Page 1

Harga Eceran Rp3.000,-

Awal Ramadhan Beda SURABAYA (Waspada): Muhammadiyah diprediksi akan berbeda dengan pemerintah dalam penentuan awal Ramadhan 1435 Hijriah. Muhammadiyah memastikan pada 27 Juni malam sudah shalat tarawih dan esok harinya puasa perdana. Sekretaris Pengurus Wilayah Muhammadiyah (PWM) Jawa Timur Nadjib Hamid mengatakan, puasa dimulai mulai Sabtu 28 Juni. “Penentuan itu berdasarkan hisab hakiki dengan kriteria wujudul hilal,” kata Nadjib, Rabu (11/6). Lanjut ke hal A2 kol. 1

Demi Kebenaran Dan Keadilan

WASPADA Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

KAMIS, Pahing, 12 Juni 2014/14 Sya’ban 1435 H

No: 24608 Tahun Ke-68 Terbit 24 Halaman

Pelunasan BPIH 9 Juli JAKARTA (Antara): Kementerian Agama melalui Direktorat Penyelenggaraan Haji dan Umrah (PHU) telah mengumumkan daftar calon jamaah haji yang berhak melunasi Biaya Penyelenggaraan Ibadah Haji (BPIH) 1435H/ 2014M. Untuk itu masyarakat yang masuk dalam daftar lunas bisa segera mempersiapkan diri untuk melakukan pelunasan karena masa pelunasan BPIH regular 1435 H/2014 M dimulai sejak Rabu, 11 Juni sampai Rabu 9 Juli 2014. Lanjut ke hal A2 kol. 2

Waspada/Surya Efendi

PRABOWO DI MEDAN: Capres nomor urut 1, Prabowo Subianto menyalami ribuan pendukungnya yang memadati gedung Serba Guna Pemprovsu Jl. Pancing Medan, Rabu (11/6).

Giliran Prabowo Meriah MEDAN (Waspada): Kampanye dialogis calon presiden (Capres) nomor urut 1 Prabowo Subianto di Medan, Rabu (11/6) disambut meriah. Semangat nasionalisme ribuan orang yang memenuhi Gedung Serbaguna Jl. Pancing berkobar, saat Prabowo, menyampaikan orasi politiknya. ‘’Kami (Prabowo – Hatta) hanya ingin menjadikan rakyat Indonesia terhormat. Saya tahu, rakyat hanya ingin bekerja dengan terhormat. Rakyat tidak ingin minta-minta. Tidak banyak permintaan rakyat. Masak itu juga tidak boleh,’’ kata Prabowo, yang disambut massa dengan teriakan dan gemuruh tepuk tangan. Capres Prabowo Subianto, hadir di Gedung Serbaguna, terlambat dari jadwal yang ditentukan. Perjalanannya ke daerah ini terhambat oleh banyaknya kegiatan kampanye di daerah lain di Indonesia.Rombongan Prabowo, baru tiba di tempat acara lewat pukul 13:00, dari jadwal pukul 10:00. Namun, massa tetap bertahan. Lanjut ke hal A2 kol. 3

Brazil Siap Lahir Bathin

Waspada/Surya Efendi

SEKRETARIS Dirjen Pemerintahan Umum Kemendagri Muhammad Rum didampingi Sekda Provsu Nurdin Lubis menyematkan tanada peserta kepada Camat Medan Labuhan Zain Noval pada pembukaan Pemantapan Keseragaman Aparat Kecamatan Di Provinsi Sumatera Utara Dalam Upaya Meningkatkan Pelayanan Pemerintahan Tahun 2014 di Hotel Madani Medan, Rabu (11/6) malam.

Dalam kesempatan itu, Nurdin Lubis mengatakan sebelum berlangsungnya pesta pemilihan Presiden danWakil Presiden 9 Juli, Pemprovsu akan mengumpulkan para Camat, Danramil, Kapolsek se Sumatera Utara untuk berkoordinasi memantapkan kekondusifan daerah masing-masing.

SAO PAULO (Waspada): Presiden Dilma Rousseff, Selasa (Rabu WIB) mengklaim, Brazil siap lahir dan bathin menggelar Piala Dunia 2014, yang dimulai dinihari nanti dengan partai perdana Selecao kontra Kroasia. “Brazil telah melewati rintangan utama dan siap lahir bathin, baik di dalam maupun luar lapangan untuk Piala Dunia,” tegas Dilma melalui siaran stasiun televisi nasional, sebagaimana dilansir AFP, Rabu (11/6). “Para pesimistis telah ditumbangkan oleh kerja keras dan tekad rakyat Brazil yang pantang menyerah,” ujarnya lagi, seraya menambahkan Piala Dunia akan meninggalkan warisan infrastruktur berkelanjutan. Wanita kelahiran 14 Desember 1947 di Belo Horizonte itu juga menepis banyaknya kritik tentang berbagai penundaan

Lanjut ke hal A2 kol. 4

Lanjut ke hal A2 kol. 7

Peran Camat Sejukkan Pilpres MEDAN (Waspada): Sekda Provsu H. Nurdin Lubis mengatakan peran kecamatan sangat diperlukan untuk menyejukkan suasa Pemilihan Presiden (Pilpres) 9 Juli mendatang. Suasana kondusif di masing-masing daerah harus kita jaga, terutama saat suhu politik tinggi menjelang Pilpres ini,kata Nurdin Lubis pada pembukaan Pemantapan Keseragaman

Aparat Kecamatan Di Provinsi Sumatera Utara Dalam Upaya Meningkatkan Pelayanan Pemerintahan Tahun 2014. Acara yang digelar di Hotel Madani Medan, Rabu (11/6) malam dihadiri Sekretaris Dirjen Pemerintahan Umum Kementerian Dalam Negeri, Muhammad Rum, sejumlah pejabat Pemprovsu, para Camat seSumatera Utara dan undangan.


KAMPANYE PEMILU ADIL: Warga Solo mengenakan topeng capres-cawapres sambil membawa pernik Piala Dunia 2014 berkampanye kreatif di Kawasan Olahraga Manahan, Solo, Jawa Tengah, Rabu (11/6). Mereka mengimbau agar slogan “Fair Play” (pertandingan yang adil) dalam sepak bola juga dapat menginspirasi proses Pemilihan Presiden dan Wakil Presiden 2014 dilaksanakan dengan adil dan jujur.

JK: “Saya Tak Menyerang Prabowo” JAKARTA (Antara): Calon wakil presiden M Jusuf Kalla membantah dirinya menyerang capres Prabowo Subianto saat debat capres/cawapres dengan pertanyaan mengenai hak azasi manusia (HAM). “Saya tidak menyerang (Capres Prabowo), saya hanya mengembalikan pernyataan yang disampaikan mereka (Prabowo-Hatta). Saya bertanya

penegakan HAM secara umum,” kata cawapres M Jusuf Kalla di Makassar, Sulawesi Selatan, Rabu (11/6). Pernyataan tersebut disampaikan Jusuf Kalla usai melakukan kampanye terbuka di lapangan Karebosi, Makassar. Dalam debat capres pada 9 Juni, Jusuf Kalla mempertanyakan soal pelanggaran HAM kepada capres Prabowo Su-

bianto. “Saya hanya bertanya secara umum. Prabowo menjawab mengenai dirinya, itu jawaban dia sendiri. Jadi terserah masyarakat menilainya,” kata Jusuf Kalla. Dia mengatakan hanya bertanya mengenai cara menyelesaikan persoalan HAM masa lalu dan mendatang. Lanjut ke hal A2 kol. 5

Sumut Rawan Cyber Crime

DPT Pilpres Sumut 9.902.948 Orang

MEDAN (Waspada): Provinsi Sumatera Utara merupakan salah satu wilayah yang memiliki kerawanan tinggi bagi operandi pelaku maupun jaringan cyber crime (kejahatan dunia maya) berskala nasional, bahkan internasional. Demikian salah satu kesimpulan Forum Dialog Antisipasi Kejahatan Dunia Maya Guna Memantapkan Keamanan dan Ketertiban Masyarakat dalam rangka Ketahanan Nasional, di Hotel Garuda Plaza Medan, Rabu (11/6). Forum ini digelar Lemhan-

MEDAN (Waspada): Komisioner Pemilihan Umum (KPU) Sumatera Utara dalam rapat pleno, Rabu (11/6) di Aula Perintis Kemerdekaan menetapkan Daftar Pemilih Tetap (DPT) Pemilihan Presiden (Pilpres) Sumut sebanyak 9.902.948 orang. Pleno dihadiri Ketua KPU Sumut Mulia Banurea, komisioner Yulhasni, Evi Novida Ginting, Nazir Salim Manik dan komisioner Badan Pengawas Pemilihan Umum (Bawaslu) Sumut Aulia Andri.Hadir beberapa utusan, tim kampanye Capres- Cawapres serta KPU

nas RI bekerjasama dengan Dinas Kominfo Sumut dibuka Deputi Pengkajian Strategik Lemhannas Ir Irjen Pol Boy Salamuddin dan paparan kunci Ir Kurdinanto Sarah MSc, Tenaga Ahli Pengkaji Bidang Iptek Lemhannas RI. Tampil narsumber Kadis Kominfo Sumut Drs Jumsadi Damanik SH, MHum, Dekan Fakultas Ilmu Komputer dan Teknologi Informasi USU Prof DR M Zarlis MSc, Dir Reskrimsus Poldasu Kombes Lanjut ke hal A2 kol. 5


PELATIH Brazil Luis Felipe Scolari sudah sebulan menggenjot Neymar (kanan) dan kawan-kawan untuk merebut trofi keenam Piala Dunia di negeri sendiri.

Mereka Yang Selalu Merepotkan Pertahanan

Al Bayan

Sifat Shiddiq Sifat para rasul ada empat, hendaknya kita semua ingat Pertama Siddiq, dua amanah, ketiga tablig, empat fathanah Wahai saudaraku umat Muhammad Tirulah para rasul dalam memimpin umat (Madah: Abu Muhammad Zakwan Al-Asyi)

Lanjut ke hal A2 kol. 2 Waspada Daily


Pedro Rodriguez

Pedro Rodriguez Nama: Pedro Rodriguez Tgl lahir : 28 Juli 1987 Kota lahir : Santa Cruz de Tenerife Klub : Barcelona Main di PD : 1 kali Tampil : 5 kali, 0 gol

BANYAK atribut yang mereka peroleh, tetapi satu hal adalah Spanyol kekurangan pencetak gol alami. Banyak orang yang mengatakan bahwa, sepuluh pemain yang diturunkan Spanyol ke lapangan semua mampu mencetak gol. Untuk memiliki Lanjut ke hal A2 kol 7

-1 Hari “Saya pikir kita semua yang bermain di Eropa sudah penuh dengan kritik Kita harus menerima semua bentuk kritik.” Giovani dos Santos

“Kami selalu menghadapi tekanan karena kami memiliki para pemain yang terbaik di dunia “

Oleh Tgk. H. Ameer Hamzah

NABI Muhammad SAW dan para nabi sebelumnya dianugerahkan Allah empat sifat yang sangat terpuji, yakni Ashshiddiq (Benar), Amanah (Kejujuran), Attabligh (Penyampaian), Alfathanah (Kecerdasan). Sifat-sifat ini mutlak bagi para Nabi, dan tidak mutlak untuk manusia biasa (umat). Ash-Shiddiq (Benar) sebagai modal utama para rasul. Benar ucapan dan perbuatannya, tidak pernah berdusta.

Road To Brazil

Giovani dos Santos

Giovani Nama : Giovani dos Santos Remirez Tgl lahir : 11 Mei 1989 Kota lahir : Monterrey Klub : Villareal Main di PD : 1 kali Tampil : 4 kali, 0 gol

GIOVANI dos Santos membeberkan kepada Miguel Herrera tentang bakat sepakbola dan keturunan pejuang para pemain Mexico, tetapi dia tidak bisa mengikut sistem pelatih baru tersebut, maka itu adalah masalah lain. Giovani telah mengantongi Lanjut ke hal A2 kol 7

kabupaten/kota se-Sumut. Khusus DPT Pilpres dari Nias Selatan (Nisel) disampaikan oleh komisioner KPU Sumut Evi Novida Ginting atas nama KPU Sumut yang mengambil alih sementara KPU Nisel , karena 4 komisionernya dipecat oleh Dewan Kehormatan Penyelenggara Pemilu (DKPP) baru-baru ini, sehingga hanya tinggal seorang komisioner saja. Jumlah DPT pada Pemilu Presiden 2014 bertambah 166.201 pemilih dibanding DPT Lanjut ke hal A2 kol. 1

Ada-ada Saja Tubuh Ditutupi 33 Kg Serangga SEORANG pria asal China diselimuti 326 ribu lebah. Gao Bingguo, seorang peternak lebah berusia 54 tahun dari Provinsi Shandong, telah menjadi peternak selama 34 tahun. Gao yang merasa sudah Lanjut ke hal A2 kol. 4

Serampang - Kalah di iklan - He...he...he...

Harga Eceran Rp 3.000

Prabowo Janji Laksanakan Butir MoU Helsinki BANDA ACEH (Waspada): Calon Presiden Republik Indonesia Prabowo Subianto saat kampanye di hadapan masyarakat Aceh menyatakan komitmennya untuk tetap mematuhi hasil perjanjian MoU Helsinki dan UUPA. “Saya akan komit dengan perjanjian MoU Helsinki dan UUPA. Kita akan laksanakan isi dari MoU Helsinki dan UUPA,” kata Prabowo. Lanjut ke hal A2 kol 5

Demi Kebenaran Dan Keadilan

WASPADA Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

KAMIS, Pahing, 12 Juni 2014/14 Sha’ban 1435 H

Masyarakat Aceh Jangan Mudah Terprovokasi JAKARTA (Antara): Masyarakat Aceh tidak terprovokasi oleh tindakan kekerasan yang dilakukan oleh pihak yang tidak bertanggung jawab yang terjadi akhir-akhir ini di wilayah Aceh. “Kita juga mengimbau pada masyarakat Aceh agar mereka tidak mudah terprovokasi, diiming-imingi oleh kekuatan politik tertentu sehingga melakukan tindakanLanjut ke hal A2 kol 2

No: 24608 * Tahun Ke-68 Terbit 24 Halaman

Waspada/Surya Efendi

PRABOWO DI MEDAN: Capres nomor urut 1, Prabowo Subianto menyalami ribuan pendukungnya yang memadati gedung Serba Guna Pemprovsu Jl. Pancing Medan, Rabu (11/6).

Giliran Prabowo Meriah Diprediksi Awal Ramadhan Berbeda, Lebaran Sama SURABAYA (Waspada): Ormas Islam Muhammadiyah diprediksi akan berbeda dengan pemerintah dalam penentuan awal Ramadhan 1435 Hijriah. Muhammadiyah memastikan pada 27 Juni malam sudah shalat tarawih dan esok harinya puasa perdana. Sekretaris Pengurus Wilayah Muhammadiyah (PWM)

Jawa Timur Nadjib Hamid mengatakan, puasa dimulai mulai Sabtu 28 Juni. “Penentuan itu berdasarkan hisab hakiki dengan kriteria wujudul hilal,” kata Nadjib, Rabu (11/6). Ia menjelaskan, ijtimak jelang Ramadhan terjadi pada Jumat 27 Juni pukul 15.10 WIB. Saat matahari terbenam, hilal

sudah berwujud (terlihat) dengan ketinggian 31 menit 17 detik. Dengan begitu, pada malam harinya Muhammadiyah sudah melakukan shalat tarawih. “Karena hilal kurang dari 2 derajat, maka dipastikan tidak bareng dengan Lanjut ke hal A2 kol 6

MEDAN (Waspada): Calon presiden Prabowo Subianto menegaskan sikapnya tidak pernah gentar menghadapi kelompok “perampok” uang negara yang menyebabkan perekonomian Indonesia terpuruk. “Hai kalian yang ingin Indonesia miskin, yang ingin mencuri uang rakyat, saya tidak gentar sama kalian,” katanya dalam kampanye dialogis untuk Indonesia Bangkit bersama Prabowo Subianto di Gedung Serba Guna Medan, Rabu (11/6). Selain itu, Prabowo mengisyaratakan siap melawan kelompok-kelompok yang ingin “menjual” berbagai keka-

yaan bangsa Indonesia ke nagara lain. “Hai kalian antek-antek bangsa asing, yang bisanya memfitnah tetapi tidak pernah membela dan memikirkan rakyat. Orang Betawi bilang, ente jual, ane beli,” katanya. Sebagai mantan prajurit, Prabowo Subianto menegaskan jika keikutsertaannya Lanjut ke hal A2 kol 3

Seniman Musik Dukung Revolusi Mental Jokowi-JK JAKARTA (Antara): Sejumlah seniman musik dan tokoh publik tergabung dalam Komunitas Revolusi Harmoni menyatakan dukungan terhadap pasangan Joko Widodo dan Jusuf Kalla pada Pemilihan Presiden (Pilpres) 2014. “Revolusi Harmoni ini isinya kelompok seniman dan tokoh publik yang berharap

melakukan pelunasan karena masa pelunasan BPIH reguler 1435H/2014M dimulai sejak hari ini, 11 Juni – 9 Juli 2014. Besarnya BPIH tergantung dari embarkasi calon jamaah haji,” kata Dirjen PHU Abdul Djamil, Rabu (11/6). Menurut Djamil, pengumuman daftar calon haji yang berhak melunasi BPIH dilakukan secara terbuka, dan bisa diakses pada website resm i Ke m e n t e r i a n A g a m a sehingga masyarakat luas bisa dengan mudah dan mengetahui siapa saja yang berhak

PANTONLABU (Waspada): Toko emas Widuri di Jl. Teungku Chik Di Tiro, Pantonlabu, Kec. Tanah Jambo Aye, Aceh Utara, terbakar, Rabu (11/6) sore. Dalamperistiwa itu, seorang balita tewas terpanggang. Ayah ibunya beserta seorang pekerja kritis. Sementara dua pengendara kereta luka berat akibat tertabrak mobil pemadam kebakaran yang hendak memadamkan api kebakaran itu. In fo r m asi d i h i mp u n Waspada, balita meninggal bernama Syibral Malasyi,

Lanjut ke hal A2 kol 7

Sumut. Khusus DPT Pilpres dari Nias Selatan (Nisel) disampaikan oleh komisioner KPU Sumut Evi Novida Ginting atas nama KPU Sumut yang mengambil alih sementara KPU Nisel , karena 4 komisionernya dipecat oleh Dewan Kehormatan Penyelenggara Pemilu (DKPP) baru-baru ini, sehingga hanya tinggal seorang komisioner saja. Jumlah DPT pada Pemilu Presiden 2014 bertambah 166.201 pemilih dibanding DPT Pemilu Legislatif 2014 Lanjut ke hal A2 kol 6


PELATIH Brazil Luis Felipe Scolari sudah sebulan menggenjot Neymar (kanan) dan kawan-kawan untuk merebut trofi keenam Piala Dunia di negeri sendiri.

Brazil Siap Lahir Bathin SAU PAULO (Waspada): Presiden Dilma Rousseff, Selasa (Rabu WIB) mengklaim, Brazil siap lahir dan bathin menggelar Piala Dunia 2014, yang dimulai dinihari nanti dengan partai perdana Selecao kontra Kroasia. “Brazil telah melewati rintangan utama dan siap lahir bathin, baik di dalam maupun luar lapangan untuk Piala Dunia,” tegas Dilma melalui siaran stasiun televisi nasional, sebagaimana dilansir AFP, Rabu (11/6). “Para pesimistis telah ditumbangkan oleh kerja keras dan tekad rakyat Brazil yang pantang menyerah,” ujarnya lagi, seraya menambahkan Piala Dunia akan mening-

Mereka Yang Selalu Merepotkan Pertahanan

Al Bayan

Sifat Shiddiq Sifat para rasul ada empat, hendaknya kita semua ingat Pertama Siddiq, dua amanah, ketiga tablig, empat fathanah Wahai saudaraku umat Muhammad Tirulah para rasul dalam memimpin umat (Madah: Abu Muhammad Zakwan Al-Asyi)

Lanjut ke hal A2 kol 2 Waspada Daily


galkan warisan infrastruktur berkelanjutan. Wanita kelahiran 14 Desember 1947 di Belo Horizonte itu juga menepis banyaknya kritik tentang berbagai penundaan pembangunan stadion, pemborosan anggaran dan kekacauan selama masa persiapan. Kendati mengakui cukup sulit menyelenggarakan turnamen akbar tersebut, Dilma bersikeras 12 stadion telah siap. Dia juga meyakinkan para pelancong luar negeri bahwa Brazil akan menyambut mereka dengan tangan terbuka. Lanjut ke hal A2 kol 1

Road To Brazil

Pedro Rodriguez

Pedro Rodriguez Nama: Pedro Rodriguez Tgl lahir : 28 Juli 1987 Kota lahir : Santa Cruz de Tenerife Klub : Barcelona Main di PD : 1 kali Tampil : 5 kali, 0 gol

BANYAK atribut yang mereka peroleh, tetapi satu hal adalah Spanyol kekurangan pencetak gol alami. Banyak orang yang mengatakan bahwa, sepuluh pemain yang diturunkan Spanyol ke lapangan semua mampu mencetak gol. Untuk memiliki Lanjut ke hal A2 kol 1

BINJAI (Waspada): Diduga akibat mengonsumsi minuman keras (miras) oplosan, dua warga Kec. Selesai, Kab. Langkat tewas, sedangkan satu orang lainnya kritis. Informasi diperoleh Waspada di rumah duka, Rabu (11/6), korban tewas Selasa malam yakni Aryono Sitepu, 40, dan Rajin Sitepu, 32, keduanya warga Desa Tanjung Merahe, Kec. Selesai dan korban kritis Sugiono, 38, adik kandung korban Aryono. Menurut salah seorang warga Budiman didampingi

-1 Hari

Giovani dos Santos

Giovani Nama : Giovani dos Santos Remirez Tgl lahir : 11 Mei 1989 Kota lahir : Monterrey Klub : Villareal Main di PD : 1 kali Tampil : 4 kali, 0 gol

berusia 4 tahun. Sementara ayah-ibunya bernama Mawardi, 32, dan Nurjannah alias Mala, 28. Sedangkan pekerjanya bernama Khaidir, 25. Dua pengendara kereta yang tertabrak mobil pemadam kebakaran, suami istri, Raju Nirwanto, 28, dan Faridah, 22, penduduk Meunasah Panton, Kec. Tanah Jambo Aye. “Api sangat besar terlihat di dekat etalase emas. Tapi saya tak tahu sumbernya dari mana. Yang jelas, begitu saya Lanjut ke hal A2 kol 7

Tenggak Miras 2 Tewas 1 Kritis

“Saya pikir kita semua yang bermain di Eropa sudah penuh dengan kritik Kita harus menerima semua bentuk kritik.” Giovani dos Santos

“Kami selalu menghadapi tekanan karena kami memiliki para pemain yang terbaik di dunia “

Oleh: H. Ameer Hamzah

NABI Muhammad SAW dan para nabi sebelumnya dianugerahkan Allah empat sifat yang sangat terpuji, yakni Ashshiddiq (Benar), Amanah (Kejujuran), Attabligh (Penyampaian), Alfathanah (Kecerdasan). Sifat-sifat ini mutlak bagi para Nabi, dan tidak mutlak untuk manusia biasa (umat).

Lanjut ke hal A2 kol 6

Balita Tewas Terpanggang, Ayah-Ibunya Kritis

DPT Pilpres Sumut 9.902.948 Orang, TPS 27.378 Unit MEDAN (Waspada): Komisioner Pemilihan Umum (KPU) Sumatera Utara dalam rapat pleno, Rabu (11/6) di Aula Perintis Kemerdekaan menetapkan Daftar Pemilih Tetap (DPT) Pemilihan Presiden (Pilpres) Sumut sebanyak 9.902.948 orang. Pleno dihadiri Ketua KPU Sumut Mulia Banurea, komisioner Yulhasni, Evi Novida Ginting, Nazir Salim Manik dan komisioner Badan Pengawas Pemilihan Umum (Bawaslu) Sumut Aulia Andri.Hadir beberapa utusan, tim kampanye Capres- Cawapres serta KPU kabu-paten/kota se-

Para seniman dan public figure yang tergabung dalam Revolusi Harmoni untuk mendukung Jokowi-JK itu antara lain personel Slank, Giring Nidji, Ello, Oppie Andaresta, Michael Idol, Cak Lontong, Melly Manuhutu, Yuni Shara, Krisdayanti, dan Erwin Gutawa.

Kebakaran Toko Emas Di Pantonlabu

Pelunasan BPIH 2014 Sampai 9 Juli JAKARTA (Antara): Kementerian Agama melalui Direktorat Penyelenggaraan Haji dan Umrah (PHU) telah mengumumkan daftar calon jamaah haji yang berhak melunasi Biaya Penyelenggaraan Ibadah Haji (BPIH) 1435H/2014M. Untuk itu masyarakat yang masuk dalam daftar lunas bisa segera mempersiapkan diri untuk melakukan pelunasan karena masa pelunasan BPIH regular 1435 H/2014 M dimulai sejak Rabu, 11 Juni sampai Rabu 9 Juli 2014. “Masyarakat yang masuk dalam daftar lunas bisa segera mempersiapkan diri untuk

ada perubahan bagi bangsa Indonesia yang besar, dan itu semua harus dimulai dari revolusi mental. Kami berkumpul hari ini untuk dukung revolusi mental Jokowi-JK,” kata personel Slank Abdi Negara Nurdin, atau biasa disapa Abdi, dalam konferensi pers konser Revolusi Harmoni di Jakarta, Rabu (11/6).

GIOVANI dos Santos membeberkan kepada Miguel Herrera tentang bakat sepakbola dan keturunan pejuang para pemain Mexico, tetapi dia tidak bisa mengikut sistem pelatih baru tersebut, maka itu adalah masalah lain. Giovani telah mengantongi Lanjut ke hal A2 kol 1

Kepala Desa Tanjung Merahe, Jhohanes Sitepu, sebelumnya ketiga korban pada Minggu (8/6) malam mengonsumsi minuman keras jenis Mention yang dicampur dengan minuman bersoda di sebuah warung di tempat hiburan pesta tak jauh dari kediaman mereka. Tak puas di sana, ketiganya berpindah ke Desa Tanjung Jati dan melanjutkan mengonsumsi minuman keras, bahkan berpindah lagi ke Kel. Tanah Lanjut ke hal A2 kol 4

Ada-ada Saja

Tubuh Ditutupi 33 Kg Serangga SEORANG pria asal China diselimuti 326 ribu lebah. Gao Bingguo, seorang peternak lebah berusia 54 tahun dari Provinsi Shandong, telah menjadi peternak selama 34 tahun. Gao yang merasa sudah

Lanjut ke hal A2 kol 4

Serampang - Kalah di iklan - He.... he....he....

Berita Utama

A2 DPT Pilpres Sumut .... Pemilu Legislatif 2014 lalu. Dengan demikian DPT Sumut menjadi 9.902.948 dari sebelumnya 9.736.747 pemilih. Komisioner KPU Sumut Divisi Sosialisasi-Data-Informasi, Yulhasni mengatakan, pemilih pemula menjadi penyumbang terbesar sehingga bertambahnya DPT tersebut. Namun, katanya, jumlah Tempat Pemungutan Suara (TPS) justru berkurang. “Sebelumnya tempat pemungutan suara atau TPS berjumlah 30.281 pada Pileg 2014, dan untuk Pemilihan Presiden jumlah TPS berkurang menjadi 27.378 TPS,” katanya dan menambahkan, pengurangan jumlah TPS ini disebabkan adanya penggabungan beberapa TPS, karena bertambahnya jumlah maksimal pemilih per TPS menjadi 800 pemilih. APK Pilpres Secara terpisah, Pimpinan Bawaslu Provinsi Sumatera Utara Bidang Pengawasan dan Humas, Aulia Andri, mengemukakan kepada wartawan, pihaknya menemukan alat peraga kampanye (APK) spanduk dan baliho milik dua pasangan Capres-Cawapres 20142019, yang terpampang di sejumlah ruas jalan melebihi jumlah yang ditetapkan Peraturan Komisi Pemilihan Umum (PKPU) No. 16 tahun 2014, tentang kampanye Pemilihan Presiden dan Wakil Presiden 2014. “Sudah ada aturan mengenai APK. Dalam PKPU No. 16/2014 disebutkan, spanduk pasangan Capres-Cawapres hanya boleh didirikan 5 unit di setiap kampung dan dusun. Sedangkan baliho hanya di-

Awal Ramadhan .... Ia menjelaskan, ijtimak jelang Ramadhan terjadi pada Jumat 27 Juni pukul 15.10 WIB. Saat matahari terbenam, hilal sudah berwujud (terlihat) dengan ketinggian 31 menit 17 detik. Dengan begitu, pada malam harinya Muhammadiyah sudah melakukan shalat tarawih. “Karena hilal kurang dari 2 derajat, maka dipastikan tidak bareng dengan pemerintah,” jelasnya. Meski awal Ramadhan tidak sama dengan pemerintah, lanjut Nadjib, datangnya hari raya Idul Fitri atau Lebaran dipastikan akan bersamaan. “Puasa memang tidak bareng, tapi nanti Lebaran akan bareng dengan pemerintah,” ujarnya. Dalam menentukan awal p u a s a , Mu h a m m a d i y a h menggunakan metode hisab hakiki. Sementara, Nahdlatul Ulama (NU) selain menggunakan metode hisab juga menggunakan metode rukyat. Setidaknya ada beberapa tempat yang dijadikan untuk melihat hilal, seperti Pantai Tanjung Kodok (Lamongan), Pantai Ngliyep (Malang), Bukit Condro (Gresik), dan beberapa tempat lagi. Sementara pemerintah dalam menentukan awal

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ....., Ba2-g2+. 2. Rf1, gxf3. 3. Bb2, Bh1+mat. Jawaban TTS: TTS

Piala Dunia 2014

Jawaban Sudoku:

perbolehkan 3 unit di setiap kelurahan dan desa,’’jelasnya. Namun, lanjutnya, masih ditemukan baliho dan spanduk terpampang melebihi ketentuan tersebut. ‘’B aliho dan spanduk tersebut memang bukan didirikan tim kampanye masingmasing pasangan Capres dan Cawapres, namun didirikan oleh relawan pasangan Capres dan Cawapres.. Sanksi terhadap pelanggaran tersebut tidak diatur dalam PKPU, tetapi sifatnya kita mengimbau mereka,”ujarnya. Namun, kata Aulia, Bawaslu Sumut akan memanggil masing-masing tim kampanye pasangan Capres- Cawapres untuk menyampaikan larangan tersebut agar direalisasikan. Dia mengingatkan, sesuai dengan PKPU tersebut, rumah ibadah, rumah sakit, gedung milik pemerintah, lembaga pendidikan dan jalan-jalan protokol serta jalan bebas hambatan, dilarang digunakan sebagai sarana didirikannya alat peraga kampanye. “Juga fasilitas negara dilarang digunakan dalam setiap kegiatan kampanye. Apabila ada pejabat negara yang menggunakannya, silahkan laporkan ke Bawaslu maupun Panwaslu. Karena itu merupakan pelanggaran pidana dan ada sanksi hukumnya,” katanya. Aulia mengatakan, ada dugaan masih banyak pejabat negara menggunakan fasilitas negara, khususnya kendaraan dinas dalam setiap kegiatan kampanye. Kalau ada fotonya, tambah dia, laporkan ke Bawaslu supaya diproses.(m34). Ramadhan melalui sidang isbat yang dipimpin oleh Kementerian Agama (Kemenag) RI.(ok/m13)

Pelunasan BPIH .... “Masyarakat yang masuk dalam daftar lunas bisa segera mempersiapkan diri untuk melakukan pelunasan karena masa pelunasan BPIH reguler 1435H/2014M dimulai sejak hari ini, 11 Juni – 9 Juli 2014. Besarnya BPIH tergantung dari embarkasi calon jamaah haji,” kata Dirjen PHU Abdul Djamil, Rabu (11/6). Menurut Djamil, pengumuman daftar calon haji yang berhak melunasi BPIH dilakukan secara terbuka, dan bisa diakses pada website resmi Kementerian Agama sehingga masyarakat luas bisa dengan mudah dan mengetahui siapa saja yang berhak melunasi BPIH. Djamil mengatakan, Ditjen PHU terus melakukan persiapan penyelenggaraan ibadah haji haji 1435H/2014M. SetelahPeraturan Presiden tentang Biaya Penyelenggaraan Ibadah Haji (BPIH) ditandatangani Presiden, Kemenag segera menerbitkan Peraturan Menteri Agama (PMA) tentang Pembayaran BPIH Reguler. Sebelumnya, dalam kesempatan jumpa pers di kantor Kementerian Agama, Jakarta, Senin lalu, Dirjen PHU Djamil me-nyampaikan kuota haji regular tahun 1435H 155.200 orang, yang terdiri dari 154.049 calon jamaah haji dan 1.151 petugas daerah.

Al Bayan .... Sifat ini telah ada sejak kecil, dan terus terpelihara sampai menjadi rasul. Nabi Ibrahim waktu kecil sudah mengatakan kepada ayahnya (Azar), bahwa patung itu bukan Tuhan yang harus disembah. Sang ayah terkejut, padahal Ibrahim waktu itu baru berusia enam tahun. Nabi Yusuf Alaihissalam sudah memiliki akhlak yang mempesona, patuh kepada ayahnya Nabi Ya’kub. Sopan, santun dan sangat menyenangkan. Nabi Isa telah membela ibunya (Maryam) sejak kecil dari tuduhan orangorang Yahudi. Rasulullah Muhammad SAW terkenal dalam kaumnya sebagai “Al-Amin” yang jujur, tidak pernah berdusta. Allah berfirman: Seandainya dia (Muhammad) mengada-ada sebagian perkataan atas nama Kami, maka Kami pegang dia pada tangan kanannya (yakni Kami tindak dia dengan sangat keras). Kemuidan benar-benar Kami potong urat tali jantungnya, yakni mati.(QS.Alhaqqah:4448). Menurut Sayyid Qutub, Nabi Muhammad SAW sangat tidak mungkin berdusta. Kalimat “seandainya” di atas sebagai penegasan bahwa beliau paling benar. Kebenaran Nabi Muhammad sudah diakui oleh musuh-musuhnya sejak awal seperti Walid bin Mughirah, Abu Jahal, Heraklius Raja Romawi. Walid bin Mughirah pernah bercerita kepada temannya Abu Jahal. “Sebenarnya Muhammad itu orang yang benar, ayat-ayat yang

WASPADA Kamis 12 Juni 2014

Tenggak Miras Oplosan 2 Tewas 1 Kritis BINJAI (Waspada): Diduga akibat mengonsumsi minuman keras (miras) oplosan, dua warga Kec. Selesai, Kab. Langkat tewas, sedangkan satu orang lainnya kritis. Informasi diperoleh Waspada di rumah duka, Rabu (11/6), korban tewas Selasa malam yakni Aryono Sitepu, 40, dan Rajin Sitepu, 32, keduanya warga Desa Tanjung

Giliran Prabowo .... Mereka yang terdiri dari kader partai koalisi, serta puluhan kelompok relawan pendukung Prabowo – Hatta, sangat antusias ingin bertemu d e n g a n Ca p re s p i l i h a n mereka. Prabowo Subianto, hadir didampingi Ketua Umum DPP Partai Golkar Aburizal Bakrie, Ketua Dewan Pertimbangan Partai Golkar Akbar Tanjung, Presiden Partai Keadilan Sejahtera (PKS) Anis Matta, serta sejumlah tokoh lainnya. Prabowo dan rombongan disambut Ketua Koalisi Merah Putih Sumut H Gatot Pujo Nugroho, Ketua Harian Ajib Shah, Sekretaris Gus Irawan Pasaribu, serta para pengurus partai koalisi. Pantauan Waspada, ribuan orang menyerbu dan berebut bersalaman dengan Prabowo Subianto, saat rombongan memasuki Gedung Serbaguna. Desakan-desakan massa, membuat Prabowo dan rombongan bejalan sangat pelan. Namun, Prabowo mengaku senang. ‘’ Saya senang hadir di tengah-tengah warga Sumatera Utara. Luar biasa. Tangan saya tadi ditarik sesana-kemari dengan genggaman yang sangat kuat. Tangan orang Medan kuat-kuat ya. Benar-benar ‘Ini Medan Bung’. Ini kehormatan bagi saya. Tapi, kalau salaman, jangan kuat-kuat ya,’’ kata Prabowo, dan disambut tepuk tangan massa. Ingin terus lemah Dalam orasi politiknya, Capres nomor urut 1 Prabowo Subianto mengatakan, banyak negara sangat tidak menginginkan Indonesia maju. Mereka tidak ingin pemimpin negeri ini tegas. Bangsa-bangsa itu ingin pemerintah Indonesia terus lemah, agar mereka bisa menjadikan Indonesia yang besar ini sebagai pasar produk-produk mereka. Indonesia, kata Prabowo, terus diasumsikan sebagai negara yang lemah. Pejabatpejabatnya gampang disogok. ‘’Karena itu, kita harus jawab ini. Indonesia masih punya putra putri yang tidak bisa disogok. Putra-putri yang tidak bohong, tidak mencla-mencle, dan tidak perlu pencitraan,’’ katanya. Bangsa Indonesia, menurut Prabowo, harus berubah dari asumsi ‘bangsa kacung’. Tidak harus tergantung dengan negara lain dan harus berdiri di atas kaki sendiri. Indonesia harus mandiri. Rakyat Indonesia harus terhormat. Selama ini, kata Prabowo, kekayaan alam Indonesia dibacakan kepada kita benarbenar bukan sihir. Cuma kita tidak mau tunduk kepada dia karena dia orang miskin, yatim dan masih muda. Abu Jahal menambahkan; Saya sependapat Muhammad itu benar, tetapi dia bukan kabilah kita. Seandainya dia lahir dari kabilah kita, maka saya orang pertama yang beriman. Abu Jahal berasal dari Bani Makhzum, sedangkan Muhammad berasal dari bani Hasyim. Dua suku ini terus bersaing dalam menguasai Mekkah. Sering berperang. Karena itu Abu Jahal anti Nabi Muhammad SAW. Abu Jahal terhinggapi penyakit dengki. Ia pernah melamar Khadijah tetapi ditolak, setelah itu Muhammad melamar Khadijah langsung diterima. Puncak kedengkian adalah dengan muncul Muhammad SAW, pengaruh Abu Jahal menurun dan pudar di Mekkah. Raja Romawi Timur yang beragama Kristen, Heraklius berdecak kagum setelah Abu Spfyan menjelaskan sifat-sifat Muhammad SAW. Abu Sofyan yang ketika itu belum Islam menjelaskan, Nabi Muhammad itu orangnya sangat jujur dan benar. Pengikutnya setia, mereka r uku’ dan sujud bersama. Kemudian Heraklius berkata.”Demi Allah, ia akan menguasai tempat duduk saya ini. Agama yang dibawa Muhammad akan diterima manusia. Ramalan Heraklius memang terbukti, Damaskus (pada waktu itu), ibu kota Romawi Timur jatuh kepada umat Islam di zaman Umar bin Khattab sampai sekarang.

Merahe, Kec. Selesai dan korban kritis Sugiono, 38, adik kandung korban Aryono. Menurut salah seorang warga Budiman didampingi Kepala Desa Tanjung Merahe, Jhohanes Sitepu, sebelumnya ketiga korban pada Minggu (8/ 6) malam mengonsumsi minuman keras jenis Mention yang dicampur dengan minuman bersoda di sebuah warung di tempat hiburan pesta tak jauh dari kediaman mereka. Tak puas di sana, ketiganya berpindah ke Desa Tanjung

Jati dan melanjutkan mengonsumsi minuman keras, bahkan berpindah lagi ke Kel. Tanah Merah, Kec. Binjai Selatan. Sepulang dari sana ketiga korban mengeluh merasakan panas pada bagian dada dan mengalami kepala pusing, sehingga oleh pihak keluarga dibawa ke RSU Dr Djoelham Binjai. Di rumah sakit milik Pemko Binjai ini korban mengalami muntah-muntah dan kejang-kejang dan sekira pukul 19.30 Aryono mengembuskan nafas terakhir dan Rajin Sitepu juga menyusul sekira

pukul 23.00. Sedangkan kondisi Sugiono berangsur-angsur pulih. Kapolsek Selesai Kompol Rosdiana membenarkan kejadian itu dan kini pihaknya sedang melakukan penyelidikan terhadap jenis minuman yang dikonsumsi korban dan sedang meminta keterangan sejumlah saksi. Sedangkan pihak keluarga korban, menurutnya, tidak mengizinkan untuk autopsi mayat kedua korban. Korban dimakamkan tak jauh dari kediamannya. (a05)

berupa kelapa sawit, karet, batubara, emas, timah dan lainnya dinikmati orang asing. ‘’Sekarang pepaya saja kita impor. Bawang putih, gula dan sejumlah komoditas lainnya. Setiap tahun kita beli jutaan sepeda motor, jutaan mobil, tapi tidak satupun merek Indonesia. Sementara perempuan-perempuan kita hanya jadi pelayan bangsa lain. Mereka menjadi pesuruh, disiksa, diperkosa, kemudian dibunuh,’’ kata Prabowo. Kehidupan masyarakat Indonesia, kata Prabowo harus berubah. Kekayaan alam negeri ini harus dinikmati oleh bangsa Indonesia. Tidak banyak permintaan rakyat. Mereka hanya ingin bekerja yang terhormat. ‘’Kaum laki-laki hanya ingin bekerja secara terhormat. Pendapatan cukup untuk menghidupi anak dan istrinya. Punya uang untuk biaya sekolah, dan kalau sakit bisa berobat. Sedangkan ibu-ibu hanya ingin melihat anaknya hidup sehat, dan tumbuh menjadi anak yang soleh, dan anak yang terjamin masa depannya. Masak itupun tidak boleh,’’ tambah Prabowo. Provinsi strategis Sementara itu, Ketua Koalisi Merah Putih Sumut H Gatot Pujo Nugroho, mengatakan Sumatera Utara merupakan provinsi di Indonesia yang letaknya sangat strategis. Karena itu harus dipimpin oleh orang yang tegas namun penuh kelembutan. Capres yang diusung Koalisi Merah Putih, menurut Gatot, adalah sosok yang tegas namun penuh kelembutan. Itu sudah ditunjukkan Prabowo, saat pelaksanaan debat Capres beberapa hari lalu. Karena itu, menurut Gatot , Koalisi Merah Putih, yang didukung lebih 100 relawan yang telah terdaftar sebagai tim pemenangan bertekad untuk memenangkan pasangan Prabowo – Hatta di Sumut, minimal 65 persen. Sambut Prabowo Di KNIA Massa dari sejumlah Ormas, diantaranya Masyarakat Pancasila Indonesia dan Pemuda Pancasila dan Parpol pendukung menyambut kedatangan calon presiden nomor urut 1 Prabowo Subianto di Kualanamu International Airport (KNIA). Selain itu, Prabowo disambut unsur pimpinan Tim Pemenangan Prabowo-Hatta, diantaranya H Gatot Pujo Nugroho, Ajib Shah, Gus Irawan Pasaribu dan tokoh masyarakat Aceh dari Partai Keadilan Sejahtera (PKS), Nasir Djamil.

Pantauan Waspada, Rabu (11/6), Prabowo yang dijadwalkan tiba di KNIA, sekira pukul 09.30, tertunda hingga sekira pukul 11.45. Prabowo yang tiba di KNIA menggunakan pesawat Batik Air, didampingi oleh Ketua DPP Partai Golkar Aburizal Bakrie dan Akbar Tandjung. Prabowo yang menggunakan fasilitas publik area, begitu tiba di kedatangan domestik langsung disambut simpatisannya, demikian juga saat menuju ke kendaraannya yang akan membawa rombongan ke Kota Medan. Kehadiran Prabowo kali ini mendapat sambutan hangat dari sejumlah kalangan di KNIA. Sekira pukul 15.20, rombongan Prabowo kembali tiba di KNIA untuk take off ke Banda Aceh serangkaian kam-panye pemilihan presiden. Kali ini Prabowo menggunakan fasilitas VIP sementara KNIA. Kampanye Di Aceh Calon Presiden Prabowo Subianto saat kampanye di hadapan masyarakat Aceh menyatakan komitmennya untuk tetap mematuhi hasil perjanjian MoU Helsinki dan UUPA.

“Saya akan komit dengan perjanjian MoU Helsinki dan UUPA. Kita akan laksanakan isi dari MoU Helsinki dan UUPA,” kata Prabowo. Menurut Prabowo, Aceh memiliki nilai istimewa. Karena Aceh dahulunya memiliki peran yang besar dalam membangun Indonesia. “Maka saya berjanji untuk tetap menjaga perdamaian Aceh. Saya tetap menjaga perjanjian MoU Helsinki jika terpilih nanti,” katanya. Selain orasi politik, Prabowo menjanjikan dana Rp1 miliar pertahun untuk setiap desa di Indonesia. Prabowo juga berjanji untuk memperbaiki kesejahteraan Aceh, memanfaatkan kekayaan Indonesia untuk rakyat, memberdayakan ekonomi, memberantas korupsi dan menjalankan pemerintahan yang bekerja untuk rakyat. Pada kampanye di Banda Aceh, Prabowo turut didampingi Presiden PKS Anis Matta, Akbar Tanjung, Nasir Djamil, Illiza Sa’aduddin Djamal, Muzakir Manaf, Abdullah Puteh, Soenarko, dan sejumlah bupati di Aceh.(m12/m16/ cb01)

JK: “Saya Tak ....

konser Revolusi Harmoni di Jakarta, Rabu (11/6). Para seniman dan public figure yang tergabung dalam Revolusi Harmoni untuk mendukung Jokowi-JK itu antara lain personel Slank, Giring Nidji, Ello, Oppie Andaresta, Michael Idol, Cak Lontong, Melly Manuhutu, Yuni Shara, Krisdayanti, dan Erwin Gutawa. Komunitas Revolusi Harmoni mengajak seluruh masyarakat Indonesia untuk menciptakan perdamaian dan harmoni dalam kehidupan berbangsa dan bernegara. Pada acara konser Revolusi Harmoni itu dibacakan tujuh butir ikrar untuk gerakan revolusi mental bangsa, yakni:1. Berjanji tidak akan menggunakan kekerasan 2. Bekerja keras dengan cara yang benar dan menjauhi segala bentuk kecurangan 3. Bertekad membangun kesetaraan 4. Berbicara hanya untuk kebenaran 5. Selalu mengedepankan dialog yang jujur, terbuka, dan bersahabat 6. Menjaga dan merawat alam dan lingkungan 7. Meningkatkan potensi manusia untuk kepentingan Indonesia Sejahtera.

Peran Camat .... Namun, kata Nurdin, se-lain menjaga daerah tetap kondunsif, para camat harus terus meningkatkan kualitas pelayanan kepada masyarakat. Pada acara tersebut, Sekda Provsu Nurdin Lubis bersama Sekretaris Dirjen Pemerinta-han Umum Kemendagri, Muhammad Rum mengalungkan secara simbolis tanda peserta kepada 6 Camat terbaik di Sumatera Utara yang mendapat penghargaan atas prestasinya. Ke enam Camat tersebut yakni Camat Aek Natas (Labuhan-batu Utara) Susi Asmarani, Camat Bandarpasir Mandoge (Asahan) M. Andry Simatupang, Camat Dolokmerawan (Serdang Bedagai) M Syafransyah P Nst, Camat Medan Labuhan (Medan) Zain Noval, Camat Sorkam (Tapanuli Tengah) Rais Kari dan Camat Sei Tualang Raso (Tanjungbalai) Pahala Zulfikar.(m46)

Ada-ada Saja .... akrab dengan lebah pun mencoba aksi ekstrem seluruh tubuhnya ditutupi sebanyak 33 kilogram (kg) serangga yang identik berwarna kuning itu. Melansir Metro, Rabu (11/6), sebelum ditutupi lebah, Gao telah mencuci tubuhnya sebelum mencatat rekor. Seperti diketahui, lebah akan menyengat orang dengan bau badan menyengat. Setelah mengetahui fakta itu, Gao nekat untuk mencobanya. Gao yakin jika dirinya tidak akan tersengat sampai mati. Pemecahan rekor pun dimulai, Gao diberikan kotak berisi lebah ratu. Ini akan menarik lebah pekerja, dibuang di kakinya oleh sejumlah pembantunya. (ok/m13)

Jusuf Kalla menjelaskan bahwa debat capres bukan merupakan perdebatan ilmiah akademis tetapi merupakan cara menjelaskan visi misi kepada masyarakat. “Debat capres ini memang bukan perdebatan akademis, ilmiah, tapi intinya bagaimana rakyat bisa dengan jelas memahaminya. Kalau tak kuasai masalah akan habis. Jangan pakai bahasa melayang. Ini debat untuk rakyat, agar mereka bisa tahu, memahami,” kata Jusuf Kalla. Seniman Musik Dukung Jokowi-JK Sejumlah seniman musik dan tokoh publik tergabung dalam Komunitas Revolusi Harmoni menyatakan dukungan terhadap pasangan Joko Widodo dan Jusuf Kalla pada Pemilihan Presiden (Pilpres) 2014. “Revolusi Harmoni ini isinya kelompok seniman dan tokoh publik yang berharap ada perubahan bagi bangsa Indonesia yang besar, dan itu semua harus dimulai dari revolusi mental. Kami berkumpul hari ini untuk dukung revolusi mental Jokowi-JK,” kata personel Slank Abdi Negara Nurdin, atau biasa disapa Abdi, dalam konferensi pers

Sumut Rawan .... Pol Drs Mestron Siboro SST, MK, SH, dan moderator Drs Ahmad Taufan Damanik MA, dari USU. Di hadapan peserta dari kalangan telekomunikasi, operator, provider, perbankan, pejabat pemerintah sipil dan militer, perguruan tinggi dan lainnya, Irjen Pol Boy Salamuddin memaparkan kondisi geografis maupun ketersediaan sarana telekomunikasi memungkinkan wilayah Sumut menjadi modus operandi cyber crime. “Beberapa wilayah perlu penanganan sungguh-sungguh dalam upaya mengantisipasi dan menangani cyber crime termasuk Sumut. Ini pekerjaan serius, sebab cyber crime sudah meresahkan dan menjurus mengganggu ketahanan nasional,” ujarnya. Dir Reskrim Poldasu Kombes Pol Drs Mestron Siboro memaparkan secara umum cyber crime merupakan bentuk-bentuk kejahatan yang timbul karena pemanfaatan teknologi internet. Polisi memiliki tanggungjawab menangani hal tersebut sehingga dibentuk Satuan Cyber Crime dalam fungsi reserse. Kadis Kominfo maupun Dekan Fakultas Ilmu Komputer dan Ilmu TI USU senada mengakui kebutuhan internet dan teknologi informatika sudah menjadi keharusan dewasa ini, namun ekses negatifnya termasuk cyber crime memang perlu diantisipasi lebih signifikan. Perangkat hukum atau cyberlaw sudah ada, namun diakui masih banyak diperlukan lebih konprehensif lagi terutama perangkat hukum

yang lebih teknis sehingga cyber crime dapat diperkecil. Beberapa modus operandi cyber crime yang sudah muncul ke permukaan dapat dikelompokkan antara lain pencurian account user internet atau pencurian identitas untuk penipuan. Kemudian deface (membajak situs web), probing dan port scanning yakni melakukan pengintaian terhadap service-service yang tersedia di server target, virus dan trojan yang dapat merusak sistem atau jaringan guna memperoleh informasi dari target seperti password, system log, data dan lain-lain guna mengendalikan target. Selanjutnya Deniel of Service (DoS) Attack yang merupakan jenis serangan terhadap sebuah komputer atau server di dalam jaringan internet dengan cara menghabiskan sumber (resource) yang dimiliki oleh komputer tersebut, sampai komputer itu tidak dapat menjalankan fungsinya. Strategis yang diperlukan dalam penanggulangan cyber crime, selain penegakan hukum pidana juga perlu mengoptimalkan undang-undang khusus lainnya, rekrutmen aparat penegak hukum yang menguasai teknologi informatika, cyber police, kerjasama antar bidang strategis hingga internasional. Strategi jangka panjang membuat perjanjian bilateral karena media internet adalah media global yang tidak memiliki batasan waktu dan tempat serta melibatkan beberapa negara, sehingga perlu hubungan di jalur bilateral untuk menanggulanginya. (m28)

Waspada/Feirizal Purba

GENANGAN banjir di ruas Jl. Irian Barat saat hujan mengguyur Kota Medan, Rabu (11/6) sore.

Hujan Lebat Guyur Medan MEDAN (Waspada) : Kondisi cuaca di kawasan Medan dan sekitarnya berfluktuasi yaitu berubah-ubah antara panas dan hujan. Setelah beberapa hari kondisi udara panas antara 34 hingga 36 derajat Celsius, Rabu (11/6) sore, diguyur hujan lebat lebih kurang 1 jam. Akibat intensitas hujan cukup tinggi, sejumlah badan jalan seperti Jl. Brigjen Katamso, Jl. Suprapto, Jl. Sudirman dan Jl. Hj. Ani Idrus digenangi air hujan antara 5 hingga 10 Cm di atas badan jalan. Di ruas Jl. Irian Barat , genangan air terjadi persis di depan bangunan Center Point dan tikungan depan RS Murni Teguh. Diduga, genangan air akibat tidak adanya saluran pembuangan.Saluran air di seberangnya kurang berfungsi. Setiap kendaraan, baik roda empat maupun roda dua terpaksa bergerak perlahanlahan, agar mesin tidak terkena air. Bahkan beberapa kendaraan roda ada yang mogok. Kalangan pengguna jalan di kawasan tersebut mengakui, ruas Jl. Irian Barat selalu digenangi banjir saat hujan mengguyur. Hujan deras itu akibat efek terjadi suhu panas meningkat di kawasan Medan dan sekitarnya beberapa hari sebelumya, membuat warga kota Medan

tidak nyaman beristirahat siang maupun malam. Sebelumnya Hendra Suwarta, Kepala data dan informasi (Datin) pada Balai Besar BMKG Wilayah I ketika dikonfirmasi tidak membantah, Juni 2014 memasuki musim kemarau, namun bukan berarti tidak ada hujan. “Hujan juga masih berlangsung di kawasan Medan dan beberapa daerah dipesisir barat maupun timur Sumut seperti Medan, Deliserdang, Langkat bahkan Samosir dan Humbanghas, “ kata Hendra. Awal Juni, kata pejabat BMKG Wilayah I, suhu udara di Kota Medan cukup tinggi seperti Minggu (8/6), suhu udara ketika itu dikawasan Medan sempat mendidih mencapai angka 36 derajat celcius dan tertinggi selama 2014 bahkan 2013. Hendra membenarkan, walaupun ada turun hujan maupun hujan-hujan lokal, suhu udara ke depan masih cukup tinggi karena Juni memasuki kemarau pada tahun 2014. Untuk itulah dia berharap, warga Medan meningkatkan kewaspadaan berpotensi peluang kebakaran, terutama di kawasan-kawasan pemukiman padat penduduk. Ke depan suhu udara masih cukup tinggi, kata Hendra Suwarta. (m32/m34)

Pedro Rodriguez .... striker khusus di pihaknya maka Spanyol akan menjalankan filosofi sepakbola yang bertentangan dengan kebiasaannya. Tetapi bagaimanapun baiknya tim lawan, kayaknya tidak ada pemain yang bertindak sebagai penyelesai akhir sebagaimana telah dibuktikan skuad Spanyol, terutama ketika apabila lawannya kalah 1-0. Mereka memiliki Fernando Torres, tetapi dia tidak dapat diandalkan lagi. Mereka memiliki Roberto Soldado, yang sudah tenang pada musim ini dan tidak pernah benar-benar menganggap dirinya sudah lebih dari cukup. Mereka memiliki Alvaro Negredo, yang telah menjalani musim yang hebat di Manchester City, tetapi juga tidak pernah terlihat sebagai pilihan pertama. Mereka mungkin sekarang memiliki Diego Costa bahwa dia memilih Spanyol berada di atas Brazil, tetapi dia belum teruji di level ini. Adakah Pedro punya jawabannya? Anda akan berpikir tidak. Dia tidak mencetak gol baik di Piala Dunia terakhir maupun di Piala Euro 2012. Dia bertindak lebih daripada kontributor. (wcs/ mujo)

Giovani .... satu medali Piala Dunia Under 17, satu medali emas Olimpiade dan dia juga menunjukkan kesungguhan janjinya di Piala Dunia lalu, namun formnya tampaknya sangat dipengaruhi oleh posisi di mana dia diharapkan untuk bermain dalam putaran final Piala Dunia kali ini. Posisi terbaiknya adalah striker kedua yang berarti dia bermain di belakang Chicharito atau Oribe Peralta. Namun Herrera, mengatakan dia berniat untuk memainkan dua striker, yang berarti Giovani bisa diminta untuk bermain di sayap kanan. Anda jarang melihat bagaimana permainan terbaiknya ketika dia memegang perannya di posisi yang diberikan pelatih. Giovani secara terbuka pernah mengeluhkan bahwa Mexico menggunakan sistem yang tidak mengakomodasi pemain terbaiknya. Giovani merupakan salah satu pemain terbaik Mexico saat ini dan setelah menderita dipaksa untuk meloloskan diri melalui babak play-off, Mexico akhirnya membutuhkan semua pemainnya untuk mengeluarkan semua bakat mereka agar dapat lolos ke putaran final Piala Dunia. (wcs / mujo)

Brazil Siap .... pembangunan stadion, pemborosan anggaran dan kekacauan selama masa persiapan. Kendati mengakui cukup sulit menyelenggarakan turnamen akbar tersebut, Dilma bersikeras 12 stadion telah siap. Dia juga meyakinkan para pelancong luar negeri bahwa Brazil akan menyambut mereka dengan tangan terbuka. “Bagi negara mana saja, menyelenggarakan turnamen semacam ini tak ubahnya melakoni pertandingan sepakbola, bercucur keringat dan kerap kali menderita,” klaim Dilma. “Juga dengan kemungkinan babak waktu tambahan dan adu penalti. Tetapi hasil akhir dan perayaan cukup layak untuk diperjuangkan,” katanya menambahkan. Pembangunan sejumlah stadium dan sarana transportasi sempat tertunda, sehingga membengkakkan biaya dan meninggalkan utang besar kepada Brazil senilai 11 miliar dolar AS. Para pekerja malah terlihat digenjot untuk menyelesaikan stadion tempat pembukaan, Corinthians Arena di Sao Paulo. Pengeluaran besar demi penyelenggaraan Piala Dunia 2014 juga memantik serangkaian protes, yang terkadang berakhir ricuh sepanjang tahun lalu. Isu utamanya kenaikan tarif transportasi publik dan tuntutan agar pemerintah mengalihkan kucuran anggaran ke bidang pelayanan kesehatan dan pendidikan. Aksi demonstrasi perlahan mereda dalam beberapa bulan terakhir, namun ancaman demo tetap membayangi laga pembukaan antara Brazil melawan Kroasia di Arena Corinthians. “Piala tanpa masyarakat, semuanya kembali ke jalanan,” bunyi salah satu spanduk yang diusung demonstran saat bergerak menuju Arena Corinthians. Menurut Daily Mail, aksi demonstrasi juga memicu penjarahan di sejumlah tempat, salah satunya di Recife, kota yang berada di Timur Laut Brazil. Mereka mengambil keuntungan dari aksi protes Polisi Militer yang mogok menuntut kenaikan gaji. Aksi demikian membuat legenda Pele, menjadi prihatin. “Kami tahu, setidaknya 25 persen turis yang ingin ke Brazil khawatir terhadap gelombang protes, saya pikir mereka malah akan membatalkannya,” sesalnya. “Ini merupakan kerugian besar bagi negara kami. Kami tidak ada urusannya dengan politisi korup dan maling. Ini bukan salah kami,” tambah pemenang Piala Dunia 1958, 1962 dan 1970 tersebut, yang menjabat duta Brazil 2014. Pele juga menegaskan, Tim Samba tidak boleh disamakan dengan koruptor yang mencuri dari pembangunan stadion. Dia pun meminta semua warga Brazil supaya mendukung perjuangan Neymar dan kawan-kawan, dimulai dari partai pembuka menghadapi Hrvatska.(m15/fifa/afp/dm/ss)

Berita Utama

A2 Pedro Rodriguez ....

Terendah Rp1,4 Juta Tertinggi Rp5,3 Juta

Giovani ....

Brazil Siap .... “Bagi negara mana saja, menyelenggarakan turnamen semacam ini tak ubahnya melakoni pertandingan sepakbola, bercucur keringat dan kerap kali menderita,” klaim Dilma. “Juga dengan kemungkinan babak waktu tambahan dan adu penalti. Tetapi hasil akhir dan perayaan cukup layak untuk diperjuangkan,” katanya menambahkan. Pembangunan sejumlah stadium dan sarana transportasi sempat tertunda, sehingga membengkakkan biaya dan meninggalkan utang besar kepada Brazil senilai 11 miliar dolar AS. Para pekerja malah terlihat digenjot untuk menyelesaikan stadion tempat pembukaan, Corinthians Arena di Sao Paulo. Pengeluaran besar demi penyelenggaraan Piala Dunia 2014 juga memantik serangkaian protes, yang terkadang berakhir ricuh sepanjang tahun lalu. Isu utamanya kenaikan tarif transportasi publik dan tuntutan agar pemerintah mengalihkan kucuran anggaran ke bidang pelayanan kesehatan dan pendidikan. Aksi demonstrasi perlahan mereda dalam beberapa bulan terakhir, namun ancaman demo tetap membayangi laga pembukaan antara Brazil


KAMPANYE JOKOWI DI BANDUNG: Calon Presiden nomor urut dua Joko Widodo (kanan) didaulat oleh Seniman dan Budayawan Bandung Tisna Sanjaya (kiri) untuk menendang bola di atas sebuah kanvas lukisan ketika acara silahturahim dengan seniman Bandung di Halaman di Gedung Merdeka, Bandung, Jawa Barat, Rabu (11/6). Joko Widodo kembali melakukan kampanye di sejumlah lokasi di Kota Bandung.

