:29 06:23 06:19 06:25 06:24

Zhuhur ‘Ashar 15:58 15:52 15:51 16:02 15:51 15:51 15:52 15:48 16:04 15:53

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:49 18:40 18:39 18:52 18:36 18:39 18:38 18:34 18:57 18:38

20:00 19:51 19:51 20:03 19:47 19:50 19:49 19:45 20:08 19:49

04:59 04:54 04:53 05:04 04:55 04:54 04:55 04:52 05:05 04:57

05:08 05:04 05:03 05:14 05:05 05:04 05:05 05:02 05:15 05:07

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:32 12:34 12:43 12:36 12:33 12:40 12:28 12:38 12:31 12:31

18:38 18:41 18:54 18:43 18:42 18:49 18:36 18:46 18:38 18:39

19:49 19:52 20:05 19:54 19:53 20:01 19:47 19:58 19:49 19:50

04:56 04:57 05:03 05:00 04:55 05:01 04:51 05:01 04:56 04:53

05:06 05:07 05:13 05:10 05:05 05:11 05:01 05:11 05:06 04:03

Panyabungan 12:29 Teluk Dalam12:36 Salak 12:34 Limapuluh 12:30 Parapat 12:31 GunungTua 12:29 Sibuhuan 12:28 Lhoksukon 12:38 D.Sanggul 12:32 Kotapinang 12:27 AekKanopan 12:29

06:26 06:21 06:20 06:32 06:22 06:21 06:22 06:19 06:33 06:24

15:53 15:54 16:02 15:57 15:53 15:59 15:49 15:59 15:52 15:51

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:24 06:24 06:31 06:27 06:23 06:28 06:19 06:28 06:23 06:21

Zhuhur ‘Ashar 15:50 15:57 15:54 15:50 15:52 15:50 15:49 15:57 15:53 15:48 15:49

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:34 18:41 18:41 18:37 18:39 18:35 18:34 18:48 18:39 18:33 18:36

19:45 19:52 19:52 19:49 19:50 19:46 19:45 20:00 19:50 19:44 19:47

04:54 05:02 04:57 04:52 04:55 04:53 04:54 04:58 04:56 04:51 04:52

05:04 05:12 05:07 05:02 05:05 05:03 05:04 05:08 05:06 05:01 05:02

06:22 06:29 06:25 06:20 06:22 06:21 06:21 06:26 06:23 06:18 06:19

Maksiat Terus Berlangsung Sepanjang Ramadhan BESITANG (Waspada): Praktik maksiat selama bulan Ramadhan berlangsung bebas di seluruh warung prostitusi Desa Bukitselamat dan Desa Halaban, Kec. Besitang. Merajalelanya bisnis syahwat di bulan suci ini, karena aparat terkait seperti Satpol PP dan Kepala Kantor Sosial dianggap impoten.

Warga Tanam Pisang, Ubi Dan Tebu Di Jalan Rusak TEBINGTINGGI (Waspada):Warga dua dusun di Desa Bakaran Batu, Kec. Sei Bamban, Kab. Serdang Bedagai, memprotes kerusakan jalan di desanya, Selasa (7/8), dengan penanaman pisang di tengah jalan. Aksi dipicu kekecewaan warga menunggu realisasi perbaikan jalan yang dianggap hanya sebatas janji dari pemerintah daerah dan provinsi yang dibiarkan makin parah. “Jalan alternatif ini sudah lama rusak parah pada musim kemarau jalananmenebarkandebuyangmengancamkesehatanwarga dengan permukaan jalan berlubang, sedangkan musim hujan permukaan jalan sangat becek menyulitkan kendaraan melintas,” ucap br Marbun. Seharusnya daerah ini jadi prioritas bagi pemerintah karena merupakan lumbung beras di Sumatera Utara. Selain itu bila jalan Provinsi Tebingtinggi -Serdang Bedagai di wilayah Desa Sei Bamban macet, satu-satunya jalan alternatif adalah jalan ini. Kerusakan jalan diperkirakan sepanjang tiga kilometer.(a11)

Waspada/Khairul K Siregar

KEPALA SDN 104208 Sumadi, S.Pd didampingi Kades Cinta Rakyat Suhendro serta Ketua Komite Sekolah Heriyanto, bersama beberapa siswa yang menerima santunan beras.

100 Siswa SD Kurang Mampu Peroleh Bantuan Beras PERCUT SEITUAN (Waspada): Guna menunjang kegiatan proses belajar mengajar dan pengenalan ajaran agama, ratusan siswa dan para guru SDN 104208 Desa Cinta Rakyat Kec. Percut Seituan mengadakan Pesantren Kilat Peduli (PKP) di halaman sekolah sejak Sabtu (4/8) hingga Selasa (7/8). Hal itu dikatakan Kepala SDN 104208 Sumadi, S.Pd didampingi Ketua Komite Heriyanto kepada wartawan, kemarin. Kegiatan dirangkai dengan pemberian santunan atau tali asih bagi 100 siswa kurang mampu. Dikatakan, kegiatan dalam rangka mengisi belajar mengajar selama Ramadhan 1433 H. Pesantren Kilat Peduli diawali shalat dhuha bersama-sama dilanjutkan Tadarrus Alquran serta ceramah singkat seputar Ramadhan. Pada acara itu Sumadi selaku Kepala SDN 104208 didampingi Heriyanto selaku Ketua Komite Sekolah, Kepala Desa Cinta Rakyat Suhendro, ST dan para guru memberi santunan beras kepada 100 siswa kurang mampu, yang diharapkan dapat meringankan beban dalam menghadapi hari raya Idul Fitri 1433 H. Santunan berasal dari kalangan siswa SD yang dikumpulkan para guru selanjutnya dibagikan kepada 100 siswa.(crul)

Masyarakat menilai, Satpol PP, Kakan Sosial dan aparat terkait lainnyadiPemkabLangkatsudah tak punya keberanian moral untuk menghentikan aktivitas pelacuran dan penjualan minuman keras di kawasan prostitusi di kedua desa. Menurut warga kepada Waspada,parawanitapekerjaseks komersial (PSK) yang umumnya berasal dari Provinsi Aceh bebas melayanilelakihidungbelang,baik siangmaupunmalam.Meskibulan Ramdahan,bisnissyahwatinitetap buka 24 jam, tanpa sanksi. Ada pun razia yang digelar

Kakan Sosial Pemkab Langkat bersama aparat terkait lainnya terhadapwarungprostitusidiKec. Besitang, menjelang datangnya bulan suci Ramadhan hanya setengah hati. Faktanya, kata warga, dari ratusan PSK yang ada, hanya 6 diamankan itu pun kemudian dilepas lagi. Tidak maksimalnya Kakan Sosial bersama Satpol PP menjalankan instruksi Bupati Langkat H. Ngogesa Sitepu, mendapat sorotan tajam berbagai kalangan, termasuk Ketua Bidang Hubungan Internasional dan Nasional Majelis Ulama Indonesia (MUI)

Kab.Langkat,H.SaidRulyArianza. H. Said Ruly Arianza kepada Waspada,kemarin, minta bupati mempertimbangan jabatan Kakan Sosial dan Kasat Pol PP yang dianggap tak becus menjalankan tugas pembersihan tempat maksiat di Besitang. Ia menegaskan, kalau Pemkab tidak mampu menghentikan aktivitas pelacuran, serahkan penanganannya kepada organisasi masyarakat. “Saya minta warungwarung liar yang menyediakan PSK dan minuman keras supaya disterilkan dari bumi Langkat,” tegasnya.(a02)

Prof. DR. HM Hasbalah Thaib, MA:

Umat Islam Berharap Lahirnya Perbankan Islam Di Indonesia BINJAI (Waspada): Prof. DR. HM. Hasbalah Thaib, MA mengemukakan,banyakumatbelum membedakan antara ekonomi Islam dengan ilmu keuangan Islam. Pembahasan tentang perbankan syariah dan asuransi/ takaful atau baitul maal wattamwil, adalah pembahasan tentang ilmu keuangan Islam, bukan ekonomi Islam. Hasbalah Thaib sebagai penceramah pada acara muzakarah yang diselenggarakan MUI Kota Binjai, Minggu (5/8) di kantor MUI Binjai, Jalan Olahraga menegaskan,ilmukeuanganIslam merupakan bahagian kecil dari ekonomi Islam. “Umat Islam berharap dengan lahirnya, perbankan Islam di Indonesia, untuk

majunya ekonomi Islam, kenyataan harapan umat Islam itu tidak tercapai sampai sekarang. Prof. DR. HM Hasbalah Thaib, MA dalam muzakarah MUI yang dibuka Ketua MUI Binjai DR. HM Jamil, MA berbicara dengan thema Ramadhan dan ekonomi Islam. Guru besar FakultasTarbiyah Universitas Dharmawangsa dan Dosen PPS Hukum USU dan Pancabudi Medan, mengemukakan, ibadah terpenting di bulan Ramadhan adalah puasa. Puasa secara langsung akan merubah pola konsumsi umat muslimin. Hasbalah menyebutkan, di Indonesia, potensi kedermawananIslamsangatbesar,namun belum mampu mengangkat

kelompok miskin keluar dari jurang kemiskinan. Hal tersebut, disebabkan perilaku penderma yang masih amat karikatif, yaitu berorientasi jangka pendek. Kerdermawananseringdilakukan dalam bentuk konsumtif dan individual, tidak terorganisir. Prof. Hasbalah mencontohkan, bagaimana Al Azhar di Kairo, dibangun dengan dana waqaf. Begitu juga di Malaysia. Kalau lembaga waqaf diaktifkan di Indonesia dan umat Islam yang kaya, patuh bayar waqaf, yakinlah,umatIslamtidakakanmiskin. Di Binjai, MUI nya mampu mengelolaaktivitaszakatumatIslam, bukan tak mungkin MUI bisa membangun sekolah agama dan memberi pendidikan gratis.(a04)

Waspada/Sugiarto

GM Pujakesuma DS Bagi Sembako Dhuafa MEDAN (Waspada): Kepedulian adalah pondasi untuk membangun masyarakat yang lebih baik dan jauh dari egoisme pribadi, kata Ketua Generasi Muda Pujakesuma Kab. Deliserdang Indra Prawira, ST saat membagi sembako bagi dhuafa di Desa Saentis Kecamatan Percut Seituan, Minggu (5/8). Indra menyampaikan komitmen pihaknya untuk menjadikan kepedulian dan gerakan pengabdian sebagai salah satu program organisasi yang berkelanjutan. Sebagai bagian dari kelompok masyarakat, GM Pujakesuma harus menjadi lokomotif perubahan dan pembangunan di Deliserdang. “Saatnya pemuda berkarya positif dan konstruktif, bukan hanya pengekor dan sekedar menjadi penonton apalagi menjadi beban masyarakat,” tegas Indra didampingi Sekretaris Zailani dan Bendahara Dewi Isnaini, di sela-sela acara yang dihadiri puluhan kader GM Pujakesuma Deliserdang dan tokoh masyarakat di Desa Saentis. Sembako yang diberikan berupa beras, gula dan tepung terigu kepada 100 dhuafa, hasil patungan pengurus didukung donatur Ketua PD Majelis Adat dan Budaya Melayu Indonesia (MABMI) Deli Serdang, T. Achmad Thalaa. Sementara Kepala Desa Saentis Racitno menyampaikan apresiasi dan terimakasih atas kiprah GM Pujakesuma Deli Serdang. “Ini bukti nyata kepedulian pemuda bagi masyarakat dan semoga ke depan GM Pujakesuma semakin bermanfaat bagi masyarakat,” ujarnya.(m41)

Proyek Sarana Air Bersih PDAM Tirta Wampu Terbengkalai LANGKAT (Waspada): Proyek sarana air bersih dengan kapasitas 20 liter/detik di Desa Batu MalenggangKec.Hinai,Kab.Langkatterbengkalai. Bangunan dilengkapi sistem penjernihan air yang diambil dari air Sungai Batang Serangan, bernilai Rp10 miliar, merupakan hibah, namun tidak jelas penggunaannyadansudahditumbuhirerumputan. Data di plang proyek tertulis, proyek dikerakan CV. Rapi, untuk masa 180 hari, tehitung September 2011 sampai Februari 2012. ternyata proyek hibah itu tidak terselesaikan. Direktur Utama PDAM TirtaWampu Jufrizal ketika dikonfirmasi, Rabu (8/8), tidak ada di kantor. Menurut stafnya sedang keluar. Beberapa sumber di kantor PDAM TirtaWampu, Stabat mengakui proyek itu sedang bermasalah akibat diserahkan pekerjaannya kepada orang PDAM Tirtawampu Stabat.

Menurut staf PDAM Tirta Wampu, SN yang juga staf teknik PDAMTirtaWampu ditunjuk Dirut sebagai pengawas dan mengerjakan pemasangan jaringan pipa distribusi , diameter 8 inci, sepanjang 20 km. Begitu juga pekerjaan mekanikal dan elektrikal pompa, serta pekerjaan intek. Pekerjaan itu banyak menimbulkan protes. Tetapi tidak diperdulikan. Seperti kedalaman penanaman pipa 8 inci, dikerjakan sembarangan tidak mencapai kedalaman 1,5 meter. Seharusnya Februari 2012 sudah dioperasikan, dan air bersih bisa dimanfaatkan masyarakat Tanjung Pura dan wilayah Hinai.Ternyata sampai Agustus 2012, belum juga dioperasikan. Apalagi menurut pengakuan karyawan PDAM Tirta Wampu Langkat, di gudang mereka sering terjadi kehilangan, seperti kabel listrik hilang, sepanjang 400 meter.(a04)

Gus Irawan Mohon Doa Restu Kepada Ibunda Syamsul Arifin P.BRANDAN (Waspada): Gus Irawan Pasaribu melakukan kunjungan silaturahmi ke rumah ibundaGubsu(nonaktif)Syamsul Arifin, Hj. Padlah di Jalan Stasiun Kereta Api depan Rutan Kelas II P. Brandan, Kab. Langkat, Rabu (8/8) petang. Kunjungan silaturahmi mantan Direktur Utama Bank Sumut ini sekaligus menyampaikan permintaan doa restu dari Hj. Padlah, karena akan ikut bertarungdalambursapemilihan Gubernur Sumatera Utara, sekitar Maret 2013. Hj.Padlah,yangdudukdikursi roda dengan wajah ceria menyambut kehadiran tamu yang tidak ia sangka datang ke rumahnya petang itu. “Saya mendoakan semoga Allah meridhoi Nak Gus terpilih menjadi orang nomor satu di Sumut,” ujarnya. Di usianya yang sudah mencapai 76 tahun, ibunda Syamsul Arifin masih tampak segar. Meski duduk di kursi roda karena sedikit

gangguan nyeri pada kaki, tapi nenek21cucudan7cicitinibegitu ceria menjalin komunikasi yang penuh nuansa kekeluargaan. Pada kesempatan itu Hj. Padlah menyatakan, dalam menjalani kehidupan manusia

tak terlepas dari cobaan, termasuk dirinya. “Kalau Allah memberi kita terus dengan kesenangan, tanpa cobaan, maka kita bisa lupa kepadaNya. Maka itu cobaan ini ada hikmahnya,” tuturnya.(a02)

Waspada/Edi Saputra

BUPATI Sergai, Ir. HT Erry Nuradi,Wabup Sergai, Ir. H. Soekirman di rumah duka Hj. T. Masyitah (almh), istri Sekretaris DPRD Sergai, Drs. H. Suprin (paling kanan).

Istri Sekretaris DPRD Sergai Meninggal Dunia

Waspada/Asrirrais

GUS Irawan Pasaribu menemui ibunda Syamsul Arifin di kediamannya Jl. Stasiun Kereta Api, P. Brandan, minta doa restu.

Dituduh Curi Laptop, Buruh Bangunan Dihajar Oknum Polisi KETUA GM Pujakesuma Deliserdang Indra Prawira menyerahkan paket sembako bagi dhuafa.

Waspada/Ist

CONTOH dugaan KKN proyek sarana air bersih di Langkat. Pemasangan pipa kedalamannya tak sesuai, seharusnya 1,5 meter.

TEBINGTINGGI (Waspada): Seorang pria babak belur dihajar oknum polisi karena dituduh mencuri laptop. Korban M. Iqbal, 29, warga Dusun III, Desa Binjai, Kec. Tebing Syahbandar, Kab. Serdang Bedagai kini terbaring di RSU Dr. Kumpulan Pane, Tebingtinggi. Didampingi istrinya Salbiah, saat ditemui wartawan, Selasa (7/8), M.Iqbal menuturkan penganiayaan itu terjadi Kamis (2/8) sekira pukul 05:30. Ketika ia bersama istrinya tengah duduk di teras rumah usai sholat Subuh, tiba-tiba Bobi dan Muis yang tak lain masih teman korban datang mengajaknya ke rumah Muis. Setiba di sana seorang oknum polisi yang dikenal bernama Indarmawan Ginting, anggota Polsek Bandar Khalifah sudah menunggu. Lalu tanpa banyak pertanyaan oknum polisi itu langsung mencekik leher korban sambil memintanya mengembalikan laptop yang dicuri dari rumah Muis.“Aku kaget polisi itu langsung mencekik, aku dituduh curi laptop dari rumah Muis,” ucap korban. SelaindianiayadirumahMuis, korbanjugadibawadenganmobil Toyota Avanza ke sebuah gudang

di tengah areal kebun sawit Desa Pengalangan.Disanakorbanjuga disiksa, juga diludahi layaknya binatang dan dipaksa menandatangani surat pengakuan yang dibuatkepaladesasetempat.“Polisi itumintaakumenandatanganisurat pengakuan,” tambahnya. Tidak terima dengan tindakan aparat yang main tangkap dan pukul, korban didampingi istrinya melaporkan kasus ini ke

Polresta Tebingtinggi. Kapolres Tebingtinggi melalui Kasubag Humas, AKP Ngemat Surbakti ketika dikonfirmasi melalui telepon salular, Selasa (7/8) mengatakan,kasustersebutkiniditangani Sat Reskrim Polres Tebingtinggi. “Benar tidaknya kasus itu masih dalam penyelidikan, kita masih memeriksadanmintaketerangan korban serta oknum tersebut,” ucapnya.(a11)

Waspada/Ist

BURUH bangunan babak belur dihajar oknum polisi karena dituduh mencuri laptop. Didampingi istrinya saat dirawat di RSU Tebingtinggi.

LUBUKPAKAM (Waspada): Istri Sekretaris DPRD Kab. Serdang Bedagai, Drs. H. Suprin, Hj. T. Masyitah, 49, meninggal dunia, Selasa (7/ 8) sekira pukul 06:30 di RSU Adam Malik Medan. Almarhumah yang kesehariannya bertugas di Dinas BKD Kab. Deliserdang meninggalkan empat putra, disemayamkan di rumah duka kompleks perumahan Pemda Deliserdang, Desa Samad, Lubukpakam, Kab. Deliserdang, dan dikebumikan di komplek pemakaman Masjid Raya Al Maksum Medan, setelah dishalatkan di Masjid Ar Rahman komplek perumahan Pemda Deliserdang. Turut melayat di rumah duka Bupati Sergai,

Ir. H.T. Erry Nuradi,Wabup Sergai, Ir. H. Soekirman, Wakil Ketua DPRD Sergai, Drs. H. Sayutinur, Sekdakab Sergai, Drs. H. Haris Fadillah, Kepala BKD Kab. Deliserdang, Syahnan Lubis, SH, para Staf Ahli Bupati, Asisten dan Kepala SKPD Pemkab Sergai, anggota DPRD Sergai dan lainnya. Bupati Sergai, HT Erry Nuradi mengatakan langkah, rezeki, pertemuan dan maut serta ajal sebenarnya telah tercatat sejak manusia berada di dalam kandungan. Keluarga besar Pemkab Sergai, lanjut HT Erry Nuradi, mengucapkan duka sedalam-dalamnya, kiranya H. Suprin beserta keluarga tabah dan tawakal menghadapi cobaan ini.(c03)

Keluar Dari Bengkel, Mobil Terbakar TELUKMENGKUDU (Waspada): Baru saja keluardaribengkelsetelahdiperbaiki,mobilSuzuki Amnity BK 1772 ZF dikenderai Khairul Anwar, 27, pegawai BPBD Kab. Serdang Bedagai terbakar di Jalinsum Medan - Tebingtinggi Desa Mata Pao Kec. Teluk Mengkudu, Selasa (7/8) pukul 15:00. Menurut Khairul Anwar di lokasi kejadian, dia baru saja mengambil mobilnya dari bengkel dekat Desa Firdaus setelah diperbaiki, dan menuju

pulang ke rumahnya di Desa Sei Sejenggi, Kec. Perbaungan. Namun di tengah perjalanan tibatiba mobilnya mengeluarkan aroma hangus. Daridepanmobilsekitarmesinkeluarpercikan api yang semakin lama makin membesar hingga menghanguskanmobil.Satuunitmobilpemadam kebakaran BPBD Serdang Bedagai yang tiba di lokasi tetap berupaya mengantisipasi adanya sisa api yang tertinggal.(c03)

Prajurit Yonif-8 Marinir Gelar Lomba Bernafaskan Islam P. BRANDAN (Waspada): Untuk menyemarakkan bulan Ramadhan, Batalyon Infantri-8 Marinir Tangkahan Lagan mengadakan event lomba azan, MTQ, tabuh bedug antar kompi. Selain itu, ibu-ibu Jalasenastri juga turut ambil bagian mengikuti perlombaan nasyid. Event yang berlangsung sejak awal Ramadhan disambut antusias kalangan prajurit. Jura I lomba azan Kompi D, II. Kompi E dan III. Kompi Markas. Sementara juara I MTQ Kompi E, II. Kompi D dan III. Kompi F. Seni tabuh beduk, juara I Kompi D Tim 2, juara II Kompi D Tim 1 dan juara III Kompi E Tim 1. Khusus nasyid, juara pertama ibu-ibu Jalasenastri dari Kompi D, jura II Kompi E, juara III Kompi Markas, juara harapan 1 ibuibu Kompi F. Dan Brigif-3 Marinir Lampung, Kolonel Mar Hardimo yang hadir bersama istri pada acara berbuka puasa bersama di Mako Yonif-8, Senin

(6/8)memberiapresiasiataskreativitasparaprajurit termasuk istri yang mengisi bulan Ramadhan dengan kegiatan bermanfaat. Kolonel Mar Hardimo didampingi Danyonif8, Letkol Mar Daniel Mar Kreuta, memberikan hadiah kepada para pemenang. Di sela pemberian hadiah, Dan Brigif-3 memberi bantuan beras danuangkepadaparaanakyatimdaripantiasuhan Darul Yatama. Ia berharap, acara buka puasa bersama ini dapat meningkatkan silaturahmi yang sudah terbina dengan baik selama ini. “Saya berharap hubungan TNI dan masyarakat tetap harmonis,” ujar Kolonel Mar Hardimo. Buka puasa bersama dihadiri ratusan prajurit, tokoh masyarakat Langkat, pemuka agama, Kapolsek beserta kanit Reskrim Polsek P. Brandan, diisi ceramah agama oleh Alustadz H. Azhari Rasyid.(a02)


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Hajrul Azhari Ritonga, Arianda Tanjung. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Nestapa Pengungsi Rohingya

‘Lebih Baik Dibunuh Daripada Kembali Ke Myanmar’ TANJUNGBALAI (Waspada): Berbagai siksaan dan perlakuan diskriminatif dialami kaum muslim etnis Rohingya, Myanmar, di negaranya, memang sungguh memilukan. Mereka pun kemudian memilih mengungsi. “Kami mohon jangan dipulangkan. Lebih baik kami dibunuhdisinidaripadaharus dikembalikan ke Myanmar,” ujar Mohd Ali, ketika bersama delapan pengungsi muslim etnis Rohingnya lainnya diamankan di ruang detensi Kantor Imigrasi Kelas II Kota Tanjungbalai, Selasa (7/8). Kesembilan imigran pencari suaka itu selain Mohd Ali bin Kaul, 46, juga ada M. Hussain bin Abdul, 30, Mohd Husain bin Hidayat, 33, Mohd Farouk bin Abdul Rashid, dan Salimullah bin Fazal Ahmad. Kemudian dua wanita di antaranya, Juma Bi, 44, dan Peruza binti Nur Muhammad, 19. Di samping itu juga ada dua pengungsi yang masih kanak-kanak, Azizah binti Mohd Ali, 5, dan Mohd Nor bin Mohd Husain, umur satu tahun.

Saat diwawancara Waspada, Mohd Ali menerangkan mereka mengungsi dari Myanmar karenanegaratersebuttidakmengakukeberadaanmuslimRohingya. Umat Islam di sana kerap mendapat bermacam diskriminasi seperti tidak mendapat pendidikan, pekerjaan, dan hak warga negara lainnya. Bukan hanya diskriminasi, etnis mayoritas juga bekerja sama dengan pemerintah setempat melakukan pembantaian dan penghapusan umat manusia (genosida) secara sistematis. Pemerintah juga melarang media mengekspos segala diskriminasi itu sehingga tidak ada informasi yang diketahui dunia luar. “Kalaukamimembunuhetnis Budha karena membela diri, maka langsung diberitakan ke seluruh dunia. Tetapi warga muslim yang mati ditembak, dipancung, dan dibakar lebih dari dua ratus ribu jiwa, tidak pernah disampaikan ke dunia luar,” ungkap Mohd Ali dengan raut wajahsedihmengenangkematian sanak keluarganya. Disinggung negara yang menjadi tujuan pengungsi Rohingya, Mohd Ali yang telah fasih

berbahasa Melayu itu mengaku dia dan keluarganya hanya mencari tempat perlindungan ke negara yang menghormati hak asasi manusia. Sebab, negara asalnya sangat tidak aman dan hidup di sana bagaikan di neraka. Kepala Kantor Imigrasi Kelas II Tanjungbalai-Asahan Yanizur didampingiKasiPengawasandan Keimigrasian Jejen Zainuddin membenarkan mengamankan sembilan pengungsi Rohingnya. MenurutYanizur, pihaknya akan melakukan penyelidikan selama seminggu dan proses selanjutnya akanmengirimkeRumahDetensi Keimigrasian (Rudenim), di Belawan, Medan. Saat ditanya soal pengembalian (deportasi) imigran gelap ke negeri asal,Yanizur menjelaskan selama ini pihaknya belum pernah mendeportasi pengungsi asal Myanmar. Demikian juga ke Australia dan negara lainnya belum pernah dikirim dan hanya ditampung di Rudenim. “Imigran asal Myanmar, sepengetahuan saya belum ada dikembalikan ke negara asal dan tidakpuladikirimkenegaratujuan seperti Australia, Amerika, Kanada dan lainnya,” terangYanizur.

Waspada/Rasudin Sihotang

PETUGAS mendata pengungsi etnis Rohingya, Mynamar, di kantor Imigrasi Kelas II TanjungbalaiAsahan. PantauanWaspada,sembilan imigran muslim Rohingya asal Myanmar ditempatkan di ruang detensi keimigrasian Tanjungbalai. Dari hasil pemeriksaan, masing-masing pengungsi me-

Aksi Pukat Tarik Apung Resahkan Nelayan Batubara BATUBARA (Waspada): Nelayan kecil yang menggarap lahan di Perairan Tanjungtiram Batubara mengakui, gangguan alat tangkap bermodal besar pukat tarik apung, garandong masih seperti ‘doeloe’ bahkan aksi mereka cenderung makin menjadi-jadi. Nelayan kecil di Batubara pun resah. “Sudah tiga hari tak melaut, tangkapanmerosot,karenamasih saja terjadi pelanggaran zona penangkapan dilakukan pukat tarik apung asal luar Batubara. Aneh, tak mampu ditertibkan

petugas,” jelas Berahim salah seorang nelayan pukat gembung di Batubara, Rabu (8/8). Diamengatakandalambulan puasa ini pendapatan nelayan semakinmemprihatinkan,apalagi

menjelang persiapan keluarga berhari raya tinggal sebelas hari lagi. Selain rezeki di laut ditentukan Allah namun tak lepas masih banyaknyagangguanalattangkap pukat tarik apung merajai lahan tangkapan nelayan kecil. Disebutnya, petugas keamanandilautbelumberpihakkepada nelayan kecil karena operasi alat tangkap haram pukat tarik dan pukat apung asal Tanjungbalai masih saja leluasa mengganggu di laut Batubara. “Kami merasa apatis, seakan

laut Batubara milik alat tangkap haram tak mampu ditertibkan, apalagi ditangkap diadili. Entah berapa lama lagi menunggu laut yang tergadai bisa ditebus kembali,” ujar Berahim kesal. Kalangan pengurus HNSI di Batubara mengaku masih saja mendapat laporan nelayan mengenai gangguan alat tangkap pukat tarik dan apung asal luar mengancam kehidupan keluarga nelayan di Batubara, yang belum bisaditertibkanaparatberwenang di laut. (a12)

Peringatan Nuzulul Quran Batubara Tingkatkan Kebersamaan LIMAPULUH (Waspada): Pemkab Batubara memperingati malam Nuzulul Quran 1433 H di Masjid Jamik Kelurahan LimapuluhKota,Kec.Limapuluh, Senin (6/8). Kegiatan itu mendapat antusias dari masyarakat khususnya bagi umat Islam. Hadir tokoh nasional yang juga Ketua Dewan Penasehat Partai Golkar DR. Ir H. Akbar Tanjung, Bupati Batubara H. OK Arya Zulkarnain, SH, MM, Ketua DPRD Selamat Arifin, SE, MSi, tokoh agama, masyarakat dan pemuda. “Melalui momentum peringatan Nuzul Quran diharapkan dapat meningkatkan kebersamaan dalam membangun mental spiritual dan religi, sehingga Batubara bisa semakin terdepan menujumasyarakatsejahteradan berjaya,” tukas bupati di sela-sela acara. Peringatan Nuzulul Quran katanyamomentumpentingbagi umat Islam untuk mengingat kembali sejarah turunnya kitab suci Alquran merupakan keyakinan atas kebenaran ajarannya. “Ini diharapkan dapat memotivasi kita semua untuk meningkatkan kualitas pengamalan keagamaan maupun melaksanakan setiap program direncanakan,” ujar Bupati Batubara yang akrab disapa OK. Bupatimengakudalambulan suci ini dilaksanakan peringatan kemerdekaan RI tepatnya, 17 Agustus 2012 yang juga memiliki makna penting bagi Bangsa

ngantongi kartu dari organisasi PBB yang menangani masalah pengungsian (UNHCR) di negara Malaysia. Kondisi mereka cukup miris, apalagi melihat balita yang masih

berumur satu tahun itu sangat memprihatinkan. Keuangan mereka pun semakin menipis karena habis dikuras para penyelundupyangmembawa mereka dari Malaysia. (a32)

Tadarus Diperlombakan Di Kotapinang KOTAPINANG (Waspada): Tadarus (mengaji kitab suci Alquran di bulan Ramadhan) diperlombakan di Kotapinang. Pemenang diberi hadiah sekaligus dirangkai dengan peringatan Nuzul Qurandi MasjidBesarJl.MesjidRayaKotapinangLabuhanbatuSelatan(Labusel), baru-baru ini. Panitia Penyelenggara H. Mahmul Siregar bersama Mahiddar Sinaga menyebutkan, jumlah peserta lomba baca Alquran ini 65 orang terdiri dari peserta putra dan putri dari semua kalangan usia. Pesertanya berasal dari utusan semua masjid dan mushalla dilaksanakan selama dua malam. Kegiatan ini baru dimulai tahun 2012 dan setiap tahun akan dilanjut karena panitia bersama donatur sudah menyiapkan trophy bergilir. Sedangkan tausyiah dalam rangka peringatan Nuzul Quran disampaikan ustad Faisal betapa pentingnya generasi kedepan untuk memahami, membaca kitab suci Alquran dengan sempurna, tadarus di malam Ramadhan adalah salah satu solusi untuk mengulang kaji sehingga perlu diperlombakan untuk memotivasi generasi kita. Tampak hadir Ketua PHBI Kab. Labusel H. Iqbal Muhammad, Remaja Masjid, tokoh agama, Kenaziran Masjid Besar, serta kaum muslimin dan muslimat tumpah ruah di dalam Masjid Besar yang banyak menyimpan sejarah peninggalan Sultan Kotapinang itu. Dewan juri mengumumkan juara I, II dan III. Putri: SitiWahdini utusan dari Masjid Al-Hikmah. Hj. Siti Kholijah dari Masjid Besar dan Mutiara Jelita utusan dari mushalla Al-Ikhlas. Harapan I, II dan III: diraih Linda dari Mushalla Bakti Kpg, Malim. Hj. Soma juga dari Mushalla Bakti dan Duma Asri Hasibuan dari Mushalla Nurfalah. Untuk juara I, II dan III Putra: diraih Arif Mabrawi utusan Mushalla Alhamdulillah Labuhan, Cipta Lubis dari Mushalla Al-Ilham Kalapane dan Ahmad Baki utusan dari Masjid Besar. Untuk harapan I, II dan III: Nazrul Effendi utusan Mushalla Almukhlisin, Agus Salim dari Masjid Al Hikmah Kpg Banjar dan Zusafri Ritonga Mushalla AlManar Labuhan. (a19)

DPC Gerindra L.Batu Santuni Anak Yatim

BUPATI Batubara H. OK Arya Zulkarnain, SH, MM dalam kunjungan di Masjid Nurul Huda Desa Pematang Panjang, Kec. Limapuluh menyambut kedatangan Tim Safari Ramadhan 1433 H Pemprovsu dipimpin Plt Gubsu, Gatot Pujo Nugroho ST baru-baru ini. Indonesia. Semangat kemerdekaan dapat dikobarkan dalam diri generasi penerus, dengan melakukan hal terbaik, bersikap positif dalam bertindak dan mengisi pembangunan demi negara, bangsa maupun Kab. Batubara. Ustadz, Drs Amhar Nasution MA dalam ceramahnya mengatakan kitab suci Alquran diturunkan Allah SWT pada 17 Ramadhan untuk dijadikan sebagaipedomanhidupmanusia di dunia. Karena di dalamnya

tertera secara lengkap dan komprehensif baik tentang Habluminallah maupun Habluminannas. Dia mengingatkan, hal yang terpenting dilakukan umat muslim melalui momentum peringatan Nuzulul Quran, yakni memasyarakatkan Alquran dan meng-Alquran-kan masyarakat (menjadikan masyarakat yang Qurani, berakhlak baik). Sebelumnya dilaksanakan berbuka puasa bersama dan dilanjutkan

Bupati Labusel Serahkan e-KTP Perdana KOTAPINANG (Waspada): Bupati Labusel,Wildan AswanTanjung menyerahkan Kartu Tanda Penduduk Elektronik (e-KTP) kepada warga di aula kantor bupati, Selasa (7/8). Wildan menegaskan, pengambilan e-KTP warga tidak boleh dipungut biaya. Penyerahan e-KTP itu dilakukan Bupati secara simbolis kepada 53 warga, utusan desa dan kelurahan dari lima kecamatan di Labusel. Masing-masing warga terlihat antusias menerima e-KTP perdana itu. Sementara warga lainnya dapat mengambil e-KTP tersebut di kantor kecamatan masing-masing. “Penyerahan e-KTP ini merupakan jawaban dari pertanyaan dan keinginan warga Labusel selama ini untuk memiliki e-KTP secara gratis,” kata Wildan. Dia menegaskan, pengambilan e-KTP tidak boleh dipungut biaya sama sekali. Karenanya Bupati menyarankan agar warga mengambilsendirie-KTPnya.Kedepannya,katadia,seluruhpelayanan di Labusel harus berdasarkan e-KTP. “Prinsip saya, kalau bisa dipermudah kenapa tidak,” katanya. Pada kesempatan itu,Wildan mengaku bangga karena Kabupaten Labusel termasuk daerah yang sukses melaksanakan program eKTPdari14kabupaten/kotayangmenerimapenghargaan.Menurutnya, pencapaian itu karena kerjasama dan peran aktif masyarakat dalam melakukan perekaman data diri untuk program e-KTP. Sebelum menyerahkan e-KTP secara simbolis kepada masyarakat, Kadisdukcapil Amran Utheh melakukan peragaan keakuratan eKTP dengan cara uji data. Hadir pada kegiatan itu, Asisten, Staf Ahli, jajaran SKPD, dan Camat se-Kabupaten Labusel. (c18)

WASPADA Kamis 9 Agustus 2012

ShalatMaghrib,Isya,danTaraweh berjamaah. Bupati H. OK Arya Zulkarnain, SH, MM dalam kunjung safari Ramadhannya telah mengunjungimasjiddanmushala di Batubara antara lain Masjid Nurul Huda Lolotan, Desa Perkebunan Sei Balai dan Masjid Nurul Huda, Desa Pematang Panjang sekaligus menerima kunjungan Tim Safari Ramadhan Pemprovsu dipimpin Plt Gubsu Gatot Pujo Nugroho, ST. (a13)

RANTAUPRAPAT (Waspada): Dewan Pimpinan Cabang (DPC) Partai Gerindra melaksanakan buka puasa bersama sekaligus menyantuni puluhan anak yatim di Sekretariat DPC Partai Gerindra L.Batu Jl Perdamean Rantauprapat, baru-baru ini. Ketua DPC Partai Gerindra L.Batu Dedi Arfan Sinaga di selasela acara itu mengungkapkan, pihaknya komit memperjuangkan hingga titik akhir membantu kaum miskin dan terpinggirkan, ini merupakan cita-cita Partai Gerindra. Terlebih lagi, kelompok masyarakat yang terpinggirkan tersebut masih banyak terdapat di negeri ini. “Komitmen keberpihakan Partai Gerindra kepada kelompokkelompok yang terpinggirkan secara ekonomi dan politik menjadi tujuan perjuangan akhir partai Gerindra,” jelasnya. Bulan Ramadhan menjadi dasar dan momentum yang tepat untuk saling membantu sesama. Kegiatan seperti itu sudah menjadi kalender rutin parpol tersebut setiap tahunnya. “Kalender rutin DPC Gerindra Labuhanbatu saling membantu dan berbagi untuk sesama di bulan Ramadhan,” ujarnya. Hadir pada saat itu, Ketua DPC Gerindra Labuhanbatu Selatan Arwi Winata, Ketua DPC Gerindra Labuhanbatu Utara Ir. ND Retno Sitowulan dan Penasehat DPC Gerindra Labura yang juga merupakan bakal calon legislatif DPR RI Dapem Sumut 2 Partai Gerindra Salomo Hutabarat yang masing-masing turut memberikan tali asih. Disisilain,DediArfanmenyebutkan,bulanRamadhanmerupakan momentum yang tepat melakukan konsolidasi sesama pengurus dan kader partai hingga ke jajaran ranting. “Bulan Ramadhan menjadi salahsatu harapan baik melakukan konsolidasi partai,” jelasnya. Selain itu, seiring dengan capaian dan cita-cita partai itu, tambah Dedi, konsolidasi semakin dibutuhkan partai menjelang Pemilu dan Pilpres. “Capaian politik dan cita-cita partai memenangkan perolehan suara di Pileg dan mengantarkan Prabowo Subianto menjadi Presiden RI melalui Pilpres 2014,” tegasnya. (a18)

Warga Dambakan Perbaikan Jalan Sipori-pori

Waspada/Rasudin Sihotang

KONDISI jalan Sipori-pori, Kota Tanjungbalai bagai kubangan kerbau saat musim hujan sehingga pengendara harus berhati-hati.

TANJUNGBALAI (Waspada): Warga Kota Tanjungbalai mendambakan perbaikan ruas jalan Sipori-pori, Lingk. VIII, Kel. Kapiaspulau Buaya, Kec. Teluknibung, karena telah lama rusak parah. “Parah sekali udah jalan sini bang, lebih lima tahun tidak diperbaiki. Mohonlah supaya bapakWaliKotaThamrinMunthe memperhatikan,” ujar Ulfa Ginting, dan juga Sangkot S warga sekitar jalan rusak, Selasa (7/8). Menurut kedua warga, hancurnya jalan yang menghubungkan Kota Tanjungbalai dengan Kapiasbatu VIII, Kab. Asahan akibat dilalui truk pengangkut sawit dan kelapa bertonase tinggi. Sementara, kapasitas jalan tidak

mampu menahan mobil sarat muatan. Akibatnya, jika musim kemarau jalan menjadi berdebu dan sebaliknya di waktu penghujan lubang yang menganga tergenang air. Sehingga jalan menjadi licin dan sangat rawan terjadi kecelakaan lalu lintas. Selain itu, proses pendistribusian hasil bumi setempat menjadi terganggu ditambah lagi ongkosnya semakin tinggi. Dampaknya, sangat merugikan masyarakat setempat dan pengguna jalan lainnya. Di tempat terpisah, anggota DPRD Dahnil Karo-karo meminta kepada Dinas Perhubungan memasang portal agar truk besar dapat dicegah melintas di

sana. Karena, hancurnya jalan di sana akibat mobil bertonase tinggi.“Selainpemasanganportal, kita meminta agar dilakukan perbaikan secepatnya sebelum hari raya Idul Fitri 1433 H,” tegas Politisi Partai Hanura tersebut. Pantauan Waspada, titik kerusakan hampir di seluruh permukaan jalan mulai dari pintu masuk jalan Sipori-pori Kec. Teluknibung, Kota Tanjungbalai, hingga perbatasan dengan Asahan. Panjang jalan sekitar tiga kilometer dan menjadi akses utama menuju Kapias Batu VII, Kab. Asahan. Pengendara sepedamotor juga tampak berhati-hati saat melintas karena jalan dilapisi lumpur dan sangat licin. (a32)


Sumatera Utara

WASPADA Kamis 9 Agustus 2012

B3

Mosi Tidak Percaya Untuk Ketua DPRD Palas SIBUHUAN (Waspada): Ketika sejumlah anggota Dewan Perwakilan Rakyat Daerah (DPRD) Kab. Padanglawas (Palas) berusaha memperbaiki situasi politik Padanglawas yang semakin meruncing, di lain sisi Ketua DPRD HM Rido Harahap menyampaikan statemen yang dinilai melukai hati rakyat. Informasi diperoleh Waspada di sekretariat DPRD Kab. Padanglawas, Rabu (8/8), 16 anggota DPRD dari 30 anggota DPRD Palas melayangkan mosi tidakpercayakepadaKetuaDPRD HM Rido Harahap 3 Agustus 2012. Hal itu menyusul Ketua DPRD banyak melakukan berbagai hal yang dinilai menyalahi aturan, bahkan membuat statemen yang melukai hati rakyat. Di antaranya, termasuk sering bertindak sendiri dalam membuat keputusan, seperti pemberian rekomendasi persetujuan proyek multy years pembangunan sarana prasarana perkantoran pemerintahan kabupaten Padanglawas yang sampai sekarang bermasalah dan sedang menjalani proses hukum. Kemudian, Ketua DPRD

Kabupaten Palas cenderung tidak pernah berkoordinasi dengan badan anggaran DPRD Kabupaten Palas soal tindak lanjut hasil evaluasi APBD Palas dari Gubernur Sumatera Utara mulai TA 2010-2012. Malah Ketua DPRD Palas sering membuat statemen di media massa yang terkesan memojokkan sehingga menimbulkan keresahan di tengah masyarakat dan menimbulkan ketidakkondusifan daerah Palas. SebagaiKetuaDPRDseyogianya bisa mengayomi seluruh anggota dewan, tetapi cenderung tidak mampu, sebaliknya sering bertindak sendiri dengan mengatasnamakanlembagasehingga menimbulkan perpecahan di lingkungan internal DPRD. Juga sering mengatasnamakanlembagaDPRD,untukkepen-

Kemenag Paluta Santuni Fakir Miskin GUNUNGTUA (Waspada): Keluarga besar Kementerian Agama Kabupaten Padanglawas Utara, Minggu, (5/8) petang menyantuni fakir miskin dan pelajar berperestasi kurang mampu yang ada diwilayah Kabupaten Padanglawas Utara (Paluta) pada acara buka puasa bersama dilaksanakan di aula Hotel Mitra, Partimbakoan, Kec. Padangbolak. Terlihat penyerahan tersebut dihadiri Wakil Bupati Paluta H. Riskon Hasibuan, Ketua DPRD Paluta, Muklis Harahap, Sekdakab Paluta, Afgani Hutasuhut Asisten I, MUI, Kepala BANK Syariah Mandiri dan Puluhan kaum muslimin dan muslimah yang ikut dalam acara tersebut. Wakil Bupati H.Riskon Hasibuan menyampaikan terimakasih kepada Keluarga Besar Kementerian Agama Paluta yang menyantuni fakir miskin di wilayah Paluta. Riskon juga berharap, hubungan silaturahmi dan bantuan seperti ini mudah-mudahan ke depan dapat lebih ditingkatkan. Dimana melalui kumpulan zakat seperti ini nantinya dapat meringankan beban serta membantu perekonomian masyarakat fakir miskin di wilayah Kab. Paluta. Kepala Kementerian Agama, H.Tohar Bayo Angin mengatakan, santunanterhadapfakirmiskinyangmenyebardisembilankecamatan di Paluta merupakan bentuk kepedulian dan silaturahmi dengan saudara kita yang kurang mampu. Dijelaskan Tohar, sumber dana santuanan tersebut adalah yang dikumpulkan dari zakat keluarga besar Kementerian Agama Kabupaten Padanglawas Utara. “Dana ini kita salurkan kepada fakir miskin dan pelajar berprestasi yang kurang mampu masing-masing mendapatkan Rp400.000 plus kain,” jelasnya. (a35)

Waspada/Sori Parlah Harahap

KELUARGA besar Kementerian Agama (Kemenag) Paluta menyantuni fakir-miskin dan pelajar berprestasi kurang mampu yang ada di Kab. Padanglawas Utara dengan dana zakat Kemenag Paluta.

Timsel Panwaslu Diminta Objektif PANYABUNGAN (Waspada): Ketua Tim bersama anggota yang melakukan Seleksi Calon Anggota Panwaslu Kabupaten/Kota seSumatera Utara di Medan khususnya untuk Kabupaten Mandailing Natal (Madina), diminta bertindak dan berfikir selektif dan objektif atas nama demokrasi. Demikian di sampaikan Ketua Yayasan Madina Centre (YMC), Irwan Daulay kepada Waspada, Senin (6/8) via seluler. Menurutnya, proses penjaringan calon anggota Panwaslu Kabupaten Madina harus bisa menghasilkan kepemimpinan yang bersih dan berwibawa. Katanya, hasil demokrasi bisa berjalan dan diterima masyarakat luas manakala proses demokrasi tersebut diawali dengan pengawasan yang baik, bersih, jujur, mandiri, berkepastian hukum, tertib, kepentingan umum, proporsionalitas, epektif dan efesien. “Untuk itu Timsel dan Panwaslu Sumatera Utara harus bisa melahirkan figur yang memiliki sikap dan karakter serta perilaku yang jujur dan bersih. Sehingga bisa melakukan pengawasan yang baik,” katanya. KetuaDPCPPMadina,SahriwanNasutionaliasKoccumengatakan, ketigaanggotaPanwaslulamayangmasihikutmencalonkandirimenjadi calon anggota panwaslu di Madina harus tahu diri. (c14)

Operasi Pasar PT PHS HUTARAJATINGGI (Waspada): Operasi pasar murah minyak goreng (migor) PT Permata Hijau Sawit (PT PHS) dan PT Permata Hijau Group (PHG) di wilayah Kab. Padanglawas disambut positif masyarakat, di saat harga migor naik sepanjang Ramadhan menjelang Idul Fitri. Menurut Muhammad Siregar, kepala desa mananti Kec. Hutarajatinggi, Minggu (5/8), operasi pasar murah minyak goreng dilaksanakan PT PHS sangat membantu bagi masyarakat, apalgi disaat harga kebutuhan di bulan Ramadhan ini cenderung naik. Dengan adanya operasi pasar murah ini sangat dirasakan masyarakat, dimana saat ini harga minyak goreng curah mencapai Rp12.000/liter. Tetapi saat Ramadhan menjelang Hari Raya Idul Fitri, PT PHS melaksanakan operasi pasar murah minyak goreng dengan harga Rp8.000/liter. David Siburian KDP PT PHS bersama Camat Hutarajatinggi, Kanti Nasution, S.Sos saat membuka pelaksanakan operasi pasar murah di desa Pasar Panyabungan kecamatan Hutaraja Tinggi, menyampaikan bahwa pelaksanaan operasi pasar murah migor yang dilakukan itu merupakan bentuk kepedulian pihak manajemen perusahaan kepada masyarakat sekitar lingkungan perusahaan. Dalam operasi pasar murah migor yang dilaksankan PT PHS tahun ini, akan menyalurkan sekira 5.000 liter minyak goreng untuk wilayah Kab. Padanglawas. Bahkan dikatakannya bahwa pihak manajemen perusahaan bukan hanya melaksanakan operasi pasar murah, tetapi juga akan memberikan tali asih terhadap keluarga kurang mampu, termasuk fakir miskin , yatim piatu. Operasi pasar migor itu dilaksanakan di beberapa titik dan desa di kecamatan Lubuk Barumun, Barumun, Sosa dan Kecamatan Hutarajatinggi. Ini merupakan kegiatan rutin pihak managemen setiap tahun, di bulan suci Ramadhan menjelang Idul Fitri. (a33)

tingan politik peribadinya, terkesan turut mengadudomba PNS Padanglawas. Ironisnya lagi, Ketua DPRD sering mengatakan bahwa beliau adalah penguasa tertinggi di kantor DPRD Palas, dan merasa keputusanya mutlak yang harus dituruti semua anggota DPRD Palas. Terakhir, Ketua DPRD tanpa melalui musyawarah, menyurati pmpinan Bank Sumut sesuai

surat No:170/280/DPRD/2012 perihal pengawasan DPRD terhadap anggaran Pemda, dan menyuruh pimpinan Bank Sumut tidak melakukan pengeluaran uang tehadap SKPD. Sehingga, dengan berbagai tindakan dan keputusan yang dibuat ketua DPRD HM.Rido Harahap, 16 anggota dewan dari sejumlah fraksi menyampaikan surat mosi tidak percaya.

Ketua Badan Kehormatan DPRD Palas H Syarifuddin Hasibuan membenarkan surat mosi tidak percaya tersebut, dimana sejumlah anggota dewan yang mengajukan mosi tidak percaya itu juga membubuhi tanda tangan. Sedang ketua DPRD H.M Rido Harahap, ketika coba dkonfirmasi tidak ada di kantor, menurut keterangan Ketua lagi keluar. (a33)

Jalur Alternatif Panyabungan Menuju Adianjior Perlu Perbaikan PANYABUNGAN(Waspada): Menjelang Lebaran yang diperkirakan arus kendaraan sangat tinggi, jalur alternatif Simpang Gunungbarani- ManyabarAdianjior tembus ke Kota Panyabungan Kab. Mandailing Natal, perlu segera diperbaiki. Kondisinya sekarang sangat tidak nyaman dilintasi akibat badan jalan kupak-kapik. Hasil pengamatan Senin (6/ 8) badan jalan yang hancur terdapat di titik Desa Huta Lombang Lubis-Adianjior. Di kawasan itu, sepanjang satu kilometer badan jalan dihiasi lubang-lubang besar

bagaikan kubangan kerbau, sehinggaPemkabMadinamelalui Dinas Pekerjaan Umum (PU) perlu segeramembenahinyaagar lalu lintas di sana tidak terganggu. Jalur menghubungkan Kec. Panyabungan-Kecamatan Hutabargotitu,perludilakukan perbaikan minimal upaya penimbunan agar masyarakat pengendara tidak terganggu melintasinya, apalagi bahu jalan yang rata-rata cukup tinggi mengakibatkan jumlah kendaraan yang melintasi cukup padat. “Pemerintah daerah segera melakukan penimbunan pasir

dan bebatuan di lokasi jalan yang mengalami kerusakan. Dengan penimbunan sementara jalan tersebut sedikit minimal bisa mengatasi kondisi jalan yang rusak dan berlubang akibat terkena gerusan air,” kata Usman Nasution, salah seorang pengemudi beca bermotor (betor). Kata dia, kerusakan jalan terjadi akibat gerusan atau erosi airhujankarenakondisijalanyang sangat rendah. Karena itu, setiap turun hujan, badan jalan tersebut sering digenangi air karena letak jalan yang sangat rendah dari bahu jalan. (a28)

Waspada/Natar Manalu

SEKIRA1 ha tanaman jagung milik marga Sembiring,berlokasi sekitar 200 meter dari kantor Camat Gunung Sitember,ditanam satu bulan lalu kebanyakan tidak tumbuh. Kalaupun ada yang tumbuh,namun terlihat kerdil.

Ratusan Hektar Jagung Terancam Gagal Panen SIDIKALANG (Waspada): Warga Kecamatan Gunung Sitember Kab.Dairi,kini menjerit karena daerah itu sudah dua bulan dilanda musim kemarau.Akibatnya ,ratusan hektar tanaman jagung terancam gagal panen. Beres Nababan,56 warga Desa Rambarata kepada Waspada,Selasa (7/8) mengatakan,sejak awal Juni hingga Minggu pertama Agustus 2012,daerah kecamatan itu tidak pernah diguyur hujan.Sehingga para petani jarang ke ladang, karena tidak dapat melakukan aktivitas, seperti pemupukan, penanaman bibit dan lainnya. Menurut Nababan di kecamatan itu diperkirakan mencapai ratusan hektar bahkan lebih tanaman jagung yang berumur 1 sampai dua bulan terancam gagal panen.Umumnya tanaman itu berumur satu bulan, nyaris punah.Kalaupunadayangtumbuh,namunterlihat sudah kerdil dan akan tanam ulang.

Camat Gunung Sitember Bahagia Ginting,S.Sos dikofirmasi Waspada,Selasa (7/ 8)mengakui, daerah itu sudah dua bulan dilanda musim kemarau.Memang sekitar tiga minggu lalu,pernah turun hujan tetapi hanya gerimis.Melihat kondisi sekarang,ratusan hektare tanaman jagung dapat dipastikan gagal panen,apabila hujan tidak turun dengan segera. Umumnya petani di kecamatan ini, sekarang jarang ke ladang karena tidak dapat melakukan aktivitas. “Kita hanya dapat menganjurkan, agar masyarakat lebih rajin berdoa. Kita sendiri sangat prihatin melihat warga,yang terancam rawan pangan,” sebutnya. Kecamatan tersebut menurut Camat,terdiri dari delapan desa dengar produk unggulan tanaman jagung.Tidak ada warga yang tidak menanam jagung.Karena memang daerah itu sangat cocok dengan tanaman jagung. (a20)

Polres Dairi Temukan 20 Pohon Ganja

Waspada/Sukri Falah Harahap

CALON Wali Kota Padangsidimpuan, Dedi JP Harahap, diabadikan bersama tokoh adat, H. Tongku Lelo Lubuk Raya, pimpinan parpol, tokoh masyarakat, dan alim ulama, di Masjid Raya Taqorrub Siharang-Karang.

Kesederhanaan Dedi-Affan Memukau Warga P. SIDIMPUAN (Waspada): Sikap bersahaja yang selalu ditunjukkan Calon Wali KotaWakilWaliKotaPadangsidimpuan Dedi Jaminsyah Putra Harahap SSTP.MSP – H. Affan Siregar SE, ternyatasangatmemukausejumlah warga Padangsidimpuan. Bahkan, tokot adat Kota Padangsidimpuan, H. Tongku Lelo Lubuk Raya Harahap, mengajak seluruhmasyarakatkotaituuntuk sama-sama mendukung dan memilih pasangan l calon wali kota-wakil wali kota,Dedi Jaminsyah Putra Harahap SSTP.MSP – H. Affan Siregar SE, di Pilkada 18 Oktober nanti. “Secara pribadi saya meminta dan mengajak seluruh masyarakat, ayo kita dukung dan menangkan Dedi-Affan di Pilkada,” kata Tongku Lelo Lubuk Raya

dihadapan ratusan warga yang menghadiriSafariRamadhansekaligus buka puasa bersama DediAffandiMasjidRayaTaqorrub,Kel. Siharang-Karang,Kec.Sidimpuan Hutaimbaru, baru-baru ini. Padaacarayangdilaksanakan Lintas Partai Pengusung DediAffan ini, Tongku Lelo menyebut Dedi Jaminsyah Putra Harahap merupakan calon pemimpin masa depan Kota Padangsidimpuan yang sudah sejak lama ditunggu-tunggu masyarakat. Diajugaberpesan,ketikaDedi nantinya diamanahkan rakyat memimpinkotaini,kiranyaharus tetap memelihara sikap ramahtamah, santun, sayang kepada rakyat, hormat kepada orangtua, pedulikaumlemah,sebagaimana sifat dan sikap Dedi selama ini. Dedi Jaminsyah Putra Hara-

hap di hadapan warga menyatakan, jika diamanahkan rakyat untuk memimpin kota ini lima tahun kedepan, dia telah berjanji untukmenjadiseorangpemimpin yang selalu mengadukan segala sesuatunya kepada Allah SWT dengan ibadah, zikir dan berdoa. Kemudian akan menjadi pemimpin yang sederhana dan bisa diterima di seluruh komponen masyarakat. Turut hadir pada Safari Ramadhanitu,KetuaDPCPDIP,Taty Ariyani Tambunan SH dan pengurus, Ketua DPD PAN, H Erwin NasutionSHdanpengurusseperti Syahrun Harahap SH, Erfi J SamuderaDalimuntheSH,Ketua DPC PBR, Hamdani Nasution SP dan pengurus, Ketua Partai Barnas, Ali Hotma Hasibuan, dan lainnya. (a27)

SIDIKALANG (Waspada): Satuan Narkoba Polres Dairi menemukan 20 batang pohon ganja dari perladangan di Desa Dolok Tolong, Kec. Sumbul, Rabu (8/8) pukul 07:00. Hal tersebut dijelaskan Kapolres AKBP Enggar Pareanon melalui Kasubbag Humas AKP Lamhot Limbong didampingi Kasat Narkoba AKP D. Sihotang dan KBO Res Narkoba, Ipda Muliadi Anwar, SH kepada Waspada, Rabu (8/8). D.Sihotangmengatakan,batangganjatersebut berumur tiga bulan, sebagian masih setinggi 40 cm. Temuan itu informasinya diperoleh dari masyarakat lalu satuan narkoba diturunkan ke lapangan. Batangganjaberlokasidisebuahperladangan

tergolong sunyi. Dua jam setelah ditemukan, tersangka pemiliknya berinisial AD, 46, warga Desa Tanjung Beringin kecamatan yang sama berhasil diamankan dari rumahnya bersama barang bukti 20 batang pohon ganja. TersangkaadalahwargaDesaTanjungBeringin, namun ia menanam bibit ganja justru di desa tetangganya, Desa Dolok Tolong. Tersangka saat hendakdicidukdarirumahnyatidakdapatberkutik setelah petugas memperlihatkan barang haram itu.Saatdiperiksaiamengakupemilikganjatersebut. Kepada wartawan AD mengatakan belum memikirkan mau kemana dipasarkan daun ganja apabila sudah dipanen. “Sebab masih berumur tiga bulan. Pohon ganja minimal berumur 1 tahun baru dapat dipanen,” sebutnya. (a20)

Polres Usut Kasus Kantor Bupati Nisbar TELUKDALAM (Waspada): Kapolres Nias AKBP Pol. Mardiaz Kusin Dwihananto, Sik, MHum mengungkapkan, kasus Kantor Bupati Nias Barat (Nisbar) dan Dinas Pendidikan dan Kebudayaan Kab. Nias Barat sedang diproses secara hukum. “Tapimemangkitamenghadapikendalayaitu belum ada hasil audit kerugian negara/daerah dari BPK/BPKP. Kita berharap dalam waktu tidak terlalulamaadahasilaudittersebut,”ujarKapolres menjawab Waspada, baru-baru ini. Sedangkan pembangunan Kantor Bupati dan Kantor Dinas Pendidikan dan Kebudayaan Kabupaten Nias Barat yang tidak sesuai Bestek menjadi sorotan tajam di masyarakat.

DemikiandisampaikanFraksiPartaiDemokrat DPRD Kabupaten Nias Barat melalui pemandangan umumnya pada pembahasan pertanggungjawaban pelaksanaan APBD TA 2010, yang ditanda tangani oleh Libertini Mendrofa, S.Pd. Drs. Sulaeman Daeli. Ramani Daeli, SP.d. Halawa, SP.p. Yamotuho Gulo, SE. Pdt. Fadaosi Waruwu, Sth.SH. Faonasokhi Daeli, baru-baru ini. Selain Faksi Demokrat juga Fraksi Pelopor Rakyat Bersatu DPRD Kabupaten Nias Barat meminta kepada penegak hukum untuk mengusut tuntas masalah adanya dugaan korupsi pada Kantor Bupati dan Kantor Pendidikan dan Kebudayaan KabupatenNiasBaratyangdibangun PT. Biduri Jaya Lestari . (ldl)

Samosir Dan Kanwil II DJKN Lakukan MoU Penilaian Aset MEDAN (Waspada): Pemerintah Kabupaten Samosir bertekad akan membangun pemerintahan yang baik dan bersih, terutama dalam pemanfaatan dan pengelolaan aset daerah. Oleh karena itu, Pemkab Samosir melakukan Penandatanganan Nota Kesepahaman Fasilitasi Pengelolaan Barang Milik Daerah dengan KantorWilayah II Direktorat Jenderal Kekayaan Negara (DJKN) Medan untuk melakukan penilaian aset daerah. Penandatanganan MoU tersebut dilakukan Bupati Samosir Ir. Mangindar Simbolon, MM dengan Kepala Kanwil II DJKN Medan Etto Sunaryanto, di Kantor DJKN Kemenkeu RI, Jl. Diponegoro No.30 Medan, Selasa (7/8). Penandatanganan tersebut dihadiri Kepala Dinas Pendapatan, Keuangan dan Aset Daerah Pemkab Samosir Jamien Nainggolan, SE, Kabid Penilaian DJKNTatang Maulana dan Kepala Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Ahsein Lubis. KepalaKanwilIIDJKNMedan Etto Sunaryanto menyambut baik kedatangan Bupati Samosir untuk melakukan kerjasama tersebut. Apalagi katanya, kerjasama tersebut merupakan sudah menjadi tugas dari DJKN sesuai dengan empat tugas pokok dan fungsinya yaitu pengelolaan barang milik negara, penilaian aset negara, melakukan pengurusanpiutangnegara/daerahdan menyelenggarakan lelang. Etto Sunaryanto menyebutkan, penialaian barang milik negara/daerah, dilakukan dalam

rangka penyusunan neraca laporankeuanganpemerintahdaerah (LKPD), juga dilaksanakan dalam rangkapemanfaatanbarangmilik negara/daerah. Sesuai dengan kesepakatan pada tahap awal ini, kerjasama akan dilaksanakan meliputi, penilaian terhadap aset negara di Samosir. Bupati Samosir Mangindar Simbolonmengatakan,kerjasama ini akan membantu Pemkab Samosir dalam melakukan pengelolaan aset secara umum dengan prinsip-prinsip yang baik dan benar. “Memang kami menyadari bahwa tujuan kerjasama ini tidak hanya semata-mata meraih opini dari BPK, tapi tujuan utama kami adalah bagaimana aset atau kekayaan daerah Samosir itu bisa dikelola secara baik dan benar

menurut aturan dan kaidahkaidah yang sudah ditetapkan,” ujarnya. Dia mengakui, selama enam tahunlaporankeuanganPemkab Samosir diaudit BPK, berturutturut mendapatkan opini WDP, belum bisa mendapatkan opini WTP, hal ini dikarenakan persoalan aset. “Namun tujuan kami bukan hanya itu, tetapi kami berharap bisa lebih bertanggung jawab untuk mengelola aset negara di Pemkab Samosir secara lebih baik di masa-masa mendatang. Pengelolaan yang lebih luas, bagaimana bisa menilai, dan memanfaatkan dengan mengikuti aturan-aturan yang ada. Oleh karenaitu,kamimemintabantuan DJKN penilaian aset tersebut,” ujar Mangindar Simbolon. (m41)

Waspada/Sugiarto

Bupati Samosir Mangindar Simbolon dan Kepala Kanwil II DJKN Medan Etto Sunaryanto menandatangani nota kesepahaman Fasilitasi Pengelolaan Barang Milik Daerah Kabupaten Samosir, di Kantor DJKN Kemenkeu RI, Jl. Diponegoro Medan.

Waspada/Sukri Falah Harahap

KETUA dan Bendahara DPD Partai Golkar Tapsel, Rahmat Nasution dan M Akhirun Piliang, didampingi istri menyerahkan santunan kepada anak yatim yang tahun ini jumlahnya 1.671 orang di kediaman Ketua DPRD Tapsel di Padangsidimpuan.

Ketua Golkar Tapsel Santuni 1.671 Anak Yatim P.SIDIMPUAN(Waspada):KetuaDPDGolkar yang juga Ketua DPRD Tapanuli Selatan, H. Rahmat Nasution S.Sos, membantu anak yatim menjelang lebaran, sebagaimana dilakukannya sejak 16 tahun lalu. Ungkapan rasa syukur atas rezeki yang dilimpahkanAllahSWT,terusdiwujudkanRahmat Nasution bersama keluarga dengan cara menyantuni anak yatim dari seluruh wilayah Kota Padangsidimpuan dan Kab. Tapsel, yang tahun ini jumlahnya 1.671 orang. Sebagai bentuk loyalitas terhadap partainya, setiapbingkisanyangdiserahkanRahmatbersama keluarga selalu dibungkus kotak bergambar bendera Golkar, yang di kiri kanannya terdapat foto Rahmat dan Ketua Umum Partai Golkar, Ir. Abu Rizal Bakrie. “Anak yatim ini berasal dari panti asuhan, desa, kelurahan se-Padangsidmpuan danTapsel. Ini malam penyerahan yang keempat, dan kebetulan tahun ini Bendahara Golkar Tapsel, M Akhirun Piliang dan keluarga turut memberi santunan,” kata Rahmat Nasution usai sholat taraweh bersama ratusan anak yatim di kediamannya, Jalan Sutan Muhammad Arief

No. 113, Kota Padangsidmpuan, Minggu (5/8) malam. Seperti tahun-tahun sebelumnya, acara menyantuni anak yatim tersebut diawali dengan buka puasa bersama, lalu shalat Magrib, Isya, dan Tarawih berjamaah hingga tausyiah yang disampaikanAlUstadzYusufAmirilSolehNasution gelar Tuan Nalomok. Diharapkan Rahmat Nasution, kiranya anakanak yatim menjelang Idul Fitri 1433 H dan peringatan hari Kemerdekaan Republik Indonesia ke-66 ini tidak mau kalah dengan keadaan. Tetap rajin menuntut ilmu dan beribadah untuk bekal masa depan yang lebih baik. Bendahara DPD Partai Golkar Tapsel, M Akhirun Keluarga, berharap santunan ini tidak dilihat dari banyaknya.Tapi dari bentuk keikhlasan sebagai makhluk sosial yang sama-sama diciptakan Allah SWT. Al Ustadz Yusuf Amiril Soleh Nasution gelar Tuan Nalomok dalam tausiyahnya mengatakan, tolong-menonolong dan membantu kaum lemah itu wajib hukumnya bagi kaum yang mampu. Ditegaskan juga bahwa anak yatim itu adalah tanggungjawab kita bersama. (a27)


Aceh

B4 Puluhan Titik Jalan Di Pantai Timur Aceh Rawan PULUHAN titik di tiga kabupaten/kota yakni Kabupaten Aceh Timur, Kota Langsa dan Kabupaten Aceh Tamiang, Provinsi Aceh rawan lakalantas. Kondisi itu dipicu tikungan tajam tanpa diserta rambu-rambu jalan yang maksimal dan akibat jalan rusak serta berlubang. Catatan Waspada, sejumlah titik yang rawan kecelakaan di Kabupaten Aceh Timur yakni simpang Lueng, tikungan Paya Naden (Madat), tikungan Paya Demam Dua, tikungan Raja Ula, tikungan Lhoknibong dan tikungan simpang Lueng Angen (Pante Bidari). Selanjutnya tikungan Simpang Ulim, Tikungan Peulalu, tikungan Bata Puteh (Simpang Ulim). Kemudian, tikungan Buket Dendeng, simpang Peut Kuta Binjei (Julok), simpang Ulee Ateung Bagok (Nurussalam), simpang Bagok Panah Sa, simpang Kuala Idi Cut, simpang Peukan Idi Cut, simpang Gampong Baro dan simpang Dama Pulo (Darul Aman). Selanjutnya Simpang Keude Geurobak, simpang Peut Idi Rayeuk, simpang Pos Idi Rayeuk. Selanjutnya simpang Peudawa dan jalan lurus di depan Gardu Induk PLN Alue Batee, Kecamatan Peudawa. Selanjutnya, titik yang rawan lainnya yakni di simpang Pasar Alue Bu, simpang Gampong Beusa, Kecamatan Peureulak Barat. Kemudian, sim-

pang Leuge dan simpang MAN Peureulak dan tikungan Seuneubok Pidie, Kecamatan Peureulak Kota. Di Peureulak Timur antara lain tikungan Alue Tho, Tikungan Alue Bugeng. Sedangkan di Sungai Raya yakni tikungan Alue Rangan. Sedangkan di Birem Bayeun yakni di tikungan Ranto Panjang Bayeun dan tikungan Paya Peulawi Bayeun. Lima titik rawan lantas di wilayah hukumnya yakni KM 413-414 di Desa Sarah Teube Kecamatan Rantau Selamat Kab. Aceh Timur, KM 420-421 di Desa Paya Pelawi Kecamatan Birem Bayeen Kab. Aceh Timur, KM 445-446 di Desa Bukit Panjang Dua Kecamatan Manyak Payed Kab. Aceh Tamiang. Selain itu, KM 450-451 di Desa Sapta Marga. Kecamatan Manyak Payed, Kabupaten Aceh Tamiang dan KM 405-406 di Desa Alue Rangan Geulumpang Payung Kecamatan Sungai Raya Kabuapten Aceh Timur. Sementara di Kota Langsa, titik-titik yang rawan lakalantas yakni jembatan Renggali, simpang Komodor serta simpang Tugu Langsa serta titik rawan lakalantas juga terjadi di jalan negara kawasan Alue Pineung dan Sungai Lueng, Kota Langsa. Sedangkan di Kabupaten Aceh Tamiang titik-titik yang rawan antara lain simpang ABC Tulang Cut, Simpang Kualasimpang setelah jembatan arah ke timur dari barat dan tikungan Kejuruan Muda serta tikungan Pulo Lhee. Kepala Dinas Perhubungan Aceh Timur Drs Zahri, MAP saat

dikonfirmasi menyebutkan, berdasarkan data yang dihimpun pihaknya di wilayah Aceh Timur memiliki 10 titik yakni tikungan Lhoknibong, tikungan Simpang Ulim, tikungan Idi Cut, tikungan Gampong Baroe Idi Cut, dua tikungan depan Dayah Paya Demam Pante Bidari, tikungan Alue Bu Tuha Peureulak Barat, tikungan Blang Bitra Peureulak Kota, Tikungan Geulumpang Payong Sungai Raya, tikungan Raja Ula Pante Bidari, tikungan Pucok Alue Simpang Ulim dan tikungan Alue Cek Doi Julok. Zahri membenarkan, salah satu penyebab kecelakaan di wilayah AcehTimur adalah sedikit tersedianya rambu-rambu jalan dan ketiadaan lampu merah di sejumlah titik seperti di Kota Idi, Julok dan Kota Peureulak. “Minimnya kesadaraan pengemudi yang sedikit juga menyebabkan terjadi kecelakaan di jalan raya, seperti belum sepenuhnya pengguna sepedamotor menggunakan lampu siang hari dan helm muka belakang,” tandasnya. Zahri menambahkan, selain tikungan dan persimpangan jalan yang kerap terjadi kecelakaan di jalan raya, pembangunan jalan negara di tiga titik tahun 2012 diperkirakan tidak tertutup kemungkinan bakal terjadi kecelakaan, sebab jalan masih pada tahap pembangunan. “Titik jalan yang sedang dibangun yakni jalan negara di kawasan Julok - Nurussalam, Gampong Jalan Idi Rayeuk dan Birem Bayeun,” tandas Kadishub Aceh Timur Zahri. (b24)

WASPADA

Kamis 9 Agustus 2012

Waspada/Muhammad H. Ishak

JALAN NEGARA yang rusak dan kini dalam tahap pembangunan dinilai bisa menjadi pemicu kecelakaan jaalan negara Banda Aceh - Medan persisnya di Nurussalam, Kabupaten Aceh Timur. Foto direkam baru-baru ini.