Giliran Prabowo .... dalam pemilihan presiden bersama Parpol yang tergabung dalam Koalisi Merah Putih lebih dimaksudkan untuk menyelamatkan bangsa Indonesia. “Kami tidak ingin Indonesia menjadi bangsa kacung yang disuruh-suruh bangsa lain,” katanya. Capres yang berpasangan dengan Ketua Umum Partai Amanat Nasional (PAN) Hatta Rajasa tersebut juga mengata-

melawan Kroasia di Arena Corinthians. “Piala tanpa masyarakat, semuanya kembali ke jalanan,” bunyi salah satu spanduk yang diusung demonstran saat bergerak menuju Arena Corinthians. Menurut Daily Mail, aksi demonstrasi juga memicu penjarahan di sejumlah tempat, salah satunya di Recife, kota yang berada di Timur Laut Brazil. Mereka mengambil keuntungan dari aksi protes Polisi Militer yang mogok menuntut kenaikan gaji. Aksi demikian membuat legenda Pele, menjadi prihatin. “Kami tahu, setidaknya 25 persen turis yang ingin ke Brazil khawatir terhadap

gelombang protes, saya pikir mereka malah akan membatalkannya,” sesalnya. “Ini merupakan kerugian besar bagi negara kami. Kami tidak ada urusannya dengan politisi korup dan maling. Ini bukan salah kami,” tambah pemenang Piala Dunia 1958, 1962 dan 1970 tersebut, yang menjabat duta Brazil 2014. Pele juga menegaskan, Tim Samba tidak boleh disamakan dengan koruptor yang mencuri dari pembangunan stadion. Dia pun meminta semua warga Brazil supaya mendukung perjuangan Neymar dan kawan-kawan, dimulai dari partai pembuka menghadapi Hrvatska. (m15/fifa/afp/dm/ss)

Masyarakat Aceh ....

polisi BK 1216 HQ diberondong orang tak dikenal dengan menggunakan senjata api laras panjang di ruas jalan Banda Aceh-Medan. Tiga orang penumpang yang merupakan satu keluarga, meninggal yakni Juwaini, 29, Azirawati, 28, dan Khairul Akbar yang merupakan bocah berusia 1,5 tahun. Khairul Akbar adalah anak dari Juwaini. Ketiga korban meninggal dunia akibat penembakan mobil di lintasan jalan nasional itu adalah warga Desa Lheu Simpang dan Blang Pohroh, Kec. Jeunieb, Bireuen. Gustav menjelaskan Polres Bireuen didukung tim dari Polda Aceh terus melakukan pengejaran terhadap pelaku.

tindakan kekerasan,” kata Sutarman di Kantor Presiden, Jakarta, Rabu (11/6). Kapolri menjelaskan terkait kasus penembakan yang terjadi beberapa waktu lalu, aparat kepolisian terus mendalami kasus tersebut dan mengejar pelakunya. “Sedang bekerja, (kasus) yang lama kan sudah tertangkap dua, dua lagi buron.Itu belum tertangkap. Kejadian kemarin (31/3) masih dalam proses penyelidikan kita,” katanya. Kapolri mengatakan motif dari penembakan diduga ada kaitannya dengan perseteruan antar partai politik. Sebelumnya, Senin (31/3), mobil kijang Innova nomor

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ....., Ba2-g2+. 2. Rf1, gxf3. 3. Bb2, Bh1+mat. Jawaban TTS: TTS

Piala Dunia 2014

Jawaban Sudoku:

Al Bayan .... Ash-Shiddiq (Benar) sebagai modal utama para rasul. Benar ucapan dan perbuatannya, tidak pernah berdusta. Sifat ini telah ada sejak kecil, dan terus terpelihara sampai menjadi rasul. Nabi Ibrahim waktu kecil sudah mengatakan kepada ayahnya (Azar), bahwa patung itu bukan Tuhan yang harus disembah. Sang ayah terkejut, padahal Ibrahim waktu itu baru berusia enam tahun. Nabi Yusuf Alaihissalam sudah memiliki akhlak yang mempesona, patuh kepada ayahnya Nabi Ya’kub. Sopan, santun dan sangat menyenangkan. Nabi Isa telah membela ibunya (Maryam) sejak kecil dari tuduhan orangorang Yahudi. Rasulullah Muhammad SAW terkenal dalam kaumnya sebagai “Al-Amin” yang jujur, tidak pernah berdusta. Allah berfirman: Seandainya dia (Muhammad) mengada-ada sebagian perkataan atas nama Kami, maka Kami pegang dia pada tangan kanannya (yakni Kami tindak dia dengan sangat keras). Kemuidan benar-benar Kami potong urat tali jantungnya, yakni mati.(QS.Alhaqqah:4448). Menurut Sayyid Qutub, Nabi Muhammad SAW sangat tidak mungkin berdusta. Kalimat “seandainya” di atas sebagai penegasan bahwa beliau paling benar. Kebenaran Nabi Muhammad sudah diakui oleh musuh-musuhnya sejak awal seperti Walid bin Mughirah, Abu Jahal, Heraklius Raja Romawi. Walid bin Mughirah pernah bercerita kepada temannya Abu Jahal. “Sebe-

Kamis 12 Juni 2014

Gaji PNS Naik

striker khusus di pihaknya maka Spanyol akan menjalankan filosofi sepakbola yang bertentangan dengan kebiasaannya. Tetapi bagaimanapun baiknya tim lawan, kayaknya tidak ada pemain yang bertindak sebagai penyelesai akhir sebagaimana telah dibuktikan skuad Spanyol, terutama ketika apabila lawannya kalah 1-0. Mereka memiliki Fernando Torres, tetapi dia tidak dapat diandalkan lagi. Mereka memiliki Roberto Soldado, yang sudah tenang pada musim ini dan tidak pernah benar-benar menganggap dirinya sudah lebih dari cukup. Mereka memiliki Alvaro Negredo, yang telah menjalani musim yang hebat di Manchester City, tetapi juga tidak pernah terlihat sebagai pilihan pertama. Mereka mungkin sekarang memiliki Diego Costa bahwa dia memilih Spanyol berada di atas Brazil, tetapi dia belum teruji di level ini. Adakah Pedro punya jawabannya? Anda akan berpikir tidak. Dia tidak mencetak gol baik di Piala Dunia terakhir maupun di Piala Euro 2012. Dia bertindak lebih daripada kontributor. Dalam satu serangan yang dilakukan tiga orang, sepertinya Spanyol segera menyusun para pemainn yang akan diturunkan, maka tempat Pedro ada di sebelah kanan, dari arah mana dia akan mencetak gol, tapi tidak dengan cara seorang diri seperti yang selalu digunakan Emilio Butragueno. Tetapi itu tidak berarti dia tidak akan berusaha memenangkan Golden Boot di Brazil (wcs/mujo) satu medali Piala Dunia Under 17, satu medali emas Olimpiade dan dia juga menunjukkan kesungguhan janjinya di Piala Dunia lalu, namun formnya tampaknya sangat dipengaruhi oleh posisi di mana dia diharapkan untuk bermain dalam putaran final Piala Dunia kali ini. Posisi terbaiknya adalah striker kedua yang berarti dia bermain di belakang Chicharito atau Oribe Peralta. Namun Herrera, mengatakan dia berniat untuk memainkan dua striker, yang berarti Giovani bisa diminta untuk bermain di sayap kanan. Anda jarang melihat bagaimana permainan terbaiknya ketika dia memegang perannya di posisi yang diberikan pelatih. Giovani secara terbuka pernah mengeluhkan bahwa Mexico menggunakan sistem yang tidak mengakomodasi pemain terbaiknya. Giovani merupakan salah satu pemain terbaik Mexico saat ini dan setelah menderita dipaksa untuk meloloskan diri melalui babak play-off, Mexico akhirnya membutuhkan semua pemainnya untuk mengeluarkan semua bakat mereka agar dapat lolos ke putaran final Piala Dunia. Tetapi jika dia tidak menemukan cara mendapatkan tiket untuk membela langsung bendera Mexico di lapangan, Giovani juga berharap agar dia dapat sekurang-kurangnya duduk di bangku cadangan. Tetapi salah satu dari harapannya itu sudah pasti, dia ikut ke Brazil. (wcs / mujo)


narnya Muhammad itu orang yang benar, ayat-ayat yang dibacakan kepada kita benarbenar bukan sihir. Cuma kita tidak mau tunduk kepada dia karena dia orang miskin, yatim dan masih muda. Abu Jahal menambahkan; Saya sependapat Muhammad itu benar, tetapi dia bukan kabilah kita. Seandainya dia lahir dari kabilah kita, maka saya orang pertama yang beriman. Abu Jahal berasal dari Bani Makhzum, sedangkan Muhammad berasal dari bani Hasyim. Dua suku ini terus bersaing dalam menguasai Mekkah. Sering berperang. Karena itu Abu Jahal anti Nabi Muhammad SAW. Abu Jahal terhinggapi penyakit dengki. Ia pernah melamar Khadijah tetapi ditolak, setelah itu Muhammad melamar Khadijah langsung diterima. Puncak kedengkian adalah dengan muncul Muhammad SAW, pengaruh Abu Jahal menurun dan pudar di Mekkah. Raja Romawi Timur yang beragama Kristen, Heraklius berdecak kagum setelah Abu Spfyan menjelaskan sifat-sifat Muhammad SAW. Abu Sofyan yang ketika itu belum Islam menjelaskan, Nabi Muhammad itu orangnya sangat jujur dan benar. Pengikutnya setia, mereka r uku’ dan sujud bersama. Kemudian Heraklius berkata.”Demi Allah, ia akan menguasai tempat duduk saya ini. Agama yang dibawa Muhammad akan diterima manusia. Ramalan Heraklius memang terbukti, Damaskus (pada waktu itu), ibu kota Romawi Timur jatuh kepada umat Islam di zaman Umar bin Khattab sampai sekarang.

kan komitmen Parpol peserta Koalisi Merah Putih sangat kuat untuk menyelamatkan bangsa Indonesia. “Ini partai-partai yang tidak bisa dibeli,” katanya sambil melihat ke arah Ketua Umum Partai Golkar Aburizal Bakrie dan Presiden Partai Keadilan Sejahtera (PKS) Anis Mata yang hadir dalam acara itu. Menurut Prabowo, meski mengetahui kelompok atau pihak-pihak yang selama ini “mencuri” uang rakyat, tetapi pihaknya tidak ingin menuduh atau membuka aib orang lain. “Namun kalau perlu, suatu saat akan saya sebut satu per satu,” kata Prabowo dan mengajak seluruh elemen bangsa untuk mengutamakan sikap jujur dalam bernegara dan tidak sering menjual rakyat untuk mengambil keuntungan pribadi. “Jangan purapura merakyat, tetapi mencuri uang rakyat”. Pilpres yang akan digelar 9 Juli 2014, diikuti dua pasangan calon presiden dan wakil presiden, Jokowi-JK yang diusung PDI Perjuangan, Partai NasDem, PKB, Partai Hanura, dan PKPI serta Prabowo Subianto-Hatta Radjasa yang diusung Partai Gerindra, PAN, Partai Golkar, PKS, PPP, dan PBB. Ingin terus lemah Dalam orasi politiknya, Capres nomor urut 1 Prabowo Subianto mengatakan, banyak negara sangat tidak menginginkan Indonesia maju. Mereka tidak ingin pemimpin negeri ini tegas. Bangsabangsa itu ingin pemerintah Indonesia terus lemah, agar mereka bisa menjadikan Indonesia yang besar ini sebagai pasar produk-produk mereka. Indonesia, kata Prabowo, terus diasumsikan sebagai negara yang lemah. Pejabatpejabatnya gampang disogok. ‘’Karena itu, kita harus jawab ini. Indonesia masih punya putra putri yang tidak bisa disogok. Putra-putri yang tidak bohong, tidak mencla-mencle, dan tidak perlu pencitraan,’’ katanya. Bangsa Indonesia, menurut Prabowo, harus berubah dari asumsi ‘bangsa kacung’.

Ti d a k h a r u s t e r g a n t u n g dengan negara lain dan harus berdiri di atas kaki sendiri. Indonesia harus mandiri. Rakyat Indonesia harus terhormat. Selama ini, kata Prabowo, kekayaan alam Indonesia berupa kelapa sawit, karet, batubara, emas, timah dan lainnya dinikmati orang asing. ‘’Sekarang pepaya saja kita impor. Bawang putih, gula dan sejumlah komoditas lainnya. Setiap tahun kita beli jutaan sepeda motor, jutaan mobil, tapi tidak satupun merek Indonesia. Sementara perempuanperempuan kita hanya jadi pelayan bangsa lain. Mereka menjadi pesuruh, disiksa, diperkosa, kemudian dibunuh,’’ kata Prabowo. Kehidupan masyarakat Indonesia, kata Prabowo harus berubah. Kekayaan alam negeri ini harus dinikmati oleh bangsa Indonesia. Tidak banyak permintaan rakyat. Mereka hanya ingin bekerja yang terhormat. ‘’Kaum laki-laki hanya ingin bekerja secara terhormat. Pendapatan cukup untuk menghidupi anak dan istrinya. Punya uang untuk biaya sekolah, dan kalau sakit bisa berobat. Sedangkan ibu-ibu hanya ingin melihat anaknya hidup sehat, dan tumbuh menjadi anak yang soleh, dan anak yang terjamin masa depannya. Masak itupun tidak boleh,’’ tambah Prabowo. Provinsi strategis Sementara itu, Ketua Koalisi Merah Putih Sumut H Gatot Pujo Nugroho, mengatakan Sumatera Utara merupakan provinsi di Indonesia yang letaknya sangat strategis. Karena itu harus dipimpin oleh orang yang tegas namun penuh kelembutan. Capres yang diusung Koalisi Merah Putih, menurut Gatot, adalah sosok yang tegas namun penuh kelembutan. Itu sudah ditunjukkan Prabowo, saat pelaksanaan debat Capres beberapa hari lalu. Karena itu, menur ut Gatot, Koalisi Merah Putih, yang didukung lebih 100 relawan yang telah terdaftar sebagai tim pemenangan bertekad untuk memenangkan pasangan Prabowo – Hatta di Sumut, minimal 65 persen. (m12/ant)

Tenggak Miras ....

sedang melakukan penyelidikan terhadap jenis minuman yang dikonsumsi korban dan sedang meminta keterangan sejumlah saksi. Sedangkan pihak keluarga korban, menurutnya, tidak mengizinkan untuk autopsi mayat kedua korban. Korban dimakamkan tak jauh dari kediamannya. (a05)

Merah, Kec. Binjai Selatan. Sepulang dari sana ketiga korban mengeluh merasakan panas pada bagian dada dan mengalami kepala pusing, sehingga oleh pihak keluarga dibawa ke RSU Dr Djoelham Binjai. Di rumah sakit milik Pemko Binjai ini korban mengalami muntah-muntah dan kejang-kejang dan sekira pukul 19.30 Aryono mengembuskan nafas terakhir dan Rajin Sitepu juga menyusul sekira pukul 23.00. Sedangkan kondisi Sugiono berangsurangsur pulih. Kapolsek Selesai Kompol Rosdiana membenarkan kejadian itu dan kini pihaknya

Ada-ada Saja .... akrab dengan lebah pun mencoba aksi ekstrem seluruh tubuhnya ditutupi sebanyak 33 kilogram (kg) serangga yang identik berwarna kuning itu. Melansir Metro, Rabu (11/6), sebelum ditutupi lebah, Gao telah mencuci tubuhnya sebelum mencatat rekor. Seperti diketahui, lebah akan menyengat orang dengan bau badan yang menyengat. Setelah mengetahui fakta itu, Gao nekat untuk mencobanya. Gao yakin jika dirinya tidak akan tersengat sampai mati. Pemecahan rekor pun dimulai, Gao diberikan kotak berisi lebah ratu. Ini akan menarik lebah pekerja, yang dibuang di kakinya oleh sejumlah pembantunya. (ok/m13)

Prabowo Janji .... Menurut Prabowo, Aceh memiliki nilai istimewa. Karena Aceh dahulunya memiliki peran yang besar dalam membangun Indonesia. “Maka saya berjanji untuk tetap menjaga perdamaian Aceh. Saya tetap menjaga perjanjian MoU Helsinki jika terpilih nanti,” katanya. Selain orasi politik, Prabowo menjanjikan dana Rp1 miliar pertahun untuk setiap desa di Indonesia. Prabowo juga berjanji untuk memperbaiki kesejahteraan Aceh, memanfaatkan kekayaan Indonesia untuk rakyat, memberdayakan ekonomi, memberantas korupsi dan menjalankan pemerintahan yang bekerja untuk rakyat. Pada kampanyena di Banda Aceh, Prabowo turut didampingi Presiden PKS Anis Matta, Akbar Tanjung, Nasir Djamil, Illiza Sa’aduddin Djamal, Muzakir Manaf, Abdullah Puteh, Soenarko, dan sejumlah bupati di Aceh. (cb01)

JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono menandatangani Peraturan Pemerintah (PP) Nomor 34 Tahun 2014 pada 21 Mei 2014, tentang kenaikan gaji Pegawai Negeri Sipil di seluruh Indonesia. PP tersebut merupakan Perubahan Keenam Belas Atas PP tentang peraturan gaji PNS. Dalam lampiran PP itu disebutkan, gaji PNS terendah (golongan Ia masa kerja 0 tahun) adalah Rp 1.402.400,00 (sebelumnya Rp 1.323.000,00), sementara gaji PNS tertinggi (golongan IVe masa kerja 32 tahun) adalah Rp 5.302.100,00 (sebelumnya Rp 5.002.000,00). “Ketentuan sebagaimana dimaksud berlaku pada 1 Januari 2014,” bunyi Pasal I ayat (2) PP tersebut. Adapun untuk PNS golongan IIa masa kerja 0 tahun, gajinya menjadi Rp 1.816.900,00 (sebelumnya Rp 1.714.100,00), gaji tertinggi PNS golongan IIa adalah Rp 3.031.100,00 (sebelumnya Rp 2.859.500,00). Gaji PNS gol o n g a n I I b t e re n d a h R p 1.984.200,00 (sebelumnya Rp 1.871.900,00), tertinggi Rp 3.159.500,00 (sebelumnya Rp 2.980.500,00). Gaji PNS golongan IIc terendah Rp 2.068.100,00 (sebelumnya Rp

1.951.100,00), tertinggi Rp 3.293.000,00 (sebelumnya Rp 3.106.600,00). Gaji PNS gol o n g a n I Id t e re n d a h R p 2.155.600,00 (sebelumnya Rp 2.033.600), tertinggi Rp 3.432.300,00 (sebelumnya Rp 3.238.000,00). Untuk PNS golongan IIIa gaji terendahnya kini Rp 2.317.600,00 (sebelumnya Rp 2.186.400,00), tertinggi Rp 3.806.300,00 (sebelumnya Rp 3.590.900,00). Gaji tertinggi PNS golongan IIIb kini Rp 2.415.600,00 (sebelumnya Rp 2.278.900,00), tertinggi Rp 3.967.300,00 (sebelumnya Rp 3.742.800,00). Golongan IIIc tertinggi kini Rp 2.517.800,00 (sebelumnya Rp 2.375.300,00), tertinggi Rp 4.135.200,00 (sebelumnya Rp 3.901.100). Gaji untuk PNS golongan IIId terendah kini Rp 2.155.600,00 (sebelumnya 4.066.100,00). Sedangkan untuk PNS golongan IVa, gaji terendah kini Rp 2.735.300,00 (sebelumnya Rp 2.580.500,00), tertinggi Rp 4.492.400,00 (sebelumnya Rp 4.238.100,00). Gaji terendah PNS golongan IVb kini Rp 2.851.000,00 (sebelumnya Rp 2.689.600,00), tertinggi Rp 4.682.400,00 (sebelumnya Rp 4.417.400,00). Gaji terendah PNS golongan IVc kini Rp

2.976.600,00 (sebelumnya Rp 2.803.400,00), tertinggi Rp 4.880.500,00 (sebelumnya Rp 4.604.200,00). Gaji terendah PNS golongan IVd kini Rp 3.097.300,00 (sebelumnya Rp 2.922.000,00), tertinggi Rp 5.086.900,00 (sebelumnya Rp 4.799.000,00). Dan terakhir gaji terendah PNS golongan IVe kini Rp 3.228.300,00 (sebelumnya Rp 3.045.600,00), tertinggi Rp 5.302.100,00 (sebelumnya Rp 5.002.000,00). “Peraturan ini mulai berlaku pada tanggal diundangkan,” bunyi Pasal II Peraturan Pemerintah Nomor 34 Tahun 2014 yang diundangkan pada 21 Mei 2014 oleh Menteri Hukum dan HAM Amir Syamsudin itu.

Hujan Lebat Guyur Medan MEDAN (Waspada): Kondisi cuaca di kawasan Medan dan sekitarnya berfluktuasi yaitu berubah-ubah antara panas dan hujan. Setelah beberapa hari kondisi udara panas antara 34 hingga 36 derajat celsius, Rabu (11/6) sore, diguyur hujan lebat lebih kurang 1 jam. (m32)

Seniman Musik .... Ko m u n i t a s R e v o l u s i Harmoni mengajak seluruh masyarakat Indonesia untuk menciptakan perdamaian dan harmoni dalam kehidupan berbangsa dan bernegara. “Kami berharap acara ini berkembang menjadi semacam gerakan kemanusiaan karena ada harapan agar Indonesia menjadi bangsa dan negara yang berkembang besar dengan cara merevolusi mental,” ujar Abdi. Pada acara konser Revolusi Harmoni itu dibacakan tujuh butir ikrar untuk gerakan revolusi mental bangsa, yakni:1. Berjanji tidak akan menggunakan kekerasan 2. Bekerja keras dengan cara yang benar dan menjauhi segala bentuk kecurangan 3. Bertekad membangun kesetaraan 4. Berbicara hanya untuk kebenaran 5. Selalu mengedepankan dialog yang jujur, terbuka, dan bersahabat 6. Menjaga dan merawat alam dan lingkungan 7. Meningkatkan potensi manusia untuk kepentingan Indonesia Sejahtera.

Diprediksi .... pemerintah,” jelasnya. Meski awal Ramadhan tidak sama dengan pemerintah, lanjut Nadjib, datangnya hari raya Idul Fitri atau Lebaran dipastikan akan bersamaan. “Puasa memang tidak bareng, tapi nanti Lebaran akan bareng dengan pemerintah,” ujarnya. Dalam menentukan awal p u a s a , Mu h a m m a d i y a h menggunakan metode hisab hakiki. Sementara, Nahdlatul Ulama (NU) selain menggunakan metode hisab juga menggunakan metode rukyat. Setidaknya ada beberapa tempat yang dijadikan untuk melihat hilal, seperti Pantai Tanjung Kodok (Lamongan), Pantai Ngliyep (Malang), Bukit Condro (Gresik), dan beberapa tempat lagi. Sementara pemerintah dalam menentukan awal Ramadhan melalui sidang isbat yang dipimpin oleh Kementerian Agama (Kemenag) RI. (ok/m13)

DPT Pilpres .... lalu. Dengan demikian DPT Sumut menjadi 9.902.948 dari sebelumnya 9.736.747 pemilih. Komisioner KPU Sumut Divisi Sosialisasi-Data-Informasi, Yulhasni mengatakan, pemilih pemula menjadi penyumbang terbesar sehingga bertambahnya DPT tersebut. Namun, katanya, jumlah Tempat Pemungutan Suara (TPS) justru berkurang. “Sebelumnya tempat pemungutan suara atau TPS berjumlah 30.281 pada Pileg 2014, dan untuk Pemilihan Presiden jumlah TPS berkurang menjadi 27.378 TPS,” katanya dan menambahkan, pengurangan jumlah TPS ini disebabkan adanya penggabungan beberapa TPS, karena bertambahnya jumlah maksimal pemilih per TPS menjadi 800 pemilih. APK Pilpres Secara terpisah, Pimpinan Bawaslu Provinsi Sumatera Utara Bidang Pengawasan dan Humas, Aulia Andri, mengemukakan kepada wartawan, pihaknya menemukan alat peraga kampanye (APK) span-


CAMAT Tanah Jambo Aye, Drs Amir Hamzah, melihat jenazah balita korban kebakaran, di UGD Puskesmas Cempeudak, Pantonlabu, Rabu (11/6) sore.

Balita Tewas .... masuk, saya langsung menarik ibunya untuk dibawa keluar. Saat itu ia berusaha menerobos api untuk mengambil anaknya,” kata Nekmin, 60, salah seorang saksi mata, di lokasi kejadian. Dugaan sementara, api berasal dari ledakan tabung gas yang biasa digunakan untuk menyepuh emas. Ledakannya menyambar cepat sehingga para korban tidak sempat menyelamatkan diri. Mereka baru dikeluarkan setelah ratusan warga sekitar menjinakkan api dengan peralatan seadanya.Para korban

Pelunasan BPIH ....

dilarikan ke Puskesmas Cempeudak Tanah Jambo Aye. Setengah kemudian, dua mobil pemadam kebakaran dari arah Lhoksukon meluncur cepat ke lokasi kejadian. Mereka melaju kencang, namun satu mobil yang di depan BL 8050 KB, menabrak kereta Supra Fit yang dikendarai Raju, di Simpang Rawang Iteik Pantonlabu. Sampai berita ini dikirim, korban meninggal masih berada di UGD Puskesmas Cempeudak Tanah Jambo Aye. Sedangkan korban luka-luka sebagian sudah dirujuk ke Rumah Sakit di Lhokseumawe. (b19)

melunasi BPIH. Djamil mengatakan, Ditjen PHU terus melakukan persiapan penyelenggaraan ibadah haji haji 1435H/2014M. SetelahPeraturan Presiden tentang Biaya Penyelenggaraan Ibadah Haji (BPIH) ditandatangani Presiden, Kemenag segera menerbitkan Peraturan Menteri Agama (PMA) tentang PembayaranBPIH Reguler. Sebelumnya, dalam kesempatan jumpa pers di kantor Kementerian Agama, Jakarta, Senin lalu, Dirjen PHU Abdul Djamil menyampaikan kuota haji regular tahun 1435H sebanyak 155.200 orang, yang terdiri dari 154.049 calon jamaah haji dan 1.151 petugas daerah. Ia menjelaskan kuota haji 1435H/2014M itu diperuntukan bagi jamaah haji yang

telah memiliki nomor porsi dan masuk dalam alokasi kuota Provinsi atau Kabupatan/ Kota tahun 1435H/2014M dengan ketentuan: 1. Belum pernah menunaikan ibadah haji; 2. Telah berusia 18 tahun atau telah menikah; 3. Jamaah lunas tunda tahun 1427H/ 2006M, 1428H/2007M, 1429H/2008M, 1430H/2009M, 1431H/2010M, 1432H/2011M, 1433H/2012M dan jamaah lunas tunda pemotongan 20% pada tahun 1434H/2013M. Namun, lanjut Abdul Djamil, ketentuan di atas bisa dikecualikan bagi jamaah haji yang sudah pernah menunaikan ibadah haji tapi akan memahrami isteri, anak kandung, dan/atau orang tua kandung, serta menjadi pembimbing ibadah haji sepanjang nomor porsinya masuk alokasi kuota 1435H/2014M.

duk dan baliho milik dua pasangan Capres-Cawapres 2014-2019, yang terpampang di sejumlah ruas jalan melebihi jumlah yang ditetapkan Peraturan Komisi Pemilihan Umum (PKPU) No. 16 tahun 2014, tentang kampanye Pemilihan Presiden dan Wakil Presiden 2014. “Sudah ada aturan mengenai APK. Dalam PKPU No. 16/2014 disebutkan, spanduk pasangan CapresCawapres hanya boleh didirikan 5 unit di setiap kampung dan dusun. Sedangkan baliho hanya diperbolehkan 3 unit di setiap kelurahan dan desa,’’ jelasnya. Namun, lanjutnya, masih ditemukan baliho dan spanduk terpampang melebihi ketentuan tersebut. ‘’B aliho dan spanduk tersebut memang bukan didirikan tim kampanye masingmasing pasangan Capres dan Cawapres, namun didirikan oleh relawan pasangan Capres dan Cawapres. Sanksi terhadap pelanggaran tersebut tidak diatur dalam PKPU, tetapi sifatnya kita mengimbau mereka,”ujarnya. Namun, kata Aulia, Ba-

waslu Sumut akan memanggil masing-masing tim kampanye pasangan Capres- Cawapres untuk menyampaikan larangan tersebut agar direalisasikan. Dia mengingatkan, sesuai dengan PKPU tersebut, rumah ibadah, rumah sakit, gedung milik pemerintah, lembaga pendidikan dan jalan-jalan protokol serta jalan bebas hambatan, dilarang digunakan sebagai sarana didirikannya alat peraga kampanye. “Juga fasilitas negara dilarang digunakan dalam setiap kegiatan kampanye. Apabila ada pejabat negara yang menggunakannya, silahkan laporkan ke Bawaslu maupun Panwaslu. Karena itu merupakan pelanggaran pidana dan ada sanksi hukumnya,”katanya. Aulia mengatakan, ada dugaan masih banyak pejabat negara menggunakan fasilitas negara, khususnya kendaraan dinas dalam setiap kegiatan kampanye. Kalau ada fotonya, tambah dia, laporkan ke Bawaslu supaya diproses. (m34)

WASPADA Kamis 12 Juni 2014

Medan Metropolitan


Tipikor Polresta Medan Geledah Kantor Distributor Alkes

Waspada/Rudi Arman

KASAT Reskrim Polresta Medan Kompol Jean Calvijn memimpin penggeledahan di kantor distributor alkes PT. Graha Agung Lestari milik tersangka, KA, 45, selaku pemenang tender di Jln. Sei Serayu Medan, Rabu (11/6).

MEDAN (Waspada): Sat Reskrim Unit Tipikor Polresta Medan menggeledah kantor distributor alkes PT. Graha Agung Lestari milik tersangka, KA, 45, selaku pemenang tender, di Jln. Sei Serayu Medan, Rabu (11/6). Penggeledahan dipimpin Kasat Reskrim Kompol Jean Calvijn Simanjuntak didampingi Kanit Tipiter AKP Azaruddin, Panit Tipikor Ipda Nelson Silalahi bersama tim identifikasi itu, bertujuan mencari barang bukti untuk melengkapi berita acara pemeriksaan (BAP) terkait dugaan korupsi alat kesehatan (Alkes) RSU Dr. Pirngadi Medan. Begitu tiba di lokasi, polisi yang memakai tanda pengenal dan rompi tersebut, masuk ke kantor distributor alkes dengan membawa kotak besar untuk menyimpan seluruh barang bukti yang ditemukan dari lokasi. Ada tiga tim yang melakukan penggeledahan. Masing-masing tim menggeledah lantai 1, 2 dan 3. Saat melakukan penggeledahan, para penyidik didampingi kepala lingkungan (Kepling) setempat dan disaksikan karyawan distributor alkes tersebut. Penggeledahan berlangsung selama 5 jam lebih, mulai pukul 10:00 hingga 15:30. Setiap tim membawa barang bukti berupa dokumen yang ditemukan dari kantor distributor tersebut. Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak mengatakan, penggeledahan ini untuk mencari barang bukti dari tiga tersangka yang ditahan setelah ditetapkan menjadi tersangka dan BAP-nya sudah dikirim ke Jaksa. “Penggeledahan untuk mencari barang bukti kekurangan dalam BAP tiga tersangka. Setelah dilakukan penggeledahan, ada beberapa barang bukti yang kita temukan untuk melengkapi BAP sesuai petunjuk dari jaksa,” kata Calvijn.

Di lokasi ini, lanjutnya, polisi menemukan barang bukti berupa komputer, kuitansi dan dokumen lainnya terkait dengan pengadaan alkes. Seluruh barang bukti tersebut dibawa ke Polresta Medan. “Selain mengamankan barang bukti dari lokasi, kita juga membawa tiga saksi untuk dimintai keterangannya,” jelas Calvijn. Seperti diberitakan sebelumnya, dalam kasus korupsi ini, Polresta Medan menetapkan tiga tersangka. Ketiga tersangka yakni KA, 45, warga Jln. Setia Budi Medan selaku pemenang tender Alkes yang menggunakan nama perusahaan PT IGM (Indofarma Global Medica), Suk, 50, PNS RSU Dr. Pirngadi Medan, warga Jln. Polonia Medan sebagai pejabat pembuat komitmen (PPK) dan AA, 45, warga Tangerang sebagai pelaksana kontrak. Tersangka KA selaku pemenang tender mendapat keuntungan dari proyek ini sebesar Rp900 juta. Kemudian pejabat RSU Pirngadi berinisial Suk menerima gratifikasi dari KA berupa tiket perjalanan ke luar negeri. Sedangkan tersangka AA menerima keuntungan atau fee sebesar Rp200 juta karena perusahaan miliknya PT IGM digunakan oleh KA untuk mengikuti tender tersebut. Ketiga tersangka dikenakan pasal 2 ayat 1, pasal 3, 5, 12b UU Korupsi No. 20 tahun 2001 tentang perubahan UU No. 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi dengan ancaman hukuman 15 tahun. Modus yang dijalankan ketiga tersangka yakni mengarahkan merek Alkes dari distributor tertentu untuk dijadikan bahan dalam pelelangan. Kemudian, harga Alkes di mark up hingga pembayaran 100 persen kepada rekanan. Alkes yang di mark up antara lain anestesi, kamera PCNL, LMA dan Vigon. Kerugian negara akibat perbuatan tersangka mencapai Rp3 miliar. (m39)

Menjelang Defenitif Eldin, Pimpinan SKPD Resah MEDAN (Waspada): Menjelang dilantiknya Plt Wali Kota Medan Dzulmi Eldin menjadi Wali Kota Medan defenitif, sejumlah pimpinan Satuan Kerja Perangkat Daerah (SKPD) di jajaran Pemko Medan mulai kasak kusuk. Apalagi, isu mutasi pejabat berkembang bakal dilakukan setelah Wali Kota defenitif dilantik.

PDAM Tirtanadi Perbaiki Jaringan Pipa Transmisi MEDAN (Waspada): PDAM Tirtanadi melakukan perbaikan jaringan pipa transmisi jalur pengantar dari Bronch Rumah Sumbul ke Tangki Bulat Sibolangit, yang mengalami gangguan. Diprediksi gangguan terjadi karena katup Flange Gate Valve jatuh atau tidak berfungsi dan menyumbat saluran pipa. “Saat ini petugas masih mencari penyebab dan lokasi tepat terjadinya penyumbatan dan sesegera mungkin memperbaikinya,” kata Kepala Divisi Public Relations PDAM Tirtanadi Ir Amrun ketika dihubingi melalui telepon selulernya, Rabu (11/6). Menurut dia, penyumbatan saluran pipa pengantar dari Bronch Rumah Sumbul ke Tangki Bulat Sibolangit, mengakibatkan jalur pengisian Bak Kuala yang normalnya diisi oleh empat jalur, saat ini hanya diisi dua jalur saja. Sehingga supply air kepada pelanggan di Kota Medan mengalami penurunan. Akibatnya, pendistribusian air ke beberapa wilayah pelayanan mengalami gangguan selama terjadinya penyumbatan tersebut dan juga selama proses pelaksanaan perbaikan dilakukan. Adapun wilayah pelayanan yang mengalami gangguan, yakni sebagian Cabang Padang Bulan, Cabang Delitua, dan Cabang Medan Kota. “Kami mohon maaf atas gangguan ini, keluhan gangguan air dapat disampaikan ke cabang terkait atau melalui Call Center Tirtanadi ke nomor 500444,|” sebut Amrun. (cwan)

Pembunuh Anggota TNI Dituntut 14 Tahun Penjara MEDAN (Waspada): Terdakwa Abdul Khaliq, warga Jln. Pinang Baris Gg Hasan Basri, dituntut 14 tahun penjara karena menikam hingga tewas anggota TNI AD Serma Samiun, yang bertugas di Kodim 0212/Tapanuli Selatan. Dalam tuntutan yang dibacakan Jaksa Penuntut Umum (JPU) Maria dalam persidangan di Pengadilan Negeri Medan, Selasa (10/6) menyatakan, terdakwa terbukti melakukan tindakan kekerasan menyebabkan korban Serma Samiun meninggal dunia. Dimana terdakwa dikenakan Pasal 338 KUHP. Diberitakan sebelumnya, petugas Polsek Sunggal membekuk Abdul Khaliq tersangka penikaman hingga tewas korban Serma Samiun, bertugas di Kodim 0212/Tapanuli Selatan. Tersangka ditangkap di rumahnya Jln. Karya III, Desa Helvetia, Kec. Sunggal, Kab. Deliserdang, Senin (6/1) subuh. “Sudah kita tangkap dan dibawa ke Mapolresta Medan untuk pemeriksaan lebih lanjut,” ujar Kapolsek Medan Sunggal Kompol Eko Hartanto, Senin (6/1) siang. Menurut Eko, pelaku merupakan anak dari Latifah (teman dekat korban) melakukan penikaman yang berujung kematian itu karena sakit hati ibunya sering dipukuli korban. “Saat kejadian berlangsung ibu pelaku juga berada di lokasi kejadian,” sebutnya. Kata dia, penikaman berawal saat tersangka melihat sebilah pisau pemilik warung Mie Aceh tempat korban dan ibu pelaku yang sedang membeli makanan. “Saat lengah, pelaku menikam dada ketiak kiri lalu tembus ke dada korban. Barang bukti sebilah pisau untuk membunuh korban juga sudah kita amankan,” tutur Eko.(m38)

Pantauan Waspada di lingkungan Pemko Medan, Rabu (11/6), sejumlah pejabat mulai kasak kusuk terkait sejumlah nama pejabat yang bakal diganti. Bahkan, sejumlah pejabat pun mulai resah atau ketar ketir jabatannya akan dicopot. “Kalau saya yang penting kerja sajalah, kalau dicopot itu sudah kewenangan atasan saya. Tapi kabarnya setelah dilantik menjadi pejabat defenitif Pak Eldin akan melakukan mutasi pejabat. Itu semua hak mutlak pimpinan,” kata salah seorang pejabat eselon II di jajaran Pemko Medan yang minta iden-

titasnya disembunyikan. Kata dia, setelah Eldin menjadi Wali Kota defenitif, maka untuk memutasi pejabat tentu lebih mudah karena tidak perlu lagi berkoordinasi dengan Gubsu dan Mendagri. “Kalau dulu sebelum defenitif kan masih sulit melakukan mutasi, namun kalau sudah defenitif, soal mutasi ini menjadi kewenangan mutlak tanpa perlu lagi meminta persetujuan Gubsu dan Mendagri,” sebutnya. PltWali Kota Medan Dzulmi Eldin sendiri mengaku, saat ini sudah ada beberapa pejabat di bawahnya yang mulai kasak

kusuk. Bahkan, sudah ada yang mencoba menyodorkan materi untuk mempertahankan dan meminta jabatan. “Saat ini saya saja disebut sudah ada memiliki sekretaris yang tugasnya khusus mengurus dan meloloskan orang yang mau menjadi pejabat di Pemko ini, saya heran siapa sekretaris saya? Inilah ada isu yang sudah berkembang,” tuturnya. Eldin menegaskan, dirinya sudah berkomitmen bahwa mutasi pejabat yang dilakukan merupakan proses kerja yang harus dilakukan dan berdasarkan kepada profesional kerja

dan bukan karena materi. “Saya ingatkan bahwa komitmen saya tidak akan ada pergantian pejabat karena materi. Tapi berdasarkan kepada hasil penilaian dari tim baperjakat, maka bekerjalah secara profesional. Saya juga tidak akan mengganti pejabat secara tendensius,” sebutnya. Untuk itulah, kata Eldin, pejabat jangan mencoba-coba menyodorkan materi untuk meraih ataupun mempertahankan jabatannya.“Saya ingatkan sekali lagi jangan mencobacoba menyodorkan materi kepada saya, tapi bekerjalah

Polsek Medan Barat Sita 12 Ribu Pil Ekstasi Dua Kurir Narkoba Ditangkap MEDAN (Waspada): Tim Khusus Reskrim Polsek Medan Barat berhasil menggagalkan peredaran narkoba di tempat hiburan malam. Pada Selasa (10/6) malam, mereka menangkap dua kurir narkoba dan menyita 12 ribu pil ekstasi dalam penggerebekan di sebuah rumah Jln. Putri Hijau, Lorong IV, Pulo Brayan Medan. Informasi yang diperoleh

Waspada di lapangan, penangkapan dua kurir narkoba itu dipimpin Kanit Reskrim AKP S. Sembiring, SH dibantu Panit Reskrim Iptu Alex Silalahi, SH. Sebelum melakukan penggerebekan, AKP S. Sembiring, SH berkoordinasi dengan atasannya Kapolsek Medan Barat Kompol Rony Nicolas Sidabutar, SIK, SH. Setelah mendapat arahan, tim khusus langsung me-

nuju ke lokasi. Saat dilakukan penggerebekan, polisi berhasil menangkap dua kurir narkoba yakni MF, 18, dan SR, 25, (wanita). Selain itu, polisi menyita 12 bungkusan plastik masing-masing berisi 1.000 butir pil ekstasi. Sumber Waspada mengatakan, pil ekstasi tersebut dipasok sekitar dua hari lalu oleh seorang

wanita. Sedangkan pria yang menyuruh wanita tersebut mengantar ekstasi, masih diburon. “Belum diketahui darimana asal ekstasi tersebut. Sebab, wanita yang mengantar dan pria yang menyuruhnya, kini masih diburon. Tetapi dua tersangka yang ditangkap Polsek Medan Barat merupakan kurir narkoba,” ungkap sumber. (m36)

Polisi Lepas Oknum Dokter Tersangka Penipuan Calon PNS MEDAN (Waspada): Sehari setelah menjalani pemeriksaan di ruang penyidik Polsek Percut Seituan karena dituduh melakukan penipuan Rp100 juta, oknum dokter gigi berinisial DN, 50, warga Jln. Bajak II, Kec. Medan Amplas, akhirnya dilepas, Selasa (10/6). Namun, berkas acara pemeriksaan (BAP) tersebut tetap dilanjutkan ke Jaksa Penuntut Umum. Informasi yang diperoleh di kepolisian, oknum dokter gigi yang berstatus PNS di Dinas Kesehatan Kota Sibolga itu, pada Minggu (8/6), ditangkap di

kawasan kanal Delitua. Oknum dokter gigi tersebut diduga melakukan penipuan terhadap seorang bidan Melda, 23, warga Jln. Garuda Raya, Perumnas Mandala. Oknum dokter gigi tersebut melakukan penipuan dengan modus akan memasukkan korban menjadi pegawai negeri dan meminta uang Rp100 juta. Namun, setelah uang Rp100 juta diberikan, ternyata korban tidak diterima menjadi PNS. Namun, saat korban hendak meminta kembali uangnya, oknum dokter gigi selalu meng-

hindar dan menghilang. Akibatnya, korban melaporkan kasus tersebut ke Polsek Percut Seituan pada Agustus 2013. Setelah hampir setahun diburu, akhirnya oknum dokter gigi itu ditangkap saat sedang makan mie pangsit di kawasan Delitua. Ketika diperiksa selama beberapa jam oleh penyidik Aiptu Edi Riatman, di ruang penyidik pada Senin (9/6), tersangka DN terlihat santai saja. Bahkan, saat oknum dokter gigi itu hendak difoto oleh wartawan, juru periksa Aiptu Edi Riatman menghalang-halangi wartawan untuk mengambil foto wanita tersebut. Begitu juga pihak keluarga tersangka terlihat kasak-kusuk keluar masuk ruang penyidik Polsek Percut Seituan. Selain itu,

seorang oknum perwira yang diduga kerabat keluarga tersangka terlihat berada di ruang penyidik untuk menjamin pembebasan tersangka DN. Menjelang malam, oknum dokter gigi tersebut akhirnya bisa menghirup udara bebas. Kapolsek Percut Seituan Kompol Ronald Sipayung yang dikonfirmasi mengakui, tersangka DN memang tidak ditahan, namun mendapat penangguhan penahanan. “Tersangka DN memang tidak ditahan karena ada pihak keluarga yang menjaminnya. Apalagi, antara tersangka dan korban telah melakukan perdamaian, namun berkas perkaranya tetap dilanjutkan ke jaksa penuntut umum,” tutur Ronald, Rabu (11/6). (h04)

dengan profesional,” ujarnya. Dia mengimbau pejabat di jajaran Pemko Medan, agar tidak percaya kepada orang yang menyebut dirinya dapat meloloskan suatu jabatan tertentu. “Jangan percaya kalau ada orang yang bisa meloloskan suatu jabatan, atau percaya sama orang yang bisa mempertahankan jabatan anda, tapi percayalah kepada kemampuan diri sendiri,” katanya. Sementara itu, Sekda Kota Medan Syaiful Bahri mengatakan, sampai saat ini belum ada nama-nama pejabat yang akan diganti. Terkait pergantian peja-

bat itu pun merupakan kewenangan dari Wali Kota Medan. “Kalau pergantian pejabat itu kewenangannya Pak Eldin, kalau kami kan hanya memberi rekomendasi penilaian saja, ketentuan tetap ditangan pak wali kota,” tuturnya. Namun, Syaiful mengakui, dirinya memang sudah menerima SK Mendagri tentang defenitifnya Dzulmi Eldin sebagai Wali Kota Medan. “Tadi sudah saya terima SK Mendagrinya. Saya sendiri yang langsung menerimanya bersama dewan di Pemprovsu,” sebutnya. (m50)

Dua Pencuri Sepedamotor Diamuk Massa MEDAN (Waspada): Dua pemuda berusia remaja diamuk massa setelah kepergok mencuri sepedamotor di depan warnet Jln. Denai, Kec. Medan Denai, Sabtu (7/6) sekira pukul 02:30. Tersangka berinisial LS, 16, dan DS, 17, keduanya warga Jln. Garuda IV, Perumnas Mandala, Kec. Percut Seituan, dijebloskan ke dalam sel Polsek Medan Area, sedangkan seorang lagi teman mereka berinisial ZS melarikan diri. Informasi yang diperoleh di kepolisian, pagi itu, ketiga remaja berinisial LS, DS dan ZS (buron) dengan mengendarai beca bermotor (betor) datang ke depan warnet Krim Sondai Net di Jln. Denai. Sesampainya di depan warnet, ketiganya membagi tugas masing-masing. Tak lama menunggu, korban Juhri, 40, warga Jln. Denai, datang dengan mengendarai sepedamotor Honda Vario Hitam BK 6222 ADO. Lalu korban memarkirkan kendaraannya di depan warnet. Saat itulah, pelaku langsung beraksi. Tersangka LS berpindah posisi dengan berpura-pura duduk di atas sepedamotor milik korban. Sementara tersangka DS melihat-lihat situasi, sedangkan tersangka ZS standby di betor. Selanjutnya, tersangka LS memasukkan kunci T yang telah dipersiapkannya untuk mencongkel sepedamotor korban. Namun, saat sepedamotor mau dibawa kabur, korban keluar dan memergoki aksi para tersangka. Spontan korban teriak maling, hingga mengundang perhatian warga yang langsung melakukan pengejaran terhadap tersangka yang berusaha kabur. Massa akhirnya menangkap tersangka LS dan DS. Keduanya langsung dihajar hingga babak belur, sedangkan tersangka ZS berhasil meloloskan diri. Bahkan, kedua tersangka nyaris dibakar massa meski sempat disiram dengan bensin. Petugas Polsek Medan Area yang tiba di lokasi kejadian segera mengamankan kedua tersangka dari amuk massa yang nyaris membakar mereka hidup-hidup. Selanjutnya, kedua tersangka dan barang bukti diamankan ke Polsek Medan Area. Kapolsek Medan Area Kompol Rama S Putra saat dikonfirmasi membenarkan penangkapan kedua tersangka. “Kedua tersangka sempat dihakimi massa. Dari situ, kita turut mengamankan 1 unit sepedamotor Vario milik korban, 1 buah mata kunci T. Kita juga akan melakukan pengembangan terhadap keduanya untuk menangkap temannya yang kabur. Selain itu, kita juga menyelidiki apakah para tersangka ada hubungannya dengan pelaku yang sebelumnya kita tangkap,” ujarnya. (h04)

Medan Metropolitan

A4 MUI Medan Labuhan Dikukuhkan

BELAWAN (Waspada): Pengurus Majelis Ulama Indonesia (MUI) Kec. Medan Labuhan masa tugas 2014-2019 dikukuhkan MUI Kota Medan, di Masjid Al Husain, Lingkungan 9, Kel. Besar, Kec. Medan Labuhan, Sabtu (7/6) malam. Dihadapan ratusan umat yang terdiri dari pengurus dan anggota organisasi Islam, kelompok perwiritan, Camat Medan Labuhan Zain Noval, lurah dan kepling, kepengurusan MUI Medan Labuhan yang dikukuhkan Ketua Drs H Norman S, Sekretaris Drs Nazaruddin Panjaitan, dan Bendahara Drs Muhmud Al Husyairi. Ketua MUI Kota Medan M Hatta dalam sambutannya, mengingatkan tugas dan pekerjaan pengurus MUI cukup berat dan membutuhkan pengorbanan. “Menjadi pengurus MUI dibutuhkan kesabaran yang tinggi dan pengorbanan materi serta perasaan karena MUI tidak memiliki anggaran. Untuk itu pengurus MUI harus sadar bahwa pekerjaannya adalah untuk kepentingan umat,” katanya. Sementara itu, Ketua MUI Medan Labuhan Drs H Norman S mengatakan, walau belum memiliki kantor, dia telah memimpin MUI Medan Labuhan selama 10 tahun dan bersama pengurus telah berusaha mengerjakan semua program yang direncanakan. “Alhamdulillah semua program bisa kita selesaikan, walau kantor belum ada karena kita harus yakin bahwa rezeki akan ada jika kita ikhlas bekerja untuk kepentingan umat,” sebutnya. (h03).

Bandar Narkoba Diringkus BELAWAN (Waspada): Naz alias Bet alias Cong, 54, bandar sabu di kawasan Lingkungan 21, Kel. Pekan Labuhan, Kec. Medan Labuhan, diringkus petugas Satuan Narkoba Polres Pelabuhan Belawan di dekat rumahnya, Jumat (6/6). Dari tangan tersangka polisi menyita barang bukti 24,6 gram sabu dan 1,7 gram daun ganja. Kasat Narkoba Polres Pelabuhan Belawan AKP JS Pakpahan, Sabtu (7/6) mengatakan, penangkapan bandar narkoba tersebut dilakukan setelah berkat informasi masyarakat yang resah dengan peredaran narkoba di lingkungannya. Lalu kita cek untuk menindaklanjuti kebenaran informasi tersebut dengan melakukan pengintaian selama tiga hari,” katanya. Tersangka Naz yang telah menjadi target operasi (TO) ditangkap petugas saat berjalan menuju benteng Sungai Deli yang ada di belakang kediamannya. Dari saku celana tersangka, polisi menyita dompet berisi 31 bungkus (paket) sabu seberat 24,6 gram dan satu bungkus daun ganja seberat 1,7 gram, serta sebuah pipet diduga digunakan sebagai alat untuk menakar ukuran sabu. Warga yang mengetahui penangkapan itu langsung berdatangan. Namun, tiba-tiba sejumlah warga melempari polisi menggunakan batu. Menyadari hal itu, dengan cepat petugas memboyong tersangka. “Saat adanya lembaran batu itu, kita tidak ada mengeluarkan tembakan. Namun sangat disayangkan, tindakan baik kita memberantas peredaran narkoba yang merusak generasi penerus bangsa dan memang sebelumnya masyarakat sendiri yang meminta kita untuk menangkap pengedarnya, tapi kenapa justru polisi yang diserang dan dilempari batu,” sebut Pakpahan. Untuk mempertanggungjawabkan perbuatannya, tersangka hingga kemarin masih menjalani proses pemeriksaan. Sedangkan, seorang rekan tersangka berinisial M diduga selaku pemasok narkoba masih diburon petugas. “Ancaman hukuman untuk tersangka maksimal 20 tahun penjara karena melanggar pasal 114 ayat 2 Undang Undang Nomor 35 Tahun 2009 tentang narkotika. Sedangkan, untuk rekan tersangka diduga selaku pemasok narkoba masih dalam pengejaran,” ujar Pakpahan. Sementara itu, pemerhati sosial Medan Utara Syahrilal MY sangat menyayangkan sikap warga yang terkesan tidak senang dengan tindakan polisi dalam upaya memberantas narkoba. “Saya yakin yang tidak senang itu adalah pengguna narkoba. Walaupun demikian saya berharap polisi terus memberantas narkoba terutama di Medan Labuhan,” tuturnya. (h03)

Tewas Ditikam Tetangga BELAWAN (Waspada): Joi Hutabalian, 30, yang lebih akrab dipanggil dengan Pak Enjel warga Jln. Pelabuhan Raya, Gang Sawita Kencana, Lingkungan 14 Belawan, tewas ditikam tetangganya, Minggu (8/6) sekitar pukul 23:00. Informasi yang dapat dihimpun dari lapangan, korban yang bekerja di PT Waruna dan menyewa rumah bertetangga dengan pelaku Ded, 28, yang bekerja di salah satu pergudangan ikan di Pelabuhan Perikanan Samudera Belawan (PPSB) Gabion. Selama satu tahun lebih bertetangga, timbul perselisihan di antara mereka dan berujung pelaku yang diduga emosi menikam korban hingga tewas. Kasat Reskrim Polres Pelabuhan Belawan AKP Ronni Bonic melalui Kanit Resum Iptu Yunardi saat dikonfirmasi, Senin (9/ 6) mengatakan, awalnya korban dan pelaku terlibat pertengkaran gara-gara masalah memasang lotere di satu warung yang tidak jauh dari lokasi. Pelaku Ded keberatan dengan keberadaan korban di warung tersebut dan minta jangan ribut. Tidak terima ditegur pelaku, korban menantang berkelahi sehingga terjadi penikaman hingga merengut nyawa Joi Hutabalian. “Sebelum kejadian perselisihan antara keduanya juga sudah ada, seperti masalah sepedamotor pelaku yang rusak saat dipinjam korban dan ketika pelaku meminta diperbaiki korban menghindar,” kata Yunardi. Usai melakukan penikaman, pelaku Ded melarikan diri bersama keluarganya. Sampai saat ini polisi masih terus melakukan pengejaran terhadap Ded. Sedangkan mayat korban disemayamkan di rumah duka setelah diautopsi di RS Pirngadi Medan. (h03)

intropeksi diri serta lebih meningkatkan etos kerja guna menghasilkan karya-karya nyata dan bermanfaat langsung dalam mengisi pembangunan. Selain untuk membangun silaturahmi antara umarah (pemerintah) dengan para ulama dan masyarakat Kota Medan, tujuan kegiatan ini digelar juga untuk mengajak semua agar dapat mempelajari makna dan hikmah yang terkandung di

Kamis 12 Juni 2014

Sopir Angkot Cabuli 9 Bocah MEDAN (Waspada): Seorang sopir angkot yang diduga melakukan pelecehan seksual terhadap 9 bocah di Simpang Gardu Perumahan Milala, Desa Namo Bintang Pancur Batu, Deliserdang, diadukan orangtua korban ke Polresta Medan, Rabu (11/6) sore. Aksi pelaku berinisial RG, 55, yang sudah bercucu itu, terbongkar dari seorang korban K, 7, yang menceritakan kepada teman-temannya tentang pelecehan yang dialaminya. “Pertama kali anak ibu E bercerita kepada teman-temannya,” kata salah satu orangtua korban bermarga Panjaitan saat membuat pengaduan di Sentra Pelayanan Kepolisian Terpadu Polresta Medan. Cerita itu pun terdengar oleh ibunya E. Penasaran, si ibu mencoba menanyakan kepada anaknya tersebut. Ternyata benar, si E mengakui dirinya telah diberlakukan tidak senonoh oleh tetangganya itu. Kabar itu pun terdengar oleh warga sekitar, hingga akhirnya terkuak sudah sembilan bocah telah dilecehkan pelaku. “Rupanya anak saya ngaku

kalau duburnya sudah dijolokjolok dengan jari si pelaku ini,” kata ibu korban E. Sejumlah orangtua korban kemudian mendatangi kediaman tersangka. Namun, RG sempat berdalih tidak mengakui, tapi sejumlah warga beramai-ramai memboyongnya ke Polsek Pancurbatu. Disitu tersangka sempat tidak mengaku. Dari petugas Polsek Pancurbatu, keluarga korban disarankan membuat laporan ke Polresta Medan. Sedangkan sopir angkot itu masih ditahan di Polsek Pancurbatu untuk diserahkan ke Polresta Medan. 15 Wanita Diamankan Sementara itu, Polda Sumut menggerebek tempat kusuk (massage) Surla Spain di Jln. Merak Jingga, Medan Barat, diduga dijadikan lokasi prostitusi, Rabu sore. Dari lokasi itu, polisi mengamankan 15 wanita diduga pekerja seks komersial (PSK) dan seorang kasir. Keterangan di Podasu menyebutkan, penggerebekan dilakukan setelah petugas menerima informasi adanya aktifitas prostitusi di lokasi tersebut. Berdasarkan informasi itu, petugas Subdit IV/Remaja Anak danWanita (Renakta) Dit Reskrimum

Poldasu melakukan pengintaian dan penggerebekan. Saat dilakukan penggerebekan, petugas menemukan seorang wanita pekerja massage dalam keadaan tanpa busana bersama seorang pria di dalam kamar. “Wanita itu langsung menutupi tubuhnya dengan handuk putih saat kita melakukan penggerebekan,” kata Kanit pada Subdit IV/Renakta Kompol Edison Sitepu yang memimpin penggerebekan. Selain mengamankan 15 wanita dan kasir, petugas juga mengamankan barang bukti berupa uang Rp800 ribu sebagai alat transaksi prostitusi, satu buah tab, uang kasir senilai Rp1,5 juta, dan beberapa lembar kertas berisikan catatan buku tamu. Direktur Dit Reskrimum Poldasu Kombes Pol. Dedy Irianto dikonfirmasi wartawan mengatakan, pihaknya masih memeriksa para wanita yang diamankan. “Mereka masih diperiksa, kalau terbukti pemilik massage itu mempekerjakan wanita sebagai pemuas nafsu pria hidung belang, akan dikenakan pasal yang berkaitan dengan human trafficking dan akan ditahan,” ujarnya.(m39/m27)

Tewas Jatuh Dari Angkot MEDAN (Waspada): Seorang penumpang angkutan kota (angkot) Tio Midar Br Sitanggang, 51, tewas mengenaskan dengan kondisi kepala pecah setelah terjatuh dari angkot Rahayu 103 BK 1016 HZ yang ditumpanginya di Jln. Jamin Ginting, Pokok Mangga, Simpang Selayang, Medan Tuntungan, Rabu (11/6). Menurut informasi diterima wartawan, sebelumnya korban, warga Jln. Lada, Perumnas Simalingkar, menumpang angkot tersebut dari Pancurbatu menu-

ju arah Medan. Namun, sesampainya di lokasi kejadian, tibatiba datang sepedamotor menyalip angkot. Spontan sopir angkot Jesron Situmeang, 22, warga Desa Tanah Pinem, Kec. Tiga Lingga, Tanah Karo, membanting stir ke kiri untuk menghindari tabrakan. Akibatnya, korban terlempar dari angkot ke badan jalan sehingga menderita cedera berat di bagian kepala. Selanjutnya, sopir angkot Jesron segera membawa korban ke RSUP H Agam Malik untuk

mendapat pertolongan. Namun, setelah beberapa saat dalam perawatan, korban menghembuskan nafas terakhir. Petugas Lantas Polsek Pancurbatu yang turun ke lokasi melakukan olah tempat kejadian perkara dan segera ke RSUP H Adam Malik Medan. Mengetahui korban tewas, petugas mengamankan sopir Jesron Situmeang ke Polsek Pancurbatu . Kanit Lantas Polsek Pancurbatu AKP Edward Tampubolon membenarkan peristiwa itu.(m40)

Poldasu Diminta Proses Kasus Aborsi Oknum PNS MEDAN (Waspada): Poldasu diminta memproses kasus aborsi yang diduga melibatkan seorang oknum PNS Biddokes Polda Sumut berinisial DSP. Kasus itu dilaporkan David Mulyono Sirait ke Subdit IV Direktorat Reserse Kriminal Umum Poldasu pada Selasa, 18 Juli 2012. Korban menduga kasus tersebut diendapkan Poldasu. Pasalnya, terlapor dalam laporan yang tertuang pada LI/72/VII/ 2012 Ditreskrimum itu, hingga kini belum mendapat tindakan tegas. “Saya baru menerima 2 kali Surat Pemberitahuan Perkembangan Hasil Penyidikan (SP2HP) atas laporan itu. Pertama, saya menerima SP2HP Nomor B/1566/IX/2012/Ditreskrimum pada 11 September 2012. Kedua, saya menerima SP2HP Nomor B/1054/X/2012/ Ditreskrimum pada 24 Oktober 2012,” kata korban David Mulyono Sirait kepada wartawan di Medan, Rabu (11/6). Setelah itu, David tidak pernah lagi menerima kabar atas laporan tersebut. “Terlebih ketika itu saya mendekam di dalam

penjara,” ujarnya. Dijelaskan David, keberadaannya di dalam penjara itu juga diyakini akibat kriminalisasi oleh DSP yang merupakan isteri sahnya. David melaporkan DSP karena diduga berselingkuh dengan AKBPYSDS serta diduga melakukan aborsi. David mengaku tidak pernah dipanggil polisi namun langsung ditangkap berdasarkan Surat Perintah Penangkapan Nomor SP.Kap/230/VIII/ 2012 tanggal 25 Agustus 2012, lalu diperiksa dan langsung dijebloskan ke penjara sesuai Surat Perintah Penahanan Nomor SP.Han/138/VIII/2012 tanggal 26 Agustus 2012, oleh pihak Polsek Delitua. “Mereka bilang penangkapan dan penahanan saya berdasarkan laporan isteri saya tanggal 13 Juli 2012. Laporan dengan nomor LP/568/VII/2012/SU/ RESTA MEDAN/SEK DELTA itu merupakan kasus KDRT, “ ujarnya. Kasubdit IV-Renakta Direktorat Reserse Kriminal Umum Polda Sumatera Utara AKBP Juliana Situmorang yang dikonfir-

masi wartawan mengatakan, kasus dugaan aborsi yang dilakukan oknum Biddokes Polda Sumut berinisial DSP, tidak dapat ditingkatkan ke proses penyidikan. Begitu juga dengan dugaan perselingkuhan yang diduga dilakukan AKBP YSDS dengan DSP, tidak dapat dibuktikan. Sementara untuk laporan David Mulyono Sirait yang ditetapkan sebagai laporan informasi sesuai LI/72/VII/2012 Ditreskrimum, juga sesuai Peraturan Kepolisian (Perkap) XII. “Kita sudah panggil dokter ahli dari IDI dan dinyatakan kalau proses curettage yang dilakukan, sudah sesuai SOP dan tidak merupakan malapraktik. Untuk izin suaminya, saat dilakukan curettage itu, si suami tidak datang sehingga pihak dokter menghubungi ibu dari yang melakukan curettage, untuk meminta izin,” ungkap Juliana. Untuk penyelidikan kasus itu, kata Juliana, pihaknya juga sudah diperiksa oleh Bidang Propam Polda Sumut. Namun, pihak Bid Propam Poldasu tidak menemukan kesalahan. (m39)

Eldin: Israk Mikraj Meningkatkan Ibadah MEDAN (Waspada): Ribuan warga dari seluruh penjuru Kota Medan, menghadiri peringatan Israk Mikraj yang digelar Pemko Medan di Lapangan Sekolah Dinul Islam Jln. Letda Sujono Medan, Rabu (11/6). Pelaksana Tugas Wali Kota Medan Dzulmi Eldin berharap melalui peringatan Israk Mikraj ini dapat dijadikan sebagai momentum yang baik bagi semua, menjadi spirit untuk melakukan


dalam peristiwa Israk Mikraj yang merupakan salah satu mukjizat terbesar dalam kerasulan Nabi Muhammad SAW. Karenanya, peristiwa luar biasa ini wajib diyakini dan diimani oleh setiap umat Muslim. Apalagi dalam peristiwa ini turun perintah melaksanakan shalat lima waktu. Atas dasar itulah Eldin tidak ingin peringatan Israk Mikraj yang rutin dilaksanakan setiap

Waspada/ME Ginting

PLT WALI Kota Medan Dzulmi Eldin saat memberikan kata sambutan di hadapan ribuan warga yang menghadiri acara Israk Mikraj, Rabu (11/6).

tahunnya ini hanya sekadar seremonial. Justru harus dapat diimplementasikan nilai-nilai dan hikmah yang terkandung di dalamnya, seperti keteladanan, kesungguhan, ketabahan dan kesabaran Rasul dalam mengemban amanah. “Jadi saya menilai peringatan Israk Mikraj ini memiliki arti dan maksud yang cukup penting, terutama mengajak seluruh umat Muslim untuk senantiasa mendekatkan diri kepada Allah SWT, mendirikan shalat, zakat dan puasa. Oleh karenanya, mari kita tingkatkan kualitas ibadah kita sebagai sarana efektif bagi kita semua berkomunikasi dengan Allah SWT secara vertikal, guna menuntun kita berperilaku lebih bermoral dan berakhlakul karimah,” kata Eldin. Jika hal itu dilakukan, menurut Eldin, optimis akan tercipta insan-insan yang berbudi luhur, suka tolong menolong serta bergotong royong dalam kehidupan sehari-hari. Dengan demikian sangat mendukung dalam upaya mengabdikan diri kepada masyarakat selaku abdi negara, khususnya dalam rangka meningkatkan pelayanan umum serta kesejahteraan masyarakat, sekaligus menciptakan kota yang religius. Selanjutnya menyikapi akan datangnya bulan suci Ramadhan 1435 H dan pemilihan presiden (Pilpres), Eldin mengajak semua untuk menggelorakan

semangat memperbaiki kuantitas dan kualitas ibadah. Selain itu memantapkan kerukunan, tolerasnsi serta memupuk rasa persaudaraan dalam bingkai ukhuwah Islamiyah. “walaupun ada perbedaan pendapat maupun perbedaan pilihan, namun kita harus tetap saling menghormati, tidak saling menghujat atau memusuhi sehingga kedamaian dan ketentraman di tengah-tengah masyarakat tetap terjaga. Dengan demikian kita dapat melaksanakan ibadah Ramadhan dengan khusuk dan damai,” tuturnya. Ustad Ahmad Wijianto dalam tausiyahnya mengatakan, melalui peringatan Israk Mikraj ini semakin menambah rasa keimanan, sehingga selalu mengingat Allah dalam kehidupan sehari-hari melalui shalat, zikir maupun doa. “Siapa yang selalu ingat kepada Allah, maka hidupnya akan selalu diberkati,” ujarnya. Dengan selalu mengingat Allah, kata Ahmad, membuat seseorang akan selalu mudah berbuat kebaikan. Selain itu juga akan selalu mengingat kematian, sehingga mampu mengendalikan segala perbuatannya. Kemudian dia mengajak semua untuk terus menjalin silaturahmi dengan sesama dan keberadaannya selalu bermanfaat bagi yang lain. “Sebaik-baiknya manusia adalah orang yang bermanfaat bagi orang lain,” tuturnya. (m50)

Waspada/Abdullah Dadeh

KETUA Aceh Sepakat Cabang I H Fazli Usman SE, menyerahkan bantuan kepada Nurdin (pakai tongkat) disaksikan pengurus lainnya Drs T Asbi Hasan, Amri Adjie (tengah) dan T Yusrizal ST.

Aceh Sepakat Cabang I Bantu Warga Kurang Mampu MEDAN (Waspada): Pengurus Aceh Sepakat Cabang I Medan Area, menyerahkan bantuan dana bergulir kepada masyarakat kurang mampu, untuk membuka usaha kecil di markas IPTR Jln. Amaliun Medan, Rabu (11/6). Ketua Cabang I Aceh Sepakat Medan Area H Fazli Usman SE, menyerahkan bantuan dana Rp2 juta kepada Nurdin, 40, warga kaki cacat (disabilitas), agar dapat membuka usaha penjualan minunan, rokok, dan makanan lainnya. “Dana diserahkan merupakan dana sosial bantuan bergulir dari masyarakat untuk masyarakat agar dapat dimanfaatkan membuka usaha kecil-kecilan,” kata Drs T Asbi Hasan, selaku Pembina Aceh Bussiness Community (ABICOM). Melalui dana bergulir ini diharapkan dapat membantu kalangan warga lainnya, jika dana yang diserahkan tersebut usaha mereka berkembang. “Bantuan tersebut lebih bersifat bantuan ikhlas apalagi dalam suasana menjelang Ramadhan, kalau berhasil bisa kembali modal lebih baik,” sebut Fazli Usman.