‘Habis Terang Terbitlah Gelap’ Di Aceh Tamiang TOKOH emansipasi wanita pada zaman kolonial Belanda ketika menjajah rakyat Indonesia, Raden Ajeng (RA) Kartini pernah menerbitkan buku yang berjudul “Habis Gelap Terbitlah Terang” .RA kartini sehingga dinobatkan sebagai pahlawan nasional sebagai tokoh emansipasi wanita Indonesia. Sedangkan di Aceh Tamiang, Senin (6/8) sekira pukul 02:30 dini hari sampai Selasa (7/ 8) sekira pukul 00:25 menjelang dini hari, nyaris hampir sehari suntuk berhasil menorehkan predikat “Habis Terang Terbitlah Gelap”. Pantauan Waspada,Senin (6/8) malam sampai menjelang dini hari, dari pengeras suara yang ada di masjid dan meunasah (surau) di Kota Kualasimpang dan sekitarnya di Kabupaten Aceh Tamiang terdengar suara orang yang sedang mengumandangkan ayat-ayat suci Alquran. Memang suasana seperti itu sudah biasa terjadi di bulan suci Ramadhan, apalagi pada malam itu memang dalam suasana memperingati Nuzulul Quran. Namun tiba-tiba suara orang mengaji di masjid dan meunasah tiba-tiba hilang berubah menjadi sunyi senyap tidak terdengar lagi lewat pengeras suara dan suasana di Kota Kualasimpang dan sekitarnya berubah menjadi gelap gulita karena aliran listrik PLN tiba-tiba padam, Senin (6/8) sekira pukul 02:30 dini hari. Selain warga yang sedang mengaji tiba-tiba hilang suaranya dari pengeras suara di Mesjid dan meunasah yang ada di sejumlah kawasan seperti di sebagian kawasan Kota Kualasimpang, Kecamatan Rantau, Karang Baru dan Kejuruan Muda. Tentu saja akibat aliran listrik PLN itu padam telah mengakibat, terutama ibu-ibu dan remaja putri yang ingin memasak untuk persiapan menu makan sahur pada bulan Ramadhan menjadi agak repot karena memasak dalam suasana gelap gulita. Bagi ibu-ibu dan remaja putri yang ingin memasak un-

tuk persiapan sahur bagi kelurganya, tentu saja kelabak akibat aliran listrik padam .Untuk mengatasinya mencari korek api dan senter, lalu menghidupkan lampu minyak dan lilin serta ditemani lampu yang menyala dari senter yang tersedia di rumah masing-masing. Pengamatan Waspada, pemandangan yang nyaris sama juga terlihat di kedai-kedai kopi dan warung nasi yang ada di seputaran kota Kualasimpang. Warga yang ingin menyantap sahur yang tersedia di meja makan ditemani alat penerangan menyalakan lilin karena aliran listrik tidak menyala setelah ditunggu cukup lama padamnya. Bahkan suasana gelap gulita bukan saja terjadi ketika menjelang santap sahur dan subuh, malahan ketika umat muslim menikmati berbuka puasa juga dalam suasana gelap gulita karena aliran listrik tidak kunjung menyala. Di tengah suasana berbuka puasa juga Kabupaten Aceh Tamiang diguyur hujan lebat dan suara petir yang sambung menyambung, hingga lengkaplah sudah suasana gelap gulita berkoloborasi dengan suasana hujan lebat dan suara petir sambung menyambung dinikmati warga di Bumi Muda Sedia itu. Untuk menghadapi susana gelap gulita yang terjadi ketika menjelang sahur dan shubuh serta waktu berbuka puasa dan Magrib dan Isya serta Tarawih, ada juga warga di rumahnya yang memiliki genset menghidupkan mesin yang menghasilkan aliran listrik itu. Begitu juga pemilik warung kopi/warung nasi ada juga yang menghidupkan genset sebagai alat penerangan . Hal itu harus dilakukan oleh warga di daerah yang dijuluki sebagai Bumi Muda Sedia itu karena aliran listrik yang dinantinantikan tidak kunjung menyala setelah ditunggu cukup lama pada Senin dini hari itu. Lagi pula sebelumnya memang tidak ada pengumuman bakal ada pemadaman aliran listrik dan memang listrik padam secara tiba sehinga suasana

Latief dan unsur Muspida Aceh Tamiang lainnya kepada Waspada, Senin (6/8). Dalam suasana hujan lebat mengguyur Aceh Tamiang pada saat menjelang berbuka puasa dan sampai pukul 21:00 , setelah dinanti-nantikan warga, akhirnya aliran listrik yang padam itu barulah menyala kembali pada hari Selasa ( 7/8) sekira pukul 24:25 menjelang dini hari. Tentu saja sebelumnya juga umat muslim yang menunaikan ibadah puasa Ramadhan sempat menikmati makan sahur dan berbuka puasa dalam suasana gelap gulita. Ka. PLN Kualasimpang, Irwan P ketika dikonfirmasi

Waspada/Muhammad Hanafiah

WARGA yang sedang memasak untuk persiapan menu santap sahur di bulan Ramadhan memasak dalam suasana gelap gulita ditemani alat penerangan berupa lampu teplok dan senter karena aliran listrik PLN padam di Aceh Tamiang, Senin (6/8) sekira pukul 02:30 dini hari. “ Habis Terang Terbitlah Gelap” pada hari menjelang datangnya subuh itu. Suasana sangat gelap gulita dank arena padamnya aliran listrik itu membuat warga dari berbagai penjuru Aceh Tamiang tanpa ada yang mengkomandoi mengirim pesan singkat kepada Waspada. Isi pesan singkatnya bermacam-macam versi. Ada yang menanyakan mengapa aliran listrik padam di bulan Ramadhan, ada juga yang menggerutu melampiaskan kemarahannya akibat listrik padam dan tidak sedikit warga melalui SMS meminta Waspada agar menulis tentang kasus “ Habis Terang Terbitlah Gelap “ini. Ada warga yang mempertanyakan melalui SMS kepada Waspada, mengapa listrik padam sangat lama tidak menyala-nyala dan sebenanrnya ada apa yang terjadi sehingga aliran listrik PLN padam di bulan puasa ini. “ Kalau kita telat bayar rekening listrik tidak ada maaf bagi PLN, tetapi pihak PLN sukasuka hati saja memadamkan lampu.bahkan kalau kita telat bayar rekening listrik langsung

denda dan pihak PLN juga tidak segan-segan main potong aliran listrik di rumah kita ,” ungkap kekecewaan warga melalui SMS yang dikirim kepada Waspada. Lebih unik lagi ada juga isi pesan singkat yang dikirim kepada Waspada , warga menyatakan suasana gelap gulita terkesan seperti mengingatkan kembali warga ketika diberlakukan zaman Aceh dibalut konflik. Bukan itu saja, ada juga warga yang mengirim SMS. Mereka menggambarkan suasana gelap gulita seperti mereka tinggal menetap di kota “ hantu” . Bahkan ada juga yang menyebutkan mereka seperti sedang berada malam hari di hutan rimba tanpa lampu ,gelap gulita. Selain itu ada juga warga yang mengirim pesan singkat menyatakan mereka seperti burung walet yang tinggal di gedung penangkaran walet yang ada di Kota Kualasimpang dan sekitarnya tanpa lampu. “ Tolong Anda tulis di koran, suasana gelap gulita ini seperti kita tinggal di tepi barat jalur Gaza ketika perang antara Palestina dengan Israel, lalu pasukan Israel memadamkan aliran lis-

trik sehingga susananya menjadi gelap gulita dan listrik tidak kunjung menyala,” begitu isi SMS yang dikirim warga kepada Waspada pada menjelang Subuh, Senin (6/8). Kekecewaan Yang Wajar Sedangkan Kepala Mukim Kota Kualasimpang,Idris Pardan kepada Waspada mengakui sangat banyak warga yang kecewa akibat aliran listrik PLN padam dan hampir sehari suntuk listrik tidak menyala di Kota Kualasimpang.“Wajar banyak umat muslim yang kecewa akibat aliran listrik yang padam hampir sehari suntuk,” ungkap Idris kepada Waspada ketika menghadiri acara buka puasa bersama di rumah kediaman Sekda Aceh Tamiang, Syaiful Bahri, Senin (6/8). Bahkan, pengamatan Waspada, acara berbuka puasa bersama yang berlangsung di rumah Sekdakab Aceh Tamiang di Karang Baru itu juga harus menggunakan genset. “ Kami pakai genset supaya tidak gelap akibat listrik padam,” kata Syaiful Bahri yang didampingi Bupati Aceh Tamiang, H Abdul

Jumlah Warga Miskin Di Aceh Tamiang Diklaim Menurun KUALASIMPANG (Waspada) : Jumlah angka orang miskin dan pengangguran semakin menurun dari tahun ke tahun sejak tahun 2007 -2011 di Kabupaten Aceh Tamiang. Bah-kan, jika industri smelter biji besi yang akan berdiri di Aceh terealisasi, maka angka kemiskinan dan angka pengangguran akan terus semakin menurun. “ Mengenai jumlah angka kemiskinan dan jumlah pengangguran yang ada di Kabupaten Aceh Tamiang, dapat kami jelaskan jumlah angka penduduk miskin di Aceh Tamiang ta-hun 2007 dan 2008 sebesar 50.800 jiwa,tahun 2009 sebesar 54.300 jiwa dan tahun 2010 se-besar 45.200 jiwa,” papar Bupati Aceh Tamiang, H Abdul Latief dalam sambutannya pada si-dang paripurna istimewa penyampaian jawaban atas pandangan umum fraksi-fraksi terhadap laporan keterangan pertanggungjawaban (LKPJ) Akhir Masa Jabatan Bupati Aceh Tamiang dan Wabup Aceh Tamiang Periode 2007-2012 di Gedung

DPRK Aceh Tamiang, Senin (6/ 8). Menurut Latief, dari tahun 2007 sampai dengan tahun 2010 angka penduduk miskin di Kabupaten Aceh Tamiang mengalami penurunan sebesar 11,02 persen. Sedangkan tingkat pengangguran, imbuhnya lagi, tingkat pengangguran terbuka merupakan perbandingan penduduk yang mencari kerja terhadap total angkatan kerja . Bupati Aceh Tamiang itu merincikan persentase tingkat pengangguran terbuka di Kabupaten Aceh Tamiang pada tahun 2007 sebe-sar 12,2 persen, tahun 2008 menurun sebesar 11,2 persen, tahun 2009 menurun sebesar 9,90 persen, tahun 2010 menurun menjadi 8,03 persen dan pada tahun 2011 menurun menjadi 6,7 persen. Rata-rata penurunan tingkat pengangguran terbuka di Kabupaten Aceh Tamiang sebesar 13,81 persen. Sementara itu data yang dihimpun Waspa-da dari Badan

Pusat Statistik ( BPS) Kabupaten Aceh Tamiang, Senin (6/8) menyebutkan, jumlah penduduk Kabupaten Aceh Tamiang menurut jenis kelamin pada tahun 2008 tercatat 265.991 jiwa, rinciannya laki-laki 132.901 jiwa dan perempuan 133.090 jiwa, tahun 2009 tercatat 250.329 jiwa yang terdiri dari laki-laki 126. 368 jiwa dan perempuan 123.961 jiwa ,pada tahun 2010 tercatat 251.914 jiwa, rinciannya laki-laki 127.355 jiwa dan perempuan 124.559 jiwa. Data statistik Jumlah penduduk Kabupaten Aceh Tamiang menurut kegiatan utama tahun 2010 tercatat jumlah penduduk yang masih sekolah pada waktu itu sebanyak 68.461 jiwa, sedangkan yang sudah bekerja tercatat 114.402 jiwa dan tidak bekerja ( unemployment) tercatat 69.051 jiwa dari total jumlah penduduk pada tahun 2010 sebanyak 251.914 jiwa yang tersebar di 12 Kecamatan dalam wilayah Kabupaten Aceh Tamiang.

Sebelum Dimekarkan Bupati Aceh Tamiang, H Abdul Latief menyatakan, mengenai persoalan investor yang sampai saat ini belum berjalan secara maksimal dapat juga dijelaskan, sebelum pemekaran dari Aceh Timur, telah ada sejumlah perusahaan besar baik perusahaan asing maupun perusahaan nasional yang menanam modalnya di wilayah Tamiang. Latief menambahkan, demikian juga perusahaan pengolahan hasil perkebunan tersebut dengan munculnya Pabrik Kelapa Sawit (PKS) yang menjamur dan sampai saat ini telah mencapai 11 unit terdiri dari 9 unit berkapasitas besar dan 2 unit berkapasitas kecil (mini) Selain itu ,sebut Latif, kemudian di kabupaten Aceh Tamiang telah ada perusahaan pengo-lahan karet di Kampung Paya Ketenggar, Keca-matan Manyak Payed yaitu perusahaan dari Malaysia. Latief menambahkan, selanjutnya di bidang perdaga-

ngan di Aceh Tamiang telah muncul swalayan-swalayan baik yang berka-pasitas besar maupun sedang. Hal ini akan sangat berpengaruh terhadap ekonomi masya-rakat dan perputaran uang di Aceh Tamiang. Bupati Aceh Tamiang itu juga menyatakan perlu dijelaskan pada tanggal 27 Juli 2012 pihaknya telah menerima manajer perusahaan MKH Berhard dari Malaysia yang berminat untuk berinvestasi di bidang usaha industri smelter biji besi di Kabupaten Aceh Tamiang sesuai dengan surat Kemenko Bidang Perekonomian Nomor :S-30/D.IV.M EKON.2/06/2012 tanggal 19 Juni 2012 telah meninjau lokasi untuk industri tersebut. “ Tentu saja jika industri itu berjalan sesuai dengan harapan kita semua dapat mengurangi penduduk miskin dan membuka lapangan kerja yang membawa ekses akan semakin menurunnya angka pengangguran di Aceh Tamiang,” tegas Latief. (b23)

Waspada melalui telepon selular, Senin (6/8) menyatakan pihak mohon maaf atas terjadinya listrik padam secara tibatiba di bulan Ramadhan. “ Kami mohon maaf karena ada gangguan sehingga aliran listrik padam di sebagain kawasan di daerah ini,” kata Irwan melalui pesan singkat yang diterima Waspada. Menurut Irwan, sebagai informasi gangguan semalam menyebabkan aliran listrik disebagian Sei Liput ( Kejuruan Muda) dan termasuk sebagian Kota Kualasimpang sekitarnya adalah akibat terbakarnya kabel induk di gardu Tualang Cut ( Kecamatan Manyak Payed), se-

hingga semalam ( baca: Senin ketika menjelang sahur dan Subuh) tidak ditemukan kabel yang terbakar karena kabel tersebut jalurnya di dalam tanah.” Pagi barulah kita temukan kabel yang terbakar itu,” terang Irwan seraya menambahkan pihaknya harus mengganti kabel yang terbakar itu agar aliran listrik bisa menyala kembali normal seperti biasa. “ Kami mohon maaf karena terjadinya ganguan sehingga aliran listrik padam cukup lama,” pinta Irwan melalui Waspada. Muhammad Hanafiah

Lukman, Penyandang Cacat Yang Mandiri Bukan bermaksud tidak sopan kepada konsumen atau siapapun, tetapi begitulah cara yang bisa dilakukan Lukman, 29, lelaki bujang asal Kemukiman Reubee, Kecamatan Delima, Kabupaten Pidie, saat menawarkan dagangannya kepada konsumen. Meski fisiknya tak sesempurna manusia ciptaan Tuhan pada umumnya, namun lelaki bertubuh ceking dan berkulit hitam ini mempunyai tekad dan semangat hidup yang tinggi. Selain cacat fisik yang merupakan bawaan sejak lahir, Lukman juga mengalami keterbelakangan mental dan bicaranya tidak begitu lancar. Baginya tidak ada kata menyerah dalam mengarungi kerasnya kehidupan. Bahkan, pantang baginya menjadi peminta-minta walau hanya untuk sesuap nasi. Ini pula yang mengundang decak kagum setiap orang yang menyaksikan cara Lukman mengumpulkan rupiah demi rupiah, dengan menawarkan kantong plastik atau kantong kresek kepada konsumen yang membutuhkan. Kantong-kantong plastik itu diperlukan untuk memudahkan mereka membawa barang belanjaan. Terpal plastik seukuran 1,5 x 2 meter dengan warna yang sudah kusam, menjadi alas tempat duduk sekaligus tempat Lukman menggelar dagangannya di kaki lima Pasar Ikan Peunayong, Kota Banda Aceh. Kantongan plastik yang ditawarkan anak kedua dari empat bersaudara ini, umumnya ukuran sedang dan besar. Untuk kantong plastik ukuran sedang, dihargainya Rp1.000 perlembar. Sedangkan ukuran besar Rp1.500 per lembar. Kantong-kantong plastik itu dijepit pada ujung kaki, lalu dikibas-kibas ke kiri dan kanan sehingga menarik minat konsumen untuk membeli. Karena ketekunan dan kegigihannya itu, tidak jarang para konsumen menolak uang kembalian yang disodorkan Lukman untuk harga satu lembar kantong plastik yang ditawarkan. Walau tidak banyak kalimat yang terucap dari mulut anak ke dua dari empat bersaudara itu, namun para pedagang kaki lima yang lain mengenalnya sebagai sosok yang peramah, suka bergurau dan tidak pernah menyimpan

rasa dendam terhadap perlakuan yang diterimanya. Amiruddin, salah seorang pedagang kaki lima yang lapaknya hanya berselang beberapa meter dari tempat Lukman menggelar dagangannya menyebutkan, Lukman adalah sosok yang sederhana dan ramah sehingga disukai semua orang. Menurut Amir, usaha sebagai penjual kantong plastik telah ditekuni Lukman sejak tiga tahun silam. Dia memulai usahanya itu berkat kemurahan hati seorang pedagang kelontong di Pasar Peunayong, yang mengutangkan beberapa kantong plastik kepada Lukman untuk dijual secara eceran. Biasanya, di lapak itu, Lukman berjualan berdampingan dengan ibunya yang menjual sayur-sayuran dan beberapa bumbu masak. Namun, pada hari itu, ibunya sedang tidak jualan karena sedang pulang ke kampungnya di Pidie. Dari hasil usahanya itu, selain untuk memenuhi kebutuhan diri pribadinya, Lukman juga ikut membantu biaya pendidikan adikadiknya. “Orang tunya sudah lama berpisah sehingga ibunya harus berjuang keras untuk membiayai kebutuhan keluarga. Untung Lukman ikut membantu meringankan beban ibunya itu,” kata seorang warga Lampaseh, tetangga tempat Lukman dan ibu serta abang dan kedua adiknya kini berdomisili. Kehidupan Lukman dan ibu serta adik dan abangnya, cukup sederhana. Mereka menempati sebuah rumah kontrakan yang dibayar dengan hasil usaha mereka. Untuk pulang dan pergi ke pasar tempatnya mencari nafkah, Lukman biasanya menumpang sebuah becak mesin yang sudah menjadi langganannya. Melalui bahasa isyarat dan gerakan mulut dengan suara harus terungkap, keinginan Lukman sekarang ini adalah memiliki tempat berjualan yang representatif. Namun disadarinya, angan-angan itu ibarat panggang jauh dari api karena Lukman dan ibunya tidak memiliki modal. Iskandarsyah

Waspada/Iskandarsyah

LUKMAN, lelaki cacat penjual kantong plastik eceran di Pasar Ikan Peunayong, Banda Aceh sedang menawarkan barang dagangannya kepada konsumen.


Aceh

WASPADA Kamis 9 Agustus 2012

Lakalantas, Warga Aceh Utara Tewas Di Aceh Timur PEUREULAK (Waspada) : Kecelakaan kembali terjadi di Jalinsum Banda Aceh – Medan, persisnya di kawasan Desa Pasir Putih, Kecamatan Peureulak Kota, Kabupaten Aceh Timur, Selasa (7/8) sekira pukul 18:30. Akibatnya, seorang pengendara sepedamotor asal Aceh Utara meninggal dunia di Aceh Timur. Kecelakaan kali ini terjadi antara Bus Pusaka BL 7387 PB dengan Supra X 125 BL 3313 LQ. Korban meninggal dunia bernama Muhammad Yunus, 33, asal Desa Pidie Rayeuk, Kecamatan Baktia, Aceh Utara. Kasus kecelakaan itu kini sudah ditangani pihak Polantas Pos Peureulak Kota. Kapolres Aceh Timur AKBP Iwan Eka Putra melalui Kasat Lantas Iptu Teysar Rhofadli Paryitno, Rabu (8/8) menjelaskan, kejadian berawal ketika Bus Pusaka melaju dengan kecepatan sedang dari arah Medan ke Banda Aceh. Sementara Supra X 125 yang dikendarai Muhammad Yunus juga melaku dari arah yang sama dengan kecepatan sedang. Kasat Lantas menambahkan, menurut saksi mata di lokasi, tiba-tiba sepedamotor yang dikendarai Muhammad Yunus terperosok ke lubang yang mengakibatkan Muhammad Yunus terpental ke badan jalan. “Saat bersamaan, Bus Pusaka yang melaju dengan kecepatan sedang spontan menghantam Muhammad Yunus dengan bagian samping kiri body Bus Pusaka,” kata Teysar.(b24)

Waspada/Mustafa Kamal

SUASANA sosialisasi KIP Lhokseumawe saat memaparkan meka-nisme verifikasi Pemilu 2014 yang disampaikan Ketua Komisioner Verifikasi di Hall Lido Graha Hotel Lhokseumawe, Rabu (8/8).

KIP Lhokseumawe Mulai Sosialisasi Pemilu 2014 LHOKSEUMAWE (Waspada): Komisi Independen Pemilihan (KIP) Kota Lhokseumawe mulai melakukan sosialiasi Pemilu 2014. Sosialisasi di hadapan para pengurus parpol, tokoh masyarakat dan intansi terkait dilakukan di Samudera Hall Lido Graha Hotel Lhokseumawe, Kamis (8/8). Ketua Komisioner KIP Lhokseumawe Busra menyebutkan, dalam sosialiasasi ini dalam melakukan tahapan verifikasi vaktual pendaftaran parpol di Lhokseumawe, pendaftaran mulai 10 Agustus hingga 7 September 2012. Dan, verfikasi mulai 11 Agus-tus sampai 30 Desember 2012 dan penetapan parpol 9 hingga 15 Desember 2012. Partai politik di tingkat kabupaten/ kota berkewajiban menyerahkan Kartu Tanda Anggota (KTA) ke KIP untuk diverifikasi. Katanya, KIP juga akan memverifikasi kantor atau sekretariat partai politik. karena selama ini banyak kantor parpol tidak jelas di mana. begitu juga verifikasi keterwakilan 30 persen perempuan dalam kepengurusan. Namun, Pemilu 2009 secara nasional ada 41 parpol. Di Lhokseumawe hanya 28 parpol, tapi pada Pemilu 2014 nanti, KIP belum memastikan jumlahnya. Sosialisai dilakukan KIP Lhokseumawe berdasarkan Peraturan Komisi Pemilihan Umum Nomor 8 Tahun 2012 tentang pendaftaran, verifikasi, dan penetapan partai politik peserta pemilu anggota DPR, DPRD provinsi dan DPRD kabupaten/ kota. Sosialisasi ini diikuti oleh 15 pengurus partai politik di Lhokseumawe.(cmk)

Rumah Terbakar Usai Buka Puasa

Janda Rawang Iteik Tinggal Di Tenda Darurat

Waspada/Musyawir

SEORANG warga naik ke atap bilik santri Pesantren Malikussaleh, ketika berusaha memadamkan api yang membakar rumah janda Kamaliah, di Dusun Damai, Desa Rawang Iteik, Kec. Tanah Jambo Aye, Aceh Utara, Selasa (7/8) malam.

Polisi Diminta Telusuri Kasus Mercon Dibungkus Alquran LHOKSEUMAWE (Waspada): Abu Mustafa Akhmad yang akrab disapa Abu paloh Gadeng, Ketua Majelis Permusyawatan Ulama (MPU) Kabupaten Aceh Utara meminta polisi usut kasus mercon berbalut Alquran hingga ke pabrik tempat produksi mercon. Pemilik pabrik mercon dinilai telah melecehkan Alquran kitab sucil umat muslim di dunia. ‘Persoalan mercon yang dibalut dengan Alquran bukan

persoalan masyarakat muslim di Aceh Utara atau Aceh, tapi persoalan ini merupakan persoalan umat muslim di dunia. Pemilik pabrik mercon itu telah melecehkan Alquran. Pemilik pabrik harus ditangkap dan diberikan hukuman yang setimpal dengan perbuatannya,” kata Abu Paloh Gadeng, Rabu (8/8). Menurut Abu, mercon berbalut Alquran telah ditemukan di lima kecamatan yaitu Tanah Jambo Aye, Langkahan, Nibong, Tanah Luas, dan Syamtalira Bayu, terbanyak ditemukan di Syamtalira Bayu. Hampir semua ayat di dalam Alquran diambil untuk membalu mercon. Menjawab Waspada, masyarakat selama ini tidak bisa

mengambil tindakan tegas terhadap penjual mercon karena mercon itu dibeli oleh anakanak mereka dari pedagang keliling, sehingga penjual tidak bisa ditemukan kembali. Sebagai bentuk protes, umat Islam diminta melarang keras anak-anaknya untuk membeli dan membakar mercon. Pembakaran mercon merupakan perbuatan mubazir dan mubazir dekat dengan syaitan. Agar kasus pembakaran Alquran lewat mercon cabai dapat segera dihentikan, polisi harus menyelidiki atau membuat investigasi sehingga diketahui pabrik siapa tempat mercon itu diproduksi. Ini penting dilakukan, karena menyangkut kitab suci umat muslim. (b18)

Waspada/Gito Rolies

Nasir Djamil Safari Ramadhan Di LP Kelas II A Lambaro

Waspada/H.AR Djuli

Lantai Pasar Ikan Bireuen Tergenang Limbah BIREUEN (Waspada) : Warga yang berbelanja ke pasar ikan Bireuen mengeluh. Pasalnya, lantaran saluran pembuangan limbah tidak berfungsi lantai pasar ikan kotor terendam air limbah ikan dari lapak-lapak penjualan pedagang. A Wahab, bersama sejumlah pedagang ikan juga sangat mengeluh tidak tenang berjualan lantaran lantai pasar ikan selalu tergenang air limbah terpaksa setiap saat harus menyapu air limbah di depan lapak penjualan mereka. Kalau air limbah yang tergenang tidak disapu masyarakat pembeli tidak dapat melewati lapak penjualan mereka. Para pedagang ikan sangat berharap kepada dinas terkait perlu sesgera merehab kembali saluran pembuangan limbah pasar ikan Bireuen yang sudah tidak berfungsi. Pengamatan Waspada, Rabu (8/8), terendamnya limbah di lantai pasar ikan Bireuen kelihatan masyarakat yang berbelanja membeli ikan terutama para kaum ibu terpaksa berhati-hati melewati lantai pasar ikan yang licin terendam limbah agar tidak tergelincir jatuh di genangan air limbah. Selain itu kondisi pasar ikan Bireuen sangat semraut masih campur aduk dengan pedagang ayam bersepeda motor menggelar dagangan ayam dalam keranjang memadati jalan masuk pasar ikan, sehingga sulit dilalui masyarakat untuk berbelanja membeli ikan. (b12)

BANDA ACEH (Waspada): Wakil Ketua Komisi III DPR Nasir Djamil bersama jajaran Kanwil Kemenkum Ham Aceh melakukan Safari Ramadhan di LP Kelas II A Lambaro, Kabupaten Aceh Besar, Selasa (7/8). Politisi PKS ini melaksanakan tausyiah Ramadhan dan acara buka bersama dengan para napi serta dilanjutkan dengan melakukan shalat tarawih bersama di mushala dalam pekarangan lapas. Dalam kesempatan itu Nasir Djamil sepat menyinggung tentang perseteruan keberadaan bilik asmara di dalam lapas dan rutan. “Kami di Komisi

III DPR RI sedang mem-pertimbangkan keberadaan ‘bilik asmara’ di lapas dan rumah tahanan,” terangnya. Menurutnya, keberadaan ‘bilik asmara’ ini merupakan bentuk penghormatan terhadap hak asasi setiap napi yang sudah memiliki istri. “Para napi juga mempunyai hak yang sama jadi satu sisi harus dipenuhi,” ujarnya. Penggunaan bilik asmara di penjara harus dipantau agar tidak terjadi penyalahgunaan oleh pihak-pihak yang ingin mengambil keuntungan. Lanjutnya, bila Kemenkum HAM tidak menyediakan bilik tersebut,

maka dikhawatirkan akan terjadi penyimpangan seks di dalam lapas atau rutan. “Beberapa kemungkinan memang bisa saja terjadi. Akibat hasrat biologis tidak tersalurkan, maka pelariannya adalah penyimpangan seks ke sesama jenis, ini yang perlu dihindari,” jelasnya. Ia mengharapkanKementerian Hukum dan HAM dapat meninjau kembali tentang kebutuhan para narapidana yang berada di penjara. Komisi III DPR RI terus berupaya untuk memperjuangkan aspirasi para narapidana. (cb01)

Waspada/Musyawir

KADIS Syariat Islam Aceh Utara, Drs Amiruddin Mahmud, didampingi Abu Salihin, menyerahkan santunan untuk anak yatim di Masjid Raya Pase Pantonlabu, Selasa (7/8) petang.

Tiba (flight, asal, waktu) Garuda Indonesia

Jamaah Tarawih Masjid Pase Santuni Yatim

Berangkat (flight, tujuan, waktu) 10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly

14:10

* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

14:30

“Warga sekitar, termasuk santri Pesantren Malikussaleh, sempat berusaha memadamkan api dengan peralatan seadanya. Tapi tak berhasil. Semua isi rumah, termasuk ijazah Julia, uang Rp1,5 juta, mesin cuci, kulkas, TV, Laptop, sepeda, pakaian dan sekitar 500 kilogram gabah kering, tak sempat diselamatkan,” kata Abdul Wahab, di lokasi kebakaran, kemarin. Kamaliah dan putrinya Julia Roza kini terpaksa tinggal di tenda darurat yang dibangun seadanya di dekat puing rumah yang terbakar. Kamaliah sendiri terlihat sangat terpukul. Janda malang ini sulit diwawancara lantaran terlalu sedih dan selalu menangis. “Mudah-mudahan Pemkab Aceh Utara bisa membantu meringankan beban kami, dengan membangun rumah baru. Kecil pun jadi. Yang penting ibu saya punya tempat berteduh dan tak lagi harus tinggal di tenda darurat,” harap Abdul Wahab diamini adiknya Julia Roza. (b19)

Waspada/Maimun Asnawi

H MUHAMMAD THAIB, Bupati Aceh Utara (kanan) dan Drs. Muhammad Jamil, Wakil Bupati Aceh Utara, Rabu (8/8) pagi mencoba sepedamotor bantuan itu usai penyerahan secara simbolis.

30 TKSK Aceh Utara Terima Sepedamotor Utara. Pada kesempatan itu, Isa Ansari, Kepala Dinas Tenaga Kerja dan Mobilitas Penduduk Kabupaten Aceh Utara mengatakan, ke 30 TKSK tersebut bertugas di 27 kecamatan. Tugas mereka mencari data tentang persoalan sosial, seperti menghimpun data masyarakat yang terkenda bencana alam, seperti puting beliung dan kebakaran. TKSK inilah yang menjadi perpanjangan tangan pemerintah di kecamatan. Sebelum TKSK, tim ini bernama TSK, namun karena sering dipelesetkan sebagai Pekerja Seks Komersial (PSK) maka diganti dengan TKSK. Anggaran untuk membeli 30 unit sepedamotor itu bersumber dari APBA tahun 2012. (b18)

Pembagian e-KTP Abdya Tunggu Pelantikan Bupati Terpilih BLANGPIDIE (Waspada) : Meskipun e-KTP sudah tersedia dan berada di Dinas Kependudukan dan Catatan Sipil Aceh Barat Daya, namun kartu identitas terbaru milik warga hingga saat ini belum diserahkan pihak terkait. Padahal sejumlah warga mengeluhkan kebutuhan mendesak akan KTP untuk sejumlah keperluan, namun pihak dinas tetap bersikukuh untuk tidak menyerahkan dengan alasan yang dinilai tidak relevan. “KTP jelas sangat kami butuhkan, karena menjadi persyaratan untuk melakukan registrasi dan syarat administrasi untuk melanjutkan pendidikan serta kebutuhan lainnya, karena KTP lama sudah berakhir masa berlakunya,” keluh salah seorang warga asal Manggeng. Terhadap keluhan itu, Kadis Kependudukan dan Catatan Sipil Abdya Fakrudin, Rabu (8/8) membenarkan bahwa e-KTP milik warga Abdya sudah masuk di kantornya dan hingga kini memang secara sengaja belum didistribusikan, jumlah e-KTP yang sudah masuk saat ini, menurutnya, telah mencapai 53 persen dari total

keseluruhan. Sisanya juga masih terus dikirim ke Abdya dalam beberapa hari mendatang, namun demikian dirinya menolak membagikan e-KTP saat ini dengan alasan ingin membagikan e-KTP tersebut setelah pelantikan bupati Abdya terpilih nantinya. “Kita tidak bagikan e-KTP sekarang, nanti setelah bupati terpilih dilantik, kita akan serahkan di depan bupati nantinya,” ujar kadis. Pengamat kebijakan publik di Abdya dari Komisi Pengawas Aparatur Negara (Komnaswaspaan) Irfan Faisal menilai aneh terhadap kebijakan itu. Menurutnya, pelayanan yang terbaik semestinya harus menjadi prioritas program dalam proses e-KTP tersebut sehingga dengan penundaan pendistribusian e-KTP dengan asalan ingin mempertunjukkan kinerja di hadapan bupati terpilih dianggap sebagai bentuk ‘show’ alias pamer yang hanya akan mengorbankan kepentingan masyarakat yang jauh lebih besar. (cb05)

Sakti Sampaikan Jawaban

Penerbangan Di Bandara SIM Banda Aceh GA 142 Jakarta/Medan GA 146 Jakarta/Medan

LHOKSUKON (Waspada): Rumah kontruksi kayu milik janda Kamaliah, 65, di Dusun Damai, Desa Rawang Iteik, Kec. Tanah Jambo Aye, Aceh Utara, musnah terbakar, seusai waktu berbuka puasa, Selasa (7/8) malam sekira pukul 19:20. Tak ada korban jiwa dalam kebakaran ini. Namun seluruh konstruksi rumah berikut semua isi di dalamnya, rata dengan tanah. Kerugian ditaksir Rp90 juta. Sementara penyebab kebakaran diduga akibat hubungan arus pendek listrik. Rumah korban berbatasan langsung dengan komplek Dayah Malikussaleh, pesantren ternama asuhan Ulama Kharismatik, Abu Panton. Saat kejadian, rumah sedang kosong. Kamaliah dan Julia, tengah menghadiri acara buka puasa bersama di rumah putranya Abdul Wahab, 35, di Desa Matang Paya, Kec. Baktiya Barat—Sampoiniet, Aceh Utara.

LHOKSEUMAWE (Waspada): 30 Tenaga Kesejahteraan Sosial Kecamatan (TKSK) di Kabupaten Aceh Utara terima sepedamotor sebagai alat transportasi, Rabu (8/8) pagi di halaman kantor bupati setempat. Diharapkan, para petugas dapat meningkatkan kinerja di wilayah tugas masing-masing. “Saya sangat berharap, tugas pokok dan fungsi tenaga kesejahteraan sosial di kecamatan dapat lebih optimal guna terwujudnya kesejahteraan sosial masyarakat sesuai dengan Tupoksi yang dibebankan kepada TKSK. Semoga dengan adanya kendaraan roda dua ini, para petugas tidak bermalas-malasan dalam menjalankan tugas. Kepada masing-masing petugas diharapkan untuk menjaga dan merawat kendaraan itu,” pinta H Muhammad Thaib, Bupati Aceh WAKIL Ketua Komisi III DPR RI Nasir Djamil sedang menerima masukan dari sejumlah napi di LP IIA Lambaro, Selasa (7/8)

TIDAK BERFUNGSI : A Wahab salah seorang pedagang ikan menunjuk saluran pembuangan limbah pasar ikan Bireuen tidak berfungsi mengakibatkan lantai pasar ikan jorok tergenang air limbah.

B5

PANTONLABU (Waspada): Jamaah tarawih Masjid Raya Pase, Pantonlabu, Aceh Utara, menyantuni 300 anak yatim dan menggelar buka puasa bersama, di masjid tersebut, Selasa (7/8) malam. Acara berlangsung khidmat, dihadiri ratusan tamu, termasuk Walikota Langsa, Usman Abdullah alias Toke SuUem. Ketua Panitia, H. Abu Salihin Ismail didampingi tokoh masyarakat Pantonlabu, M Yusuf Amin, menjelaskan, selain dari

jamaah tarawih, dana kegiatan ini juga berasal dari donatur lain, diantaranya sumbangan dari Wagub Aceh Muzakkir Manaf untuk 100 yatim dan sumbangan dari Bupati Aceh Utara, Muhammad Thaib untuk 50 yatim. “Kegiatan ini rutin kita laksanakan setiap bulan ramadhan. Disamping untuk membantu meringankan beban anak yatim, kegiatan juga bertujuan memupuk persaudaraan dan menjaga persatuan umat, khususnya warga di seputaran

kemasjidan Masjid Raya Pase,” tambah Abu Salihin. Acara diawali dengan pembacaan ayat suci Alquran, lalu dilanjutkan dengan penyerahan santunan secara simbolis oleh Bupati Aceh Utara yang diwakili Kadis Syariat Islam, Drs Amiruddin Mahmud. Setelah itu, tausiyah singkat, pembacaan doa oleh Ketua Majelis Ulama Nanggroe Aceh (MUNA) Kabupaten Aceh Utara, Tgk Ibrahim Ali, lalu ditutup dengan buka puasa bersama.(b19)

SUBULUSSALAM (Waspada): Lanjutan Paripurna Laporan Pertanggungjawaban Anggaran Pendapatan dan Belanja Kota (LPj.APBK) dan LHP 2011 yang pembahasannya, Kamis silam ditolak DPRK Subulussalam dilanjutkan, menyusul Ketua DPRK, Pianti Mala, mencabut skors dan membuka Paripurna Jawaban Wali Kota Atas Pandangan Umum Fraksi-Fraksi DPRK, Rabu (8/8) di ruang rapat DPRK setempat. Menanggapi F-Keadilan Bersama dan FKarya Bersama, Wali Kota Subulussalam Merah Sakti menyebutkan, UPTD ayam petelur di Desa Namo Buaya tidak pernah dibentuk Pemko Subulussalam dan bukan bagian dari Dinas Peternakan dan Perikanan setempat. Soal Unit Pengelola Teknis Daerah (UPTD)

Air Minum, meski telah dibentuk sebagai bagian dari Dinas Pekerjaan Umum, ia bukan Badan Usaha Milik Daerah (BUMD), tetapi UPTD yang secara khusus dibentuk menangani air minum. Sedangkan RSIA, 2011 telah dibentuk sebagai Satuan Kerja Perangkat Kota (SKPK) melalui qanun. Karenanya, Sakti memaparkan pihaknya tidak mungkin memenuhi permintaan DPRK untuk menyajikan ikhtisar laporan kerja dan laporan keuangan perusahaan daerah dalam Raqan tentang pertanggungjawaban pelaksanaan APBK 2011. Dalam kedudukannya sebagai unit kerja SKPK maupun SKPK maka UPTD air minum dan RSIA hanya diwajibkan menyusun laporan keuangan SKPK. (b28)

Waspada/Khairul Boangmanalu

WALI Kota Subulussalam, Merah Sakti dikonfirmasi wartawan usai menyampaikan jawaban atas pandangan umum fraksi DPRK Subulussalam, Rabu (8/8)


Aceh

B6

1.946 Peserta JMU Jalani Tes Di Unsyiah

Jepang Masih Bantu Anak Korban Tsunami Aceh BANDA ACEH (Waspada) : Meski bencana tsunami di Jepang beberapa waktu silam belum sepenuhnya tuntas terselesaikan hingg kini, namun negeri para Samurai itu hingga kini masih membantu anak korban tsunami di Aceh dalam bentuk beasiswa pendidikan. Lost Children Operation (LCO) sebuah lembaga swadaya masyarakat yang bergerak di bidang pendidikan, masih menyalurkan beasiswa dari lembaga amal Jepang NPO PAC (People’s Association on Conscience) yang berkedudukan di Kyoto, Jepang. “Alhamdulillah masih dibantu pendidikan anak-anak kita hingga selesai SMA,” kata Abdullah Madyah pimpinan LCO di Banda Aceh, Rabu (8/8) siang. Bantuan Jepang sudah berlangsung sejak Juni 2006 dan 138 anak hingga hari ini masih menerima bantuan pendidikan. “Semuanya adalah anak- anak yang terdaftar dalam database LCO dan sebagian besar berdomisili di wilayah Aceh Besar.” kata Abdullah. Dijelaskan Abdullah, beasiswa ini diberikan tiap bulan dengan pengawasan yang sangat ketat tidak ada celah untuk bisa disalahgunakan oleh anak dan orangtua asuh, kemudian untuk anak-anak yang mendapatkan prestasi yang baik akan diberikan beasiswa sampai ke perguruan tinggi. “Tahun ini untuk beasiswa percontohan ke perguruan tinggi satu anak sudah disalurkan,” kata Abdullah. Awalnya, kata Abdullah, lembaga LCO fokus pada pencarian anak-anak hilang korban tsunami yang masih selamat, lembaga ini lahir setelah musibah gempa dan tsunami di Aceh tahun 2004 lalu, di mana pada prinsipnya adalah mencari langsung anak- anak yang selamat dari bencana dengan langsung ke tempat- tempat potensial. “Dari pada menunggu laporan dari keluarga korban maka dalam poster- poster awal ditulis“ditemukan” anak hilang, “berbeda dengan” dicari” anak hilang,” kata Abdullah. Pada awal pendiriannya lembaga ini mendapat perhatian khusus dari masyarakat, karena berada di bawah koordinasi dan didanai DPD RI dan kemudian dukungan pendanaan lembaga diambil alih lembaga amal dari Jepang, yaitu NPO PAC (People’s Association on Conscience) yang berkedudukan di Kyoto, Jepang. (b08)

PLN Langsa Serahkan Zakat Ke Baitul Mal LANGSA (Waspada): PLN Area Langsa menyerahkan langsung zakat kepada Baitul Mal Kota Langsa sebesar Rp36.330.029 diserahkan Manager PT PLN Area Langsa Sayed Julihan Armadani diterima Ketua Baitul Mal Langsa, Aidil Fan, Rabu (8/8). Ketua Panitia Bazis PLN Area Langsa, M Hanafiah di selasela penyerahan zakat kepada wartawan mengatakan, zakat yang diserahkan ke Baitul Mal ini merupakan dari gaji karyawan yang dipotong setiap bulan sebesar 2,5 persen dari pendapatan. Selain itu, zakat yang telah terkumpul itu ada beberapa yang diserahkan langsung kepada yang berhak menerimanya. Seperti, sebesar Rp114.834.000, diserahkan kepada karyawan untuk diserahkan kepada saudaranya yang kurang mampu. Kemuadian, sebesar Rp47.000.000, telah diserahkan kepada kelembagaan keagamaan seperti masjid, pesantren, panti asuhan, TPA dan TPQ dan sebesar Rp36.330.029, diserahkan langsung kepada Baitul Mal Langsa. Ketua Baitul Mal Langsa, Aidil Fan menyampaikan, pihaknya menyambut gembira atas penyaluran zakat karyawan PLN oleh Manager Area Langsa. Dirinya, juga mengucapkan terima kasih kepada PLN Langsa yang telah mempercayai penyaluran zakat melalui Baitul Mal Langsa. (m43)

Dinas SI Aceh Utara Serukan Pengajian Ba’da Maghrib LHOKSEUMAWE (Waspada): Dinas Syariat Islam Aceh Utara menyerukan kepada Badan Kemakmuran Masjid (BKM) di Aceh Utara untuk mengefektifkan pengajian di masjid setelah maghrib. Hal ini, BKM agar segera dilakukan setelah lebaran nanti. Ungkapan ini disampaikan Kadis Syariat Islam Aceh Utara Amir Mahmud. Kadis mengatakan, BKM yang telah dibentuk bisa berperan menghidupkan berbagai kegiatan keagamaan di masjid, seperti pembinaan generasi muda, melaksanakan syiar-syiar Islam dan peringatan hari-hari besar Islam. Untuk memaksimalkan BKM, setelah lebaran akan memanggil pengurus masjid untuk mengikuti pelatihan seperti administrasi dan keorganisasian kepengurusan masjid. Badan ini, untuk tahap awal akan diterapkan di masjid-masjid besar, seperti Masjid Raya Pase Pantonlabu dan Masjid Bujang Salim Krueng Geukueh, selanjutnya ke sejumlah masjid-masjid di kecamatan. (cmk)

Surat Yasin Untuk Muslim Rohingya IDI (Waspada): Pengurus KNPI Aceh Timur, menggelar baca suratYasin dan doa bersama untuk muslim Rohingya, Myanmar, di Masjid Agung Darusshalihin, Idi Rayeuk, Aceh Timur, Rabu (8/8). Ritual ini dipandu Tgk Suherdi dan turut diikuti jamaah lain dari luar lembaga KNPI Aceh Timur. “Ini aksi solidaritas sesa-ma muslim. Mudah-mudahan saudara kita muslim Rohingya segera terbebas dari berbagai bentuk ancaman,” harap Ketua KNPI Aceh Timur, Iskandar Usman Al-Farlaky, seusai acara. “Pemerintah Aceh juga harus memberikan bantuan kemanusiaan untuk saudara muslim Rohingya. Lebih-lebih, beberapa waktu lalu, sebagian dari mereka juga pernah terdampar di wilayah Aceh, termasuk di Idi, Sabang dan Bireuen,” kata Alfarlaky sembari menyeru semua komunitas pemuda di Aceh ikut berdoa untuk muslim Rohingya. (b19)

Waspada/Musyawir

PENGURUS KNPI Aceh Timur membaca surat Yasin untuk muslim Rohingya di di Masjid Agung Darusshalihin, Idi Rayeuk, Aceh Timur, Rabu (8/8).

Untuk Banda Aceh & Sekitarnya Kamis, 20 Ramadhan 1433 H/09 Agustus 2012 Berbuka : 18.56 Wib Imsak : 05.05 Wib Catatan: Calang, Sinabang (+1 menit), Sabang, Jantho (-1 menit), Sigli, Blang Pidie, Meureudu (-3 menit), Takengon, Tapaktuan, Singkil (-4 menit), Bireuen, Simpang Tiga Redelong (-5 menit), Blangkejeren, Subulussalam (-6 menit), Lhokseumawe, Kutacane (-7 menit), Langsa, Idi, Kuala Simpang (-9 menit). (b04)

WASPADA Kamis 9 Agustus 2012

BANDAACEH (Waspada) : 1.946 Calon mahasiswa yang mendaftar melalui Jalur Mandiri Unsyiah (JMU), Rabu (8/8) mengikuti ujian tulis di universitas itu. Puluhan peserta tak hadir dalam ujian yang digelar di beberapa lokasi itu. Penjabat Rektor Unsyiah Prof Samsul Rizal, yang didampingi Kepala Humas A Wahab Abdi menyebutkan, ujian JMU terbanyak diikuti calon yang memilih kelompok IPS yakni 1.046 peserta disusul IPA sebanyak 900 peserta. Samsul menyebutkan, JMU merupakan jalur penerimaan mahasiswa terakhir yang dibuka Unsyiah untuk tahun ini dari lima jalur

yang disediakan. “Kita harapkan melalui jalur mandiri ini akan terjaring calon mahasiswa yang belum berhasil lulus melalui jalur lain,” paparnya. Disebutkan, peserta akan mengikuti ujian selama dua hari, yakni 8 Agustus untuk ujian tulis dan 9 Agustus untuk tes keterampilan khusus peserta yang memilih jurusan olahraga dan kesenian. “Jumlah yang ditampung hanya berkisar 15 persen dari total peserta yang mendaftar. Ini sudah termasuk untuk program DIII-nya,” kata dia. (b07)

Baitul Mal Banda Aceh Salurkan Zakat Rp3,768 Miliar Waspada/Munawardi Ismail

PESERTA ujian tulis Jalur Mandiri Unsyiah (JMU), terlihat serius menjawab soal, Rabu (8/8) di Darussalam, Banda Aceh.

Berduaan Di Mess Polhut Aceh Timur, Sepasang Insan Babak Belur LANGSA (Waspada): Sepasang insan non muhrim yang dipergoki warga sedang berduaan di tempat sepi babak belur dihajar massa, Rabu (8/8) dini hari . Saat dipergoki, keduanya diduga sedang melakukan mesum di mess Polhut Aceh Timur, Gampong Matang Seulimeng, Kecamatan Langsa Barat. Setelah babak belur, pasangan itu diserahkan masyarakat ke Polres Langsa, kemudian oleh pihak Polres karena masalah itu menyangkut pelanggaran Syariat Islam maka diserahkan ke pihak Dinas Syariat Islam.

Kepala Dinas Syariat Islam Kota Langsa, Drs H Ibrahim Latif membenarkan pihaknya ada menerima penyerahan sepasang insan non muhrim yang ditangkap warga. Penyerahan itu berlangsung sudah menjelang dini hiri, Rabu (8/8), katanya. Adapaun indentitas mereka yang laki-laki berinisial Ab ,34, warga Gampong Rantau Panjang, Kecamatan Simpang Jernih, Kabupaten Aceh Timur, dan yang perempuan berinisial WY, 25, warga Tajungpura, Langkat, Sumatera Utara, yang bekerja sebagai sales dan sekarang berdomisili di Gampong Sidodadi, Kecamatan Langsa Lama. Setelah keduanya tiba di kantor Dinas Syariat Islam, jelas Ibrahim Latif, mereka langsung diamankan dan kemudian

diberi nasihat dan pembinaan. Lalu malam itu juga, dihadirkan kedua pihak orang tua / wali untuk dilakukan msuyawarah bersama masyarakat Gampong Matang Seulimeng dan Sidodadi. Hasil dari musyawarah itu, masyarakat Sidodadi dan Matang Seulimeng bersepakat, pasangan itu baik laki-laki maupun perempuan harus dinikahkan, dan setelah itu keduanya tidak boleh lagi tinggal baik di Sidodadi maupun di Matang Seuleimeng. Usai menandatangani perjanjian dengan warga sekira pukul 4 pagi, kata Ibrahim Latif, lalu kedua insan yang berlainan jenis itu diserahkan petugasWH Kota Langsa kepada penanggung jawab keluarga masingmasing. (b20)

Ratusan Karyawan PDKS Demo Ke Kantor Bupati SIMEULUE ( Waspada): Setelah tidak mendapat jawaban konkrit soal pembayaran gaji mereka yang tertunggak selama menjelang empat bulan terakhir ini, ratusan karyawan PDKS, Rabu (8/8) berunjukrasa ke kantor bupati setempat. Para pengunjuk rasa menuntut agar pemerintah segera membayar gaji mereka. Para pengunjuk rasa bersikukuh, Pemkab harus bertanggungjawab karena Perusahaan Daerah Kabupaten Simeulue (PDKS) adalah milik daerah dan selama ini sepenuhnya bersumber pembelanjaan PDKS dari APBK. Oleh itu sejumlah pengunjuk rasa yang minta nama mereka untuk tidak ditulis, Rabu (8/8) menyatakan jika saat ini terjadi kebobrokan keuangan oleh oknum PDKS maka tidak harus para karyawan dan buruh PDKS yang menanggung. “Jika yang rusak itu pimpinan maka pimpinan saja yang perlu “dihukum”. Hak hak kami karyawan dan staf jangan tidak dibayar. Ini dilindungi undangundang,” ujar seorang pendemo.

Demo kemarin awalnya berkumpul di sekitar kantor DPRK yang kebetulan dekat dengan kantor PDKS. Menjelang shalat ba’da Dzuhur pendemo bergerak ke kantor bupati. Jalannya demo hingga dikirim berita ini ke redaksi masih berjalan aman. Namun pantau-

an Waspada ada pendemo yang pingsan. Ini dikarenakan kelelahan dan tengah berpuasa. Para pengunjuk rasa melalui salah seorang perwakilan mereka, Mak Ogek mengancam akan bertahan di kantor Bupati Simeulue hingga gaji mereka dibayar. (cb04)

Waspada/Muhammad Rapyan

SEORANG pendemo pingsan di halaman Kantor Bupati Simeulue. Foto direkam Rabu (8/8).

ERWIN B, Tukang Obat Kuat foto orang tua itu ulama Aceh,” kata Daman, warga Pusong Lama, Banda Sakti. Selanjutnya, kata Daman, tukang obat langsung bergegas membungkus barang dagangannya. Kemudian Erwin B naik becak untuk pulang keWisma Tiara tempat dia menginap. Khawatir tukang obat itu melarikan diri, Daman memberitahukan persoalan itu kepada Basri Musa,35, warga Pusong Baroe. Basri dan Daman mengejar tukang obat itu hingga ke wisma itu, dan ternyata benar, kalau tukang obat tersebut sedang

memasukkan baju-bajunya dalam tas untuk pergi dari Lhokseumawe. “Saat itulah, kami telepon Polisi Wilayatul Hisbah dan Petugas Satpol PP serta MPU guna menangkap tukang obat yang kami nilai telah melecehkan Abu Tu Min,” katanya. Erwin ketika dikonfirmasi di MPU Kota Lhokseumawe mengaku tidak kenal dengan foto orang tua yang ada di brosurnya. Erwinjugamengakufototersebut diberikan Tgk Aceh di Malaysia dan Usman, warga Medan. Foto Abu Tu Min yang dipasang dibrosur obat kuat telah dibawa bersamanya selama dua tahun dan dia mengaku sering keluar masuk Provinsi Aceh. “Selama dua tahun itu tidak ada yang protes. Selama dua tahun itu pula, brosur ini sering saya jadikan sebagai pembatas dan tidak ada yang protes. Saya sama sekali tidak tahu kalau foto itu foto ulama. Foto itu dikasih Tgk Aceh dan Usman di Malaysia,” kata Erwin B. Tgk. Muhammad Isa, Wakil Ketua MPU Kota Lhokseumawe mengatakan, tindakan tukang obat itu merupakan pelecehan terhadap Abu Tu Min. Karena itu, ulama dan masyarakat Aceh mengutuk keras pelaku yang menempelkan foto ulama di brosur obat kuat. (b18)

Kardi, Rabu (8/8). Kata dia, penyaluran zakat ini berlangsung sejak 8 hingga 15 Agustus 2012, yang disalurkan di masing-masing kecamatan dalam kota Banda Aceh. Untuk Kecamatan Kutaraja, Rabu (8/8), Ulee Kareng, Sabtu, (11/8) dan Meuraxa, Selasa (14/8). “Sementara untuk kecamatan lain yang meliputi Jaya Baru, Banda Raya, Kuta Alam, Syiah Kuala, Lueng Bata, dan Baiturrahman, jadwalnya akan ditentukan kemudian,” terang Kardi. Kasubbag Pengembangan Informasi dan Teknologi Baitul Mal Kota Banda Aceh, Niyyatinur sangat berterimakasih kepada para muzakki yang telah menyalurkan zakat pada Baitul Mal Kota Banda Aceh, yang menunjukkan tingginya partisipasi masyarakat dalam upaya pengentasan kemiskinan di Kota Banda Aceh melalui dana zakat. (b04)

Sidang Kasus Pupuk Subsidi

Hakim Pertanyakan Barang Bukti Tak Ditahan LHOKSUKON (Waspada) : Sidang keenam kasus penjualan pupuk bersubsidi di Pengadilan Negeri Lhoksukon, Rabu (8/8), Majelis Hakim mempertanyakan barang bukti berupa mobil colt diesel BK 8725 CB yang digunakan saat mengangkut pupuk, dan kini telah dilepas penegak hukum. Mobil digunakan pihak distributor CV Grafindo Star saat mengangkut pupuk ke kios, selanjutnya ke pihak petani di Koperasi Unit Desa (KUD) Gampong Alue Leuhop, Kec. Cot Girek, Aceh Utara. Saat ditanya hakim kepada JPU, kenapa truk tidak ditahan, sontak saja JPU terkejut. Padahal truk telah melakukan kejahatan. Sidang ini dipimpin Ketua Majelis Hakim Zainal Hasan, dan hakim anggota T Almadyan, dan Muhammad Dede Idham, Penuntut Umum (JPU) Antoni Mustaqbal, dan Penasihat Hukum terdakwa, Syukri dan Ahmad Munir. Dalam sidang, hakim memeriksa empat

saksi, yaitu Tri Lestari, 21, (penjaga pintu gudang KUD), Mujono, 47, (anggota Kelompok Tani), Musyawir, 46, (Ketua Kelompok Tani) dan Amiruddin Sulaiman (sopir truk pupuk). Namun, dalam sidang itu hakim terkesan mengajukan pertanyaan yang bersifat menjerat saksi. Seperti menanyakan tentang keuntungan KUD, padahal sistem KUD tidak mengenal adanya keuntungan, hanya sisa hasil usaha. Saksi juga mengaku tidak pernah menerima dari keuntungan dari KUD, saksi mengaku pernah menerima Sisa Hasil Usaha (SHU), tapi hakim berulang-ulang menanyakan pertanyaan itu. Sebenarnya dalam persidangan, hakim tidak boleh mengajukan pertanyaan menjerat kepada terdakwa atau kepada saksi, karena ini jelas melanggar pasal 166 KUHAP. Begitu juga, hakim dilarang menunjukkan sikap atau mengeluarkan pernyataandisidangtentangkeyakinanmengenai salah atau tidaknya terdakwa. (b11)

Masa Tugas Bupati –Wabup Sudah Berakhir

Syaiful Bahri Berpeluang Sebagai Plh Bupati Aceh Tamiang KUALASIMPANG (Waspada): Masa tugas Bupati dan Wakil Bupati Aceh Tamiang, Drs H Abdul Latief dan H Awaluddin,SH.Spn.MH periode 2007-2012 sudah berakhir pada 7 Agustus 2012. Meskipun masa tugas jabatan sudah berakhir, tetapi belum ada kepastian yang bakal ditunjuk oleh Gubernur Aceh tentang Pejabat Sementara ( Pjs) ataupun Pelaksana Tugas harian ( Plh) Bupati Aceh Tamiang. Meskipun begitu dari desas-desus yang beredar disebut-sebut Sekdakab AcehTamiang, H Syaiful Bahri,SH sangat berpeluang ditetapkan sebagai Plh Bupati Aceh Tamiang sampai terpilihnya pasangan Bupati-Wabup Aceh Tamiang yang defenitif pada Pilkada Putaran Kedua yang dijadwalkan berlangsung pada 12 September 2012. Ketika hal tersebut dikonfirmasi Waspada

MPU Lhokseumawe Tuding Tukang Obat Keliling Lecehkan Ulama Aceh KOTA LHOKSEUMAWE (Waspada) : Erwin B, warga Medan Amplas, Medan, Sumatera Utara yang berprofesi sebagai penjual alat sulap dan penjual obat kuat menempelkan foto Abu Tu Min, ulama Aceh, pimpinan Dayah Blang Blah Deh, Bireun, di brosur obat kuat yang dijualnya itu. Akibat perbuatannya, Erwin BharusberurusandenganMajelis Permusyawaratan Ulama (MPU) KotaLhokseumawedanPolisiWilayatul Hisbah, karena dia ditangkapwargasaatberjualanobatkuat di Pajak Ikan Pusong Lama. Beberapa penonton terkejut begitu mengetahui, kalau model obat kuat yang ditempel di brosur obat ersebut ternyata ulama kharismatik Aceh Abu Tu Min. Masyarakat tidak terima dengan perbuatan tukang obat itu. “Saya saat itu langsung naik darah. Sebelum saya tegur, tukang obat itu bilang, kalau obat kuatnya cukup manjur dan untuk meyakinkan calon pembeli, tukang obat itu sempat mengatakan, kalau pria tua yang ada di brosurnya itu telah pernah memakai obat kuat miliknya. Brosur itu diperlihatkan kepada penonton. Saat itulah saya tahu kalau orang tua itu Abu Tu Min. Saya langsung menanyakan kepada dia, apakah dia tahu kalau

BANDA ACEH (Waspada): Baitul Mal Kota Banda Aceh menyalurkan zakat senilai Rp3,768 miliar untuk senif fakir konsumtif, miskin konsumtif dan fisabilillah, yakni untuk majelis taklim, petugas tajhiz mayat, TPA/TPQ dan balai pengajian. Secara rinci, dana tersebut dibagi masingmasing Rp1.183.500.000 untuk 2.630 orang fakir konsumtif, Rp1.347.500.000 untuk 3.850 orang miskin konsumtif, Rp354 juta untuk 177 buah TPA/TPQ, Rp223 juta untuk 223 buah balai pengajian, Rp300 juta untuk 150 majelis taklim, dan Rp460 juta untuk 180 petugas tajhiz mayat. “Sedangkan untuk petugas Baitul Mal, petugas kecamatan, petugas keamanan dan petugas gampong yang bertugas dalam menyalurkan dana di masing-masing kecamatan, akan memperoleh dana sejumlah Rp50.000 per hari kerja yang dialokasikan dari dana infaq,” kata Kepala Sekretariat Baitul Mal Kota Banda Aceh

kemarin pada H Abdul Latief, Bupati Aceh Tamiang itu enggan memberikan komentar seputar hal tersebut.” Kita lihat dan tunggu saja nanti siapa yang bakal ditunjuk sebagai Pjs atau PLh Bupati Aceh Tamiang,” ujar Latief. Sedangkan Sekdakab Aceh Tamiang, H Syaiful Bahri,SH ketika ditanya Waspada enggan memberikan komentar terkait dengan hal itu, namun dari raut wajahnya dan aksen bicaranya tampak kemungkinan besar Syaiful Bahri sangat berpeluang ditetapkan sebagai PLH Bupati Aceh Tamiang. “Ya kita lihat dan kita tunggu saja nanti kalau sudah ada Surat Keputusannya siapa yang ditunjuk sebagai PLH Bupati Aceh Tamiang,” tegas Syaiful Bahri yang wajahnya terlihat ceria ketika dikonfirmasi Waspada di rumahnya kemarin malam. (b23)

Tim Safari Ramadhan Kabupaten Disambut Hangat IDI CUT (Waspada): Berkat kerjasama antara pihak kecamatan dengan pengurus Badan Komunikasi Pemuda Remaja Masjid (BKPRMI) setempat, Tim Safari Ramadhan Kabupaten Aceh Timur disambut hangat saat berkunjung ke Kecamatan Darul Aman, Selasa (7/8). Kegiatan keislaman itu dipusatkan di Masjid Besar Baitul Muttaqin Idi Cut. Kegiatan safari ramadhan kabupaten kali ini ke Kecamatan Darul Aman pimpin Sekda Aceh Timur Syaifannur, SH.MM. Kegiatan diawali dengan buka puasa bersama di Lantai II masjid setempat dan dilanjutkan dengan shalat Magrib. Usai shalat isya dan tarawih dilanjutkan dengan tausiah yang disampaikan Tgk Sulaiman dari Idi Tunong. Dalam tausiahnya, Tgk. Sulaiman menyampaikan berbagai hikmah

bertarawih dan hikmah berpuasa di bulan ramadhan serta amalan-amalan yang dilipatgandakan pahalanya oleh Allah setelah kebangkitan umat Islam nanti. Dalam kesempatan itu juga, Sekda Syaifannur sempat memberikan 10 Alquran yang disumbangkan untuk masjid dan diterima langsung Imam Masjid Baitul Muttaqin Idi Cut, Tgk Abdul Gani. Kegiatan yang dikoordinir pihak kecamatan bersama jajaran pengurus BKPRMI Idi Cut berjalan lancar sesuai rencana. Camat Darul Aman, Muhammad Nasir, SP kepada Waspada di sela-sela acara mengaku sangat puas atas kelancaran kegiatan itu. Tahapan demi tahapan yang dilalui demi kesuksesan kegiatan berjalan sebagaimana terjadwal. (b24)

Waspada/Muhammad H. Ishak

SEKDA Aceh Timur Syaifannur (kiri) menyerahkan Alquran kepada Imam Masjid Besar Baitul Muttaqin Idi Cut Tgk. Abdul Gani (tengah) didampingi Camat Darul Aman Muhammad Nasir, SP (kiri) ketika Tim Safari Ramadhan Pemkab Aceh Timur berkunjung ke Idi Cut, Selasa (7/8).


Aceh

WASPADA Kamis 9 Agustus 2012

Api Hanguskan Hutan Pinus Lut Tawar

Alquran Dorong Umat Islam Kembangkan Ilmu Pengetahuan SABANG (Waspada):. Dalam Alquran, Allah mengajarkan kita semua untuk menjadi “ulil albab”, orang yang senantiasa menggunakan akalnya. Menjadi cendekiawan yang senantiasa membaca alam. Empat cirinya: berdzikir, berfikir, bertauhid, dan beristighfar. Senantiasa berdzikir (ingat) kepada Allah dalam segala situasi. Tak jemu berfikir tentang segala fenomena alam. Bertauhid mengesakan Allah yang menciptakan alam ini. Tak lupa beristighfar atas kemungkinan lalai dan salah dalam pemikirannya. Demikian Ustadz Muhammad Rafiq dari Kota Medan mengatakan dalam uraian peringatan Nuzulul Quran yang berlangsung di halaman Masjid Babussalam Sabang, Senin (6/8) malam. PenjabatWali Kota Sabang Zulkifli HS diwakili Asisten I Setdako Sabang Azwardi mengatakan, di bulan Ramadhan ini mari kita meningkatkan segala bentuk amalan dan ibadah, salah satunya adalah membaca dan mengqatamkan Alquran. (b31)

Iwapi Santuni Anak Yatim SUBULUSSALAM (Waspada): Ikatan Wanita Pengusaha Indonesia (Iwapi) Subulussalam menyantuni ratusan anak yatim dan dhuafa/jompo diserahkan Ketua Iwapi Subulussalam Hj Mariani Harahap kepada liam orang dhuafa/jompo pada acara buka puasa bersama ratusan anak yatim, dhuafa/jompo dan undangan, Selasa (7/8) di kediamannya. Kepada penerima, Mariani, anggota DPRK Subulussalam dari Partai Hanura sampaikan permohonan maaf jika bantuan/ santunan tidak seperti yang diharapkan. “Jangan lihat nilainya, tetapi lihatlah kepedulian Iwapi, mudah-mudahan bermanfaat,” tandas Mariani, istri Wakil Wali Kota, Affan Alfian Bintang. Dalam tausiyahnya, Ustadz Maskur menguraikan sejumlah keistimewaan Ramadhan, seperti bulan pemersatu. “Di luar bulan Ramadhan tidak akan terjadi seperti ini, mungkin dalam sebuah keluarga pun tidak pernah makan bersama karena masing-masing sibuk, tetapi dengan Ramadhan kekompakan, kebersamaan dan kemesraan keluarga sangat terasa,” tutur Maskur. (b28)

Waspada/Irwandi MN

HUTAN pinus di pinggiran Danau Lut Tawar atau tepatnya Bur Pukes, terbakar. Menurut petugas Upes Api, kuat dugaan kejadian itu terjadi karena unsur kesengajaan dari orang yang tidak bertanggungjawab. Foto direkam, Rabu (8/8).

BC Banda Aceh Sita 2,7 Ton Gula Sabang BANDAACEH (Waspada) : Petugas Bea Cukai Banda Aceh menyita 2,7 ton gula yang dipasok dari Sabang, Rabu (8/8). Gula merupakan gula impor dari Thailand. Petugas mengambil gula dari sebuah gudang di Desa Deah Glumpang, Aceh Besar. Penyitaan itu berdasarkan pemantauan petugas BC di Pelabuhan Ulee Lheue. Kemudian, gula sebanyak 54 sak berukuran 50 kg per sak diangkut menggunakan dua unit mobil double kabin milik

Waspada/Khairul Boangmanalu

KETUA Iwapi Subulussalam Hj Mariani Harahap menyerahkan secara simbolis santunan kepada jompo di Subulussalam, Selasa (7/8) di kediamannya.

Oyon Diminta Profesional Dalam Penempatan Pejabat SINGKIL (Waspada) : Bupati Aceh Singkil Safriadi diminta profesional dalam penempatan pejabat eselon II,III dan IV di jajaran Pemkab Aceh Singkil. Sebab apabila tidak, perubahan yang dicanangkan Oyon dalam visi dan misinya untuk melakukan perubahan Aceh Singkil lima tahun ke depan menjadi lebih baik hanya tinggal tulisan saja. “Jika Oyon masih mendengar para pembisik dalam penempatan pejabat tanpa melihat keahlian dan kemampuan, maka Aceh Singkil hanya jalan di tempat,” papar Muftadin, mahasiswa Unsyiah Banda Aceh, Rabu (8/8) di Singkil. Selama ini, kata Muftadin, penempatan Pejabat di Aceh Singkil dilakukan secara acak dan kedekatan tanpa melihat latar belakang pendidikan calon pejabat itu sendiri sehingga banyak ditemukan kerancuan di mana banyak dari tenaga guru yang menduduki jabatan struktural setingkat Kepala SKPK, bahkan camat , itu artinya tidak memberi ruang bagi PNS yang memiliki kemampuan dan keahlian sesuai disiplin Ilmu yang dimilikinya. . Bahkan yang lebih parah dari itu banyak ditemukan pangkat sekretrais atau kepala bidang lebih tinggi dari pangkat kepala dinas dalam satu lingkup SKPK sehingga wajar saja 14 tahun Usia Aceh Singkil tidak ada kemajuan yang siknifikan . Kepala BKPP Aceh Singkil Syamsul Bahri yang dikonfirmasi sebelumnya sekaitan dengan mutasi pejabat Aceh Singkil mengatakan sampai saat ini belum ada perintah dari bupati. (cdin)

Realisasi Kegiatan Disbudpar Sabang Baru 38 Persen

B7

kantor Bea Cukai lalu dibawa ke Kantor Bea Cukai yang berada di Lamtemen, Jalan Soekarno Hatta. Sementara sejumlah pemilik gula tersebut yang merupakan warga Sabang mendatangi Kantor BC untuk meminta kejelasan terhadap pihak BC yang menyita gula mereka. Salah seorang pemilik Bustami, yang berada di Kantor BC mengatakan, pemilik gula ini merupakan masyarakat Sabang yang hanya mengambil untung Rp30 ribu per sak setelah pemotongan biaya angkut kapal. “Kami masyarakat kecil, yang mengambil gula di Sabang

dengan harga Rp500 ribu per sak dan kami jual ke Banda Aceh Rp560 ribu, kami tidak membayar kontan saat mengambilnya dan sekarang kami berutang sama agen di Sabang,” ujarnya. Kepala Kantor Pengawasan dan Pelayanan Bea Cukai Tipe A3 Banda Aceh, Beni Novri, mengatakan, gula impor dari Sabang tidak boleh diperjualbelikan di luar Sabang. “Kami akan menyita barang-barang seperti gula jika terlihat di Pelabuhan Ulee Lheue, dan menjadikan barang sitaan itu milik negara,” ujarnya.(cb01)

Tolak Pasien, DPRK Investigasi RSUD Nagan Raya NAGAN RAYA (Waspada) : DPRK Nagan Raya akan melakukan investigasi terkait penolakan yang dilakukan pihak Rumah Sakit Umum Daerah Kabupaten (RSUD) Nagan Raya yang mengakibatkan Wati, warga Beutong Banggala kehilangan bayinya. Anggota DPRK Nagan Raya, Rabu (8/8) menyatakan, digelarnya pertemuan di gedung dewan, untuk mencari solusi penyelesaiannya. Dalam pertemuan yang dipimpin Ketua DPRK Nagan Raya Samsuardi bersama sejumlah anggota Komisi D, turut hadir Kadinkes Mansuriadi, juga perwakilan dari pihak RSUD. Samsuardi mengatakan, persoalan serupa ke depannya tidak harus terjadi. Karena itu, perlu dilakukan upaya-upaya pembenahan di instansi terkait tersebut. Sedangkan dari Ketua Komisi D Adifal, menurutnya dari sudut pandang kemanusian persoalan tersebut salah satu persoalan yang cukup memprihatinkan. “Apakah ada pasien yang ingin melahirkan dan tidak ada dokter spesialai pasien harus di tolak,” katanya.