Hadir pada kesempatan itu pengurus Himpunan Niagawan Aceh (HUNA) Amri Adjie, Sekretaris Umum IPTR SumutYusrizal ST, Nurdin Dahlan, dan lainnya. Menurut Amri Adjie, selama ini HUNA beranggotakan lebih kurang 100 orang, yang merupakan pelaku ekonomi usaha menengah dan kecil di Medan. “Di HUNA kita melakukan kegiatan pengajian rutin anak-anak dan orang dewasa yang diikuti lebih kurang 70 hingga 100 orang setiap Selasa malam maupun Minggu malam,” ujarnya. Kata dia, bantuan diberikan kepada Nurdin (penyandang cacat/disabilitas) agar dapat menghidupi istri dan tiga orang anaknya dengan melakukan usaha kecil-kecilan. Dalam kesempatan itu, Ketua Cabang I Aceh Sepakat Fazli Usman dan Asbi Hasan menyatakan, pihaknya sedang mengumpulkan bahan-bahan kebutuhan sehari-hari (Sembako), untuk menggelar pasar murah kepada warga Medan Area dan sekitarnya dalam memasuki Ramadhan. (m32)

Langkat Percayakan Pembayaran PBB-P2 Ke Bank Sumut MEDAN (Waspada): Pemerintah Kabupaten Langkat mempercayakan Bank Sumut sebagai bankpenerimapembayaranPajakBumidanBangunan sektor Pedesaan dan Perkotaan (PBB-P2). Untuk menyebarluaskan informasi tersebut ke seluruh wajib pajak Langkat, Dinas Pendapatan Daerah Pemkab Langkat bekerjasama dengan Bank Sumut, melakukan sosialisasi Pengalihan Pembayaran PBB-P2, Kamis (5/6) lalu. Dalam sosialisasi bertajuk “Pekan Panutan Pembayaran Pajak Bumi dan Bangunan Sektor Perkotaan Pedesaan (PBB-P2) Kabupaten Langkat”, wajib pajak yang telah menerima surat pemberitahuan pajak diimbau agar dapat melunasinya tepat waktu. Untuk memberikan kemudahan pembayaran PBB-P2, Pemkab Langkat telah menunjuk Kantor Bank Sumut Cabang Stabat, sebagai bank penerima pembayaran PBB-P2. Sebagaimana diketahui, terhitung 1 Januari 2014, semua kabupaten/kota diwajibkan mengelola PBB-P2. Pengalihan pengelolaan PBB-P2 dari pemerintah pusat ke pemerintah kabupaten/ kota itu merupakan bentuk tindaklanjut kebijakan otonomi daerah dan desentralisasi fiscal, sebagaimana tertuang dalam Undang-Undang Nomor 28 Tahun 2009 tentang Pajak Daerah dan Retribusi Daerah (PDRD). Dengan adanya pengalihan ini maka kegiatan pendataan, penilaian, penetapan, pengadministrasian, pemungutan/penagihan dan pelayanan PBB-P2 diselenggarakan oleh kabupaten/kota. Sedangkan kerjasama dengan Bank Sumut sebagai bank penerima pembayaran PBB-P2 dengan tujuan untuk menciptakan efektifitas dan efisiensi dalam pemungutan PBB-P2. Pemimpin Divisi Jaringan dan Layanan Bank Sumut TM Jeffri mengatakan, untuk sementara

pembayaran PBB-P2 di Kabupaten Langkat, masih dilakukan secara offline di mana wajib pajak bisa melakukan pembayaran PBB-P2 di Kantor Bank Sumut Cabang Stabat. “Direncanakan, pada tahun 2015 pembayaran PBB-P2 di Kabupaten Langkat akan dilakukan dengan menerapkan payment online system (sistem pembayaran online), sehingga pembayaran PBB-P2 dapat dilakukan di semua unit Kantor Bank Sumut yang ada di Kabupaten Langkat,” ujar Jeffri didampingi Sekretaris Perusahaan Didi Duharsa. Khusus di Kabupaten Langkat yang memiliki 35.000 wajib pajak, pada tahun 2014 diproyeksikan potensi penerimaan sekitar Rp8 miliar. Sejak 2014, dari 33 kabupaten/kota se-Sumatera Utara, 19 kabupaten/kota di antaranya telah melakukan kerjasama pembayaran PBB melalui Bank Sumut. Dari 19 kabupaten/kota itu, wajib pajak di 6 kabupaten/kota telah dapat melakukan pembayaran PBB-P2 dengan sistem payment online system di Bank Sumut, sehingga memudahkan wajib pajak untuk melakukan pembayaran PBB-P2 di seluruh unit kantor Bank Sumut yang berada di daerahnya. Sedangkan di 12 kabupaten/kota lainnya, sistem pembayaran PBBP2 masih dilakukan secara offline. Sementara itu, Direktur Pemasaran Bank Sumut Ester Junita Ginting mengatakan, Bank Sumut kini semakin fokus mengembangkan layanan transaksi bagi publik. Untuk melayani kebutuhan masyarakat melakukan transaksi perbankan, Bank Sumut terus-menerus mengembangkan diri menjadi bank yang dikelola secara profesional, dengan senantiasa melakukan inisiatif, kreasi dan inovasi sebagai slogan etos kerja yang mencerminkan semangat baru dalam memberikan pelayanan transaksi perbankan. (m28)

Polsek Patumbak Diduga Rekayasa Penangkapan Tersangka Narkoba MEDAN (Waspada): Polsek Patumbak dituding merekayasa penangkapan tersangka narkoba bernama Febri Purnama, 28, warga Jln. Antariksa Karangsari, Polonia Medan, yang ditangkap 16 Mei lalu di Jln. Tritura. Tudingan itu disampaikan pihak keluarga didampingi sejumlah massa Satma Generasi Muda Peduli Tanah Air (Gempita) Sumut. Mereka menggelar aksi demo di Mapolsek Patumbak Jln. Pertahanan Medan, Rabu (11/6). Syahrial, adik tersangka menyebutkan, ada sejumlah kejanggalan dalam penangkapan dan ditetapkannya Febri Purnama sebagai tersangka. Menurut dia, ditetapkannya Febri menjadi tersangka penuh rekayasa. “Febri dipaksa mengambil barang bukti narkoba saat terjaring Operasi Antik di Jln. Tritura 16 Mei lalu,” katanya. Saat itu, Febri menggunakan sepedamotor Zupiter warna merah BK 3435 IZ, kemudian disuruh berhenti oleh petugas dari Polsek Patumbak. “Dia digeledah petugas, namun tidak ditemui narkoba. Di saat menggeser sepedamotornya, polisi melihat ada satu amp ganja di aspal tepat di bawah sepedamotor Febri. Di situ polisi memaksa Febri mengaku miliknya dan disuruh untuk mengambil ganja itu, namun dia tidak mau,” ujar Syahrial.

Menjadi pertanyaan, kata dia, polisi menetapkan Febri sebagai tersangka karena ditemukan ganja di bawah sepedamotornya. “Karena abang saya tidak mau mengambil, kemudian dipukuli sampai pingsan, lalu dijadikan tersangka dan dibawa ke Mapolsek Patumbak,” sebutnya. Dia berharap Febri yang sudah ditahan di Rutan Tanjunggusta dibebaskan. Karena sampai sekarang Febri tidak pernah mengakui ganja itu miliknya. Kapolsek Patumbak AndikoWicaksono dikonfirmasi Waspada mengatakan, penangkapan dan penyidikan dilakukan pihaknya sesuai prosedur. “Saat penangkapan ditemukan barang bukti, dan dari hasil tes urine tersangka positif menggunakan narkoba,” tuturnya. Andiko mempersilahkan mahasiswa melakukan aksi, karena merupakan hak setiap warga negara. Dia juga mempersilahkan pihak tersangka melaporkan masalah ini ke Propam. “Tadi mereka sudah saya terima, dan sudah saya dijelaskan prosedur penangkapan dan penyidikan. Tetapi mereka belum terima, dan berencana melaporkan kasus itu ke Propam. Tetapi itu merupakan hak mereka, silahkan saja, karena saya juga percaya dengan personel yang melakukan penangkapan dan penyidikan,” sebutnya.(m27)

Medan Metropolitan A5 Peran Terbuka TNI Tak Boleh Lampaui Kewenangan Polri

WASPADA Kamis 12 Juni 2014

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-280 12 Palembang GA-266 13. Batam GA-270 14. Penang GA-804 15. Surabaya GA-288 16. Tanjungkarang GA-270 17. Makasar GA-627 18. Jeddah GA-986

05.20 09.05 11.15 12.20 13.25 14.05 17.00 18.35 20.35 09.40 16.30 06.00 09.20 10.55 06.00 09.20 05.00 08.40

Jeddah (Selasa-Kamis-Sabtu)

Tiba Dari Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Palembang Batam Penang Surabaya Tanjungkarang Makasar Jeddah

Flight GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-143 GA-281 GA-267 GA-271 GA-805 GA-289 GA-271 GA-626 GA-987

Pukul 08.00 08.55 10.15 11.20 13.05 16.00 17.30 19.35 22.10 12.35 19.45 15.45 16.55 13.20 19.40 16.55 07.10 02.55

Jeddah (Selasa-Kamis-Sabtu)

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Bangkok 9 Bandung 10 Surabaya 11 Bandung 12 Penang 13 Pekanbaru 14 Singapura 15 Kuala Lumpur LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

QZ-8050 06.20 QZ- 8054 17.40 AK- 1351 08.00 AK-1355 17.55 QZ-8072 14.25 AK-1581 18.45 AK-1357 21.20 QZ-8084 14.15 QZ-7987 08.45 QZ-7611 13.15 QZ-7981 17.10 QZ-8078 06.25 QZ-8028 11.30 QZ-664 07.45 QZ-8052 13.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Penang Pekanbaru Singapura Kuala Lumpur

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-1580 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8079 QZ-8029 QZ-665 QZ-8053

08.30 10.55 07.35 17.00 16.35 18.30 21.05 16.40 11.30 09.55 19.55 08.35 12.50 10.35 15.55

JT- 211 JT- 381 JT- 397 JT-207 JT- 301 JT-395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.05 17.20 17.50 19.45 10.25 15.55 09.20 18.25. 21.05 22.20 23.50 12.15 16.00 07.05 07.20

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.40 08.05 13.35 2010 18.00 20.40 19.30 21.00 07.00 12.55 12.15 18.30

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur

MH-861 MH-865 NH-841

09.40 15.45 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur

MH-860 MH-864 MH-840

08.50 15.00 06.15

SILK AIR 1 Singapura 2 Singapura 3 Singapura

MI-233 MI-237 MI-235

08.40 20.35 13.15

Singapura Singapura Singapura

MI-234 MI-238 MI-236

07.35 19.50 12.20

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang 9 Jakarta

SJ-021 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021 SJ-017

13.15 15.55 16.50 10.20 17.20 12.50 07.20 16.00 08.05

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang Jakarta

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020 SJ-016

18.10 16.20 14.55 11.50 15.45 14.20 09.50 14.10 17.20

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55





MANDALA AIRLINE 1 Singapura RI-861

Jadwal Perjalanan Kereta Api No KA

Nama KA





U42 U44 U46 U48 U41 U43 U45 U47 U50 U52 U54 U39 U51 U53 U55 U56 U60 U62 U64 U66 U68 U70 U72 U74 U76 U76 U59 U61 U63 U65 U67 U69 U71 U73 U75 U77 U57 U58

Sribilah Sribilah Sribilah Sribilah Sribilah Sribilah Sribilah Sribilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Sireks Sireks Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Medan Medan Medan Medan R.Prapat R.Prapat R.Prapat R.Prapat Medan Medan Medan Tj. Balai Tj. Balai Tj. Balai Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Binjai Binjai Binjai Binjai Binjai Binjai Binjai Binjai Binjai Binjai Tebing Medan

R. Prapat R. Prapat R. Prapat R. Prapat Medan Medan Medan Medan Tj. Balai Tj.Balai Tj. Balai Medan Medan Medan Medan Siantar Binaji Binjai Binjai Binjai Binjai Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing

08.17 10.31 14.28 22.25 08.27 15.15 17.13 23.18 06.32 12.40 16.36 07.37 14.09 19.14 07.55 13.36 04.45 06.25 08.30 10.10 11.50 13.30 15.10 17.20 19. 00 20.40 05.40 07.10 09.20 11.00 12.40 14.20 16.00 18.10 19.50 21.30 05.34 18.51

14.02 15.57 20.20 03.34 14.01 20.54 12.23 04.34 10.39 17.11 21.09 12.01 18.19 23.26 11.21 16.48 05.27 06.57 09.02 10.42 12.22 14.02 15.42 17.52 19.32 21.12 06.12 07.42 09.52 11.32 13.12 14.52 16.32 18.42 20.22 22.02 07.24 20.44

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu

Kuala Namu- Medan

No. KA

No. KA

U2 U4 U6 U8 U10 U12 U14 U16 U18 U20 U22 U24 U26 U28 U30 U32 U34 U36 U38 U40


4.00 6.00 7.00 8.00 9.00 9.17 9.55 10.57 11.37 12.03 13.10 14.03 14.57 15.35 16.10 17.05 17.40 18.35 19.25 20.00


4.30 6.30 7.30 8.30 9.30 9.47 10.25 11.27 12.07 12.23 13.40 14.33 15.27 16.05 16.40 17.35 18.10 19.05 19.55 20.30

U1 U3 U5 U7 U9 U11 U13 U15 U17 U19 U21 U23 U25 U27 U29 U31 U33 U35 U37 U39

Berangkat KNIA Tiba Medan

5.25 7.57 8.13 8.57 9.52 10.08 10.54 11.50 12.35 12.56 14.16 14.56 15.48 16.23 17.18 17.53 18.32 19.38 20.40 21.30

5.55 8.41 8.55 9.41 10.29 10.55 11.35 12.37 13.05 13.34 14.53 15.33 16.34 17.01 18.04 18.33 19.16 20.24 21.10 22.00

NB : Bagi penumpang KA Bandara diwajibkan untuk berangkat dari stasiun KA Bandara Medan menuju stasiun Bandara Kuala Namu minimal 2 jam sebelum jadwal keberangkatan dalam negeri dan 3 jam sebelum keberangkat internasional. (m32)

DPRD Medan Minta TNI AD Dan Polri Lakukan Patroli Bersama MEDAN (Waspada): Semua pihak sangat mengapresiasi peran serta TNI dalam menjaga keamanan dan ketertiban masyarakat (Kamtibmas) di sejumlah daerah terutama di Kota Medan. Namun, jangan sampai peran terbuka TNI menangani gangguan Kamtibmas melampaui batas kewenangan Polri, sebagaimana diamanatkan UU. “Agar tidak menimbulkan pertanyaan bagi masyarakat, sangat bijak dan baik bila dijelaskan apa alasan TNI turun secara terbuka melakukan patroli sekali seminggu. Sebab sesuai UU, banyak tahapan harus dilakukan pemerintah untuk melibatkan TNI dalam penanganan masalah non-pertahanan termasuk konflik sosial,” kata praktisi hukum Sumatera Utara Dr. Abdul Hakim Siagian, SH, M.Hum. Berbicara kepada Waspada, Rabu (11/6), Siagian mengatakan, sesuai UU yang berlaku di negeri ini, jelas TNI tidak dapat melangkahi dan mengambil alih, tugas dan kewenangan Polri. Misalnya, menangani konflik sosial kategori biasa atau Kamtibmas. Ini merupakan kewenangan polisi. “Yang berwenang menangani persoalan Kamtibmas terutama yang akan berhadapan langsung dengan masyarakat dalam upaya penghentian kekerasan adalah Polri,” tegasnya. Jika memang situasi mendesak, katanya, Polri dapat meminta bantuan TNI. Dalam hal ini, TNI dapat diperbantukan apabila keadaan konflik sosial meningkat dan tidak dapat dihentikan oleh Polri. Pernya-taan status keadaan darurat ka-rena konflik sosial dikeluarkan oleh pemerintah. Jika konflik sosial dalam lingkup nasional, maka yang berwenang menyatakan status keadaan darurat adalah presiden. Jika

dalam lingkup provinsi, maka menjadi kewenangan gubernur. Begitu juga di tingkat kabupaten/kota, akan menjadi kewenangan bupati/wali kota. Lalu, bantuan TNI dalam menangani masalah Kamtibmas harus berdasarkan permintaan dari Polri. “Tentunya, Polri akan meminta bantuan TNI bila keadaan dan situasi konflik sudah tidak dapat ditangani,” tegasnya. Permohonan bantuan yang diajukan Polri kepada TNI diatur dalam UU No.2 Tahun 2002 tentang Kepolisian Negara Republik Indonesia. Pada pasal 41 disebutkan, dalam melaksanakan tugas keamanan, Polri dapat meminta bantuan kepada TNI yang diatur lebih lanjut dalam peraturan pemerintah. “Keterlibatan TNI menangani masalah non-pertahanan, dapat ditangguhkan apabila Polri mampu menangani konflik sosial yang terjadi, dan pemerintah tidak menyatakan status keadaan darurat. Permohonan bantuan kepada TNI merupakan opsi terakhir yang dapat diambil dalam penanganan konflik sosial,” kata Siagian. Kendati demikian, lanjut Siagian, TNI tetap memiliki peran dalam pemberantasan terorisme. Diantaranya dengan melakukan tugas pengamanan dan pertahanan wilayah guna mencegah adanya penyusupan terorisme dari luar negeri. “TNI berperan menjaga pertahanan dan menjaga wilayah perbatasan serta titik rawan konflik di Indonesia. Selain itu, TNI juga dapat memberi bantuan berupa informasi yang dianggap perlu dan berguna untuk penanggulangan terorisme. Namun, TNI tidak boleh melampaui kewenangannya sebagai fungsi pertahanan tersebut, TNI secara khusus tidak boleh mengambil alih peran penegakan hukum seperti penangkapan dan penahanan,” katanya. Patroli bersama Di tempat terpisah, DPRD

Medan meminta 500 prajurit TNI AD dari Kodim 0201/BS melakukan patroli bersama dengan jajaran kepolisian guna mewujudkan situasi lebih kondusif, bersahabat dan tentram. Wakil Ketua Komisi A DPRD Medan Parlindungan Sipahutar, Rabu (11/6) berpendapat, sudah saatnya TNI AD dan Polri bersinergi menggelar patroli bersama. “Hal seperti inilah yang kita tunggu-tunggu dengan harapan patroli bersama TNI AD dan Polri tidak dilakukan setengah hati, namun frekuensi patroli rutin digelar lebih sering lagi,” tegasnya. Saat ini, kata Parlindungan, aksi kejahatan seperti perampokan, penjambretan dan geng kereta sudah sangat meresahkan masyarakat. Apalagi menjelang Pilpres 9 Juli mendatang, sehingga dikhawatirkan akan mengganggu keamanan Kota Medan. Dengan adanya tim Patroli Bermotor Kodim 0201/BS yang membantu pihak kepolisian untuk melakukan patroli bersama, maka akan terpelihara kondusivitas, kenyamanan dan ketentraman di Kota Medan. “Jika selama ini sudah berjalan dengan baik, maka dengan adanya sinergi TNI AD dan Polri melakukan patroli bersama, maka kondisi keamanan di Kota Medan akan menjadi lebih baik,” ujar Parlindungan seraya menambahkan, sejauh ini pihaknya banyak mendapat keluhan dari pihak kepolisian tentang jumlah personel yang terbatas untuk melakukan patroli di lapangan sehingga pemeliharaan keamanan di Kota Medan tidak berjalan maksimal. Dikatakannya, Kota Medan yang memiliki luas 26.500 hektare dengan intensitas kegiatan sosial ekonomi cukup tinggi, membutuhkan rasio jumlah personel dan sarana yang memadai guna mendukung tugastugas kepolisian. Di sisi lain, juga harus memiliki kemampuan untuk

Gugatan Terhadap Bank Sumut Masuki Persidangan Ke-9 Di PTUN MEDAN (Waspada): Gugatan mantan pejabat eksekutif Bahrein H. Siagian terhadap Bank Sumut, hari ini (Kamis, 12/ 6), memasuki persidangan ke9 di PTUN. Pada persidangan sebelumnya, pekan lalu, Direksi Bank Sumut tidak memiliki bukti dan saksi. Sebaliknya, Bahrein menghadirkan saksi fakta Zenilhar mantan Direksi Bank Sumut. Dalam kesaksiannya, Zenilhar menjelaskan tentang proses mutasi, demosi dan prosedur pemberian sanksi yang seharusnya sesuai ketentuan di Bank Sumut. Dia juga menyatakan secara tegas tuduhan terhadap

Bahrein melakukan sosialisasi program peningkatan status outsourcing menjadi pegawai tetap tanpa seizin direksi, tidak benar sama sekali. Sebab, karena dia bersama M. Yahya selaku Direktur Operasional telah memberikan persetujuan tertulis. Bahkan program itu sebelumnya telah disetujui semua direksi dan dimasukkan dalam rencana kerja tahun 2014. Kepada wartawan, Rabu (11/6), Bahrein mengatakan, persidangan pekan lalu merupakan klimaks dari upaya pembuktian dugaan arogansi kekuasaan dan kesewenangan direksi sekaligus klarifikasi terhadap

empat kesalahan yang dituduhkan direksi kepadanya. “Saya dicopot direksi karena dituduh melakukan empat kesalahan berat. Tapi di persidangan, mereka tidak mampu menghadirkan saksi satu orang pun untuk memperkuat tuduhan mereka,” kata Bahrein. Dari persidangan selama ini, Bahrein mengatakan, pencopotan dan pemecatan dirinya bernuansa politis. Berbagai kesalahan yang dituduhkan hanya rekayasa untuk menyingkirkannya sebagai anggota KRN karena menolak calon direksi titipan tanpa prosedur PBI. (m25/rel)

Didakwa Menipu Rp2 M

Pengusaha Elektronik Mau Bertanggungjawab MEDAN (Waspada): Pengusaha barang elektronik Suanto alias Akiet, didakwa Jaksa Penuntut Umum (JPU) Dwi Meily Nova menipu rekan bisnisnya sebesar Rp2 miliar. Dalam persidangan di Pengadilan Negeri (PN) Medan, Selasa (10/6) sore, terdakwa mengaku mau bertanggungjawab. Sebagaimana dakwaan JPU, terdakwa Suanto alias Akiet melakukan tindak pidana penipuan dan penggelapan sebagaimana diatur dalam Pasal 378 dan 372 KUHPidana. Dalam perkara ini, saksi korban Husin juga seorang pengusaha elektronik. Dalam sidang lanjutan dengan agenda pemeriksaan terdakwa dan langsung dikonfrontir dengan keterangan saksi korban, terdakwa Suanto mengaku bekerjasama dengan korban Husin dalam transaksi jual beli barang-barang elektronik sejak tahun 2008. Awalnya, terdakwa melalui perusahaannya UD Bintang Nugraha memasok atau mengirimkan barang atas pesanan pihak saksi korban. Namun, sejak tahun 2012, terdakwa yang memesan barang pada perusahaan saksi korban. Semula pembayaran berlangsung lancar. Barang-barang yang dipe-

san terdakwa dijual kembali pada toko-toko langganannya hingga ke luar kota seperti Pematang Siantar. Namun, awal tahun 2014 terjadi permasalahan. Pembayaran yang sudah jatuh tempo tersendat alias macat. Seperti pesanan barang untuk bulan November 2013 dan pembayaran Desember 2013 macat. “Jatuh temponya Januari 2014, biasanya pesan barang, dua bulan kemudian jatuh temponya,” kata terdakwa yang mengaku perusahaan miliknya itu sekarang sudah tutup. Macatnya pembayaran barang yang dipesan itu, menurut terdakwa, disebabkan toko-toko yang memesan barang padanya belum membayar. Dalam persidangan yang dipimpin majelis hakim diketuai Saor Sitindaon, terdakwa mengaku mendapat keuntungan Rp10ribu hingga Rp25ribu-an untuk setiap item barang elektronik yang dia jual kembali. “Misalnya kulkas, saya beli dari saksi Rp1.300.000, saya jual kembali Rp1.325.000,” ujarnya. Sementara dalam persidangan kemarin, selain cek giro yang nyatanya kosong, terdakwa mengaku menjaminkan rumahnya kepada Husin. “Saya

mau jual rumah saya, karena saya harus bertanggungjawab sama Husin. Selain itu, mobil saya juga saya serahkan sama dia, mereknya mercy,” tutur terdakwa ngaku mau membayar utangnya. Atas pengakuan itu, saksi Husin saat dikonfirmasi mengatakan, memang rumah terdakwa hendak dijual padanya. Namun tidak jadi, karena terdakwa tidak datang saat janjian ke bank. “Saat di bank terdakwa tidak datang pak hakim,” kata Husin. Sedangkan satu mobil mercy yang masih status kredit dan sisa cicilannya Rp100 juta lagi, kini berada di Polda Sumut. Terungkap juga, lima cek giro untuk pembayaran utang terdakwa yang sudah jatuh tempo kepada saksi, saat hendak dicairkan ke bank ternyata kosong. Sidang ini sementara ditunda hingga Kamis (12/6) mendatang untuk mendengar keterangan saksi meringankan dari pihak terdakwa. Menurut korban Husin, terdakwa tidak memiliki itikad baik untuk melunasi utangutangnya itu. Sebab, terdakwa sempat melarikan diri ke Jakarta, dan ditangkap oleh tim Subdit II Harda Tahbang Dit Reskrimum Polda Sumut. (m38)

mengantisipasi setiap potensi gangguan keamanan dan ketentraman masyarakat. Parlindungan mengakui, persoalan keamanan di Kota Medan menjadi salah satu program kerja prioritas Komisi A dan harus menjadi perhatian serius pihak keamanan. Apalagi tahun 2014 merupakan tahun politik dimana akan digelarnya pemilihan umum presiden (Pilpres). “Kita harapkan TNI AD dan

Polri bekerja keras menciptakan keamanan. Kita juga meminta agar patroli, pos-pos keamanan, dan tim pemburu preman ditingkatkan. Kita tidak mau warga Medan semakin resah. Apalagi kita tahu akhir-akhir ini kejahatan jalanan seperti perampokan semakin meningkat,” ujarnya. Sebelumnya Plt Wali Kota Medan Dzulmi Eldin mengungkapkan, saat ini Kota Medan dalam keadaan cukup kondusif.

Rasa aman dan nyaman masyarakat tersebut didukung sepenuhnya oleh koordinasi, komunikasi dan kerjasama yang kokoh di antara sesama forum koordinasi pimpinan daerah. Eldin menyebutkan tahun 2014 merupakan tahun pelaksanaan proses politik yang cukup demokratis. Ini menjadi tanggung jawab bersama agar seluruh agenda demokrasi berjalan secara berkualitas dan santun. (m49/m30)

Waspada/Rizky Rayanda

ORANG MISKIN UNJUKRASA: Massa yang tergabung dalam Forum Orang Miskin melakukan unjukrasa di depan Kantor Wali Kota Medan, Rabu (11/6). Mereka menuntut pemerintah segera membagikan kartu BPJS sebelum pelaksanaan pemilihan presiden pada Juli mendatang

Perampok Diamuk Massa MEDAN (Waspada): Polsek Medan Kota mengamankan tersangka kasus perampokan ponsel Blackberry dalam keadaan babak belur, kemarin. Tersangka Ju, 28, warga Jln. Bromo Gg Seto Medan, kini mendekam dalam sel tahanan. Kanit Reskrim Polsek Medan Kota AKP Faidir Chaniago kepada wartawan, Rabu (11/6) mengatakan, tersangka ditangkap Selasa malam di Jln. Bakti saat merampok Blackberry milik Putri br Sinaga, 17, warga Jln. Pelajar Kompleks PT Aron Medan. “Dia dipukuli warga yang melihat, kemudian diserahkan ke Polsek Medan Kota dalam kondisi babak belur,” kata Faidir menyebutkan tersangka

pernah ditahan selama 5 tahun lebih kasus kepemilikan sabu-sabu. Korban kepada penyidik Polsek Medan Kota mengatakan, kejadian itu saat dia melintas dengan sepedamotor di Jln. Menteng 7. Tibatiba Blackberry yang dipegangnya dirampas pelaku. “Saya dibonceng teman hendak pulang ke rumah. Tiba-tiba dia merampas HP ku. Dia sempat menertawai kami,” kata Putri, kemudian menjerit sehingga warga mengejar pelaku. Sedangkan tersangka Ju mengaku baru keluar dari LP Tanjung Gusta pada November 2013. “Saya ditangkap Polsek Medan Area dan menjalani hukuman 5 tahun lebih,” sebutnya.(m27)



WASPADA Kamis 12 Juni 2014

Warga Sergai Mengadu Ke DPR Ketua DPR Minta BPN Koreksi Proses Pemberian HGU PTPN III JAKARTA (Waspada): Ketua DPR RI Marzuki Alie meminta Badan Pertanahan Nasional (BPN) untuk mengoreksi kembali proses pemberian Hak Guna Usaha (HGU) PTPN III di Kec. Tebingtinggi, Kab. Serdang Bedagai.


TERPIDANA perkara suap penggiringan anggaran pembangunan Wisma Atlet, Muhammad Nazaruddin (kiri) menyalami terdakwa kasus proyek Hambalang, Andi Alfian Mallarangeng dalam sidang lanjutan di Pengadilan Tindak Pidana Korupsi, Jakarta Selatan, Rabu (11/6).

Rp19 M Dibagi-bagi Lancarkan Proyek Hambalang JAKARTA (Waspada): Mantan Bendahara Umum Partai Demokrat Muhammad Nazaruddin mengakui Mindo Rosalina Manulang yang saat itu menjabat Direktur Marketing PT Anugerah Nusantara telah mengeluarkan uang sebesar Rp19 miliar untuk kelancaran proyek Hambalang. “Iya untuk Hambalang, kata Anas uang tersebut mau dikasih ke DPR, itu yang urusWafid Muharam saja yang mengkordinasikanya,” kata Nazarudin saat bersaksi di pengadilan Tipikor dengan terdakwa Andi Alfian Mallarangeng, Jakarta, Rabu (11/6). Nazaruddin kemudian menjelaskan, uang tersebut akhirnya dibagi-bagikan kepada sejumlah pihak. Nazaruddin mengklaim tidak terlalu hafal kepada siapa saja uang tersebut dibagikan, karena tidak semua uang tersebut diberikan di hadapannya. “Ya diberikan kepada Kepala BPN JoyoWinoto untuk kelancaran tanah Rp3 miliar, kemudian ke Kemenpora, katanya untuk panitia dan pejabat di Kemenpora, katanya untuk menteri

persisnya lupa. Menteri Rp5 miliar, Mirwan Amir Rp2 miliar, Anggelina Sondakh Rp2 miliar,” bebernya. Mantan Menpora Andi Mallarangeng sudah berkali-kali membantah tudingan Nazaruddin bahwa telah menerima uang melalui stafnya. Dia juga mengaku tidak tahu bila adiknya, Choel Mallarangeng, disebut meminta komitmen fee sebesar 18 persen dari PT Adhi Karya terkait proyek Hambalang. “Saya tidak pernah diberi tahu oleh staf maupun adik saya. Dan adik saya tidak juga pernah melaporkan kepada saya,” kata Andi Malarangeng saat bersaksi di Pengadilan Tipikor, Jakarta Selatan, Selasa 7 Januari 2014. Jaksa pada Komisi Pemberantasan Korupsi, Abdul Basyir lantas bertanya terkait asal-usul uang yang digunakan untuk mengurus kelancaran proyek Hambalang. Menurut Nazar, uang tersebut berasal dari Permai Grup. “Sumber dari Permai Grup, dan Mahfud Suroso Dutasari. Kantongnya berbeda tapi dua-duannya punya Anas ,” ujar Nazar. (vn)

KSM Tingkat Nasional Akan Berlangsung Di Makasar MEDAN (Waspada) : Kompetisi Sains Madrasah tingkat nasional akan berlangsung di Makasar bulan Agustus mendatang. Untuk itu, seluruh peserta siswa madrasah Ibtidaiyah, MTs dan Aliyah yang sedang mengikuti KSM di seluruh kabupaten/ kota yang dimulai hari ini (Kamis-Red), harus optimis lolos sebagai pemenang. “Jadilah pemenang untuk menjadi wakil Sumutke tingkat nasional,” kata Kepala Kanwil Kemenagsu Drs. H. Abd Rahim M.Hum melalui Kabid Penmad Drs. H. Tohar Bayoangin, MAg (foto), Rabu (11/6). Tohar Bayoangin menyebutkan, KSM merupakan wahana bagi siswa madrasah untuk mengembangkan bakat dan minat di bidang sains kepada siswa, sehingga dapat menumbuhkan, mengembangkan dan mencintai sains kepada siswa. Selain itu, untuk memotivasi siswa madrasah agar selalu meningkatkan kemampuan intelektual, emosional, dan spiritual berdasarkan nilai-nilai agama Islam. Kemudian untuk menumbuhkembangkan

budaya kom-petitif yang sehat di kalangan siswa. Dan untuk memberikan kesem-patan yang sama kepada siswa madrasah dalam belajar, berkrea-tifitas dan berprestasi, ujarnya. Dia menambahkan, KSM dengan memperlombakan Matematika dan IPA untuk tingkat Ibtidaiyah. Matematika, IPA dan Fisika untuk MTS. Dan Matematika, Biologi, Fisika, Kimia, Ekonomi dan Geografi untuk Aliyah. Ada juga Lomba Karya Tulis Ilmiah untuk Madrasah Aliyah. Dari setiap Kabupaten/Kota akan mengirimkan pe-menang terbaik 2 orang untuk Ibtidaiyah, 3 untuk MTs dan 6 siswa untuk Aliyah sesuai mata pelajaran yang diperlombakan. “Semua peserta yang lolos dari kabupaten/ kota akan mengikuti perlombaan tingkat Provinsi yang akan dilaksanakan 25 s/d 27 Juni di Hotel Asean Medan. Untuk KSM tahun 2014 tingkat Nasional, berlangsung pada 25 s/d 29 Agustus di Makasar. Direncanakan pemenang tingkat Nasional akan diikutkan pada KSM tingkat Asean,” ujarnya. (m37)

Bahasa Melayu Siap Jadi Bahasa Internasional JAKARTA (Waspada): Bahasa melayu siap menjadi bahasa internasional. Selain jumlah penutur yang mencapai lebih dari 350 juta jiwa di seluruh dunia, saat ini sudah ada lebih dari 350 ribu istilah dalam bahasa melayu yang terbagi dalam 41 bidang ilmu.Hal itu dikatakan Kepala Badan Bahasa Kementerian Pendidikan dan Kebudayaan, Mahsun di Jakarta, Rabu (11/6). Kemajuan bahasa Melayu seiring hubungan yang semakin erat antara negara serumpun, Indonesia-Malaysia-Brunai Darussalam. Apalagi belum lama ini, Indonesia menjadi tuan rumah Seminar Kebahasaan yang diselenggarakan Majelis Bahasa Brunei-Indonesia-Malaysia (Mabbim), membuat kedudukan bahasa Melayu di tingkat ASEAN semakin kuat.”Bahkan kita sudah memiliki kamus 90 ribu istilah Bahasa Melayu yang mengisi 17 bidang ilmu. Ke depan, jumlah istilah dalam kamus akan terus ditingkatkan,” kata Mahsun. Meski terus ada peningkatan dari segi kosa kata dan istilah, Bahasa Melayu juga rentan terhadap serangan bahasa asing. Apalagi dinamika sosial di kelangan generasi muda, khususnya, seringkali menempatkan Bahasa Melayu sebagai bahasa yang kalah keren dibanding Bahasa Inggris. Wakil Menteri Pendidikan dan Kebudayaan bidang Kebudayaan, Wiendu Nuryanti mengatakan, dalam konteks dinamika sosial yang berkembang saat ini, bahasa harus menjadi alat

mengekspresikan diri. Karena itu, mau tidak mau, Bahasa Melayu, harus bersahabat dengan generasi muda. Artinya, Bahasa Melayu harus dapat menangkap keinginan generasi muda dalam berekspresi lewat bahasa. “Janganlah bahasa Melayu di negara-negara serumpun ini secara eksklusif meninggalkan generasi muda. Mereka adalah penutur-penutur baru yang siap menjaga kelestarian bahasa kita bersama,” kata Wiendu, yang dihubungi di Jakarta. Bahasa Indonesia sebagai bagian dari Bahasa Melayu, kini juga tengah berupaya meningkatkan eksistensinya sebagai alat perekat persatuan bangsa. Salah satunya dengan memasukkan Bahasa Indonesia dalam porsi besar di kurikulum baru. “Kita berupaya terus supaya Bahasa Indonesia menjadi media pembentukan karakter bangsa. Saya yakin, negara-negara lain di kawasan ASEAN pun telah melakukan hal yang sama,” ungkap Wiendu. Encik Rusli bin Abdul Gani, perwakilan Malaysia dalam Mabbim mengatakan, harapan besar meningkatkan peran Bahasa Melayu di ranah pergaulan internasional ada di pundak Indonesia. Hal itu karena Indonesia adalah negara berpenduduk terbesar ke-4 di dunia. “Kita semua bersama-sama mendukung upaya menjadikan Bahasa Melayu sebagai tuan di rumahnya sendiri, apalagi menghadapi komunitas ASEAN 2015 nanti,” tandas Rusli. (dianw)

Memiliki Sabu, WN Taiwan Ditangkap JAKARTA (Waspada) : Wisatawan asal Taiwan,Yeh Ming Hua, 32, ditangkap polisi karena memiliki narkoba jenis sabu dan pil ekstasi pada Rabu (11/6) dinihari. Kapolsek Metro Sawah Besar, Kompol Shinto Silitonga mengatakan, penangkapan terhadap Yeh Ming Hua berawal dari digelarnya Operasi cipta kondisi, sekira pukul 01:30 WIB, Rabu (11/ 6) dinihari di Jl. Kartini Raya tepatnya di depan Swisbell Hotel. Saat itu, wisatawan yang baru tiga hari tiba di Jakarta melintas menggunakan mobil APV warna hitam metalik tahun 2006, no pol B 1217 XV. Saat diberhentikan, pelaku berusaha melarikan diri. Karena banyak petugas, aksi tersebut berhasil digagalkan. Tim Reskrim Polsek Metro Sawah Besar langsung melakukan penggeledahan dan menemukan satu plastik klip ukuran kecil berisi shabu dengan berat 0,3 gram, satu butir tablet warna kream yang diduga pil ekstasi dan satu

butir pil penenang sejenis ampetamin. “Jadi pelaku sempat membuang serbuk putih sebelum memberhentikan mobilnya,” ucap Kapolsek. Lebih lanjut Kapolsek mengatakan, dari keterangan tersangka diketahui bahwa dirinya merupakan wisatawan yang hendak ke Bali pada Jumat 13 Juni 2014 mendatang. Dirinya mendapatkan barang haram tersebut dari M, di sebuah tempat hiburan malam. Menurutnya saat itu Yen memang seorang diri datang ke Indonesia. “Surat-surat administrasinya lengkap, tidak ada yang berma-salah, pasportnya pun menjelaskan bahwa Yeh, hanya akan berada di Indonesia selama satu bulan,” ucapnya. Atas perbuatannya, tersangka akan dikenakan Undang-undang RI Tahun 2009 tentang penyalahgunaan narkoba dengan hukuman empat tahun penjara.(j02)

HGU PTPN III atas tanah seluas 82 hektar selama ini adalah lahan yang ditempati warga sekaligus sebagai pemiliknya. “Kalau ada ketidakberesan dalam proses pemberian HGU itu, saya minta BPN mengoreksinya dan PTPN III mengembalikan lahan tersebut kepada pemiliknya yang sah,” ujar Marzuki Alie saat dikonfirmasi Waspada di ruang kerjanya Gedung DPR RI Jakarta, usai menerima delegasi warga Serdang Bedagai, Rabu (11/6). Untuk menyelesaikan hal ini, Marzuki berjanji memediasi kasus lahan yang disebut masyarakat pengadu telah diserobot oleh PTPN III sejak tahun 1995. “ Jika bukti-bukti yang ditunjukkan masyarakat benar asli, seharusnya PTPN III mengembalikan lahan tersebut kepada masyarakat sebagai pemilik asli,” tandasnya. Ketua DPR menjelaskan, pihak BPN melalui Ketua BPN Hendardji Supandji sudah mengetahui permasalahan ini. Hendardji juga telah menyetujui dilakukannya eksaminasi atas kasus sengketa tanah tersebut. Marzuki mengaku, pihaknya sudah mendapatkan ketegasan bahwa dalam waktu paling

lama 3 minggu mendatang, pihak BPN akan membawa hasil investigasi mereka. “Mereka janji paling lama 3 minggu hasil investigasi akan mereka bawa. Sejauh yang saya lihat, yang salah memang pihak PTPN, tapi kita lihat saja apa bukti-bukti yang dibawa masyarakat pada pertemuan mendatang. Apa bukti bukti mereka kuat dan asli ,” ujarnya. Ketua Kelompok Tani Panguripan Suwarno sekaligus sebagai juru bicara warga mengatakan kasus ini sebenarnya murni penyerobotan di era orde baru. Bukti-bukti yang dimiliki masyarakat juga diakuinya sudah sangat kuat. Menurut Suwarno, warganya sudah menempati kampung itu sejak tahun 1936 berdasarkan dokumen yang dikeluarkan pemerintah Hindia Belanda waktu itu. Sebelumnya, kata dia, DPR sudah memfasilitasi tiga kali pertemuan. Namun, hingga kini belum juga mendapat penyelesaian. Dijelaskan Suwarno, HGU yang dikeluarkan untuk PTPN III tahun 1995, padahal, menurutnya, PTPN sudah beroperasi di daerah tersebut sejak tahun 1988. “Seluruh instansi sudah menyatakan tanah itu adalah tanah kami, mengapa mereka masih ngotot memertahankan apa yang bukan menjadi hak mereka,’’ katanya. Selain itu, imbuh Suwarno, luas tanah yang mereka miliki tidak bertambah seperti yang terlihat dari sertifikat, tapi peta

Politisi Gokar Sorot Mafia Minyak JAKARTA (Waspada): Politikus Partai Golkar Poempida Hidayatullah menilai kebijakan impor minyak hanya menguntungkan segelintir kelompok, dan tidak berpihak pada kepentingan rakyat. Karena itu dia meminta Hatta Rajasa bertanggung jawab atas merajalelanya mafia minyak di Indonesia. “Selaku Menteri Koordinator Perekonomian saat itu, Hatta seharusnya bertanggung jawab memberantasnya, dan tidak membiarkan mafia minyak merajalela di negeri kita,” tegas Poempida Hidayatullah kepada wartawan, Rabu (11/6) menanggapi pemberitaan seputar masih kuatnya cengkraman mafia impor minyak, dikaitkan dengan pernyataan PrabowoHatta Rajasa untuk memberantas korupsi dan penegakan hukum dalam debat calon presiden-calon wakil presiden, Senin malam lalu. Poempida menambahkan, kondisi perminyakan Indonesia

sudah sangat memprihatinkan. “Mafia minyak menikmati uang negara dari dua sisi, impor dan ekspor, sementara APBN berdarah-darah terus, subsidi terus membengkak, negara menambah utang terus. Ini sangat memprihatinkan,” katanya. Dia berharap Presiden mendatang harus mampu memberantas mafia minyak. Berbagai langkah strategis kebijakan minyak dan gas, juga harus diambil. Desakan ini telah disuarakan sekelompok masyarakat yang melakukan aksi unjuk rasa di depan Istana Kepresidenan, Selasa lalu, menuntut dibongkarnya mafia minyak yang merugikan negara. Ferdinand Hutahayan, Direktur Pengolahan Solidaritas Kerakyatan Khusus Migas, menuntut Presiden Susilo BambangYudhoyono (SBY) mengusut keterlibatan mafia minyak yang diduga merugikan negara mencapai Rp 100 miliar/hari atau Rp 36 triliun/tahun.(aya)

mereka bertambah. ‘’ Tanah yang masuk peta dan tidak masuk dalam sertifikat adalah tanah kami,” ujarnya. Para ibu, warga Panguripan yang turut menjumpai Ketua DPR juga mengatakan, mereka terus mendapat acaman dan

kekerasan. Mereka dipaksa keluar dari kampung halamannya sendiri. Marzuki menambahkan, kalau haknya punya masyarakat, ya kita kembalikan ke masyarakat. ‘’ Jangan sampai masyarakat dikorbankan untuk

kepentingan usaha. Kita tahu PTPN punya negara. Janganlah menyakiti masyarakat. Harusnya PTPN berada di tengahtengah. Kalau alasannya salah, mereka harus akui salah saat menerbitkan HGU,” demikian Marzuki Alie. (aya)

Moratorium Pendaftaran Haji Terus Mendapat Dukungan JAKARTA ( Waspada): Wacana moratorium (pemberhentian sementara) pendaftaran haji terus mendapat dukungan dari lembaga legislatif DPR RI. Daftar tunggu yang sudah terlalu panjang bak benang kusut, harus dihentikan sementara sambil melakukan pembenahan layanan haji. Dukungan moratorium pendaftaran haji ini dinyatakan Wakil Ketua DPR RI M. Sohibul Iman, dengan harapan masa moratorium itu juga harus sekaligus dilakukan pembenahan layanan haji. “Setiap kebijakan apapun, termasuk moratorium, harus tujuannya adalah membenahi, bukan semata-mata karena sudah kebanyakan kuota hajinya. “Jangan terus menerima pendaftaran, tapi tak ada pembenahan sama sekali,” ujarWakil Ketua DPRRI dari Fraksi Partai Keadilan Sejahtera ini, kepada wartawan, Rabu (11/6), di Gedung DPR Jakarta. Sebagaimana diketahui, dukungan dilakukan moratorium ini mengingat daftar tunggu calon jamaah haji Indonesia

minimal 5 tahun. Di beberapa daerah bahkan ada yang mencapai belasan tahun. Karenanya, Sohibul Iman berharap kepada pemerintah agar jangan terus membuka pendaftaran haji. Selain daftar tunggunya sudah terlalu panjang, juga tidak bisa memberi kepastian kepada para calon jamaah untuk bisa pergi ke Tanah Suci. Akibatnya, dana calon jamaah terus menumpuk di rekeningpemerintahtanpaterkontrol. RUU PKH Sementara itu, Wakil Ketua Komisi VIII DPR Sayed Fuad Zakaria mengharapkan Menteri Agama Lukman Hakim Syaifuddin bisa mensupport terbentuknya badan khusus yang menangani haji, termasuk mempercepat RUU Pengelolaan Keuangan Haji (PKH). Menurutnya, RUU PKH yang tengah dibahas DPR sekarang ini, dimaksudkan agar dana yang dihimpun dari masyarakat bisa dikelola dengan baik, tepat sasaran dan memberi manfaat yang besar bagi jamaah haji. UU ini pula akan memberikan landasan hukum yang kuat terha-

dap pengelolaan keuangan haji. “ Dengan UU ini akan ada kejelasan bagi pemerintah dalam pengelolaan keuangan haji dan tidak bisa dilepaskan dengan Revisi UU Penyelenggaraan Haji. Sesuai harapan kami penyelenggaraan haji dilakukan oleh satu badan khusus yang bertanggungjawab langsung kepada Presiden, tidak lagi dibawah Kementerian Agama,” paparnya. Diyakininya, dengan adanya badan khusus dan UU Pengelolaan Keuangan Haji, dana yang jumlahnya trilunan rupiah itu lebih jelas dan bisa dipertanggungjawabkan. Dalam RUU PKH itu pula nanti akan diatur soal pengawasan pengelolaan keuangan haji. Ditanya kapan RUU ditargetkan selesai, ia menyatakan secepatnya. Setelah disetujui di tingkat Badan Legislasi DPR. Baru kemudian pembahasan antara Komisi VIII dengan Kemenag, diharapkan pada masa sidang pertama tahun 2014/2015 atau masa sidang terakhir anggota DPR periode 2009-2014 September 2014 , tukas Sayed Fuad Zakaria. (aya)

Rekomendasi KPK Untuk Menag Baru

Penggunaan Setoran Awal Hingga Transparansi Kuota Haji JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK) memberikan sejumlah rekomendasi kepada Menteri Agama Lukman Hakim Saifuddin terkait penyelenggaraan haji di kementerian tersebut. “Secara spesifik kami ada rekomendasi mengenai penyelenggarana haji yaitu pertama saat ini adalah momentum untuk perbaikan terkait dengan revisi Undang-undang penyelenggaraan haji,” kata Wakil Ketua KPK Busryro Muqoddas dalam konferensi pers di gedung KPK Jakarta, Rabu (11/6). Konferensi pers tersebut dilaksanakan pasca pertemuan antara Menag Lukman Hakim Saifuddin yang ditemani dengan Direktur Jenderal Penyelenggaraan Haji dan Umroh Kemenag Abdul Jamin dengan jajaran pimpinan KPK yaitu Busyro Muqoddas dan Bambang Widjojanto. “Versi kami berdasarkan

kajian-kajian deputi pencegahan maka diperlukan ada pemisahan fungsi regulator dengan fungsi operator atau pelaksana,” ungkap Busryo. Selama ini, Kementerian Agama berfungsi sebagai pembuat aturan (regulator) sekaligus penyelenggara ibadah haji. “Kedua, pentingnya penyelesaian peraturan atau aspekaspek regulasi yang terkait penyelenggaraan ibadah haji berikut aturan pelaksanaanya,” tambah Busyro. Rekomendasi ketiga adalah untuk melakukan standarisasi komponen “indirect cost” haji dan kepatuhan pelaksanaannya. “Indirect cost” adalah setoran awal dari jamaah untuk biaya penyelenggaraan ibadah haji yang digunakan untuk membiayai operasional haji, service fee, hingga pengadaan kendaraan operasional petugas haji yang rentan penyimpangan. “Yang terakhir adalah ten-

tang kuota haji supaya bisa ditransparansi. Tekanannya, kuota haji adalah menjadi hak utama dari calon jamaah ibadah haji sehingga ketika ada calon yang pada saatnya berangkat berhalangan karena meninggal atau masalah kesehatan, kursikursi yang kosong dikembalikan kepada jamaah haji yang sebelumnya sudah mengantri, bisa dibagi rata kepada calon-calon di daerah-daerah. Tentu ini terkait dengan Sistem Komputerisasi Haji Terpadu (Siskohat) di sana,” jelas Busyro. Busryo menjelaskan bahwa KPK pada 2008 telah melakukan kajian-kajian tentang sistem di Kemenag. “Kala itu sudah ada 44 saran yang sudah disampaikan pimpinan KPK jilid 2. Dari 44 saran tersebut kami sudah sampaikan masih ada beberapa yang ditindaklajuti temasuk di sektor yang terkait dengan penyelenggaraan haji,” tambah Busryo.

Masyarakat Disarankan Sering Lakukan Swa-Monitoring Glukosa 6,5 Persen Berusia 15 Tahun Mengindap Diabetes MEDAN (Waspada): Sebagi para diabetisi untuk damakin tingginya angka pengpat melakukan Swa-Monitoidap diabetes di Indonesia ring Glukosa Darah (SMGD) mendorong pemerintah meterstruktur, karena memiliki ngajak masyarakat menerapempat manfaat dalam melakan pola hidup 4 Sehat 5 kukan deteksi gula darah teratur, salah satunya melalui yaitu, mudah digunakan aktivitas Swa-Monitoring karena memiliki layar lebih Gula Darah (SMGD). besar, dan dua tombol untuk Namun, hingga saat ini, mendeteksi gula darah dan kebiasaan dari mayoritas pedata yang dapat ditransfer ke ngidap diabetes tidak melakucomputer dengan kabel USB. kan kontrol secara rutin, Alat ini juga aman dengan karena menganggap asupan proses deteksi kekurangan terapi obat yang dilakukan Waspada/t.junaidi sampel darah dan opsi sehari-hari akan efektif secara KIRI-KANAN: Dr. dr. Dharma Lindarto, Sp. PD - KEMD - Ketua (Parkeni & Kepala Divisi Endokrin sampling ulang dalam 10 detik terus menerus. Padahal per- Metabolik Fakultas Kedokteran Universitas Sumatera Utara / RSUP H. Adam Malik), dr. Benny y a n g m e m u n g k i n k a n kembangan kadar gula darah Kurniawan, Marketing Manager PT Roche Indonesia Diabetes Care, Jopie Leksmana, Business pengguna menambahkan seseorang secara berkala Unit Head Diabetes Care PT Roche Indonesia dan Drs. H. Syafruddin Ritonga MSI, MAP dalam sampel darah jika volume dapat berubah dalam kurun acara Peluncuran New Accu-Chek Active, di Medan (11/6). sampel darahnya belum waktu tertentu, sehingga dimencukupi. Canggih karena perlukan SMGD terstruktur, dapat membedakan hasil pengetesan glukosa darah sebelum dan sesudah yaitu SMGD yang mempunyai jadual dan frekuensi teratur. makan, alarm pengingat deteksi gula darah kembali 2 jam setelah makan Swa-Monitoring Gula Darah (SMGD) terstruktur memiliki peran sangat dan hasil rata-rata tes hingga 90 hari penting bagi pengidap diabetes, yaitu memantau kadar gula darah dan Akurat karena memiliki hasil sangat mendekati dengan hasil laboratorium memudahkan diabetisi maupun dokter menyesuaikan asupan obat dan cukup menggunakan sedikit volume sampel darah dan teruji keakuratannya juga dapat membantu program terapi pengelolaan diabetes. Dengan demikian, telah memenuhi standar internasional ISO 15197 kadar gula darah dalam tubuh dapat tetap terkontrol dengan baik untuk “Monitor gula darah mandiri, atau dikenal dengan Swa-Monitoring Glukosa menghindari terjadinya komplikasi diabetes. Darah (SMGD) terstruktur adalah pemeriksaan gula darah secara mandiri PT Roche Diabetes Care menyadari pentingnya melakukan SMGD dalam waktu tertentu yang dilakukan diabetisi. terstruktur secara rutin bagi para pengidap diabetes untuk menghindari Tujuannya adalah untuk menyesuaikan dosis obat / insulin dan mengetahui terjadinya komplikasi diabetes, dengan turut mensosialisasikan pentingnya keberhasilan pengobatan agar komplikasi jangka pendek maupun jangka melakukan monitoring gula darah secara rutin sehingga kadar gula darah panjang dapat dicegah.” jelas Dr dr Dharma Lindarto, Sp. PD – KEMD, sebagai dapat tetap terkontrol dengan baik dan diharapkan dapat menghindari terjadinya Ketua Perkeni & Kepala Divisi Endokrin Metaboliik Fakultas Kedokteran komplikasi diabetes berkelanjutan. Universitas Sumatera Utara/ RSUP H. Adam Malik. Peran serta semua pihak tentu diperlukan untuk turut ambil bagian dalam Dr dr Dharma Lindarto, Sp. PD – KEMD, menambahkan bahwa pada mensukseskan kampanye ini. Demi menyebarkan edukasi seluas-luasnya dasarnya prinsip utama dari pelaksanaan SMGD, yaitu keterampilan bagi mengenai Swa-Monitoring Gula Darah (SMGD), PT Roche Indonesia diabetisi dalam melakukan SMGD terkait cara penggunaan, pemantauan mengeluarkan generasi terbaru produk Accu-Chek® Active, alat pendeteksi kadar gula darah dan tingkat akurasi dari SMGD. kadar gula darah dalam tubuh yang smart & simple, sebagai solusi tepat Menurut Kementrian Kesehatan pada tahun 2013, penduduk Indonesia monitor gula darah secara mandiri terstruktur bagi para diabetisi sehariberusia lebih dari usia 15 tahun mengindap Diabetes sebanyak 6,9 persen. hari untuk mendukung terapi diabetes lebih optimal. Sementara prevalensi Diabetes tertinggi yang terdiagnosis dokter di Indonesia “New Accu-Chek® Active ini merupakan terobosan baru dari Accuadalah Yogyakarta 2,6 persen, DKI Jakarta 2,5 persen, Sulawesi Utara 2,4 persen, Chek® yang smart karena menghasilkan informasi jelas dan akurat, simple dan Kalimantan Timur 2,3 persen. karena alat ini mudah digunakan, aman dan memiliki teknologi canggih.” Wanita di perkotaan dengan pendidikan tinggi mempunyai prevalensi Papar Jopie Leksmana, selaku Business Unit Head Diabetes Care, PT Roche Diabetes yang cenderung lebih tinggi dibanding laki-laki. Kelompok umur Indonesia di Medan Rabu (11/6). yang paling banyak mengidap Diabetes adalah 45-52 tahun dengan resiko Beliau menambahkan bahwa New Accu-Chek® Active memberikan fasilitas Diabetes yang meningkat seiring penambahan usia. Terutama pada usia diatas 40 tahun dikarenakan terjadi intoleransi glukosa.(m19)

Pilpres 2014

WASPADA Kamis 12 Juni 2014



Hari Lagi

A7 Kamis 12 Juni 2014

Jokowi:Pendidikan Dan Kesehatan Dua Kebutuhan Utama Rakyat Yang Sering Dikeluhkan

Waspada/Rizky Rayanda

CALON presiden nomor urut 1 Prabowo Subianto menyampaikan orasi politik di hadapan pendukung pada kampanye dialogis di Gedung Serba Guna Jln. Pancing, Medan, Rabu (11/6).

Guru Besar FISIP USU Prof Dr Badaruddin:

Isu SARA Sangat Rentan MEDAN (Waspada): Guru Besar juga Dekan FISIP USU Prof. Dr. Badaruddin mengingatkan bahwa persoalan isu SARA merupakan hal yang sangat rentan dan oleh karena itu pasangan calon Presiden dan Wakil Presiden harus memiliki komitmen untuk tidak menggunakan isu itu. “Isu SARA sangat seksi untuk ditampilkan karena mampu membangkitkan semangat dalam menentukan pilihan,” tegas Prof. Badaruddin pada dialog tokoh agama menyongsong pemilihan Presiden 2014 yang dilaksanakan oleh Forum Kerukunan Umat Beragama (FKUB) Sumut di gedung Bina Graha Medan, Senin (9/6). Dialog yang dibuka Wagubsu Ir. HT. Erry Nuradi dihadiri 100 peserta dari para pimpinan majelis-majelis agama dan ormas. Komitmen untuk tidak menggunakan isu SARA tersebut harus diikuti oleh para seluruh tim sukses, simpatisan, media massa, dan kelompokkelompok kepentingan lainnya. Sebab, bahwa isu SARA dalam konteks masyarakat Indonesia yang multikultural dan tingkat pendidikan politik yang masih relatif rendah adalah alat yang jitu untuk dapat memengaruhi orang lain. Justru, lanjut Prof. Badaruddin, bila kita semua telah memiliki kesadaran bahwa persoalan SARA bagi bangsa Indonesia masih merupakan persoalan yang rentan, maka jika kita ingin menjadikan Pilpres 09 Juli 2014 sebagai momentum merajut keharmonisan, kita harus memulai melakukan

tindakan yang mengarah pada terciptanya keharmonisan. Miskipun banyak sarjana (peneliti) mengatakan bahwa akar sesungguhnya adalah perebutan sumberdaya ekonomi, namun yang muncul di permukaan lebih mengarah pada konflik yang bernuansa SARA. Kakankemenag Sumatera Utara Drs. H. Abd. Rahim, M. Hum mengkhawatirkan bahwa isu agama akan dipergunakan menjadi senjata utama bagi pihak-pihak yang tidak bertanggung jawab untuk menjatuhkan pihak lain. “Mereka beranggapan masyarakat Indonesia yang religius dan memiliki ketaatan tinggi kepada agamanya masih dapat dihasut dengan menggunakan isu agama,” tegas Rahim sebagai keynote speaker pada dialog tersebut. Sebagai Kakankemenag, Rahim menyesalkan adanya pihak-pihak tidak bertanggung jawab yang menggunakan isu agama untuk menghadapi pihak lawan, apa lagi pada tahuntahun politik seperti saat ini. Kerukunan umat beragama yang telah terjalin dengan baik selama ini diharapkan tetap dipertahankan. Bahkan kerukunan umat beragama harus menjadi modal utama kita dalam membentengi masyarakat dari upaya pihak-pihak yang tidak bertanggungjawab, menggunakan isu agama menjadi bahan untuk mencederai pemilihan Presiden dan Wakil Presiden. Ketua Forum Kerukunan Umat Beragama (FKUB) Sumatera Utara Dr. H. Maratua Simanjuntak menegaskan, peran tokoh agama dalam menyuk-


Ketua DPC Hanura Medan Hariman Tua Siregar (tengah) bersama pengurus lainnya foto bersama di kantor DPC Hanura Medan usai rapat pemenangan Jokowi-JK.