Selain itu, dikatakannya pula, dalam waktu dekat pihaknya (DPRK) akan melakukan investigasi terhadap RSUD Nagan Raya terkait kasus itu. KTU RSUD Nagan Raya mewakili RSUD mengatakan, pihaknya siap untuk dilakukan investigasi. Persoalannya berawal ketika Wati, warga Desa Kuta Teungoh sebelum diberangkatkan ke RSUD Nagan Raya, anaknya Wati ditangani di Puskesmas Beutong Ateuh Banggalang. Karena kondisinya mengkhawatirkan, perawat di Puskesmas itu merujuk Wati ke RSUD Nagan Raya. Namun, setibanya di RSUD Nagan Raya mereka ditolak, dan mengakibatkan anaknya meninggal dunia. Pasalnya pasien yang sudah sekarat ini malah ketika tiba di depan IGD RSUD Nagan Raya langsung disuruh bawa ke RSUD Cut Nyak Dhien Meulaboh dengan dalih dokter kandungan di RSUD Nagan Raya sedang di luar daerah. Kepala RSUD Nagan Raya Hasbi Quraisy mengaku, berdasarkan keterangan yang diperoleh, ada unsur pembiaran begitu saja oleh dokter piket saat pasien

itu dibawa ke IGD RSUD Nagan Raya. “Seharusnya diperiksa dulu. Persoalan ini akan dibawa ke rapat dokter,”ujarnya. Sementara dr Ika, dokter jaga di IGD RSUD Nagan Raya dibebaskan tugas (diistirahatkan) sementara waktu sambil menunggu pemeriksaan lebih detil kasus tersebut. Pihak keluarga dari Wati Sabtu (4/8) dini hari secara resmi telah membuat pengaduan ke Polres Nagan Raya terkait penolakan RSUD Nagan Raya menanganiWati ketika hendak melahirkan di rumah sakit tersebut. Kapolres Nagan Raya AKBP Heri Heryandi membenarkan pihaknya telah menerima pengaduan dari Syarifuddin terkait penolakan RSUD Nagan Raya menangani pasien yang hendak melahirkan. Pj Bupati Nagan Raya Azwir menyatakan sudah memerintahkan Sekda setempat melakukan pengecekan dan pemeriksaan terhadap kasus Wati. Wati, warga Kuta Teungoh, Kecamatan Beutong Ateuh Banggalang, Nagan Raya, pasien yang terpaksa melahirkan di rumah warga karena ditolak di RSUD Nagan Raya, Selasa (7/8) sudah diperkenankan pulang. (cda)

SABANG (Waspada): Realisasi kegiatan Dinas Kebudayaan dan Pariwisata Kota Sabang baru mencapai 38 persen, dalam waktu dekat akan dipacu terus kegiatannya. Demikian kata Kadis Kebudayaan dan Pariwisata Sabang, Yusfa Hanum, Rabu (8/8). Kata dia, kegiatan-kegiatan yang sudah dilaksanakan seperti bahana nusantara dan tarek situk ternyata mendapat sambutan masyarakat setempat. Masih banyak kegiatan berbagai event yang harus dilaksanakan dala tahun ini seperti lomba masak pliek U Rekor Muri sebanyak 1 ton dengan peserta seluruh kab/ kota di Aceh, lomba safari foto wisata, pameran foto, festival seni nol kilometer 2012, musikalisasi puisi tingkat Provinsi Aceh. Kegiatan lain yang tidak kalah menariknya, kataYusfa Hanum, yaitu persebahan seni dan tradisi yang ada di daearah ini, musik garapan, gebyar HUT RI, audisi idola cilik, pemilihan duta wisata, lintas alam, hunting foto, situs sejarah, loba gelayang tunang, lomba sepeda gunung dan Sabang Internasional Regatta 2012. Festival Seni Sabang Nostalgia XII 2012. (b31)

TAKENGEN (Waspada) : Diperkirakan puluhan hektare hutan pinus di pinggiran Danau Lut Tawar, Aceh Tengah, atau tepatnya di Bur (gunung) Pukes hangus akibat diamuk si jago merah. Menurut Darman Sari, petugas Upes Api (UA) wilayah Mendale, Kebayakan, Rabu (8/ 8), kuat dugaan kebakaran hutan itu sengaja dilakukan oleh oknum tidak bertanggungjawab. Hal itu dibuktikan dengan ditemukannya potongan karet yang diprediksi sebagai sumbu penyulut kobaran api. “Ada dua titik api kami temukan di pinggiran jalan utama di areal Bur Pukes ini. Untuk sementara kita duga ada yang sengaja membakar pinus ini. Selain itu ditemukan potongan karet dari ban dalam sepeda motor di lokasi merupakan sumber api,” jelas Darman. Menurutnya, percikan api di hutan tersebut terjadi Selasa (7/8). Bahkan pihaknya berhasil memadamkan kobaran api yang saat itu masih ‘melahap’ sekitar 2 rante pinus.

“Namun berselang beberapa jam kemudian, tiba-tiba kobakaran api kembali terjadi di titik berbeda dari sebelumnya. Karena minim personil, sulit sekali mengatasi rambatan api,” jelasnya. Selain itu tambahnya, sulitnya memadamkan api juga disebabkan keterbatasan alat dan pinus yang terbakar berada di areal sangat terjal dan curam. “Medan yang kurang mendukung dan sulit dilalui juga membuat petugas kesulitan mengendalikan api,” katanya. Harun, Kepala Unit Pelaksana Tehnis (UPT) Dinas Kehutanan Aceh Tengah menyebutkan, keberadaan pinus tersebut selain berfungsi sebagai penyimpan air untuk keseimbangan alam, juga bermanfaat sebagai penyangga reruntuhan batu dari atas pegunungan. “Dengan kejadian ini, saya kira butuh beberapa puluh tahun untuk mengembalikan habitat dan populasi pinus ini. Karena itu kami berharap masyarakat dan semua pihak berupaya menjaga keberadaannya,” ujarnya. (cb09)

Uang Baitul Mal Dipinjam

DPRK Minta Sidang Anggaran Ditunda REDELONG (Waspada) : Anggota Badan Anggaran Dewan Perwakilan Rakyat Kabupaten (DPRK) Bener Meriah meminta sidang pembahasan nota perhitungan anggaran tahun 2011 ditunda, akibat adanya pinjaman dana baitul mal oleh sejumlah pejabat dan dewan, serta karyawan baitul mal itu sendiri. Permintaan dihentikannya sidang pembahasan nota perhitungan anggaran tersebut dilontarkan anggota Banggar DPRK Sarhamija, saat sidang telah berlangsung di ruang sidang dewan itu, Rabu (8/8). “Kami meminta pimpinan sidang agar pembahasan nota perhitungan anggaran 2011 ini ditunda, karena terdapat kejanggalan dalam laporan keuangan,” ungkap Sarhamija. Sarhamija dalam sidang tersebut meminta pihak eksekutif agar mencantumkan dalam buku laporan bahwa ada pinjaman pihak ketiga kepada baitul mal dan pinjaman timbul menjadi piutang yang harus dibayar. Namun kenyataannya dalam buku susunan laporan pertanggungjawaban piutang itu tidak tertulis sehingga

menimbulkan kecurigaan dan protes dari anggota dewan. Sidang agak memanas karena adanya interupsi dari beberapa anggota dewan yang meminta sidang itu diskors akibat adanya kejanggalan yang terjadi pada laporan pembukuan milik eksekutif. Asisten I Setdakab Bener Meriah Tasnim mengatakan, susunan laporan pertanggungjawaban tersebut telah disesuaikan dengan hasil pemeriksaan badan pemeriksa keuangan republik Indonesia nomor : 1,A/LHP/XVIII.BAC/ 04/2012 tanggal 24 April 2012 tentang laporan hasil pemeriksaan BPK RI atas laporan keuangan Pemerintah Kabupaten Bener Meriah tahun anggaran 2011. Namun laporan asisten tetap tidak diterima dewan, akhirnya pimpinan sidang Wakil Ketua DPRK Joni Suryawan mengetok palu dan menghentikan sidang sampai pihak eksekutif menyantumkan ke dalam buku laporan keuangan tersebut. (b33)

PAS Minta ‘Zikir’ Perhatikan Wilayah Terpencil BANDA ACEH (Waspada): Pemuda Aceh Selatan (PAS) Banda Aceh menyurati Gubernur Aceh agar memprioritaskan percepatan pembangunan di daerah-daerah terpencil dan terisolasi. Salah satu kawasan tersebut adalah Buloh Seuma di Kec Trumon, Aceh Selatan. Ketua Umum PAS, Mus Mulyadi, Rabu (8/ 8) menyebutkan, dalam suratnya kepada Gubernur Zaini Abdullah, pihaknya meminta agar pemerintahan baru melakukan percepatan pembangunan daerah-daerah terpencil di wilayah Aceh dalam rangka peningkatan kesejahteraan taraf hidup rakyat. Surat yang dikirim pada 3 Agustus itu, PAS mendesak semua pihak untuk bersamabersama ikut andil dalam pembebasan wilayahwilayah tertinggal dan terisolasi tersebut seperti wilayah Buloh Seuma, Kecamatan Trumon,

Aceh Selatan. “Kami menyurati Gubernur Aceh untuk memohon percepatan proses lanjutan pembangunan infrastruktur umum (jalan dan jembatan) di wilayah Buloh Seuma karena sampai saat ini, masyarakat di sana masih amat terkendala,” paparnya. Menurut Mus Mulyadi, khusus Buloh Seuma, pemerintah harus memberikan perhatian serius dari semua kalangan, mengingat warga setempat seperti hidup di zaman belum merdeka. Kata Mus, infrastruktur yang perlu dibangun, setidaknya lebih kurang 25 kilometer jalan dan beberapa unit jembatan besar dan kecil. “Sarana ini akan sangat membantu warga setempat terbebas dari penderitaan,” tutur Mulyadi. (b07)

Pemerintah Aceh Harus Berjalan Baik BANDA ACEH (Waspada) : Ketua Dewan Pertimbangan Partai Golkar, DR Ir H Akbar Tandjung menyebutkan, dirinya mendorong pembangunan politik dan nasional di Aceh, khususnya supaya berjalan dengan baik setelah terpilih gubernur definitif. Akbar Tandjung menegaskan hal itu dalam arahan singkatnya seusai buka puasa bersama dengan kader Partai Golkar Aceh, Selasa (7/ 8) di Banda Aceh. Akbar dan rombongan melakukan kunjungan kerja sehari ke Aceh. Dia juga melakukan diskusi dengan kader HMI seusai shalat tarawih. Kata dia, untuk melaksanakan misinya sebagai gubernur, sebagai Ketua Wantim Partai Golkar.

Akbar sudah menyampaikan amanat kepada jajarannya. “Partai Golkar sebagai suatu kekuatan politik selalu memperhatikan pembangunan konstitusi, demokrasi dan hukum,” urai dia. Begitu pula dengan Gubernur Aceh yang baru terpilih sesuai dengan konstitusi dan perundangan-undangan. “Maka menjadi kewajiban Partai Golkar untuk memberi dukungan, agar misi yang diemban bisa berjalan baik bagi kemajuan, kesejahteraan dan kemaslahatan masyarakat Aceh,” urai dia. Ketua DPD I Partai Golkar Aceh Sulaiman Abda, menyebutkan, dirinya mengajak semua elemen di Aceh untuk saling bahu membahu membangun Aceh ke depan. (b07)

IKAT Aceh Gelar Aksi Peduli Rohingya Ratusan Jamaah Larut BANDA ACEH (Waspada): Ikatan Alumni Timur Tengah (IKAT) Aceh kembali mengadakan aksi dengan doa bersama untuk muslim Rohingya, Selasa (7/8). Kegiatan itu dipusatkan di Masjid Babul Jannah, Neusu Kota Banda Aceh. Kegiatan yang diawali dengan tausiah dan doa itu berakhir dengan kegiatan Buka Bersama (bubar). IKAT juga membagikan 100 kupon paket ramadhan kepada masyarakat dari beberapa desa dalam Kecamatan Baiturrahman dan Banda Raya. Doa bersama yang dihadiri ratusan masyarakat berlangsung haru dan khidmat. Ketua IKAT, Muhammad Fadhil Rahmi, Lc kepada Waspada menjelaskan, pihakmya

sangat bersyukur atas dukungan dan partisipasi masyarakat dalam rangkaian doa dan ceramah agama. “IKAT fokus terhadap etnis muslim Rohingya dan tak akan berhenti menyalurkan kepeduliannya hingga masalah itu benar-benar diselesaikan oleh PBB,” katanya. Fadhil menambahkan, selanjutnya IKAT Aceh akan membuka kesempatan kepada umat Islam dan seluruh masyarakat untuk menyalurakan kepedulianya berupa dana tunai ke Rekening Bank Aceh Syariah 61001990000055 atas nama IKAT Peduli. “Sebelumnya IKAT Aceh telah mengadakan doa bersama untuk Rohingya di Sekretariat IKAT, Beurawe pada 30 Juli lalu,” tandas Fadhil Rachmi. (b24)

Waspada/Muhammad Riza

WARGA Desa Papeun, Kecamatan Muara Tiga, Pidie menunjukkan sebutir selongsong peluru saat anggota Polsek Muara Tiga membubarkan warga yang sedang menginterograsi oknum polisi yang diduga berkencan dengan ER, 32 janda beranak satu asal desa setempat, Rabu (8/8)

Berduaan Dengan Janda, Anggota Polsek Ditangkap Warga Waspda/Tarmizi Ripan

BUKA PUASA DI SOCFINDO LAE BUTAR: Adm PT Socfindo Lae Butar, Rimo Heru Darmawan (tiga dari kanan) berbincang-bincang dengan Dandim O109 Aceh Singkil Letkol (Inf) Afson R Sirait (kanan kedua) serta Ustadz Hasby (kanan pertama) dan undangan lainnya usai buka puasa dan shalat Maghrib bersama di kediaman Adm Kompleks Socfindo Lae Butar, Rimo, Selasa (7/8).

SIGLI (Waspada) : Oknum anggota Polsek Muara Tiga, Kabupaten Pidie ditangkap warga, karena dugaan berdua-duaan sampai pagi bersama janda satu anak asal Desa Papeun berinisial ER, 32, Rabu (8/8). Kepala Desa Papeun, Kecamatan Muara Tiga, Ibrahim Mahmud membenarkan warganya telah menangkap oknum anggota polisi yang bertugas di

Mapolsek Muara Tiga berinisial L. Ia ditangkap warga setelah sekira delapan jam berduaduaan di dalam rumah bersama ER janda anak satu. “Oknum polisi ini datang ke rumah ER sekira pukul 19:45. Lalu pulang, tidak lama kemudian sekira pukul 20:00, L datang lagi ke rumahjandainidantidakpulangpulang. L baru keluar dari rumah janda itu sekira pukul 04:45.

Menurut Ibrahim, oknum polisi tersebut sempat diinterograsi warga di Pos desa. Tidak lama kemudian datang anggota Polsek Muara Tiga melepaskan tembakan ke udara membubarkan warga yang sedang memeriksa oknum polisi tersebut. Kapolres Pidie AKBP Dumadi mengatakan oknum anggota polisi tersebut kini sudah ditangani oleh Propam. (b10)

Waspada/Ist

KAUM ibu tampak larut dalam doa bersama peduli Rohingya di Masjid Babul Jannah, Neusu Kota Banda Aceh, Selasa (7/8).


Opini

B8 TAJUK RENCANA

Perlu Aturan Yang Tegas

P

eristiwa kebakaran di dalam rumah kembali terulang di Medan. Penyebab utama soal berlapisnya pagar pengamanan di rumah menjadi salah satu penyebab utama. Tewas akibat terjebak di dalam rumah di saat kebakaran mengambil empat korban dalam satu keluarga yakni, Suwandi alias Ting Kuang, 63, dan Istri Poliana, 60, serta kedua anaknya Joni, 34, dan Johan, 38, warga Jl. Gandi Kec. Medan Area, Selasa (7/8). Keempat korban tidak dapat menyelamatkan diri karena terjebak di lantai dua dan tiga bangunan. Pintu yang berlapis, jerjak yang tinggi menjadi penyebab sulitnya mereka menyelamatkan diri dan sulitnya petugas kebakaran memadamkan api. Akibatnya, mereka mati lemas terhirup karbondioksida yang ditimbulkan dari asap. “Melihat kondisi korban diduga mereka mati lemas akibat mengirup asap yang mengandung karbondioksida, sedangkan luka bakarnya hanya derajat satu sampai tiga, mungkin mereka tidak sempat menjauhi sumber asap,” kata Kepala Instalasi Forensik RSU dr Pirngadi Medan dr. Surjit Singh, SPF, DFM kepada wartawan. Hal serupa diungkapkan Wali Kota Medan Rahudman Harahap saat melihat korban. Malahan, dia membantah kalau armada pemadam kebakaran terlambat datang ke lokasi. “Sebenarnya pemadaman dari armada kita cukup cepat, hanya saja masalahnya petugas tidak dapat menjangkau karena pagar-pagar atau jejaknya yang berlapislapis tidak dapat ditembus oleh petugas kita,” imbuhnya. Apa yang disinyalir Wali Kota Medan itu benar adanya. Hampir di seluruh rumah warga kota ini khususnya yang berada di tengah-tengah kota memiliki pagar pengaman yang cukup ketat. Bisa di dalam satu rumah memiliki lima pintu mulai dari pagar, kemudian jerejak luar, lalu pintu masuk ke dalam rumah dan di belakangnya pintu ada lagi pintu besi. Memang itu semua dilakukan para pemilik rumah untuk menjaga keamanannya dan juga keluarganya dari gangguan pihak-pihak yang ingin melakukan tindak kejahatan. Dan trend pemasangan pagar berlapis itu mulai marak manakala peristiwa Mei 1998 terjadi. Untuk keamanan boleh-boleh saja, namun untuk kenyamanan bagaimana. Kita sepakat dengan pernyataan Wali Kota Medan. Kata dia, ini harus menjadi perhatian kita bersama agar petugas pemadaman tidak sulit. “Kita harus waspada, tapi tidak dengan membuat pagar berlapislapis begitu. Kita sudah lihat kondisi jenazah korban, rata-rata mereka meninggal akibat Intisari menghirup asap. Ke depan kita imbau kepada lurah dan camat agar pintu-pintu masuk di Jangan biarkan masya- perumahan dibuat akses, sehingga ketika kebakaran petugas mudah untuk rakat dalam ketakutan terjadi memadamkan,” imbuhnya. Di sinilah kemudian menjadi pertanyaan yang amat sangat. Jika penting bagaimana sebenarnya aparat pejerejak besi harus dibong- merintahan di lapangan mampu menertibkan yang memiliki pagar berlapis. Namun kar harus ada solusi pe- rumah begitu manakala masyarakat sudah tunduk, ngamanan warga. pertanyaan berikutnya mampukah aparat mencegah terjadinya kejahatan di lingkungan. Di sinilah yang seharusnya bisa menumbuhkan sinergitas semua kalangan untuk memberikan rasa aman dan nyaman bagi masyarakat. Peraturan yang dibuat selalu saja dilanggar mengingat kondisi lapangan. Sudah lama disuarakan kalangan publik terkait pemagaran yang berlebihan. Tentu saja ini bukan hanya kondisi keprihatinan soal keamanan namun juga bagaimana kurangnya bersoalisasi pemilik rumah ke lingkungan sekitar. Tentu Pemko Medan dapat menerapkan aturan yang ketat yang mengacu pada aturan yang sudah berlaku. Menurut Undang-undang No 28 Tahun 28 Tahun 2002 tentang Bangunan Gedung, Sanksi administratif akan dikenakan kepada setiap pemilik bangunan. Sanksi tersebut berupa peringatan tertulis, pembatasan kegiatan pembangunan, penghentian sementara atau tetap pekerjaan pelaksanaan, pencabutan izin yang telah dikeluarkan, dan perintah pembongkaran bangunan. Selain itu jika etahuan membangun bangunan yang melebihi GSB, maka akan dikenakan sangsi yang lain. Sanksinya berupa denda paling banyak 10% (sepuluh per seratus) dari nilai bangunan yang sedang atau telah dibangun. Pasal 13 Undang-undang No 28 tahun 2002 tentang Bangunan Gedung menyebutkan bahwa sebuah bangunan harus mempunyai persyaratan jarak bebas bangunan yang meliputi GSB dan jarak antargedung. Selain itu dalam membangun rumah, Anda juga harus sudah mendapatkan standarisasi dari pemerintah yang tercantum di dalam SNI No 03-1728-1989. Standar ini mengatur bahwa dalam setiap mendirikan bangunan harus memenuhi persyaratan lingkungan bangunan, diantaranya larangan untuk membangun di luar GSB. Namun kesemuanya tentu adalah bagaimana peraturan yang sudah disahkan ditegakkan dengan ketat tanpa pandang bulu. Namun juga masyarakat juga diberi rasa keamanan dan kenyamanan sehingga masyarakat tidak perlu membentengi diri dengan berlebihan.****

Muslim Rohingya, Potret Muslim Minoritas Oleh Prof Dr H.Hasan Bakti Nasution, MA ... di negara bersemboyankan ”bhinneka tunggal ika” ini minoritas Muslim menjadi masyarakat kelas dua, tidak mendapat akses menjadi pegawai negeri.Berbeda jika daerah mayoritas Muslim, kaum minoritas tetap mendapat peluang bahkan jadi pejabat.

B

agi sebagian masyarakat tentu sangat terkejut ketika melihat dan mendengar informasi mengenai derita Muslim Rohingya. Misalnya seperti laporan Waspada bahwa telah terjadi pembunuhan massal mencapai 6000 orang, suatu jumlah yang sangat besar tapi tak bernilai bagi sebagian orang—tergantung siapa yang menilai dan siapa yang jadi korban. Jika yang jadi korban adalah Yahudi, Amerika atau umat selain Islam, beritanya akan besar dan menggemparkan dunia. Semua dunia akan heboh, seolah dunia sesak dengan beritanya. Tetapi jika yang jadi korban adalah umat Islam semuanya adem-adem, termasuk negara-negara Islam. Hanya beberapa negara dan berapa orang saja yang peduli. Selainnya sudah mati rasa, tak peduli dan mengganggapnya halhal biasa. Atau paling mengeluh lalu melupakannya. Begitulah potret kepedulian umat hari ini, tentu sebagai dampak dari globalisasi yang membuat umat ini semakin individualis, sehingga jumlah besar tak bernilai apa-apa. Seperti sinyalemen hadis Nabi bahwa suatu saat nanti umat Islam akan menjadi buih, kelihatan kuat menggunung tapi ternyata lemah dan rapuh. Rohingya adalah salah satu etnis yang ada di negaranya Myanmar yang dulu bernama Burma ini. Seperti juga etnis lain, seperti Birma, Shan, Mon, Rakhine, Kayak, Keren, Kacin, dan Cin. Mereka telah mendiami tanah air mereka dan menjadi bagian dari anak bangsa Myanmar. Menurut berbagai laporan jumlahnya mencapai satu juta lebih sebelum mengalami diaspora (terpencar untuk menyelamatkan diri). Jumlah ini memang minoritas (sekitar 2 %) dari keseluruhan bangsa Myanmar yang mencapai 51 juta lebih, baik dari segi etnis maupun agama. Minoritas dari segi etnis, karena etnis ini merupakan salah satu dari sekian etnis di Myanmar, dan minoritas dari segi agama, karena mereka menganut Islam. Selainnya ialah mayoritas Budhis dan Kristen. Begitulah memang jika Islam yang jadi minoritas. Bukan Yang Pertama Derita ini bukan yang pertama, tetapi untuk kesekian kali di berbagai rangkaian derita umat islam di belahan dunia. Pertama dan yang paling mudah

Faks 061 4510025

Facebook Smswaspada

+6281362151555 hallo PDAM TIRTANADI, tlg perhatikan penduduk perumnas simalingkar medan, setiap hari menderita, karna air setiap hari mati, baik siang,sore,malam. kok gitu ya ? padahal kami tetap membayar rekening air. tolong ya.... +6285361239899 TELKOMSEL , Jaringan INTERNET mu paling JELEK dan Paling BURUK serta paling BOBROK , saya sebagai Pengguna layanan TELKOMSEL sangat KECEWA dan KECEWA tidak seperti oprator lainya XL - IM3 dan AXISS , Jaringan TELKOMSEL paling JELEK, BURUK , dan BOBROK , MENGECEWAKAN ribuan Pelanggan , Tolong dimuat Terimakasih WASPADA +6285371990473 Kpd yth bpk KAPOLDASU di Kab Sergei khususnya Kec Bandar Khalipah sangat marak judi togel ironisnya sang bandar blak2an ngomong tak usah takut karena POLSEK &POLRES sudah kita atur.tolong di respon pak ini Bulan Ramadhan. +6285261616845 Keterangan dr Arifin Sakti Srg di h waspada tgl 2o Juli Jumat kok sampai hati mengatakan sholat taraweh yg 23 rakaat di masjidil harom atau di masjid nabawi itu hadisnya lemah bahkan palsu kalau sudah dari sumbernya pun tidak percaya dari mana lagi kalau dari Alquran dan hadis ya sumbernya dari sana juga sampai kuburan rosul pun di samping nya yg jadi pertanyaan apakah lebih ngerti Arifin Sakti Srg dari pada ulama 2 di Mekah dan Medinah? +6285261086007 Menjelang Ramadhan harga kebutuhan pokok melonjak naik, sudah bukan rahasia lagi. Jika pemerintah benar-benar ingin membantu masyarakat harus dilakukan secara luas di banyak tempat. meskipun pemerintah mengadakan Pasar Murah, kebutuhan Harga Daging Sapi di Aceh TERMAHAL di Dunia. Menjelang Ramadhan maupun Idul Fitri, harga daging sapi tetap berkisar anatara Rp 130 s/d Rp 140 ribu per kilogram. Ini harga fantastis, menyengat !!! Jika dibanding dengan harga daging di Medan misalnya tidak lebih Rp 70 ribu/kg. Padahal, sejak dahulu sebagian besar sapi dipasok dari Aceh. Lalu kenapa harga daging sapi di Medan bisa lebih murah dan di Aceh begitu tinggi? Jawabannya tentu ada PEMDA Aceh, Pemda Jangan banyak tidur tapi buatlah persiapan matang lebih awal untuk membantu masyarakatnya . +6285270953050 PLN di Padang Lawas khususnya 2 km dari Sibuhuan setiap malam mati sampe jam 10.Sepertinya PLN hanya menambh derita rakyat, bayaran terus naik tapi listrik selalu mati. +6285260088842 Hallo masyarakat Kab.Simalungun, mari kita turunkan bupati JR Saragih dari jabatannya, karena dia adalah pembohong dan ingkar janji kampanye. Dan dia juga pejabat yg tak tau dan tak bisa kerja, lihat saja seluruh Jalan Rusak di Simalungun ( J R S ) khususnya di Serbelawan hancur total,Tq Waspada. +6282164666580 alah pln. +6285763196160 Ambo tampung. Alah kasanang hati sanak tu ?amboko a banalah kucing kurok mandi di papannyo.klw dapek bueklah salebarannyo bagi2 kan kalapaw nasi sababkan baa manko baitu disiko nan bajaga nasi urg awak kecamatan nan sabaris nyo sadonyo bue salebarannyo tembusan pkdp dan bmtigo dan walikota rahudman hrp dri lb ktorong tmbg. +6282369489181 Saya warga Labuhan Batu Induk. Meminta kepada Bapak Bupati agar memasukkan lampu PLN. Di Desa tanjung Medan. Dusun Tanjung Beringin. Jangan janji saja ke pada masarakat saya mohon bukti kan. Janji. Setelah duduk jgn lupa janji itu. Tolong ke pada para wartawan. Bahwa masarakat membutukan lampu PLN.

diingat ialah Palestina yang terusir dari kampung halaman di Jerussalem. Para penulis modern dalam berbagai penelitian membuat perbandingan penurunan jumlah bangsa Jerussalem dan peningkatan jumlah Yahudi di tanahtanah Jerussalem sejak 20 tahun terakhir sejak dikuasai Israel tentunya. Semua dunia sudah bicara, tapi tindak kekerasan dan pengusiranYahudi atas Pelestina terus berlanjut sampai kini, termasuk pembangunan rumah-rumah Yahudi di tanah Pelestina. Derita juga dialami Muslim di Thailand bagian Selatan, seperti provinsiYala, Pattani, Naratiwa, dan Songkla. Mereka sebetulnya mayoritas, namun berada dalam kekuasaan mayoritas agama Budha. Karena menurut sejarah mereka bukan bagian dari negara Siam lalu menuntut memerdekakan diri. Tapi tuntuan dibalas dengan peluru dan mesiu, tiada hari tanpa darah. Untuk mengurangi persentase Muslim di daerah ini, pemerintah pusat mengadakan imigrasi Budhis ke daerah-daerah Muslim, dan program imigrasi berjalan mulus karena mendapat bantuan dana penuh dan mendapat hak prifeles dari pengua-sa. Sudah barang tentu masyarakat Islam menolak, dan lagi-lagi dijawab dengan peluru dan mesiu. Derita mayoritas dalam tekanan juga dialami Muslim Uigur di China bagian Barat. Di provinsi Xinziang dengan ibukota Urumuqi, mereka sebenarnya mayoritas, termasuk di dalam satu kabupatennya Qasghar. Namun mereka juga mendapat tekanan dan intimidasi, sehingga darah dan air mata menjadi bagian keseharian mereka. Informasi terbaru yang diperoleh, para pejabat dan siswa sekolah dilarang melaksanakan ibadah puasa, suatu tindakan yang memilukan bagi yang punya perasaan tentunya. Begitu juga Filipina Selatan yang terus-terusan menghadapi teror, darah

dan air mata, hanya karena mereka Muslim dan ingin membebaskan diri dari kendali Filipina. Tokoh-tokoh agama ditangkapi, sekolah Islam ditutup, dan berbagai kebijakan dan tindakan keras lainnya. Di depan mata Eropa, masih terngiang-ngiang dalam hati bagaimana Muslim Bosnia Herzegovina dibantai Serbia di depan pasukan PBB. Dalam salah satu karikatur digambarkan bagaimana pasukan Serbia membantai umat Bosni di depan pasukan PBB. Sang pasukan Serbia meminta tolong pasukan PBB memegang topinya agar lebih bebas menembaki Muslim Bosnia. Itu cerita belasan tahun lalu. Kinipun intimidasi dan teror masih dialami umat Islam di beberapa negara Eropa sana yang katanya menjunjung HAM. Tidak jarang mendapat tindak pelecehan sosial dan fisik, termasuk pelarangan menggunakan jilbab bagi wanita Muslimah, pemecatan dari sekolah, dan sebagainya. Akibat Minoritas Salah satu akibat dari penindasan ialah karena umat Islam menjadi minoritas, sehingga dapat diajukan paradigma bahwa umat Islam akan tertindas ketika menjadi minoritas. Sebaliknya umat bukan Islam minoritas akan aman ketika berada di lingkungan mayoritas Muslim seperti Indonesia, Malaysia, dan sebagainya. Kesan ini akan meningkat menjadi teori karena dapat dibuktikan secara empiris, termasuk di Indonesia yang secara nasional mayoritas Muslim, tetapi di beberapa daerah menjadi minoritas. Di beberapa daerah di negara yang bersemboyankan ”bhinneka tunggal ika” ini minoritas Muslim menjadi masyarakat kelas dua sehingga tidak mendapat akses menjadi pegawai negeri. Hal ini berbeda jauh jika suatu daerah mayoritas Muslim, kaum minoritas tetap mendapat peluang menjadi PNS bahkan pejabat. Dampak minoritas juga terjadi dan dialami umat Islam dalam hal pengamalan ajaran agama. Bagaimana sulitnya mendirikan mushalla apalagi masjid. Ketika mulai dibangun lalu dibongkar atau dilempari sebagai tindakan teror. Beda dengan Medan yang mayoritas Muslim di mana masjid yang dibongkar dan rumah ibadah agama bukan Islam berdiri dengan megah setingkat Asia tenggara. Bahkan ada daerah mayoritas Muslim tetapi masjid menjadi korban pembakaran seperti terjadi di Kabupa-

ten Asahan. Di beberapa daerah bahkan anak-anak yang sedang belajar mengaji Alquran dilempari, sehingga anak-anak takut belajar mengaji. Betapa tidak adil dunia ini. Ironi Ironi dan ironi tentunya. Paradigma di atas ternyata kini mengalami pelebaran makna, sehingga umat Islam tidak akan tertekan ketika minoritas, ketika mayorutaspun umat Islam akan mengalami ketertekanan. Untuk memudahkan pengambilan contoh, Indonenesia dalam berbagai kasus dapat dijadikan sebagai model mayoritas ditekan minoritas. Beberapa kasus yang dapat dijadikan sekedar contoh ialah pengapusan tujuh katadariPiagamJakarta,UUjaminanhalal, UU haji, dan sebagainya. Bayangkan tujuh kata dari Piagam Jakarta yang memberi hak umat Islam menjalankan ajaran agamanyapun dihapus, tidak diberi peluang, padahal itu adalah HAM. UU jaminan halal juga belum dimiliki umat Islam, padahal kehalalan adalah hal penting bagi umat Islam, tetapi karena ada tekanan minoritas, pengendali ekonomi di negeri ini, UU ini kandas di tengah jalan. MenyangkutkepentinganumatIslamyang terbesar, negara nampaknya lalai. Entah sampai kapan, semoga Allah membukakanhatiparalegislatorsehinggasecepatnya mensahkan UU tersebut. Penutup Semuanya terjadi, karena umat Islam di seluruh dunia atau secara nasional tidak bersatu. Masing-masing mempunyai agenda sendiri sehingga tidak ada keinginan untuk bersatu. Padahal Islam mendorong umat Islam harus bersatu “berpegang teguhlah kamu pada agama Allah dan jangan bercerai berai” (wa’tashimuwbihablil-lahijami’awalatafarraquw), begitu perintah salah satu ayat Alquran. HubunganyangsatuitudiilustrasikanNabi Muhammad SAW dengan sebuah bangunan seperti sabdanya yang artinya: “Hubungan di antara umat Islam ibarat satu bangunan yang saling menopang” (al-mukminu lil-mukmini kal-bunyanil wahid yasyuddu ba’dhuhu ba’dha). Agar umat ini bisa bersatu, maka harus menyibukkan diri pada kesamaan pandang, persoalan-persoalan besar, seperti kemiskinan, kebodohan, dan lain-lain. Bukan masalah-masalah kecil, seperti jumlah shalat taraweh, qunut, melihat atau menghitung bulan, dan lain-lain. Jika hal-hal seperti itu yang dikedepankan, pesatuan hanyalah tinggal mimpi yang tidak terwujud di alam nyata. Dalam kondisi ini kehancutan atau kemampusan adalah nasib umat ini. Maka sadarlah wahai umat! Penulis adalah Sekretaris Umum MUI Sumatera Utara.

Mensinergikan Peran KPK - Polri

APA KOMENTAR ANDA SMS 081362240523

WASPADA Kamis 9 Agustus 2012

Oleh Hamidulloh Ibda UU No 30 Tahun 2002 tentang KPK menetapkan jika KPK sudah lebih dahulu melakukan penyidikan, kejaksaan dan Polri tidak berwenang lagi bertindak.