DPC Partai Hanura Medan Galang Suara Jokowi-JK MEDAN (Waspada): Dewan Pimpinan Cabang (DPC) Partai Hanura Kota Medan menargetkan sedikitnya 120 ribu suara untuk Jokowi-JK . Jumlah ini diperoleh setelah melihat kekuatan DPC Partai Hanura Kota Medan. “Pada pemilihan legislatif, Hanura memperoleh 66 ribu suara. Ini merupakan modal dasar. Untuk mencapai 120 ribu suara, seluruh fungsionaris bekerja keras,” kata Ketua DPC Partai Hanura Kota Me-dan, Hariman Tua Dibata Siregar didampingi Wakil Ketua Hendra DS, Rusli Tanjung, Sekretaris Landen Marbun dan Ratna Sitepu usai melakukan rapat pe-me-nangan JokowiJK di DPC Partai Hanura Kota Medan, Senin (9/6). Menurut Hariman, sosok Jokowi yang sederhana dan merakyat merupakan modal untuk mendapatkan simpatik masyarakat. Seluruh jajaran pengurus Hanura Kota Medan terus melakukan so-sialisasi kepada masyarakat. Tujuannya agar masyarakat mengetahui apa alasan memilih Jokowi-JK. “Sebagai partai pendukung, Hanura Kota Medan punya kewajiban untuk me-memangkan Jokowi-JK di Kota Medan. Bersama partai pen-dukung lainnya, Hanura harus dapat memberikan kon-tribusi dengan menyum-bang-kan suara untuk kemenangan Jokowi-JK,” ungkap Sekretaris DPC Partai Hanura, Landen Marbun. Ditambahkan Landen, Jo-kowi sebelum mencalonkan diri menjadi presiden sudah menun-jukkan kinerjanya di tingkat pemerintah kota dan gubernur. Bila melihat dari kinerja yang telah dilakukan, masyarakat yakin Jokowi juga mampu menunjukkan ki-ner-janya di tingkat presiden. Begitu juga dengan Jusuf Kalla yang sukses menjalankan tugas sebagai wakil presiden. Dengan pengalaman yang pernah dilakukan, Jusuf Kalla tidak diragukan lagi untuk mendampingi Jokowi. Potensi Sejak Hanura resmi bergabung dengan Jokowi-JK, seluruh pengurus terus me-lakukan sosialisasi di tingkat ranting. “Di tingkat ranting kita terus berdayakan. Kita menyadari di tingkat ranting langsung ber-sentuhan dengan masyarakat. Berbagai kesem-patan sosialisasi terus dilakukan misalnya di organisasi kepemudaan dan sosial, warung kopi, kerabat terdekat dan se-bagai-nya. Semakin sering dilakukan sosialisasi diharapkan tumbuh kesadaran untuk memilih Joko-wi-JK,” sebut Landen.(m09)

seskan Pemilu 2014; mendorong masyarakat untuk terdaftar sebagai pemilih pada Pemilu 2014, mengajurkan masyarakat agar menggunakan hak pilihnya, menjelaskan manfaat memilih dan kerugian tidak memilih. Kemudian, menjelaskan hubungan kewajiban memilih pemimpin dengan pemilu, menjelaskan bahwa dengan menggunakan hak politik tidak merusak kerukunan, menjaga jangan sampai menjadi SARA sebagai alat kempanye, menghindari menggunakan ayatayat kitab suci dalam berkampanye di muka umum, menjaga martabat sebagai pemuka agama dari setiap agama dan siapa pun yang berhasil dalam pemilu capres dan cawapres adalah keberhasilan bangsa Indonesia. Menurut Maratua, untuk

meminimalisir terjadinya konflik antara pendukung capres dan cawapres maupun antar umat beragama, diperlukan pencegahan, pengarahan dan kebijakan para pemuka agama, memberikan pengertian kepada umatnya agar pemilu jangan dijadikan tujuan tetapi alat/upaya untuk mencapai cita-cita mulia bangsa Indonesia melalui pemilihan umum kepemimpinan nasional Presiden dan Wakil Presiden. Kedua pasang calon adalah putra terbaik di Indonesia, maka selayaknya umatberagama harus memilih dan tidak golput. Maratua juga menjelaskan bahwa pemuka agama atau juga disebut tokoh agama atau fungsionaris agama, ialah seorang yang memiliki pengetahuan agama yang lebih dari anggota masyarakat biasa. (m26)

MEDAN(Waspada): Capres nomor urut 2, Ir H Joko Widodo mengatakan, sektor pendidikan dan kesehatan merupakan dua kebutuhan utama rakyat yang sering dikeluhkan karena pelayanan primanya dianggap membutuhkandanayangcukupbesar. “Ada dua hal kebutuhan utama rakyat yaitu pendidikan dan kesehatan.Kedua hal ini harus dipikirkan oleh pemerintah,” kata Jokowi dalam pertemuan dengan tokoh masyarakat di Convention Hall Hermes Palace di Medan, Selasa (10/6). Menurut Jokowi, dua kebutuhan rakyat tersebut diketahuinya dari kegiatan blusukan ke berbagai pemukiman masyarakat selama ini. ”Pendidikan perlu karena dapat meningkatkan kecerdasan masyarakat dan menjadi salah satu faktor yang dapat mengubah taraf hidup rakyat,”ucap Jokowi yang saat menaiki pentas didampingi Sekretaris Tim Kampanye Jokowi-JK Sumut, Iskandar ST. Namun,kata Jokowi kebijakan sektor pendidikan selama ini masih memberatkan karena masyarakat masih harus mengeluarkan biaya dalam jumlah besar meski pemerintah menerapkan program pendidikan gratis. Meski SPP tidak lagi dipungut, tetapi masih banyak pengeluaran masyarakat untuk membiayai pendidikan anaknya, mulai dari seragam sekolah, transportasi, buku, sepatu, hingga kegiatan les. “Pengeluaran itu yang sering tidak dipikirkan pemerintah selama ini,” tandasnya. Jokowi menyebutkan, dirinya bisa ikut merasakan dan memahaminya karena pembuat kebijakan dalam dunia pendidikan kurang memperhatikan faktor pengeluaran masyarakat tersebut. “Bagaimana mau mengerti,jika seorang pemimpin tidak pernah turun ke kampung,”ungkapnya


SEKRETARIS Tim Kampanye Jokowi-JK Sumut, Iskandar St (paling kanan) mendampingi Capres Nomor Urut 2 Ir H Joko Widodo saat naik ke atas pentas. Sedangkan kebutuhan utama kedua masyarakat adalah kesehatan yang sering meresahkan akibat mahalnya biaya yang harus dikeluarkan untuk mendapatkan pelayanan maksimal. “Orang berduit saja bisa jatuh miskin karena masuk ru-

mah sakit. Bisa dibayangkan apalagi jika orang miskin yang jatuh sakit,” ucap Capres yang didukung PDI-Perjuangan, NasDem, PKB, Hanura dan PKPI ini. Dalam orasinya Jokowi menawarkan program Kartu Indonesia Sehat yang akan dimiliki

seluruh rakyat guna mempermudah dalam mendapatkan pelayanan kesehatan di seluruh Tanah Air. “Kalau seluruh rakyat sudah memegang kartu sehat, hatinya bisa tenteram.Jika ke rumah sakit tak perlu membayar lagi ,” kata Jokowi.(m25)

Prabowo Menang Di Medan Jokowi Masih Unggul 5,7% JAKARTA (Waspada): Hasil survei Pusat Data Bersatu (PDB) menunjukkan selisih elektabilitas pasangan nomor urut satu, Prabowo Subianto-Hatta Rajasa, dengan pasangan nomor urut dua Joko WidodoJusuf Kalla semakin tipis. Jokowi masih unggul 5,7 persen. Melalui siaran pers, Selasa (10/6), peneliti senior lembaga survei yang didirikan oleh politisi Partai Amanat Nasional (PAN) Agus Herta menjelaskan bahwa sampai pada akhir Mei 2014, selisih kedua pasang caprescawapres tersebut hanya 5,7 persen. “Dari survei yang kita

lakukan di tujuh kota besar, Jokowi-JK meraih 32,2 persen suara dan Prabowo-Hatta meraih 26,5 persen,” ujarnya. Menurut Herta, dari 8 kali pelaksanaan survei, tren elektabilitas Jokowi-JK cenderung turun, sementara elektabilitas Prabowo-Hatta cenderung naik. Namun, Herta tidak dapat memastikan sampai di mana kenaikan atau penurunan elektabilitas itu. “Dalam pengalaman riset, tren sulit berubah dalam waktu sempit.Yang turun akan tetap turun dan sebaliknya,” kata Herta. Pengumpulan data survei dilaksanakan dari tanggal 26 Mei

sampai dengan 1 Juni 2014 dengan jumlah responden 2.688 yang tersebar di tujuh kota pada tujuh provinsi besar di Indonesia. Jenis responden adalah pengambil keputusan, baik kepala keluarga maupun istri kepala keluarga. Pengumpulan data dilakukan tatap muka dan kuesioner terstruktur. Sekadar gambaran, dari tujuh kota besar yang disurvei, Prabowo-Hatta menang di Medan dan Bandung. Sementara itu, Jokowi-JK menang di Semarang, Balikpapan, dan Makassar. Adapun suara di Jakarta dan Surabaya sangat ketat.(kc)

55 Penyelenggara Pemilu Diberhentikan DKPP JAKARTA (Waspada): Dalam sidang pembacaan putusan yang digelar Dewan Kehormatan Penyelenggara Pemilihan Umum (DKPP) pada, Senin (9/6), sebanyak 55 penyelenggara Pemilu dijatuhi sanksi berupa Pemberhentian Tetap oleh DKPP. Hal ini dikarenakan mereka terbukti melakukan pelanggaran kode etik penyelenggara Pemilu. Seperti diketahui, pada Senin (9/6) DKPP menggelar sidang pembacaan putusan sebanyak 26 Putusan untuk 32 perkara, yakni perkara KPU Kab. Pontianak, PPK Lembah Bawang, KPU Fak Fak, KPU KotaTanjung Balai, KPU Kota Medan, KPU Prov. Sumut, Panwaslu Langsa, Aceh, KPU dan Panwaslu Solok, KPU Kepulauan Mentawai, Bawaslu Lampung, KPU Kab. Tebo, KPU Banten, KPU Tangerang, KPU Batam, Panwaslu Tanjung Mo-

rawa, KPU Kab Banyuasin, Panwaslu Poso, dan KPU Raja Ampat. Ke-18 putusan tersebut dibacakan pada sesi pagi pukul 09:00 WIB. Sedangkan pada sesi siang pukul 13:30 WIB dibacakan untuk Putusan Perkara Panwaslu Tanjung Morawa, KPU Nias Selatan, KPU Cianjur, KPU Takalar, KPU Tasikmalaya, PPK Soreang Kota Pare-Pare, KPU Kotawaringin Timur, Panswaslu. Kab.Tuban dan KPU Prov Sulut dan KPU Manado. Ke-55 Penyelenggara Pemilu yang diberhentikan yakni (5) lima orang anggota PPK Lembah Bawang, Ketua KPU Kab Fakfak, Ketua dan satu orang anggota KPU Kota Medan, satu orang Panwaslu Langsa, Aceh, Ketua KPU dan Panaslu Solok Selatan, Ketua KPU Kab Tebo, Jambi, PPK Pasar Kemis dan Panwascam Pasar Kemis seba-

nyak tiga orang, Ketua dan anggota KPU Kab Tapanuli Tengah, lima orang PPS di Kab Tangerang, dua orang KPU dan satu Panwaslu Kep Mentawai, Ketua KPU Kota Batam, lima anggota PPK Rantau Bayur, Banyuasin, empat anggota KPU Kab. Nias Selatan, 15 Penyelenggara Pemilu seKabCianjur,satuoranganggota KPUKotawaringinTimur(Kotim), dua orang KPU Kab Takalar, dan tiga orang KPU Kota Manado. Selain itu, DKPP juga memberikan Peringatan kepada 34 penyelenggara Pemilu serta merehabilitasi nama baik 42 penyelenggara Pemilu yang tidak terbukti melakukan pelanggaran kode etik penyelenggara Pemilu. “Dari total perkara yang disidangkan, sebanyak 68% penyelenggara Pemilu terbukti melakukan pelanggaran kode etik, ini artinya pengaduan dari

SUASANA sidang pembacaan putusan yang digelar DKPP. Sidang ini juga digelar secara video conference dengan kantor Bawaslu seluruh Indonesia. Pengadu ini tidak main-main, dan terbukti. Tapi masih banyak juga yang direhabilitasi,” ungkap Ketua DKPP Prof Jimly Asshiddiqie di ruang kerjanya. Dalam keterangannya, Ketua Majelis yang juga Ketua DKPP Jimly Asshiddiqie menyebutkan bahwa DKPP terpaksa memberhentikan mereka

karena memang terbukti melanggar kode etik. DKPP tidak akan melindungi kalau mereka memang terbukti melanggar kode etik. Pemberhentian ini untuk menyelamatkan nama baik lembaga, baik KPU maupun Bawaslu. Harapannya, Pilpres yang sudah dekat ini jangan lagi dikotori oleh mereka-mere-

ka yang bermasalah, terang Jimly. Sidang pembacaan putusan ini dipimpin oleh Ketua DKPP Prof Jimly Asshiddiqie bersama Anggota Saut H Sirait, Valina Singka Subekti dan Nelson Simanjuntak. Sidang ini juga digelar secara video conference dengan kantor Bawaslu seluruh Indonesia. (adv)

A8 1 CM


Rp. 22.000

2 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

BM W 3231 Over Kredit Merah Met Th. 98. Sgt orisinil, sudah dibayar 21x sisa 15x2.600.000. Balik DP 35Jt Nego. Hub. 0 8 5 2 6 1 3 4 0 5 3 8

Jual DAIHATSU Xenia XI Plus 1.3 Thn. 2007. BK Mdn Cantik, Jarang pakai. Pajak Baru. Harga 100Jt. Hub. 0812 6393 235 “ DAI H AT SU BERH ADI AH “ Gran Max Pick Up 1’3 DP 8 Jt’an Angs 2 Jt’an Xenia 1’0 M DP 20 Jt’an Angs 3 Jt’an Terios TS DP 30 Jt’an Angs 4 Jt’an Gran Max Minibus DP 20 Jt’an Angs 3 Jt’an DP 20 Jt’an Angs 1 Jt’an AYLA D Hub ERWI N H P 0 8 1 2 6 3 1 5 4 1 3 2 DAI H AT SU Feroza Th. ‘94/95 (Spesial Edition). Biru-Abu2. Original, Full Sound, Ban Baru. Siap pakai. Jl. Jermal 4 No. 84 Denai. HP. 0 8 5 2 9 6 4 0 7 3 6 3

DAIHATSU BARU TERMURAH * Xenia - DP 20 Jt-an * Grand Max PU - DP 8 Jt-an * Terios - DP 30 Jt-an * Ayla DP 20Jt-an Hub. I N DAH - 0 8 5 2 9 7 7 7 8 2 5 5 DAYA DAIHATSU Promo June Diskon Ganas Xenia DP 20 Jt-an / 2 Jt-an. Terios DP 30 Jtan/3 Jt-an. PU DP 20 Jt-an/2 Jt-an. Proses cepat Bunga ringan RISMA. Hub. 0813 6146 0678

HONDA All New CRV, AT, Th. 2002. BK Mdn Warna silver, Ban Baru, Pajak Baru. DP 75Jt. Tinggal 27 bln x 187 3000. Suzuki Baleno Thn. 2002 BK Mdn Wrn. Hitam. Ban Baru, Pajak Baru, Tinggal pakai. Hub. 0853 5978 2343

H O N D A Stream 1,7 M/T Thn. 2002. Biru, BK Mdn Rp. 85Jt Net. Hub. 0 8 1 2 6 5 9 4 2 7 8 9 I SU Z U Panther LS Turbo Th. 2007. Coklat met, Plat B. Pajak, STNK Baru Rp. 140Jt. Hub. 0 8 5 2 7 5 3 8 3 2 1 8 MITSUBISHI Kuda Super Exceed Bensin Th. 99. Orisinil sekali, merah, complit. Hrg. 65Jt Nego. Abis. Hub. 0812 6281 6585 ISUZU Panther Pick Up Th. 2009 W. Hitam, BK Mdn AC, Tape, Mesin sehat, cat asli. Hrg. 105Jt Nego. Hub. 0812 6328 0528. Perum Lalang Green Land I No. D14.

ISUZU Panther New Royal Over Kredit Thn. 99. Silver, Complit, AC DB, Sudah dibayar 18x Sisa 18x2.450.000. Balik DP 48Jt Nego. Hub. 0823 6432 0052

Rp. 33.000

3 CM

Rp. 44.000

4 CM

Rp. 55.000

MITSUBISHI Kuda GLS Solar Silver Thn. 99. Sgt orisinil, mesin sehat, Hrg. 76 Jt Nego. Hub. 0853 7354 0433

TOYOTA GREAT Corolla ‘93 biru, mulus, AC dingin, kolong senyap, VR baru, sound sistem, stiur racing, BK Mdn, pajak panjang, cantik, simpanan. H. 65 Nego. HP. 0812 654 6463

M I T S . Colt PS 120 HD. Th. 03/ 04 (2 unit), BK Tgn. I, Keadaan Jalan, rawat body, chasis/ mesin baik. Hub. 0852 6022 9691

T OY OT A Altis Type G Thn. 2001. Warna Silver, Full sound, TV/CD. Original, jarang pakai. Harga: 115Jt/ damai. Hub. 0813 7618 8118 / BU.

NISSAN Xtrail ST Matic Thn. 2005, Hitam. BK Mdn Rp. 119Jt. Hub. 0 8 5 3 7 0 8 9 9 8 9 3

I N FO T OYOTA 1 0 0 % BARU Dapatkan Info Toyota Baru dan Special Promo di Bulan Juni. Cash/Credit dan Terima Tukar Tambah Hub. 0 8 2 3 7 0 8 8 0 8 1 5 . Annua r Da m a nik .

SU Z U K I Katana GX Putih met Th. 2002 Akhir. Ban Besar, Tampilan Gagah, Asli Medan. Hrg. 58Jt Nego. Hub. 0 8 1 2 6 0 6 3 7 8 2 3

DIJUAL SUZUKI FUTURA Box Thn. 2004. Warna biru, Box Aluminium. Harga 61 Nego. Hub. 0852 9737 6929 OV ER K REDI T Nissan Grand Livina 1,5 XV Manual. Warna Grey Abu2 metalic. Thn. 2007. Mobil cantik, orisinal. Balik DP 50Jt. Sdh. Bayar 10 Bln x Rp. 2.489.000. Sisa 26 Bln. Peminat Hub. 0812 6944 6999 SUPER JIMMNY 83, 4x4 (aktif), putih asli, ban “30, komodo extream, SR, VR, PS, AC Dingin, Tape, CD DVD MP3, BK Medan. off road model, atap rata, jok baru hadap dpn. H. 44Jt. Nego (Khusus penggemar) HP. 0 8 1 2 6 5 4 6 4 6 3

SU Z U K I APV Arena GX Thn. 11/12. Warna Abu2, AC DB, Jarang pakai. Harga 125 Jt/damai. Hub. 0 8 5 3 6 1 8 2 2 4 5 8 . Jual Cepat. TOYOTA Kijang Super G Thn. ‘95. Warna biru metalik, 1 tangan dari baru. Mobil cantik. Pajak panjang, AC DB, Asli Medan, Full orisinil, Rp. 65Jt. Depan Sekolah Eria No. 200. Hub. 0 8 5 3 6 2 3 1 2 3 2 3 / 7 8 5 1 4 0 2

TOYOTA Avanza G Th. ‘05. 1300cc. Manual, warna hitam metalik, mobil cantik Rp. 102Jt. Jl. SM. Raja No. 200. Hub. 0821 6767 7000 / 785 1402 TOYOTA Innova Thn. 2012 Tipe G Warna Grey mobil diasuransikan All Risk 2 Thn. Harga Rp. 230Juta/nego (TP). Hubungi 0 8 1 2 6 5 6 8 7 3 3 7 (M a nda H ut a soit )

SEDAN COROLLA All New. Th. 1997. Coklat metalik. Harga Rp. 67 Juta. Hub. JONI 0816 307 335

BUTUH DANA SOLUSI DANA CEPAT Bunga 1 % - 3 %, Tanpa Usaha, 3 Jam Cair Jaminan: SHM, HGB, SK Camat, BPKB Mobil, Spd. Mtr, Mobil kredit) Over Leasing/Pelunasan BPKB Hub: RINALDI

0821 6757 1653 - 0853 6100 3453

6 CM

Rp. 121.000


8 CM Rp. 137.500



* Khusus Pria, Tambah Ukuran - Panjang 13-16-19-22 cm diameter : 3,5, 4-4,5, 5-5,5,5-6 cm - Kuat dan Tahan Lama - Ejakulasi dini, Sphilis/rajasinga mani encer - Lemah Syahwat, diabetes, impoten, dll

2. DESIGN GRAFIS Syarat2: * Wanita * Pendidikan Min. SLTA/sederajat * Usia min. 18 tahun * Belum menikah * Disiplin, teliti dan jujur * Menguasai program coreldraw dan photoshop * Berpenampilan menarik Kirimkan lamaran lengkap dengan biodata ke C V. M A N DA L A G L O B A L I N D O , Jl. Bersama Ujung Griya Albania Blok K No. 4 Medan Tembung. Cantumkan posisi pada sudut kiri atas amplop anda


* Ingin cepat dapat jodoh, pengasihan & disegani atasan, menyatukan dan memisahkan PIL/WIL, puter giling, juga melayani pasang susuk. Tersedia pegangan untuk dagang, lulus tes, keselamatan, buka tambang, membuka lahan baru, pekerja hiburan, untuk jual beli tanah, rumah, mobil dengan cepat. Pengisian kosmetik, rokok, membuat anda tampil karismatik, cantik dan menarik, tampan, dll. Bergaransi, alami tanpa efek samping, langsung reaksi ditempat. Hasil permanen untuk seumur hidup

Alamat Praktek : Jl. SM Raja No. 134/10 (Depan Taman Makam Pahlawan) Samping Gedung Dakwah Muhammadiyah

HP. 0 8 1 3 8 0 4 2 6 2 5 3 , 0 8 2 1 6 6 5 6 4 5 1 3 Buku setiap hari jam 08.00 - 22.00 WIB 1 NB : Mobil Bisa Masuk, Rahasia Terjamin. Izin :B-70/DSP.5/II/2007

Special Kaos


* Promosi * Sekolah * Olahraga * Instansi / Dinas * DLL Harap Hubungi:

Jln. MT. Haryono No. 91/105 MEDAN Telp. (061) 4566414 - 4522412 Email:


CUCI GUDANG LAPTOP TERMURAH Merk Terkenal * Toshiba 14"...............1.7Jt ** Kwalitas Terjamin * Digaransi * Fujitsu 14" Lyr Ptr....1.9Jt Hub: 7508 3972 * Infokus Proyektor....1.8Jt 0813 0853 5880 0373 0813 6293 3325 * Toshiba 15".. . . . . . . .1.9Jt Pondok Kelapa No. 9B Road * Fujitsu 15"..................2.2Jt Medan-Ring Tersedia Cicilan Promo 5 Hari Saja !!! Kartu Kredit 12 Bln


G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

D I J U A L R U M A H /R U K O Ukuran 4,75x25 siap huni jl.laksana no 62.harga nego hp 081396113753

BURSA PERABOT T EM PAH AN M U RAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1.750.000 /mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun

Jl. Bunga Baldu I No. 13. SHM. Uk. 8,6 x 27M. Untuk tempat tinggal. 2 KM, 4 KT, Dapur Garasi. Hrg. 375 Jt Nego. Hub. 0852 3694 7401 - 0813 9667 5747

Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347

RUMAH DIKONTRAKKAN JL. DR. Mansyur Gg. Berdikari Komp. PLN No. 5, 4 KT, 2 KM, 1 Garasi. Air PDAM Listrik PLN. Hub. 0 8 1 5 5 5 6 7 8 0 3 3 0821 6849 1533

DI J U AL Rumah ukuran bangunan 8,5x18,5, 3 kamar tidur, 2 kamar mandi. Surat Sertifikat. Lokasi Strategis dan nyaman. di Jl. Bromo Gg. Mesjid Al Hidayah No. 6. HP. 0813 9657 9062 (samping Perumahan Bromo Regency)

DIJUAL 1 Rumah permanen di Jl. Amaliun Gg. Kp. Boyan no. 4C. LT. 10x12,5. Fasilitas: 3 KT, KM, RT, dapur, PLN 2200W, PAM, Lantai Granit, 2 AC, Lampu hias, teras bisa muat 2 mobil, Pagar keliling, SHM, Lokasi strategis, Lingk. muslim, bebas banjir. Peminat serius Hub. Lang : 0812 6905 5110

Hub: (061) 7364920 - 7323590










PRODUKSI: Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.7194 Fax. (061) 415.7504 SUMUT - INDONESIA

TERCECER TERCECER STUK BK 8697 CL No. Uji AB.01011609. An. PT. MITHA SARANA WIJAYA. Alamat Jl. Raya Pelabuhan No. 1 Medan Merk Mitsubishi.

TERCECER STUK BK 8699 CL. No. Uji AB. 01011610. An. PT. MITHA SARANA WIJAYA. Alamat Jl. Raya Pelabuhan No. 1 Belawan. Merk Mitsubishi.

T ERCECER STUK BK 1638 GF. No. Uji Mdn 54058 A/n. PT. U. Morina. Alamat Jl. Letda Sujono No. 18 Medan. Merk Daihatsu.

H I LAN G 1 Buah BPKB, STNK BK 4276 ABW, SIM C. A/n. Putri Feronika. Alamat Komp. PTP N. IV LK. XV. No. 31 B Medan.


DIJUAL CEPAT TANAH Seluas 1.789 meter. SHM, terletak di Jl. Sidomulyo Gg. Gelatik Ujung. Pasar 8 Bandar Khalifah Percut Sei Tuan. Hub. 0823 6614 5554

Dpt Diperoleh di Sumatera - Aceh




Media yang Tepat untuk Iklan Anda



Uk. 9,7 x 18 SK Camat. Jl.Makmur Gg. Sedar Tembung. Hub. 0 8 1 3 7 6 9 0 8 2 0 2 0852 7795 6969 0823 6844 5695

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar.

BIBIT TANAMAN Menjual Segala Jenis Bibit Tanaman: Bibit Gaharu, Jambu Madu, Pala, Cengkeh, Rambutan, Duku, Mangga Rusia, Manggis, Durian, Vokat Sambung, Sawoh, Kelapa Pandan Wangi, Asam Glugur, Jernang, Karet, Sawit, Jabon, Ingul/Suren, Melayani Partai Besar/Bersertifikat, Hub. Bapak Jamal - 0813 7091 2113



(Untuk Ambeien)


PT. REZ EK I PRI M A J AYA ABADI DI J U AL 1 Unit Rumah Ukuran Tanah 14,5 x 13 Meter, Luas Bangunan = 160 M2, SHM, Di Jln Garu II-B Gg. Pribadi No. 91 G. Hubungi: SOFYAN HARUN 081 2608 8206


Ingin Promosikan Produk Anda Harian




Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna K H U SU S WAN I T A: K H U SU S PRI A: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DI J AM I N 100% K ON SU LT ASI U M U M : H AN YA T EM PAT - Buka aura K AM I K LI N I K - Cari jodoh M AK EROT - Pelaris - Mencari orang hilang J L. LAK SAN A N O. 6 2 A M ASU K DARI J L. AM ALI U N Y U K I SI M PAN G RAYA M EDAN (PRAK T EK T ETAP) H P: 0 8 1 2 4 0 3 8 3 3 3 - w w w.t e ra pia lat vit a lm a ke rot .c om

Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000

L B T i p e 5 4 , LT 9 x 1 7 . S H M . Perumnas Griya Martubung. Berminat Hub. 0 8 1 3 9 6 5 2 8 9 5 0

DI J U AL RU K O Uk. Tanah : 5 1/2 x 28 M2 Bangunan 5 1/2 x 12 M2 Jl. M. Yakub Lbs. Bandar Klipa. No. 39 Medan. Hubungi: 0813 7690 8202 / 0852 7795 6969 - 0823 6844 5695

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG


Toko Bandung Jaya

Informasi Pembaca Bursa Property

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain?


* Khusus Wanita - Memperbesar Payudara - Terapi Perawan/Virgin - Kista, Lemah Kandungan - Kanker Payudara - Ingin mempunyai keturunan, dll

1 . S A L E S /M A R K E T I N G Syarat2: * Pria/Wanita * Pendidikan Minimal SLTA/sederajat * Usia min. 18 tahun * Memiliki kendaraan sendiri dan SIM C * Berpenampilan menarik * Sehat, disiplin, jujur dan bertanggungjawab * Bisa Negosiasi dan orientasi target * Bersedia untuk ditugaskan didalam dan diluar kota.




Dibut uhk a n Ce pa t S t a f f I n fo r m a s i


I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0


Bpk. Umar & Ust. A. Aziz

LOWON GAN K ERJ A PT. M om e nt Plus

Kami perusahaan berkembang yang bergerak di bidang distribusi popok bayi membutuhkan:


6 CM x 1,5 kolom Rp. 165.000

K ERJ A K APAL PESI AR Ikuti Training Sngkat, Usia max 31 thn. Lebih cepat, murah, terjamin. Hub. Jl. Karya Wisata no. 23 A. Johor. Ph. 7861690, Jl. KH Wahid Hasyim Medan. Tp. 4 5 3 3 8 7 5 , 4 5 6 9 2 . H P. 0 8 1 2 7 6 3 5 1 1 4 9

Syarat: Pria/wanita, usia 17-37 thn, Pend. terakhir SMU, Fotocopy Ijazah, Foto copy KTP. Antar langsung lamaran anda serta CV/Riwayat Hidup ke Alamat ini. Jl. Setia Luhur Komplek Griya Millenium Plaza No. 11 A. Info lebih lanjut anda bisa menghubungi: I BU ST EPH AN Y GRACE S. H P. 0 8 2 1 6 5 3 8 6 7 0 3 BAPAK N OV RI AN DI PU T RA AM D. H P. 0 8 1 3 8 2 4 7 7 0 0 7 Penghasilan Rp. 1.500.000,- Rp. 2.500.000/ bulan. 100% Bukan Sales.

Kamis, 12 Juni 2014





JL. SETIA BUDI .88: 0852 7683 0121 JL. B. KATAMSO 48: 0813 7628 9900 JL. YOS SUDARSO.178: 0813 7031 9992 BERSEDIA LUAR KOTA



HP. 0813 7035 7291 0813 6210 8239 Ada Garansi


8 4 5 .8 9 9 6 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim





Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

Luar Negeri Bandara Internasional Karachi Dibebaskan Dan Kembali Operasi WASPADA Kamis 12 Juni 2014

Milisi Etnik Uzbek Mengaku Serang Karachi Sebagai Balasan KARACHI, Pakistan (Waspada): Bandara terbesar Pakistan kembali beroperasi setelah serangan milisi yang menewaskan 28 orang, termasuk seluruh penyerang yang berjumlah 10 orang. Serangan terhadap bandara internasional Jinnah di Karachi dimulai Minggu dan pasukan keamanan kembali

Karachi. Menurut kelompok itu, serangan dilakukan sebagai balasan atas serangan udara Pakistan di daerah-daerah kesukuan bulan lalu yang diduga menewaskan sejumlah perempuan dan anakanak.

Gerakan Islam Uzbekistan menjalin kerja sama erat dengan kelompok militan al Qaida dan Taliban di Pakistan. Sebelumnya pemerintah Pakistanmengatakanparapelaku serangandibandarudaraKarachi sangatterlatihdantampaksebagai

orang-orang yang berdarah Uzbek.SeranganpertamaMinggu itu menewaskan 39 orang, termasuk para militan, dalam aksi tembak-menembak. Senin terjadi serangan lagi di dekat Bandar Udara Internasional Jinnah di Karachi.

Sementara itu kabinet Pakistan telah mengadakan sidang Rabu (11/6) membahas keamanan dalam negeri menyusul dua serangan. Pasukan keamanan baru menguasai keadaan di Bandara Jinnah Senin dinihari.(bbc/ r-m10)

menguasai keadaan Senin dini hari. Berita terkait TalibanPakistanmengatakan mereka melakukan penyerangan untuk membalas dendam pembunuhan pemimpin mereka tahunlalu.Pemerintahmengatakan penyelidikanmenyeluruhsedang berlangsung. Asif Kirmani, jurubicara PM Nawaz Sharif, juga memuji reaksi pasukan keamanan. Pada pengamat mengatakan kekerasan terbaru ini semakin mempertanyakan usaha Sharif memulaiperundingan damai denganTaliban.Pembicaraankedua belah pihak mencatat sedikit kemajuan sejak bulan Februari. Sejumlah pengecam mengatakan langkah ini dapat memberikan para milisi waktu untuk menghimpunkekuatan.Pakistan memerangi kelompok pembe-

rontak Islamis selama lebih sepuluh tahun dengan Taliban Pakistan sebagai kelompok militan utama di negara itu. PM Sharif baru-baru ini mengatakan kepada BBC dirinya berharap usaha perdamaian dengan Taliban akan berhasil. Tetapi kekerasan terus berlanjut dan Karachi seringkali menjadi sasaran utama.( Kelompok milisi etnik Uzbek yang beroperasi di ProvinsiWaziristanUtara,Pakistan,mengatakan para pejuang kelompok itu menyerang bandar udara Karachi. Kelompok milisi yang bernama Gerakan Islam Uzbekistan mengunggah foto-foto 10 pria yang mengenakan serban hitam dan membawa senapan. Mereka dikatakan sebagai pelaku serangan di bandar udara kota

Setelah Ukraina, AS Melatih Pasukan Khusus Eropa Timur WASHINGTON, AS (Reuters): Di saat NATO kembali fokus pada perbatasan sebelah timur setelah aneksasi Rusia terhadap Krimea, AS secara diam-diam mengerahkan lebih banyak pasukan untuk melatih pasukan khusus di bekas negara Soviet yang khawatir dengan niat Moskow. Latihan besar-besaran dimulai bulan lalu di Polandia, Slowakia dan negara-negara Baltik seperti Estonia, Lithuania dan Latvia yang melibatkan ratusan personil dari pasukan khusus AS, kata Komando Eropa-AS (EUCOM) dalam satu pernyataan kepada Reuters. Rencana jangka panjang termasuk latihan perang yang secara konsisten akan menempat-kan sekitar 100 pasukan elit AS di daratan dinegara-negaraNATOyangdekatdenganRusia,dimanatim-timnya bekerja di beberapa negara, kata pejabat AS Selasa (10/6). Kejadian di timur Ukraina, di mana pemberontak yang menggunakan bahasa Rusia menggunakan senjata canggih dalam mengancam memecah-belah negara itu, telah membuat seluruh negara bekas blok Soviet waspada dan menginginkan jaminan NATO. EUCOMmengatakan,KomandoOperasiKhususEropa(SOCEUR) meningkatkan jumlah pasukan dan cakupan latihan yang menurut rencanamerekaikutisetelahUkrainamengalamikerusuhan,sehingga memaksaWashington mengeluarkan peringatan kepada Moskow bahwa pihaknya akan membela sekutunya.(m23)

Helikopter NATO Bunuh Lima Tentaranya Sendiri KABUL, Afghanistan (Antara News): Lima tentara asing tewas diAfghanistanselatan,katapasukankoalisipimpinanNATO,sementara polisi dan gerilyawan Taliban mengatakan mereka dibunuh akibat tembakan dari pesawat-pesawat yang dipiloti sekutu mereka sendiri. PasukanBantuanKeamananInternasional(ISAF)tidakmemberikan alasan atas kematian Senin itu di Provinsi Zabul, Afghanistan selatan, beberapa hari sebelum pemilihan presiden putaran kedua. Pasukan itu mengatakan pihaknya sedang menyelidiki kematian itu. Komandan kepolisian lokal Ghulam Sakhir Roghlewai mengatakan Selasa (10/6): “Pasukan ISAF sedang dalam perjalanan pulang ke pangkalan-pangkalan mereka setelah satu operasi ketika mereka diserang gerilyawan itu. Serangan udara itu keliru menghantam pasukan mereka sendiri dan menewaskan para seradu itu.”

Junta Thailand Bantu Warga Menonton Piala Dunia BANGKOK, Thailand (AP): Junta militer Thailand, yang menjanjikan untuk‘mengembalikan kebahagiaan rakyat’ setelah kudeta bulan lalu, telah meminta para pejabat terkait untuk mencarikan jalan guna mengizinkan banyak fans sepakbola untuk menyaksikan seluruh acara pertandingan final Piala Dunia dengan gratis. Seorang pejabat regulator penyiaran, Takorn Tanthasit, mengatakanpihakjuntatelahmenghubungiketuabadanpenyiaran Rabu(11/6)danmemintadiauntukmengatursemuapertandingan untuk disiarkan secara gratis melalui jaringan bebas mengudara guna membahagiakan masyarakat di negara itu. Sebelumnya Rabu, satu pengadilan memutuskan bahwa perusahaan yang memegang hak siaran dapat menyiarkan lebih dari setengah dari 64 pertandingan yang dimainkan Piala Dunia melalui televisi satelit. Pemegang hak, RS, mengatakan pihaknya berencana untuk mengizinkan penyiaran 22 pertandingan secara gratis. Jam malam yang diterapkan junta tampaknya memaksa banyak orang untuk menyaksikan Piala Dunia di rumah.(m10)

Pemimpin Gerilyawan Abu Sayyaf Filipina Ditangkap MANILA, Filipina (Antara/AFP): Seorang pemimpin gerilyawan, yang masuk daftar buruan Amerika Serikat di antara orang “paling dicari” di dunia, ditangkap di Manila, Rabu (11/6), setelah dikejar beberapa tahun, kata polisi. Khair Mundos, yang kepalanya dihargai setengah juta dolar AS oleh pemerintah AS, ditangkap di daerah pinggiran Manila, kata pernyataan polisi. Departemen luar negeri AS menyebut dia sebagai seorang“pemimpin penting dan bendahara” Abu Sayyaf, satu kelompok garis keras Islam Filipina.Kelompok itu, yang dibentuk dengan bantuan dana dari Osama bin Laden pemimpin Al Qaida, melancarkan seranganserangan bom dan penculikan massal, sering jadi sasaan para warga asing dan Kristen yang mereka gunakan untuk meminta uang tebusan.Mundos sebelumnya ditangkap di Filipina selatan yang kacau tahun 2004 tetapi melarikan diri dari satu penjara provinsi tahun 2007.Sejak itu, pasukan keamanan telah mennburu dia di selatan, di mana Abu Sayyaf berpangkalan.

Pria Tennessee Mutilasi Dan Makan Jasad Korbannya TENNESSE, AS (CNN): Seorang pria asal Tennesse bernama Gregory Scott Hale tidak puas dengan hanya membunuh korbannya. Dia juga memenggal kepala, tangan dan kakinya. Dia menguburkan tubuh wanita yang sudah dimutilasi itu dalam tumpukan sampah diluarrumahnya,dandenganpengakuannya,diamemakansebagian jasad korbannya, demikian menurut surat tuntutan yang diajukan terhadap dirinya. Menurutdokumenyangsama,Halemengakumembunuhseorang wanita berusia 36 tahun, yang diidentifikasi bernama Lisa Hyder oleh KaptenFrankWatkinsdariDepartemenSherifdiCoffeeCounty,Tennesse. “Lisaadalahwanitabaik,diasangatcantik,”katatemandantetangganya Vicki Keenan kepada cabang CNN,WSMV. “Pasti orangnya benarbenar sudah sakit sampai bisa berbuat seperti itu.” Tidak ada indikasi Hale dan Hyder memang saling kenal sebelum dirinya ditemukan dalam keadaan tewas Jumat (6/6), kataWatkins, yangmenambahkanbahwapihakberwenangtidakpunyaalasanuntuk mempercayai Hale yang telah melakukan tindakan keji tersebut. PihakberwenangmengetahuitentangkejahatantersebutMinggu, danmenangkapHalehariberikutnya.Setelahmembunuhkorbannya, pria berusia 37 tahun itu meletakkan kepala dan tangannya dalam satu ember plastik. Kaki dan bagian tubuh lainnya dalam ember lain. (m23)


Ledakan Gas Tambang Batubara Tewaskan 10 Orang Di China The Associated Press

SEORANG polisi Kurdi berdiri berjaga-jaga sementara para pengungsi dari Mosul bergerak menuju daerah utara Kurdi di Irbil, Irak, 350 km utara Baghdad, Selasa (10/6). Militan Islamis menguasai beberapa bagian dari kota Mosul, kota terbesar kedua di Irak Selasa, mengusir pasukan keamanan dari pos mereka dan menyita markasbesar pemerintah provinsi, kantor pasukan keamanan dan gedung penting lainnya. PM Nouri al-Maliki ditekan parlemen untuk pentissed parliament to declare a state of emergency.

Gubernurl: Irak Pastikan Merebut Mosul Kembali BAGHDAD, Irak (AP): Pihak berwenang Irak mempertimbangkan untuk merebut kembali kota Mosul di Irak Utara setelah hampir seluruh kota tersebut direbutolehmilitanyangterinspirasi al Qaida, kata gubernur provinsi itu Rabu (11/6). Dia sendiri juga melarikan diri dari kota itu. “Mosulmampuberdiridiatas kakinya lagi dan menyingkirkan semua pendatang dari luar dan kita punya rencana untuk memulihkan kembali keamananm,” kata Atheel al-Nujaifi, gubernur provinsi Ninevah. Serangan mengejutkanolehkelompokalQaida itu, yang dimulai Minggu malam, ke sejumlah gedung pemerintah,

memaksa pasukan keamanan keluar dari kota tersebut dan menyitakendaraanmilitersementara ribuanpendudukmengungsidan meninggalkan kediaman mereka di kota kedua terbesar di Ninivah. Rabu, sejumlah warga Mosul mengatakan kelompok bersenjata mengetuk pintu mereka, berusahameyakinkanwargakota bahwa mereka tidak akan menyakiti mereka. Situasi di kota itu terlihat tenang, namun tegang, kata penduduk. Sekitar 500.000 warga Irak meninggalkan rumah-rumah merekadikotaMosulsetelahgerilyawan menguasai kota itu, kata Organisasi Internasional untuk

Migrasi (IOM), Rabu (11/6). Organisasi yang bermarkas di Jenewaitumengatakansum-bersumbernyadilapanganmemperkirakan aksi kekerasan itu menyebabkan kelompok gerilyawan NegaraIslamIrakdanLevant(ISIL) merebut Mosul, Selasa“mengakibatkan500.000otangdidansekitar kota itu mengungsi”. Aksi kekerasan di Mosul “menimbulkan banyak korban di kalangan sipil,” kata IOM dan menambahkan bahwa “kampus kesehatan utama, satu kelompok empat rumah sakit, tidak dapat menampung, karena letaknya dekat dengan satu lokasi di mana terjadi pertempuran.”“Sejumlah

masjid telah digunakan untuk klinik-klinik yang merawat para korban,” katanya. Kendaraan-kendaraan dilarang memasuki pusat kota, dan penduduk dipaksa mengungsi berjalankakimenghadapipenembakan yang membabibuta. Daerah-daerah permukiman di baratkotaitukekuranganairminum setelah pusat air utama di daerah itu hancur akibat serangan bom, danbanyakkeluargamenghadapi kekurangan pangan, kata IOM. IOMmengatakanpihaknyadan organisasi-organisasiinternasional telahmenerimaseruandaripihak berwenangIrakuntukmembantu mengatasi situasi itu. (m10)

Presiden Assad Pimpin Daftar Tersangka Penjahat Perang JENEWA, Swiss (Reuters): Presiden Syria Bashar Assad memimpin daftar 20 pejabat pemerintah dan pemberontak yang didakwa menjadi penjahat perang yang disusun sejumlah pakar hukum yang akan diadili suatu hari nanti, kata mantan jaksa yang menangani kejahatan perang internasional. Daftar tersebut telah diserahkan kepada Pengadilan Kriminal Internasional (ICC), disertai dengan setiap insiden yang menjelaskan pelanggaran hukum Roma di mana seorang tersangka bisadidakwa,begitumenurutDavid Crane, mantan Kepala Jaksa Pengadilan Khusus untuk Sierra Leone dan sekarang memimpin Proyek Akuntabilitas Syria. Satu tim penyelidik PBB secara terpisah telah membuat empat daftar rahasia berisi nama-

nama tersangka penjahat perang di masing-masing pihak di Syria, namun menolak menjabarkan nama-namanya. Crane mengatakan, dalam daftar itu yang dikumpulkan kelompok pakar itu berisi nama-nama anggota militer dan tokoh elit politik Syria serta angngota pemberontak Islam ISIS dan Front Al-Nusra, meski dia tidak menyebutkan nama-nama selain Assad. “Kami memiliki sekitar 20 terdakwayangbertanggungjawab besar atas perang di Syria. Kami bukanhanyamengejarAssaddan antek-anteknya, kami mendokumentasikan semua insiden di kedua pihak,” kata Crane kepada Reuters Selasa (10/6). Dia menyampaikanhalitusetelahterlibat dalamdiskusitentangpenyiksaan dankejahatanlainyangdilakukan di pusat-pusat tahanan selama

berlangsung perang sipil di Syria, yang bermula dari demonstrasi damai anti-Assad Maret 2011. Gambar-gambar yang diambil oleh jurufoto polisi militer Syria dengankodeCaesar,terbitJanuari lalu, memperlihatkan ‘bukti jelas’ penyiksaan dan pembunuhan yang sistemik terhadap sekitar 11.000 tahanan dalam kondisi yang mirip dengan kamp kematian Nazi, kata sejumlah mantan jaksa termasuk Crane. “Kami jarang mendapatkan bukti seperti ini, sebagian besar bukti yang didapat sambil lalu,” kata Crane tentang 55.000 foto jenazah, banyak di antaranya dengan kondisi mata dicungkil dan tanda-tanda kelaparan. “Foto-foto ini tidak bisa dipalsukan. Ini bukan perbuatan tentara gila, ini hasil dari kebijakan pemerintah,” kata Sir Desmond de Silva,

salah seorang yang menganalisa foto-foto ‘Caesar’ dan mantan jaksa lain, kepada panel. Crane, seorang guru besar Amerika di Akademi Hukum Universitas Syracuse di NewYork, meluncurkan Proyek Akuntabilitas Syria di tahun 2011 untuk mendokumentasikan kejahatan perang dan kejahatan terhadap kemanusiaan yang dilakukan semua pihak dalam konflik Syria. Proyek tersebut sekarang memiliki 1.400 halaman berisi tuduhan yang bisa dipercaya, dilengkapidengantanggal,tempat dansatuanyangdicurigaimelakukan kejahatan itu, katanya.|(m23)

GUIYANG, China (Antara/Xinhua-OANA): Sepuluh orang dikonfirmasi tewas setelah ledakan gas terjadi di satu tambang batu bara di Provinsi Guizhou, China Baratdaya pada Rabu (11/ 6) dinihari. Pemerintah lokal di Kota Liupanshui mengastakan 130 pekerja tambang sedang bekerja di bawah tanah di Tambang Batu Bara Xinhua ketika ledakan gas terjadi beberapa menit setelah tengah malam. Sebanyak 120 pekerja di antara mereka berhasil menyelamatkan diri. Sampai pukul 05:20 waktu setempat, petugas pertolongan telah menemukan mayat semua 10 korban dari lorong tambang, demikianlaporanXinhua.TambangituadalahmilikGuizhouHualong Coal Industry Co. Ltd., yang merupakan perusahaan patungan antara satu perusahaan tambang lokal dan China Resources Power Holdings Co. Ltd., yang terdaftar di Hongkong.

Rekonsiliasi Palestina Terancam Perpecahan GAZA CITY, Jalur Gaza (Antara News): Seorang pemimpin kelompok Hamas menuduh Presiden Mahmoud Abbas dari partai Fatah telah membahayakan kesepakatan rekonsiliasi, hanya sepekan setelah terbentuknya pemerintah gabungan antara dua faksi berseteru di Palestina. Persoalan antara kedua pihak muncul setelah pemerintah gabungan Palestina tidak membayar gaji 40.000 pegawai negeri sipil yang diangkat oleh Hamas di Gaza, menyatakan para pegawai harus menjalani pemeriksaan terlebih dahulu sebelum menerima gaji mereka. Ketegangan itu bergeser keTepi Barat pada Senin, ketika Hamas mengatakan bahwa pasukan keamanan yang setia pada Abbas telah menggunakan kekerasan untuk membubarkan demonstrasi yang diorganisir oleh gerakan dan menghina ulama senior Hassan Youssef. Sebelum pemerintah gabungan terbentuk, Hamas adalah partaiyangberkuasadiGazasejak2007sementaraFatahmembentuk pemerintahan terpisah bernama Otoritas Palestina di Tepi Barat. “Sejak pakta rekonsiliasi ditandatangani, kesenjangan kita dan Fattah dan pasukan keamanan makin besar,” kataYoussef di Kota Ramallah, Selasa (10/6). “Ini bukan persatuan. Mereka melakukan ini untuk menekan kami untuk mengatakan kami tidak ingin rekonsiliasi. Kami menginginkan rekonsiliasi,” kata pejabat Hamas itu, menuduh polisi-polisi Abbas menyita bendera dan menahan kelompok pendukung. Seorang sumber keamanan diTepi Barat mengatakan bahwa polisi mulai mengintervensi pengunjuk rasa setelah mereka mengumandangkan slogan-slogan menentang Otoritas Palestina. Sementara Fatah menuduh aktivis Hamas telah menyerang pendukungnya di kota Hebron,Tepi Barat, pada Selasa dan sehingga menyebabkan empat orang harus dirawat di rumah sakit. Seorang pejabat senior dari Fatah, Azam al-Ahmad, mengatakan bahwa keterlambatan pembayaran gaji PNS bukan merupakan kesalahan pemerintah gabungan. Dia mengatakan bahwa pemerintah membutuhkan waktu empat bulan untuk menyelesaikan proses pemeriksaan pegawai dari Gaza. Ketegangan meningkat di Gaza karena saat pegawai Hamas belum dibayar, staf yang terikat dengan Otoritas Palestina tetap menerima gaji. Setelah Hamas mengambil alih kekuasaan di Gaza pada 2007, pihak Otoritas Palestina di Tepi Barat tetap membayar gaji 70.000 pegawainya di Gaza meskipun sebagian besar dari mereka tidak lagi bekerja.

Masjid-masjid Di Saudi Siap Untuk Menyambut Ramadhan PUASA Ramadhan tidak lama lagi sampai dan sebagaimana tahun-tahun sebelumnya, pihak Kerajaan Arab Saudi kini sibuk membenahi masjidmasjid di seluruh kerajaan untuk disiapkan menyambut kedatangan bulan suci itu, pada saat mana jumlah jamaahnya selalu makin bertambah. Kementerian Urusan Islam telah menginstruksikan departemen masjid-masjid di kementerian itu untuk mengatur untuk mengakomodasi penambahan besar jamaah selama bulan Ramadhan. Sejumlah masjid di Riyadh telah direnovasi dan dipasang permadani baru dan dilengkapi sajadah untuk sholat. Departemen masjid telah mengarahkan para imam dan muazzin dari semua masjid di Kerajaan Arab Saudi untuk menjaga mereka tetap rapi dan menjamin cukupnya pasok

listrik dan air selama bulan suci untuk memenuhi kebutuhan terutama karena kenaikan jumlah jamaah yang akan datang ke masjid untuk melaksanakan sholat Taraweh setelah sholat Isya.’ Lembaga-lembaga swasta yang dikontrak untuk mengurus keperluan masjid-masjid telah diminta untuk menjalankan tugasnya pada malam hari selama bulan suci untuk menjamin ketersediaan air dan pasok listrik di semua tempat ibadah dan untuk menerangi masjid. Departemen masjid mengurusi lebih dari 7.000 masjid di Riyadh saja, sementara masjidmasjid lain di kota dan kawasan pinggiran kota telah dibangun dan diurus oleh para anggota keluarga kerajaan dan lembaga amal. Ruang pemisah permanen untuk wanita dibangun di masjid-masjid yang tidak memiliki ruang sholat yang memisahkan

antara ruang pria dan perempuan Imam Ubaidullah Abdul Aziz, di Distrik Naseeriyah mengatakan: “Masyarakat senang datang ke masjid untuk melakukan ibadah, teristimewa pada bulan Ramadhan, pada saat mana biasanya diperlukan ruangan yang luas bagi mereka yang inginmelaksakansholatTaraweh.” Dia juga mengatakan bahwa Ramadhan bukan saja memberikan kesempatan paling besar dan menarik untuk bertemu dengan banyak saudaranya seiman dan juga membantu mereka melakukan perbuatan baik yang akan mendapatkan imbalan yang amat besar dari Allah SWT. “Kami membuat berbagai usaha untuk memberikan kenyamanan dan suasana damai sehingga mereka dapat melaksanakan ibadahnya dengan khusuk,” kata imam Ubaidah.

Dia juga mengatakan pengeras suara di luar masjid tidak akan digunakan pada saat sholat Taraweh, sesuai dengan arahan Departemen Masjid di Kementerian Urusan Islam. Hotel juga siap sambut Ramadhan Bukan masjid saja yang bersiap menyambut kedatangan bulan Ramadhan, banyak hotel juga telah melakukan persiapan menyongsong datangnya bulan suci itu. Banyak hotel di Jeddah telah mulai membangun tenda-tenda untuk menyambut kedatangan Ramadhan. Biasanya pada saat Ramadhan ada tradisiuntukmenunjukkansaling berkasih sayang antara sesama Muslim, terutama di kalangan penduduk di Jeddah , yang bersama-sama menunggu saat iftar (berbuka puasa) dan sahur bersama teman dan saudara. Mohammed Alrifai, kepala

marketing dan hubungan masyarakat di Intercontinental Hotel, mengatakan tenda-tenda telah menjadi favorit untuk tempat berkumpul bagi banyak warga lokal selama lebih 30 tahun terakhir,teristimewa bagi mereka yang senang berbuka puasa di luar acara rutin. Dia mengatakan hotelnya telah mulai memasang tenda, yang dilengkapi lampion tradisional. Pada acara berbuka bersama itu akan disajikan buffet untuk iftar dan sahur dan duduk dengan gaya duduk tradisional Arab di mana keluarga dapat menikmati suasana spiritual Ramadhan. Alrifai mengatakan acara buffet itu menyuguhkan makanan tradisional, termasuk sup, sambusaks, kopi Arab, kurma, salad, nasi, ayam dan ikan, serta minuman tradisional seperti Vimto dan jus aprikot. (sg/an/mujo)

The Associated Press

WARGA India melepaskan dahagaya dengan air dingin yang diberikan para pedagang dengan cuma-cuma di satu pasar di New Delhi, India, Rabu (11/6). Gelombang udara panas berlanjut melanda beberapa bagian India dengan temperaturnya tercatat 45 derajat Celsius (113 Fahrenheit).


WASPADA Kamis, 12 Juni 2014


WASPADA Kamis 12 Juni 2014


LhokseumaweJuaraUmumPopdaXIII Bireuen Kampiun Sepakbola

Perolehan Medali Popda XIII

LHOKSEUMAWE (Waspada): Tuan rumah Kota Lhokseumawe tampil sebagai juara umum Pekan Olahraga Pelajar Daerah (Popda) XIII/2014 Provinsi Aceh. Popda Aceh ditutup resmi Wali Kota Lhokseumawe, Suadi Yahya, di Stadion Tunas Bangsa, Rabu (11/6) sore.

Waspada/Munir Lubis

SEKDAKAB Madina, Drs M Yusuf Nasution didampingi Kabid Organisasi KONI Sumut Mukhtar Aritonang dan Ketua KONI Madina Khoiruddin Faslah Siregar, menyerahkan bola kepada wasit Suprapto saat pembukaan Porwil IV Sumut di Stadion Madina, Rabu (11/6).

Madina Gelar Empat Cabor Porwilsu PANYABUNGAN (Waspada): Pelaksanaan Pekan Olahraga Wilayah IV Sumatera Utara untuk empat cabang olahraga, yakni sepkbola, bola voli, tinju, dan angkat berat dibuka resmi Sekdakab Madina, M Yusuf Nasution, di Stadion Pemkab Madina, Rabu (11/6). Pembukaan ditandai penyerahan bola kepada wasit Suprapto yang memimpin pertandingan perdana antara tuan rumah PS Madina dan PS Taput. Turut menyaksikan Ketua KONI Sumut diwakili Kabid Organisasi Mukhtar Arito-

nang, Ketua KONI Madina Khoiruddin Faslah Siregar, Ketua PSSI Madina Budi Rahmad Lubis, dan undangan. Sekdakab mengatakan Pemkab Madina sangat mendukung Porwilsu dan mengucapkan terima kasih atas kepercayaan KONI Sumut kepada Madina yang berada di Wilayah IV sebagai tuan rumah cabor sepakbola, bola voli, tinju, dan angkat berat. “Melalui Porwilsu ini, mari kita junjung sportivitas, jalin persaudaraan, dan pererat tali silaturahim sesama atlet, pe-

Waspada/Zamzamy Surya

BUPATI Aceh Selatan, HT Sama Indra (kiri), menyerahkan bendera pataka kepada Ketua Kontingen Syamsulijar saat acara penglepasan kontingen Pora Aceh Selatan, Rabu (11/6).

Rp5 Juta Bonus Medali Emas Pora

latih, ofisial serta insan olahraga demi menciptakan rasa persatuan dan kesatuan di antara kontingen dari kabupaten/kota lain,” ujarnya. Ketua KONI Madina, Khoruddin Faslah Siregar, juga mengaku bangga atas kepercayaan diberikan KONI Sumut sebagai tuan rumah penyelenggara empat cabang olahraga, karena tujuannya untuk peningkatan SDM di bidang olahraga. “Mudahan-mudahan tahun depan Madina tidak hanya sebagai tuan rumah pelaksanaan seleksi Porprovsu, tetapi dapat melaksanakan Porprovsu. Kegiatan ini juga sangat kami apresiasi, karena banyak bakat dan atlet terpendam di daerah untuk bisa berkiprah di PON 2016,” katanya. Ketua Panitia, Rahmad Hidayat Dalimunthe, melaporkan cabor sepakbola diikuti empat dari sembilan kabupaten/kota peserta Wilayah IV, yakni Madina, Taput, P. Sidimpuan, Palas. Cabor tinju dilegar 13-15 Juni 2014, voli 16-22 Juni, dan angkat berat 23-26 Juni 2014. Pertandingan sepakbola hari pertama kemarin, tuan rumah Madina menundukkan PS Taput 1-0. Gol kemenangan anak-anak asuhan Budi Rahmad Lubis dan Miswar Daulay tersebut disumbangkan Yasiruddin Nasution di menit 13. (a28)

Kota Lhokseumawe yang menurunkan 127 atlet berhasil menyabet 14 medali emas, 8 perak, dan 13 perunggu. Pencak silat menjadi cabor pengumpul medali emas terbanyak bagi tuan rumah, yaitu 5 emas. Sedangkan sepakbola, takraw, dan voli gagal meraih medali. Juara bertahan Kota Banda Aceh harus puas di posisi kedua dengan meraih 9 emas, 5 perak, dan 14 perunggu. Perolehan ini menunjukkan Banda Aceh bersama Aceh Utara terbanyak meloloskan atlet ke semifinal dengan perolehan perunggu masing-masing 14 medali.

Aceh Besar di posisi ketiga dengan 7 emas, 11 perak, dan 4 perunggu. Sedangkan posisi juru kunci diduduki Kabupaten Gayo Lues setelah gagal meraih satu medali pun. Sebelum acara penutupan, digelar partai final cabor sepakbola antara Bireuen dan Pidie. Bireuen tampil juara setelah menang 5-1. Tambahan medali sepakbola membuat Bireuen naik ke peringkat 13 dari sebelumnya di posisi 15. Sedangkan Pidie tetap di posisi sembilan. Wali Kota Lhokseumawe, Suaidi Yahya didampingi Kadispora Aceh Asnawi, Dandim 0103/Aceh Utara Letkol Inf

Waspada/Mustafa Kamal

WALI KOTA Lhokseumawe, Suaidi Yahya (kiri), memegang piala juara umum Popda XIII Aceh di Stadion Tunas Bangsa, Lhokseumawe, Rabu (11/6) sore. Agus Triantoni, mengaku bersyukur dan memberikan apresiasi kepada para atlet yang telah membawa Lhokseumawe tampil sebagai juara

LHOKSEUMAWE ( Waspada): Sejumlah Tokoh Masyarakat Kabupaten Aceh Utara dan beberapa LSM serta Ormas meminta Gubernur Aceh, Zaini Abdullah, untuk segera memisahkan Dinas Pemuda dan Olahraga (Dispora) dari dinas lainnya. Hal ini dinilai penting agar kegiatan pemuda dan olahraga tidak terkendala dengan masalah lain. Apalagi sejak penggabungan dinas terjadi, kegiatan pemuda dan olahraga di gampong-gampong (desa) terlihat lesu. Selain disebabkan lemahnya perhatian dinas terkait, juga karena minimnya anggaran olahraga yang didapat oleh para pemuda selama ini. Padahal dalam Undang-Undang Keolahragaan telah diingatkan, pemerintah wajib membantu biaya olahraga masyarakat. “Bagaimana mungkin Aceh memiliki atlet atau tim olahraga yang solid, jika perhatian dan pembinaan olahraga minim anggaran? Untuk mendapatkan bola voli saja, para pemuda di gampong-gampong harus membeli dengan uang mereka sendiri,” ujar Zainal Abidin Badar, Tokoh Masyarakat Aceh Utara yang juga

Waspada/Maimun Asnawi

Direktur Eksekutif LSM Reuncong Aceh, Rabu (11/6). Kemudian, lanjutnya, pembangunan lapangan olahraga juga masih sedikit. Umumnya yang telah dimiliki masyarakat lapangan sepakbola dan bola voli, tapi untuk bulutangkis, tenis meja, dan lainnya belum ada. “Ini harus menjadi perhatian,” kata Zainal lagi. Menurut Zainal, pemisahan Dinas Pemuda dan Olahraga dari Dinas Pendidikan, Pariwisata dan Kebudayaan merupakan hal mutlak yang harus dilakukan dalam waktu dekat, jika Aceh menginginkan prestasi olahraga ke depan lebih baik. Terkait hal tersebut, Kepala Dinas Pemuda dan Olahraga Provinsi Aceh, Asnawi (foto),

saat ditemui Waspada, Rabu (11/6) pagi, dalam acara penutupan Popda XIII di Lhokseumawe, mengatakan Kementerian Pemuda dan Olahraga (Kemenpora) juga menginginkan agar Dispora dipisahkan dari dinas lain di seluruh provinsi di Indonesia. Begitu pun, kebijakan tersebut tetap dikembalikan kepada kepala daerah masing-masing karena ini otonomi khusus. Ditanya Aceh sepi dalam pembinaan pemuda dan olahraga, Asnawi menjawab dengan mentamsilkan penanaman mangga diharapkan berbuah mangga, bukan buah kuini dan itu merupakan hara-

Hitam melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2. 8
















8 5 11 7 3 1 8 8 3 2 2 2 1 3 2 0 3 2 2 1 0 0 0

13 14 4 8 11 4 14 6 4 3 3 2 3 10 2 4 4 4 2 4 6 1 0

XIV/2016. Tujuh kabupaten/ kota dimaksud adalah Aceh Timur, Langsa, Aceh Barat, Aceh Besar, Aceh Utara, Aceh Singkil, dan Sabang. (cmk)

LANGSA (Waspada): Kontingen Kota Langsa menduduki posisi kelima dalam perolehan medali Pekan Olahraga Pelajar Daerah (Popda) XIII/ 2014 Provinsi Aceh di Kota Lhokseumawe. Langsa menduduki posisi kelima dengan menyabet 5 medali emas, 3 perak, dan 11 perunggu. Posisi pertama diraih tuan rumah Kota Lhokseumawe, disusul Banda Aceh, Aceh Besar, dan Kota Sabang.

PIALA DUNIA 2014 MENDATAR 1. Tuan rumah Piala Dunia 2014 yang dibuka hari ini. 4. Kroasia (tulis dalam bahasa Inggris), lawan tuan rumah hari ini. 7. Negara juara tahun 1966, tampil tanggal 14 Juni lawan Italia. 8. Negara juara tahun 2010, tampil tanggal 13 Juni lawan Belanda. 9. Negara Amerika Selatan di Grup E bersama Prancis, Swiss dan Honduras. 11. Negara Eropa Barat di grup E selain Swiss, bertanding 15 Juni lawan Honduras. 13. Negara CR7 lawan Jerman tanggal 16 Juni. 14. Tuan rumah Piala Dunia 1986, lawan Brazil tanggal 17 Juni. 17. Juara Piala Dunia 1978, satu Gruf F dengan Bosnia, Iran dan Nigeria. 19. Kode negara Ghana dari FIFA. 20. Kode negara Belgia. 21. Negeri sakura, lawan Pantai Gading tanggal 14 Juni. 24. Negeri asal Zidane (tulis dalam bahasa Inggris). 26. Kode negara Honduras. 27. Negaranya Luis Suarez, satu grup D dengan Inggris, Italia dan

pan Kemenpora. Namun semua itu tergantung pemerintah di daerah. “Meski demikian, perkembangan olahraga di Aceh cukup baik. Walau Dispoara digabung dengan dinas lain, Pemerintah Aceh tetap membantu berbagai alat olahraga untuk seluruh daerah di Aceh. Cuma anggaran olahraga memang masih sangat terbatas,” kata Asnawi. Kepala Bidang Pemuda dan Olahraga Dispoara Aceh, Musri, menambahkan persoalan pemuda dan olahraga memang telah dikuatkan dalam undang-undang agar membentuk satu badan atau dinas

yang mengurus keolahragaan. Kendala daerah dalam membentuk lembaga tersendiri mungkin akan menambah beban untuk APBA dan APBK. Maka untuk mengurangi beban ini, daerah menggabungkan Dispoara dengan dinas lain, tetapi tidak mengabaikan dunia olahraga. “Pembinaan olahraga di Aceh sudah cukup bagus. Contohnya di Popda ini hampir rata-rata daerah memperoleh medali yang seimbang. Itu berarti meski tidak ada dinas olahraga, pembinaan tetap berkembang. Buktinya atletatlet kita cukup bagus,” katanya. (b18)

Langsa Peringkat 5 Popda Aceh

TAPAKTUAN (Waspada): Bupati HT Sama Indra berjanji memberikan bonus Rp5 juta kepada atlet Kabupaten Aceh Selatan yang berhasil menyabet medali emas Pekan Olahraga Aceh (Pora) XII/2014 di Kabupaten Aceh Timur, 14-21 Juni. Janji tersebut diucapkan bupati di hadapan para atlet saat acara penglepasan kontingen Aceh Selatan menuju Aceh Timur di Gedung Pertemuan Rumoh Agam, Tapaktuan, Rabu (11/6). “Saya akan memberikan bonus 5 juta rupiah kepada atlet yang berhasil meraih satu medali emas di Idi, Aceh Timur,” kata bupati yang langsung mendapat sambutan hangat para atlet, termasuk unsur Muspida yang hadir dalam acara itu. Bupati HT Sama Indra yang juga Ketua Umum KONI Aceh Selatan ini mengakui prestasi olahraga di daerah penghasil pala ini belum menjadi imam, melainkan masih menjadi makmum, bila ditamsilkan dalam shalat berjamaah. “Karenanya, atlet-alet Aceh Selatan harus terus meningkatkan kemampuan, khususnya di Pora nanti diharapkan dapat berjuang maksimal mempersembahkan prestasi terbaik bagi daerah,” pinta bupati sambil memberikan semangat kepada para atlet. Acara penglepasan kontingen turut dihadiri Muspida Aceh Selatan ditandai dengan penyerahan bendera pataka kepada Ketua Kontingen Syamsulijar untuk dikibarkan di arena pertandingan Pora di Aceh Timur. Ketua Kontingen, Syamsulijar, melaporkan Aceh Selatan menurunkan 208 personil, terdiri atas 145 atlet, 5 tenaga medis, 48 ofisial, dan 10 panitia. Aceh Selatan mengikuti 16 dari 25 cabang olahraga yang diperlombakan di Pora. Sebelumnya dalam Pora 2010 yang saat itu masih bernama Porprov Aceh, Kabupaten Aceh Selatan berhasil menduduki posisi 10 Besar dengan menyabet 18 medali emas, 23 perak, dan 40 perunggu. Sebelumnya, bupati juga berharap Aceh Selatatan minimal mempertahankan prestasi yang diraih di tahun 2010 tersebut. (b30)


14 9 7 6 5 5 4 4 4 4 4 3 2 1 1 1 0 0 0 0 0 0 0

Gubernur Aceh Diminta Pisahkan Dispora

Janji Bupati Aceh Selatan

Problem Catur

umum. Sebelumnya, panitia menyebutkan sebanyak tujuh kabupaten/kota telah mencalonkan sebagai tuan rumah Popda

Lhokseumawe Banda Aceh Aceh Besar Sabang Langsa Aceh Barat Aceh Utara Pidie Jaya Pidie Bener Meriah Nagan Raya Aceh Tengah Bireuen Aceh Tamiang Aceh Singkil Subussalam Aceh Selatan Aceh Timur Simeulue Aceh Barat Daya Aceh Tenggara Aceh Jaya Gayo Luwes

Kosta Rika. 29. Tim oranye, satu grup B dengan Spanyol, Chile dan Australia.

MENURUN 2. Rusia (tulis dalam bahasa Inggris) satu grup H dengan Belgia, Aljazair dan Korsel. 3. Negerinya Khomeini, lawan Nigeria tanggal 16 Juni. 4. Negara Amerika Selatan penantang Australia tanggal 13 Juni. 5. Kode negara Aljazair dari FIFA. 6. Negeri Kanguru. 10. Kode negara Korea Selatan. 12. ——Rica, penantang Uruguay di grup D. 13. Kode negara Portugal. 15. Negara berkode “Eng” dari FIFA (grup D). 16. Cameroon (tulis dalam bahasa Indonesia). 18. Italia (tulis dalam bahasa Inggris), lawan Inggris tanggal 14 Juni. 20. Kode negara Bosnia & Herzegovina. 22. Kode negara Ekuador. 23. Negara Afrika, satu grup G dengan AS, Jerman dan Portugal. 25. Kode negara Jerman. 28. Kode negara Yunani.

Demikian dikatakan Kasi Olahraga Prestasi Dispoara Langsa, Drs Muzakir M Adji, Rabu (11/6). Menurut Muzakir, hasil ini jauh di bawah target yang diusung Langsa. Sebelumnya, Langsa menargetkan meraih minimal 9 medali emas. “Sejumlah cabor yang diharapkan mendulang medali emas malah gagal, seperti bola basket, begitu juga cabor pencak silat dan sepakbola. Setelah kita lakukan evaluasi, ke-

gagalan Langsa memenuhi target medali karena masa persiapan atlet masih kurang,” ucapnya. Begitu pun, Muzakir berharap atlet yang belum berhasil meraih prestasi untuk terus dapat meningkatkan kemampuan dengan memperbanyak latihan. Sehingga dalam Popda 2016 seluruh atlet Langsa bisa bermain maksimal dan mempersembahkan prestasi terbaik. (m43)



A11 Bintang Jaya Gagal Balas PSMS

Kamis 12 Juni 2014

KISARAN (Waspada): Misi balas dendam PS Bintang Jaya atas kekalahan di pertemuan pertama dari PSMS Medan gagal terwujud, setelah ditahan Ayam Kinantan 0-0 dalam laga Divisi Utama Liga Indonesia Grup I di Stadion Mutiara Kisaran, Rabu (11/6).

Waspada/Dedi Riono

ATLET judo MJC yang sukses tampil sebagai juara umum Medan Judo Championship 2014 diabadikan bersama para pelatih dan ofisial.

MJC Puas Rebut Juara Umum Medan Judo Championship MEDAN (Waspada): Medan Judo Club (MJC) sukses melahirkan para juara dengan menyabet 9 medali emas, 11 perak, dan 14 perunggu dalam ajang Medan Judo Championship 2014. Kejuaraan digelar Pengkot PJSI Kota Medan itu berlangsung di Palladium Medan. “Dalam kejuaraan yang berlangsung 7-8 Juni lalu itu, MJC pimpinan Ketua Umum Juandri Nasution menurunkan 37 atlet. Mereka ditangani tiga pelatih, yakni Deni Zulfendri, Hera Sulistia, dan Ricky Ramadhani,” ujar pelatih MJC, Deni Zulfendri, Rabu (11/6). Dijelaskan, dengan raihan medali tersebut, MJC tampil sebagai juara umum. Tahun

lalu dalam kejuaraan yang sama, gelar juara umum diraih tim dari Sumatera Barat. “Kami bersyukur bisa mendominasi kejuaraan, mengingat event kali ini bertarap internasional dengan diikuti peserta dari Singapura, Malaysia, dan sejumlah negara asing lainnya,” ucap Deni. Lebih lanjut Deni mengatakan, saat ini MJC membina sekira 40 judoka di Dojo Jl Gaharu. Para atlet latihan setiap Senin, Rabu, dan Jumat. Namun selama ini para atlet kurang bisa unjuk kemampuan karena jarang digelar kejuaraan judo. “Kalau ikut kejuaraan ke luar Medan biayanya besar. Jadi memang jarang sekali

anak-anak menguji kemampuannya. Padahal potensi mereka untuk menjadi atlet nasional cukup besar, namun lagi-lagi minim jam tanding,” ungkap Deni. Sembilan medali emas MJC, tiga di antaranya diraih dari kelompok senior oleh Ricky Ramadhani (60 kg), M Yufli (-66), dan Raihan Fuadi (-73). Dari kelompok U-16 juga mendapat tiga emas dipersembahkan Husaini (-60 kg), Juan Felix (-66 kg), dan Kristian Hadinata (-73 kg). Tiga medali emas lainnya diraih dari kategori usia 19 tahun melalui Rudian Syahputra (-60 kg), M Iqbal Nasution (-66 kg), dan Novira Sandra Dewi (-57 kg). (m42)

IPGA Korwil Sumbagut Terbentuk MEDAN (Waspada): Kepengurusan Indonesian Professional Golf Assosiation (IPGA) Korwil Sumbagut masa bakti 2014-2018 terbentuk dalam kegiatan yang diselenggarakan bersamaan dengan turnamen Golf Pro-Am di Graha Metropolitan Golf & Country Club Medan. Terbentuknya kepengurusan IPGA dalam acara dirangkai dengan pengumuman pemenang turnamen Pro-Am, Sabtu (7/6), ditandai penyerahan pataka oleh Samsurizal dari Badan Pengurus Pusat IPGA atau PGPI (Persatuan Golf Profesional Indonesia) kepada Ketua Korwil Sumbagut, Ir Syahrial Oemry MS, beserta jajarannya. Hidayat Nasution dari IPGA Korwil Sumbagut, Rabu (11/6), mengatakan terbentuk-

nya IPGA Korwil Sumbagut ditandai dengan pengguntingan pita dan penglepasan balon udara sebagai simbol disahkannya kepengurusan oleh Kasdam I/BB, Brigjen TNI Cucu Sumantri (mewakili Pangdam), Gus Irawan Pasaribu, dan Samsurizal (Ketua Umum), disaksikan Dewan Kehormatan Musa Idishah, Pimpinan Wilayah BRI Ebeneser Girsang, dan Komandan Pangkalan TNI AU Soewondo Kolonel Pnb S Chandra Siahaan. Dalam kepengurusan IPGA Korwil Sumbagut, Dewan Kehormatan Korwil dijabat Prof Dr Ir Djohar Arifin Husein, Musa Idishah, Gus Irawan Pasaribu, dan William Ongko. Pengurus Harian Korwil Sumbagut diketuai Ir Syahrial Oemry MS, Wakil Ketua Fernando Barus, Sekretaris Su-

Madina Gelar Empat Cabor Porwilsu

giarto, dan Bendahara Hidayat Nasution. Diharapkan dengan terbentuknya kepengurusan ini dapat meningkatkan kualitas dan kuantitas pemain golf baik amatir maupun profesional di wilayah Sumatera Bagian Utara, dari Sumatera Barat sampai Aceh. Diharapkan juga tumbuhnya bibit bibit baru. Turnamen Pro-Am diikuti 70 pegolf dengan rincian 35 katagori profesional dan 35 amatir. Selain dari Medan, peserta juga datang dari Jakarta, Bandung, Batam, Banda Aceh, Pekanbaru, dan Palembang. Katagori amatir dimenangkan Sukrizal (Aceh), disusul Efendi (Riau), dan Tito (Sumut). Sedangkan untuk profesional gelar juara menjadi milik Agus L (Medan). Untuk juara bersama dimenangkan oleh Suparno (Medan), Edi Sembiring (Jakarta), dan Gemik (Jakarta). (m47)

Kijang Gunung langsung mengambil inisiatif serangan begitu laga dimulai. Striker Bintang Jaya, Mousa Keita yang diduetkan dengan Jeki Pasarela, terus menekan pertahanan tim tamu. Namun ketatnya barisan pertahanan PSMS sulit ditaklukkan keduanya. Malah serang balik PSMS cukup menyulitkan pertahanan Bintang Jaya yang digalang Hardiaonto cs. Begitu pun, tekananan Fajar F Adinata dan Sutrisno juga belum mampu membobol gawang tuan rumah.

Kondisi cuaca yang kurang mendukung dengan turunnya hujan deras, membuat pertandingan terhenti hingga 30 menit. Laga babak pertama kembali dilanjutkan setelah kondisi lapangan cukup memungkinkan. Namun hingga turun minum gol belum tercipta. Usai turun minum, pelatih Bintang Jaya Abdul Rahman Gurning tidak tinggal diam dengan memasukkan Sony Heriadi Siregar dan Edy Syahputa untuk menambah daya dobrak. Namun PSMS masih terlalu tangguh menahan gem-

puran . Pertandingan kemarin juga sempat diwarnai kericuhan pemain yang memerotes kepemimpinan wasit karena dinilai tidak tegas. Beruntung keributan tersebut bisa dikendalikan sehingga laga dapat terus berjalan. Meski sama-sama mendapat sejumlah peluang emas, kedua tim tidak mampu mencetak gol sehingga harus puas berbagi poin. Dalam laga ini, Bintang Jaya dan PSMS samasama mendapatkan tiga kartu kuning. “Saya kecewa dengan anak-anak, mereka mendapat banyak peluang emas mencetak gol, namun tidak diselesaikan dengan baik. Kondisi lapangan yang diguyur hujan juga menjadi faktor gagalnya sejumlah peluang menjadi gol,”


Hitam melangkah, mematikan lawannya tiga langkah.

Jawaban di halaman A2. 8
















ujar pelatih Bintang Jaya, Abdul Rahman Gurning. Sedangkan pelatih PSMS, Legirin, kecewa dengan kepemimpinan wasit yang dinilainya tidak tegas. “Kami berha-

rap PSSI bisa lebih selektif lagi dalam memilih wasit, sehingga bisa memimpin pertandingan dengan profesioal dan tidak ada tim dirugikan,” ucap Legimin. (a15)

Persiraja Penuhi Target Poin BANDA ACEH (Waspada): Persiraja Banda Aceh memenuhi target satu poin di kandang PSPS Riau, Rabu (11/6), dalam laga lanjutan kompetisi Divisi Utama Liga Indonesia Grup I. Kedua tim bermain imbang 1-1. Bermain di Stadion Kaharuddin Nasution, pasukan Laskar Rencong unggul lebih dulu pada menit 31 melalui gol Jessi Gunawan. Kemudian, tuan rumah membalas lewat tendangan bebas Novrianto menit 36 Menyikapi hasil ini, Pelatih Persiraja Akhyar Ilyas menyebutkan skor imbang sebuah hasil yang luar biasa bagi skuadnya. “Ini poin yang amat penting, mengingat kita dapat di kandang lawan dari pemim-

pin klasemen lagi,” ujarnya ketika dihubungi Waspada. Dia menyebutkan para pemainnya terlihat kelelahan menjelang 20 menit laga berakhir. Hal ini dipengaruhi waktu istirahat yang kurang. “Sebab kami baru tiba di Riau pada sore harinya, jadi waktu istirahat tak cukup,” sebut dia. Sejak laga babak pertama berjalan, skuad Askar Bertuah lagngsung menekan barisan pertahanan Persiraja. Kurniawan cs membuat publik tuan rumah terdiam saat memasuki menit 31. Serangan anak asuh Achyar Ilyas tidak sia-sia, kekosongan pemain belakang PSPS mampu dimanfaatkan dengan baik Jessi Gunawan. Dengan bebas tanpa penjagaan, Jessi melesatkan bola ke

Waspada/Armansyah Th

PENGLEPASAN balon ke udara sebagai simbol disahkannya kepengurusan IPGA Korwil Sumbagut.

gawang PSPS. Tidak ingin kalah begitu saja, hadiah tendangan bebas yang diberikan wasit di menit 36 ke pemain PSPS setelah pemain belakang Persiraja Irwandi melanggar Firman Septian, dimanfaatkan Novrianto dengan baik. Tendangan kerasnya berhasil membawa PSPS menahan Persiraja 1-1. Hingga babak pertama usai, tidak satu pemain pun yang mampu mengubah kedudukan. Memasuki babak

P. SIANTAR ( Waspada): Persesi Pematangsiantar kembali meraih poin penuh usai menundukkan PS PTPN III Medan 3-2 di Lapangan Kebun Sei Mangkei dalam Liga Amatir Nusantara (LAN) Wilayah II Sumut, Rabu (11/6). Begitu laga dimulai, pemain Persesi langsung menggebrak pertahanan lawan. Serangan rapi dan tajam yang dibangun penyerang Persesi seperti Vivery, Johan, dan Diky cukup merepotkan pertahanan PTPN III. Menit kelima, gelandang Persesi Diky berhasil membobol gawang lawan melalui tendangan jarak jauh yang tidak bisa diantisipasi kiper lawan. Tidak butuh waktu lama, tepatnya menit 10,Vivery Firmansyah menambah pundi-pundi golnya. Berawal kerjasama satu dua dengan Johan,Vivery berhasil membobol gawang PTPN

PIALA DUNIA 2014 MENDATAR 1. Tuan rumah Piala Dunia 2014 yang dibuka hari ini. 4. Kroasia (tulis dalam bahasa Inggris), lawan tuan rumah hari ini. 7. Negara juara tahun 1966, tampil tanggal 14 Juni lawan Italia. 8. Negara juara tahun 2010, tampil tanggal 13 Juni lawan Belanda. 9. Negara Amerika Selatan di Grup E bersama Prancis, Swiss dan Honduras. 11. Negara Eropa Barat di grup E selain Swiss, bertanding 15 Juni lawan Honduras. 13. Negara CR7 lawan Jerman tanggal 16 Juni. 14. Tuan rumah Piala Dunia 1986, lawan Brazil tanggal 17 Juni. 17. Juara Piala Dunia 1978, satu Gruf F dengan Bosnia, Iran dan Nigeria. 19. Kode negara Ghana dari FIFA. 20. Kode negara Belgia. 21. Negeri sakura, lawan Pantai Gading tanggal 14 Juni. 24. Negeri asal Zidane (tulis dalam bahasa Inggris). 26. Kode negara Honduras. 27. Negaranya Luis Suarez, satu grup D dengan Inggris, Italia dan

kedua, permainan semakin sengit. Kedua kesebelasan ngotot untuk mengubah angka. Beberapa peluang tercipta dari berbagai sudut, namun masih belum membuahkan hasil. Memasuki menit 49, PSPS hampir menambah skor setelah Andre Abubakar menerima bola akibat kesalahan pemain belakang Persiraja. Namun, kesempatan tersebut gagal dikonversi menjadi gol setelah bola masih melebar ke atas gawang.

Peluang untuk menambah angka terbuka bagi PSPS ketika memasuki menit 81. Kesempatan ini bermula ketika Indra Kahfi menerima umpan dari Ifrawandi dan mencoba ke luar dari kawalan pemain belakang. Kesempatan mengeksekusi pun terbuka. Namun lagilagi gagal untuk menceploskan bola ke mulut gawang setelah ketatnya pemain belakang Persiraja mematahkan bola tersebut. (b07)

Persesi Kembali Poin Penuh

PANYABUNGAN (Waspada): Pelaksanaan Pekan Olahraga Wilayah IV Sumatera Utara untuk empat cabang olahraga, yakni sepkbola, bola voli, tinju, dan angkat berat dibuka resmi Sekdakab Madina, M Yusuf Nasution, di Stadion Pemkab Madina, Rabu (11/6). Pembukaan ditandai penyerahan bola kepada wasit Suprapto yang memimpin pertandingan perdana antara tuan rumah PS Madina dan PS Taput. Turut menyaksikan Ketua KONI Sumut diwakili Kabid Organisasi Mukhtar Aritonang, Ketua KONI Madina Khoiruddin Faslah Siregar, Ketua PSSI Madina Budi Rahmad Lubis, dan undangan. Sekdakab mengatakan Pemkab Madina sangat mendukung Porwilsu dan mengucapkan terima kasih atas kepercayaan KONI Sumut kepada Madina yang berada di Wilayah IV sebagai tuan rumah cabor sepakbola, bola voli, tinju, dan angkat berat. “Melalui Porwilsu ini, mari kita junjung sportivitas, jalin persaudaraan, dan pererat tali silaturahim sesama atlet, pelatih, ofisial serta insan olahraga demi menciptakan rasa persatuan dan kesatuan di antara kontingen dari kabupaten/kota lain,” ujarnya. Ketua KONI Madina, Khoruddin Faslah Siregar, juga mengaku bangga atas kepercayaan diberikan KONI Sumut sebagai tuan rumah penyelenggara empat cabang olahraga, karena tujuannya untuk peningkatan SDM di bidang olahraga. “Mudahan-mudahan tahun depan Madina tidak hanya sebagai tuan rumah pelaksanaan seleksi Porprovsu, tetapi dapat melaksanakan Porprovsu. Kegiatan ini juga sangat kami apresiasi, karena banyak bakat dan atlet terpendam di daerah untuk bisa berkiprah di PON 2016,” katanya. Ketua Panitia, Rahmad Hidayat Dalimunthe, melaporkan cabor sepakbola diikuti empat dari sembilan kabupaten/kota peserta Wilayah IV, yakni Madina, Taput, P. Sidimpuan, Palas. Cabor tinju dilegar 13-15 Juni 2014, voli 16-22 Juni, dan angkat berat 23-26 Juni 2014. Pertandingan sepakbola hari pertama kemarin, tuan rumah Madina menundukkan PS Taput 1-0. (a28)

Problem Catur


BEK PSMS Medan menghalau bola dari penguasaan penyerang Bintang Jaya, Zulkifli (kanan), dalam laga Divisi Utama Liga Indonesia Grup I di Stadion Mutiara Kisaran, Rabu (11/6).

Kosta Rika. 29. Tim oranye, satu grup B dengan Spanyol, Chile dan Australia.

MENURUN 2. Rusia (tulis dalam bahasa Inggris) satu grup H dengan Belgia, Aljazair dan Korsel. 3. Negerinya Khomeini, lawan Nigeria tanggal 16 Juni. 4. Negara Amerika Selatan penantang Australia tanggal 13 Juni. 5. Kode negara Aljazair dari FIFA. 6. Negeri Kanguru. 10. Kode negara Korea Selatan. 12. ——Rica, penantang Uruguay di grup D. 13. Kode negara Portugal. 15. Negara berkode “Eng” dari FIFA (grup D). 16. Cameroon (tulis dalam bahasa Indonesia). 18. Italia (tulis dalam bahasa Inggris), lawan Inggris tanggal 14 Juni. 20. Kode negara Bosnia & Herzegovina. 22. Kode negara Ekuador. 23. Negara Afrika, satu grup G dengan AS, Jerman dan Portugal. 25. Kode negara Jerman. 28. Kode negara Yunani.

III melalui tendangan kaki kanan yang keras ke sudut kanan gawang untuk membawa Persesi memimpin 2-0. Hujan yang turun tidak terlalu deras membuat konsentrasi Persesi sedikit menurun. Menit 17, pemain bawah Persesi, Rizal, tidak sempurna menghalau bola sehingga dapat direbut penyerang PTPN III, M Irfani yang langsung melakukan tendangan keras ke gawang tanpa mampu dihalau kiper Choirul Ritonga. Berhasil memangkas jarak, semangat pemain PTPN III meningkat dan terus membangun serangan yang membuat pemain bertahan Persesi digalang Beny Situmorang kedodoran. Usaha keras PTPN III menyamakan skor membuahkan hasil di menit 35 berkat gol Dedy melalui tendangan kaki kanan. Skor 2-2 bertahan hingga turun minum.

Babak kedua, Persesi kembali menunjukkan kualitas permainannya. Mereka membuat kerjasama yang rapi serta penyerangan terpola. Hasilnya, baru lima menit babak kedua berjalan, pemain sayap kiri Raphael berhasil menjebol gawang PTPN III. Setelah gol itu, pertandingan yang disiram hujan gerimis berlangsung semakin menarik. Serangan silih berganti dilakukan kedua tim, namun hingga pluit panjang ditiup wasit, skor 3-2 untuk Persesi tetap bertahan. Atas kemenangan itu, Persesi tetap bertengger di posisi puncak klasemen sementara dengan mengemas 16 poin dari hasil lima kali menang, sekali seri, dan sekali kalah. Persesi akan menjamu PSDS Deliserdang di Stadion Sangnaualuh, Pematangsiantar, Minggu (15/6). (a30)



A12 Persiraja Penuhi Target Poin Tahan PSPS Riau 1-1 BANDA ACEH (Waspada): Persiraja Banda Aceh memenuhi target satu poin di kandang PSPS Riau, Rabu (11/6), dalam laga lanjutan kompetisi Divisi Utama Liga Indonesia Grup I. Kedua tim bermain imbang 1-1. Bermain di Stadion Kaharuddin Nasution, pasukan Laskar Rencong unggul lebih dulu pada menit 31 melalui gol Jessi Gunawan. Kemudian, tuan rumah membalas lewat tendangan bebas Novrianto menit 36 Menyikapi hasil ini, Pelatih Persiraja Akhyar Ilyas menyebutkan skor imbang sebuah hasil yang luar biasa bagi skuadnya. “Ini poin yang amat penting, mengingat kita dapat di kandang lawan dari pemimpin klasemen lagi,” ujarnya ketika dihubungi Waspada. Dia menyebutkan para pemainnya terlihat kelelahan menjelang 20 menit laga berakhir. Hal ini dipengaruhi waktu istirahat yang kurang. “Sebab kami baru tiba di Riau pada sore harinya, jadi waktu istirahat tak cukup,” sebut dia.

Sejak laga babak pertama berjalan, skuad Askar Bertuah lagngsung menekan barisan pertahanan Persiraja. Kurniawan cs membuat publik tuan rumah terdiam saat memasuki menit 31. Serangan anak asuh Achyar Ilyas tidak sia-sia, kekosongan pemain belakang PSPS mampu dimanfaatkan dengan baik Jessi Gunawan. Dengan bebas tanpa penjagaan, Jessi melesatkan bola ke gawang PSPS. Tidak ingin kalah begitu saja, hadiah tendangan bebas yang diberikan wasit di menit 36 ke pemain PSPS setelah pemain belakang Persiraja Irwandi melanggar Firman Septian, dimanfaatkan Novrianto dengan baik. Tendangan kerasnya berhasil membawa PSPS menahan Persiraja 1-1. Hingga babak pertama

Waspada/Maimun Asnawi

KADISPORA Aceh, Asnawi, mengalungkan medali emas kepada kapten tim bola voli Aceh Tamiang di Lapangan Jenderal Sudirman Kota Lhokseumawe, Rabu (11/6).

Waspada/Munawardi Ismail

STRIKER Persiraja, Angga Parnanda, berduel dengan pemain PSPS Riau saat kedua tim bentrok di Stadion H Dimurthala, Banda Aceh. ngotot untuk mengubah angka. Beberapa peluang tercipta dari berbagai sudut, namun masih belum membuahkan hasil.

usai, tidak satu pemain pun yang mampu mengubah kedudukan. Memasuki babak kedua, permainan semakin sengit. Kedua kesebelasan

Memasuki menit 49, PSPS hampir menambah skor setelah Andre Abubakar menerima bola akibat kesalahan pemain belakang Persiraja. Namun, kesempatan tersebut gagal dikonversi menjadi gol setelah bola masih melebar ke atas gawang. Peluang untuk menambah angka terbuka bagi PSPS ketika memasuki menit 81. Kesempatan ini bermula ketika Indra Kahfi menerima umpan dari Ifrawandi dan mencoba ke luar dari kawalan pemain belakang. Kesempatan mengeksekusi pun terbuka. Namun lagilagi gagal untuk menceploskan bola ke mulut gawang setelah ketatnya pemain belakang Persiraja mematahkan bola tersebut. Hingga babak kedua berakhir, kedua tim tidak mampu mengubah kedudukan. (b07)

Aceh Kirim 4 Atlet Kejurnas Muaythai atlet yang dikirim bisa mengharumkan nama baik Aceh di pentas nasional. Apalagi, Lisnobel adalah peraih perunggu di Kejurnas 2013 di Bali. Ketika itu adalah keikutsertaan pertama Pengprov Muaythai yang cuma mengirim satu atlet saja. Kendati begitu, Agus Sani juga yakin dengan kemampuan dari Masykur, Irham Angga, dan Abdul Razak. “Ini untuk pertama kali tiga petarung kita terjun di Kejurnas. Jadi kita tak bebankan target

BANDA ACEH (Waspada): Pengurus Provinsi Muaythai Aceh mengirim empat atlet terbaiknya mengikuti Kejuaraan Nasional (Kejurnas) Muaythai di Istora Senayan Jakarta. Kejurnas tersebut untuk memperebutkan piala bergilir Menpora dan Kapolri. Sekretaris Umum Pengprov Muaythai Aceh, Agus Sani, Rabu (11/6), mengatakan keempat petarung itu adalah Abdul Razak (72 kg), Irhan Angga Denilza (69 kg), Lis-nobel (51 kg), dan Masykur (48 kg). Agus Sani menyebutkan, keempat atletnya sudah berlatih selama dua tahun di bawah bimbingan Syarwan. “Kami sangat yakin kalau mereka sudah disiapkan secara matang untuk berlaga di sana,” ujarnya. Dia menyebutkan, semua

muluk-muluk,” ungkap dia. Di s e b u t k a n , Pe n g rov Muaythai Aceh ke depan akan mempersiapkan mereka untuk mengikuti Prakualifikasi PON 2015. Dengan adanya empat atlet tersebut, diharapkan program itu bisa berjalan maksimal. Menurut Agus, pihaknya juga punya target tinggi supaya keempat atlet muda tersebut dapat merebut tiket PON 2016 di Bandung, Jawa Barat. (b07)

Pasang Iklan Telp. 4528431 HP. 081370328259

Kamis 12 Juni 2014

Waspada/M Ishak

PESERTA Pelatihan Teknik Penulisan Berita Olahraga serius mendengar bimbingan pemateri di Aula Serba Guna Idi, Aceh Timur, Rabu (11/6).

Wartawan Aceh Timur Pelatihan Teknik Menulis Berita Olahraga IDI (Waspada): Wartawan dalam melaksanakan tugas dan tanggungjawab sebagai jurnalis diwajibkan menaati Kode Etik Jurnalistik (KEJ). Wartawan juga diharuskan menguasai aturan-aturan main dalam sebuah objek peliputan, khsusnya peliputan berita olahraga. “Selaku jurnalis olahraga harus menguasai aturan yang ada di sebuah perandingan, karena hal tersebut menjadi acuan dasar peliputan selanjutnya di lapangan. Jika hal itu tidak kita kuasai, maka wartawan akan menyajikan berita yang salah,” kata Sekretaris Umum KONI Aceh, Muhammad Saleh SH, ketika menyampaikan materi dalam Pelatihan Teknik Penulisan Berita Olahraga di Aula Serba Guna Idi, Aceh Timur, Rabu (11/6). Watawan senior Aceh itu menambahkan, KEJ sangat dibutuhkan dalam peliputan dan penulisan berita. Begitu juga etika dalam pengambilan gambar seseorang yang harus disertai izin orang bersangkutan, semisal ketika narasumber sedang dalam kondisi duduk di

sebuah warung kopi dengan keperluan pribadi. “Sara dan kalimat-kalimat yang tidak senonoh harus dihindari sejak dini,” ujar M Saleh, seraya meminta jurnalis dalam peliputan berita olahraga mencari informasi dari para pelatih ataupun orang yang mengerti tentang cabor yang akan diliput. Puluhan wartawan yang mengikuti pelatihan tersebut di antaranya Yusri, Ilyas, Ismail, Ilham, Said Maulana, Ismail Abda, T Munzir, Mukhsin, Hasballah, Munawir, dan sejumlah wartawan dari berbagai media. Kegiatan itu digelar dalam rangka menyongsong Pekan Olahraga Aceh (Pora) XII/2014 di Aceh Timur, 14-21 Juni. Pelatihan ini untuk para wartawan yang bertugas di Aceh Timur dan sebagian besar mereka berdomilisi di Aceh Timur. “Harapan kita, pemberitaan Pora ke depan benar-benar membantu masyarakat dalam informasi. Apalagi masyarakat banyak yang mencari informasi melalui media,” kata T Amran SE, Kabag Humas Setdakab Aceh Timur. (b24)

Cren PU Aceh Tembus Semifinal BIREUEN (Waspada): Cren PU Aceh meraih tiket semifinal turnamen bola voli Piala PT Alif Putra Mandiri dan PT Pertamina Marketing Branch Aceh setelah menundukkan PT Pertamina 3-1 (22-25, 25-16, 26-24, 25-20) di Lapangan Raja Club, Rabu (11/6). Sukses Cren PU Aceh melaju ke semifinal disambut suka cita para pemainnya seperti Darmawan, Yoyo, dan Marcel. Pasalnya, dalam pertarungan melawan PT Pertamina yang dipimpin wasit Asri-Ibnu, pemain Cren harus lebih dahulu mengakui keunggulan lawan yang

mengandalkan Amri Daulay, Junaidi, Andi Aji cs. Memasuki set kedua, anak-anak Cren berhasil bangkit untuk berbalik unggul 25-16 sekaligus menyamakan skor 1-1. Smes-smes tajam anak-anak Cren semakin sulit dibendung pemain lawan hingga akhirnya Cren mampu memimpin dua set berikutnya sebaligus memengkan pertandingan 3-1. Kamis (12/6) ini, Rajasa Kuala Bireuen akan menghadapi KPA Sampoeiniet Aceh Utara. Pemenang dalam pertandingan ini juga berhak melaju ke babak empat besar. (cb02)

Aceh Tamiang Sabet Emas Voli LHOKSEUMAWE ( Waspada): Tim bola voli pelajar Kabupaten Aceh Tamiang meraih medali emas setelah mengungguli Aceh Utara dalam partai final Pekan Olahraga Pelajar Daerah (Popda) Aceh XIII/2014 di Lapangan Jenderal Sudirman Lhokseumawe, Rabu (11/6). Kemenangan Aceh Tamiang tidak diraih dengan mudah, di mana mereka harus berjuang hingga lima set pertandingan. Sukses anak-anak Aceh Tamiang disambut gembira Kepala Dinas Kebudayaan, Pariwisata, Pemuda dan Olahraga Aceh Tamiang, Yetno. “Prestasi ini berkat keseriusan anak-anak selama masa persiapan, termasuk saat uji tanding. Sebagian mereka berasal dari gampong di Sungai Yu, tapi mereka mampu memberikan prestasi terbaik bagi daerah dan ini satu-satunya medali emas diraih Aceh Tamiang,” kata Yetno Sebelumnya, medali perunggu disabet Kabupaten Bener Meriah setelah mengalahkan Aceh Barat. Penyerahan medali kepada masing-masing tim juara dilakukan Kepala Dinas Pemuda dan Olahraga Aceh, Asnawi dan Kabid Olahraga Musri serta Yetno. “Dalam Popda tahun ini, Aceh Tamiang hanya mampu menyabet 1 emas dan 3 perak. Ini disebabkan sejumlah cabang olahraga gagal menuai prestasi seperti taekwando dan tenis meja. Hasil ini akan menjadi bahan evaluasi ke depan,” pungkas Yetno. (b18)


Bapak H. SYAHRUL M. PASARIBU, SH BUPATI TAPANULI SELATAN Atas Penganugerahan Tanda Kehormatan

SATYALANCANA PEMBANGUNAN Atas Jasa dan Keberhasilan Pembangunan Sektor Pertanian Melalui Peningkatan Hasil Produktivitas Pertanian Dalam Menstabilkan Swasembada Pangan dan Pengembangan Infrastruktur Pertanian untuk Meningkatkan Kesejahteraan Rakyat. (Keputusan Presiden Nomor: 25/TK/Tahun 2014, tanggal 2 Juni 2014)


Bener Meriah 61 Atlet Pora REDELONG (Waspada): Kabupaten Bener Meriah akan menurunkan 61 atlet dalam mengikuti Pekan Olahraga Aceh (Pora) XII/2014 di Kabupaten Aceh Timur. Pasukan asal Negeri Merapi itu diagendakan turun gunung pada Kamis (12/6) pagi ini. Mereka akan dilepas resmi Bupati Bener Meriah. Ketua Harian KONI Bener Meriah, Fauzan, Rabu (11/6), mengatakan sesuai informasi dari panitia, meski acara pembukaan Pora dijadwalkan baru akan berlangsung pada 24 Juni, sebagian cabor sudah mulai dipertandingkan. “Sebagian cabor seperti atletik sudah mulai dipertandingkan, meski Pora belum dibuka resmi. Kabar kami terima, atlet kita telah berhasil menyabet satu medali perunggu dari cabor atletik,” kata Fauzan. Dijelaskan, atlet penyumbang medali pertama bagi Bener Meriah itu adalah Herma Yunita. Dia berhasil mendulang medali perunggu cabor atletik dari kelas lari 400 meter putri. “Selain itu, sampai hari ini (kemarin), dua atlet atletik kami lainnya sudah lolos ke perempatfinal. Kami sangat berharap perolehan medali akan terus bertambah, meski sejauh ini kami belum menetapkan target,” sebutnya. (cb09)


Atas Penganugerahan Penghargaan

Pada Pembukaan Pekan Nasional Tani Nelayan XIV Tahun 2014 di Stadion Kanjuruhan, Kabupaten Malang, Provinsi Jawa Timur, Sabtu 7 Juni 2014.



Yang Telah Berjasa dan Berhasil Dalam Pembangunan Sektor Pertanian Melalui Peningkatan Hasil Produktivitas Pertanian Dalam Menstabilkan Swasembada Pangan di Kabupaten Tapanuli Selatan


M.Yamin Batubara, S.Sos

A. Raja Nasution, MAP

Disematkan Oleh:




Presiden RI, Bapak DR. H. Susilo Bambang Yudhoyono

Yohanes, SIP

Mhd. Syarif, SH

Haris Ritonga, SH


Saipar Dolok Hole

Aek Bilah

Arman Pasaribu, S.Sos

Mhd. Zein H. Ritonga

H. Ongku Muda Atas, SE

Muara Batangtoru

Angkola Sangkunur

Angkola Barat

Zamhir, SE

Darwin Dalimunthe

Drs. Akbar Hutasuhut

Angkola Selatan

Angkola Timur

Batang Angkola

Pada Acara Pembukaan Pekan Nasional Tani Nelayan XIV Tahun 2014 di Stadion Kanjuruhan, Kabupaten Malang, Provinsi Jawa Timur, Sabtu 7 Juni 2014. Dari:

Pimpinan, Staf, Karyawan dan Karyawati

Kelompok Usaha Austindo Nusantara Jaya Agri Wisma BII Lantai 7 Jl. P. Diponegoro No. 18 Medan 20152 Sumatera Utara – Indonesia



PENGUMUMAN PELELANGAN No. 005.PL/PPBJ/UPTMDN/2014 PT PLN (Persero) P3B Sumatera Unit Pelayanan Transmisi Medan mengundang para Penyedia Barang/ Jasa, Bidang Sub Bidang Usaha : Jasa Lainnya, Pengadaan Jasa Tenaga Kerja (PJTK/Outsourcing) untuk mengikuti Pelelangan melalui e-procurement PLN dengan Pascakualifikasi e-Biding di Kantor PT PLN (Persero) P3B Sumatera Unit Pelayanan Transmisi Medan, pekerjaan sebagai berikut : No

Jenis Pekerjaan


Pagu Anggaran



Gred-5, 6 dan 7 (Non Kecil)

Rp. 9.816.791.830,-

PENGUMUMAN PELELANGAN UMUM ULANG Nomor : 14.10/05/06/2014/004 1. PT. Angkasa Pura II (Persero) Kantor Cabang Bandar Udara Kualanamu Deli Serdang c.q. Panitia Pengadaan Barang/Jasa akan melaksanakan Pelelangan Umum dengan Pascakualifikasi yang dibiayai dengan dana PT. Angkasa Pura II (Persero) Tahun Anggaran 2014 sebagai berikut : Nama Pekerjaan


Pemindahan dan Penyempurnaan Pagar Panel Perimeter Utara

Kualifikasi : Usaha Kecil (K2 atau K3) Klasifikasi : Jasa Pelaksana Konstruksi Bangunan Gedung Lainnya (BG009) atau Pekerjaan Beton (SP010)

Pagu Anggaran


2. Pendaftaran dilaksanakan pada : Hari/Tanggal : Kamis s.d. Selasa / 12 s.d. 17 Juni 2014 (Hari Kerja) Waktu : Pukul 09.30 s/d 15.00 WIB (Istirahat 12.00 s/d 13.00 WIB) Tempat : Ruang Sekretariat PANPEL Bandara Kualanamu Deli Serdang Syarat dan Ketentuan lebih rinci dapat dilihat di Papan Pengumuman pada alamat tersebut di atas. 3. Peraturan yang berlaku untuk proses pelelangan ini adalah Keputusan Direksi PT. Angkasa Pura II (Persero) tentang Pengadaan Barang / Jasa di lingkungan PT. Angkasa Pura II (Persero)

Yang Diserahkan Oleh:

Presiden Republik Indonesia, Bapak DR. H. Susilo Bambang Yudhoyono

Lingkup Pekerjaan Sumber Dana

: Pengadaan Barang/Jasa : APLN Anggaran Operasi Tahun 2014

Bagi Calon Penyedia Barang yang berminat dapat mendaftar di e-Procurement PLN dengan alamat atau dengan jadwal sebagai berikut : 1. Pendaftaran dan Pengambilan dokumen pengadaan/RKS pada : Tanggal : 12 s/d 18 Juni 2014 Waktu : 09.00 s/d 15.00 WIB Tempat : PT PLN (Persero) P3B Sumatera UPT Medan Jl. Listrik No. 12 Medan 2. Biaya Penggantian Dokumen Sebesar Rp.2.500.000,- (Dua Juta Lima Ratus Ribu Rupiah), harus ditransfer atau disetor ke Rekening PT PLN (Persero) P3B Sumatera pada Bank Mandiri dengan Nomor Rekening: 111-000-4824310 Atas Nama : PT PLN (Persero) P3BS RECEIPT dan Pengambilan Dokumen lelang dapat dilakukan dengan menyerahkan printout bukti pendaftaran melalui e-proc dan bukti transfer/setor dokumen lelang kepada Panitia Lelang Pengadaan Barang/Jasa di Kantor PT PLN (Persero) P3B Sumatera UPT Medan. 3. Pengambilan dokumen pengadaan/RKS dilakukan langsung oleh Direktur/Pimpinan Perusahaan atau kuasa yang namanya tercantum dalam Akte Pendirian Perusahaan/Struktur Organisasi. Penyedia Barang yang diwakilkan/dikuasakan, wajib membawa Surat Kuasa dari Direktur/Pimpinan Perusahaan yang ditanda tangani diatas meterai 6000,- , photo copy Akte Pendirian Perusahaan dan photo copy KTP Pemimpin Perusahaan serta photo copy KTP yang diberi kuasa / wakil untuk mendaftar. 4. Untuk hal-hal yang belum jelas dapat ditanyakan langsung kepada Panitia Lelang Pengadaan Barang/ Jasa di Kantor PT PLN (Persero) P3B Sumatera UPT Medan.

Medan, 12 Juni 2014

Medan, 12 Juni 2014 TTD



Taufik R. Lubis, S.STP

Saftar Harahap, S.sos, MM



Sport A12 Heat Lupa Leonard MIAMI, AS (Waspada): San Antonio Spurs mencuri kemenangan 111-92 pada Game 3 Final NBA 2014 atas Miami Heat untuk kembali unggul 2-1 di American Airlines Arena, Miami, Rabu (11/6). Spurs tampil nyaris sempurna sepanjang dua kuarter awal dan sempat unggul hingga 25 poin. Tim Duncan cs pun menutup babak pertama dengan keunggulan 71-50. Di kuarter ketiga, Heat bangkit dan sempat memangkas ketinggalan 74-81. Namun, tim tamu tetap menawan untuk

mencuri satu poin dari markas Heat. Salah satu kunci sukses Spurs turut menghentikan rekor sempurna Heat di kandang pada playoff adalah kegemilangan Kawhi Leonard. Dalam 39 menit waktu bermain, Leonard mencetak 29 angka, tertinggi sepanjang kariernya.

Tony Parker dan Danny Green menambahkan 15 poin. Di kuarter keempat ini, Spurs mampu meredam permainan agresif LeBron James dan Dwyane Wade. Spurs berhasil memasukkan 75 persen tembakan sepanjang dua kuarter pertama, namun kredit khusus patut disematkan kepada Leonard. “Saya sempat frustrasi di Game 2 karena terkena foul trouble. Tadi, saya hanya berusaha bermain sebaik mungkin. Tak sering saya menemu-

kan ritme seperti pertandingan tadi, apalagi rekan-rekan seolah begitu percaya bola selalu diberikan kepada saya,” ungkap Leonard yang tak pernah luput dari enam usaha tembakan pertamanya. Selain bermain apik dalam offense, kemenangan Spurs memang tak lepas dari keberhasilan Leonard mematikan gerakan LeBron. Tercatat, LeBron hanya diberi cetakan 22 poin dan tujuh assist, sama seperti Dwyane Wade. Bedanya, kini giliran LeBron yang mengalami foul trouble. “Ini bukan pertandingan biasa, melainkan final antara dua tim terbaik di liga musim ini. Kami tentu tidak boleh gegabah pada game berikutnya jika ingin mempertahankan cincin juara,” sebut Wade. Pada Jumat (13/6) besok, Heat masih bertindak sebagai tuan rumah pada Game 4. Setelah itu, giliran Spurs kembali menjamu pasukan Erik Spoelstra di AT&T Center pada Game 5. (m33/ap)

WASPADA Kamis 12 Juni 2014


FORWARD San Antonio Spurs Kawhi Leonard berhasil meredam LeBron James asal Miami Heat dalam Game 3 Final NBA 2014 di American Airlines Arena, Miami, Rabu (11/6).

Honda Pilihan Utama Pedrosa motogp

Marquez Masih Penasaran Catalunya CATALUNYA, Spanyol (Waspada): Pebalap Repsol Honda, Marc Marquez (foto), berharap bisa mempertahankan tren positif di MotoGP Catalunya, Minggu (15/6) nanti. Pemuncak klasemen MotoGP 2014 itu juga berharap meraih kemenangan pertamanya di Catalunya di kelas grand prix. Musim lalu, Marquez hanya mampu menduduki peringkat ketiga setelah kalah dari pebalap Movistar Yamaha, Jorge Lorenzo, dan rekan setimnya di Repsol Honda, Dani Pedrosa. Satu-satunya kemenangan Marquez di Catalunya terjadi di kelas 125cc pada 2010. Marquez berharap bisa mengakhiri catatan buruk di Catalunya akhir pekan ini. Pebalap berusia 21 tahun tersebut yakin dengan tren positif yang didapatnya dalam enam

seri awal musim ini, kemenangan pertama di Catalunya pada kelas primer grand prix bisa dipetiknya. “Sekarang kami pulang ke rumah sendiri. Sirkuit Catalunya bukan trek yang terlalu saya nikmati di masa lalu, tapi bentuk sirkuit ini bagus. Dengan pengalaman yang saya dapat tahun lalu, saya berharap situasinya berbeda akhir pekan ini,” ujar Marquez, Rabu (11/6). Jika mampu meraih kemenangan di Catalunya, maka Marquez akan mematahkan rekor Valentino Rossi sebagai pebalap termuda yang bisa meraih tujuh kemenangan beruntun, saat 21 tahun dan 118 hari. “Fans dan tentunya fan club saya akan datang dan memberi dukungan. Hal itu memberi saya tambahan motivasi, jadi saya berharap bisa

memberikan penampilan yang bagus untuk mereka,” tegas Marquez. Sang juara bertahan masih kokoh di puncak klasemen pebalap dengan torehan 150 poin, unggul 53 angka dari Rossi. (m33/mgp)

mi, tetapi Honda adalah pilihan pertama saya,” kata Pedrosa, Rabu (11/6). Akhir pekan nanti, Pedrosa akan bersaing dengan pebalap lain pada MotoGP Catalunya di Montmelo, Barcelona. Pada seri sebelumnya atau MotoGP Italai di Mugello, Pedrosa hanya bisa finish keempat. “Balapan di Mugello lebih sulit dari yang saya perkirakan, lagipula tangan saya masih belum 100 persen pulih,” kata Pedrosa yang harus menjalani operasi lengan kanan pada Mei lalu. “Saya melakukan check-up

Nama Pekerjaan


Pemindahan dan Penyempurnaan Pagar Panel Perimeter Utara

Kualifikasi : Usaha Kecil (K2 atau K3) Klasifikasi : Jasa Pelaksana Konstruksi Bangunan Gedung Lainnya (BG009) atau Pekerjaan Beton (SP010)

Pagu Anggaran


2. Pendaftaran dilaksanakan pada : Hari/Tanggal : Kamis s.d. Selasa / 12 s.d. 17 Juni 2014 (Hari Kerja) Waktu : Pukul 09.30 s/d 15.00 WIB (Istirahat 12.00 s/d 13.00 WIB) Tempat : Ruang Sekretariat PANPEL Bandara Kualanamu Deli Serdang Syarat dan Ketentuan lebih rinci dapat dilihat di Papan Pengumuman pada alamat tersebut di atas. 3. Peraturan yang berlaku untuk proses pelelangan ini adalah Keputusan Direksi PT. Angkasa Pura II (Persero) tentang Pengadaan Barang/Jasa di lingkungan PT. Angkasa Pura II (Persero)

balapan di Montmelo, lintasan yang menyenangkan de-

ngan atmosfer luar biasa!” ucap Pedrosa. (m33/mgp)

Bapak H. SYAHRUL M. PASARIBU, SH BUPATI TAPANULI SELATAN Atas Penganugerahan Tanda Kehormatan

SATYALANCANA PEMBANGUNAN Atas Jasa dan Keberhasilan Pembangunan Sektor Pertanian Melalui Peningkatan Hasil Produktivitas Pertanian Dalam Menstabilkan Swasembada Pangan dan Pengembangan Infrastruktur Pertanian untuk Meningkatkan Kesejahteraan Rakyat. (Keputusan Presiden Nomor: 25/TK/Tahun 2014, tanggal 2 Juni 2014)


Yang Diserahkan Oleh:

Presiden Republik Indonesia, Bapak DR. H. Susilo Bambang Yudhoyono Pada Pembukaan Pekan Nasional Tani Nelayan XIV Tahun 2014 di Stadion Kanjuruhan, Kabupaten Malang, Provinsi Jawa Timur, Sabtu 7 Juni 2014.

Atas Penganugerahan Penghargaan



Yang Telah Berjasa dan Berhasil Dalam Pembangunan Sektor Pertanian Melalui Peningkatan Hasil Produktivitas Pertanian Dalam Menstabilkan Swasembada Pangan di Kabupaten Tapanuli Selatan


Disematkan Oleh:

Parlindungan Harahap, SH

M.Yamin Batubara, S.Sos

A. Raja Nasution, MAP




Presiden RI, Bapak DR. H. Susilo Bambang Yudhoyono

Yohanes, SIP

Mhd. Syarif, SH

Haris Ritonga, SH

Pada Acara Pembukaan Pekan Nasional Tani Nelayan XIV Tahun 2014 di Stadion Kanjuruhan, Kabupaten Malang, Provinsi Jawa Timur, Sabtu 7 Juni 2014.


Saipar Dolok Hole

Aek Bilah


Arman Pasaribu, S.Sos

Mhd. Zein H. Ritonga

H. Ongku Muda Atas, SE

Muara Batangtoru

Angkola Sangkunur

Angkola Barat

Zamhir, SE

Darwin Dalimunthe

Drs. Akbar Hutasuhut

Angkola Selatan

Angkola Timur

Batang Angkola

Pimpinan, Staf, Karyawan dan Karyawati

Kelompok Usaha Austindo Nusantara Jaya Agri Wisma BII Lantai 7 Jl. P. Diponegoro No. 18 Medan 20152 Sumatera Utara – Indonesia





Jenis Pekerjaan


Pagu Anggaran



Gred-5, 6 dan 7 (Non Kecil)

Rp. 9.816.791.830,-

PENGUMUMAN PELELANGAN UMUM ULANG 1. PT. Angkasa Pura II (Persero) Kantor Cabang Bandar Udara Kualanamu Deli Serdang c.q. Panitia Pengadaan Barang/Jasa akan melaksanakan Pelelangan Umum dengan Pascakualifikasi yang dibiayai dengan dana PT. Angkasa Pura II (Persero) Tahun Anggaran 2014 sebagai berikut :



PT PLN (Persero) P3B Sumatera Unit Pelayanan Transmisi Medan mengundang para Penyedia Barang/ Jasa, Bidang Sub Bidang Usaha : Jasa Lainnya, Pengadaan Jasa Tenaga Kerja (PJTK/Outsourcing) untuk mengikuti Pelelangan melalui e-procurement PLN dengan Pascakualifikasi e-Biding di Kantor PT PLN (Persero) P3B Sumatera Unit Pelayanan Transmisi Medan, pekerjaan sebagai berikut :

Nomor : 14.10/05/06/2014/004

setelah balapan dan dokter memastikan proses penyembuhan berjalan lancar. Semoga akhir pekan ini akan membaik,” harapnya. Tahun lalu di Catalunya, pebalap berusia 28 tahun tersebut finish runner-up di belakang Jorge Lorenzo (Movistar Yamah) dan di depan Marquez. Namun, Pedrosa sudah pernah juara di semua kelas di sirkuit tersebut. Kemenangan pertamanya dicatat pada 2003 di kelas 125 cc, lalu 2005 (250 cc), dan terakhir 2008 (MotoGP). “Saya selalu menantikan


Wagubsu: Brazil Menang Tipis MEDAN (Waspada): Wakil Gubernur Sumatera Utara (Wagubsu), Ir H Tengku Erry Nuradi MSi, optimis tuan rumah Brazil akan menaklukkan Kroasia pada laga perdana Piala Dunia 2014, Jumat (13/6) dinihari. Erry (foto) memprediksi skor 1-0 untuk tim asuhan Luiz Felipe Scolari. Prediksi itu disampaikan Wagubsu saat dihubungi Waspada, Rabu (11/6). Menurut Dok. Waspada Erry, kemenangan Brazil dikarenakan tim tuan rumah diperkuat pemain bintang seperti Neymar, Hulk, David Luiz, dan Thiago Silva. Belum lagi Brazil didukung rasa percaya diri untuk menang di kandang sendiri. “Tentu mental menang mereka akan lebih baik dibanding Kroasia. Tidak berlebihan jika saya prediksi Brazil menang 1-0. Saya juga yakin minimal Brazil akan melaju hingga babak delapan besar,” tambah Erry. Erry menambahkan, pelatih Luiz Felipe Scolari pasti menurunkan pemain terbaiknya menghadapi laga perdananya di Grup A sekaligus mengamankan poin penuh. Pasalnya, laga pembuka tersebut juga pertaruhan martabat sepakbola Brazil sebagai tuan rumah. Meski demikian, perlu dicermati bahwa tim Eropa Timur tidak mudah ditundukkan. Terbukti, Kroasia memiliki pertahanan solid dan tidak mudah dibobol. Mereka juga akan dipimpin Luka Modric dan Mario Mandzukic yang terkenal berbahaya dan haus gol. Jika tidak dapat diantisipasi, Brazil bisa kecolongan. (m33)

CATALUNYA, Spanyol (Waspada): Kontrak kerja sama Dani Pedrosa (foto) dan Honda akan habis pada akhir musim nanti. Hingga sekarang, belum ada kepastian pebalap Spanyol tersebut akan bertahan di Honda atau beralih tim. Sebaliknya, rekan setimnya, Marc Marquez, sudah resmi bertahan hingga akhir 2016. “Pilihan pertama saya adalah terus bersama Honda. Saya selalu bersama Honda sepanjang karier, dan karena saling menghormati, kami berniat untuk berbicara lebih dulu. Belum ada pembicaraan res-

Lingkup Pekerjaan Sumber Dana

: Pengadaan Barang/Jasa : APLN Anggaran Operasi Tahun 2014

Bagi Calon Penyedia Barang yang berminat dapat mendaftar di e-Procurement PLN dengan alamat atau dengan jadwal sebagai berikut : 1. Pendaftaran dan Pengambilan dokumen pengadaan/RKS pada : Tanggal : 12 s/d 18 Juni 2014 Waktu : 09.00 s/d 15.00 WIB Tempat : PT PLN (Persero) P3B Sumatera UPT Medan Jl. Listrik No. 12 Medan 2. Biaya Penggantian Dokumen Sebesar Rp.2.500.000,- (Dua Juta Lima Ratus Ribu Rupiah), harus ditransfer atau disetor ke Rekening PT PLN (Persero) P3B Sumatera pada Bank Mandiri dengan Nomor Rekening: 111-000-4824310 Atas Nama : PT PLN (Persero) P3BS RECEIPT dan Pengambilan Dokumen lelang dapat dilakukan dengan menyerahkan printout bukti pendaftaran melalui e-proc dan bukti transfer/setor dokumen lelang kepada Panitia Lelang Pengadaan Barang/Jasa di Kantor PT PLN (Persero) P3B Sumatera UPT Medan. 3. Pengambilan dokumen pengadaan/RKS dilakukan langsung oleh Direktur/Pimpinan Perusahaan atau kuasa yang namanya tercantum dalam Akte Pendirian Perusahaan/Struktur Organisasi. Penyedia Barang yang diwakilkan/dikuasakan, wajib membawa Surat Kuasa dari Direktur/Pimpinan Perusahaan yang ditanda tangani diatas meterai 6000,- , photo copy Akte Pendirian Perusahaan dan photo copy KTP Pemimpin Perusahaan serta photo copy KTP yang diberi kuasa / wakil untuk mendaftar. 4. Untuk hal-hal yang belum jelas dapat ditanyakan langsung kepada Panitia Lelang Pengadaan Barang/ Jasa di Kantor PT PLN (Persero) P3B Sumatera UPT Medan.

Medan, 12 Juni 2014

Medan, 12 Juni 2014 TTD



Taufik R. Lubis, S.STP

Saftar Harahap, S.sos, MM




WASPADA Kamis, 12 Juni 2014

Selecao Khawatir Nishimura

Nikmatnya Demokrasi Prediksi Juara Brazil DINIHARI nanti mulai

pkl 03:00 WIB, trailer Piala Dunia 2014 akan dimulai dengan duel pembuka Brazil kontra Kroasia di Arena Corinthians, Sao Paulo. Sebulan kemudian, rangkaian drama selesai di Estadio Maracana, Rio de Janeiro, tempat Selecao dipermalukan Uruguay pada final 1950. Sebagaimana pagelaran di edisi-edisi sebelumnya, Brazil kembali menempati posisi pole calon kampiun. Itu artinya, Daniel Alves cs diprediksi mulus melewati hadangan Kroasia, Kamerun dan Mexico di fase Grup A. Favoritas tuan rumah kali ini malah lebih wahh, karena hampir semua lembaga survei olahraga menjagokan Tim Samba bakal merebut trofi keenam World Cup, melengkapi sukses 1958, 1962, 1970, 1994 dan 2002. Bahkan kendati demo masih marak di beberapa kota hingga kawasan wisata Copacabana, nyatanya mayoritas warga Brazil juga sangat mengharapkan sekaligus meyakini, Ramires cs bakal juara di negeri sendiri. Perlu dipilah, para demonstran sesungguhnya bukan anti Piala Dunia. Mereka unjuk rasa, tak lain karena anti kebijakan pemerintah yang jor-joran menggelontorkan anggaran pesta Piala Dunia, tetapi kurang serius membenahi masalah pendidikan, kesehatan dan fasilitas umum. Awak sangat yakin, saat pementasan drama telah di-

mulai, suhu politik kembali kondusif. Emosi semua warga Brazil akan tercurah sepenuhnya pada perjalanan bersejarah pasukan Luis Felipe Scolari, sebab Negeri Samba sejatinya tanah sepakbola. Mereka akan melupakan sejenak segala perbedaan kemudian bersatu-padu lagi mendukung perjuangan Neymar Junior dan kawan-kawan. Visi maupun misinya jelas dan tegas dalam rule of game; gol, menang dan juara. Begitulah dahsyat sekaligus nikmatnya pesona sepakbola, cabang olahraga yang memang paling emosional, demokratis, taktikal serta universal. Kenikmatan demokrasi sepakbola juga telah awak rasakan ketika memimpin rapat tim Waspada untuk prediksi juara Brazil 2014. Sepuluh peserta rapat sebenarnya sudah punya jago sendiri, tetapi tidak ada negara yang dominan. Penyebarannya merata di antara Brazil, Spanyol, Argentina, Jerman dan Uruguay, lengkap dengan argumen masing-masing. Namun setelah melalui proses voting dengan tanpa money politics dan tegang urat di setiap babak, akhirnya Selecao disepakati sebagai jagoan Waspada. Usil sedikit, kalaulah semangat demokrasi serta sportivitas olahraga model begitu bisa ditumbuh-kembangkan dalam proses membangun bangsa dan negara ini, tentu kenikmatan luar biasa akan di-

SAO PAULO (Waspada): Brazil khawatir pengalaman gagal empat tahun silam, terulang ketika wasit asal Jepang Yuichi Nishimura memimpin laga Selecao kontra Kroasia pada partai pembuka Piala Dunia 2014.

Ulasan Usil Jonny Ramadhan Silalahi Redaktur Olahraga Waspada rasakan segenap lapisan masyarakat Indonesia. Demokrasi bukan berarti mayoritas menindas minoritas, pemenang menista pecundang, demikian pula sebaliknya. Rule of law demokrasi yang hakiki dan realistis, contoh sederhananya ada dalam rule of game sepakbola. Sebelas orang dalam satu tim dengan posisi dan peran berbeda-beda, saling bertanggungjawab menyerang dan bertahan untuk mencapai kemenangan. Jika ada yang tidak sanggup, pasti diganti dengan tanpa reaksi, apalagi gejolak. Nikmatnya lagi, ketika kemenangan gagal diraih, bukan berarti mesti pecah kongsi secara internal maupun eksternal. Sebab rule of game sudah jelas dan tegas, tetapi tolong kelas Piala Dunia jangan disamakan dengan Indonesia Super League, Divisi Utama, Divisi I PSSI, dan seterusnya. *****

Ajang Pembuktian Talenta Neymar PIALA Dunia 2014 bakal menjadi debut Neymar da Silva tampil pada pesta sepakbola terbesar di jagad raya ini. Neymar sebetulnya sempat diusulkan bermain di Piala Dunia 2010. Saat itu, Pele, Romario, dan masyarakat Brazil mendesak pelatih Carlos Dunga membawa sang pemain ke Afrika Selatan. Desakan tersebut karena Neymar merupakan pemain bertalenta besar. Ia memiliki skill individu luar biasa yang membuat orang tercengang saat melewati lawan dan tendangan mematikan di setiap pertandingannya. Salah satu bukti adalah merebut FIFA Puskas Award 2011. Kehebatan Neymar sudah terlihat saat masih mengenakan seragam kebesaran Santos pada 2009-2013. Prestasi tersebut yakni membawa klub tersebut menjuarai Campeonato Pauilisya (2010, 2011, 2012), Copa Brazil (2010), Copa Libertadores (2011), dan Recopa Sudamericana (2012). Namun bakat besar tak cukup memuluskan langkah Neymar bermain di Afrika Selatan. Dunga mengabaikan Neymar karena dinilai belum cukup teruji di pertandingan internasional. Pintu timnas senior terbuka bagi Neymar ketika Dunga digantikan Mano Menezes. Neymar melakoni debut gemilang bersama

skuad Samba dan mencetak gol kemenangan atas Amerika Serikat pada 10 Agustus 2010. Sejak itu, Neymar menjadi tumpuan Brazil. Tak salah jika pelatih Luiz Felipe Scolari memberikan nomor punggung 10 kepada Neymar, nomor keramat yang pernah dikenakan legenda Brazil, Pele. Setali tiga uang, Neymar mampu melunasi kepercayaan Scolari dengan mem-persembahkan trofi Piala Konfederasi 2013. Neymar menciptakan satu gol dan satu assist di balik kemenangan 3-0 atas Spanyol di final. Tak cukup sampai di situ, Neymar dinobatkan sebagai pemain terbaik. Penampilan gemilang tidak hanya ditunjukkan Neymar saat membela Brazil, tetapi juga Barcelona. Keputusan Barca membeli Neymar dari Santos dipandang tak siasia. S e jauh ini, Neymar sukses mempersembahkan trofi Piala Su-

Nishimura orang di balik kekalahan 1-2 Tim Samba dari Belanda pada perempatfinal Piala Dunia 2010 di Port Elizabeth. Tapi FIFA telah mengumumkan dia akan memimpin laga perdana Grup A dinihari WIB nanti di Corinthians Arena, Sao Paulo. “Saat itu saya pemain termuda dalam skuad Piala Dunia pertama saya, dikelilingi para pemain lebih berpengalaman,” kenang Ramires, seperti dikutip dari AFP, Rabu (11/6). Bintang Chelsea berusia 27 tahun itu absen melawan Meneer, karena mendapat kartu kuning kedua ketika menghadapi Chile pada babak 16 besar. “Melawan Belanda, tim bermain sangat bagus pada babak pertama,” jelas Ramires. Selecao malah unggul lebih dulu melalui gol Robinho pada babak pertama. Namun dua gol di babak kedua dari Wesley Sneijder membalikkan keadaan. Brazil kemudian makin menderita, setelah Nishimura memberikan kartu merah kepada gelandang Felipe Melo karena melakukan pelanggaran terhadap Arjen Robben. “Segala hal bisa terjadi dalam 90 menit. Kadang-kadang wasit membuat kesalahan, sehingga tergantung kepada kita untuk melakukan yang terbaik mengatasi apa pun yang menghalangi kita,” pesan Ramires. Dia pun percaya, sentuhan pelatih Luiz Felipe Scolari


WASIT asal Jepang, Yuichi Nishimura, memberi kartu merah gelandang Brazil Felipe Melo akibat melanggar winger Belanda Arjen Robben (kiri) pada perempatfinal Piala Dunia 2010 di Port Elizabeth, Afsel. membuat Samba praktis banyak berubah. Apalagi kini hanya dirinya, kiper Julio Cesar dan bek kanan Dani Alves, veteran 2010 yang berada dalam line-up melawan Kroasia. “Tidak patut dibandingbandingkan antara tim 2010 dan tim saat ini. Kita membahas dua tim luar biasa, tetapi kita tak bisa pula mengatakan skuad sekarang lebih baik,” dalih Ramires. Tapi yang pasti, skuad sekarang punya pengalaman menjuarai Piala Konfederasi 2013. Tim dapat mengandalkan staf belakang layar, terutama Scolari, yang mengantarkan sukses Selecao menjuarai Piala Dunia 2002. Juga koordinator teknis Carlos Alberto Parreira, yang membawa Samba menjuarai Piala Dunia 1994 di Amerika Serikat. “Kami memiliki skuat sangat muda, tapi kami mempunyai staf pelatih berpengalaman. Mereka tahu semua kesulitan yang mungkin kami akan hadapi sepanjang wak-

tu,” tegas Ramires. Wasit Terbaik Asia Kembali tentang Nishimura, pria 42 tahun itu merupakan wasit terbaik Konfederasi Sepakbola Asia (AFC) pada 2012. Tugasnya memimpin laga Brazil kontra Kroasia akan dibantu rekan senegaranya, Toru Sagara dan Toshiyuki Nagi. Sedangkan Alireza Faghani asal Iran menjadi ofisial keempat. Nishimura menjadi wasit Jepang ketiga yang bertugas di dua Piala Dunia, setelah Shizuo Takada (1986 dan 1990) dan Toru Kamikawa (2002 dan 2006). Sejak melakukan debut internasionalnya pada 2004, dia telah bertugas pada sejumlah putaran final turnamen besar. Penugasan terpentingnya sejauh ini adalah final Piala Dunia U-17 antara Spanyol melawan Nigeria. Juga semifinal Piala Dunia Antar Klub antara TP Mazembe (Kongo/ Afrika) melawan Inter Milan (Italia/Eropa).