S

eharusnya, KPK dan Polri bersinergi dalam memberantas korupsi. Pasalnya, Undang-undang KPK sudah mengatur melakukan penyidikan yang selama ini menjadi polemik. Polri seharusnya menunjukkan sebagai sebuah institusi yang pro pemberantasan korupsi, dengan membiarkan KPK melakukan penyidikan, bukan sebaliknya. UU No 30 Tahun 2002 tentang KPK menetapkan jika KPK sudah lebih dahulu melakukan penyidikan, kejaksaan dan Polri tidak berwenang lagi bertindak. Hal itu diatur dalam Pasal 50 ayat (3) dan (4) dalam UU tersebut. Atau jika penyidikan dilakukan bersamaan, maka Polri atau kejaksaan harus menghentikan penyidikannya. Jika tetap ingin melakukan penyidikan, sikap Polri dinilai dapat merusak kondisi penegakan hukum di negeri ini karena tidak mau tunduk pada UU. Kengototan Polri untuk melakukan penyelidikan kasus korupsi alat simulator SIM tidak bisa diterima. Pasalnya, tak ada satu pun alasan logis dan sesuai UU yang ada. Kalau Polri membaca dengan benar aturan perundangan yang ada, maka mereka akan tahu bahwa kengototan mereka itu salah. Memang ada MoU antara lembaga penegak hukum bahwa yang berwenang menyelidiki adalah siapa yang lebih dahulu melakukan penyelidikan, tapi menurut Pasal 50 UU KPK, itu tidak berlaku jika KPK mengambilalih penyelidikan. MoU hanyalah kesepakatan yang tak ada sanksi hukum atasnya jika dilanggar. Lagipula posisi UU jelas berada di atas MoU. Jika terus melakukan penyelidikan, kepolisian melangar UU KPK yang sayangnya tidak mengatur sanksi terhadap pelanggaran tersebut. Polisi menghambat pelaksanaan UU korupsi, dan itu bisa dipidanakan. Kekisruhan Polri dan KPK bisa memecah masyarakat. Kondisi masyarakat yang terbelah dari kasus hukum yang mencuat harus dihindari. Apalagi, ketika masyarakat mengambilalih permasalahan ini di tangan mereka sendiri melalui berbagai cara, termasuk lewat sosial media. Banyak yang menilai polisi tak siap bebas dari korupsi dan melakukan perubahan. Seharusnya, Polri membiarkan KPK yang menetapkan tersangka dan terus

mengembangkan kasus itu. Polisi terkesan tidak ingin menyerahkan penyidikan kasus itu kepada KPK. Sinergi Presiden Susilo Bambang Yudhoyono telah memerintahkan Menko Polhukam Djoko Suyanto berkomunikasi dengan Kapolri dan KPK—agar kedua lembaga tersebut bersinergi dalam penanganan perkara korupsi pengadaan simulator alat uji Surat Ijin Mengemudi (SIM) di Korps Lalu Lintas (Korlantas) Mabes Polri. Namun, sampai saat ini juga melahirkan hasil jelas. Presiden menekankan agar tak saling berkompetisi. Harus ada sinergi karena tujuannya untuk pemberantasan korupsi. Presiden mengikuti dinamika pemberitaan bahwa ada kalangan dari pengamat hukum dan anggota DPR yang meminta Presiden mendorong Kepolisian untuk menyerahkan penyidikan ke KPK. Dalam posisi seperti itu, posisi Presiden menghormati hukum, percaya sistem telah bekerja. Ada prosedur yang dipatuhi. Antara KPK, Kejaksaan Agung, dan Polri, ada nota kesepahaman (MoU) untuk melakukan tindak lanjut penanganan kasus. Karena itu, kembali ke mekanisme MoU. Sebelumnya, Kepala Bareskrim Polri Komjen Pol Sutarman mengatakan pihaknya sudah jauh-jauh hari menyidik kasus ini. Polri telah menyelidiki kasus ini sejak 21 Mei 2012 sesuai dengan surat perintah penyelidikan nomor 55/V/ 2012/Tipidkor.Telah diambil keterangan dari 33 orang yang dinilai mengetahui. Penyelidikan ini juga sudah diberitahukan ke KPK pada tanggal 17 Juli 2012. Salah satu saksi yang sekarang sudah jadi tersangka, Sukotjo S Bambang mengaku telah memberikan sejumlah data dan informasi ke KPK. Karena itu, Polri pada tanggal 17 Juli 2012 mengirim surat ke KPK perihal dukungan penyelidikan. Dalam surat tersebut dinyatakan Polri meminta data dan informasi yang dimiliki KPK tentang kasus simulator mengemudi. Tanggal 30 Juli 2012 dua pimpinan KPK Abraham Samad dan Zulkarnaen datang menemui Kapolri Jenderal Pol Timur Pradopo di Mabes Polri. Menurut Sutarman, di ruang kerja Kapolri itu, dua

pimpinan KPK menyatakan akan menyidik kasus simulator mengemudi. Kemudian, Kapolri minta waktu satu atau dua hari untuk mendiskusikannya karena Bareskrim juga sudah menyelidiki. Bahkan, rencananya penyidik Bareskrim akan mempresentasikan hasil penyelidikan ke KPK. Namun, belum dipresentasikan kasus ini oleh Polri, pada sore hari 31 Juli 2012 penyidik KPK melakukan penggeledahan di gedung Korps Lalulintas Polri. Salah satu penyidik KPK mengatakan penggeledahan sudah diizinkan karena Ketua KPK sudah menghadap Kapolri. Padahal, dalam pertemuan tersebut sama sekali tidak membahas soal penggeledahan. Meski begitu, penggeledahan tetap dilakukan setelah Sutarman berdiskusi dengan tiga pimpinan KPK yakni Abraham Samad, Busyro Muqoddas dan Bambang Widjajanto. Disepakati barang-barang hasil penggeledahan akan ditempatkan di satu ruangan tertentu yang tersegel yang kuncinya dipegang masing-masing pihak. Pada hari yang sama Abraham Samad dan Bambang Widjajanto kembali bertemu dengan Kapolri untuk membicarakan masalah penyidikan ini. Di depan wartawan yang menghadapnya, Samad mengatakan bahwa baik KPK dan Bareskrim akan sama-sama menyidik kasus ini. Bedanya, KPK hanya akan memproses Irjen Pol.DjokoSusilo sebagai tersangka dalam kasus ini. Sementara Bareskrim akan menangani tersangka pejabat pembuat komitmennya. Sehari setelah pertemuan itu, KPK ternyata mengumumkan tersangka tambahan yakni Brigjen Pol Didiek Purnomo, AKBP Teddy Rusmawan, Budi Susanto, dan Sukotjo S Bambang. Pada hari yang sama Bareskrim Polri juga meningkatkan penyelidikan kasus ke penyidikan. Budi Suanto, Direktur PT Citra Mandiri Metalindo Abadi ditetapkan menjadi tersangka. Disusul penetapan tersangka pada Didiek Purnomo, Teddy Rusmawan, Sukotjo S Bambang, dan Kompol Legimo sehari setelahnya pada 1 Agustus 2010. Bareskrim, menurut Sutarman, akan tetap menyidik kasus ini. Penyidikan akan tetap dilanjutkan sebelum ada ketentuan beracara yang mengatur tentang siapa yang paling berhak menyidik yang diputuskan melalui pengadilan. Sebelumnya, Ketua KPK Abraham Samad menegaskan komisinya yang pertama kali mengusut kasus dugaan korupsi itu. KPK tidak akan menyerahkan kasus yang menjerat dua jenderal polisi itu kepada Polri. Menurut Abra-

ham, hal tersebut sesuai dengan Pasal 50 UU Nomor 30 Tahun 2002 tentang KPK. Ayat (3) dalam pasal tersebut menyebutkan bahwa kepolisian atau kejaksaan tidak berwenang melakukan penyidikan terhadap kasus tindak pidana korupsi yang telah dilakukan KPK. Kemudian dalam ayat 4 dikatakan bahwa kepolisian atau kejaksaan harus segera menghentikan penyidikan apabila kasus ditangani bersama-sama oleh KPK. Inti dari selesainya kasus ini adalah sinergi. Jika KPK, Polri, dan pemerintah mampu bersinergi, maka kasus ini akan segara berakhir, begitu pula sebaliknya. Wallahu a’lam bisshawab. Peneliti Centre for Democracy and Islamic Studies (CDIS) IAIN Walisongo Semarang.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Wali Kota: Jangan seenaknya buka usaha tanpa izin - Bukan cuma gertak sambal kan, he....he...he * KPK jangan lupakan Century dan Hambalang - Jangan terlena karena Simu lator * Aroma korupsi proyek Crys tal Square sangat terasa - Sekarang terasa bebannya

oel

D Wak


Opini

WASPADA Kamis 9 Agustus 2012

Masih Tentang Trenggiling Belum lama ini Reskrim Unit Tipiter Polresta Medan berhasil menggagalkan penyeludupan 85 ekor Trenggiling melalui pengiriman barang di stasiun bus penumpang Antar Lintas Sumatera (ALS) Jln. SM Raja Medan, sebagaimana diberitakan Harian Waspada edisi Selasa 31 Juli 2012. Dari 85 ekor,78 ekor diserahterimakan ke Balai Besar Konservasi Sumber Daya Alam (KSDA) Sumatera Utara. Selanjutnya oleh Balai Besar KSDA Sumatera Utara, pada hari Selasa 31 Juli 2012, dari ke 78 ekor trenggiling tersebut 60 ekor diantaranya dilepasliarkan di kawasan konservasi Cagar Alam (CA) Sibolangit di Kabupaten Deli Serdang, 10 ekor dalam keadaan mati ditanam (dikuburkan) juga di kawasan CA Sibolangit,dan 8 ekor dititipkan di penangkaran (lembaga konservasi) dengan maksud apabila sewaktu-waktu pihak Polresta Medan menindaklanjuti kasus ini maka barang bukti trenggiling bisa dihadirkan dalam proses penyidikan maupun persidangan di peradilan. Kasus penyeludupan dan perdagangan satwa trenggiling ini bukanlah yang pertama terjadi. Khusus untuk tahun 2012 saja, kasus ini merupakan yang kedua setelah sebelumnya pada bulan Januari 2012 Kepolisian Resort (Polres) Sibolga juga berhasil menangkap seseorang yang kemudian dijadikan sebagai tersangka atas kasus mengangkut,menyimpan,memperniagakan satwa trenggiling sebanyak 8 ekor. Disamping itu, menurut data pada Balai Besar KSDA Sumatera Utara, kasus yang berkaitan dengan satwa trenggiling setiap tahunnya tetap terjadi. Simak data berikut ini, tahun 2009 ada 2 kasus yang penyidikannya ditangani oleh Kepolisian Resort (Polres) Tapanuli Selatan (penyeludupan sebanyak 15 ekor trenggiling) dan Kepolisian Sektor (Polsek) Batang Angkola (penyeludupan sebanyak 11 ekor). Tahun 2010 tercatat 5 kasus yang penyidikannya masing-masing ditangani oleh Polres Tebing Tinggi (penyeludupan sebanyak 22 ekor),Polres Tapanuli Selatan (penyeludupan sebanyak 39 ekor), Polres Belawan (mengangkut, menyimpan dan memperniagakan sebanyak 111 ekor), Polresta Medan (penyeludupan sebanyak 34 ekor) dan Poldasu (penyeludupan sebanyak 33 ekor). Terakhir,tahun 2011 ada 3 kasus yang penyidikannya masing-masing ditangani oleh Polres Tapanuli Utara (penyeludupan sebanyak 12 ekor dan 3 tas plastik daging trenggiling),Polres Tapanuli Tengah (penyeludupan sebanyak 6 ekor) dan Penyidik Pegawai Negeri Sipil (PPNS) Balai Besar KSDA Sumatera Utara (penyeludupan sebanyak 1.795 ekor dan 790 kg sisik trenggiling). Data diatas hanyalah rekaman dari sebagian kecil kasus trenggiling yang terjadi di Propinsi Sumatera Utara dan belum dari propinsi lain yang kasusnya jauh lebih spektakuler.Sebagai contoh, pada bulan Mei 2011 Petugas Bea dan Cukai Pelabuhan Tanjung Priok berhasil mencegah penyeludupan sebanyak 7,4 ribu kg daging trenggiling beserta 64,60 kg sisiknya. Bulan Juli 2011, petugas Bea dan Cukai Bandara Soekarno Hatta berhasil menggagalkan pengiriman 500 kg trenggiling ke Singapura. Dan awal Mei 2012, petugas Balai Karantina Kelas II Cilegon-Banten di Pelabuhan Merak menemukan truk box Termo King yang ditinggalkan pengemudinya dan ditemukan trenggiling sebanyak 4,1 ribu kg dan 31,36 kg sisiknya (Harian Analisa edisi Kamis, 21 Juni 2012). Dari data-data tersebut, terlihat jelas bahwa trenggiling merupakan salah satu satwa yang menjadi primadona untuk diburu dan diperdagangkan.Padahal menurut Peraturan Pemerintah No. 7 Tahun 1999 tentang Pengawetan Jenis Tumbuhan dan Satwa, Trenggiling (Manis javanica) merupakan salah satu jenis satwa yang dilindungi. Demikian juga Undang-undang No. 5 Tahun 1990 tentang Konservasi Sumber Daya Alam Hayati dan Ekosistemnya dalam pasal 21 ayat 2 telah memuataturan tentanglaranganperlakuan/perbuatandantindakanterhadapsatwayangdilindungi baik dalam keadaan hidup ataupun mati.Konsekwensi hukumnya bagi setiap orang yang melanggar pasal 21 ayat 2 tersebut juga cukup tegas dan keras sebagaimana diatur dalam pasal 40, dimana apabila pelanggaran pasal 21 ayat 2 dilakukan dengan sengaja diancam pidana penjara paling lama 5 (lima tahun) dan denda paling banyak Rp. 100 juta (ayat 2), dan apabila dilakukan dengan tidak sengaja (karena kelalaian) diancam dengan pidana kurungan paling lama 1 (satu) tahun dan denda paling banyak Rp. 50 juta (ayat 4). Tingginya intensitas penyeludupan dan perdagangan satwa trenggiling secara illegal tentunya akan sangat mempengaruhi degradasi populasi satwa tersebut di habitatnya.Bila tidak ada upaya penanganan dan pengendalian yang serius dan tuntas, maka status satwa ini di alam bebas dapat dipastikan akan menuju kepada kepunahan. Oleh karena itu perlu ada langkah-langkah yang strategis dan menyeluruh untuk menyelamatkan satwa trenggiling ini Penegakan hukum tetap menjadi tumpuan dan harapan sebagai salah satu langkah prioritas penanganan.Mulai dari proses penyelidikan sampai kepada keputusan hakim semestinya mampu mengusut dan membongkar kasus ini sampai kepada akar permasalahan. Demikian halnya dengan sanksi hukum yang diberikan (diputuskan) sejatinya juga diharapkan mampu menjadi efek jera bukan hanya bagi terpidana tetapi juga bagi calon pelaku lainnya. Partisipasi masyarakat untuk ikut mencegah terjadinya kasus penyeludupan dan perdagangan satwa trenggiling juga tidak kalah pentingnya. Fakta membuktikan, sebagian besar keberhasilan menggagalkan kasus tersebut selama ini merupakan peranserta masyarakat melalui penyampaian informasi kepada aparat penegak hukum.Oleh karena itu ke depan perlu terus dibangun komunikasi dengan berbagai elemen masyarakat agar tetap pro aktif dalam membantu mengantisipasi terjadinya perburuan, perdagangan dan penyeludupan satwa trenggiling secara illegal. Terakhir, yang juga urgen adalah peran media massa (pers) baik cetak maupun elektronik dalam menyiarkan (memberitakan) informasi berkaitan dengan trenggiling. Pers diyakini sebagai salah satu kekuatan yang mampu membangun dan membentuk perspektif serta opini masyarakat. Disamping itu, pers juga merupakan media pembelajaran dan pencerdasan yang efektif.Krusialnya peran pers ini tentu akan sangat membantu dalam upaya penyelamatan satwa trenggiling. Bila ketiga faktor (penegakan hukum,partisipasi masyarakat dan peran media massa) bersinergi maka ekspektasi untuk melestarikan satwa trenggiling dari kepunahan tentunya akan mudah mewujudkannya. Evansus Renandi Manalu, SH. Staf Sub Bagian Data, Evlap dan Humas Pada Balai Besar KSDA Sumatera Utara

Foliopini

Dedi Sahputra dedisahputra@yahoo.com

Malam Yang Sempit Malam itu selalu saja jadi penawar. Karena sejauh langkah selama ini, ditebus hanya dalam semalam; tunai. Tapi sekaligus, malam ini juga misterius. Kehadirannya tak terdeteksi hisab dan rukyah. Dia ada di antara 10 malam terakhir. Begitulah manusia, kita memang terlalu kasar untuk ramai-ramai merasakan kehalusannya, terlalu kotor untuk berbondong-bondong menjamahi kesuciannya. Anda tentu akan membantah, tak percaya, pinomat memandang penuh selidik ke sekujur mata—kalau ada orang yang ngaku-ngaku bertemu dengan malam lailatul qadr. Dia mungkin melihat sesuatu yang ganjil, yang tak lazim tetapi luar biasa. Tapi sekuat apapun penolakanmu, tetap lebih besar rasa penasaranmu. Bahkan engkau sangat merindukannya setengah mati, engkau menanti kehadirannya sepanjang nafasmu— walau kerinduan ini sering terbenam di dasar hatimu, hingga tak sempat kau sadari. Ia tak pernah sempat meraja dalam dirimu. Teriakannya sangat lemah, lemah sekali. Persis seperti lemahnya teriakan penuh derita Muslim Rohingya atau rakyat Palestina. Dia cuma sekelebat berlalu, dan engkaupun segera melupakannya. Maka kasihanilah dirimu sendiri. Karena engkau akan mengabaikan “pesta” semalam suntuk itu. Malam itu bumi ini jadi sempit, para Malaikat turun berlaksa-laksa dipimpin sang Jibril as. Kerlapkerlip sinar itu bertaburan tiada henti menandai kemeriahan pesta. Kemilaunya menyinari setiap dahaga. Suasana riuh rendah. Dan gununggunung pun menahan nafasnya, Taufiq Ismail menggambarkan malam itu. Pada malam ini, jamuan tiada henti berdatangan silih berganti. Engkau bisa mencicipi sesuka hatimu. Tapi tentu, engkau harus jadi tamu pesta malam itu. *** Mata lelaki itu menjelaskan beban yang diembannya. Tiada hari dilalui dengan bangun tidur tanpa suara Xerxes mengiang di telinga. Anak perempuan itu kini terpisah darinya ketika terjadi penyerangan oleh pasukan Raja Khosrou. Kashva, lelaki itu mendaki 13 gunung di Tibet, bersama ashidelek. Iapun tenggelam dalam lautan peziarah di tempat berkumpulnya segala doa itu, demi satu tujuan, menemukan kembali Xerxes. Rasa kehilangan itu membuat pikiran Kashva hanya tertuju untuk menemukan cara

bertemu Xerxes kembali. Kasvha bahkan hampir lupa dengan tujuan utama dari pelariannya itu. Sebuah perjalanan panjang untuk mencari Astvat-ereta, dialah Sang Al-Amin, guna menyucikan ajaran Zardusht. Tasaro GK, sang penulis buku “Muhammad Sang Pengeja Hujan” ini membandingkan kehilangan Kashva dengan kehilangan ‘Umar bin Khaththab. Ia harus menggantikan Abu Bakar yang telah meninggal untuk berangkat ke medan jihad di Irak dan Syam. Rasa ragu dan takut sempat menghampirinya. ‘Umar merasa tak mampu menjadi pemimpin bagi banyak umat, sebab Nabi Muhammad SAW dan Abu Bakar tidak bisa dijumpainya lagi untuk meminta bimbingan. Ya.., haru biru itu kepada Al-Amin, sang lelaki pilihan. Lelaki yang terus mengasah kebeningannya dengan kesunyian di gua yang senyap. Lelaki yang merawat kepercayaan dengan sekujur kejujurannya—sebelum ia menjadi lelaki terpilih. Sang pemimpin umat. *** Maka butakanlah matamu, tulikanlah telingamu, kuncilah hidungmu, lumpuhkan tanganmu, matikanlah rasamu dan kosongkanlah pikiranmu— biarkanlah ia menjadi ruang luas tanpa tepi. Biarkan keheningan merambat menghampirimu. Lepaskan segala bebanmu dan temui keheninganmu. Nanti akan datang suara riuh rendah yang tergesa-gesa menyergapmu. Akan banyak gambar yang tiba-tiba muncul di hadapanmu. Abaikan saja mereka, karena bukan itu tujuanmu. Tidak kali ini. Mereka cuma lapisan luar dirimu. Ohh.., duhai Allah. Sungguh kemeriahan malam yang sempit itu ada dalam kelapangan hati hamba-hambaMu. Biarkanlah kami mencicipinya barang sekali ini saja. Bangkitkanlah kesadaran-kesadaran kami, depaklah kesombongan-kesombongan kami. Berharaplah doamu diijabah. Tapi, kosongkanlah cawan dirimu dengan tirakat puasa, baru cahaya itu memenuhi dirimu; lepaskan segala kotoran, bersihkan dirimu, baru kesucian itu menjadi pakaianmu. Ini seperti engkau berada dalam antrian panjang BBM, maka drum-mu harus kosong, seperti melukis keindahan di kanvas, maka ia harus putih bersih lebih dulu. Ketika engkau sudah kosong dan bersih, maka ketika itulah engkau memiliki kesiapan menerima limpahan cahaya-cahaya itu. Tapi lihatlah, betapa sempitnya hatimu.(Vol.336,9/8/2012)

B9

Geliat Demokrasi Plus Negeri Muslim Oleh Shohibul Anshor Siregar Obsesi agar Islam memainkan peran utama dalam kehidupan publik cukup kuat,atau setidaknya diinginkan agar Islam memiliki beberapa pengaruh penting pada hukum negara.

S

ejumlah negeri Muslim yang disurvei oleh Pew Research Centre untuk Global Attitude Project menunjukkan kontinuitas keinginan untuk melanjutkan demokratisasi dengan sejumlah upaya adaptasi lokal yang merujuk pada ajaran Islam. Negeri sample untuk survei yang berlangsung 19 Maret sampai dengan 20 April 2012 ini ialah Libanon, Turki, Mesir, Tunisia, Jordania dan Pakistan. Meski dalam laporan yang dirilis tanggal 10 Juli 2012 lalu digarisbawahi adanya optimisme tentang prospek demokrasi yang berlangsung, namun di sana-sini terdapat perbedaan dalam memandang perubahan-perubahan bernuansa kekerasan terindikasi design luar. Mayoritas di Mesir,Tunisia,Yordania dan Libanon mengatakan bahwa kekacauan dan pemberontakan 2011 menyebabkan demokrasi di Timur Tengah makin tumbuh. Tetapi sebaliknya Turki dan Pakistan, di sisi lain, kurang menaruh harapan. Mayoritas di Libanon, Turki, Mesir, Tunisia dan Jordania tanpa ragu-ragu meyakini demokrasi sebagai bentuk pemerintahan terbaik. Pengakuan serupa diperdapat di Pakistan. Tetapi publik menyadari mendukung gagasan umum demokrasi saja tidaklah cukup, termasuk jika hanya mengurusi fitur-fitur tertentu yang inherent dari sebuah sistem demokrasi yang lazim seperti Pemilu jujur dan adil yang kompetitif, serta kebebasan berbicara. Negeri-negeri ini berbicara serius tentang banyak hal lain, termasuk kesetaraan gender, peran agama (Islam) dalam negara, sikap terhadap kekerasan, dan lain-lain. Karena keterbatasan tulisan ini tidak membicarakan seluruh isu itu. Demokrasi Plus Ekonomi jelas menjadi salah satu tujuan. Tetapi banyak yang mengatakan stabilitas politik merupakan prioritas penting, dan bahkan lebih mengutamakannya ketimbang kemakmuran ekonomi. Ketika responden ditanya mana yang lebih penting, demokrasi yang baik atau ekonomi yang kuat, Turki dan Leba-

non adalah negeri-negeri yang hanya lebih dari setengah memilih demokrasi. Mesir terbagi, sedangkan Tunisia, Pakistan dan Yordania tampaknya memrioritaskan perekonomian. Secara keseluruhan, pandangan tentang situasi ekonomi di negeri-negeri ini suram, walaupunTurki adalah pengecualian khusus. Hampir enam dari sepuluh orang Turki (57%) mengatakan perekonomian negeri mereka dalam kondisi yang baik, tapi setidaknya tujuh dari sepuluh di Pakistan, Lebanon, Tunisia, Mesir danYordania menawarkan penilaian negatif. Jika pengalaman Indonesia diukur dengan cara serupa, kelihatannya perasaan publik tidak akan jauh berbeda. Negeri ini sudah cukup berupaya dalam eksperimentasi demokrasi, tetapi rakyatnya tidak merasa puas. Dalam banyak hal ekspose tentang dampak demokrasi begitu gencar mendiskreditkan demokrasi. Perasaan lebih nyaman dipimpin Soeharto pada masa Orde Baru yang diperkirakan kini semakin besar, adalah salah satu akibat dari ketidakpuasan atas capaian demokrasi. Dalam pengukuran atas kemajuan indeks demokrasi Indonesia memang ditemukan pertumbuhan aspek kebebasan mengemukakan pendapat. Tetapi pendewasaan lembaga-lembaga demokrasi sangat mengecewakan, bahkan banyak bukti tentang perannya yang begitu buruk justru meruntuhkan sendisendi kehidupan berbangsa dan bernegara. Sejumlah pengalaman yang dapat dipetik dari pelaku-pelaku percobaan demokrasi di belahan bumi lain, menjadi sangat relevan untuk dirujuki di sini.

Karenanya proporsi besar orang di negari-negeri Muslim yang disurvei menginginkan peran besar bagi Islam dalam kehidupan politik. Ini mengesankan pandangan bahwa demokrasi itu sebetulnya adalah satu hal, dan ajaran Islam adalah agenda dan hal yang lebih besar yang diandaikan inspiratif secara kuat. Tidak mengherankan jika kelihatannya ada semacam kebimbangan tentang kesaling-terkaitan kedua domain itu. Bukankah negeri seperti Indonesia sudah begitu jauh menjalani percobaan demokrasi dengan penonjolan kebebasan mengemukakan pendapat—namun tak mengalami perubahan apa pun yang berarti dalam demokrasi ekonomi dan penataan kelembagaan demokrasi yang malah terlihat jelas bergerak pasti menjauhi sifat dan karakter demokrasi? Itulah yang membuat mereka pusing. Pertanyaan sederhana “apakah demokrasi yang harus dimajukan terlebih dahulu, ataukah ekonomi yang diben a h i ”, t e l a h menjadi diskusi elementer yang berkelanjutan. Hak-hak demokratis dan lembaga demokrasi yang populer jelas dianggap bukan sebuah prioritas dibanding pembenahan ekonomi. Jika harus memilih, Yordania, Tunisia dan Pakistan lebih suka memiliki ekonomi yang kuat dibandingkan demokrasi yang baik. Tentu ada alas an mengapa Turki dan Libanon lebih suka memprioritaskan demokrasi. Sedangkan di Mesir pendapat publik terpecah berimbang, mendua. Agama Dalam Negara Tentu saja akan ditemukan juga pola-pola kontroversi di berbagai negeri lain, bahwa di sini juga ada perbedaan yang signifikan atas seberapa jauh sistem hukum harus didasarkan pada agama (termasuk Islam). Ini pasti melelahkan dan tak jarang akan menelan pengorbanan yang tidak kecil. Obsesi agar Islam memainkan peran

utama dalam kehidupan publik cukup kuat,atausetidaknyadiinginkanagarIslam memilikibeberapapengaruhpentingpada hukum negara. Mayoritas di Pakistan, Yordania dan Mesir percaya hukum secara tegas harus mengikuti ajaran Quran. Sedangkan di Tunisia untuk pendapat ini hanya diperdapat angka dukungan 44%. Turki sendiri memperlihatkan keinginan agar hukum dipengaruhi oleh nilai-nilai dan prinsip-prinsip Islam, tetapi tidak secara ketat mengikuti Quran. Sekitar 4 dari 10 orang di Libanon menginginkan hukum seharusnya tidak dipengaruhisamasekaliolehajaranQuran, meskipununtukisusepertiini,sebagaimana untuk isu-isu lainnya, pandangan bervariasi akan selalu terdapat pada hampir seluruh agama dan sekte agama di mana pun dan kapan pun. Sejumlah 63% orang Kristen Lebanon dan 38% dari Muslim Sunni mengatakan hukum tidak harus dipanduolehQuran.Hanya13%dariMuslim Syiah yang setuju untuk ini. Samasepertipendapattentangagama dan politik yang berbeda-beda di enam negeri, begitu juga pandangan tentang kesetaraan gender. Mayoritas responden di enam negeri itu percaya bahwa perempuan harus memiliki hak yang sama dengan lelaki, dan pandangan ini dianut oleh lebih dari 8 dari 10 orang Lebanon dan Turki. Namun berbeda dengan di Mesir. Hanya 53% pria Mesir mendukung persamaan hak-hak itu. Tetapi jangan lupa, meskipun begitu besar dukungan atas prinsip umum kesetaraan gender, ada antusiasme yang kurang untuk kesetaraan gender dalam politik, ekonomi, dan kehidupan keluarga. Misalnya, banyak yang percaya bahwa pria akan memimpin lebih baik dalam politik. Tradisi turun temurun dan kecenderungan pemahamandanpenerimaanterhadapsumbersumber Islam dan kesejarahan Islam diyakini memiliki pengaruh besar untuk hal ini. Penutup Survei ini tentu sangat erat kaitannya dengan isu-isu penting terkait dengan kebijakan politik luar negeri Amerika Serikat. Lembaga ini selalu akan mengkaitkan persepsi publik di negeri-negeri yang mereka survei itu terhadap Amerika Serikat dan juga Israel. Bersamaan dengan itu, mereka selalu menganggap penting untuk mengetahui posisi kelompokkelompok ekstrim di mata publik yang mereka survei. Penulis adalah Dosen FISIP UMSU, Koordinator Umum ‘nBASIS.

Pertarungan Polri Vs KPK Oleh Fajar As Karena “tokoh-tokoh amatir” yang melompat dan ditempatkan di lembaga penentu perjalanan negara, maka pekerjaan tokoh-tokoh ini sungguh tidak memiliki mutu. Maka tampillah perbuatan kekanak-kanakan.

N

egara Kesatuan Republik Indonesia (NKRI) sejak didirikan telah dilanda kekecaubalauan konstitusi dan administrasi (tata usaha) negara. Kekacaubalauan telah demikian meluas pada masa pemerintahan Soeharto dan terutama saat ini. Kekecaubalauan yang paling mendasar adalah rentetan dan lingkaran perbuatan menyerimpung Undang-undang Dasar yaitu hukum darurat perang dan hukum perang yang diterapkan dalam keadaan negara berada dalam tertib sipil atau normal. Hukum darurat perang dan hukum perang itu adalah dibentuknya dan dioperasikannya apa yang disebut Komando Operasi Pemulihan Keamanan dan Ketertiban (Kopkamtib). Pejabat militer dalam hal ini Angkatan Darat berwewenang melakukan penyelidikan, penyidikan, penahanan (yang pada hakekatnya adalah penculikan), vonis (penjatuhan hukuman), pengasingan, dan pembunuhan di luar Pengadilan Kopkamtib ini juga menjadikan Kepolisian (Polri) dan Kejaksaan menjadi alat mati. Karena kritik dan protes dari lembaga internasional, pemerintahan Soeharto menjelang keruntuhannya telah mulai mengurangi wewenang Kopkamtib kendati tidak sepenuhnya berlangsung. Institusi Kopkamtib diubah menjadi Badan Ko-ordinasi Pemantapan Nasional (Bakortanas) di mana wewenangnya bersamaan dengan wewenang Kopkamtib. Pembangunan ekonomi yang dilaksanakan di masa Soeharto adalah pembangunan ekonomi penuh rekayasa di mana keruntuhan ekonomi pada 1997 yang berakibat bangkrut dan kekeringan likuiditas. Keruntuhan ekonomi inilah yang berakibat runtuhnya pemerintahan Soeharto. Keruntuhan ini ternyata tidak berhasil membangun kekuasaan rakyat Indonesia dalam makna yang sebenarnya. Para pemegang utama kebijaksanaan ekonomi politik pasca Soeharto bagian terbesarnya adalah pengikut-pengikut Soeharto yang telah demikian mendalam dicekoki ajaran dan trick-tricl. Maka kekacaubalauan tata usaha negara berlangsung terus kendati ada perubahan yang pada hakekatnya tidak merupakan pembaruan (reformasi) dan transformasi yang total mengacu kepada Undang-undang Dasar dan tata usaha modern. Dewan Perwakilan Rakyat (DPR) dan Majelis Permusyawaratan Rakyat (MPR) memang bergemuruh akan tetapi para tokoh-tokoh anggotanya terlihat bukanlah tokoh yang cerdas dan tepat. Mereka bukan manusia-manusia besar dalam

arti kata sebenarnya, tetapi lebih merupakan tokoh yang melompat menjadi “manusia-manusia besar yang cerdas”. Karena “tokoh-tokoh amatir” yang melompat dan ditempatkan di lembaga-lembaga penentu perjalanan negara, maka pekerjaan tokoh-tokoh ini sungguh tidak memiliki mutu dilihat dari sisi kepentingan menyeluruh bangsa Indonesia dalam kaitan perubahan dan pembaruan. Maka tampillah perbuatan kekanak-kanakan yang bergerak mengobrak-abrik Undang-undang Dasar oleh tokoh yang total tidak memahami akurat tentang makna dari PEMBUKAAN, BAB demi BAB, dan Pasal demi Pasal Undangundang Dasar. Maka terjadilah empat perubahan Undang-undang Dasar yang berakibat NKRI memiliki 2 dua UUD. Dan kemudian lahirlah berbagai UU yang bertentangan diametrial dengan UUD di mana salah satunya adalah UU No.2 Tahun 2002 Tentang Kepolisian Negara Republik Indonesia. Pasal-pasal Undang-undang ini banyak mengandung cacat, antara lain Pasal 1 angka 4 Peraturan Kepolisian adalah segala peraturan yang dikeluarkan Kepolisian dalam rangka memelihara ketertiban dan menjamin keamanan umum sesuai dengan peraturan perundang-undangan. Ketentuan ini adalah cacat besar karena Kepolisian hanya berwewenang menerbitkan peraturan teknis Kepolisian yang hanya terbatas berlaku untuk intern Kepolisian dan tidak berlaku untuk masyarakat umum. Pasal 8: (1) Kepolisian Negara berada di bawah Presiden dan (2) Kepolisian Negara dipimpin oleh Kapolri yang dalam pelaksanaan tugas bertanggungjawab kepada Presiden sesuai dengan peraturan Perundangundangan. Ketentuan ini mengandung cacad sangat mendasar, oleh karena Kapolri tidak dipimpin oleh Pejabat Negara Penetap Kebijaksanaan Politik yaitu Menteri, dan oleh karena itu Kapolri telah menjadi Pejabat Penetap Kebijaksanaan Politik dan Kebijaksanaan Tekhnis Kepolisian. Pasal 11 (1) Kapolri diangkat dan diberhentikan oleh Presiden dengan persetujuan Dewan Perwakilan Rakyat. Ketentuan ini juga mengandung cacat besar, karena di satu sisi menempatkan Kapolri menjadi Pejabat Negara Penetap Kebijaksanaan Politik Kepolisian dan di sisi lainnya menempatkan Kapolri lebih superior dari para Menteri. Pasal 28 (1) : Kepolisian Negara bersikap netral dalam kehidupan politik

dan tidak melibatkan diri pada kegiatan politik praktis. (2) Anggota Kepolisian tidak menggunakan hak memilih dan dipilih. Ketentuan ini adalah cacat besar dan absurd oleh karena Kepolisian mutlak terikat kepada Keputusan Politik Negara dan Anggota Kepolisian tidak boleh dibedakan dengan Warga Negara di luar Kepolisian dan mutlak berhak untuk memilih dan untuk dipilih di mana ketentuannya diatur dengan Undang-undang. Dan banyak lagi Pasal-pasal lainnya yang mengandung cacat besar dan absurd. KPK Komisi Pemberantasan Korupsi (KPK) dibentuk dengan prakarsa DPR setelah melihat maraknya perbuatan pencurian, perampokan, dan pencopetan (korupsi) uang rakyat, serta faktafakta kebobrokan pelaksanaan fungsi Kepolisian, Kejaksaan, dan Kehakiman. Maka terbentuklah UUPemberantasan Tindak Pidana Korupsi yang melahirkan satu Badan Superior yang pada hakekatnya melanggar ketentuan hukum dan perundang-undangan. Bahwa dalam negara modern dan tertib bahwa wewenang melakukan penyidikan adalah di tangan Kepolisian dan wewenang penuntutan di tangan Kejaksaan. Bahwa tidak dibenarkan pelaksanaan Penyidikan yang ditangani Kejaksaan, dan wewenang penyidikan yang ditangani Pegawai Negeri Sipil Penyidik harus selalu mendapat pengawasan dari Kepolisian. Karena itu KPK sebenarnya tidak dibenarkan melakukan fungsi penyidikan dan penuntutan. Karena mengacu kepada UU bahwa KPK telah melakukan gebrakan besar yang sangat memukau masyarakat luas Indonesia dan KPK menjadi primadona yang mendapat simpati masyarakat luas. Tetapi kejadian ini pasti menimbulkan bentrokan dari Kepolisian dan Kejaksaan, karena fungsi KPK ini bersamaan dengan fungsi Kopkamtib. Dan menjadilah penggerakan KPK ini yang menimbulkan benturan sebagaimana telah terjadi ketika Kepolisian menyidik dan menahan pimpinan KPK dan benturan besar antara Kepolisian dengan KPK yang berlangsung simpati saat ini. Memang dapat dipahami berlangsungnya simpati besar terhadap KPK serta pandangan yang mengacu kepada Lembaga KPK di Hongkong dan negara lainnya. Tetapi hal yang benar dan positif bagi NKRI adalah sikap tidak boleh latah meniru-niru negara lain. Tetapi mutlak bersikap membangun negara dan masyarakat modern yang total mengacu kepada konstitusi, hukum, dan perundang-undangan terutama mutlak mengacu kepada ketentuan hukum modern yang telah teruji. Sedemikian kompleks dan rumitnya krisis administrasi negara Indonesia yang membutuhkan pemikiran yang sangat cerdas, penuh kearifan, dan yang total menciptakan ketenteraman dan keuntungan masyarakat luas. Karena itu diperlukan satu solusi

yang sangat cerdas dan jenial dalam proses pemberantasan tikus-tikus pencuri, perampok, dan pencopet uang rakyat Indonesia. Solusi Betapa menyedihkan bagi bangsa, negara, dan seluruh rakyat Indonesia, di mana institusi Kepolisian dan Kejaksaan yang direndahkan dan dimerosotkan kedudukan dan nilainya. Bahwa kinerja dan prestasi Kepolisian dan Kejaksaan sangat bobrok adalah kenyataan, tetapi kebobrokan ini tidak boleh dibuat menjadi poin untuk mendirikan lembaga tandingan. Bahwa Kepolisian dan Kejaksaan harus ditangani dengan cara sempurna oleh Presiden dan MPR (DPR dan Dewan Utusan). Bila personil-personil Kepolisian dan Kejaksaan telah demikian bobrok, maka ada baiknya agar jenderal-jenderal Kepolisian saat ini dan pejabat senior Kejaksaan dihentikan dari jabatannya dan mulai melakukan penyempurnaan besar-besaran dengan menonjolkan pejabat muda dan terlihat bersi. Pada saat yang sama mulai direkrut para sarjana yang masih muda dan cerdas untuk menjadi pejabat-pejabat teras Kepolisian dan Kejaksaan. KPK memang tidak perlu dibubarkan saat ini tetapi difungsikan sebagai Lembaga Adhoc (istimewa), sementara (Ad Interim), dan darurat dengan syarat fungsinya diluruskan. Fungsi KPK difokuskan untuk melakukan fungsi intelijen (penyelidikan) dan ketika bukti-bukti permulaan tindak pidana korupsi telah ditemukan, maka fungsi Penyidikan diserahkan kepada pejabat Kepolisian dengan pengawasan penuh dari KPK dan Kejaksaan. Pada saat yang sama sebagaimana dikemukakan di depan, Presiden dan MPR melakukan langkah proaktif untuk menyempurnakan Kepolisian dan Kejaksaan. Bahwa langkah KPK yang benar adalah sebagai Lembaga Darurat yang mutlak harus berhasil menekan maksimal perbuatan pencurian, perampokan, dan pencopetan uang rakyat. Jadi tindakan general preventie (pencegahan umum) mutlak menjadi prioritas. MPR (DPR dan Dewan Utusan) harus menempatkan tindak pencegahan dan pemberantasan pelaku-pelaku pencurian, perampokan, dan pencopetan uang rakyat, dengan membentuk panitia kerja dan komisi-komisi pengawasan rutin. Jadi fungsi MPR sebagai wakil rakyat mutlak harus benarbenar dimaksimalkan. MPR harus jadi lembaga yang disegani oleh seluruh rakyat dan seluruh aparatur, dan bukan menjadi lembaga yang menjadi olokolokan masyarakat luas sebagaimana berlangsung saat ini. Adalah saat yang sangat baik bagi Presiden dan MPR untuk menyempurnakan fungsi Presiden, MPR, KPK, Kepolisian, Kejaksaan dan segenap Aparatur NKRI. Penulis adalah Pengamat Ekonomi – Politik Internasional.