Nishimura juga telah memimpin beberapa laga bergengsi, seperti Piala Dunia FIFA U-17 pada 2007, Piala Dun i a F I FA U-20 pada 2009, Piala Dunia Klub 2010, Cabor Sepakbola Olimpiade 2012, dan dua edisi Piala Asia pada 2007 dan 2011. Dari 25 wasit yang akan me-mimpin laga di Brazil 2014, Nishimura adalah satu dari lima wasit veteran Piala Dunia 2010. Saat di Afrika Selatan, dia memimpin empat partai dan aksinya yang paling fenomal saat

itu mengusir Felipe Melo usai melanggar Robben. (m15/ant/afp/rtr/fifa)

Modric Berbekal La Decima


per Spanyol dan berperan penting dalam membawa Barca menjadi runner-up La Liga musim lalu. Cedera di penghujung musim sempat membuatnya absen beberapa pekan. Namun, Neymar sudah fit dan kembali menunjukkan kemampuan terbaiknya. Hal ini terlihat dalam beberapa laga ujicoba terakhir Brazil jelang kejuaraan. Harapan meraih trofi juara dunia keenam pun ada di pundak Neymar. Kelihaiannya mengolah bola dan naluri tajam di depan gawang lawan diharapkan terlihat di hadapan publiknya sendiri. Dua legenda sepakbola Brazil tiada henti memuji kehebatannya. Bila Pele menyebut Neymar seorang pemain jenius, maka Ronaldo Lima menilai sang junior itu bak dirinya dulu semasa membela timnas. Mampukah Neymar mencatatkan namanya dengan tinta emas dalam sejarah sepakbola Brazil? Piala Dunia 2014-lah ajang pembuktiannya. *Austin Antariksa

Profil Neymar Lahir

: 5 Februari 1992 (22 tahun) Nomor Punggung: 10 Posisi : Penyerang Klub : Barcelona (Spanyol) Caps/Gol : 49/31 Debut Timnas : Vs AS (10 Agt 2010)

LUK A Modric dikenal sebagai gelandang yang punya kecepatan, baik ketika menguasai bola maupun tidak. Ia juga mampu mengubah jalannya pertandingan dengan umpan-umpan tak terduga dan tembakan jarak jauh. Namun, Modric tak selalu mampu menunjukkan permainan terbaiknya. Pemain kelahiran 9 September 1985 ini selalu kesulitan ketika berhadapan dengan lawan yang mengandalkan kontak fisik. Alhasil, kariernya pun mengalami pasang surut. Modric memulai kariernya di tim junior Zadar pada 1996. Tiga tahun kemudian, ia pindah ke Dinamo Zagreb. Sempat dua kali dipinjamkan ke Zrinski dan Inter Zapresic, Modric akhirnya dilepas permanen oleh Dinamo Zagreb ke Tottenham Hotspur pada 2008. Di Spurs, Modric langsung menjadi pemain utama. Pada musim pertama di White Hart Lane, Modric bermain 34 kali sebagai starter. Musim berikutnya, Modric terganggu cedera kaki, sehingga hanya bermain 25 kali. Modric kembali mendapatkan tempat utama pada musim berikutnya dengan torehan 32 kali bertanding, tiga gol, dan dua assist. Setelah bermain 36 kali dan mencetak empat gol dan empat assist pada 2011-2012, Modric dilepas ke Real Madrid. Selama debut di La Liga, Modric bermain 33 kali, delapan di antaranya sebagai pemain pengganti dan mencetak tiga gol. Musim lalu, pria berusia 28 tahun itu telah 22 kali bermain di La Liga, empat kali sebagai cadangan plus membukukan enam assist. Di level internasional, Modric juga merupakan pemain penting bagi Kroasia. Dalam 12 pertandingan di babak kualifikasi, Modric bermain 11 kali. Kendati cerdas dalam menyerang, Modric juga memiliki kegigihan dalam bertahan. Hal tersebut adalah kemampuan lainnya yang membuktikan bahwa dia sangat penting bagi Carlo Ancelotti di Madrid dan Niko Kovac di timnas. Pengaruh dan talenta mengatur permainan Modric sangat krusial untuk Kroasia. Jangkauan umpan, visi, ketenangan, penguasaan taktik sangat istimewa, dan menjadi pemain paling sering membantu Mario Mandzukic, Ivan Rakitic, dan Ivica Olic mencetak gol.

Modric sendiri mengaku siap tampil di Piala Dunia 2014 dengan motivasi tinggi seiring keberhasilannya menjuarai Liga Champions bersama Madrid. Itu bisa menjadi keuntungan tersendiri bagi pasukan Vatreni, nama lain Kroasia. Peran vitalnya memainkan tiga posisi berbeda di Madrid, dari gelandang bertahan, sentral hingga serang, Modric diyakini bakal menjadi salah

satu kunci lolos tidaknya Kroasia ke babak 16 Besar. Modal merengkuh trofi Liga Champions ke-10 bagi Madrid alias La Decima, Modric dipastikan termotivasi bekerja lebih keras dan percaya diri di Brazil. Optimisme yang akan dibuktikan pada laga pembuka kontra Brazil, Jumat (11/ 6) besok. *Austin Antariksa

Profil Luka Modric Lahir

: 9 September 1985 (28 tahun) Nomor Punggung: 10 Posisi : Gelandang Klub : Real Madrid (Spanyol) Caps/Gol : 75/8 Debut Timnas : Vs Argentina (Maret 2006) AP

Piala Dunia 2014


WASPADA Kamis 12 Juni 2014

Gertakan Gustavo SAO PAULO (Waspada): Gelandang Luis Gustavo menggertak Kroasia bahwa serangan Brazil bukan hanya datang dari Neymar Junior, melainkan dari 23 pemain yang akan diturunkan pelatih Luis Felipe Scolari.


SUPERSTAR Portugal Cristiano Ronaldo terjatuh saat duel dengan pemain Irlandia Jeff Hendrick (25) di East Rutherford, New Jersey, AS, Rabu (11/6) pagi WIB.

Portugal Puas NEW JERSEY, AS (Waspada): Pelatih Paulo Bento puas dengan penampilan para pemain Portugal terutama Cristiano Ronaldo saat menggasak Republik Irlandia 5-1 dalam laga eksibisi di Amerika Serikat, Rabu (11/6) pagi WIB. “Tim kami menunjukkan permainan yang bagus. Terutama Ronaldo, mengingat dia tidak pernah bermain selama dua pecan,” beber Bento, seperti dilansir Reuters. “Pemain seperti Ronaldo sangat penting bagi setiap tim. Dalam hal ini, saya senang dan puas dia kembali bermain,” puji pelatih berusia 44 tahun tersebut. Meski belum prima, Ronaldo tetap mendapatkan peluang emas untuk mencetak gol di Stadion MetLife, East Rutherford, New Jersey. Salah satunya malah mengenai tiang gawang Irlandia menit 19. Ronaldo absen di dua laga ujicoba Portugal sebelumnya, karena cedera paha dan lutut. Dia pun sempat diragukan da-

pat tampil pada laga perdana Seleccao das Quinas melawan Jerman di Piala Dunia 2014 Grup G, 16 Juni mendatang. “Saya pikir Ronaldo bermain bagus. Saya yakin dia akan tampil dengan kondisi 100 persen di Piala Dunia,” tegas winger Luis Nani. Ronaldo hanya bermain 65 menit ketika melawan Irlandia, sebelum akhirnya digantikan bek Kepler Pepe, yang juga baru pulih dari cedera. Dalam duel itu, striker Hugo Almeida sukses mencetak dua gol, sedangkan tiga gol lainnya berasal dari bunuh diri Richard Keogh, serta sumbangan kaki Vieirinha dan Fabio Coentrao. “Saya berlatih dengan baik mempertahankan saran dari tim dokter. Mereka mengatakan prosesnya sangat menakjubkan, saya juga merasa lebih baik setiap harinya,” ungkap Ronaldo kepada Times of India. Superstar Real Madrid berumur 29 tahun itu juga meng-

Irlandia 48% 1 6 1 4 6 11 4 2 0


Penguasaan Bola 52% Skor Akhir 5 Tembakan Total 16 Tembakan Tepat 11 Tembakan Pojok 3 Penyelamatan 0 Pelanggaran 10 Offsides 1 Kartu Kuning 0 Kartu Merah 0 *Sumber ESPN

klaim, dirinya siap tampil melawan Jerman. “Anda harus bisa berada di sana ketika Anda berada dalam performa terbaik, baik secara fisik dan mental. Saya harus bisa berada di sana, saya benar-benar fit, tidak perlu khawatir,” tegasnya. “Kami main melawan Jerman di Euro, jadi kami tahu sedikit satu atau dua hal mengenai mereka. Di sisi lain, Jerman tahu mengenai kami juga. Der Panzer memiliki tim hebat, salah satu negara favorit dan itu akan menjadi sangat berat,” pungkas Ronaldo. (m15/vvn/rtr/toi)

“Saya meyakini timnas ini sangat siap bermain dengan atau tanpa Neymar,” klaim Gustavo, seperti dikutip dari Goal, Rabu (11/6). “Ada 23 pemain berkualitas yang bisa masuk dan membantu, bahkan mengubah gaya kami. Semuanya bukan untuk menjadikan tim kami lebih baik atau buruk,” tambah pemain asal klub Wolfsburg tersebut. Brazil akan menghadapi Kroasia dinihari nanti mulai pkl 03:00 WIB pada partai pembukaan Piala Dunia 2014 di Arena Corinthians, Sao Paulo. Menurut Gustavo, segalanya akan mereka kerahkan untuk meraih kemenangan. “Siapa pun yang bermain akan melakukan yang dia bisa secara maksimal sesuai kemampuannya dan membantu kami dengan cara sebaik mungkin,” tegasnya. Setelah melawan Kroasia, Brazil akan menjalani laga berikutnya menghadapi Mexico dan Kamerun pada babak penyisihan Grup A. Skuad Scolari memiliki bekal bagus menatap laga nanti, mereka memenangkan 15 dari 15 laga terakhirnya dan cuma kebobolan dua gol sejak kalah dari Swiss, Agustus 2013 silam. Tim Samba juga punya lini depan sangat maut dengan trisula Hulk-Neymar-Fred, yang ditopang Oscar. Kontras dengan tim tuan rumah, Kroasia asuhan pelatih Niko Kovac malah mengalami banyak

Brazil Bersinar, Azzurri Juara Sejarah Piala Dunia (Spanyol 1982) SEJAK Piala Dunia Spanyol 1982, jumlah kontestan bertambah menjadi 24 tim, dengan Asia/Oceania dan Afrika masing-masing mendapat dua wakil. Wakil Afrika, Aljazair, membuat kejutan dengan mengalahkan Jerman Barat 2-1 di penyisihan grup. Aljazair gagal lolos ke putaran II karena di laga akhir Jerman Barat bermain mata dengan Austria dalam laga yang berakhir 1-0 untuk Jerman Barat, yang membuat keduanya lolos, dan Aljazair tersisih karena kalah selisih gol. Argentina masih membawa bintang yang bersinar empat tahun silam, yakni Mario Kempes, Osvaldo Ardilles bersama Daniel Pasarella. Maradona muda juga sudah bermain di sini, tetapi harus keluar dari turnamen karena terkena kartu merah akibat menendang pemain Brazil Batista di laga putaran II. Langkah tim juara bertahan ini juga terhenti setelah menjadi juru kunci grup pada putaran II, di bawah Italia dan Brazil. Sebelumnya, di laga pembuka penyisihan grup, Argentina juga kalah 0-1 dari Belgia, meski tetap lolos karena menempati peringkat kedua di bawah lawannya itu pada posisi akhir.


DINO Zoff dan kawan-kawan gembira mengangkat trofi Piala Dunia 1982. Italia dan Polandia selanjutnya bermain di semifinal ditemani Jerman Barat serta Prancis, yang kembali mampu lolos ke semifinal sejak 1958. Dino Zoff cs selanjutnya mengatasi Polandia 2-0, sementara Jerman Barat menang adu penalti dramatis 5-4, setelah bermain 3-3, untuk menyingkirkan Prancis dalam partai yang diwarnai benturan antara kiper Tony Schumacher dan Patrick Battiston yang membuat beberapa gigi pemain pengganti Prancis tersebut copot. Paolo Rossi, yang baru lolos dari sanksi akibat tersangkut skandal suap sepakbola di Negaranya, ikut dibawa Enzo Bearzot ke Spanyol, dan ber-

sama Claudio Gentile, Gaetano Scirea, Marco Tardelli dan kiper Dino Zoff. Dia memimpin rekan-rekannya di partai final yang mereka menangkan di Santiago Bernebau, Madrid, 11 Juli. Rossi, yang mencetak hatrik saat mengalahkan Brazil, mencetak gol pembuka, untuk membawanya meraih Sepatu Emas. Dua gol masing-masing dari Tardelli dan Alessandro Altobell membawa Azzurri unggul 3-0, sebelum Paul Breitner memcetak gol hiburan bagi Jerman Barat. Italia akhirnya merebut trofi Piala Dunia ketiga mereka di Spanyol untuk menyamai prestasi Brazil dan Jerman. (arman)

Arena Corinthians, Sao Paulo layar raksasa untuk memanjakan penonton. Rencananya, layar ini akan menjadi yang terbesar di seluruh stadion di dunia dengan ukuran 120m x 7,5 m atau sebesar 4,734 inch. Karena hal itu juga pihak penyelenggara menetapkan Arena de Sao Paulo menjadi stadion pembuka Piala Dunia 2014. Dari tiga klub terbesar di kota Sao Paulo, satu-satunya yang tidak memiliki stadion berstandar turnamen internasional justru klub dengan suporter terbaik di kota tersebut: Corinthians. Itu sebabnya kepada mereka “diberikan” stadion baru. Stadion yang sebelumnya bernama Arena Sao Paulo itu dibangun untuk Piala Dunia 2014, tapi setelah itu akan diserahkan kepada klub Corinthians. Hanya saja, selain memiliki nama alias Stadion Arena de Corinthians, kapasitas tempat duduk penonton dikurangi sekitar 20 ribu kursi, dari

Brazil 1-4-2-3-1


Kroasia 1-4-2-3-1 Usia/Caps

12 Julio Cesar 2 Dani Alves 3 Thiago Silva (c) 4 David Luiz 6 Marcelo 8 Paulinho 16 Ramires 7 Hulk 10 Neymar Junior 11 Oscar 9 Fred

34/79 31/74 29/45 27/35 26/30 25/25 27/42 27/34 22/48 22/30 30/33

1 Stipe Pletikosa 3 Danijel Pranjic 5 Vedran Corluka 6 Dejan Lovren 11 Darijo Srna (c) 7 Ivan Rakitic 10 Luka Modric 4 Ivan Perisic 9 Nikica Jelavic 20 Mateo Kovacic 18 Ivica Olic

Pemain Cadangan 1 Jefferson 5 Fernandinho 13 Bonfirm Dante 14 Maxwell 15 Henrique 17 Luiz Gustavo 18 Hernanes 19 Willian 20 Bernard 21 Jo 22 Victor 23 Maicon

31/9 29/6 30/12 32/8 27/5 26/18 29/24 25/6 21/10 27/16 31/6 32/71

Pemain Cadangan 2 Sime Vrsaljko 22/6 8 Ognjen Vukojevic 30/55 12 Oliver Zelenika 21/0 13 Gordon Schildenfeld 29/21 14 Marcelo Brozovic 21/0 15 Ivan Mocinic 21/0 16 Ante Rebic 20/4 17 Mario Mandzukic 28/49 19 Sammir 27/5 21 Domagoj Vida 25/23 22 Eduardo 31/63 23 Danijel Subasic 29/6

35/110 32/48 28/72 24/23 32/112 26/61 28/74 25/28 28/33 20/9 34/91

1-0 Piala Dunia 1-1 Persahabatan

Kovac Revisi Skuad

Layar Raksasa Lengkapi Pembukaan MENJELANG pembukaan pesta sepakbola dunia, penyelenggara Piala Dunia 2014 Brazil masih dihadapkan kepada tiga masalah pokok, yakni demonstrasi, pemogokan alat transportasi dan kemacetan lalu lintas. Polemik ini juga melanda sekitar Arena Corinthians di Sao Paulo, tempat berlangsungnya pembukaan dan laga perdana antara Brazil versus Kroasia, Jumat (13/6) dinihari WIB. So pasti Sao Paulo tidak ingin kehilangan momentum bersejarah pembukaan perhelatan akbar sepakbola dunia empat tahunan ini. Apapun ceritanya, rakyat Sao Paulo pasti menginginkan tiga sukses, yakni sukses sebagai tuan rumah,. pemberdayaan ekonomi rakyat dan tentunya sukses meraih prestasi sebagai juara dunia. Berbeda dengan stadion lainnya di Brazil, Arena de Sao Paulo akan dilengkapi dengan

kendala sebelum memulai turnamen akbar di Negeri Samba. Striker Mario Mandzukic mesti menjalani hukuman menyusul kartu merah saat melawan Islandia di babak kualifikasi zona Eropa. Tim peringkat ketiga Piala Dunia 1998 itu terpaksa mengandalkan penyerang veteran Ivica Olic bersama Nikica Jelavic di lini depan. Karena Samba terbiasa memainkan sepakbola agresif dengan catatan 17 gol dalam lima laga terakhirnya, Hrvatska bisa saja bermain defensif dalam duel nanti. Duet jangkar Luka Modric dan Ivan Rakitic, menjadi pilar pertahanan Kroasia sejak di

14-06-2006: Brazil vs Kroasia 18-08-2005:Kroasia vs Brazil

Juara Runner-up Peringkat 3 Peringkat 4 Sepatu Emas

Brazil tetap menjadi unggulan, apalagi di sini mereka memiliki Zico. Falcao, Socrates, Junior, dan Eder. Namun, setelah dengan mulus menjadi juara grup, dan menang 3-1 atas Argentina, tim asuhan Tele Santana ini akhirnya menyerah 2-3 dari Italia di pertandingan terakhir putaran II, untuk memberi tempat kepada tim juara itu di semifinal. Gli Azzurri sebenarnya tidak mulus mengawali turnamen, di mana mereka hanya mampu bermain seri di tiga pertandingan penyisihan grup. Tim asuhan Enzo Bearzot ini lolos ke putaran kedua karena unggul agresivitas gol dari Kamerun yang sama mengumpulkan poin 3, guna menemani Polandia.


lini tengah. Berlabel sebagai dua gelandang terbaik yang membawa Real Madrid dan Sevilla menjuarai Eropa musim ini, kualitas Modric dan Rakitic tentu tak perlu lagi diragukan. Namun Brazil punya keuntungan lain berupa dukungan mayoritas penonton di Arena Corinthians. “Kami tahu, kami memiliki dukungan fantastis dari fans dan kami akan memberikan mereka segalanya untuk membuat mereka gembira,” klaim winger Willian. Gelandang Chelsea berusia 25 tahun itu malah yakin, dukungan publik tuan rumah akan mampu membuat mereka merebut trofi keenam dalam sejarah Piala Dunia di negeri sendiri. “Warga Brazil layak mendapatkannya, mereka telah menunggu dalam waktu yang lama. Kami tahu betapa besar tugas yang kami hadapi, tetapi kami sudah siap,” pungkas Willian. (m15/goal/fifa/espn)

euni tan R ta Ca Reuni tatan Cata

Ringkasan Data : Italia : Jerman Barat : Polandia : Prancis : Paolo Rossi/Italia (6 Gol) Pemain Terbaik : Manuel Amoros (Prancis) FIFA Fair Play : Brazil Jumlah Gol : 146 (Rata-rata 2.8) Penonton : 2.109.723 (Rata-rata 40.571)


PENDUKUNG Kroasia ikut menikmati aksi hiburan yang disajikan gabungan fans Brazil dan Kolombia di Sao Paulo, Rabu (11/6).

yang semula 65.807 untuk Piala Dunia. Pemberian stadion ini kepada klub Corinthians ini diharapkan meningkatkan kegiatan perekonomian yang nantinya akan mendatangkan keuntungan bagi kota Sao Paulo ataupun klub Corinthians itu sendiri. Kota Sao Paulo merupakan kota terbesar di Brazil, dan penduduknya adalah yang terbesar pula di negara tersebut. Kota ini juga mempunyai pengaruh yang besar dalam perdagangan dunia, sehingga dianggap juga sebagai Kota Global. Di kota ini terdapat museum yang sangat terkenal, yakni Museum Kesenian Sao Paulo. Ada juga tugu bendera yang dinamai Monumento as Bandeiras. Ada juga Jembatan Estalada yang terletak di atas Sungai Phineiros dan dibuka pada Mei 2008. Kota ini dianggap salah satu kota penting dan berse-

jarah bagi dunia persepakbolaan Brazil. Di kota inilah Charles Miller, seorang Skotlandia kelahiran Brazil, memperkenalkan sepakbola ke Negeri Samba pada tahun 1894, setelah pulang ke Sao Paulo usai menyelesaikan sekolahnya di Inggris. Kehawatiran tetap ada. Pasalnya, pekan lalu, sekitar 3,5 juta masyarakat Brazil yang menggunakan sistem transportasi umum (stasiun) di Sao Paulo terdampar saat jam sibuk atau kerja. Aksi itu terjadi ketika pihak operator kereta api dan komuter melakukan pemogokan massal. Meski masih jauh dari memuaskan, para pendukung klub Corinthians, yang akan menjadi pemilik stadion itu, merayakan kegembiraan. Pihak Corinthians mengatakan, stadion itu akan selesai dikerjakan dengan menghabiskan biaya 920 juta hingga 950 juta reais atau sekitar Rp 4,725 triliun sampai Rp 4,876 triliun.

SAO PAULO (Waspada): Kroasia mesti merevisi skuadnya jelang laga melawan Brazil pada partai pembuka Piala Dunia 2014, karena cedera yang dialami Ivan Mocinic. Pemain 23 tahun itu cedera engkel, sehingga posisinya akan digantikan gelandang Hamburg SV, Milan Badelj. “Kami sudah mengirim dokumen ke FIFA mengenai cedera yang dialami Mocinic. Apabila FIFA menyetujui, Badelj segera gabung bersama kami,” ungkap pelatih Niko Kovac, Rabu (11/6). Bila semua berjalan sesuai rencana, menurut Kovac (foto), Badelj akan bergabung dengan skuad Hrvatska, Jumat besok. Badelj tidak masuk dalam 23 skuad utama yang dibawa ke Negeri Samba, lantaran mengalami cedera ringan. “Saya sudah bicara dengan Mocinic, sayangnya dia mengalami cedera lagi. Cedera itu kembali menerpa pergelangan kaki yang sama,” ucap Kovac.

“Proses pemulihannya membutuhkan waktu sekitar 2-3 pekan. Melihat kepentingan timnas dan juga pemain beserta klub, maka kami putuskan untuk mengirimnya pulang,” katanya menambahkan. Hanya saja Kovac yakin, revisi skuadnya tidak akan mempengaruhi laga melawan Tim Samba dinihari WIB nanti di Arena Corinthians, Sao Paolo. Striker Nikica Jelavic bahkan menegaskan, Hrvatska tidak takut dengan nama besar tim tuan rumah. “Ini justru pertandingan yang sudah saya impikan,” jelas Jelavic melalui Daily Mail. “Brasil favorit saya di turnamen ini, tapi kami juga punya pemain berkualitas. Kami bisa lolos, kami tidak akan kalah. Di lapangan, ada 11 lawan 11 dan saya yakin starting eIeven Kroasia bisa menghadapi tim mana pun,” katanya lagi. Selain Selecao, Kroasia ju-


ga akan bersaing dengan Mexico dan Kamerun di Grup A. Menurut penyerang veteran Ivica Olic, Hrvatska punya kemampuan besar untuk lolos dari grup ini sekaligus melaju sejauh mungkin. “Setelah melewati beberapa turnamen tanpa hasil nyata, saya yakin kami memiliki skuad dan individu yang da-

pat mencapai putaran kedua,” tegasnya. “Sekarang kami memiliki para pemain terbaik di Eropa dan mereka berada di tahuntahun terbaiknya. Kami tidak bisa lari dari kenyataan, karena kami memang tidak bisa lari dari kenyataan,” ucap mantan bomber Bayern Munich tersebut. (m15/vvn/sw/dm)

Agenda Pertandingan Di Arena Corinthians 12 Juni 2014 Brazil vs Kroasia Grup A 19 Juni 2014 Uruguay vs Inggris Grup D 23 Juni 2014 Belanda vs Chile Grup B 26 Juni 2014 Korea Selatan vs Belgia Grup H 01 Juli 2014 Juara Grup F vs Runner-up Grup E 09 Juli 2014 Semifinal Jumlah ini melewati anggaran yang awalnya disediakan. Pembangunan stadion ini diharapkan juga mendongkrak kesejahteraan masyarakat Zona Timur, adalah area paling padat dan kumuh di Sao Paulo dengan jumlah penduduk mencapai 4 juta jiwa. Untuk itu pemerintah merekrut hampir 6.000 penduduk setempat, untuk terlibat secara langsung maupun tidak dalam proses konstruksi stadion ini. Pembangunan Arena Corinthians juga memakan korban jiwa. Sebuah tragedi terjadi pada 28 November 2013,


SUASANA di dalam stadion Arena Corinthians di Sao Paulo dilengkapi dengan layar raksasa sebagai tempat hajatan pembukaan Piala Dunia 2012 sekaligus pertandingan perdana tuan rumah Brazil melawan Kroasia. dengan runtuhnya mesin derek sehingga menimpa atap stadion. Insiden ini mengakibatkan tiga orang tewas. Peristiwa nahas itu terjadi saat waktu makan siang. Secara tiba-

tiba mesin derek terjatuh menimpa bagian atap timur stadion. Tentunya ini menjadi pembelajaran bagi pihak penyelenggara. Pastinya, milia-

ran pasang mata berharap pembukaan Piala Dunia 2014 berjalan lancar dan sukses. Semoga... #Budi Regar/ Berbagai Sumber

Ekonomi & Bisnis

WASPADA Kamis, 12 Juni 2014


Pengelolaan Rumah Susun Akan Ditertibkan JAKARTA (Waspada): Kementerian Perumahan Rakyat bakal menertibkan pengelolaan rumah susun sewa dan rumah susun milik yang dibangun di berbagai wilayah di Indonesia guna menyukseskan program rumah susun yang kini menjadi prioritas Kemenpera. “Kami akan berusaha menertibkan pengelolan di Rusun baik Rusunawa maupun Rusunami yang ada di seluruh Indonesia,” ujar Plt Deputi Bidang Perumahan Formal Kemenpera Rildo Ananda Anwar dalam rilis Humas Kemenpera yang diterima di Jakarta, Rabu (11/6). Menurut dia, Kemenpera melalui Deputi Bidang Perumahan Formal memiliki tugas dan fungsi untuk ikut membina pemilik dan penghuni Rusun. Apalagi, Kemenpera juga terus mendorong pengembang dan pemerintah daerah untuk membangun Rusun ketimbang rumah tapak sebagai tempat tinggal masyarakatnya. Ia juga mengimbau agar pemilik serta penghuni rusun bisa lebih cerdas dan memahami peraturan yang mengatur tentang hunian vertikal itu. Melalui pembentukan PPPSRS (Perhimpunan Pemilik dan Penghuni Satuan Rumah



PEDAGANG menimbang telur di Pasar PSPT Tebet, Jakarta, Selasa (10/6). Harga empat komoditas pangan yaitu telur ayam, bawang merah, bawang putih dan daging ayam merambat naik hingga 10-15 persen dikarenakan tingginya permintaan jelang puasa.

DPD Minta Perizinan Pembangkit Listrik Dipermudah MEDAN (Waspada): Pemerintah diminta mempermudah investor nasional maupun asing untuk membangun pembangkit listrik guna mengatasi krisis energi yang terus terjadi di Sumatera Utara (Sumut). “Krisis listrik sudah sangat mengganggu Sumut. Bukan saja masyarakat secara umum tetapi sudah menghambat perekonomian dan investasi Sumut yang juga akan berdampak negatif ke nasional,” kata anggota DPD RI utusan Sumut, Parlindungan Purba, di Medan, Rabu (11/6). Kemudahan dinilai sangat perlu karena PT. Perusahaan Listrik Negara (PLN) yang diharapkan selama ini tidak juga bisa

memenuhi kebutuhan energi. Parlindungan yang juga Ketua Asosiasi Pengusaha Indonesia (Apindo) Sumut itu menjelaskan, kemudahan yang diperlukan investor pembangkit mulai dari soal pembebasan lahan, peminjaman lahan di kawasan hutan atau yang dilindungi hingga soal penjualan energi itu. Menurut dia, banyak investor nasional dan asing yang su-

Hanya 3,5 Juta Orang Anggota Pensiun Diperusahaan Swasta JAKARTA (Waspada): Dari sekitar 250 juta penduduk Indonesia hanya 3,5 juta orang yang tercatat sebagai anggota program pensiun di perusahaan pengelola dana pensiun swasta, baik melalui Dana Pensiun Pemberi Kerja (DPPK) maupun Dana Pensiun Lembaga Keuangan (DPLK). Ketua Harian Asosiasi DPLK Nur Hasan Kurniawan di Jakarta, Rabu (11/6), mengatakan, sebanyak 3,5 juta peserta pensiun itu hanya berasal dari DPPK dan DPLK, di samping program pensiun pemerintah dengan kepesertaan PNS/TNI/Polri. “Sekitar 1,5 juta peserta DPPK dan sisanya 2 juta merupakan peserta DPLK. Kebanyakan dari peserta DPPK dan DPLK ini peserta yang diikutkan perusahaan mereka bekerja, bukan atas inisiatif sendiri,” ungkapnya. Menurutnya, kesadaran masyarakat Indonesia terhadap perencanaan pensiun masih minim. Tidak hanya karena keterbatasan informasi mengenai manfaat jangka panjangnya, tetapi juga lantaran sosialisasi yang kurang dari pihak-pihak terkait. Nur Hasan yang juga menjabat Chief of Employee Benefits PT Asuransi Jiwa Manulife Indonesia menambahkan, hasil penelitian Manulife Investor Sentiment Index (MISI), sebanyak 45 persen responden belum sama sekali merencanakan masa pensiun mereka. Kabar baiknya, 55 persen lainnya sudah merencanakan masa pensiun. “Sayang, kenyataannya cuma 3,5 juta masyarakat Indonesia yang memiliki program pensiun,” tuturnya. Sementara itu Badan Penyelenggara Jaminan Sosial (BPJS) Ketenagakerjaan mengincar sekitar 15 juta pekerja untuk menjadi peserta program jaminan pensiun yang mulai diselenggarakan pada 1 Juli 2015. Direktur Utama BPJS Ketenagakerjaan Elvyn G.Masassya mengatakan jumlah peserta program itu diharapkan tercapai dalam dua tahun hingga 2016. “Jumlah potensinya ada 40 juta pekerja formal. Yang menjadi target awal kita 15 juta dalam dua tahun. Jadi, setelah itu kita berharap universal coverage di 2019 seperti road map jaminan sosial,” katanya. Pada awalnya, lembaga hasil pembubaran PT Jamsostek itu akan mengincar para pekerja dari perusahaan skala besar. Berdasarkan regulasi, program ini wajib diikuti para pekerja di Indonesia. Elvyn menilai iuran sebesar 8 persen dari gaji bulanan (take home pay) merupakan paling relevan. Angka itu sudah turun dari usulan sebelumnya yang mencapai 12 persen. “Untuk iuran itu kita harus lihat tiga hal, affordability (tingkat kesanggupan), adequacy (tingkat kelayakan), dan aspek suistainability (tingkat keberlangsungan),” paparnya. Seperti diketahui, program jaminan pensiun merupakan satusatunya program yang belum dijalankan oleh BPJS Ketenagakerjaan sampai saat ini. Pelaksanaan program tersebut masih menanti peraturan pemerintah yang kini sedang dibahas. (J03)

dah antrian untuk berinvestasi di pembangunan pembangkit listrik di Sumut, tetapi belum bisa merealisasikan keinginan karena terbentur banyak hambatan atau birokrasi perizinan khususnya soal pinjam pakai lahan di kawasan yang dilindungi seperti hutan. “Pemerintah sudah harus memberi solusi kepada Pemprov Sumut untuk mengatasi krisis energi yang sudah lebih dari lima tahun,”katanya. Gubernur Sumut H Gatot Pujo Nugroho juga mengaku sedang memperjuangkan dibuka lebarnya investasi oleh swasta di sektor pembangkit listrik itu. “Pemprov Sumut sudah terus mendesak Pemerintah Pusat memberikan solusi untuk mengatasi krisis energi Sumut,” katanya. Selain memberikan kesempatan kepada investor baru, kata

gubernur, Pemprov Sumut juga mendesak Pemerintah Pusat mendorong operasional sejumlah pembangkit listrik yang sedang dalam proses pembangunan maupun yang sedang bersiap beroperasi seperti Pembangkit Listrik Tenaga Uap (PLTU) Pangkalan Susu. “Krisis listrik di Sumut yang terjadi sejak lima tahun lalu harus diatasi agar masyarakat Sumut semakin sejahtera dan Sumut bisa menjadi pendorong pertumbuhan ekonomi nasional,” katanya. Menurut dia, dalam dua tahun terakhir, Sumut mengalami kekurangan daya dalam kondisi normal mencapai 150 megawatt atau kurang 450 megawatt saat beban puncak dari kebutuhan listrik yang sebanyak 1.650 megawatt setiap hari. Dewasa ini, ada tiga pembangkit listrik yang akan ber-

operasi yakni Pembangkit Listrik Labuan Angin, Sarulla dan PLTA Asahan 3 dengan total daya mencapai 1.000 megawatt. Kebutuhan listrik di Sumut sendiri meningkat cukup besar atau tujuh persen setiap tahun sehingga harus ada tambahan sedikitnya 120 megawatt per tahun. General Manager PT Indonesia Power PLTU UBOH Pangkalan Susu, Fardin Hasibuan mengatakan, berdasarkan rencana sebelumnya, PLTU itu sudah beroperasi awal Oktober mendatang walau diakui ada permasalahan soal pembebasan lahan. Dalam tahap awal, PLTU Pangkalan Susu akan mampu memasok daya listrik 200 megawatt dan naik hingga 400 megawatt kalau PLTU itu beroperasi penuh. “Semoga semuanya berjalan sesuai rencana,” pungkasnya.(ant)

Susun) diharapkan bisa menjamin pelaksanaan pengelolaan benda bersama dan meminimalisir munculnya konflik antar penghuni karena seluruh keputusan diambil secara bersamasama. “Saat ini kami juga sedang menyusun RPP mengatur tentang pengelolaan rusun termasuk bagaimana pembentukan PPPSRS. Karena itu pemilik Rusun juga harus memahami dan mempunyai persepsi yang sama tentang peraturan rusun,” ucapnya. Sebelumnya, Menteri Perumahan Rakyat Djan Faridz mengatakan, pembangunan rumah susun merupakan solusi yang efektif bagi penyediaan rumah sebagai tempat tinggal bagi masyarakat berpenghasilan rendah (MBR). “Penduduk setiap tahun bertumbuh, tetapi tanah tidak tumbuh. Jalan keluar yang terbaik adalah rumah susun,” kata Djan Faridz dalam diskusi yang digelar Forum Wartawan Perumahan Rakyat (Forwapera) yang digelar di kantor Kemenpera, Jakarta, Selasa (13/5). Menurut Menpera, pembangunan rumah susun merupakan solusi yang efektif apalagi mengingat kebutuhan rumah diperkirakan bertambah hingga sebesar 1 juta unit per tahun.(ant)

Pemudik Tahun Ini Diperkirakan 19 Juta Orang JAKARTA (Waspada): Menteri Perhubungan (Menhub) Evert Erenst Mangindaan memperkirakan jumlah pemudik pada Lebaran tahun ini bakal mencapai lebih dari 19 juta orang. “Persiapan matang mesti dilakukan karena jumlah penumpang angkutan Lebaran akan naik,” kata E.E. Mangindaan di Jakarta, Rabu (11/6). Menurut Mangindaan, jumlah penumpang angkutan Lebaran tahun 2014 berjumlah sekitar 19,29 juta penumpang atau meningkat 3,83 persen dibandingkan tahun sebelumnya. Puncak arus mudik bakal terjadi pada H-3 sampai H-1, sedangkan puncak arus balik adalah H+4 sampai H+5. Bila dibagi kepada jenis moda transportasi, ujar dia, maka jumlah untuk moda angkutan jalan akan naik 0,9 persen menjadi 5,59 juta penumpang, yang diperkirakan bakal menaiki antara lain 2,37 juta kendaraan sepeda motor dan 1,78 juta kendaraan mobil pribadi. Sedangkan untuk moda angkutan kereta api diprediksi naik 3,1 persen menjadi 4,49 juta

orang, moda angkutan udara naik 11,48 persen menjadi 4,1 juta orang, moda angkutan sungai, danau, dan penyeberangan naik 1,73 persen menjadi 3,54 juta orang, serta moda angkutan laut naik 3 persen menjadi 1,57 juta orang. Sebelumnya, Direktur Angkutan Udara Kemenhub Djoko Murdjatmodjo mengemukakan terdapat lima maskapai penerbangan yang mengajukan tambahan penerbangan dalam rangka mengantisipasi lonjakan penumpang moda angkutan udara sebagai transportasi mudik lebaran tahun 2014. Menurut Djoko Murdjatmodjo, kelima maskapai penerbangan tersebut adalah Sriwijaya Air, Nam Air, Lion Air, Indonesia AirAsia, dan Garuda Indonesia. Penambahan penerbangan itu untuk jangka waktu H-7 sampai dengan H+7 lebaran, sehingga terjadi penambahan 62 frekuensi selama 16 hari. “Selama 16 hari tersebut, total frekuensi penerbangan mencapai 903 penerbangan,” ucapnya. (ant)


WAKIL Gubernur Sumatera Utara (Wagubsu) HT Erry Nuradi didampingi Ketua Pembina Dr. I Nyoman Ehrich Lister M.Kes AIFM, Ketua BPH DR.Tommy Leonard SH M.Kn saat membuka Seminar Nasional Kewirausahaan FE Unpri, Rabu (11/6).

Pertamina Siapkan Pasokan BBM Wagubsu Apresiasi Unpri Kebutuhan Ramadhan Dan Lebaran Dorong Mahasiswa Jadi Pengusaha MEDAN (Waspada): PT Pertamina Marketing Operation Region I segera mempersiapkan diri, baik penambahan pasokan BBM, menjamin kelancaran pasokan dan sebagainya, guna menghadapi berbagai momen penting yang bakal berlangsung seperti Pilpres, Ramadhan, maupun Lebaran. Hal tersebut dikatakan Manager Retail Fuel Marketing Pertamina Region I Nurhadiya didampingi Manager Brand Managemen Pertamina Agus Mashud, dan External Relation PT Pertamina Marketing Operation Region I Fitri Erika, di sela-sela penarikan undian program Pertamax & Fastron Go to Europe 2014, di SPBU Singapore Station, Jl. Brigjen Katamso Medan, Rabu (11/6). “Banyak momen penting ke depan, baik Pilpres, Puasa maupun Lebaran. Pertamina segera mempersiapkan diri dengan membentuk Satgas mulai 1 Juli 2014 dengan persiapan menambah stok di terminal-terminal BBM yang ada di Sumbagut, penambahan armada mobil tanki untuk menjamin kelancaran pasokan ke SPBU dan sebagainya,” ujar Nurhadiya. Terkait dengan penambahan pasokan untuk memenuhi kebutuhan tersebut, Nurhadiya mengatakan, diperkirakan untuk bahan bakar minyak (BBM) jenis premium akan ada peningkatan sebanyak 6 persen,

Pertamax diperkirakan meningkat sebanyak 10 persen, sedangkan solar biasanya mengalami penurunan. “Kalau premium diperkirakan meningkat 6 persen, pertamax 10 persen, sedangkan solar biasanya turun. Karena pada saat lebaran, kegiatan industri tidak beroperasi, truk pengangkutan juga tidak beroperasi, sehingga seperti biasanya penggunaan solar mengalami penurunan,” ujarnya. 16 Kursi Keliling Eropa Sementara itu, terkait dengan penarikan undian tahap I Pertamax & Fastron Go to Europe 2014, Agus Mashud mengatakan, hal itu sebagai wujud apresiasi kepada konsumen loyal produk Pertamina. Program ini akan memberangkatkan 16 orang pelanggan keliling Eropa. Penarikan undianitu bagian dari penarikan hadiah hiburan yang dilakukan dalam 3 tahap periode undian. Penarikan undian tahap pertama ini memperebutkan 4 unit motor Honda Beat, 6 unit iPhone 5, 7 unit Galaxy Note3 dan 12 keping emas 5 gram. Acara pengundian juga dihadiri oleh komunitas mobil Bavarian Club (BMW) dan komunitas motor Ninja yang ikut serta dalam program Pertamax & Fastron Go to Europe 2014. “Pertamax & Fastron Go to Europe 2014 merupakan wujud apresiasi Pertamina kepada

konsumen loyal pengguna produk-produk Pertamina yang berkualitas tinggi, khususnya Pertamax dan Fastron Series,” ujarnya. Program undian Pertamax & Fastron Go to Europe 2014 dilangsungkan mulai 1 Mei 2014 sampai 31 Juli 2014 dan akan diundi dalam 3 tahap yaitu Rabu (11/6) untuk periode pertama, 3 Juli periode kedua dan 5 Agustus 2014 untuk periode ketiga. Secara keseluruhan hingga akhir periode, program undian ini menyediakan hadiah hiburan berupa 10 motor Honda Beat, 15 unit Iphone5, 18 Samsung Note 3, 25 emas batangan. Sebagai hadiah utama, Pertamina tahun ini menyediakan 16 kursi untuk konsumen setia Pertamax & Fastron untuk mendukung langsung aksi Rio Haryanto yang berlaga pada GP2 Series sirkuit Monza, sekaligus keliling Eropa yang diantaranya perjalanan wisata di Milan, Italia dan Paris, Perancis. “Untuk memberi kesempatan lebih besar kepada konsumen, tahun ini Pertamina memang memberikan hadiah yang lebih tinggi dan lebih banyak. Pada akhirnya, dengan program ini kami mengharapkan konsumen, khususnya di tanah air, menjadi lebih cinta akan produk anak negeri yang terbukti dan teruji memiliki kualitas tinggi,” tambah Erika. (m41)

MEDAN ( Waspada): Wakil Gubernur Sumatera Utara (Wagubsu) HT Erry Nuradi memberikan apresiasi kepada Universitas Prima Indonesia (Unpri) yang terus memberikan dorongan semangat, pelatihan, dan meningkatkan capacity building kepada para mahasiswanya untuk menjadi pengusaha, serta siap berkompetisi di tengah masyarakat. Hal tersebut dikatakanWagubsu saat membuka acara Seminar Nasional Kewirausahaan yang digelar Fakultas Ekonomi Unpri dengan tema ‘Passion of Innovation for Young Generation’ dan menghadirkan pembicara dua orang motivator yakni Prof. Rhenald Kasali dan Irwan Wiseful Berutu, di gedung Selecta Medan, Rabu (11/6). Seminar yang diikuti 2.000-an peserta tersebut turut dihadiri Ketua Pembina Dr. I Nyoman Ehrich Lister M.Kes AIFM, Ketua BPH DR.Tommy Leonard SH M.Kn, Penasehat Dr. Sofyan Wijaya MHA, Rektor Unpri Prof. Dr. Djakobus Tarigan AAI DAAK,Wakil Rektor I Prof. Dr. drg. Monang Panjaitan MS MA,Wakil Rektor II Unpri, Ermi Girsang, SKM, M.Kes, Dekan Fakultas Ekonomi Cut Fitri Rostina SE MM, Wakil Dekan I Fakultas Ekonomi Unpri Hendry SE MM, dan lainnya. Wagubsu mengatakan, seminar kewirausahaan ini sangat penting, apalagi dengan menghadirkan guru besar terkenal sebagai seorang motivator Prof. Rhenald Kasali yang mampu memberikan motivasi dan semangat bagi mahasiswa untuk bisa menjadi seorang pengusaha. “Saya tekankan,, kita sangat membutuhkan enterpreneur, kita sangat membutuhkan pengusaha. Apalagi Indonesia maupun Sumut ternyata masih sangat kurang dari sisi jumlah pengusahanya,” ujarnya.

Oleh karena itu,Wagubsu sangat mengapresiasi upaya Unpri yang terus memberikan dorongan semangat, memberikan pelatihan dan meningkatkan capacity building kepada para mahasiswa untuk bisa menjadi SDM siap bersaing setelah selesai kuliah di tengah-tengah masyarakat, khususnya bisa menjadi pengusaha dengan membuka lapangan kerja baru. “Jadi, kami berharap lulusan-lulusan Unpri nantinya bukan menjadi pencari kerja, tetapi justru bisa membuka lapangan pekerjaan maupun membuka peluang-peluang usaha baru. Pengusaha itu harus bisa mampu berdiri sendiri, jangan setelah tamat menjadi PNS, karena PNS jumlahnya terbatas,” ujarnya. Selain itu, Wagubsu juga mengimbau kepada para mahasiswa untuk mempersiapkan diri menjadi SDM yang handal dengan menimba ilmu, tentunya juga memiliki semangat, keinginan yang kuat, semangat tinggi dan percaya diri sehingga mampu bersaing baik di tingkat nasional maupun internasional. Sementara itu, Prf. Rhenald Kasali di hadapan peserta mengatakan, potensi usaha di Indonesia cukup banyak, namun jumlah pengusahanya yang masih sedikit. Oleh karena itu, mahasiswa diharapkan bisa menjadi pengusaha atau memiliki jiwa pengusaha. Karena menurutnya, jiwa enterpreneurship (pengusaha) juga sangat dibutuhkan profesiprofesi lainnya seperti calon gubernur, calon wali kota, bahkan calon presiden.“Semuanya membutuhkan jiwa enterpreneurship. Kalau Anda tidak mempunyai jiwa enterpreneurship, maka tidak akan bisa melakukan terobosan-terobosan. Karena orang yang mempunyai jiwa enterpreneurship akan selalu membuat karya-karya baru dan membuat inovasi baru,” ujarnya. (m41)

Pertambahan Wirausaha Baru Terancam Terhambat

Polandia Tempat Terbaik Untuk Investasi

JAKARTA (Waspada): Pertambahan wirausaha baru diperkirakan akan terhambat, pasca-pemangkasan anggaran bagi program bantuan modal wirausaha pemula hingga Rp51 miliar, atau untuk 3.650 calon wirausaha. “Pemangkasan anggaran berdasarkan Inpres Nomor 4 Tahun 2014 khususnya untuk program penumbuhan wirausaha jelas akan berpengaruh pada target penambahan wirausaha di Indonesia,” kata Deputi Bi-

WASPADA (Warsawa): Sebuah survei di kalangan perusahaan Jerman di 16 negara Eropa Tengah dan Eropa Timur (CEE), yang dilakukan oleh kamar dagang lokal Jerman, mengonfirmasi bahwa Polandia masih dianggap tempat terbaik untuk berinvestasi. Posisi tersebut, tidak berubah dari hasil survei tahun lalu. “Pada 2013, Polandia menduduki peringkat atas dan menegaskan posisinya dalam survei tahun ini,” kata Kamar Dagang Jerman (AHK) di Polandia dalam sebuah pernyataan pada Selasa (10/6). Dari skor maksimum enam poin, Polandia menerima 4,09 poin, diikuti oleh Republik Ceko, Estonia, Slovakia, Slovenia, Latvia dan Lithuania.

dang Pengembangan Sumber Daya Manusia, Kementerian Koperasi dan UKM (KemenkopUKM), Prakoso BS, di Jakarta, Rabu (11/6). Karena, menurut Prakoso, program ini sangat strategis dan efektif untuk mendorong caloncalon wirausaha pemula, agar berani memulai usaha sebagai alternatif pilihan profesi. Pihaknya, tambah dia, akan tetap melaksanakan amanat Inpres terkait pemangkasan anggaran tersebut, meskipun

berdampak terhadap program pemberian modal bagi wirausaha pemula turut dipangkas. Padahal menurutnya, Kemenkop-UKM telah menyeleksi calon penerima bantuan sejak Januari 2014 melalui kegiatan Gerakan Kewirausahaan Nasional (GKN) 2014. Salah satu penyeleksiannya melalui perguruan tinggi, lembaga pendidikan, lembaga swadaya masyarakat, hingga Ormas pemuda.

Bahkan saat ini proses seleksi itu telah sampai pada tahap penilaian, di mana setiap provinsi mendapatkan alokasi anggaran rata-rata lebih dari Rp1 miliar disesuaikan dengan jumlah wilayah dan potensi masingmasing. “Kami tidak ingin dianggap ingkar janji sebab kalau ini terjadi dikhawatirkan akan berdampak kurang baik, karena sosialisasi program ini sudah dilaksanakan di seluruh Indonesia yang melibatkan berba-

gai unsur meliputi Pemda, akademisi, dan praktisi,” katanya. Prakoso menjelaskan, Indonesia saat ini sedang dalam tahap mengejar rasio ideal jumlah wirausaha 2 persen dari total jumlah penduduk sebagai prasyarat negara maju dan sejahtera menurut sosiolog David McClelland. Di samping itu, saat ini tingkat pengangguran di Indonesia sudah mencapai 6,25 persen. (ant)

Daya tarik untuk berinvestasi diukur dengan 21 faktor berbeda yang mempengaruhi arus masuk modal asing, dengan sebagian besar bobot melekat pada keanggotaan Uni Eropa, keuntungan tenaga kerja, kualitas pendidikan akademik, dan ketersediaan pemasok lokal. Sebanyak 91 persen dari perusahaan yang disurvei memandang situasi ekonomi Polandia sebagai baik atau memuaskan, dibandingkan dengan rata-rata 58 persen di seluruh wilayah. Survei ini dilakukan antara Februari hingga Maret 2014 pada sekelompok 1.435 perusahaan dengan modal Jerman yang telah diinvestasikan di negara-negara CEE, demikian laporan Xinhua. (ant)


B4 MenolakUmumkanKelulusan CPNS (Bisa) Pelanggaran HAM


Dedi Sahputra


Oleh M Ridwan Lubis Dalam perjalanan kehidupan selalu ditemui adanya faktor tidak kasat mata yang mempengaruhi hasil sebuah perencanaan.


erminologi usaha dan takdir sering disalahpahami sebagai dua hal yang saling bertentangan. Usaha sebagai milik manusia diasosiasikan selalu bertentangan dengan takdir karena kalau manusia melakukan sebuah usaha maka tentulah tidak ada ketentuan hasil lebih awal dari Tuhan. Demikian pula sebaliknya, manakala sudah ada pengakuan terhadap takdir maka dengan sendirinya manusia tidak lagi berguna melakukan usaha. Demikianlah perdebatan lama dalam sejarah kehidupan manusia sejak dahulu sampai sekarang. Tetapi bagaimanapun perdebatannya dua hal tersebut tetap menjadi dilema dalam kehidupan manusia. Manusia melakukan usaha karena Allah menganugerahkan kepada mereka dua potensi yaitu kemauan (masyi-ah) dan kemampuan (istitha’ah). Seberapa pasrahpun manusia secara total terhadap kehendak takdir tetapi kenyataannya manusia tetap melakukan usaha. Para petani, nelayan, pedagang, karyawan merupakan contoh bahwa secara sadar bekerja dengan berusaha memeroleh tingkat kehidupan lebih baik. Dalam kaitan itu, seseorang yang memutuskan menjadi pengangguran pada dasarnya adalah orang yang terlambat mensyukuri nikmat dari dua potensi di atas dan nanti akan diminta pertanggunganjawaban oleh Tuhan di hari kemudian. Jangankan manusia, segala jenis yang bergerak di muka bumi selalu diberi peluang untuk tetap terpelihara keberadaannya karena selalu menggerakkan potensi dirinya. Belum ditemukan ada manusia yang secara sengaja pasrah tanpa melakukan pergerakan sama sekali baik fisik maupun psikis. Hal itu menandakan bahwa usaha adalah sesuatu yang bersifat melekat pada diri manusia dalam bentuk refleksi dinamika dan kreativitas baik yang direncanakan maupun tidak direncanakan. Kata usaha dalam istilah Alquran disebut dengan fa’ala, kasb, ikhtiyar dan sa’yu. Kata fa’ala artinya berbuat yaitu gabungan pikiran dan tenaga yang dalam istilah lain disebut budaya. Kasb menunjukkan pada pengertian usaha dengan balasan yang baik maupun

etalase penarik minat belaka. Ia disangga dengan sangat kuat oleh prestasi di belakangnya. Dan begitulah gaya ini kemudian “meledak” dan bernilai jual komersil. Dan segala keberuntungan kemudian seolah sedang ditumpahkan ke hadapannya. Bagi saya Ronaldo bahkan lebih dari sekedar itu. Karena ia adalah sedikit dari orang-orang tenar dunia yang bisa merasakan ketidakadilan. Karena usai laga kualifikasiPialaDuniaGrupFantaraPortugal dan Israel, Maret tahun lalu, ia menolak bertukar kostum dengan pemain Israel. Kepada wartawan dia menyampaikan alasannya, “Saya berada di bumi Palestina,” katanya mengejutkan saya. *** Lawrence D.Bronnan dengan sangat apikmerumuskanlangkah-langkahmenyusun pesan komunikasi massa. Riset adalah dasar dari semua langkah itu. Dengan riset ini,siapapunyangakanmelancarkan pesan melalui media akanmengetahuiapasajaharapan, keinginan, ketakutan, dan kekhawatiran khalayak yang akan menjadi sasaran pesan. Hebatnya, ketika pesan yang dirancang sudah sangat presisi dengan keinginan khalayak, maka kita akan menyaksikan orang-orang laksana kerbau dicucuk hidung diseret-seret tali penggembala. Kalau pesan itu berupa produk dagangan, ia akan digilaidantaktergantikan,jika ia berwujud manusia ia akan dipuji setengah mati. Jika ia punya prestasi kecil, ia akan langsung disukai dengan “pokoknya”, kesalahannya gampang sekali dimaafkan, soal content (isinya) sudah tak perlu lagi. Setiap yang tak setuju adalah musuh yang menghalangi.Diaakansegerajadipahlawanmeski cuma berbicara dengan gaya bahasa khalayaknya, dia akan dianggap pekerja keras walaupun sekedar blusukan, dia akan dicap peduli dan merakyat padahal hanya bicara dengan rakyat kebanyakan, dan kesederhanaannya akan disanjung karena memerkan pakaian murahannya. Ini adalah etalase yang dirancang sedemikianrupauntukterlihatapikciamik.Lantas di mana letak salahnya? Saya perlu jawab dengan tegas: Tidak ada sama sekali! Bahwa citra itu memang harus dibuat semenarik mungkin.Tapi jangan lupakan bahwa citra ituharusdisanggaprestasi,sepertimengangkangnya Ronaldo disangga permainan menawan. Karena jika engkau memuji citra orang tanpa prestasi, Anda bukan saja harus bersiap menerima aib kelak, tapi juga harus ikut bertanggungjawan atas azab yang datang. (Vol.474, 12/6/2014)

Kolom foliopini dapat juga diakses melalui

yang buruk yang ditetapkan Allah sebagai keputusan hukum dari perbuatannya. Kata ikhtiyar merujuk kepada potensi akal untuk menentukan pilihan dari sekian banyak pilihan. Oleh karena manusia memilih melakukan atau tidak melakukan perbuatan tertentu maka tentulah wajar manusia menuai hasil pilihannya. Demikian pula kata sya’yu, bahwa hasil yang diperoleh manusia selalu terkait dengan kuantitas dan kualitas dari seluruh perbuatannya. Dari uraian di atas, dapat ditarik kesimpulan bahwa betapapun pasrahnya sikap setiap manusia namun pada dasarnya mereka tetap melakukan perbuatan baik yang sifatnya tidak kasat mata maupun yang kasat mata. Selanjutnya, sesuatu hasil baik yang positif maupun negatif tidak mungkin ditetapkan manusia sendiri karena manusia tidak mampu melakukannya. Dalam perjalanan kehidupan selalu ditemui adanya faktor tidak kasat mata yang mempengaruhi hasil sebuah perencanaan. Hal itu menandakan ada sesuatu yang sifatnya adi kodrati sebagai penentunya. Keputusan yang adi kodrati itu adalah Zat yang tidak memiliki kebutuhan terhadap ciptaanNya karena keberadaanNya adalah berada di alam (immanent) sekaligus di luar alam (transcendent). Dan itulah Zat Mahatunggal yang tidak mempunyai kepentingan terhadap alam semesta (qiyamuhu ta’ala bi nafsihi). Keputusan itu mestilah berasal dari Zat Yang Mahakuasa, Mahamengetahui, Mahabijaksana sehingga setiap keputusan yang kemudian disebut takdir bertujuan untuk peningkatan kualitas keberadaan makhluk sesuai dengan tujuan penciptaannya. Kehidupan manusia yang paripurna sangat tergantung kedekatan diri terhadap Zat Yang Mulia yang ditempuh dengan berbagai jalan (suluk) maupun metode (thariqah). Keputusan takdir yang ditetapkanNya sedikitpun tidak bersifat aniaya kepada manusia karena keputusanNya selalu berfungsi sebagai wahana pembelajaran agar manusia tumbuh dan berkembang menjadi makhluk yang lebih baik untuk menuju manusia yang paripurna. Takdir bukanlah suatu perbuatan

aniaya karena takdir adalah merupakan artikulasi dari Sifat Pengasih (al rahman) dan Penyayang (al rahim) dariNya. Sebagai dasar argumentasi bahwa takdir berangkat dari prinsip kebaikan maka Allah selalu menegaskan dalam Alquran bahwa Allah tidak berlaku zalim terhadap hamba-hambaNya. Karena keputusan Allah di akhirat (qadla) yang menyiksa dan membalas mereka yang berbuat dosa adalah konsekuensi dari kegagalan mereka yang tidak menggunakan potensi akal dan budi. Akal berfungsi menimbang antara yang benar dan salah sedang budi untuk menimbang antara baik dan buruk. Selanjutnya, bukti bahwa Allah tidak berlaku aniaya terhadap hambaNya karena Allah juga menyediakan peluang bagi manusia untuk menyadari perbuatannya yang buruk, berjanji untuk tidak mengulanginya lagi dan merasa benci terhadap perbuatan buruk yang terlanjur diperbuatnya. Sikap tersebut dikenal dengan taubat. Sebaliknya, manakala manusia yang sudah dibuka peluang kembali ke jalan yang benar namun tetap dalam keburukannya bahkan merasa bangga maka tentulah mereka termasuk orang yang mengingkari kontrak yang mereka buat kepada Allah ketika berada di alam azali. Dalam kaitan inilah, manusia harus

menempatkan usaha dan takdir dalam pemahaman yang moderasi (tawassuth), seimbang (tawazun) dan konsisten (i’tidal) guna mewujudkan kesadaran insaniah dan ilahiah berada dalam suasana yang seimbang. Menonjolkan usaha tanpa mengikutinya dengan takdir akan mendorong manusia menjadi sekuler bahkan ateis dan menonjolkan takdir tanpa dibarengi usaha akan menjadikan manusia menjadi fatalistik. Dua kecenderungan ini mengingkari hakikat dan tujuan penciptaan manusia. Dunia Islam selama lebih kurang enam ratus tahun sejak dari dakwah Rasulullah sampai jatuhnya Daulah Abbasiyah telah berhasil memberi contoh model integrasi antara usaha dengan takdir yang kemudian melahirkan kemajuan peradaban umat manusia melalui metode pemikiran ahli sunnah waljama’ah. Tetapi begitu berubah pola pemahaman umat mendikhotomikan antara usaha dan takdir menjadi penyebab kemunduran dunia Islam sampai sekarang. Karena itu menjadi tugas umat Islam untuk menjalin kembali keakraban pemahaman antara usaha dengan takdir. Penulis adalah Guru Besar UIN Syarif Hidayatullah Jakarta.

Pilpres Dan Kader Muhammadiyah

Saat Ronaldo Mengangkang Sebuah prestasi itu punya takdir untuk diraih dan dicitrakan. Urut-urutannya selalu begitu; pertama diraih baru dan kedua dicitrakan. Jika citra itu bendera maka prestasi adalah tiang penyangganya. Tapi ada jenis citra tanpa prestasi. Jenis ini bukan hanya akan muncul di kelak sebagai aib, tetapi juga akan menjadi azab. Dia azab karena tanpa prestasi, citra harus berdiri dengan disangga oleh kebohongan dan tanpasubstansi.Jikamandathidupmanusia harus berujung pada martabat, tapi citra tanpa prestasi ini adalah perusak martabat yang sungguh menggoda. *** Di dinding sebuah restoran cepat saji, foto Ronaldo terpampang besar sekali. Foto mega bintang Real Madrid itu memegang wadah berisi makanan. Bagian atas foto adanamanyadengansiluetnyasedangberdiri mengangkang—lengkap de-ngan uniform boladancelanakolornya.Sudah beberapa kali saya melihat foto yang sama—balehonya juga dipampang besar di beberapa titik jalan protokol. Tapi baru kali ini imaji saya menerawang pada posisimengangkangpemain ligat satu ini. Anda bayangkan dia cuma mengangkang, tapi menjadi trend yang mendunia di sepakbola. Beberapa pemain lokal mencontohnya, bahkan para pemain futsal amatir merasa gagah hanya dengan meniru gaya kangkang ini. Hebatnya, untuk gaya ini, perusahaan makanan cepat saji dunia membayarnya Rp98 miliar pertahun. Itu baru ngangkang, belum gaya jongkok apa-lagi jungkir balik. Lantas apa hebatnya gaya ngangkang ini kalau semua orang bisa melakukannya? Saya kira bukan di gaya ini yang jadi poinnya. Tapi apa yang dilakukan di belakang gaya itulah yang jadi penyebabnya. Pemain satu ini larinya cepat sekali, dribble bolanya sempurna, tendangannya keras dan akurat, fisiknyaprima,bodinyaideal.Dengansemua modal itu dia mampu membuat kesan mencetak gol jadi tampak mudah. Seringkali ketika mengeksekusi bolabola mati, tendangannya menjebol gawang lawan dengan sangat terukur. Dan itu dimulai dengan menghadapi bola bergaya mengangkang. Namun apa jadinya jika dia cuma bergaya mengangkang tapi tendangan bebasnya meleset melulu, dan apa kataduniakalaudiahanyapinterngangkang tapi larinya letoy, dribblingnya pun payah. Jangankan jadi bintang iklan atau begaji Rp6,2 miliar perpekan, bahkan untuk sekedar dipilih Carlo Ancelotti bermain juga belum tentu. Jadi, gaya ngangkang itu hanyalah

Rabu 12 Juni 2014

Dialog Usaha Dan Takdir


enderitaan batin atau kejiwaan peserta ujian CPNS di Mandailing Natal (Madina) belum berakhir meskipun aksi unjukrasa yang berlangsung sejak Senin (2/ 6) sudah berakhir Senin (9/6). Mengapa belum usai? Hal ini disebabkan bupati Madina bertahan tidak mau mengumumkan kelulusan peserta ujian CPNS di daerahnya. Memang ada solusi yang ditawarkan sesuai kesepakatan antara pengunjukrasa dengan bupati Madina Dahlan Hasan Nasution bahwa perwakilan pengunjukrasa bersama bupati akan berangkat ke Jakarta bertemu langsung pihak Kementerian PAN dan Badan Kepegawaian Nasional. Keberangkatan ke Jakarta ini dalam rangka mengetahui secara detail duduk persoalan mengapa pihak daerah tak mau mengumumkan pemenang CPNS formasi tahun 2013. Hemat kita, bupati Madina bisa dinilai otoriter dengan tidak mengumumkan Intisari: hasil ujian CPNS yang sudah begitu lama berlangsung, sehingga peserta ujian yang ‘Pejabat daerah bertang- jumlahnyaribuanorangdanmayoritasnya Madina terus menunggu dengan gung jawab mengumum- warga harap-harap cemas. Berharap bisa lulus, kan kelulusan CPNS walau namuncemaskarenasemakinlama‘’dipendam’’ bisa-bisa terjadi ‘’kebocoran’’ alias calonnya sendiri gagal’ ‘’permainan’’, di mana peserta yang lulus denganrankingtertinggimalahdikalahkan peserta yang nilainya pas-pasan. Permainan KKN inilah yang dikhawatirkan banyak peserta. Mereka berharap ujian dan pengumuman CPNS benar-benar jujur, bersih, dan transparan, seperti berlangsung di pemprovsu dan kabupaten-kota lainnya. Aneh memang sikap bupati Madina dinilai masyarakat, sepertinya lebih tahu hukum ketimbang gubernur dan kepala daerah lainnya se-Indonesia. Sebab, hanya Madina yangmenolakmengumumkanhasilujianCPNS-nya.Sedangkandiprovinsidankabupatenkota lainnya rata-rata sudah diumumkan. Memang pada awalnya sejumlah kepala daerah yang menolak hasil ujian CPNS karena banyak sanak saudara/famili dan orangorang dekat penguasa daerah tidak lulus karena rankingnya rendah. Kita memberi apresiasi tinggi pada Kementerian Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (KemenPAN-RB) atas keberhasilannya mereformasi sistem rekrutmen CPNS sehingga banyak anak pejabat pemerintah daerah yang gagal lulus karena memang nilainya rendah. Kalau pintar tanpa harus dibantu dan diurus pun pasti lulus. Biasanya, setiap penerimaan CPNS merupakan masa panen buat oknum pejabat daerah. Sebab, di tangan calo, tarif untuk lulus CPNS tingkat sarjana mencapai Rp200 juta per kepala. Mereka hanya ambil komisi 10-20 persen saja, selebihnya stor untuk oknum-oknum yang menentukan kelulusan. Itu sebabnya jumlah CPNS cenderung semakin banyak dan sebagian besar tidak berkualitas, seperti diungkap Menteri PANRB. Mengapa tidak berkualitas? Sebab, maraknya permainan ala KKN di setiap penerimaan CPNS selama ini sehingga anggaran pemerintah daerah umumnya membaengkak dan dihabiskan hanya untuk membayar gaji dan kebutuhan PNS saja. Sebaliknya pelayanan kepada masyarakat semakin parah, malah banyak oknum PNS yang minta upeti setiap kali berurusan, seperti mengurus KTP, KK dll karena bobroknya sistem rekrutmen CPNS di masa lalu. Tidak tertutup kemungkinan hal serupa juga terjadi di Madina, termasuk peserta yang lulus dan mendapatkan ranking tertinggi dari luar daerah. Sedangkan putra-putri daerah kebanyakan nilainya rendah atau pas-pasan, hanya sebagian kecil saja mampu bersaing dengan peserta dari luar daerah, memenuhi passing grade,dan berpeluang lulus. Walaupun awalnya banyak KDh yang ngotot menolak mengumumkan kelulusan peserta CPNS, namun pada akhirnya semua kepala daerah tingkat-I dan tingkat-II –kecuali Madina—sadar bahwa mereka selaku pejabat tidak boleh berlaku arogan. Mentang-mentang punya kekuasaan semena-mena menggantung harapan dan hak peserta ujian CPNS. Kasihan mereka yang masih muda sudah diperlakukan kejam oleh pejabat daerahnya sehingga dikabarkan banyak yang stress dan jatuh sakit. Jika sampai kejiwaan mereka terguncang, bisa-bisa aparatur pemerintahnya dinilai melakukan pelanggaran hukum. Lebih parahnya lagi bisa dianggap melakukan pelanggaran HAM (hak asasi manusia) bila ditindaklanjuti ke aparat penegak hukum atau diadukan ke komisi informasi. Sebab, pelanggaran HAM tidak saja menghilangkan nyawa dengan kekerasan, tapi juga dilakukan aparat pemerintah terhadap warga masyarakat, termasuk bila bupati menolak mengumumkan kelulusan CPNS.+


Oleh Anang Anas Azhar Secara lembaga Pemuda Muhammadiyah tidak terlibat, namun kader inti dan akar rumputnya sudah membentuk relawan Laskar Melati yang sudah dideklarasikan di sepertiga provinsi di Indonesia untuk Prabowo-Hatta


erkaca dari sejarah, Muhammadiyah secara lembaga memang tidak pernah mengumumkan ikut berpolitik praktis secara terbuka. Apakah dukung mendukung dalam pemilihan kepala daerah atau pemilihan presiden. Penguatan Muhammadiyah secara lembaga tidak terlibat politik praktis, karena dikuatkan dalam khittah Muhammadiyah (Muktamar Muhammadiyah 1971). Keterlibatan Muhammadiyah secara lembaga, berada pada tataran politik normatif, khususnya dalam kontribusi pemikiran politik bangsa dan negara. Konsep politik pembangunan bangsa hanya ikut memajukan bangsa yang “dimotori” kader Muhammadiyah secara personal tanpa membawa-bawa nama Muhammadiyah. Mungkin dalam konteks inilah, Muhammadiyah secara lembaga tetap aman dari virus politik pragmatis, karena antara Muhammadiyah dan kader secara pribadi benarbenar terpisah. Muhammadiyah tak boleh masuk ke ranah politik pragmatis, sementara kadernya justru bebas memilih partai politik dan mendukung calon presiden/calon wakil presiden (Capres/Cawapres). Lantas, yang menjadi pertanyaan kita adalah, bagaimana sikap politik kader Muhammadiyah di balik netralitas Muhammadiyah secara lembaga pada pemilihan presiden (Pilpres) 2014 ini? Pertanyaan ini hemat penulis menarik untuk ditelusuri. Kenapa antara Muhammadiyah secara lembaga dan kader Muhammadiyah tidak sejalan dalam Pilpres. Sikap Muhammadiyah pada Tanwir 23-24 Mei 2014 lalu di Samarinda, Kaltim menegaskan, khusus kepada kader Muhammadiyah dibebaskan memberikan dukungan kepada pasangan Capres manapun. Kader Muhammadiyah dipersilakan mempertimbangan rasionalitas dan spritualitas Capres mana yang diinginkan. Sedangkan Muhammadiyah secara lembaga tidak mendukung pasangan manapun. Sikap Kader Kesepakatan bulat Muhammadiyah ternyata tak perlu diperdebatkan kader Muhammadiyah. Namun ternyata, ini

berdampak tidak sehat kepada kadernya. Elit politik Muhammadiyah justru terpecah-pecah secara pribadi untuk mendukung pasangan Capres berdasarkan kriteria yang diinginkan. Dan ini berimbas kepada kader Muhammadiyah di basis akar rumput juga ikut terpecah-pecah. Sikap Muhammadiyah secara lembaga, hanya menggiring kriteria Capres mana yang harus dipilih kader Muhammadiyah. Padahal jika kita melihat kriteria yang disampaikan Muhammadiyah melalui Ketua Umum PP Muhammadiyah Din Samsuddin masih memunculkan multi-tafsir. Perbedaan pandangan di internal kader, akhirnya menyebabkan kader terpecah kepada dua kubu. Kubu pertama, mendukung pasangan Prabowo-Hatta. Sedangkan kubu kedua, mendukung pasangan Jokowi-JK. Perbedaan pilihan pasangan Capres ini, dalam fakta politiknya ditunjukkan dengan dukungan yang disebut relawan. Relawan yang satu adalah “Surya Madani” yang berkomitmen memenangkan pasangan Prabowo-Hatta. Sedangkan relawan kedua mengatasnamakan “Matahari Indonesia” berkomitmen memenangkan pasangan Jokowi-JK. Dua kubu relawan ini kini sedang bergerilya untuk saling mengambil simpati ke kader-kader Muhammadiyah di akar rumput. Yang pasti, aktivitas politik kader Muhammadiyah secara praktis ini sudah tidak sejalan dari sikap Muhammadiyah secara lembaga. Nah, di sinilah yang saya maksudkan bahwa sikap tegas Muhammadiyah tidak sejalan dengan kadernya. Akhirnya, kader Muhammadiyah terpecah menurut selera politiknya masing-masing. Yang paling rentan adalah, sangat dimungkinkan kader-kader Muhammadiyah berpikir politik pragmatis dan terjebak pada politik uang dalam pemilihan presiden nanti. Pembentukan relawan untuk mendukung dua pasangan ini, justru merambah ke tingkat organisasi otonom Muhammadiyah. Seperti Pemuda Muhammadiyah, Nasyiyatul Aisyiah, Ikatan Mahasiswa Muhammadiyah, Ikatan Pelajar Muhammadiyah, Aisyiyah, Tapak

Suci dan Hizbul Wathan. Pemuda Muhammadiyah misalnya, sudah mendeklarasikan dukungannya kepada Prabowo-Hatta. Meski dalam realitas dukungannya, secara lembaga Pemuda Muhammadiyah tidak terlibat, namun kader-kader inti dan akar rumput Pemuda Muhammadiyah sudah membentuk relawan Laskar Melati. Relawan ini sudah dideklarasikan di sepertiga provinsi di Indonesia, termasuk di Sumatera Utara. Kenapa Pemuda Muhammadiyah cenderung mendukung Prabowo-Hatta, ini tidak lain karena Ketua Umum PP Pemuda Muhammadiyah dari PAN. Maka sangat mudah kita menjustifikasi bahwa wajar kalau Pemuda Muhammadiyah menggiring kadernya ke pasangan Prabowo-Hatta. Ancaman Di balik netralitas Muhammadiyah dalam pilpres 2014 ini, dan terpecahnya kader Muhammadiyah mendukung pasangan Capres/Cawapres, ternyata dapat mengancam keutuhan kader Muhammadiyah. Bahkan sangat dimungkinkan konflik horizontal antara kader Muhammadiyah bakal terjadi. Munculnya kubu-kubuan, dukung mendukung dalam Pilpres ini, sehat secara demokrasi tapi terlihat jelek dalam keutuhan umat. Muhammadiyah sebagai gerakan tajdid dan dakwah, sejatinya harus diikuti kader-kadernya untuk berdiri pada satu konsep yakni menjaga keutuhan umat. Dakwah politik yang disebar dalam Pilpres ini, justru lebih terlihat sejuk, damai bukan menunjukkan ego di masing-masing kubu. Jika ini terjadi, sangat dimungkinkan ancaman di internal Muhammadiyah, benturan antara kader Muhammadiyah bisa terjadi. Dalam konteks Pilpres kali ini, ada baiknya kader-kader Muhammadiyah lebih mengedepankan sikap dan semangat ukhuwah islamiyah antara sesama kader. Bukan malah menunjukkan kompetisi yang tidak sehat yang mengarah kepada konflik horizontal. Sudah saatnya warga Muhammadiyah tidak digiring-giring lagi kepada ranah dukung mendukung. Apalagi, kriteria yang diumumkan Muhammadiyah, bahwa kader harus memilih kriteria spiritual. Ini artinya kader harus menjadikan semangat keagamaan dan komitmen ibadah menjadi faktor utama. Capres yang mengarah ke sanalah yang menjadi pilihan warga Muhammadiyah. Kita sering menyebut kader Muhammadiyah itu cerdas dalam memilih. Kader-kader Muhammadiyah tak perlu diragukan lagi dalam memilih Capres mana yang dia sukai. Tapi, kita justru

heran mengapa elit Muhammadiyah sendiri yang mengiring-giring kadernya ke ranah politik. Semestinya, modelmodel seperti ini tidak perlu dikembangkan lagi di Muhammadiyah. Sudah saatnya kita menebar politik santun kepada kader Muhammadiyah. Tanpa ada relawan dan dukungan kepada Capres pun, kader Muhammadiyah tetap memilih. Masalahnya sekarang, kaderkader Muhammadiyah justru masih haus terhadap kekuasaan. Sebagian kecil elit Muhammadiyah mendukung pasangan Capres, karena ingin kekuasaan. Setidaknya ingin masuk ke ranah kabinet bagi pasangan Capres yang menang. Dari dua kubu relawan kader Muhammadiyah, setidaknya ada satu menteri yang sangkut untuk diangkat menjadi menteri di kabinet presiden/wakil presiden terpilih. Penulis adalah Dosen FISIP UMSU, Ketua Pimpinan Pusat Pemuda Muhammadiyah, Sekretaris Lembaga Hikmah PD Muhammadiyah Medan, Dan Sedang Studi Program Doktor (S3) di Pascasarjana IAIN Sumut.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * 16 Juni Dzulmi Eldin Walkot definitif - Jangan lupa pulut kuning, he...he...he * Ketua DPR: Debat Capres tak substansial - Maklum masih grogi * Penerbangan Garuda JakartaPinangsori mulus - Asal jangan perdana dan terakhir

o k D Wa


Sumatera Utara

WASPADA Kamis 12 Juni 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:27 12:40 12:27 12:34 12:34 12:31 12:27 12:23 12:30 12:29

‘Ashar 15:53 16:07 15:54 16:01 16:01 15:57 15:54 15:49 15:56 15:56

Magrib 18:37 18:54 18:38 18:48 18:46 18:37 18:37 18:32 18:40 18:41



Shubuh Syuruq


19:52 20:09 19:53 20:03 20:01 19:52 19:52 19:47 19:55 19:56

04:42 04:52 04:43 04:47 04:48 04:51 04:44 04:40 04:46 04:43

04:52 05:02 04:53 04:57 04:58 05:01 04:54 04:50 04:56 04:53

L.Seumawe 12:33 L. Pakam 12:26 Sei Rampah 12:25 Meulaboh 12:37 P.Sidimpuan 12:24 P. Siantar 12:25 Balige 12:25 R. Prapat 12:22 Sabang 12:40 Pandan 12:26

06:14 06:24 06:15 06:19 06:20 06:22 06:16 06:12 06:18 06:15

Zhuhur ‘Ashar 16:00 15:52 15:52 16:03 15:50 15:51 15:51 15:48 16:07 15:52





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:46 18:36 18:36 18:48 18:31 18:34 18:33 18:30 18:54 18:34

20:01 19:51 19:50 20:03 19:45 19:49 19:48 19:44 20:09 19:48

04:45 04:42 04:41 04:51 04:44 04:42 04:43 04:41 04:51 04:46

04:55 04:52 04:51 05:01 04:54 04:52 04:53 04:51 05:01 04:56

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:26 12:27 12:37 12:30 12:27 12:34 12:22 12:32 12:25 12:25

18:33 18:37 18:51 18:38 18:38 18:46 18:32 18:42 18:33 18:35

19:48 19:51 20:06 19:53 19:53 20:01 19:46 19:57 19:48 19:49

04:46 04:45 04:50 04:49 04:43 04:48 04:39 04:49 04:44 04:41

04:56 04:55 05:00 04:59 04:53 04:58 04:49 04:59 04:54 04:51

Panyabungan 12:23 Teluk Dalam 12:30 Salak 12:28 Limapuluh 12:23 Parapat 12:25 Gunung Tua 12:23 Sibuhuan 12:22 Lhoksukon 12:32 D.Sanggul 12:26 Kotapinang 12:21 Aek Kanopan 12:22

15:49 15:56 15:54 15:50 15:52 15:49 15:48 15:59 15:52 15:47 15:49

18:29 18:35 18:37 18:33 18:34 18:30 18:28 18:45 18:34 18:28 18:31

19:43 19:49 19:51 19:48 19:49 19:44 19:43 20:00 19:49 19:43 19:46

04:44 04:52 04:46 04:40 04:43 04:43 04:43 04:45 04:45 04:40 04:41

04:54 05:02 04:56 04:50 04:53 04:53 04:53 04:55 04:55 04:50 04:51

06:17 06:13 06:12 06:23 06:16 06:14 06:15 06:12 06:23 06:17

15:52 15:54 16:04 15:56 15:54 16:01 15:49 15:59 15:52 15:51

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:17 06:17 06:22 06:20 06:15 06:20 06:11 06:21 06:16 06:13

06:15 06:23 06:17 06:12 06:15 06:14 06:14 06:17 06:16 06:11 06:12

Prostitusi Resahkan Warga Besitang Pemkab Diminta Ambil Tindakan BESITANG (Waspada): ‘Bisnis’ prostitusi di Desa Bukitselamat dan Desa Halaban, Kec. Besitang, Kab. Langkat makin ‘berkembang’, bahkan sebagian lokasi maksiat ini sudah menyebar hingga ke pemukiman penduduk. Tentu saja, ini sangat meresahkan. Muncul keinginan sejumlah kalangan untuk membasmi ‘bisnis’ prostitusi yang sudah berdiri sejak 1980-an ini. Apalagi, dampak negatif bisnis pelacuran sangat merusak moralitas generasi muda. Salahseorang tokoh masyarakat Telukaru, Harizal, SH kepada Waspada, Selasa (10/6) mengatakan, berkembangan bisnis prostitusi di daerah yang berbatasan dengan Provinsi Aceh ini karena sejak awal adanya proses pembiaran, baik dari warga

maupun dari pemerintah. Menurut dia, jika tokoh masyarakat, pemuka agama termasuk pemerintah daerah memiliki komitmen yang sama utuk membasmi pelacuran, niscaya bisnisyangbanyakmendatangkan mudarat ini tidak akan berkembang pesat seperti saat sekarang. “Saya mencermati, belum adaterlihatkomitmenyangserius terutama dari pemerintah untuk membasmi lokasi prostitusi liar di Besitang,” ujar Hasrizal seraya meminta pemerintah tidak me-

nutup mata atas maraknya fenomena pelacuran di Besitang dan sejumlah kecamatan di Langkat. IamendesakPemkabLangkat untuk mensterilkan daerah ini dari lokasi-lokasi maksiat. Momentum kedatangan bulan suci Ramadhan ini, lanjutnya, merupakan langkah yang tepat bagi Pemkabuntukmengambiltindakan tegas agar umat Islam dapat khusuk dan tenteram menjalankan ibadah. Hasrizal meminta Pemkab

Langkat dapat berkaca dariWali Kota Surabaya, Risma, yang memiliki keberanian moral dan berkomitmenmenutuplokalisasi prostitusi Doli pada 18 Juni ini, meskipun sangWali Kota mendapat penentangan yang cukup besar dari komunitas warga yang pro maksiat. Sebenarnya, kata Hasrizal, kalau pemerintah memiliki kemauan yang kuat untuk memberantasperkembanganbisnisprostitusi tidak ada sulitnya, apalagi

mayoritas masyarakat dipastikan siap memberikan dukungan penuh untuk tindakan eksekusi. Selain kepada Pemkab, Hasrizal juga mendesak Kapolres Langkat meningkatkan razia ke lokasi prostitusi mengingat di tempatmaksiatinikerapdijadikan ajangtransaksinarkobatermasuk penjualan minuman keras. “Polri juga bertanggungjawab untuk menciptakan ketertiban dan ketentraman di tengah masyarakat,” tukasnya. (a02)

Hidupkan Kembali Semangat Gotongroyong

Bupati Labura Serahkan Rp50 Juta Bangun Menara Masjid AEKKANOPAN (Waspada): Bupati Labuhanbatu Utara H Kharuddin Syah, SE meletakkan batu pertama pembangunan menara Masjid Nurul Iman Desa Damuli Pekan Kecamatan Kualuhselatan Selasa (10/6). Acara dilaksanakan di halaman masjid tersebut. Bupatiyangsaatitudidampingi CamatKualuhselatanHIrwansyah Pohan, SSTP, M.AP Kepala Desa Damuli Pekan Sofyan Tambunan serta tokoh masyarakat Desa Damuli Pekan menyerahkan uang bantuan dari Pemkab Labura Rp50 juta untuk pembangunan menara masjid tersebut. Dalam sambutannya H Buyung memberikan apresiasi atas kerja keras pengurus Masjid Nurul Iman dan seluruh masyarakat Desa Damuli Pekan yang telah bergotongroyong dalam mengumpulkan dana untuk pembangunan menara masjid serta rehab Masjid Nurul Iman. “Kami dari Pemkab Labura memberikan bantuan Rp50 juta, mudah-mudahan bantuan dari Pemkab yang diambil dari dana bantuan sosial dapat bermanfaat dan membantu kelancaran pembangunan Masjid Nurul Iman ini,” sebut H Buyung. Pada kesempatan itu H Buyung memberikan bantuan secara pribadi berupa bahan material untuk pembangunan Masjid Nurul Iman.”Bantuan ini saya berikan atas nama orangtua saya yang sudah meninggal dunia,” ucap H Buyung. Ketua Panitia pembangunan Masjid Nurul Iman Azwan Hutapea mengucapkan terimakasih kepada Bupati Labura yang telah memberikan perhatian lebih kepada pembangunan Masjid Nurul Iman karena masjid tersebut merupakan Masjid Raya Desa Damuli Pekan serta masjid kebanggaan bagi warga Damuli Pekan. “Insya Allah dengan dibangunnya menara Masjid Nurul Iman ini, dapat menambah semangat bagi masyarakat untuk beribadah. Kita ingin menciptakan Kabupaten Labuhanbatu Utara yang religius sesuai dengan visi Pak Bupati,” ujar Azwan. (c08)

Waspada/Budi Surya Hasibuan

BUPATI Labuhanbatu dr H Tigor Panusunan Siregar, SpPD dan Wakil Bupati Suhari Pane, SIP beserta istri saat diabadikan dengan Bambang Sudrajat, SH dan Kepala Kejaksaan Negeri Rantauprapat Hermon Dekristo, SH, MH beserta istri dalam acara silaturahmi dan pengantar tugas di pendopo kabupaten.

Kajari Labuhanbatu Mutasi Ke Tuban RANTAUPRAPAT(Waspada): Bupati Labuhanbatu dr H Tigor Panusunan Siregar, SpPD beserta unsur Muspida, melepas keberangkatan mantan Kajari RantauprapatBambangSudrajat, SH dari Pendopo Kabupaten menujuketempattugasyangbaru sebagai Kajari di Tuban Jawa Timur, Selasa (10/6). Di situ terlihat Wakil Bupati Suhari Pane, SIP, Plt. Sekdakab Labuhanbatu H Ali Usman Harahap, SH, tokoh masyarakat, tokoh agama dan Kepala SKPD serta Ketua Tim Penggerak PKK Kabupaten Labuhanbatu. Bupati Labuhanbatu dr H

Tigor Panusunan Siregar, SpPD mengucapkan selamat jalan kepadaBambangSudrajatbeserta keluargayangtelahbertugassekira tiga tahun empat bulan di Kab. Labuhanbatu sebagai Kepala Kejaksaan Negeri Rantauprapat ‘’Selama kita bergaul, dalam pergaulan kita sehari-hari tentu tentu ada yang salah dari kami, maka pada malam ini kami memohon maaf, mudahmudahan di tempat yang baru karirnya semakin meningkat,” ungkapnya. Bambang Sudrajat, SH dalamsambutannyamengucapkan terimakasih kepada Bupati Labu-

hanbatu yang telah membuat acara seperti ini dan telah banyak mendukung kinerjanya sebagai Kajari Rantauprapat, demikian juga dengan para unsur Muspida. Sedangkan Kajari RantauprapatHermonDekristo,SH.MH mengharapkan dukungan dari semuapihakterutamadariBupati danunsurMuspidaLabuhanbatu untuk tetap menjalin kerjasama. Dalam kegiatan silaturrahmi dan malam pengantar tugas itu juga turut hadir dan memberikan kata sambutan yakni Bupati Labuhanbatu Selatan HWildan Aswan Tanjung, SH dan Ketua DPRD Labusel Fery Andika. (c07)

Tangkap Pengedar Sabu, Polisi Dikejar Warga

Waspada/Syahri ilham Siahaan

BUPATI Labura H Kharuddin Syah menyerahkan bantuan kepada Ketua Panitia Pembangunan Masjid Nurul Iman Azwan Hutapea saat peletakan batu pertama pembangunan menara masjid tersebut.

Nek Salamiah Terharu Rumahnya Kini Layak Huni STABAT (Waspada): Nenek Salamiah, 76, warga Desa Ara Condong Kec. Stabat Kab. Langkat yang rumah tidak layak huninya dibongkar masyarakatsepekansilamuntukdibangunkembalikinitelahrampung. Sang nenek mulai menghuninya dengan rasa syukur tidak terhingga. ‘’Alhamdulillah, terimakasih kepada sejumlah masyarakat yang telah membantu,’’ katanya Minggu (8/6). Dia tidak lagi merasakan air hujan membasahi kasurnya, tidak lagi merasakan genangan air di lantai rumahnya dan juga tidak waswas jika angin kencang, sebab masyarakat gotong-royong kumpul uang membangunkan rumahnya. Padahal, sebelumnya kondisi rumah sang nenek sangat memprihatinkan. Salamiah tinggal bersama anaknya Ahmad Fauzi yang masih lajang. Suaminya sudah bertahun-tahun meninggal. (a03)

Proyek Jalan Di Langkat Amburadul P.BRANDAN (Waspada): Pengerjaan proyek jalan yang dilaksanakan Kontraktor AK di Langkat dinilai amburadul. Menurut pengamatan di lapangan, saat ini seperti pekerjaan tambal sulam jalan di sepanjang jalan negara Medan - Aceh di Desa Securai Utara sebagianjalanyangdikupassampaisaatinibelumjugadiaspalsehingga menyulitkan pemakai jalan negara itu. “Keterangan dihimpun Waspada, kontraktor proyek jalan itu saat ini sedang mengerjakan pengaspalan di Hinai dan juga di Besitang. Sehingga pekerjaan yang sedikit ini sudah berbulan-bulan belum juga ditambal aspal sehingga menyulitkan bagi pemakai jalan. ‘’Hendaknya pihak kontraktor milik BUMN itu sudah matang tentang perbaikkan jalan raya, namun kelihatannya amburadul,’’ ungkap warga. (c01)

M. Arif Tinggalkan Rumah MEDAN (Waspada): Muhammad Arif (foto) sudah lebih enam bulan meninggalkan rumah. Anak dari Ali Sabri ini meninggalkanrumahnyadiJalanSudirman No.289 Lk. VII Tebingtinggi. M. Arif, 18, pergi memiliki ciri-ciri antaralain kurus, kulit sawo matang, ada tahi lalatnya di punggung dengan tinggi badan sekira165 cm. Pergi dari rumah karena sakit. Orangtuanya sampai sekarang masih terus mencari dan tidak tahu dimana keberadaannya. Orangtua M. Arif berharap kepada masyarakat yang melihatnya dapat menghubungi Azwar di 081375471351 dan Ardiansyah di 081361243336. (rel/ihn)

Waspada/Riswan Rika

WALI KOTA Binjai HM Idaham, SH, MSi menyerahkan bantuan peralatan membuat kue yang diserahkan pada acara pencanangan bulan bakti gotong royong masyarakat (BBGRM) XI dan hari kesatuan gerak PKK Kota Binjai Tahun 2014.

STABAT (Waspada): Aparat Sat Narkoba Polres Langkat meringkus pengedar narkotika jenis sabu-sabu untuk wilayah Kec. Wampu di Dusun 4 Desa Setungkit. Namun, saat menggerebek pelaku melawan hingga borgol yang telah dipakaikan putus, kemudian sejumlah warga mengejar petugas untuk membebaskannya. Perlawanan sekelompok rekan pelaku terus terjadi ketika mobil petugas yang membawanya berusaha dihadang. Dalam medan yang menyulitkan karena beradadipelosokdesa,banmobil petugas kemudian bocor dan tersangka JU, 37, alias Genjreng, diamankan di lingkungan rumah warga yang mendukung upaya

polisi memberantas narkotika. Akhirnya, dua tembakan ke udara dimuntahkan petugas untuk memecah konsentrasi sejumlah rekan JU yang ingin membebaskannya. Tersangka kemudian dibawa ke Mapolres Langkat untuk pemeriksaan selanjutnya, Selasa (10/6) sore. Dalam penangkapan itu polisi menyitaduapaketsabuberatdua gram, seperangkat alat isapnya dan beberapa kemasan kosong sisa sabu. KasatNarkobaPolresLangkat AKPLukminSiregarmenuturkan, keterangan tersangka masih dikembangkan untuk mengetahuioknumpengedarlainnya hingga diketahui sang bandar. “Kita mendapat perlawanan

berarti kemarin, namun kelompok warga yang mendukung polisi untungnya membantu,” kata Lukmin. Informasi lain dihimpun, selamainitersangkaberperansebagai pengedar sabu ke beberapa desa di Kec.Wampu, terduga juga memasarkannyauntukagen-agenkecil di Kel. Bingai, Kec. Wampu. Masyarakat Bingai kini resah sabu-sabu sudah berkembang di sana dan ada beberapa rumah yang sering dijadikan lokasi pesta narkotika tersebut. Salahsatu dampak yang ditimbulkan pencurian meningkat karena sebagian anak-anak muda pengangguran sudah kecanduan sabu sementara tidak memiliki uang untuk membelinya. (a03)

BINJAI (Waspada):Wali Kota Binjai HM Idaham, SH, MSi, mencanangkan Bulan Bakti Gotongroyong Masyarakat (BBGRM) XI dan Hari Kesatuan Gerak PKK Kota Binjai, Jumat (6/6). Hadir Dandim 0203 Langkat Letkol Inf Tri Saktiyono dan unsur pimpinan daerah. Wali Kota HM Idaham mengemukakan, gotongroyong sebagai satu kearifan lokal semakin memudar, akibat masyarakat semakin sibuk dengan urusannya masing-masing. Pencanangan BulanBaktiGotongRoyongMasyarakat(BBGRM), diharapkan menumbuhkan kembali semangat gotongroyong di kehidupan masyarakat. “Gotongroyong bukan hanya membersihkan parit bersama-sama membantu tetangga yang mendapat musibah, juga salah-satu bentuk gotongroyong,” kata HM Idaham. Gotongroyong bukan semata-mata untuk membangun dan membenahi sarana fisik, tapi juga membangun non fisik, yaitu pembangunan manusia seutuhnya meliputi pembangunan dan

pembentukan akhlak, moral dan karakter masyarakat. Pencanangan BBGRM XI dan hari kesatuan gerak PKK diingatkan jangan sekadar seremoni, jadikan sebagai momentum menguatkan komitmen untuk membangun Kota Binjai dengan mengedepankankebersamaandangotongroyong. Ketua TP PKK Kota Binjai Ny Lisa Idaham mengatakan, tim penggerak PKK memerankan fungsi sebagai mitra pemerintah dan merupakan salahsatu unsur pelaku pembangunan. Pada tahun 2013 TP PKK Kota Binjai meraih prestasi membanggakan, seperti juara 2 lomba masak menu B2SA tingkat provinsi, juara 3 lomba pelaksana terbaik tertib administrasi PKK tingkat provinsi, juara 2 lomba pelaksana terbaik UP2K tingkat provinsi, juara 2 lomba pelaksana terbaik pemanfaatan lahan pekarangan tingkat provinsi, juara terbaik I kader PHBS tingkat nasional dan juara terbaik 2 kader posyandu tingkat nasional atas nama Marlina. (a04)

PAC PP Percut Seituan Peduli Rumah Ibadah PERCUT SEITUAN (Waspada): Pimpinan Anak Cabang Pemuda Pancasila (PAC PP) Kec. Percut Seituan memberikan bantuan pembangunan perbaikan mushola di Dusun 23 Desa Sampali Percut Sei Tuan Deliserdang Minggu (8/6), bantuan ini berkaitan dengan program kerja PAC PP Percut Seituan menjelang bulan suci Ramadhan. Bantuan yang diberikan berupa material bangunan untuk pemugaran mushola agar dapat digunakan kegiatan sholat tarawih dan pengajian anak-anak di bulan suci Ramadhan. Bantuan tersebut diserahkan Ketua PAC PP Percut Seituan, Kamirin berserta jajaran pengurus kepada masyarakat BKM Mushola Al-Bayan. Ketua PAC PP Percut Seituan, Kamirin mengatakan, kegiatan peduli rumah ibadah menjelang bulan suci Ramadhan ini bukanlah kali pertama dilaksanakan oleh Pemuda Pancasila Percut Seituan,namunsudahmenjadiagendarutintahunan setiap menjelang bulan puasa, ormas Pemuda Pancasila wajib melaksanakan kegiatan peduli rumah ibadah. “Ini merupakan kegiatan kalender tahunan Pemuda Pancasila di bidang keagamaan, yaitu program peduli rumah ibadah, kita mulai dari pendataan mushola dan masjid yang ada di Kecamatan Percut Seituan, lalu kita rapatkan di sekretariat PAC PP Percut Seituan, agar bantuan

yang diberikan tepat sasaran sesuai kebutuhan mushola atau masjid,” ucap Kamirin didampingi Penasehat, H. Joko Susilo, ErwinWijaya dan jajaran pengurus PAC PP Percut Seituan. PenasehatPACPPPercutSeituan,ErwinWijaya mengatakan, kegiatan peduli rumah ibadah merupakan hal yang biasa dan rutin dilaksanakan oleh PAC Percut Seituan, “Jadi ini bukan kegiatan dadakan di saat menjelang puasa atau pencitraan ormas, tapi sudah diagendakan setiap tahun untuk program peduli rumah ibadah dari beberapa agama yang ada di Kec. Percut Seituan,” ujar Erwin Wijaya diamini H. Joko Susilo selaku Penasehat. Sementara itu, masyarakat dan badan kemakmuran Mushola Al-Bayan yang diwakili olehSujadimengucapkanterimakasihatasbantuan material bangunan untuk perbaikan Mushola Al-Bayanyangsaatinikondisinyamemprihatinkan. “Alhamdulilah, berkat bantuan dari Pemuda Pancasila Percut Seituan, masyarakat sekitar bisa menggunakan kembali mushola untuk kegiatan sholat tarawih dan pengajian anak-anak, “kata Sujadi didampingi Kepala Lingkungan 23 Desa Sampali, Adi G. Rencananyadalamwaktudekat,PACPPPercut Seituan juga akan memberikan bantuan kepada masjiddanmusholayangadadiKecamatanPercut Seituan yang membutuhkan, baik berupa material bangunan atau kebutuhan lainnya. (m08)

Bupati Langkat Minta PNS Tingkatkan Kinerja STABAT (Waspada) : Bupati Langkat H. Ngogesa Sitepu, SH mengimbau para PNS di lingkungan Pemkab Langkat untuk meningkatkan kinerja yang profesionalisme , sejalan dengan semakin meningkatnyatuntutanditengah masyarakat untuk memperoleh pelayanan yang lebih baik. Tingkatkan disiplin dan moralitas dalam melaksanakan tugas, kata Bupati H Ngogesa dalam sambutan tertulis dibacakan wakilnya H Sulistianto dalam acaraperingatanIsrakMikrajNabi Muhammad SAW 1435 H di SerambiJenteraMalayrumahdinas bupati di Stabat, Selasa (10/6). Dalamkesempatanitubupati juga mengucapkan terimakasih dan penghargaan kepada anakanak peserta MTQ Tingkat Provinsi Sumatera Utara yang telah memberikan hasil terbaiknya untuk mengangkat marwah dan nama baik Kab. Langkat. Menyinggung pelaksanaan Pilpres 9 Juli 2014 dan bulan suci Ramadhan, Bupati meminta peran serta tokoh masyarakat, pemuka agama, tokoh pemuda dan seluruh komponen masyarakat untuk tetap menjaga suasana kondusif sehingga nyaman dalam beribadah dan menghasilkan pemimpin yang mendapat-

kan kepercayaan penuh dari masyarakat. Sebelumnya Asisten II Ekbangsos Drs. H. Hermansyah selaku panitia penyelenggara melaporkan, tujuan kegiatan peringatan Israk Mikraj Nabi Muhammad SAW untuk membina mentalspritualdijajaranPNSKab. Langkat sekaligus wahana silaturahim dengan seluruh elemen masyarakat ,unsur pejabat legislatif dan eksekutif serta pimpinan organisasi, sebagai bagian melanjutkan terbinanya

visi masyarakat religius di daerah ini. Israk Mikraj Nabi Muhammad SAW diisi dengan tausyiah disampaikan Al Ustadz Prof. Dr. H. Ramli AbdulWahid guru besar IAIN Sumatera Utara yang mengisahkan tentang kisah Israk Mikraj Nabi Muhammad SAW yang intinya perintah kepada seluruh umat Islam untuk menjalankan sholat lima waktu dalam kehidupan sehari-hari serta mentauladani sifat-sifat Rasulullah SAW. (a01)

Waspada / Ibnu Kasir

WAKIL Bupati Langkat Drs. H. Sulistianto M. Si ketika memberikan bantuan kepada pengurus LPTQ Kab. Langkat pada peringatan Israk Mikraj Nabi Muhammad SAW 1435 H di Serambi Jentera Malay rumah dinas bupati di Stabat.


PENGURUS PAC PP Percut Seituan diabadikan bersama masyarakat dan pengurus mushola usai penyerahan bantuan.

Umat Islam Laporkan Pelaku Penyebar Majalah Ke FKUB BESITANG (Waspada): Masyarakat Kel. Kampunglama, Kec. Besitang, Kab. Langkat melaporkan pelaku penyebar majalah yang bertentangan dengan ajaran Islam kepada Ketua Forum Kerukunan Umat Beragama (FKUB) Langkat. Dalam surat laporan disebutkan, dua oknum wanita memberikan majalah “Menara Pengawal” dengan mendatangi warga muslim dari rumah ke rumah. Kedua oknum ini memberikan majalah tersebut seraya meminta warga untuk membaca sekaligus memahami makananya. Masyarakat muslim di Lingk IV, Kel. Kampunglama, menyampaikan protes serta rasa keberatan mereka atas penyebaran majalah tersebut kepada umat Islam. Tindakan pelaku dianggap telah mungusik ketenangan warga dan jika tidak segera disikapi dikhawatirkan dapat memunculkan gejolak SARA.

Diantarawargayangmenandatangikeberatan atas penyebaran majalah, yakni Ka. Ling VI, Salamuddi, M. Ridwan, Spd.I, Ismail, Spd.I, Periedian, SHI, Dram Idawai, Darmansyah, SHI, Ardiansyah, SHI, Ismaliana, Spd, Sonia Noviriandari, Spd, Taufik, SE, Ir. Bustamamn dan Syafrida, Spd. Anggota FKUB Langkat, Rusmanto dikonfirmasi Waspada, Sabtu (7/6) menyatakan, sesuai hasil konfirmasi yang dilakukannya dengan beberapa pendeta, aliranYehua atau Saksi Jahoba dinyatakan sesat dan mereka tidak terdaftar di Persatuan Gereja Indonesia (PGI). “Aliran Saksi Jahoba ini hanya terdaftar di Badan Koordinasi Aliran Kepercayaan (Bakorpakem),” ujar mantan Ketua MUI Besitang itu seraya menegaskan, dalam waktu dekat ini FKUB akan menggelar rapat untuk menindaklanjutilapoporanmasyarakatyangresah atas peredaran majalah ini. (a02)

Sumatera Utara

B6 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

KOTAPINANG (Waspada): Pembentukan Provinsi Pantai Timur Sumatera dipandang perlu. Karena, efektifnya pemekaran daerah memperpendek rentang kendali birokrasi dan mempercepat pembangunan cukup dirasakan masyarakat, sehingga aspirasi untuk pemekaran daerah terus disuarakan oleh masyarakat. HalitudiungkapkanBupatiLabusel,H.Wildan Aswan Tanjung, SH, MM di hadapan para lurah dankepaladesase-Kab.Labusel,ketikamenghadiri Rapat Pembahasan Usul Pembentukan Provinsi SumateraPantaiTimuryangdigelardiAulaKantor Bupati Labusel, Senin (11/6). Bupati menyebutkan, pemekaran wilayah dipandang sebagai terobosan untuk memperce-

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta).

Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Efendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Efendi, Hamdani, Rizky Rayanda. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra, Agustian Akhmad. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Munawardi Ismail, (Koordinator Liputan) Muhammad Zairin, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan


SALAH seorang simpatisan memberikan tanda tangan di Spanduk dukung Prabowo - Hatta.

Prabowo-Hatta Pilihan Anak Otomotif Asahan KISARAN (Waspada): Anak otomotif yang tergabung dalam Rival Tim Kab. Asahan, dengan sukarela mendukung Prabowo Subianto-Hatta Rajasa menjadi Presiden RI ke-7, dengan mengumpulkan tanda tangan di spanduk berukuran 2 kali 10 meter. Dukungan itu diberikan dengan sukarela dan dengan biaya sendiri membuat spanduk ukuran 2 kali 10 meter di Jalan Diponegoro. Akibatnya, aksi sini banyak menarik simpatisan dari berbagai kalangan, mulai dari kalangan remaja, dan tokoh masyarakat dari berbagai daerah yang melintasi jalan tersebut. “Ini adalah gerakan hati, dan tanpa dikomandoi dari pihak manapun.Karenakamimenilai,Prabowo-Hattayanglayakmemimpinnegeri ini dengan tegas dan dapat mengembalikan martabat Indonesia,” jelas Koordinator Simpatisan Anak Otomotif Rival Tim Asahan Heri Koces Manurung, saat berbincang dengan Waspada, Selasa (10/6). Koces menuturkan, spanduk pengumpulan tandatangan ini telah dipasang hampir sepekan, dan lebih kurang sudah ada 2.000 tanda tangan lebih yang memberikan dukungan. “Spanduk ini akan terus dipasang sampai penuh tandatangan dukungan. Dan spanduk ini akan kami kirimkan ke Tim Kampanye Prabowo-Hatta Provinsi Sumut,” jelas Koces, didampingi tim penggerak Boim,Wan Jak, Kewell, Khairuddin, Rivai Sitorus, Nico,Cai, dan rekan-rekan lainnya. (a15)

Kamis 12 Juni 2014

Pembentukan Provinsi Pantai Timur Sumatera Perlu


Redaktur Pelaksana Opini, Artikel & Agama: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: H.Akmal AZ Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Efendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); ; T. Junaidi (Hiburan); Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret).


pat pembangunan melalui peningkatan kualitas dan kemudahan memperoleh pelayanan bagi masyarakat. “Pemekaran wilayah juga merupakan bagian dari upaya untuk meningkatkan kemampuan pemerintah daerah dalam memperpendek rentang kendali pemerintah, sehingga meningkatkan efektifitas penyelenggaraan pemerintah dan pengelolaan pembangunan,” katanya. Di tempat serupa Sekdakab Labusel, Zulkifli menjelaskan, perlu adanya sentuhan pembangunan di Pantai Timur Sumatera Utara. Karenanya, kata dia, perlu dikaji pembentukan Provinsi Pantai Timur Sumatera yang merupakan pemekaran Provinsi Sumatera Utara. (c18)

Koramil Se-Labusel Gelar Baksos Waspada/Ist

SALAH satu korban tewas tabrak lari saat dievakuasi warga dari TKP Jalinsum KM 63-64 Dusun IV, Desa Pon, Kec. Sei Bamban, Kab. Sergai, Selasa (10/6) malam.

Dua Warga Sergai Tewas Tabrak Lari SEIBAMBAN (Waspada): Dua warga Dusun II, Desa Pon, Kec.Sei Bamban, Kab.Serdang Bedagai, Ramses Manik,4 3, dan S. Purba, 40 , tewas di lokasi kejadian dengan kondisi mengenaskan setelah menjadi korban tabrak lari, Selasa (10/6) malam sekira pukul 23:30 di Jalinsum KM 63-64 di depan mushala Nur Sa’adah Dusun IV di desa yang sama. Informasi dihimpun Waspada diKepolisianmenyebutkan, kedua korban yang mengendarai sepeda motor Vega R BK 2749 NAA setiba di lokasi kejadian diduga langsung ditabrak truk Colt Diesel yang datang dari arah Tebingtinggi menuju Medan.

Setelah kejadian, truk tersebut langsung melarikan diri, dugaan tersebut dikuatkan dengan tertinggalnya bagian bumper depan truk berwarna kuning. Akibat tabrakan tersebut sepeda motor terlempar, sedangkan kedua tubuh korban di bagian

kepala terlindas dengan luka mengenaskan. Petugas Pos Lantas Sei Bamban yang tiba dilokasi kejadian dibantu warga sekitar mengevakuasi korban ke RSU Melati Desa Pon dan mengamankan sepeda motorberikutbarangbuktibagian bumper depan truk yang tertinggal ke Mapos Lantas Sei Bamban. Kasat Lantas Polres Sergai, AKP.SoyaLatoPurnaketikadikonfirmasi Waspada, Rabu (11/6) membenarkan peristiwa tabrak lari tersebut dan pihaknya tengah menangani perkaranya. (c03)

Anak Pejabat T. Balai Nyaris Tabrak Polantas TANJUNGBALAI (Waspada): Dua anggota Polantas Polres Tanjungbalai nyaris ditabrak mobil dinas plat hitam BK 1056 Q yang dikemudikan anak oknum pejabat eselon II di Kota Tanjungbalai. Peristiwa itu terjadi tatkala kedua Polantas itu hendak menghentikan mobil tersebut karena melanggar peraturan lalu lintas dengan menerobos verboden di Jalan SM Raja Kota Tanjungbalai.Bukannyaberhenti, pengemudiyangdiketahuimasih di bawah umur, malah kabur dan

hampir menabrak Polantas. “Benar ada dua personil kita yang nyaris ditabrak pengemudi mobil BK 1056 Q,” ujar Kasat Lantas Polres Tanjungbalai Gali AtmajayadidampingiBaurTilang Aipda Ponimin kepada wartawan di ruang kerjanya Selasa (10/6). Menurut Atmajaya, pengemudi diduga takut sehingga langsung tancap gas tanpa menghiraukan keselamatan personil Polantas. Begitu melarikan diri, lanjut Atmajaya, dua personil Lantas langsung mengejar dan berhasil mengamankan mobil Avanza

Nopol BK 1056 Q tersebut yang terjebak jalan macet di Jalan Jenderal Sudirman. Mobil dan pengemudinya langsung digelandang ke Satlantas Polres Tanjungbalai. Saat diperiksa, kata Atmajaya, pengemudi mengaku masih di bawah dan tidak memilik SIM, bahkan STNK mobil pun tidak dibawanya. Pengemudi itu juga menyatakan,mobilyangdibawanya tersebut merupakan kendaraan dinas orangtuanya yang menjabat sebagai Kadis Koperasi danUKMKotaTanjungbalai. (a14)

Aksi Alat Berat Dalam Kawasan Hutan Mangrove LIMAPULUH (Waspada): Aktivitas alat berat berlangsung di dalam kawasan hutan mangrove di pinggir Sungai Batubara, tepatnya Sungai Udang, Desa Mesjid Lama, Kec Talawi guna dialihfungsikan menjadi perkebunan kelapa sawit untuk di usut tuntas. Di samping mencari tahu pemiliklahansebenarnya,apakah telah diusahai pihak salah perusahaanataumilikperorangandan dasar hukum mereka menguasai kawasan hutan yang seharusnya dilindungi dari tindakan perambah. ‘’Ini perlu dilakukan agar kawasan hutan khususnya hutan mangrove dapat terjaga dan terpelihara secara baik dengan menindak tegas setiap pelaku

melakukan pengrusakan maupun mengalihfungsikan tanpa pandang bulu, jika tidak mempunyai dasar hukum yang jelas,’’ tukas sejumlah warga kepada Waspada, terkait aksi alat berat dalam kawasan hutan mangrove. Kawasan hutan kondisinya telah beralihfungsi menjadi areal perkebunan, baik diusahai perusahaanmaupunperorangan,yang disebut telah diperjual belikan oleh pemilik lahan beberapa waktu lalu. ‘Jika benar ini terjadi perlu di usut, sebab kawasan tersebut berada di pinggir sungai atau jalur hijau yang tidak dibenarkan diusahai,apalagisampaidiperjual belikan dan dapat dikenakan sanksi hukum sebagaimana peraturan dan undang-undang ten-

tang hutan,’’ ujar warga, sembari mengatakan pinggir sungai telah ditembokaliasdibentengmaupun dipasangcerocokolehpemiliklahan. Dishutbun setempat diminta untuk turun tangan menindak tegas aksi alat berat, sekaligus untuk menyelusuri dasar surat yang dikuasai pemilik lahan. Camat Talawi Basrah yang kembali dikonfirmasi Waspada melalui telepon mengaku, pihaknya telah meminta laporan Kepala Desa Mesjid Lama. Kepala Dishutbun Kab Batubara,Ir Zainal Manurung yang dihubungi, Rabu (11/6) berjanji untuk turun ke lokasi sekaligus melakukan upaya penindakan atasaksialatberatdalamkawasan hutanmangrovedipinggirSungai Udang. (a13)

Komunitas PSM Sumbang Alquran Untuk Rumah Tahfidz Shohibul Quran MEDAN (Waspada): Komunitas Pejuang Sedekah Mandiri (PSM) serahkan 60 eksemplar Alquran untuk rumah Rumah Tahfidz Shohibul Quran di Jalan St. Iskandar Gg. KH. Sabar Lk. V Mu-tiara, Kisaran, Minggu (8/6). Pengelola Rumah Tahfidz Shohibul Quran Ahmad Fitrio, S.Pd, mengucapkan terimakasih atas sumbangan Alquran dari KomunitasPSMuntukparasantri binaannya. Menurut Rio, panggilan akrabnya, walaupun rumah tahfidz mereka masih menumpang di rumah salah seorang warga setempat dengan fasilitas

yangmasihkurangmemadai,tapi Alhamdulillah saat ini sudah ada 35 anak yang belajar di situ. Rio menjelaskan, beberapa waktu lalu ada seorang donatur yang menyumbangkan sebidang tanah untuk pembangunan rumah tahfidz di tempat tersebut. Saatinisedangdalamtahappembangunan. Rio mengharapkan bantuandarisegenapmasyarakat agar rumah tahfidz ini dapat segera berdiri. Sementara itu perwakilan Komunitas PSMVinanta mengatakan, kegiatan PSM selain kunjungan rutin ke panti asuhan,

PSM juga membuat kegiatan bersifat spontanitas seperti kali ini yaitu mengumpulkan sumbangan sedekah Alquran dan memberikan langsung ke rumah tahfiz yang membutuhkan. Vinanta menambahkan, sebelumnya PSM juga telah melakukan kunjungan ke salahsatupasiendhuafadiRumah Sakit H. Adam Malik Medan. ‘’Kami berharap semakin banyak sumbangan dan sedekah yang bisa disalurkan kepada yang membutuhkan, sesuai dengan slogankamiPenebarManfaatdan Kebaikan,’’ katanya. (rel/ihn)

KOTAPINANG (Waspada): Dalam rangka memperingati Hari Ulang Tahun (HUT) Kodam ke-64, gabungan anggota TNI Komando Rayon Militer (Koramil) se-Kab. Labusel, Rabu (11/6) menggelar bakti sosial. Kegiatan dikordinatori Perwira Penghubung (Pabung) Mayor Inf Rinaldi, Dansub Denpom I-1/5 Cikampak Kapt Jafaruddin, Danramil Kotapinang Kapt Inf M Latif Siregal, Danramil Langgapayung Kapt Inf Rusli, dan Danramil Kampungrakyat Kapt Czi PH Purba. Pelaksanankerjabaktiberupakegiatangotong royong membersihkan saluran drainase tersebut dipusatkan di sepanjang Jalan Temu Tua, Kel. Kotapinang,Kec.Kotapinangyangselamainikerap tergenangbanjir,karenatersumbat.Puluhanpersonil TNI dibantu kader Pemuda Pancasila Kec. Kotapi-

nang,LPPLHKab.LabuseldanpihakKec.Kotapinang bersama-samamengeruksampahdaridalamparit dan membersihkan seluruh saluran air tersebut. “Kegiatan ini digelar dalam rangka HUT Kodam I/BB yang ke-64. Penetapan lokasi untuk kerja bakti ini berdasarkan hasil survey yang dilakukan oleh Danramil se Kab. Labusel. Dari beberapa lokasi yang di survei, ditetapkan di Jalan Temu Tua, karena kawasan ini dianggap paling rawan, sehingga menjadi prioritas untuk dibersihkan,” kata Mayor Inf. Rinaldi. Dikatakan, selain kerja bakti, pihaknya juga melakukan kegiatan donor darah yang dipusatkan di Makodim 0209 LB. Menurutnya, alat untuk donor tersebut saat ini hanya berada di PMI Labuhanbatu. “Donor darah juga dilaksanakan, namun dipusatkan di Makodim,” katanya. (c18)

Iptu Handy Senonugroho Kapolsek Pantai Cermin SEIRAMPAH (Waspada): Iptu. Handy Senonugroho mendapat promosi jabatan sebagai Kapolsek Pantai Cermin, Kab. Serdang Bedagai. Perwira yang sebelumnya bertugas sebagai Kanit Reskrim Polres Binjai, menggantikan AKP Willy Syoufi Muchtar Hasibuan, yang pindah tugas menjabat sebagai Paur SIM Polda Sumut. Serah terima jabatan (Sertijab) kedua perwira digelar, Selasa (10/6) di aula Mapolres setempat dipimpinKapolresSergai,AKBP.BAniesPurnawan SIK dihadiriWaka Polres Sergai, para Kabag, Kasat perwira dan personil di jajaran Polres Sergai, para Kapolsek serta pengurus Bhayangkari Polres Sergai. Kapolres Sergai memberikan apresiasi kepada Kapolsek yang lama atas tugas dan tanggung jawabnya selama ini, diharapkan lebih sukses dalam mengemban tugas dan jabatan yang baru. Sedangkan kepada Kapolsek yang baru, Anis mengucapkan selamat bertugas. (c03)

Waspada/Edi Saputra

KAPOLRES Sergai, AKBP B Anies Purnawan saat memimpin sertijab Kapolsek Pantai Cermin dari AKP.Willy Syoufi Muchtar Hasibuan kepada Iptu. Handy Senonugroho, Selasa (10/6).

Majelis Taklim Percut Wisata Dakwah Ke Tanjungbalai TANJUNGBALAI (Waspada): Sebanyak 520 jamaah MajelisTaklim Kec. Percut Seituan, Kab. Deliserdang, berwisata dakwah ke KotaTanjungbalai Selasa (10/6). Kehadiran mereka di kota kerang, bukan hanya untuk zikir dan tablig akbar, tapi juga silaturahmi dengan seorang ustad yang dulu sering mengisi pengajian di majelis tersebut, yaitu Dr. H. Thamrin Munthe, M.Hum. “Satu-satunya Wali Kota Waspada/Ist yang ustad, cuma di Kota WALI KOTA Tanjungbalai H Thamrin Munthe (tengah) Tanjungbalai yaitu Thamrin Munthe. Beliau ini dulu didampingi Buya KH Amiruddin MS, H Tukarimin Adnan (kedua mengajar kami, dan sekarang dari kanan) dan H Burhan Saragih (kiri) foto bersama pada Tour muridnya mendatangi guru & Dakwah jamaah Majelis Taklim Kantor Camat Percut Seituan untuk mengambil berkah ke Tanjungbalai. khususnya menjelang Ramadan,” kata Koordi- taklimtersebut.KataThamrin,silaturahmiinisangat nator Majelis Taklim Kec. Percut Seituan, bermanfaat karena menumbuhkembangkan rasa H.Tukarimin Adnan di pendopo rumah dinas cinta dan kasih sayang antara sesama. Dia menambahkan, selama menjabat Wali kepala daerah. Para jamaah majelis taklim itu hadir bersama Ketua Umum Majelis ZikirTazkira Kota, Thamrin dan jajarannya berupaya maksimal Sumut Buya KH Amiruddin MS serta jamaah untuk menumbuhkembangkan dakwah di majelis zikir Takzira Pematangsiantar. Hadir di Tanjungbalai, di antaranya pendidikan membaca sana, para alim ulama Kota Tanjungbalai dan danmenghafalAlquranyangjumlahnyamencapai Ketua TP.PKK Tanjungbalai Armaini Jannah serta 400 anak di pendopo rumah dinas, dan Malam Budaya Islam. Kabag Kesos M.Yunan Saragih. Selainitu,kataThamrin,jikadidaerahlainMTQ Pada kesempatan itu, Tukarimin dan para jamaah mendoakan Thamrin Munthe supaya hanya untuk anak-anak hingga dewasa, maka jabatannya meningkat, bahkan bila perlu menjadi di Tanjungbalai ada untuk kalangan Lansia. HaWali Kota Medan. Pernyataan Tukarimin pun diahnya,samasepertiyangdiperolehuntuktingkat langsung diamini oleh ratusan jamaah, termasuk anak-anak dan dewasa. “Juara MTQ tingkat lansia juga mendapatkan sepedamotor, ini kami lakukan pengajian di Tanjungbalai. Sementara itu, Thamrin Munthe menyatakan untuk memotivasi belajar, membaca dan mengkegembiraannya atas kunjungan jamaah majelis amalkan Alquran,” ujar Thamrin Munthe. (a14)

Optimalisasi Produktivitas Sapi Potong Di Labuhanbatu RANTAUPRAPAT (Waspada): Diskanla Kab. Labuhanbatu bekerja sama dengan Balai PembibitanTernak Unggul dan Hijauan PakanTernak (BPTU HPT) Padang Mangatas, Sumbar, melaksanakan kegiatan Optimalisasi Produktivitas Sapi Potong Melalui Sinkronisasi Berahi di Kecamatan Bilah, 12 sampai 26 Mei lalu. “Alokasi kegiatan itu 400 dosis berlangsung dalam dua tahap.Tahap pertama dilakukan mulai 12-16Mei2014,selanjutnyatahapkeduadilakukan

pada tanggal 22-26 Mei 2014”, kata Kadis Kelautan, Perikanan dan Peternakan L.Batu Ir. H. Leo Sunarta, M.MA. Leo Sunarta menjelaskan, dalam budidaya sapi potong, adanya penampilan reproduksi yang optimal adalah hal yang paling menentukan keberhasilan produktivitasnya. Salah satu penampilan reproduksi optimum adalah jarak beranak (calvinginterval)dengankisaran12-15bulanuntuk kondisi peternakan rakyat di Indonesia. (a18)

Seksi Penmad Kemenag DS Gelar Workshop


PENGURUS Komunitas Pejuang Sedekah Mandiri (PSM) berfoto bersama dengan para santri Rumah Tahfidz Shohibul Quran saat menyerahkan bantuan Alquran di Kisaran.

MEDAN (Waspada): Penggunaan dana BOS harus tepat sasaran, efektif dan akuntabel. Demikian antaralain disampaikan Kepala Kantor Kementerian Agama Deliserdang Drs Ilham Pasaribu melalui Seksi Pendidikan Madrasah Dr H Torang Rambe MAg, Minggu (8/6) saat berlangsungnya kegiatan workshop Bantuan Operasional Sekola (BOS) tahun 2014 di Hotel Sultan Medan. Dalam sambutannya, dia berharap agar para kepala madrasah mempedomani petunjuk teknis (Juknis) Bantuan Operasional Sekolah (BOS) yang ada dan mempergunakan BOS sesuai peraturan, sehingga berdaya guna, tepat guna dan akuntabel serta dapat dipertanggungjawabkan. Ditambahkan, tujuan BOS digulirkan pemerintah antaralain untuk membantu operasional sekolah, mengurangi angka putus sekolah, mem-

beri kesempatan pada siswa untuk mengenyam pendidikan serta keberpihakan pemerintah terhadap pendidikan anak bangsa. Dalam kesempatan tersebut, Kakan Kemenag DS juga berharap pada operator Sistem Informasi pada Bagian Perencanaan (EMIS) agar bekerja dengan baik dan sungguh-sungguh sehingga data madrasah bisa terhubung dengan aplikasi dan sistem yang ada.“Tujuan EMIS ini sebagai perumusan kebijakan dan perencanaan,” katanya, seraya menambahkan agar peserta mengikuti kegitan dengan sungguh-sungguh sampai selesai. Workshop tersebut dihadiri 30 peserta terdiri dari kepala madrasah se Kemenag DS dan 30 peserta untuk EMIS terdiri dari operator. Narasumber antaralain, H Solehuddin SH, Drs H Khairul Amani MM, Parida Hanum Ritonga SAg dan Heldina Susi Sag. (m37)

Sumatera Utara

WASPADA Kamis 12 Juni 2014


Massa Mogok Makan Tolak Kenaikan Tarif Air Minum PEMATANGSIANTAR (Waspada): Massa dari Forum Air Hidup Air Untuk Rakyat (Aura) Kota Pematangsiantar, gabungan berbagai elemen masyarakat terdiri Gema Kappi 1966, GP Anshor, PMKRI, Repdem, PSM, SBSI, Pembebasan, KP2H, Foros Kota, Masyarakat Kelurahan Pardomuan, JTR, Eltrans, Forfera dan Warga Tuhan, mengadakan aksi mogok makan untuk menolak kenaikan tarif dasar air minum yang menyengsarakan rakyat.

Aksi mogok makan menolak kenaikan tarif air minum itu dilakukan di pinggir Jalan Merdeka, persisnya di depan kantor Wali KotaPematangsiantar,Selasa(10/ 6) dengan membangun Posko berupa tenda serta membentang spanduk, poster-poster serta selebaran. Mereka juga mengharapkan sumbangan dalam perjuangan mereka dengan meletakkan kotaksumbangandipinggirjalan.

Sekretaris Koordinator Forum Aura Syahri Ramadhan Siregar, SH, didampingi Sukoso WinartodariSBSIyangdihubungi di Posko sore itu menyebutkan, aksiituakandilakukandelapanorang relawan mulai 10 sampai 15 Juni.. KhususJumat(13/6)dilakukandoa bersamauntukMuslimdanMinggu (15/6) untuk Kristiani. Menjawab pertanyaan, Siregar menyatakan aksi sudah ber-

kali-kali dilakukan, tapi tidak ada inisiatif dan kepedulian DPRD. “Kami sangat geram dengan kondisi itu, padahal, sudah ada kajiantentangdasarkenaikantarif air minum itu kami sampaikan ke DPRD, tapi itu pun tidak ditindaklanjuti.DiKomisiIIDPRD, keluhan kami tidak digubris dan kalau ditanya, dijawab dengan berbagai alasan, karena memang tidakadaitikadbaikmereka.”(a30)

Warga Gunungsitoli Resah Isu Culik Anak Ronda Malam Diberlakukan GUNUNGSITOLI (Waspada): Masyarakat Nias, khususnya KotaGunungsitolidansekitarnya, beberapa minggu terakhir menjadi resah akibat maraknya isu maling/penculikan anak-anak. Akibatnya, warga di hampir semua desa terpaksa membentuk dan melakukan ronda malam. Namun demikian, hingga saat ini

belum ada laporan resmi adanya anak-anak yang hilang maupun pelakunyayangberhasilditangkap. Informasi yang berhasil dihimpun Waspada menyebutkan, isu maling/culik anak di Kota Gunungsitoli dan sekitarnya sudah mulai marak beredar sekira sebulan terakhir ini. Beberapa warga di sejumlah desa/kelurahan

DPT Pilpres Di Tapsel 198.035, Di Padangsidimpuan 144.714 P.SIDIMPUAN (Waspada) : Komisi Pemilihan Umum (KPU) Kab.Tapanuli Selatan , Senin (9/6) menetapkan Dafar Pemilih Tetap (DPT) Pemilu Presiden dan Wakil Presiden (Pilpres) 2014 sejumlah 198.035 pemilih terdiri dari 97.209 laki-laki dan 100.826 perempuan. Menciut 2.427 pemilih dibandingkan dengan DPT pemilu legislatif lalu. Penetapan Rekapitulasi DPT Pilres 2014 hasil pemutakhiran tersebut dilakukan melalui rapat pleno terbuka dipimpin Ketua KPU Tapsel Ir. Potan Edy Siregar didampingi Mustar Edi Hutasuhut, SH(DivisiHukum),SyawaluddinLubis,S.Sos(Divisilogistic),Panataran Simajuntak, M.Hum (Divisi Sosialisasi) dan Rafika Nawari, S.Pd, SH (Divisi Teknis).Hadir Bupati Tapsel diwakili Kakan Kesbangpol Linmas Ibrahim Lubis, S.Sos, Panwaslu Tapsel, PPK dan pewakilan tim kampanye Capres. Ketua KPUTapsel mengatakan, jika dibandingkan dengan jumlah pemilih pada Pemilu Legislatif yang mencapai 200.462, berarti terjadi penciutan pemilih sebanyak 2427 akibat berbagai faktor.”Setelah dimutakhirkan, hasilnya DPT Pilpres 2427 pemilih bila dibanding DPT Pileg”, katanya. Di P.Sidimpuan Komisi Pemilihan Umum (KPU) Kota P.Sidimpuan menetapkan Daftar Pemilih Tetap (DPT) Pemilu Presiden dan Wakil Presiden (Pilpres) 2014 sejumlah 144.714 pemilih terdiri dari 69.595 laki-laki dan 75.119 perempuan. Jumlahnya bertambah 2.917 pemilih jika dibandingkan dengan Pemilu Legislatif 141.797 pemilih. “Hanya tim kampanye pasangan no.2 dan seluruh PPK yang hadir dalam penetapan DPT semalam (9/6). Pertambahannya didominasi pemilih pemula 2.311 orang”, kata Ketua KPU Kota P.Sidimpuan, Ahmad Rasid didampingi Divisi Hukum Hatimbulan Siregar dan Divisi Sosialisasi Mukhtar Helmi kepada Waspada, Selasa (10/6) di Kantor KPU, Jalan Kenanga, P.Sidimpuan. Menurut Ketua KPU P.Sidmpuan, DPT yang ditetapkan sesuai dengan jadwal dan tahapan Pemilu Presiden dan Wakil Presiden tahun 2014tersebut sudah final dan tidak akan ada perobahan lagi.”Ini sudah final dan tahapan selanjutnya menunggu DPK (Daftar Pemilih Khusus) sampai 1 Juli,” katanya. (cml)

Prajurit TNI AD Karya Bakti Di P.Siantar PEMATANGSIANTAR (Waspada): Menyambut HUT Kodam I/BB ke-64 tahun 2014, sebanyak 383 prajurit TNI AD dari Korem 022/PT, Rindam I/BB, Yonif 122/TS, Kodim 0207/Sml, Satdisjan dan Minvet, melaksanakan kegiatan karya bhakti pembersihan parit dan sampah di komplek Pasar Horas, RSUD Dr. Djasamen Saragih serta sarana jalan yang ada Kota Pematangsiantar, Rabu (11/6). Kasiter Korem 022/PT Letkol Inf B. Simbolon menjelaskan, kegiatan karya bakti itu, selain menyambut HUT Kodam I/BB ke64tahun2014,jugabertujuanmeningkatkankomunikasisosialdengan masyarakatuntukmewujudkankemanunggalanTNI-Rakyat,sekaligus melaksanakan pembinaan teritorial sebagaimana yang tercantum di dalam tugas pokok TNI. “Dengan harapan, kegiatan karya bakti yang dilaksanakan para prajurititudapatdimanfaatkansebagaisaranauntukberinteraksidengan masyarakat, sekaligus memberikan motivasi kepada masyarakat Pematangsiantar dalam menjaga kebersihan,” ujar Simbolon. “Turut menyaksikan kegiatan karya bakti ini antara lain, Kasiter Korem 022/PT, Kasipers Korem 022/PT dan Dandenkesyah 01.04.01,” sebut Kapenrem 022/PT Mayor Inf. Jhonson Mangasitua Sitorus. (a30)

Waspada/Sy. Nasution

SISWA Kelas X dan XI Madrasah Aliyah Negeri 1 Padangsidimpuan tampak serius mengerjakan soal ujian semester.