B10 Kajian Tafsir Alquran

Penjelasan Alquran Alquran itu tidak lain hanyalah pelajaran dan kitab yang memberi penerangan. (Q.S. Yasin ayat 69)

Oleh Achyar Zein Alquran, selain memberikan petunjuk, maka Alquran juga memberi penerangan kepada manusia (al-bayyinat). Bedanya, petunjuk Alquran untuk mengarahkan manusia mencari atau untuk mendapatkan sesuatu, sedangkan “penerangan” ialah menjelaskan cara-cara atau sifat-sifat dari objek dimaksud. Sebagai contoh, Alquran memberikan petunjuk kepada manusia bahwa ada beberapa makhluk yang diciptakan oleh Tuhan seperti malaikat, iblis dan jin. Karena ketiga makhluk ini tidak dapat dilihat oleh manusia secara kasat mata maka Alquran menjelaskan esensi dan eksistensi ketiga makhluk dimaksud. Demikian juga halnya tentang khamar (minuman keras) dimana Alquran memberikan petunjuk kepada manusia untuk menjauhkannya. Kemudian Alquran menerangkan tentang sifatsifat khamar yang dapat menimbulkan bahaya bagi kehidupan manusia seperti mendatangkan kebencian dan permusuhan. Penjelasan Alquran ini membuat manusia semakin mengerti jika khamar wajar diajuhkan dari kehidupan. Sehingga tidak ada alasan bagi manusia untuk tidak menjauhkannya karena Alquran sendiri sudah menjelaskannya. Demikian juga hal-hal yang lain semuanya dijelaskan oleh Alquran. Hal ini menunjukkan bahwa Alquran tidak pernah membiarkan manusia berada di dalam kebingungan. Ketika Alquran memberikan petunjuk kepada manusia maka secara otomatis akan dijumpai ayat-ayat lain yang memberikan penerangan tentang petunjuk dimaksud supaya manusia dapat memperolehnya dengan mudah. Dengan demikian, tidak ada ayat-ayat Alquran yang maknanya tidak diketahui oleh manusia karena Alquran akan menerangkan makna-

makna dimaksud pada ayat-ayatnya yang lain. Dengan kata lain, jika terdapat kesulitan dalam memahami suatu ayat maka ayat yang lain akan membantu untuk memahaminya. Di dalam kajian Ulum al-Qur’an disebutkan bahwa masing-masing ayat Alquran saling menafsirkan (yufassiru ba’dhuhu ba’dha). Kemudian, melalui metode ini muncul metode penafsiran baru yang disebut dengan tafsir al-Mawdhu’i (menafsirkan satu topik dengan mengutip ayatayat Alquran yang berkaitan dengannya). Lafaz-lafaz yang maknanya terkesan sulit dipahami di dalam Alquran dapat dicari melalui kedua metode di atas. Oleh karena itu, kuat dugaan bahwa huruf-huruf potongan yang terdapat di awal surat Alquran (fawatih al-suwar) seperti alif lam mim, alif lam ra dan lain-lain dapat diketahui maknanya melalui ayat-ayat yang lain. Inilah makna yang dapat dipahami dari pernyataan Alquran bahwa dirinya adalah albayyinat (memberi penerangan). Dengan demikian, tidak ada satupun makna yang tersembunyi dari ayat-ayat Alquran karena semuanya sudah dijelaskan oleh Alquran sendiri dengan baik dan rinci. Menurut al-Thabari, Alquran memberikan penerangan kepada orang-orang yang mengkajinya dengan akal dan hati. Maksudnya, tanpa melibatkan akal dan hati maka penerangan Alquran tidak dapat ditangkap dengan baik dan benar. Menurut Ibn Katsir, keterangan dalam Alquran cukup jelas jika dikaji secara mendalam. Ketika Alquran menyatakan dirinya sebagai al-bayyinat (memberi penerangan) maka sulit diterima oleh akal jika Tuhan membuat ada sebagian ayat-ayat Alquran yang tak mungkin dipahami oleh manusia. Dengan demikian, semua ayat Alquran dapat dipahami jika ada upaya yang serius untuk menggalinya.

Rubrik Tanya Jawab MUI Kota Medan

Kurban Kolektif DR. H. Ahmad Zuhri, Lc. MA (Ketua Komisi Fatwa MUI Kota Medan) Tanya: Sebentarlagikitaakan memasuki musim haji. Dimana pada musim tersebut di anjurkan untuk berkurban. Akan tetapi saya memilki keterbatasan dana . Apakah boleh saya berkorban secara kolektif? Jawab: Terlepas dari perbedaan ulama tentang hukum kurban. Ada yang mengatakan wajib, ada yang mengatakan fardhu kifayah dan ada yang mengatakan sunnat Muakkad. Namun kurban adalah satu hal yang sangat dianjurkan dalam Islam. Saya melihat bahwa kurban atas nama kolektif adalah bleh. Berdasarkan argumantasi. Diantaranya: Dari Jabir, berkata: Aku shalat bersama Rasulullah Saw pada hari Idul Adha. Usai shalat, Nabi dating dengan membawa seekor kambing dan menyembelihnya seraya berkata: Bismillahi wallahu Akbar. Allahumma hadza ‘anni wa ‘an man lam yudhahhi min ummati. Dengan nama Allah, dan Allah Maha Besar. Ya Allah, (kurban) ini dariku dan dari siapa pun yang tidak (mampu) berkurban di antara ummatku. Hadits ini diriwayatkan juga oleh Imam Ahmad dalam Musnadnya, Sunan Abu Dawud, dan Turmudzi. Dan dari Ali bin Husain dari Abi Rafi’ dari Rasulullah Saw bahwa Nabi ketika berkurban membeli dua ekor kambing yang gemuk, sehat, dan putih bersih. Setelah shalat dan berkhutbah, seekor kambing itu didatangkan kepada Nabi dan Nabi berdiri di Mushallanya kemudian menyembelihnya dengan tangan beliau sendiri. Kemudian berkata: Allahumma hadza ‘an ummati jami’an man syahida laka bil tauhid wa syahida li bil balagh. Ya Allah, (kurban) ini

dari semua umatku yang bersaksi kepada-Mu dengan keesaan dan yang bersaksi kepadaku terhadap apa yang aku sampaikan. Kemudian didatangkan kambing yang kedua, lalu Nabi menyembelihnya dengan tangan beliau sendiri dan berkata: Hadza ‘an Muhammad wa Ali Muhammad, (kurban) ini dari Muhammad dan keluarga. Dengan kedua kurban itu dikenyangkanlah seluruh yang miskin dan Nabi memakannya bersama keluarganya sebagian dari daging kurbannya…..Hadits ini diriwayatkan oleh Imam Ahmad. Menarik untuk mencermati hadits di atas, bahwa sebetulnya kurban kolektif bukan saja dibolehkan, tetapi pernah dicontohkan Nabi Saw. Meski dalam keterangan hadits yang pertama Imam Ahmad mengatakannya sebagai hadits dha’if, tetapi hadits yang kedua diriwayatkan beliau sebagai hadits yang sampai pada tingkat hasan. Imam Ahmad meriwayatkan kedua hadits ini dalam Musnadnya Dalam lanjutan keterangan yang tercantum pada kitab Nayl al-Awthar, disebutkan bahwa dua hadits ini menunjukkan dalil dibolehkannya seseorang untuk berkurban atas dirinya dan atas keluarganya, kerabatnya, dan bergabung mereka dalam pahalanya. Saya kira Tuhan tidak pernah akan kebingungan untuk “membagi” pahala kurban itu di antara kita. Lalu bagaimana dengan distribusi daging kurbannya? Sesuai hadits Nabi di atas, daging kurban itu kemudian diberikan sebagai makanan bagi fakir miskin, dan Nabi beserta keluarganya juga memakan sebagian dari kambing itu. Saya kira, kita cukup dewasa untuk bisa membagi distribusi kurban kolektif itu, atau –lebih baik lagi– kita relakan semua untuk mengenyangkan mereka yang kelaparan di sekitar kita. Wallau a’lam.

Tanya Jawab Konsultasi Zakat 1433 H

Ukuran Zakat Fitrah Soal : Assalamu’alaikum Wr.Wb. Beberapa tahun belakangan ini hangat didiskusikan di masjid-masjid tentang ukuran zakat fithrah, khususnya jika dikonversi ke uang. Sebagian ada yang berpandangan zakat fithrah dengan beras 2,7 kg. Tapi bila zakat fithrah diuangkan harus senilai 3,8 kg. Sebab madzhab yang membolehkan zakat fithrah dengan uang menentapkan ukuran zakat fithrah itu 3,8 kg. Bagaimana sebenarnya Ustadz? Mohon penjelasan. (Anwar Bakhtiar, Simpang Selayang) Jawab : Wa’alaikumussalam Wr.Wb. Bapak Anwar yang dimuliakan Allah SWT. Alhamdulillah kita bersyukur kepada Allah SWT kian hari semakin meningkatkan kesadaran masyarakat Muslim di negeri ini untuk menunaikan zakat, terutama zakat fithrah. Kita juga berfikiran positif dengan kajian-kajian yang dilakukan oleh kalangan terpelajar kita yang tentu saja memperluas wawasan kita tentang Islam, termasuk wacana zakat dengan pendekatan muqaranah (perbandingan, komparasi). Semoga dinamika ummat dalam ber-Islam ini membawa keberkahan kepada kita dari Allah SWT. Zakat fithrah disebut juga sebagai zakat individu, sebab setiap pribadi Muslim diwajibkan berzakat fithrah .Dari Ibnu Umar ra, ia berkata: “Rasulullah Saw menyuruh kami untuk mengeluarkan zakat fithrah dari setiap manusia kecil, besar, yang merdeka dan hamba sahaya, satu sha’ dari kurma dan gandum...” (HR. Baihaqi). Sha’ adalah takaran yang digunakan di masa Nabi Saw sebagaimana di tempat kita dikenal ukuran/takaran ada gantang, kaleng, liter, kati, dan lain-lain. Takaran kalau ditimbang sangat tergantung pada barang yang ditakar. Bahkan antara barang sejenis beda varian jika ditimbang bisa beda bobot timbangannya, umpamanya antara beras Cianjur dengan beras ramos, dengan takaran yang sama bisa beda berat timbangannya. Jadi perbedaan fatwa di kalangan Ulama’ tentang zakat fithrah antara 2,5 kg, 2,7 kg dan 3,8 kg sebenarnya perbedaan me-kilogramkan ukuran sha’ yang digunakan di zaman Nabi Saw atau bahkan ukuran sha’ itupun ketika diterjemahkan di daerah lain bisa diartikan gantang, kaleng, kati atau lainnya.

Diasuh oleh :

Ustadz H Muhammad Nuh (Dewan Syari’ah LAZ Peduli Ummat Waspada) LAYANAN JEMPUT ZAKAT (Khusus Kota Medan):08126375062 Pembayaran ZIS Via Bank Zakat, Infak/Sedekah BMI 211-00044-15 BMI 211-00002-15 BSM 006-002240-7 BSM 006-000832-1 BNI Syariah 009-2687629 BNI 005-7504808 Bank Mandiri 106-0002203803 BRI 0693-01-000055-30-9 Bank Sumut Syariah 611-01-04-000024-0 BCA 022-1750828 Keterangan : Rubrik ini terbit setiap hari selama Ramadhan yang dikelola oleh LAZ Peduli Ummat Waspada. Bagi anda yang ingin konsultasi zakat melalui rubrik ini dapat dikirim ke alamat kami : Jl. Brigjend Katamso No. 1 Medan 20151 (Gedung Harian Waspada) Telp/fax. (061) 4511936 / 08126375062 atau e-mail : Muhammadnuh66@gmail.com

Tentang menunaikan zakat fithrah dengan harganya, memang sebagian besar Ulama’ cenderung dengan makanan pokok, tidak diuangkan. Tetapi dengan pendekatan manfaat dan kemudahan, argumentasi yang membolehkan zakat fithrah dengan uang, kami cenderung bisa menerima dan memakluminya. Maka tidak perlu ada pembedaan antara zakat fithrah dengan makanan pokok dan menunaikannya dengan harganya. Perlu dalil yang sharih, tegas dan jelas untuk membedakan di antara keduanya. Tidak ada perlunya alasan konsistensi dengan madzhab tertentu sebab Islam yang kita anut berdasarkan Al-Qur’an dan Al-Hadits, para Ulama’ yang mulia menjelaskan dengan pemahamannya yang mendalam, sehingga kita dapat menjadi hamba Allah yang beribadah dengan benar kepadaNya. Semoga. Amin

Semarak Ramadhan

WASPADA, Kamis, 9 Agustus 2012 8 Agustus 2012

19

Imsak 04:55 Shubuh 05:05 Maghrib 18:41

9 Agustus 2012

20

10 Agustus 2012

Imsak 04:55 Shubuh 05:05 Maghrib 18:40

21

Imsak 04:55 Shubuh 05:05 Maghrib 18:40

11 Agustus 2012

22

Imsak 04:55 Shubuh 05:05 Maghrib 18:40

Waspada/Surya Efendi

TAUSYIAH PANGDAM: Pangdam I/BB Mayjen TNI Lodewijk F Paulus memberi tausyiah dihadapan ratusan jamaah Masjid At Taqwa di Markas Yonzipur I/DD di Helvetia Medan, Selasa (7/8) malam. Tausyiah digelar sebelum menunaikan shalat taraweh berjamaah.

Pertengahan Ramadhan, Masjid Mulai Sepi MEDAN (Waspada): Pelaksanaan shalat subuh dan cermah agama di masjid-masjid pada awal Ramadhan sangat ramai. Kaum tua dan muda asyik tampak mendengar ceramah. Namun setelah 17 Ramadhan, suasana keramaian mulai berkurang, terutama kehadiran para remaja berkurang 50 persen. “Orang tua masih tetap, tetapi anak muda yang hadir tinggal 50 persen saja,” kata Ustadz Sutan Syahrir, mengaku mengisi ceramah di berbagai masjid di Medan selama Ramadhan, Senin (6/8). Menurut dia, jumlah jamaah mengikuti shalat dan mendengarkan ceramah subuh pada Ramadhan tahun ini sesungguhnya mengalami peningkatan dari tahun lalu. Jika tahun sebelumnya hanya empat saf saja, maka tahun ini ada 6 saf yang ikut shalat.

Setelah itu mereka tekun mendengar ceramah hingga selesai. “Bahkan ada yang mengajak saya berbincang dan berdiskusi tentang banyak hal menyangkut pelaksanaan ibadah Ramadhan,” sebutnya. Memang diakui, memasuki minggu kedua Ramadhan, jumlahnyamulaimenurun.“Tapiyang kaum muda saja, kalau kaum tua nampaknya masih bertahan,” kata Syahrir yang juga Kepala KUA Medan Tembung itu. Semestinya, semakin mengakhiri Ramadhan masjid harus

diramaikan, karena puncak amalan dan pahala beribadah itu ada di akhir. Dia menyebutkan, kaum muda yang mulai berkurang datang ke masjid saat subuh, terlihat di Masjid Nurul Ihsan Jln. Durung Medan, Masjid Al Hikmah Jln. Bajak V, Masjid Al Majidiyah Jln. Serdang, Masjid Al Huda Jln. Malaka, Masjid Darul Amin Titi Sewa. “Saya pikir anak muda yang masih mau mendengarkan ceramah, mereka yang benarbenar tekun beribadah, karena sebagiannya lagi setelah shalat langsung beranjak dan berjalanjalan. Kebiasaan itu harus segera dicari solusinya agar mereka lebih memilih di masjid daripada jalan-jalan,” katanya. Hal sama disampaikan Al Ustad Azhar Sitompul yang ber-

ceramah di Masjid Taufik Medan. Dia mengaku jika kaum muda tetap ramai melaksanakan shalat subuh, tetapi setelah salam mulai beranjak satu persatu sehingga yang tinggal hanya satu atau dua orang saja. Selebihnya kaum tua yang tekun mendengarkan ceramah. “Saya pikir, inilah fenomena kaum muda, mereka lebih memilih berkumpul bersama kelompoknya daripada mendengarkan cermah. Padahal mereka ada di jalan raya yang tak jauh dari masjid,” kata Sitompul berharap ada gerakan menjadikan remaja cinta masjid, sehingga mereka memilih ada di masjid daripada di jalan-jalan usai shalat subuh. Sementara di Masjid Lama Gang Bengkok, Kesawan Medan seperti disampaikan pengurus

BKM HM Ikhsan Tanjung, ceramah bagi jamaah disaat malam hari usai tarawih, sedangkan pagi setelah shalat subuh. Kaum tua terutama para ibu melaksanakan kegiatan tadarus Alquran. “Setiap tahun aktivitasnya seperti itu. Ceramah usai tarawih dan pagi hari hanya tadarusan Alquran.” Sedangkan pantauan di Masjid Al Ikhlas Jln. Madio Santoso, Medan, jamaah shalat subuh pada barisan terakhir di dominasi anak-anak dan remaja. Demikian juga di Masjid Bilal Ar Ridho Jln. Bilal. Menurut pengurus BKM Sahyar M Nur, masjid itu selalu ramai sekalipun saat shalat subuh. Jamaahnya juga melaksanakan kegiatan tadarus Alquran usai melaksanakan shalat subuh.(m37)

Catatan Ramadhan Di Tanah Suci

Merasakan Nikmat Allah Di Bawah Terik Matahari Oleh HT Erry Nuradi (Bupati Serdang Bedagai) DUA hari sebelum tibanya bulan suci Ramadhan setelah mendapat izin dari Gubernur Sumatera Utara dan Mendagri, penulis bersyukur bisa kembali mengunjungi tanah suci Makkah dan Madinah dalam melaksanakan ibadah Umroh dalam tahun 1433 H. Saya dan keluarga serta rombongan kecil berangkat via Kualalumpur, Malaysia pada hari Rabu (18/7) pukul 15:00 langsung menuju Jeddah, Arab Saudi. Setelah melalui perjalanan udara lebih dari 8 jam, kami mendarat di Bandar Udara Internasional King Abdul Aziz, Jeddah, Arab Saudi. Sebagaimana tahun lalu, penumpang pesawat diangkut dengan dua tujuan, penumpang biasa menuju terminal internasional, sementara penumpang umroh menuju terminal haji. Sebagaimana pengalaman tahun yang lalu, bagasi untuk dapat diperoleh di terminal haji harus diberi label umroh; kalau tidak, bisa nyasar ke terminal internasional. Tahun ini kami langsung melaksanakan umroh. Setelah menggunakan pakaian ihram dan niat kami langsung menuju kota suci Makkah. Dapat dibayangkan bagaimana lelahnya setelah dalam perjalanan yang cukup panjang, kami langsung melaksanakan tawaf dan sai. Selama perjalanan dari Jeddah ke Makkah, para jamaah umroh melafaskan kalimat talbiah. Selama lebih kurang 1 jam perjalanan akhirnya kami sampai di Makkah pada pukul 23:00 waktu Saudi. Kemudian sejenak meletakkan barang-barang di kamar hotel , kami langsung ke Masjidil Haram. Kami memulai tawaf tepat pukul 00:00 waktu Saudi. Ternyata pilihan tawaf pada malam hari agar bisa sedikit lapang juga dipikirkan oleh banyak orang. Akibatnya tawaf pukul 00:00 suasana di Masjidil Haram masih sangat padat danmenurut catatan penulis hampir satu jam menyelesaikan tawaf karena padatnya jamaah. Demikian juga saat mengikuti Sai, tujuh putaran dari Safa ke Marwa juga cukup padat walaupun saat ini tempat Sai jauh lebih baik. Di beberapa tempat di atas diberikan alat pendingin yang langsung bisa dirasakan oleh jamaah. Akhirnya kami menyelesaikan umroh pertama pada pukul 02:00 waktu Saudi, Kamis (19/7). Ramadhan Berbeda dengan di tanah air dimana Ramadhan pertama jatuh pada hari Sabtu (21/9) walau warga Muhammadiyah menunaikan puasa Ramadhan pada 20 Juli, di Arab Saudi juga pelaksanaan ibadah puasa Ramadhan jatuh pada Jumat (20/7). Saat kami menyelesaikan shalat Isya pada Kamis (19/7) malam, imam menyebutkan shalat malam di bulan Ramadhan yang menandakan esok hari waktu Saudi Arabia jatuhnya pelaksanaan ibadah puasa Ramadhan pertama. Malam itu kami ikut menunaikan shalat tarawih sebanyak 20 rakaat, ditambah shalat witir 3 rakaat 2 salam. Keesokan harinya, kami melaksanakan

dan minuman segera dibersihkan dengan alas plastik yang dilipat. Dalam waktu yang singkat masjid sudah bersih dan shalat Magrib dilaksanakan. Setelah shalat Magrib, jamaah banyak mencari makan malam di sekitar masjid dan juga kembali ke hotel. Shalat Isya dimulai dari pukul 21:10 sehingga jarak Magrib ke Isya lebih kurang dua jam. Setelah selesai sholat Isya, kemudian dilanjutkan dengan shalat tarawih dan witir 23 rakaat yang dimulai jam 21.30WAS. Imam menghabiskan satu juz Alquran sehingga shalat Tarawih dan witir ini baru selesai jam 23:30 WAS. Pada rakaat ke 10 biasanya ada penggantian imam.

Waspada/ist

Penulis duduk bersama jamaah lainnya menanti saat berbuka dengan makanan hidangan dermawan.

shalat Jumat di hari pertama Ramadhan dan saat itu cukup padat jamaah yang menunaikan shalat jumat di tengah terik matahari yang suhunya mencapai 48 derajat celcius. Di Masjidil Haram yang biasanya ada menyediakan air zamzam di setiap sudut shaf dan juga sudut masjid, maka untuk selama bulan Ramadhan, hal itu tidak disediakan para pengurus masjid. Pada hari kedua Ramadhan, penulis kembali menunaikan ibadah umroh sekalian membawa putri penulis yang berusia 14 tahun yang pada umroh kemarin belum melaksanakan . Setelah kami melaksanakan ziarah di beberapa tempat di Makkah, pada pagi Ramadhan hari kedua dan telah menyiapkan pakaian ihram, kami singgah di Masjid Ja’rona lebih kurang 20 km di luarkota Makkah untuk mengambil niat umroh. Kemudian setelah memakai pakaian ihram dan niat kami kembali ke Makkah untuk melaksanakan umroh kedua di bulan Ramadhan. Berbeda dengan umroh yang pertama, yang kami lakukan menjelang malam dini hari, penulis melaksanakan ibadah umroh kedua pada pukul 11: 00 di tengah terik matahari. Ternyata Alhamdulillah suasana di tengah hari siang jauh berbeda dengan umroh kemarin karena ternyata suasana tawaf sangat lengang dan sepi. Lebih kurang 30 menit menyelesaikan tawaf dibandingkan dengan malam kemarin yang hampir satu jam. Demikian juga saat melaksanakan sai pada pukul 12:00. Walaupun waktu melaksanakan umroh singkat karena tidak terlalu ramai, tetapi kendalanya dilaksanakan di bawah matahari yang menyengat. Ada hadis yang menyatakan umroh di bulan Ramadhan pahalanya sama dengan melaksanakan ibadah haji, karena memang tantangan yang dihadapi cuaca dan dahaga. Dan di sinilah saya merasakan nikmat Allah berikan kepada saya dan rombongan. Walau matahari cukup menyengat namun alhamdulillah, kami bisa menyelesaikan ibadah umroh tanpa ada halangan. Berbuka Puasa di Tanah Suci Menjelang berbuka puasa di Masjidil Haram, ramai jamaah memasuki pelataran masjid. Demikian juga banyak orang yang berinfak sedekah yang mengajak jamaah berbuka puasa di tempatnya masing-masing, karena menurut mereka apabila jamaah berbuka puasa di tempatnya maka mereka akan mendapatkan pahala puasa dari jamaah tersebut. Inilah yang mengakibatkan berduyun-duyun orang menggelar plastik untuk tempat berbuka puasa, baik itu di dalam masjid maupun di pelataran luar masjid. Hanya saja karena cuaca begitu panas, penulis mencoba masuk kedalam masuk untuk sama-sama berbuka puasa. Di dalam ruangan Masjidil Haram ini ada beberapa tempat diperbolehkan berbuka bersama dengan keluarga dan waktu berbuka di Makkah pada pukul 19:05 WAS. Menu berbuka yang dihidangkan para penyumbang kurma, roti, susu yoghurt atau susu laban dan minuman teh atau kopi Arab yang bagi kita di tanah air terasa aneh di lidah. Setelah azan berkumandang pihak masjid memberikanwaktu 10 menit untuk berbuka dan kemudian dalam waktu yang singkat semua makanan

Di Madinah Pada hari ketiga Ramadhan, penulis dan rombongan meninggalkan Makkah. Sebelum itu kami melaksanakan Tawaf Wada dan seterusnya menuju Madina. Lebihkurang 5 jam perjalanan darat, saat Ba’da Ashar, kami tiba di kota kelahiran dan sekaligus makam Rasulullah di Madinah Almunawarah Ternyata udara di Madinah, menurut informasi yang kami dengar, jika di Makkah panas maka di Madinah akan lebih panas lagi. Demikian juga kalau di Makkah dingin maka di Madinah lebih dingin lagi. Ternyata memang benar suhu di Madinah lebih panas daripada di Makkah. Menjelang Magrib saja suhu di Nabawi 38 derajat celcius dan waktu berbuka di Madinah berbeda sedikit saja di Makkah yakni pukul 19:10. Sistem berbuka puasa di Madinah tidak bisa berdekatan antara pria dan wanita sementara di Makkah masih bisa berdekatan antara pria dan wanita. Sama juga seperti di Makkah disini banyak juga dermawan yang menarik jamaah untuk berbuka puasa di tempatnya masing-masing , hanya saja di Madinah ini menu berbuka puasa lebih bervariatif. Penulis melihat ada di beberapa tempat disediakan nasi briyani dan berbagai menu lain yang disiapkan oleh para dermawan di luar menu khas, yaitu kurma, roti susu, yoghurt, teh dan kopi. Di Nabawi ini juga jamaah sangat penuh dalam menunaikan shalat lail. Orang banyak masuk ke dalam masjid karena udara sangat panas. Walaupun di luar Masjid Nabawi ada payung, tetapi karena musim panas angin tidak bertiup, membuat panas kering suhu udara 50 derajat celcius pada siang hari. Seperti biasa di Madinah sesudah mengunjungi beberapa tempat seperti Masjid Kuba, Masjid Kiblatain yang mempunyai banyak sejarah yaitu Masjid Kiblatain tempat bertukarnya arah kiblat dari Palestina ke arah Masjidil Haram sedangkan Masjid Kuba apabila shalat sunat dua rakaat di masjid itu pahalanya sama dengan melaksanakan umroh. Hari-hari selama di Madinah tetap melaksanakan shalat fardhu dan shalat lail. Akhirnya pada Ramadhan ke 6 kamipun bersiap kembali ke tanah air. Dalam melanjutkan perjalanan dari Madinah ke Jeddah selama lebih kurang 5 jam, singgah sebentar di Masjid Terapung, Jeddah, sebelum bertolak ke terminal haji King Abdul Aziz untuk pulang ke tanah air.


B11

WASPADA, Kamis, 9 Agustus 2012 12 Agustus 2012

23

Imsak 04:55 Shubuh 05:05 Maghrib 18:40

13 Agustus 2012

14 Agustus 2012

24

25

Imsak 04:55 Shubuh 05:05 Maghrib 18:39

Imsak 04:55 Shubuh 05:05 Maghrib 18:39

15 Agustus 2012

26

Imsak 04:54 Shubuh 05:04 Maghrib 18:39

16 Agustus 2012

27

Imsak 04:54 Shubuh 05:04 Maghrib 18:39

17 Agustus 2012

28

Imsak 04:54 Shubuh 05:04 Maghrib 18:38

18 Agustus 2012

29

Imsak 04:54 Shubuh 05:04 Maghrib 18:38 * Waktu untuk Medan.

Bertandang Ke Gubuk Fakir Miskin STABAT (Waspada): Safari Ramadhan Peduli Duafa diselenggarakan TP PKK Langkat diketuai Hj Nuraida Ngogesa, mengunjungi kediaman sejumlah kaum duafa dan fakir miskin di Kec. Pematangjaya, Babalan, Tanjungpura, Batangserangan dan Kec. Sirapit. Bertandang ke gubuk sejumlah fakir miskin dan warga kurang mampu dari pintu ke pintu seraya membawa bantuan paket sembako, terdiri dari beras, minyak goreng, telur, mi instan, gula, sirup dan mukena, kain sarung serta tali asih yang keseluruhannya merupakan sumbangan pribadi Ngogesa Sitepu dan keluarga. “Semoga kedatangan kami bersilaturrahmi ada manfaatnya untuk bapak dan ibu sekeluarga,” kata Hj Nuraida, seraya menyerahkan bantuan itu kepada sejumlah warga yang dikunjunginya, Rabu (1/8). Suasana haru mewarna kunjungan silaturrahmi tersebut, bahkan beberapa keluarga yang dikunjungi merasa bagaikan mimpi memperoleh rezeki yang tidak terduga.(a01)

Waspada/Armin Nasution

GUS Irawan Pasaribu saat usai bersilaturrahim dengan warga Perumnas Mandala kemarin.

Jadikan ZIS Sebagai Kebutuhan Gus Irawan Di Perumnas Mandala Waspada/Ibnu Kasir

Nek Tumini, 85, merangkul Ketua TP PKK Langkat Hj Nuraida Ngogesa yang bertandang ke gubuknya, seraya membawa sejumlah bantuan, Rabu (1/8).

BTN Syariah Buka Puasa Bersama Anak Yatim MEDAN (Waspada): Sebagai wujud syukur menempati kantor baru, Bank Tabungan Negara (BTN) Syariah Cabang Medan menggelar buka puasa bersama anak yatim di kantor bank tersebut, Jln. Juanda Medan, Selasa (7/8). “Insyah Allah, berkah Ramadhan dapat kita rasakan bertepatan hijrahnya kantor BTN Syariah Cabang Medan dari Jalan SM Raja ke Jalan Juanda,” kata Kepala Cabang BTN Syariah Cabang Medan Nelisma Suryani, di sela acara buka puasa bersama. Menurut dia, hijrahnya kantor BTN Syariah Medan ke tempat yang lebih strategis merupakan upaya pihaknya meningkatkan pelayanan kepada nasabah. Terlebih selama ini kepercayaan nasabah semakin meningkat akan layanan BTN Syariah. “BTN Syariah akan terus berupaya meningkatkan perkembangan ekonomi syariah, baik dari segi pendanaan seperti Tabungan Batara IB yang bebas biaya administrasi, deposito tanpa penalti dengan bagi hasil, juga tabungan haji dengan setoran awal yang ringan,” ucapnya. Dikatakan, dari segi pembiayaan, BTN Syariah memiliki produk talangan haji, dimana porsi haji dapat diperoleh hanya dengan setoran awal Rp500 ribu. “Juga ada pembiayaan modal kerja dan investasi, KUR, serta KPR BTN IB,” sebutnya. Selain menyediakan menu berbuka puasa, BTN Syariah memberi santunan kepada puluhan anak yatim berasal dari sekitar lingkungan kantor bank tersebut. Hadir dalam acara itu di antaranya, Kepala Cabang BTN Medan M Ichwan, Deputih Branch Manager Comercial BTN Cabang Medan Slamet Purwadi, dan Deputih Branch Manager Costumer BTN Syariah Cabang Medan Ferry Despriza. (m41)

MEDAN ( Waspada): Ramadhan 10 hari lagi, menandakan bulan penuh rahmat ini segera berakhir. Kewajiban membayar zakat fitrah sudah bergema di masyarakat. Inilah saat berbagi paling indah menjelang hari yang fitrah. Hal itu disampaikan Ketua Masyarakat Ekonomi Syariah (MES) Sumatera Utara Gus Irawan Pasaribu, saat menjadi penceramah peringatakan Nuzulul Quran di Masjid Al Hidayah Perumnas Mandala, Percut Sei Tuan, Deliserdang, kemarin. Di hadapan ratusan jamaah malam itu, Gus menyampaikan makna Nuzulul Quran dalam bingkai keluarga, masyarakat dan pembangunan daerah. Menurut Gus, selain menurunkan Alquran pada Ramadhan, Allah SWT juga menjanjikan malam yang lebih baik dari 1000 bulan, yakni malam lailatul qadar. Kata Gus, siapapun tidak akan tahu kapan malam itu akan turun. “Tapi satu hal, hanya keluarga muslim yang menerapkan Alquran dalam kehidupan rumah tangganya yang bisa menyentuh lailatul qadar,” ujarnya. Dia mengatakan Alquran merupakan sumber referensi terpercaya yang up to date dan tidak ada keraguan di dalamnya. Di dalamnya, kata dia, Allah Swt sudah menyajikan seluruh aturan main kehidupan. Mulai dari kehidupan sosial, budaya, pertahanan dan keamanan, hingga ekonomi (muamalah). “Umat harus bisa menjalani hidup dengan baik dalam masyarakat, Alquran sudah memberikan semuanya. Tinggal kita

yang menjalaninya, mau atau tidak. Termasuk soal membangun ekonomi umat dengan sistem syariah. Mari kita jadikan Alquran sebagai sumber amalan dan dijalankan secara kaffah,” bebernya. Gus menambahkan, persoalan besar dihadapi umat Islam saat ini adalah kemiskinan yang kemudian membawa pada keterpurukan. Kenapa ini bisa terjadi ? Padahal kata Gus, Islam memiliki instrumen pengentasan kemiskinan paling efektif yakni lewat zakat, infak, sedekah dan wakaf. “Kenyataannya banyak dari kita yang lupa membayar kewajibannya. Atau memang sengaja melupakan. Apa kita harus diam saja. Padahal itu kewajiban kita untuk mengingatkan,” ungkapnya. Dalam konteks ini, pemimpin harus bisa mengarahkan hal ini pada masyarakat muslim yang dipimpinnya. Kata dia, potensi zakat umat Islam di Sumut sangat besar. Tapi kenapa itu tidak tergarap dengan baik. Padahal itu bisa disalurkan dengan baik untuk umat Islam lain yang membutuhkan. “Dulu waktu di Bank Sumut, saya buat surat gaji karyawan dipotong langsung untuk bayar zakatnya. Zakat para karyawan saya itu kami salurkan lagi sebagian lewat zakat produktif.

Perguruan Al-Ulum Terpadu Santuni Kaum Duafa

Waspada/Sugiarto

PIMPINAN, staf dan karyawan BTN Syariah Cabang Medan diabadikan bersama sejumlah anak yatim usai acara buka puasa bersama di kantor bank tersebut, Jalan Juanda Medan, Selasa (7/8).

Pesantren Kilat Tempa Keimanan Siswa MEDAN (Waspada): SMA Persiapan Sei Mencirim, Kec. Sunggal, Deliserdang terus membina dan menempa siswanya dengan berbagai kegiatan esktrakurikuler, salah satunya pesantren kilat yang dilaksanakan pada bulan Ramadhan. Kepala Sekolah SMA Persiapan Sei Mencirim H Muhammad Fauzi, SAg, Minggu (5/8) mengatakan, kegiatan pesantren kilat secara resmi sebenarnya telah ditutup. “Selain para guru, instruktur saat itu diisi Ben S Nainggolan dari PT Telkom Medan,” katanya. Tujuan pesantren kilat, agar lembaga pendidikan tidak hanya melahirkan siswa pada satu disiplin ilmu saja, tapi juga mampu melahirkan generasi muda lebih energik dan bersaing dalam penguasaan sains dan tekhnologi tanpa meninggalkan ilmu agama. “Kita berupaya melahirkan generasi muda yang berilmu pengetahuan, beriman dan bertaqwa serta berakhlah mulia,” sebutnya. Selama mengikuti pesantren kilat, para siswa diberi berbagai pembelajaran, seperti pembelajaran Alquran, pelatihan imam, pelatihan ceramah, pemberian materi ilmu fiqih dan ilmu tauhid. Kemudian siswa yang telah paham dikirim ke masjid-masjid. “Kalau dia berbakat sebagai penceramah akan kita kirim mengisi kuliah tujuh menit (kultum) ke masjid, dan kalau dia pandai mengaji kita didik menjadi qori dan qoriah,” kata dia menyebutkan pesantren kilat menjadi agenda rutin tahunan sekolah setiap bulan Ramadhan. (m30)

MEDAN (Waspada): Mengisi bulan suci Ramadhan, Perguruan Al-Ulum Terpadu memberikan santunan kepada kaum duafa, anak yatim dan jompo di sekolah tersebut, Jln. Tuasan Medan, Sabtu (4/7). Kepala SMA Al-Ulum Terpadu, M Nizamuddin, SAg, SH mewakili Ketua Yayasan Prof Dr H Nawir Yuslem, MA, mengatakan, santunan itu sebagai bentuk kepedulian sosial Perguruan Al-Ulum Terpadu kepada masyarakat, terutama kaum duafa, anak yatim dan jompo. “Perguruan ini hadir di tengah lingkungan masyarakat, maka sepantasnyalah lembaga pendidikan yang banyak mengajarkan tentang nilai-nilai

Islam memberikan contoh yang baik kepada masyarakat,” ujarnya. Nizamuddin mengatakan, kegiatan ini agenda rutin setiap tahun, dan sudah menjadi komitmen untuk terus terjaga dan terpelihara. “Infaq ini merupakan penggalangan dana dari siswa, orang tua siswa, guru dan staf yayasan, dan alhamdulillah terkumpul sebesar Rp40 juta,” katanya mengatakan, tahun ini ada 60 kaum duafa yang disantuni. Kepala SMP Al-Ulum Nur Rahimah, SPdi didampingi Kepala SD Al-Ulum Dra Hj Endang Wahyuni berharap program kerja itu terus berjalan se-tiap tahunnya. Arianda Tanjung

Waspada/Arianda tanjung

Kepala SMA Al-Ulum Terpadu, M Nizamuddin, SAg, SH (kanan) memberikan bingkisan kepada kaum duafa di sekolah tersebut, Jl Tuasan Medan, Sabtu (4/7).

Bukber Alumni SMP 7 Angkatan 87 Reuni 26 Agustus

MEDAN (Waspada): Alumni SMP Negeri 7 Angkatan ’87 mengadakan buka puasa bersama (bukber), sekaligus membahas rencana gelaran reuni mereka yang akan dilaksanakan 26 Agustus. Buka puasa bersama digelar di kediaman salah satu alumni di Jln. Harapan Pasti, Medan, Minggu kemarin, kata Yuni Prihartini, salah satu alumni, Rabu

(8/8). Disebutkannya, acara buka puasa bersama itu sebagai ajang silaturrahmi, sekaligus rapat membahas reuni mereka. “Setelah berbuka dan melaksanakan shalat berjamaah, kita rapat alumni untuk persiapan reuni yg akan digelar Minggu 26 Agustus,” katanya menjadi bendahara kepanitian reuni. Ketua pelaksana reuni Eri

Dharma Putra menambahkan, reuni yang pertama bagi angkatan 87 digelar di salah satu kediaman alumni Rizal Reza Harahap di Jln. Garu VI No. 15 Medan. Dengan tema Memori Putih Biru, maka kepada para alumni diwajibkan datang memakai baju warna putih dan celana, atau rok berwarna biru. “Ini bertujuan untuk mengingat masa-

masa sekolah di SMPN 7 Jalan Turi,” katanya diamini Sekretaris Nirwan Syafri Simanjuntak. Dia berharap kepada seluruh alumni 87 dapat hadir pada acara tersebut. Untuk informasi lengkap agar menghubungi Yuni Prihartini 085297215804, Nirwan Syafri 082164798240, Tato Regar 081263786571, Nasir 085275161243 dan Ajafery Sinaga 081397644051.(m27)

Alhamdulillah, yang menerima sudah mulai terangkat kehidupannya. Intinya saya harap mulai sekarang, kita bisa menjadikan zakat, infak, sedekah dan wakaf itu sebagai kebutuhan,” terangnya. Sementara Ketua Panitia Nuzulul Quran, Khozali Mar’i, menyampaikan terimakasih pada Gus Irawan Pasaribu, yang hadir memberikan tausiahnya. Jamaah juga mendoakan Gus, semoga sukses dengan tujuan yang ingin dicapai. “Semua masyarakat sudah tahu, Gus salah satu balon gubernur Sumut. Semoga berhasil dan Allah Swt meridhoi. Banyak pemimpin kita yang suul khatimah. Mudah-mudahan Gus bisa berbuat baik saat jadi pemimpin,” katanya. Dalam kesempatan itu, Gus bersama panitia menyerahkan santunan pada puluhan anak yatim, janda dan orang jompo, bilal mayit dan penjaga masjid. Mereka semua mendoakan agar Gus diberikan kekuatan oleh Allah Swt dalam perjuangan yang dilakukan menuju kursi Gubernur Sumut pada 2013.(m06)

Ramadhan Mulia

Qunut Nazilah Untuk Solidaritas Umat Islam Di Rohingya-miyanmar Oleh : H.M. Nasir, Lc, MA Ukhuwah Islamiyah kita di bulan suci Ramadan ini sedang diuji oleh Allah Swt, di mana ribuan umat Islam di Rohingya, salah satu wilayah yang padat dihuni oleh kaum muslimin di negara Miyanmar (dahulunya kerajaan Burma) telah mengalami pembantaian dan pengusiran besar-besaran dari kampung halaman mereka sendiri. Dengan alasan bahwa, pemerintahan Miyanmar tidak mengakui umat Islam Rohingya sebagai penduduk pribumi. Padahal jauh sebelum berdirinya Miyamnar kaum muslimin sudah lama bermukim turun temurun di sana. Sebenarnya bukan persoalan etnis, akan tetapi persoalan kedengkian orang-orang kafir terhadap keimanan yang dimiliki oleh orangorang Islam. Seandainya penguasa Miyanmar seakidah dengan penduduk Rohingya pasti mereka tidak akan berdendam dan melakukan pembantaian yang amat keji itu. Maha benar firman Allah Swt yang mengatakan: Mereka menyiksa orang-orang mukmin itu hanya karena (orang-orang mukmin itu) beriman kepada Allah Yang Maha perkasa dan Maha terpuji (QS. AlBuruuj: 8). Sedemikian buruknya doktrin yang ditanamkan dalam keyakinan mereka, bahwa orang-orang yang tidak satu keyakinan dengan mereka dianggap sebagai “domba-domba” yang dapat diperlakukan sesuka hati mereka, dibunuh, diperkosa, diusir, diambil harta benda mereka, bahkan dibumihanguskan di tanah tumpah darah mereka sendiri, begitulah nasib umat Islam minoritas. Sebaliknya, jika mereka (orang kafir) hidup di negeri mayoritas muslim, mereka dapat hidup dengan tenang, kaya raya, menumpuk harta dan membangun hotel-hotel pencakar langit, tanpa ada rasa dengki, iri hati sedikitpun dari umat Islam, karena doktrin yang ditanamkan ke dalam keyakinan umat Islam adalah “lakum diinukum waliyadiin (bagi kamu agamamu dan bagiku agamaku”. Walaupun sebutan untuk orang yang tidak seakidah/ seagama bagi umat Islam disebut kafirun, yang notabenenya masih dalam kategori manusia, tapi umat Islam tidak pernah menyebut mereka (orang kafir) sebagai “domba-domba” yang notabenenya memang bukan manusia, dan pada gilirannya mereka (orang kafir) memperlakukan mereka (umat Islam) seperti yang mereka (orang kafir) sebut (domba-domba). Oleh sebab itu, sesuai prinsip “rahmatan lil ‘alamiin” umat Islam di mana saja berada, ukhuwah Islamiyahnya tidak dibatasi oleh batas teritorial, perbedaan suku, warga negara, status sosial dan lain sebagainya. Semuanya melebar dalam satu bingkai persaudaraan akidah bagi sesama Islam, dan melebur dalam satu bingkai ukhuwah insaniah (persaudaraan sesama manusia) bagi mereka yang tidak menganut agama Islam. Tragedi yang menimpa umat Islam di Rohingya bukan hanya merupakan tragedi keagamaan, akan tetapi merupakan tragedi kemanusiaan yang menuntut kita untuk membuka mulut, kuping, mata, sesuai kapasitas dan propesi yang kita miliki, sekaligus mempraktekkan hikmah puasa yang sedang kita jalani. Di antaranya untuk meningkatkan kepedulian kemanusiaan dan kepeduliaan sosial. Ironisnya, di negeri yang mayoritas muslim ini, di bulan suci Ramadan ini, solidaritas terhadap umat Islam Rohingya yang sedang mengalami pengusiran dan pembantaian,

pemerkosaan, tidak maksimal dilakukan. Tindakan preventif yang dapat mengurangi jumlah jatuhnya korban tidak dilakukan secara optimal. Media-media televisi sibuk dengan acara hura-huranya, siraman-siraman rohani yang ditayangkan berkutat seputar lawaklawakan yang mematikan hati, sementara ibadah puasa yang sedang kita jalani katanya dapat membangun solidaritas, membangun kepeduliaan. Ukhuwah Islamiyah kita sedang diuji, ibadah puasa yang kita lakukan belum dapat diaplikasikan hikmahnya dalam konteks persaudaraan. Persaudaraan yang kita bangun baru sebatas tingkat buka bersama dengan pejabat, pengusaha, dan seterusnya. Dalam kondisi yang berjauhan antara kaum muslimin Rohingya dan muslimin Indonesia, kita masih dapat membantu mereka dengan “senjata iman” yang kita miliki, yaitu do’a, karena do’a merupakan “silahul mukmin (senjata orang-orang mukmin)”. Pada parohan terakhir bulan Ramadan ini dapat dititipkan do’a qunut nazilah pada raka’at terakhir shalat witir, sebagai solidaritas kita kepada muslimin Rohingya. Karena qunut nazilah dianjurkan untuk membacanya di saat sebagian kaum muslimin menghadapi bahaya, dan wabah peyakit, atau bahaya yang diakibatkan oleh adanya permusuhan orang kafir, dan do’a qunut nazilah boleh terus menerus dibacakan pada akhir raka’at shalat witir, atau shalat subuh sampai bencana itu berakhir. Rasul Saw pernah membaca qunut nazilah selama 1 bulan untuk pembunuh-pembunuh para sahabatnya di Bi’ral Ma’unah, sebagaimana diriwayatkan oleh Bukhari dan Muslim di dalam hadis shahihnya dan di dalam hadis riwayat Abu Hurairah, dia ada menyatakan: Sesungguhnya apabila ingin mendo’akan seseorang, Nabi Muhammad Saw membaca qunut sesudah ruku’ (HR. Bukhari dan Imam Ahmad bin Hambal). Dari qunut yang pernah dibaca oleh Nabi Muhammad Saw yang diriwayatkan oleh Ibnu Umar ra. yaitu: Allahummaghfirlil mukminin wal mukminat, wal muslimin wal muslimat, wa allif baina qulubihim, wa ashlih zaata bainahum wanshur hum ‘ala ‘aduwwika wa ‘aduwwihim, Allahummal ‘ankafarata ahlal kitab allazina yukazzibuna rasulaka, wa yuqatiluuna auliya ‘aka. Allahumma khalif baina kalimatihim, wazalzil aqdamahum, wa anzil bihim ba’sakallazi la yuraddu ‘an alqaumil mujrimin. Bismillahirrahmanirrahim inna nasta’inuka. Ya Allah ampunilah orang-orang beriman baik laki-laki maupun perempuan dan orangorang muslim baik laki-laki maupun perempuan, jinakkanlah hati mereka semuanya, perbaikilah keadaan mereka dan berilah pertolongan kepada mereka untuk melawan musuh-Mu dan musuh-musuh mereka.Ya Allah laknatlah orang-orang kafir ahlil kitab yang mendustai Rasul-Mu dan membunuh para wali-Mu. Ya Allah ceraiberaikanlah kesatuan kata mereka, dan goncangkanlah kekuatan mereka, dan turunkanlah bencana kepada mereka yang tidak mungkin dapat ditolak oleh orang-orang yang berdosa itu. Dengan nama Allah Yang Maha pengasih lagi Maha penyayang.Ya Allah kami minta tolong kepada-Mu. Wallahua’lam bil ash-shawab Penulis: Pimp. Pondok Pesantren Tahfiz Alquran Al Mukhlisin Batubara dan Wakil Sekretaris Dewan Fatwa Pengurus Besar Al Washliyah


B12

Ekonomi & Bisnis

Pengusaha Armada Berbenah Jelang Lebaran TAK terasa lebaran 1433 H tak lama lagi segera dijelang. Bagi sebagian besar orang tradisi mudik menjadi semacam kewajiban yang harus dilaksanakan saat menjelang lebaran sehingga kini mulai sibuk mempersiapkan rencana tahun ini. Mudik atau pulang kampung bukan suatu beban berat bagi yang kebetulan kampung halamannya bisa ditempuh dalam hitungan jam, namun bagi yang harus menempuh perjalanan seharian atau bahkan berhari-hari sangat dibutuhkan persiapan matang untuk melakukan pengecekan terhadap kondisi kendaraan yang akan di naiki untuk menuju kampung halaman. Maka dari itu, tak heran jika beberapa pengusaha armada bus di Medan mulai melakukan pembenahan terhadap kendaraan mereka. Hal ini tak lain dapat menyelamatkan para penumpang sampai ke tujuan. Acara mudik harus dipersiapkan benarbenar, terutama pada kondisi fisik kendaraan. Hal ini untuk menciptakan rasa aman dan nyaman selama perjalanan. Dan dapat pastikan jauh-jauh hari bahwa kendaraan yang akan dipakai sudah siap ‘tempur’. Hal ini seperti yang diakui Humas PT ALS Medan, Alwi Matondang, saat ditemui Waspada, Selasa (8/8). Dia mengatakan, beberapa kalangan pengusaha angkutan darat, awal Juli lalu sudah mulai melakukan pembenahan terhadap seluruh armadanya. Hal ini dilakukan sebagai bentuk persiapan guna menghadapi lonjakan penumpang lebaran pada Agustus mendatang. “PT ALS sejak sepekan yang lalu sudah mulai melakukan perbaikan armadanya. Meski masa lebaran masih lama. Kita mulai melakukan perbaikan mesin dan bodi kendaraan. Termasuk mempersiapkan unit armada tambahan, semua direnovasi agar layak jalan saat masa lebaran,” ujarnya. Ditambahkan Alwi, untuk mengantisipasi lonjakan penumpang saat lebaran nanti, PT ALS setidaknya telah menyiapkan 270 unit armada bus untuk semua jurusan. Sejauh ini menurutnya, pemesanan tiket jelang lebaran ke sejumlah daerah belum mengalami kenaikan. Suasana loket bus antarkota dan antarprovinsi masih terlihat sepi. Alwi memprediksi para pemudik bakal membanjiri terminal pada H-4 Lebaran. Mengenai kenaikan tarif angkutan yang sering terjadi saat lebaran, Alwi menuturkan, sampai saat ini pihaknya belum ada menaikkan harga. Menurutnya, soal kenaikan harga tarif yang menentukan adalah pihak Dirjen Perhubungan Darat. “Kenaikan tarif yang menentukan Dirjen Perhubungan Darat, jika nanti keputusan mereka naik, ya terpaksa harga juga kita naikkan. Sampai saat ini harga tiket masih normal, untuk tujuan Medan-Padang misalnya, harganya masih Rp165.000 dengan fasilitas AC dan toilet, dan untuk MedanJakarta harganya Rp425.000,” ungkapnya. Sementara itu, selain bus antar kota antar provinsi dan bus antar kota dalam provinsi persiapan yang matang jelang lebaran kali

WASPADA Kamis 9 Agustus 2012

Siap-siap Mudik LEBARAN sebenarnya masih cukup lama. Tapi setidaknya para pemudik sudah bersiap-siap mengantisipasi kepadatan lalu lintas menjelang hari

PT ALS sejak sepekan yang lalu sudah mulai melakukan perbaikan armadanya. Meski masa lebaran masih lama. Kita mulai melakukan perbaikan mesin dan bodi kendaraan. Termasuk mempersiapkan unit armada tambahan, semua direnovasi agar layak jalan saat masa lebaran. Alwi Matondang Humas PT ALS Medan ini juga dilakukan pada armada taksi dan bus dalam kota. Hal ini seperti yang dikatakan Koordinator Lapangan CV KUPJ TOUR Andre Tarigan, saat ditemui di Jalan SM Raja Medan. Menurut Andre, CV KUPJ TOUR memang sudah memulai perbaikan mesin dan bodi kendaraan, termasuk mempersiapkan unit armada tambahan untuk mengantisipasi lonjakan penumpang. Andre mengaku, pihaknya akan menurunkan 135 armada dengan tujuan Medan-TJ Balai dan Medan-Bagan Batu untuk lebaran nanti. Ditambahkannya, untuk mengutamakan keselamatan penumpang, semua armadanya saat ini sudah diperiksa baik-baik untuk kelayakan perjalanan. “CV KUPJ TOUR memiliki aturan sendiri, jika kendaraan tidak safety maka kita tidak akan merunkannya. Misalnya saja jika ada kerusakan pada bangku dan bagasi, maka kita tidak akan merunkannya,” ujarnya. Sejauh ini menurutnya, belum ada terjadi peningkatan penumpang, malah saat ini penumpang sepi. Tapi dirinya memprediksi lonjakan penumpang akan terjadi pada H-4 lebaran nanti. Mengenai harga tiket sendiri sejauh ini harganya masih normal dan belum ada kenaikan. Untuk tujuan Medan-TJ Balai berkisar Rp25.000, sedangkan Medan-Bagan Batu berkisar Rp60.000. Ditempat terpisah, belum melonjaknya pesanan tiket juga dirasakan di Loket PMTOH Jalan Gajah Mada Medan. Penjaga loket bus PMTOH, Nita, mengatakan pemesanan tiket jelang lebaran ke sejumlah daerah belum mengalami kenaikan. � Dio Utama Nasution

besar keagamaan itu. Bukan hanya itu, perusahaan yang menggelar kegiatan CSR (corporate social responsibility) dengan mudik malah jauh-jauh hari menyiapkannya. Untuk mudik dari Medan ke berbagai wilayah bisa ditempuh dengan banyak alternatif. Kalau dulu para pemudik hanya memanfaatkan jalur darat ke Sibolga dan Padangsidimpuan, pelan-pelan sudah mulai bergeser. Munculnya penerbangan membuat jalur mudik ke daerah tersebut pun bisa ditempuh dengan pesawat udara. Susi Air danWings Air adalah perusahaan penerbangan yang menempuh rute tersebut. Yang pasti jika memesan tempat dua atau tiga hari sebelum mudik sudah pasti habis. Itu sebabnya para pemudik jauh-jauh hari menyiapkan semuanya. Data di Kementerian Perhubungan menunjukkan tahun ini akan tetap terjadi peningkatan jumlah pemudik. Prediksi jumlah pemudik melalui angkutan jalan untuk tahun 2012 sebesar 5,5 juta penumpang, meningkat sekitar 1,3 persen dari 5,5 juta penumpang di tahun 2011. Untuk angkutan sungai dan penyeberangan danau meningkat sekitar 4,2 persen. Yaitu, dari 3,3 juta penumpang untuk 2012, dari 3,2 juta pada 2011. Sementara itu, untuk angkutan jasa Kereta Api, diperkirakan akan mengalami penurunan. Hal ini dikarenakan, Kementerian Perhubungan dan PT KAI akan mengawasi secara ketat pendistribusian dan penggunaan tiket agar hanya dapat

PARA calon penumpang mulai ramai memadati stasiun bus yang ada di Jl. SM Raja Medan, kemarin. dipergunakan oleh mereka yang membeli tiket. Untuk angkutan laut juga akan mengalami peningkatan 1,5 persen.Yaitu dari 1,4 juta jiwa di tahun 2011, menjadi 1,5 juta jiwa di 2012. Jumlah sepeda motor yang digunakan untuk perjalanan mudik diprediksi mencapai 2,51 juta unit dan mobil pribadi 1,52 juta unit atau masing-masing naik 6,16 persen dan 5,6 persen dibanding 2011. Kemudian, kendaraan umum terdiri atas 21.014 bus AKAP, 13.676 bus AKDP, dan 2.270 bus pariwisata. Sementara itu, untuk angkutan udara, menurut Kementerian Perhubungan, diperkirakan tahun ini akan meningkat sekitar 10 persen. Yaitu dari 2,9

juta penumpang, naik menjadi 3,2 juta penumpang. Semua angka prediksi itu berskala nasional. Sementara dari Dinas Perhubungan Pemko Medan pun memprediksi jumlah penumpang mudik lebaran 1433 H akan meningkat 10 persen dibanding tahun lalu. Ledakan penumpang, baik darat laut dan udara diperkirkan terjadi mulai H-2 lebaran. Mulai 11-27 Agustus 2012, di Terminal Amplas warga yang akan berangkat menjalani arus mudik sebanyak 450.887 orang, dan di Terminal Pinang Baris 88.511 orang. Sedang penumpang yang tiba di Medan pada periode yang sama di Terminal Amplas warga 465.211 orang dan Terminal P.Baris 74.536

orang. Jadi aka nada 10 persen kenaikan dibandingkan tahun lalu yang mencapai 990.132 orang. Untuk kesiapan armada angkutan yang mengangkut pemudik selama arus mudik ini menyebutkan 770 armada angkutan penumpang antar kota antar propinsi (AKAP) telah disiapkan. Tahun ini disiapkan 770 bus AKAP, 450 unit di Amplas, 230 di Pinang Baris. Total kursinya 11.560, dimana 7.650 di Terminal Amplas dan 3.910 di terminal Pinang Baris. Sedangkan, untuk angkutan dalam provinsi (AKDP) disiapkan 950 kendaraan perhari di terminal amplas dengan jumlah bangku keseluruhannya 19.000

Waspada/Armin Nasution

perhari dan di terminal Pinang Baris 450 kendaraan perhari dengan jumlah bangku 9.000 per hari. Begitu pun pemudik harus tetap berhati-hati karena dari 38.500 km jalan nasional, memang ada beberapa titik yang masih dalam pekerjaan perbaikan dan pemeliharaan, khususnya di sejumlah titik di jalan Pantai Utara (Pantura) Jawa dan jalan nasional di lintas Sumatera. Untuk jalur Sumatera, beberapa titik dianggap rawan longsor seperti di Sumatera Utara 10 titik, Bengkulu dua titik, Sumatera Selatan 4 titik dan Jambi tiga titik dan Lampung empat titik. � Armin Nasution

Semakin Lama Semakin Murah

Waspada/Hamzah

Manager TIKI Medan Hadi memperhatikan pekerja TIKI mulai pengepakan barang untuk dikirim ke luar kota seperti Jakarta, Pekanbaru, Padang, Palembang, dan beberapa kota besar lainnya.

Rendang Paling Banyak Dipaketkan SEPERTINYA pengiriman barang melalui Titipan Kilat (Tiki) di Medan mengalami peningkatan sejak awal Ramadhan. Kenaikan tersebut mencapai 25 s/d 35 persen dari hari-hari biasanya. “Benar peningkatan volume pengiriman sudah sejak awal Ramadhan persentase kenaikannya lumayan, bahkan sepekan menjelang lebaran hampir 35 persen,” ujar Manager TIKI Medan Hadi yang disapa Popo. Dia menjelaskan, sejak awal Ramadhan angka peningkatan berkisar antara 10 hingga 15 persen. Tetapi begitu sepeluh hari menjelang Lebaran peningkatannya mencapai 35 persen. Lonjakan pengiriman melalui Tiki baik berupa barang maupun dokumen. “Pekan terakhir ini barang yang dikirim kebanyakan semacam parcel berupa makanan seperti makanan khas Medan berupa rendang, pakaian dan jenis barang lainnya untuk kebutuhan lebaran,” katanya. Dijelaskan, kepercayaan masyarakat khususnya para konsumen semakin tinggi terhadap layanan yang diberikan Tiki, hal itu terbukti dengan jumlah pelanggan yang dari tahun ke tahun semakin meningkat. Berbagai jenis barang dapat dikirimkan kecuali barang-barang yang dilarang. Dalam hal ini Tiki tetap selektif dalam menerima barang yaitu tidak mengirim barang yang melanggar hukum seperti berbahaya bagi kesehatan dan keselamatan penerima. Sedangkan tarif pengiriman masih tetap tarif biasa. Semua daftar harga dengan daerah tujuan masing-masing semua sudah terdaftar dan bsia diakses oleh calon konsumen melalui web Tiki. “Jadi meskipun menjelang Lebarang volume pengiriman melonjak, kami tidak memanfaatkan moment itu dengan cara menaikkan tarif. Lantaran itu relasi semakin mempercayai pengiriman barang lewat Tiki disamping lebih nyaman, aman dan murah,” bebernya. Sedangkan untuk tarif, kata dia, itu tergantung daerah tujuan dan nilainya dihitung sesuai dengan berat barang yang dikirim. Pengiriman domestik dibayar dengan uang

rupiah, sedangkan luar negeri tergantung mata uang negara bersangkutan. “Kecuali jika BBM naik, maka biaya pengiriman juga mengalami peningkatan sesuai dengan harga transportasi,” ujarnya. Ditambahkannya, Tiki senantiasa memberikan pelayanan secara optimal dan layanan dibuka dari pk.08.00 hingga pk.21.00. Sedangkan beberapa layanan untuk mengirim barang hingga ke tujuan yaitu jenis spesial service (SS) atau paket khusus, overnaice service (ONS), holiday atau pengiriman khusus pada hari libur dan pengiriman reguler. Khusus untuk barang elektronik seperti laptop, hendpone dan barang elektronik lainnya, kata dia, diasuransi yang nilai asuransi disesuaikan dengan nilai barang. “Kalau untuk barang berharga harus diasuransikan sesuai dengan nilai barang, sebagai jaminan pelayanan bagi mereka yang mengirim barang melalui Tiki,” jelasanya Namun Popo mengakui terkadang yang menjadi kendala di dalam pengiriman barang adalah telatnya barang yang datang dari Jakarta sehingga tidak sedikit pelanggan datang langsung ke kantor TIKI untuk mengambil pesanannya. “Ya mereka terkadang tidak sabar menunggunya di rumah, akan tetapi kebanyakan dari mereka juga khawatir ketika pengiriman barang datang mereka tidak berada di rumah,” ujar Popo kembali. Untuk biaya pengiriman barang, lanjutnya, ke Jakarta TIKI menetapkan sekitar Rp16.500 per kilogram dalam untuk wilayah Timur, hal ini cukup mahal dan pihak TIKI juga tidak berani berjanji kapan waktu sampai barang tersebut. “Ya terkadang pengiriman lewat kapal yang datang ke sana, jika kapal datangnya dua hari sekali maka sampai barang disana sudah berhari-hari,” ujarnya kembali. Akan tetapi setelah melewati hari-hari besar keagamaan, lanjutnya, pengiriman barang kembali normal. � Hamzah

LEBARAN memang masih beberapa hari lagi. Namun, tempat persewaan mobil sepertinya sudah mulai diincar sejumlah masyarakat untuk melakukan mudik. Namun tidaksedikit pemesanan mobil tersebut akan dipakai mencari sarana rekreasi liburan. Joni, salah seorang pengusaha rental mobil di Medan tepatnya di Lapangan Merdeka, menyatakan puncak pemakaian mobil diprediksi mulai H1 hingga H+7 setelah lebaran. “Namun untuk pemesanan akan dilakukan seminggu sebelum pemakaian,” ujarnya. “Untuk Lapangan Merdeka jumlah mobil yang dirental dengan berbagai merek dan jenis sekitar 30 unit, namun menjelang lebaran biasanya sudah banyak dipesan,” lanjutnya. Pemesanan, terangnya, akan terus berlangsung mulai H-8 hingga stok yang ada di Lapangan Merdeka akan habis dan ini juga terjadi pada di sejumlah ruas jalan yang menjajakan mobil rental lainnya. “Untuk harga sewa mobil seperti Inova per harinya, penyewa akan dikenakan Rp500 ribu dalam kota termasuk minyak dan supir,” ujarnya. Namun untuk luar kota, lanjutnya, penyewa akan dikenakan biaya sekitar Rp800 ribu per hari tidak dengan pemakaian minyak. “Namun jika lebih dari tiga hari maka harga dapat dikurangi menjadi Rp700 ribu per hari, dan seandainya pemakaian lebih dari satu minggu harga dapat dipotong menjadi Rp600 ribu per hari,” ujarnya kembali. Mengapa perbedaan sewa begitu tinggi, lanjutnya, dikarenakan supir ataupun pemilik mobil tidak ingin dirugikan dari penyewaan yang cepat, mengingat kebutuhan sejumlah pelanggan ada yang memakainya dengan waktu yang cukup lama. “Ya sepertinya tidak fair jika sebelah kita disewa dengan waktu yang lama sekitar satu minggu dengan yang tiga hari kalau harga sewa sama. Sementara, setelah pemakaian mobil yang disewa relatif sebentar tidak ada penyewanya kembali,” ujarnya. Bayangkan, lanjutnya, jika sewa mobil dilakukan tiga hari

Seorang pengusaha rental sedang melihat kondisi mobil yang terpajang di Lapangan Merdeka, Medan.

Namun jika lebih dari tiga hari maka harga dapat dikurangi menjadi Rp700 ribu per hari, dan seandainya pemakaian lebih dari satu minggu harga dapat dipotong menjadi Rp600 ribu per hari. Joni Pengusaha rental mobil dengan harga Rp600 ribu maka kita hanya dapat setoran sekitar Rp1,8 juta, sedangkan yang tujuh hari akan mendapatkan Rp4,2 juta. “Agar menghindari perbedaan yang cukup tinggi, kita memasok patokan harga Rp800 ribu per hari sehingga kita mendapat Rp2,4 juta,” ujarnya kembali. “Sedangkan untuk lepas kunci kita hanya mematok harga Rp350 ribu pada hari biasa, dan hari besar keagamaan seki-

tar Rp500 ribu s/d Rp600 ribu, biasanya langsung berhubungan dengan toke atau pemilik mobil sendiri,” lanjutnya. Adapun persyaratannya, terangnya, selain fotocopy KTP juga rumah penyewa akan dipantau terlebih dahulu dan beberapa syarat lainnya. “Ya selain untuk keselamatan terhadap pemilik mobil juga penyewa sendiri,” terangnya. Karim Sitorus, seorang pengusaha rental mobil juga

menyatakan biasanya hari-hari besar keagamaan seperti Idul Fitri merupakan panen tahunan yang didapatkan oleh pemilik mobil dan supir. “Walaupun terkadang supir ataupun pemilik mobil juga menarik pada hari-hari biasa, namun untuk menjelang Lebaran ini adalah paling banyak diminati oleh orang yang akan melakukan pulang kampong atau mudik,” ujarnya. “Mobil-mobil yang kita sewakan selain Innova, ada Avanza dan Isuzu Elf yang merupakan bus mini yang mampu mengangkut sekitar 11 s/d 15 orang dan biasanya merekamereka yang hendak melakukan liburan,” ujarnya. Untuk jenis Isuzu Elf sendiri, terangnya, sewa mobil sekitar Rp700 ribu pada hari biasa dan menjelang Lebaran sekitar Rp1 juta per hari. “Dapat dikatakan Medan sepertinya sangat potensial

Waspada/Hamzah

untuk bisnis persewaan mobil, dilihat dari angka pertumbuhan persewaan setiap tahunnya juga mengalami pertumbuhan yang cukup tinggi,” ujarnya. Namun yang perlu diperhatikan bagi pemilik mobil ataupun pemilik sekaligus supir adalah keselamatan atas dirinya terhadap penyewa-penyewa yang tidak bertanggungjawab. “Terkadang kita harus mengetahui dan kenal betul terhadap penyewa mobil kita, mengingat hal ini akan menjadi boomerang bagi pemilik ataupun supir,” ujarnya. “Tidak sedikit teman-teman kita yang mengalami tindakan kekerasan, kehilangan mobil, mobil yang dipakai rental untuk membawa barang-barang haram dan lainnya. Untuk itu kita harus benar-benar menjaga keamanan kita dan mobil,” lanjutnya kembali. � Hamzah


Waspada, kamis 9 Agustus 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you