119 Siswa MAN 1 P. Sidimpuan Lulus PTN Bebas Testing P. SIDIMPUAN (Waspada): 119 Siswa Madrasah Aliyah Negeri (MAN) 1 Padangsidimpuan lulus ke Perguruan Tinggi Negeri ternama melalui jalur bebas testing pada Tahun Ajaran 2014/2015. Kepala MAN 1 P.Sidimpuan, Dra. Mariana Nasution, Senin (9/ 6), sebelum pelaksanaan ujian semester menjelaskan, siswa yang lulus tersebar di beberapa PTN ternama yakni IPB, USU, Unimed, UNP, Sekolah Tinggi Teknik Nuklir NegeriYogyakarta, UNRI, UNSRI, UIN Sutan Syarif Kasim, UIN Syarif Hidayatullah, IAIN Sumut, UIN Sunan Gunung Jati. Kemudian, IAIN Imam Bonjol, IAIN Bengkulu, UIN AR Raniry Banda Aceh, IAIN Jambi, IAIN Padangsidimpuan, AkademiTeknologi Industri Padang, UniversitasTelkom Bandung, Poltekes Pos Bandung, Politeknik Kesehatan Medan dan Poltek Negeri Riau “Pencapaian prestasi merupakan dari hasil upaya yang dilakukan pihak sekolah di antaranya tumbuhkan sifat disiplin, menertibkan proses belajar mengajar, membentuk kepribadian anak berkarakter,” jelas Mariana Disampaikannya, pada tahun ini terjadi peningkatan cukup signifikan siswa yang lulus di PTN ternama melalui jalur bebas testing dibandingkantahunsebelumnya.Halinimenunjukkan,siswatamatan dari madrasah tidak kalah bersaing dengan sekolah umum. Saat ditanyakan tentang proses ujian semester, Kepala MAN 1 Padangsidimpuan mengatakan, ada 432 siswa yang terdiri kelas X IPA 137 siswa, X IPS 72 siswa, XI IPA berjumlah 140 siswa dan XI IPS 83 siswa. “Metode ujian semester dibuat seperti ujian nasional, hal ini dimaksud agar siswa mampu mengaplikasikan ilmunya saat pelaksanaan UN, dan sebelum pelaksanaan ujian semester, pihak sekolah melakukan les tambahan kepada para siswa” jelasnya. Katanya, dari 432 siswa, ada dua siswa yakni Muhammar dan Lisa Andriani mendapatkan dispensasi dari pihak sekolah, hal ini disebabkan keduanya menjadi duta perwakilan sekolah di Kota Padangsidimpuan dalam ajang Olimpiade Sains Nasional tingkat Provinsi. (a26)

mengakuresahakibatisutersebut yang mengkhawatirkan hal-hal yang tidak diinginkan terjadi kepada anggota keluarganya. KapolresNiasAKBPJuliatPermadiWibowo yang dikonfirmasi, Selasa (10/6), terkait isu yang meresahkanmasyarakattersebut, mengaku pihaknya sudah men-

dengar beredarnya isu dimaksud. Menurutnya, kepolisian terus melakukan upaya pencegahan dengan meningkatkan patrtoli serta melakukan sosialisasi kepadamasyarakatmelaluihimbauan baik siaran radio maupun media massa lainnya bahwa isu tersebut hanya menyesatkan.

Walapun menurut Kapolres Nias, isu tersebut hanya menyesatkan, namun pihaknya telah memberikan himbauan agar warga di masing-masing desa/ kelurahanuntukmembentukdan melaksanakanrondamalamuntuk menjagakamtibmasdilingkungannya masing-masing. (a25)

Jokowi-JK Target 60 Persen Suara P.SIDIMPUAN (Waspada): Tim pemenangan pasangan capres-cawapres Joko WidodoMuhammad Jusuf Kalla (JokowiJK)optimismeraih60persensuara masyarakat Kota Padangsidimpuan (Psp) pada Pemilu Presiden 9 Juli mendatang. “Target kita 60 persen suara sah di kota ini,” kata Ketua Tim Pemenangan Jokowi-JK Kota Padangsidimpuan, Rudi Hemanto, di rapat koordinasi dan konsolidasi pemenangan, sekaligus pengukuhan Relawan Pemenangan Jokowi-JK di Gedung Nasional, Senin kemarin. SekretarisDPCPDIPerjuangan Kota Padangsidimpuan ini yakin target itu tercapai. Apalagi koalisi partai politik Jokowi-JK hingga kini tetap solid dan kompak. Menurut Rudi, Jokowi-JK pilihan tepat untuk memimpin bangsa ini. Hal senada diungkapkan Ketua DPC PDI-Perjuangan,Taty Ariyani Tambunan SH. Katanya, target 60 persen cukup beralasan. Karena koalisi parpol pengusung Jokowi-JK, PDI-P, Hanura, PKB, NasDem, dan PKPI, menduduki 50 persen kursi di DPRD P.Sidimpuan. Berdasarkan hasil Pemilu Legistlatifkemarin,15dari30kursi di DPRD Kota Padangsidimpuan merupakan milik koalisi parpol


TIM pemenangan Capres-Cawapres No.2 untuk Sumatera Utara, HM Yunan Nasution, mengukuhkan Tim Pemenangan JokowiJK Kota Padangsidimpuan. Ketua DPC Partai Hanura pngusung Jokowi-JK. PDI-P 5 kursi, Hanura 5, PKB 3, Partai Kota Padangsidimpuan, Henny NasDem 1 kursi, dan PKPI 1 kursi. Herlina SE.MM, akan berjuang Wakil Ketua DPRD Kota sepenuh tenaga mengerahkan Padangsidimpuan 2009-2014 ini segalapotensiyangdimilikipartai, mengajak semua tim menyatu- demi untuk memenangkan kantekadmemenangkanJokowi- Jokowi-JK di Pilpres nanti. Keyakinan akan pencapaian JK. Demi mewujudkan Indonesia target dan rencana strategi yang yang lebih gemilang. Sementara Ketua Dewan akan dijalankan untuk memeSyuro PKB Sumut, HM Yunan nangkan Jokowi-JK di PadangsiNasution, pada kesempata itu dimpuan juga disampaikan mengatakan, setelah melalui TimbulP.SimanungkalitdariPartai pertimbangan yang sangat ma- NasDemdanGozaliHarahapdari tang, PKB mendukung Capres- PKPI. Juga Ketua Tim Relawan CawapresJokowi-JKuntukPilpres Jokowi-JK Tabagsel, Saiful Jamil Hasibuan. (a27) 2014.

MUI Tambangan Dikukuhkan PANYABUNGAN(Waspada): Dewan Pimpinan Majelis Ulama Indonesia (DP MUI) Kab. Mandailing Natal mengukuhkan dan melantik DP MUI Kec. Tambangan yang baru masa khidmat 2014-2019 di Aula Kantor Camat Tambangan, belum lama ini. Dalamkesempatanitu,Ketua Umum MUI Madina Drs. H. Syamsir mengharapkan DP MUI Kec. Tambangan yang baru agar dapatmeneruskanprogramkerja pengurus sebelumnya dalam

rangka pembinaan umat sesuai Pedoman Dasar dan Pedoman Rumah Tangga MUI dan bisa menjadi mitra yang baik bagi masyarakat Tambangan, Camat dan Unsur Muspika. Camat Tambangan Drs. M. Yunus dalam sambutannya menyatakan kesiapannya bekerjasama dengan MUI yang baru terutama dalam menghadapievenkeagamaanyangakan datang seperti Ramadhan dan Idul Fitri serta mengucapkan terimakasih kepada pengurus

MUI yang lama. Hadir dalam acara tersebut Kakan Kementerian Agama Kab. Mandailing Natal Drs. H. Muksin Batubara, M.Pd, Sekretaris Umum MUI Madina Ahmad Asrin,MAdanBendaharaUmum H. Amir Husin, Ka. KUA Kecamatan Tambangan Fahrur Rozi SH, perwakilan Karang Taruna, UPT Dinas Pendidikan. Susunanpengurusantaralain Ketua Muhammad Ali, Sekretaris Tambat Pandapotan, S. Ag, dan pengurus komisi.(c15)

Tim Penilai Pemprovsu Tinjau Desa Tumpatan LUBUKPAKAM (Waspada): Tim penilai lomba Desa-Kelurahan Terbaik Pemprovsu 2014 melakukanpenilaiankeDesaTumpatan, Kec. Beringin sebagai Desa Terbaik Kab. Deliserdang, di Balai Desa Tumpatan, Selasa (10/6). Kunjungan Tim disambut Wakil Bupati Deliserdang H Zainuddin Mars, Ketua TP PKK Ny Hj Yunita Ashari Tambunan Br Siregar, Wakil Ketua PKK Ny Hj Asdiana Zainuddin Mars Br Nasution,Ketua DharmaWanita Persatuan Ny Hj Titiek Asrin Naim, Staf Ahli Bupati Bidang Pembangunan H Parlaungan Lubis SH, Staf Ahli Bupati Bidang Kemasyarakatam dan SDM Ir DrsYahya Parmonangan, Kaban PMD Darwin Zen S.Sos, Camat Beringin Batara Rifal Harahap S.Sos MSi bersama Muspika, Kepala Desa Tumpatan Supardi beserta perangkat desa serta

Ketua PKK Desa se- Kecamatan Beringin. KunjunganTim Penilai Pemprovsu dipimpin Boby Darmansyah SE.MSi bersama anggota Edwin SH, Muara Harahap, HulmanSubahardanRusmainilangsung melakukan penilaian secara objektif tentang kondisi dan keadaan desa Tumpatan yang merupakan nominasi desa terbaik untuk mengikuti lomba di tingkat nasional, Selain bertatap muka, tim juga melakukan sesi tanya jawab kepada seluruh perangkat desa dan kader-kader desa. Sedangkan yang menjadi fokus penilaian tim di antaranya bagaimana peran kepala desa dalam menjalankan tugas pokok dan fungsinya (Tupoksi) serta tanggungjawab terhadap desa serta upaya dalam mengembangkanusahadanekonomimasyarakat serta menyadarkan

masyarakat apa yang menjadi hak dan kewajiban. Wakil Bupati Deliserdang H Zainuddin Mars menjelaskan Desa Tumpatan Kec. Beringin merupakan desa yang sangat dekat dengan lokasi Bandara Kuala Namu,Internasional Airport (KNIA) sehingga desa ini menjadi salahsatu jalur utama menuju Bandara. Jadi jelasnya, sebut Pak Zai sapaan akrabWabup Deliserdang ini, keberadaan desa Tumpatan sangat diperhitungkan menjadi juara serta menjadi salahsatu contoh bagi desa-desa yang lain. Pada kesempatan itu Kepala Desa Tumpatan Supardi memaparkan luas Desa Tumpatan 307 ha, pemukiman 61,58 ha, perkotaan 904 m2, jalan 11,662 m2, pertanian 149,70 Ha dengan jumlah penduduk 7.040 jiwa (1.596 KK) tersebar di 8 dusun. (a06/m16)

Waspada/HM Husni Siregar

TIM Penilai Lomba Desa Terbaik Pemprovsu foto bersama Wabup Deliserdang H Zainuddin Mars, Ketua TP PKK Ny Hj Ashari Tambunan Br Siregar, Ny Hj Asdiana Zainuddin dan Kepala Desa usai penilaian di Balai Desa Tumpatan Kec.Beringin, Selasa (10/6).

Waspada/Micky Maliki

TERSANGKA NSG berikut barang bukti sabu sabu yang diapit petugas saat berada di ruang unit Narkoba Polres Tanah Karo.

Pengedar Sabu Dan Pemain Judi Domino Diringkus Polisi KABANJAHE(Waspada): Tim Sat Narkoba dan Reskrim Polres Tanah Karo kembali mengamankan seorang tersangka pengedar sabu sabu berikut barang buktinya dan empat pemain judi di lokasi berbeda ,(11/6). Penangkapan tersangka pengedar sabu sabu di wilayah hukum Polres Tanah Karo, dalam sepekan terakhir mulai mengalami peningkatan. Bukan hanya pemakai melainkan para pengedarnya seperti yang dialami tersangka NSG, 27, warga Kelurahan Lau Cimbah, Gang Ikan Mas, Kec. Kabanjahe saat sedang memaketkan sabusabusebanyaksembilanpaketdiperumahan Tigan Kabanjahe Dalam aksinya, tersangka yang diketahui sering melakukan peredaran narkoba, saat diamankan petugas sempat mencoba melarikan diri. Namun usahanya gagal akibat petugas dengan sigap segera mengamankanya berikut barang buktinya. Kasat Narkoba AKP Syarifuddin SH didamping Kanit 1 Ipda S Sigalingging SH dan Kanit 2 Aiptu Dokan SH, saat ekspos di ruang unit

narkoba mengaku, pihaknya sebelumnya telah mendapatkan laporan dari masyarakat tetang aksi tersangka pengedar sabu sabu yang sering beroperasi di sekitar Kabanjahe dan tersangka juga di ketahui sangat hati hati dalam menjalankan peredaran narkoba di lokasi tempat tersangka diamankan. Di unit Reskrim Polres Tanah Karo, timsus, yang dipimpin Kanit Judisila Ipda Barus, kembali mengamankan empat tersangka yang didapati sedang asik bermain kartu domino dalam sebuah warung kopi di Desa Sukarame, Kec. Tigapanah. Keempat tersangka HS, 22, EG, 22, CST, 19, dan AS, 17. Keempatnya, warga Desa Sukarame, Kec. Tiga Panah, dan dari tangan keempat tersangka petugas kembali mengamankan 1 set kartu domino dan uang Rp 208 ribu. Kapolres Tanah Karo AKBP ATB Sianipar SH Sik melalui Kasatreskrim AKP T Alvian SH Sik didamping Kanit Judisila Ipda Barus SH membenarkan pihaknya telah mengamankan empat pemain berikut barang buktinya 1 set kartu domino dan uang Rp 208 ribu. (c10)

Ormas Dan LSM Di Samosir Tidak Pernah Dapat Dana Hibah SAMOSIR (Waspada): Dalam mensukseskan pembangunan, masyarakat sangat perlu diikut sertakan sebagai subjek dan objek pembangunan, di mana keikutsertaan masyarakat dilakukan melalui Organisasi Kemasyarakat dan Lembaga Swadaya Masyarkat (LSM). Hal ini sesuai amanat Undang-Undang Nomor 17 tahun 2013 tentang Ormas. Melalui Sosialisasi UU Keorganisasian, yang digelar Kesbang Pol Pemkab Samosir, Selasa (10/6), di Hotel Dainang yang dihadiri Narasumber Kabid PembinaanPolitikBadanKesbangPolDanLinmas Provsu Ahmad Hutasuhut dan pengurus LSM

dan Ormas. Disebutkan,bahwaorganisasiKemasyarakatan didirikan dan dibentuk masyarakat secara sukarela berdasarkan kesamaan aspirasi dan tujuan untuk berpartisipasi dalam pembangunan demi tercapainyatujuanNKRIyangberdasarkanPancasila. Kakankesbang Kab Samosir Kitman Malau mengatakan, Pemkab Samosir belum pernah menyalurkan bantuan dana hibah maupun sosial kepada Ormas dan LSM. Berbagai cara dan alasan telahdiusulkandalampengajuananggaran,namun hal ini tidak mendapat tanggapan dari DPRD Samosir. (c11)

BKD Palas Dituding Abaikan PP 56/2012 SIBUHUAN (Waspada): Badan Kepegawaian Daerah (BKD) Padanglawas (Palas) dinilai mengabaikanPP56Tahun2012untukmeluluskan sejumlah Bidan PegawaiTidakTetap (Bidan PTT) menjadi CPNS dari honorer katagori dua (K2) Direktur Exekutif Padanglawas Institute, SaharudidinSahalaHasibuanSHmengungkapkan hal itu di Sibuhuan, Senin (9/6). Katanya, penilaian itu berdasarkan kelulusan enam orang (bukan lima)BidanPTTsebagaihonorerK2Palas,padahal persyaratan berkas yang diajukan jelas menyalahi aturan. Kata Sahala, PP 56 Tahun 2012 yang menjadi payung hukum pengangkatan tenaga honorer K2 menjadi CPNS menyebutkan, tenaga honorer yang diangkat harus penghasilannya bukan berasal dari APBN atau APBD. Sementara bidan PTT diangkat berdasarkan SK Kementerian Kesehatan (Kemenkes) No. 7 tahun 2013. Secara aturan, status bidan PTT tersebut dipekerjakan oleh pemerintah pusat, hanya wilayah kerjanya di Padanglawas. Selain itu mereka masih terikat kontrak kerja dengan pemerintah pusat. Untuk itu, Saharuddin Sahala meminta aparat kepolisian maupun pihak kejaksaan agar segera menangani adanya kemungkinanan dugaan tindakan korupsi dalam proses pemberkasan dan persyaratan ujian seleksi tersebut. Secara terpisah Ketua LSM Perwammi Palas Iwan Lubis mengatakan, para bidan PTT yang lulus sebagai CPNS honorer K2 tersebut adalah angkatan 14 dan hal itu, kata dia, diakui Bagian Umum Dinas Kesehatan Palas, dimana pengakuan tersebut diakui secara tertulis dan dibubuhi stempel dinas. Dalam kesempatan itu, Iwan juga memper-

tanyakan keenam orang Bidan PTT yang lulus tersebut, menurutnya kalau memang bisa dari Bidan PTT kenapa tidak seluruh bidan PTT yang telah mengabdi turut diajukan agar tidak menimbulkan kecumburuan sosial. Sekretaris BKD Amid Hadi Nasution SH, yang dijumpai dikantornya mengatakan seluruh pemberkasan honorer K2 ditangani Kabid Penram yangsaatitudijabatolehWiskanWardanaHasibuan. “Kamitidaktahusoalitu,karenayangmengurus berkas dan listing ujian adalah Saudara Wiskan sendiri, sedangkan yang kami ikuti hanya setelah adanya ferivikasi itupun karena penugasan dari pimpinan,” terang Amid. Wiskan Wardana Hasibuan yang dijumpai di Desa Paringgonan, Selasa (10/6), membantah dia mengacuhkan PP 56 tahun 2012 saat pengumpulan berkas untuk ujian seleksi Honorer K2. Dia juga membenarkan adanya Bidan PTT yang lulus sebagai tenaga honorer K2, namun para bidan itu sebelumnya telah menjadi tenaga honor yang penghasilannya bukan berasal dari APBN atau APBD. Kemudian setelah itu mereka menjadi Bidan PTT. Katanya, Surat Edaran Menpan nomor 03 tahun2012merupakanacuanpenyusunanberkas, dimana SE tersebut menyatakan syarat mengikuti seleksi honorer K2 adalah telah mengabdi selama setahun dengan gaji non APBN atau APBD pada 31 Desember 2005 yang dibuktikan dengan SK. Disinggung mengenai SK yang berkelanjutan tanpa terputus-putus, menurut Wiskan hal itu adalahbutirselanjutnya.“Pokoknyaseluruhproses pendataan dan pengumpulan berkas telah sesuai dengan mekanisme peraturan dan perundangundangan yang berlaku dan saya menjamin hal itu,” jelas Wiskan. (a34)


Disdik Sibolga Lamban Cairkan Dana Sertifikasi SIBOLGA (Waspada): Belum dicairkannya dana setifikasi sekira 50 orang guru dan pengawas di lingkungan Dinas Pendidikan kota Sibolga, ternyata Dinas Pendidikan yang dinilai lamban untuk memprosesnya. Sementara Dinas PKAD (PengelolaKeuangandanAsetDaerah)menunggu proses administrasi dari Dinas Pendidikan. “Setelah kita telusuri ke Dinas PKAD, ternyata DinasPendidikanyanglambanuntukmemproses administrasi seperti SPM (Surat Perintah Membayar). Padahal, Dinas PKAD telah menunggu proses itu dan mereka selalu siap untuk menindak lanjutinya,” kata Muhammad Yazid SPd MAP, Ketua LKBH (Lembaga Kehormatan dan Bantuan Hukum) PGRI Kota Sibolga kepadaWaspada, Selasa (10/6). Disebutkannya, sedikitnya ada 50 orang yang saat ini menunggu pencairan dana tersebut dan telah keluar SK Dirjen Dasar dan Menengah Kemendikbud dan telah diperintahkan untuk membayarkannya. “Secara hitungan kasar ada 50 guru dan pengawas yang belum dibayarkan, jika dikalikan dengan rata-rata Rp 9 juta per orang, maka ada

sekiraRp950jutayangbelumdibayar,”ujarmantan kepala sekolah berprestasi tingkat nasional itu yang didampingi beberapa orang pengawas di lingkungan Dinas Pendidikan. Sementara itu, penelusuran Waspada di Dinas PKAD,pihaknyaselalusiapmenindaklanjutiproses pencairan dana sertifikasi itu.”Seperti kemaren, kalau ada proses dari Dinas Pendidikan, kita langsung menindaklanjuti dan sebagian besar telah dicairkan. Jadi, kalau ada pengajuan dari Dinas Pendidikan, kita akan segera menindaklanjutinya,” ucap beberapa PNS di Dinas PKAD yang tak sudi dipublikasikan namanya. KadisPendidikanKotaSibolgaAlfianHutauruk melalui pesan singkatnya masuk ke Waspada menyatakan, ada beberapa orang yang terlambat masuk SK Dirjend. “Kita akan mencairkannya pada tahap kedua nanti. Kita meminta para rekan pengawas SD dan SMP yang belum dibayarkan untuk bersabar,” kataKadisPendidikantanpamenyebutkantanggal pastikapanakandiprosespencairandanasertifikasi yang sangat diharapkan para guru dan pengawas itu. (cpol)


Intoleransi Karena Inkonstitusi H. Erwan Efendi PEMERINTAH terus melakukan berbagai upaya untuk menciptakan kerukunan nasional sebagai mana dicita-citakan oleh UUD 1945. Diawali lahirnya Surat Keputusan Bersama Menteri Agama dan Menteri Dalam Negeri Nomor 1 Tahun 1969 yang kemudian direvisi dan melahirkan SKB Nomor 9 dan 8 tahun 2006 tentang Pedoman Pelaksanaan Tugas Kepala Daerah/Wakil Kepala Daerah Dalam Memelihara Kerukunan Umat Beragama, Pemberdayaan Forum Kerukunan Umat Beragama dan Pendirian Rumah Iba-dat. Pembuatan PBM tersebut melibatkan Majelis Ulama Indonesia (MUI), Persekutuan Gerejagereja di Indonesia (PGI), Konfrensi Wali Gereja (KWI) Parisadha Hindu Dharma Indonesia (PHDI) dan Perwakilan Umat Buddha Indonesia (WALUBI) dan menyetujui lahirnya PBM tersebut. Keterlibatan pemerintah dalam konteks ini bukanlah doktrin agama yang merupakan kewenangan masing-masing agama melainkan hak yang terkait dengan lalulintas para pemeluk agama yang juga warga negara Indonesia ketika mereka bertemu sesama warga negara Indonesia pemeluk agama lain dalam mengamalkan ajaran agama mereka. Karena itu, pengaturan ini sama sekali tidak mengurangi kebebasan beragama sebagaimana disebut dalam Pasal 29 UUD 1945. Harus pula dipahami bahwa beribadat dan membangun ru-mah ibadat adalah dua hal yang berbeda. Beribadat merupakan ekspresi keagamaan seseorang kepada Tuhan Yang Maha Esa. Sedangkan membangun rumah ibadat tindakan yang berhu-bungan dengan warga negara lainnya karena kepemilikan, kedeka-tan lokasi dan sebagainya. Karena itu, prinsip yang dianut dalam peraturan bersama adalah bahwa pendirian sebuah rumah ibadat harus memenuhi peraturan perundang-udangan. Kemudian dalam waktu yang sama harus tetap menjaga ketenteraman serta ketertiban masyarakat. Ironisnya, masih ada komunitas agama di negeri ini yang belum menerima sepenuhnya kehadiran PBM Nomor 9 dan 8 tahun 2006 dengan alasan bahwa pemerintah tidak boleh terlibat dalam pengaturan pelaksanaan ibadat dalam bentuk apapun, terutama pendirian rumah ibadat. Dengan alasan itu, mereka membangun tempat ibadat sesuai kehendak dan keinginan, karena beranggapan di manapun di atas bumi Tuhan boleh melaksanakan ibadat dan olehkarenaitutidakbolehadayangmenghalangi,meskipunmengabaikan peraturan, kondusifitas dan harmonitas antar umat beragama. Forum Kerukunan Umat Beragama (FKUB) Sumatera Utara mencatat kasus yang mengusik kerukunan antar umat beragama paling banyak adalah masalah pendirian rumah ibadat seperti; tidak memenuhi syarat, rumah tempat tinggal yang dijadikan rumah ibadat, balai pengobatan merangkap tempat ibadat, pendirian rumah ibadat di tengah-tengah pemukiman umat beragama lain. Dalam hal ini panitia pembangunan cenderung melakukan pemaksaan meskipun tidak memenuhi ketentuan. Keadaan itu mengundang lahirnya kelompok yang ingin menegakkan peraturan setelah tidak berhasil melakukan berbagai pendekatan. Mereka inilah disebut-sebut intoleransi. Jadi, intoleransi lahir bukan tanpa alasan, tetapi kerena tuntutan tindakan inkonstitusi. Jika mencermati berbagi persoalan pembangunan rumah ibadat yang muncul ke permukaan, sesungguhnya pemaksaan pendirian tanpa memenuhi syarat bukanlah murni karena tuntutan agama. Jika berdasarkan agama, pemaksaan tentu tidak akan pernah terjadi, karena hampir semua agama menganjurkan kebaikan dan tidak boleh ada pemaksaan. Justru, kita khawatir dalam hal ini ada semacam skenario kepentingan global yang ikut bermain dan bertujuan untuk mengusik kondusifitas dan harmonitas antar umat beragama yang sudang terbangun dengan baik. Tentunya, sebagai bangsa yang bermartabat, kita tidak ingin ada yang melawan kebijakan negara dengan memaksakan kehendak apa lagi disusupi kepentingan asing, karena itu dapat dianggap anarkhis. Pemerintah tidak pernah bersikap toleran terhadap siapapun yang melakukan tindakan anarkhis, karena hal itu akan sangat membahayakan terhadap keutuhan Pancasila sebagai landasan berbangsa dan bernegara dan Negara Kesatuan Republik Indonesia (NKRI). Tindakan melawan hukum dalam pendirian rumah ibadat bukan hanya berdampak pada diri sendiri, tapi juga terganggunya ketenangan dan kenyamanan orang lain. Jika hal itu terjadi, wajar saja kalau yang merasa terganggu juga bertindak sekaligus membantu pemerintah dalam menegakan peraturan.Tetapi, bukan berarti kita setuju dengan tindakan main hakim sendiri. Sebaiknya, jika ada persoalan yang menyangkut hukum harus dibicarakan secara hukum, sehingga kita menjadi bangsa yang taat hukum. Semoga.

SOSOK Wildan: Wujudkan DEMA IAIN SU ASIK Wildan Ansori Hasibuan, putra kelaihran Desa Hutaraja Lamo Kec. Sosa Kabupaten Padang Lawas, 22 Januari 1991, terpilih menjadi Ketua Dewan Eksekutif Mahasiswa (DEMA) IAIN-SU 2014-2015. Anak ke 5 dari 9 bersaudara, putra dari pasangan Pangihutan Hasibuan dan Mahyar Diana Dalimunthe dan merupakan keponakan dari guru besar IAIN-SU Prof. Dr. H. Syukur Kholil Dalimunthe, MA, dari jurusan Manajemen Dakwah Fakultas Dakwah dan Komunikasi terpilih melalui pemilihan parlemen yaitu delegasi dari setiap Himpunan Mahasiswa Jurusan (HMJ) dilingkungan IAIN-SU, Senin (2/6). Di lapangan futsal IAINSU yang dihadiri olehWakil Rektor III Prof. Dr. Ilhamuddin Nasution, MA dan panitia pengawas pemilihan DEMA. Mahasiswa asal putra asli Padang Lawas ini ingin mewujudkan DEMA IAIN-SU yang ASIK (Aspiratif, Solutif, Inklusif,dan Kontributif) dan itu tidak akan bisa dilaksanakan tanpa kerjasama yang baik dengan seluruh UKK-UKM di Lingkungan IAIN-SU. Wildan memulai pendidikan formalnya di SDN Hutaraja Lamo dan lulus tahun 2004. Kemudian selanjutnya menempuh pendidikan di SMP N 1 SOSA Kabupaten Padang Lawas dan lulus tahun 2007. Selanjutnya masuk di Sekolah Menengah Atas (SMA) Negeri 1 Sosa dan lulus pada tahun 2010. Pada tahun yang sama, terdaftar sebagai mahasiswa pada Program Studi Manajemen Dakwah Fakultas Dakwah dan Komunikasi Institut Agama Islam Negeri Sumatera Utara.(m26)

Iqbal Lulus Jalur Undangan Ke Unsyiah MEDAN (Waspada): Iqbal Fahri Tobing, 17, (foto) lulus melalui jalur undangan masuk di Universitas Syiah Kuala (Unsyiah) pada Jurusan Teknik Pertanian. Anak dari pasangan H.Wirman Tobing dan Dra. Hj. Hariyawati Pohan yang memiliki hobi mendaki gunung ini telah banyak mengikuti berbagai organisasi seperti Pelajar Islam Indonesia (PII). Bahkan pernah ke Jakarta mengikuti konfrensi anak. Lulusan SAMN 3 Medan ini mengawali pendidikannya di SD Centre 060879 (2007), SMP Swasta Pertiwi (2010) paling senang mendaki gunungsibayak. Wirman Tobing yang juga dosen Fakultas Ushuluddin IAIN Sumut dan Ketua DPW Gerakan Peduli Anti Narkoba dan Tawuran (GPENTA) Sumatera Utara, merasa bahagia dan senang atas kelulusan Iqbal. “Saya bangga sebagai siswa Smanting Medan dibawa bimbingan Drs. H. Sahlan Daulay, Drs. H. Abdul Hafiz, MM dan wali kelas yang Wirman cintai Ibu Desi Siantuiri yang telah membimbing Iqbal hingga lulus jalur undangan.(m26)


WASPADA Kamis 12 Juni 2014

STAIS Wisuda 267 Sarjana

Kopertais: Mahasiswa Harus Mampu Jadi Pemikir MEDAN (Waspada): Koordonator Perguruan Tinggi Agama Islam (Kopertais) Wilayah IX mengingatkan bahwa sesungguhnya mahasiswa adalah para pemikir untuk melahirkan berbagai pembaharuan menuju kemajuan. “Para mahasiswa harus melakukan perubahan para digma, sehingga tidak terperangkap dalam cara berfikir tradisional tapi harus generig”, kata Sekretaris Kopertais Wilayah IX Dr. Ansari Yamamah, MA pada wisuda sarjana XXII Sekolah Tinggi Agama Islam (STAI) Sumatera Medan di Hotel Madani Medan, Rabu (11/6). Sebagai pemikir, mahasiswa harus mampu menjawab berbagai persoalan bangsa, khususnya umat Islam. Mahasiswa juga harus banyak melakukan berbagai penelitian dalam bidang

keilmuan. Menurut Ansari, bangsa yang besar adalah bangsa dimana di dalamnya ada para pemikir dan peneliti serta penemuan-penemuan bagi pembaharuan seperti Jepang dan negara lain. Mengingat hal itu, pendidikan merupakan salah satu solusi untuk memecahkan berbagai persoalan dan melahirkan manusia yang berkarakter mulia. Ansari juga menekankan sepenuhnya bahwa kita semua khususnya mahasiswa harus mengubah paradigma demi kemajuan. Bangsa Indonesia saat ini masih memerlukan para pemikir-pemikir yang mampu membawa bangsa ini kepada keadaan yang labih baik ke depan. Ketua SekolahTinggi Agama Islam (STAI) Sumatera Medan Drs. Khairuddin, M.Ag menyebutkan, wisuda merupakan momentum penting yang menunjukkan berakhirnya tugas laya-

nan dan asuhan secara formal kepada mahasiswa dalam mengembangkah potensi mahasiswa menjadi insan yang bertaqwa kepada Tuhan Yang Maha Esa. Tidak hanya bertaqwa, lanjut Khairuddin, tapi juga berakhlak mulia, berilmu serta siap mengamalkan ilmu sesuai bidang keahlian serta memiliki kemampuan hidup mandiri. Lebih dari itu, wisuda adalah merupakan peristiwa penting untuk nenandai batas antara tahapan kehidupan belajar di kampus dengan mahasiswa. Sebelumnya Ketua Panitia Wisuda Hotma Tua P. Harahap, M. Ag pada wisuda yang dihadiri staf Konsul Malaysia di Medan Muhammad Azmi Bin Abdul Ali dan staf Konsul Jepang di Medan Kawai Taka Yuki, pengurus yayasan dan para orang tua wisudawan menyebutkan, wisuda ke XXII ini dilakukan terhadap 267 sarjana dari berbagai program studi.(m26)

Waspada Erwan Efendi

PARA anggota Senat pimpinan wisuda antara lain Ketua STAI Sumatera Medan Drs. Khairuddin, M.Ag, Sekretaris Kopertais Wilayah IX Dr. Ansari Yamamah, MA, Ketua Panitia Wisuda Hotma Tua P. Harahap, M. Ag.

FDK IAIN SU Penyelenggara Sertifikasi Manasik Haji MEDAN (Waspada): Sertifikasi Pembimbing Manasik Haji (SPMH) yang dilaksanakan Direktur Jenderal Penyeleng-

garaan Haji dan Umrah Kementerian Agama RI, KantorWilayah Kementerian Agama Sumut dan Fakultas Dakwah dan Komuni-


KEPALA KantorWilayah Kementerian Agama Sumut Drs. H. Abdul Rahim, M.Hum. Dr. H. Abdullah, M.Si. selaku Dekan Fakutas Dakwah dan Komunikasi IAIN Sumatera Utara foto bersama.

Farmasi UMN AW 90 % Diterima Diberbagai Provinsi MEDAN (Waspada): Sejak berdirinya FMIPA Farmasi Universitas Muslim Nusantara Alwasliyah (UMN AW) Medan, hampir 90 persen alumni diterima diberbagai provinsi bukan saja di Sumut tapi juga di Sumbar, P. Jawa bahkan di Universitas Jenderal AhmafYani (Unjani) Bandung mengikuti program pendidikan profesi Apoteker. Dekan Fakultas FMIPA Farmasi UMN Aw Medan Drs. H. Ridwanto, Msi (foto) mengatakan kepada Waspada di ruang Rektor UMN AW Jl.Garu II-A Medan Amplas, Selasa (10/6). Kata Ridwanto, FMIPA Farmasi UMN AW semakin berkembang, terbukti secara keseluruhan terdata 660 mahasiswa bukan saja kalangan wanita tapi yang menggembirakan mulai banyak kalangan pria pun mendaftarkan diri. Karena kalau sudah lulus, optimis mereka akan menjadi apoteker dan saat ini sudah banyak diterima diberbagai rumah sakit di Sumut, Riau dan daerah lainnya. Ini semua tidak terlepas dari FMIPA UMN AW yang memiliki staf pengajar dari berbagai disiplin ilmu serta fasilitas yang lengkap. Adapun prospek kerja antara lain di Dinas Kesehatan, BPOM, Rumah sakit, Puskesmas, Klinik, industry farmasi, wirausaha, PBF (Perdagangan Besar Farmasi), Perapotekan dan staf pengajar. Untuk lebih menjaga eksistensinya, saat ini kita sedang merevisi proses baru disesuaikan dengan pedoman dari Asosiasi Perguruan Tinggi Farmasi

Indonesia (APTFI) dimana kita sudah menjadi anggota APTFI sejak tahun 2013 bahkan sudah mengikuti berbagai kegiatan yang digelar APTFI tersebut. Kedepan, lulusan FMIPA Farmasi UMN AW akan menjadi seorang Farmasis yang utuh dan mampu memberikan kontribusinya di tengah-tengah masyarakat. Sejak dipimpin Rektor Drs.H.Kondar Siregar,MA setiap tahun animo masyarakat masuk FMIPA Farmasi semakin meningkat datang dari luar Sumut apalagi FMIPA Farmasi UMN AW pertama terakreditasi. Guna mewujudkan visi misi, maka FMIPA Farmasi UMN AW terus meningkatkan kualitas mulai dari dosen, SDM serta melakukan penelitian demi terciptanya mahasiswa yang berdaya guna dan berhasil guna. Selain dalam waktu dua kali setahun mengundang pakar, guru besar dibidang farmasi untuk menambah wawasan bagi mahasiswa. Salah satunya kami telah mengundang guru besar farmasi dari Universitas Gajah Mada (UGM) Prof. DR. JokoWahyono Apoteker, katanya.(m24)

kasi IAIN Sumut berlangsung di Asrama Haji Jalan Abdul Haris Nasution Medan selama 10 hari yang dimulai pada tanggal 10 hingga 19 Juni 2014. Sertifikasi Pembimbing Manasik Haji kali ini dibuka secara resmi oleh Kepala Kantor Wilayah Kementerian Agama Sumut Drs. H. Abdul Rahim, M.Hum. Kegiatan ini merupakan angkatan kedua setelah yang pertama dilaksanakan pada Agustus 2013 tahun lalu. Peserta yang ikut sebanyak 100 orang yang berasal dari 5 provinsi di wilayah Sumatera bagian utara (Sumbagut), yakni provinsi Aceh, Sumatera Utara, Riau, Kepulauan Riau, dan Sumatera Barat. Dalam sambutannya, Ka. Kanwil Kemenag Sumut menegaskan bahwa menurut UU No. 13 Tahun 2003 tentang Penyelenggaraan Ibadah Haji khususnya dalam pasal 6 dijelaskan tentang pemerintah berkewajiban melakukan pembinaan, pelayanan, dan perlindungan dengan menyediakan layanan administrasi, bimbingan ibadah haji, akomodasi, transportasi, pelayanan kesehatan, keamanan, dan hal-hal lain yang diperlukan oleh jemaah haji. Terkait dengan tugas pembinaan sebagaimana dalam aturan tersebut, maka pemerintah melakukan pembimbingan manasik haji untuk tingkat kecamatan, yaitu di Kantor Urusan Agama (KUA). Lebih lanjut Ka. Kanwil menyebutkan bahwa penyelenggaraan haji dari tahun ke tahun terus menerus mengalami perbaikan, sehingga terus-menerus semakin baik. Kendati demikian, diakui bahwa dewasa ini penyelenggaraan haji di tanah air sedang mendapat sorotan tajam dari berbagai pihak. Oleh karena itu melalui Sertifikasi Pembimbing Manasik Haji ini

ITM Gelar Baksos MEDAN (Waspada): Untuk mengamalkan Tridharmawa Perguruan Tinggi (PT) Salah satunya yakni pengabdian pada masyarakat, Himpunan Mahasiswa Elektro Institut Teknologi Medan (HME-ITM) melaksanakan Bakti Sosial (Baksos) di Lingkungan I Kelurahan Titik Kuning Kecamatan Medan Johor, kemarin. M Ilham anggota Badan Pengurus Harian HME didampingi Ketua Panitia Baksos Timbul Marino mengatakan, kegiatan baksos itu nantinya akan diisi diantaranya penyuluhan tentang hemat energi, services instalasi listrik kerumah masya-

Kompetensi Bahasa Inggris Mutlak M E D A N ( Wa s p a d a ) : Kompetensi Bahasa Inggris bagi guru, mahasiswa dan pelajar mutlak dimiliki dengan baik, terutama dalam menghadapi era perdagangan bebas Asean atau Masyarakat Ekonomi Asean tahun 2015 mendatang. Kalau kita ketinggalan dalam penguasaan Bahasa Inggris, sedangkan dalam MEA nanti menjadi keharusan, maka bangsa kita harus rela menjadi penonton di negerinya se ndiri. Sebab ketika MEA diberlakukan, maka tenaga kerja dari Asean akan masuk bebas di Indonesia. Demikian disampaikan pimpinan Essential, Mr Mady di ruang kerjanya Jalan Abdullah Lubis Nomor 26-B Medan, Sabtu (7/6). Dia yang menyampaikan itu usai menyerahkan trophy kepada pemenang ujian TOEFL yang dilaksanakan lembaga pendidikan Bahasa Inggris itu mengakui

saat ini masih cukup banyak guru mata pelajaran Bahasa Inggris khususnya yang relatif lemah dalam penguasaan Bahasa Inggris sesuai tuntutan pasar internasional. “Kalaupun relatif lancar berbahasa Inggris, namun kurang memperhatikan aspek tata bahasa(structure),sehinggaketika menulisselalukeliru,”ungkapnya. Oleh karena itu, lanjutnya pemerintah diharapkan dapat mengintegrasikan pola pendidikan Bahasa Inggris ini dalam Kurikulum 2013 yang akan diterapkan pada Tahun Pelajaran 2014/2015 ini. Hal ini semata agar penguasan Bahasa Inggris guru, pelajar, mahasiswa dan masyarakat bisa menjadi lebih baik terutama dalam kesiapan menghadapi era pasar bebas yang telah di ambang pintu. Bahkan setelah MEA, lanjut Mady Indonesia akan berha-

diharapkan dapat dijadikan sebagai salah satu upaya yang dilakukan pihak Kementerian Agama untuk memperbaiki citranya ke arah yang positif. Dr. H. Abdullah, M.Si. selaku Dekan Fakutas Dakwah dan Komunikasi IAIN Sumatera Utara. Dalam pemaparan materi yang dipandu oleh H. Muaz Tanjung, MA ini Dr. H. Abdullah menyampaikan, bahwa berdasarkan Keputusan Direktur Jenderal Penyelenggaraan Haji dan Umrah No. D/134/2014 tentang Pedoman Sertifikasi Pembimbing Manasik Haji dijelaskan sasaran kegiatan ini adalah para pembimbing manasik haji dari unsur PNS di lingkungan Kantor Urusan Agama Kecamatan, Kabupaten/Kota dan Provinsi, dan pembimbing manasik haji swasta baik yang berasal dari tokoh masyarakat, ulama, guru agama, dan pengurus/pembimbing kelompok bimbingan haji. Lebih lanjut, Dr. H. Abdullah, M.Si. mengemukakaan, selama pelatihan para peserta yang mengikuti sertifikasi pembimbing manasik haji diwajibkan mengikuti berbagai kegiatan, yaitu ujian pre-test, proses pembelajaran/penyajian materi, ujian micro-guiding, ujian praktek, tes wawancara, dan post-tes. “Apabila persyaratan administratif telah dilengkapi, kemudian dapat mengikuti penyajian materi minimal 92 JPL, artinya toleransi yang diberikan untuk tidak mengikuti materi maksimal 8 JPL, serta lulus dalam ujian yang ada, maka para peserta berhak mendapatkan sertifikat kelulusan yang ditandatangani oleh pihak Dirjen Penyelenggaraan Haji dan Umrah Kementerian Agama RI dan Rektor IAIN Sumatera Utara”, tambah dekan.(m26)

dapan dengan era perdagangan bebas Ujian TOEFL tidak hanya dengan standar lokal atau institutional Test Prediction (iTP), tapi juga mampu mengikuti tes TOEFL internet Based Test (iBT) dan IELTS. Adapun pemenang test TOEFL Essential yang dilaksanakan tanggal 19 Mei lalu adalah Befry Sembiring nilai 597 mahasiswa Fakultas Hukum USU juara I, Dira Tamirza siswa MAN I Medan dengan nilai 537 juara II, dan Fadia Ramadhana pelajar SMP Negeri 3 Medan dengan nilai 527 juara ketiga. Selanjutnya Siti Syarah Amalia dari MAN 1 Medan nilai 517 juara harapan 1, Rahmi Fitri mahasiswa UMSU semester 8 dengan nilai 510 harapan 2 Suci Annisa Fitriyanti nilai 510 harapan 3 , Mhd Ghofar Triyono nilai 507 dan Tri Astuty nilai 500 ketiganya mahasiswa Fisip USU semester 6. (m26)

rakat dengan cara door to door. dan kegiatan gotong royong berupa pembersihan drainase bekerjasama dengan warga sekitar. Adapun pelaksanaan daripada baksos tersebut, kata Ilham, sudah merupakan program kerja himpunan Mahasiswa Elektro dan sekaligus adalah bentuk pengabdian pada masyarakat. Ditanya HME ITM yang akan berpartisipasi pada kegiatan ini. Menurutnya sampai saat ini tercatat sudah 50 orang yang telah mendaftar dan ikut untuk berpartisipasi, “Kemungkinan jumlah tersebut bisa meningkat, karena masih ada waktu satu hari lagi,” katanya. (m49)

FKIP UNIVA Medan Gelar Seminar Curiculum And Theacher’s Professionalism MEDAN (Waspada): Rektor Universitas Al Washliyah (UNIVA) Medan Ir. H. Aliman Saragih, M.Si membuka acara Seminar dengan tema”The Education Curiculum And Improving The Quality Of Education By Profesionalism Of Teachers” pada hari Kamis tanggal 05 Juni 2014 di AULA UNIVA Medan. Dalam sambutannya beliau menyampaikan” Saat ini pendidikan bahasa Inggris memegang peran penting dalam kehidupan masyarakat global. Bahasa Inggris kini telah diakui publik sebagai bahasa Internasional yang telah berdomisili di berbagai bidang industri yang ada. Baik itu bidang politik, ekonomi, atau pun seni dan budaya. Bahasa Inggris telah menginvasi semua sektor dan mendominasi pop culture society, bahkan mayoritas isi konten dari World Wide Web (www) tertulis dalam bahasa Inggris. Dengan demikian, perlu disadari pentingnya pendidikan bahasa Inggris bagi kita, masyarakat Indonesia, untuk bekal masa depan dan karir yang akan atau pun sedang dijalani. Kini, persaingan global di Indonesia semakin ketat adanya. Dengan dipekerjakannya tenaga-tenaga kerja asing, penduduk kita harus berusaha lebih giat lagi agar dapat berkompetisi dengan para expat tersebut. Kemudian, perusahaan-perusahaan asing yang berinvestasi di Indonesia semakin bertambah banyak, dan tentunya mereka membuka kesempatan bekerja pula di perusahaan mereka, khususnya kepada masyarakat yang bisa berbahasa Inggris. Khusus dengan Seminar kali ini yang membahas tentang kurikulum, pendidikan yang berkualitas maupun guru yang profesional disampaikan dengan berbahasa Inggris oleh Ketrua Organisasi Guru Bahasa Inggris Aceh Tamiang Bapak Edi Salim Chaniago, MS dengan berbagai paparannya akan dapat dihasilkan guru-guru yang profesional terutama dalam bidang Bahasa Ingggris. Sesuai dengan tuntutan perubahan masyarakat, profesi guru juga menuntut profesionalisme. Dalam bidang profesi, seorang guru professional berfungsi untuk mengajar, mendidik, melatih dan melaksanakan penelitian masalah-masalah kependidikan. Dalam bidang kemanusiaan, guru profesional berfungsi sebagai pengganti orang tua khususnya di dalam bidang peningkatan kemampuan intelektual peserta didik. MTQ Nasional 2014 Satu mahasiswa Fakultas Agama Islam (FAI) dan dua Siswa Madrasah Aliyah Muallimin Universitas Al Washliyah (UNIVA) Medan yakni Adnan dari cabang Tilawah Remaja Putra serta Nidaul Husna Khairi dan Anwar Syukri dari cabang Fahmil Qur’an menjadi Duta Sumut pada MTQ nasional di Batam. Rektor Universitas Al Washliyah (UNIVA) Medan Ir. H. Aliman Saragih, M.Si menyambut positif prestasi ini dengan mengatakan “ kami sangat berbangga hati dengan menjadi Duta Sumatera Utara Mahasiswa Fakultas Agama Islam dan siswa MAS Muallimin UNIVA Medan, kami berdo’a mudah-mudahan mereka dapat meraih juara pada MTQ Nasional di Batam”. Sementara itu Dekan Fakultas Agama Islam (FAI) UNIVA Medan yang juga ibunda dari Nidaul Husna Khairi mengatakan “FAI UNIVA Medan mengukir sejarah dengan menjadi duta Sumut pada MTQ Nasional di Batam.


PKS III MAS Muallimin Irwan, S.Pd dan Pelatih Fahmil Qur’an LPTQ UNIVA Medan Supriyadi, S.Pd bersama Juara I Fahmil Qur’an MTQN Sumut di Binjai”.

FP UMA dan Balai Penelitian Sei Putih Teken MoU MEDAN (Waspada): Balai Penelitian Sei Putih dan Fakultas Pertanian Universitas Medan Area menjalin MoU sekaligusKuliahUmum,diConvention Hall Kampus UMA. Jln Kolam, Medan Estate, Selasa (10/6). Penandatanganan kerjasama kedua lembaga itu dilakukan Rektor UMA, Prof.Dr.H.A Yak’ub Matondang, MA serta Head of Sei Putih Research Center Dr.Ir.Sumarmadji, MS. Turut menyaksikan, Wakil Rektor III Dr.Ir Zulheri Noer,MP, Dekan Fakultas Pertanian Dr.Ir Syahbuddin,M.Si, Wakil Direktur Pasca Sarjana, Erwin Pane, Ir Rizal Aziz, Humas Ir.Asmah Indrawaty,MP, Kepala Urusan Pelayanan Hasil Penelitian Ir.Istianto serta ratusan mahasiswa pertanian.Pada kesempatan itu Rektor mengatakan, pengembangan Sumber Daya Manusia dibidang pertanian bisa

memberikan peluang untuk melakukan penelitian dibidang produk unggulan seperti karet. Untuk itu, perlu pembelajaran mencakup berbagai aspek. Bukan hanya tatap muka, tapi punya akses lebih luas dibidang pertanian.Sebagai peningkatan motivasi teknologi pertanian. Kerjasama juga diharapkan mampu melahirkan kebijakan beroriantasi kemajuan dan peningkatan dibidang pertanian . Memberikan rekomendasi kepada pemerintah guna pengembangan teknologi pertanian di tanah air. Sejalan dengan itu, sebut Rektor, UMA telah menerapkan 3 kompetensi. Diantaranya, penerapan keilmuan, kepribadian dan kewirausahaan. “ Salah satunya bergerak dengan cepat menjalin kerjasama dengan berbagai lembaga termasuk Sei Putih tentang perkembangan pertanian,

“ katanya. Kepala BPP Dr.Ir. Sumarmadji, MS pada sambutannya menyebutkan individu atau populasi yang baik secara kultural bisa memberikan kompetensi ilmu. Diterapkan untuk selanjutnya diberdayakan setelah lulus. “ Itu sejalan dengan yang dikatakan rector tentang tiga kompetensi yang dimaksud,” ujarnya. Dengan kompetensi , sambung Madji, bisa meningkat secara linier disertai komitmen untuk tidak menjadi sesuatu yang sederhana . “Pada saat memasuki sebuah system. Sebagai contoh jenjang SD hingga perguruan tinggi. perlu komitmen tinggi. Meskipun diterpa dan goyang. Pada akhirnya akan naik kembali. Kita jangan sampai menjadi individu tanggung yang tidak mencapai komitmen sempurna.(m49)


WASPADA Kamis 12 Juni 2014

Program KB Berhasil, Sekolah Kekurangan Murid TAPAKTUAN (Waspada) : Bupati Aceh Selatan T Sama Indra mengatakan, banyak sekolah dasar di daerahnya, mengalami kekurangan murid, sebagaimana terjadi di sejumlah sekolah dasar di Kecamatan Meukek.

Berdasarkan laporan Kadisdik Aceh Selatan, jumlah sekolah yang kekurangan murid tersebut mencapai dua puluhan. Ini menjadi indikator, di mana program keluarga berencana (KIB) di daerahpenghasilpalaitu,telahberhasil dan berjalan sukses. “Hal ini tercapai berkat kesadaran masyarakat dan dukungan

semuapihak,dalamupayamenekan angka kelahiran dan pertumbuhan penduduk,” kata Bupati Sama Indra pada acara Peningkatan Kesetaraan Kerja Optimalisasi Pelayan KB dan HUT ke21 KB tahun 2014, di Puskesmas

Suak Bakong-Kandang, Kecamatan Kluet Selatan, Aceh Selatan, Selasa (10/6). Menurutnya, upaya mewujudkankeluargasejahteramenjadi sangatpentinggunamenciptakan sumber daya manusia yang ber-

kualitas. Sebab fakta membuktikan, kesuksesan program KB ini,berbandinglurusdengankualitas sumber daya manusia. Sebaliknyajika programKBnya gagal,akanberdampaknegatifbagi kesejahteraan masyarakat. (b30)

Imran Joni Pimpin AJI Langsa LANGSA (Waspada): Imran Joni meraih suara mutlak dalam musyawarah Pemilihan Ketua Aliansi Jurnalis Independen (AJI) Persiapan Langsa, Sabtu (7/6) lalu dibalai hutan Kota Langsa. Imran Joni mengatakan, dimana kepercayaan yang telah diamanatkan kepadanya akan dijalankan semaksimal mungkin terutama dalam menyongsong pengukuhan menjadi AJI Langsa defenitif. “Selain membentuk kepengurusan baru, kita juga akan membenahi semua administrasi dan keanggotaan AJI Langsa,” papar Imran. (cri)

Dishub Razia Angkutan Umum BIREUEN (Waspada): Dinas Perhubungan, Komunikasi, dan Informatika Kabupaten Bireuen melakukan razia kendaraan angkutan umum di jalur lintas Sumatera tepatnya di kawasan Cot Gapu, Selasa (10/6). Razia ini juga dibantu oleh personel Satlantas Polres Bireuen serta anggota Polisi Militer. KabidPerhubunganDarat,LautdanUdaraDinasPerhubungan Bireuen, Said Sulaiman di sela-sela kegiatan ini mengatakan, pada aksi tersebut petugas melakukan razia terhadap kelengkapan surat-surat kendaraan umum. “Bila ada angkutan umum yang tidak dapat menunjukkan surat izin trayek, masa uji layak kendaraan berakhir maka STNK kendaraan ditahan sementara,” katanya. (b17)

Dialog Eksistensi Peran Ulama SUBULUSSALAM (Waspada): Sekira 80 unsur umara, ulama, cendikiawan, tokoh masyarakat, pemuda dan perempuan di Kota Subulussalam mengikuti dialog Eksistensi Peran Ulama Dalam Pembangunan Daerah di Hotel Khairul Syah Subulussalam, Senin-Selasa (9-10/6). Agenda Sekretariat Majelis Permusyawaratan Ulama (MPU) Prov. Aceh itu juga dipaparkan Sinergifitas Ulama Umara Dalam Membangun Daerah serta Koordinasi dan Konsolidasi Ulama Umara Mengoptimalkan Peran Ulama dalam Pembangunan daerah. Ketua Panitia, Alimsyah, Selasa (10/6) mengatakan, selain membuka acara, Ibrahim Muslim,Wakil Ketua MPU Aceh tampil sebagaipembicarabersamaSalmaza,WakilWaliKotaSubulussalam, mewakili Bupati Aceh Singkil dan Kepala Sekretariat MPU Aceh, Saifuddin. (b28)

PA Bireuen Dukung Prabowo-Hatta BIREUEN (Waspada): Sekretaris Partai Aceh (PA) Bireuen, Muzakir Zulkifli, menyatakan, Partai Aceh (PA) Bireuen sekarang ini, siap mendukung untuk pemenangan Prabowo-Hatta. Demikian dikatakan, Juru Bicara Pemenangan PrabowoHatta kabupaten Bireuen Tarmizi Age dan Bidang Data Muklis Rama, Selasa (10/6). “Kita harus mampu mencapai target 90 persen kemenangan Prabowo-Hatta di Bireuen,” ujarnya. (cb02)

Tidar Bireuen Deklarasi Pemenangan Prabowo-Hatta BIREUEN (Waspada): Pengurus Organisasi MasyarakatPimpinanCabang-TunasIndonesiaRaya(Ormas-PCTidar)Bireuen, mendeklarasikan untuk pemenangan pasangan Capres-Cawapres Prabowo-Hatta di Bireuen, Minggu (8/6). Juru bicara Koalisi Merah Putih (KMP) Pemenangan Prabowo-Hatta, Kabupaten Bireuen, Tarmizi Age, Selasa (10/6) mengatakan, pengurus serta anggota Tidar Bireuen akan terus melakukan berbagai upaya untuk pemenangan Prabowo-Hatta bersama KMP dan pengurus APPSI Bireuen. “Kita akan bergerak ke seluruh pelosok desa untuk mengkonsolidasikan para pemuda dan pemudi seluruh kabupaten Bireuen, sekaligus menjelaskan visi dan misi Prabowo-Hatta sebagai Capres dan Cawapres,” katanya. (cb02)


PUSKESMAS Manggeng, Kabupaten Aceh Barat Daya merupakan puskesmas yang bakal dibangun kembali dalam tahun ini. Foto direkam, Rabu (11/6)

Dua Puskesmas Gagal Dibangun MANGGENG RAYA (Waspada) : Rencana pembangunan ulang Pusat Kesehatan Masyarakat(Puskesmas)Manggengdan Puskesmas Blangpidie, Kabupaten Aceh Barat Daya dilaporkan tertunda, hal itu terjadi karena terhalang peraturan menteri.

Kadis Kesehatan Abdya Martunis, Rabu (11/6) mengatakan, tahun 2015 mendatang akan direncanakan pembangunan kedua gedung puskesmas tersebut yaitu, Puskesmas Manggeng dan Puskesmas Blangpidie, dari sumber dana Otsus dengan

besaran anggaran Rp3 miliar per puskesmas. Perencanaan bangunan kedua puskesmas tersebut sempat tertunda dalam tahun 2014 ini, dan akan dilaksanakan pada tahun 2015 mendatang. (cza)

Tiba (light, asal, waktu)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.


FY 3400 Penang*


BANDA ACEH (Waspada):Wakil Ketua DPRA Sulaiman Abda berbicara tentang pengelolaan aset daerah di hadapan sekretariat Dewan Perwakilan Rakyat Kabupaten/Kota Se – Aceh, dan kepala pendapatan dan kekayaan Aceh dalam rapat koordinasi pengelolaan barang dan jasa bidang umum, di Kantor DPRA, Selasa (10/6). Sulaiman Abda mengatakan, aset daerah merupakan sumber daya penting bagi pemerintah Aceh sebagai penopang pendapatan asli daerah. Maka itu perlu dilakukan pengelolaan secara optimal untuk mencapai pembangunan Aceh yang seutuhnya. “Dalam hal pengelolaan aset, pemerintah daerah harus memperhatikan prinsip efesiensi, efektivitas, transparansi dan akuntabilitas bagi terhindari dari hal-hal yang tidak diinginkan seperti korupsi dan manipulasi,” ujarnya. Bagi pengelolaan aset harus sangat hati-hati dan cermat dalam melakukan pengelolaannya. Dalam pelaksanaannya harus memperhatikan lingkup pengelolaan sebagaimana telah diatur dalam Peraturan Pemerintah Republik Indonesia Nomor 6Tahun 2006, telah diubah dengan Peraturan Pemerintah Republik Indonesia Nomor 38 Tahun 2008 dan ditindaklanjuti dengan Permendagri No.17Tahun 2007 tentang Pedoman Pengelolaan Barang Milik Daerah. Iamenambahkan,khususnyabagiAceh,selain berpedoman kepada peraturan yang telah disebutkan itu juga berpedoman pada Qanun Aceh No. 14 Tahun 2013 tentang Pengelolaan Barang

Milik Aceh. Qanun tersebut dibuat dalam rangka mempertimbangkan kekhususan Aceh baik dari aspek sosiologis maupun filosofis masyarakat Aceh. Tentunya keberadaan qanun ini masih sangat baru, maka diperlukan semua pihak untuk terlibat mensosialisasikan terkait dengan keberadaan qanun ini supaya tidak menghilangkan kekhususan Aceh. Menurut Sulaiman, pengelolaan aset daerah yang baik tentunya akan memberikan kontribusi optimalbagipemerintahdalammewujudkanpembangunan Aceh yang lebih baik. Maka itu, pengelolaan barang milik daerah Aceh harus diawali dari penyiapan sumber daya manusia yang mumpu dan memiliki pemahaman yang baik tentang pengelolaan Barang Milik Daerah. “Hal ini penting, karena dengan SDM yang berkualitas penerapan pengelolaan Barang Milik Daerah Aceh dapat dilaksanakan berdasarkan asas fungsional, kepastian hukum, transparansi dan keterbukaan, efisiensi, akuntabilitas, dan kepastian nilai,” terangnya. PemerintahAcehperlumenyiapkaninstrumen yangtepatuntukmelakukanpengelolaanasetdaerah secara profesional, transparan, akuntabel, efesien dan efektif mulai dari tahap perencanaan, pendistribusian dan pemanfaatan serta pengawasannya. Setiappemerintahdaerahperlumengetahuijumlah dan nilai kekayaan daerah yang dimilikinya serta perlu melakukan identifikasi dan inventarisasi aset daerahtersebutuntukpembuatanneracakekayaan daerah yang akan dilaporkan kepada masyarakat melalui DPRK maupun DPRA. (cb01)

BANDA ACEH (Waspada): Palang Merah Indonesia(PMI)BandaAcehberkerjasamadengan Badan Penanggulangan Bencana Daerah (BPBD) Banda Aceh mengadakan sosialisasi pencegahan danpenguranganrisikokebakarandirumahtangga di Desa Gampong Jawa. Sosialisasi tersebut mengikutsertakan seluruh masyarakat untuk meningkatkan pengetahuan tentang cara-cara pencegahan dan penanganan kebakaran, terutama kepada ibu-ibu yang bersentuhan langsung dengan bahan bakar di dapur masing-masing. “Tujuan sosialisasi ini adalah untuk meningkatkan pemahaman dan penyadaran Pengurangan Risiko Bencana (PRB), sehingga

masyarakat dapat mengetahui sistem pencegahan dari bahaya kebakaran sebelum terjadi dan pengendalian pada saat terjadi kebakaran,” tutur Ketua PMI Kota Banda Aceh, Qamaruzzama Hagny, Selasa (10/6) Sementara salah satu Kasie Kesiapsiagaan Bencana BPBD Banda Aceh, Azhari, S.Sos, menjelaskan kepada masyarakat ada tiga unsur penyebab terjadinya kebakaran, yaitu bahan yang mudah terbakar, panas dan oksigen (udara). Sosialisasi kebakaran juga langsung dilakukan praktekterutamapadakebakaransederhanadengan menggunakan kain basah serta masyarakat juga di berikan praktek terhadap pemakaian bubuk APAR (alat pemadam api ringan). (b04)

Rapat Paripurna LPJ APBK 2013 Ditunda LANGSA (Waspada): Rapat Paripurna Laporan Pertanggung Jawaban(LPJ)APBK2013ditunda. Hal ini sebabkan sejumlah anggota DPRK Langsa tidak hadir, sehingga tidak mencukupi forum untukmelakukanrapatparipurna tersebut, di aula RSUD Langsa. Rabu (11/6). Informasi yang diterima wartawan,jadwalundanganrapat paripurna tersebut dimulai pada pukul 10:00, namun hingga pukul 11:30, rapat itu baru dibuka oleh Ketua DPRK Langsa, M.Zulfri didampingiWakil Ketua I,T.Hidayat. Namun, dibukanya rapat itu hanya untuk memberitahukan bahwa rapat ditunda sampai Kamis (12/6), karena tidak cukup forum rapat. Sekrtaris Dewan DPRK Langsa,Samino,ketikadihubungiwartawanviatelepon,membenarkan Rapat Paripurnaa LPJ APBK 2013 ditunda karena tidak cukup forum. Dimana, anggota DPRK Langsa yang hadir hanya berjum-

lah11orang,sedangkanyangtidak hadir berjumlah 14 orang. Dijelaskannya, untuk ke 14 orangyangtidakhadiritu,dimana tiga orang sedang melakukan Dinas Luar (DL), lima orang sudah meminta izin. Sementara yang lainnya tidak diketahui, namun apakah mereka sudah meminta izin melalui staf saya itu belum tau.”Rapat ditunda sampai besok (hari ini) jam 10.00WIB,” katanya. Kabag Persidangan DPRK Langsa, Saifudin, menyebutkan, anggota DPRK Langsa yang hadir diantaranya, M.Zufri, T.Hidayat, Salahudin, Saiful Anwar, Joni, Zulfikar, Muhammad Nur, Rosmalia, Efendi, Faisal dan Farida Hanum. Sementara yang tidak hadir namunsudahmemintaizinyakni Zubir, Widoyo, Bukhari, Rubian Harja dan Fitri, dan ada tiga orang anggota DPR yang sedang melaksanakan Dinas Luar (DL) yakni Burhansyah, Ali Sadli dan Yeni Handayani. Sedangkan, enam oranglainnyayangtidaktaudima-

na atau tanpa keterangan yakni Mursid, Muharram, Ridwan, Syahyuzar,AKA, Syahrial Salim dan Joni Asril. Sementara itu, Ketua LSM Perintis Kota Langsa, Zulfadli, sangat menyayangkan dan menyesalkan terhadap anggota DPR yang tidak hadir sehingga rapat paripurna ditunda, apalagi jika ketidak hadiran anggota DPR itu tanpa alasan yang jelas.”Apa karena diakhir-akhir masa jabatan seperti ini lantas mereka mengabaikan tugas dan tanggung jawab mereka sebagai wakil rakyat,” tegasnya. Menurutnya, jangan ketika melakukanstudybandingmereka bersemangat dan harus pergi, tapi disaat-saat rapat seperti ini mereka sesuka hatinya tidak hadir.” Saya berharap anggota DPRK Langsa dapat melaksanakantugasnyahinggaberakhir masa jabatannya,” imbuhnya. (cms)

Industri Pembersih Lokal Terhambat Dapatkan Izin mendatangi kantor koordinator Waspada di Lhokseumawe, Selasa (10/6). Adapun CV S7 Din Chemical Industri adalah industri yang memproduksi berbagai deterjen pembersih untuk mobil, sepedamotor,alatrumahtangga,perangkat elektronik, dan sebagainya yang telah memiliki merek dagang, di antaranya adalah merek Geu-uet. Namun, pembersih ini tidakbisadipasarkansecararesmi akibat tidak adanya TDI tadi. Sebagaimana surat nomor

503/82 tanggal 6 Mei 2014 yang ditanda-tanganiKepalaKP2T,Nazaruddin, pihaknya tidak mengeluarkan izin TDI itu adalah karena CV S7 Din Chemical Industri belum memiliki mesin produksi yang dimaksud. Namun,Safaruddin mengatakanbahwadiatelahmenunjukkan perangkat kerja di tempat kerjanya. “Kami memiliki lokasi, alat-alat,danjugaduaorangtenaga kerja.Berdasarkanundangundang yangsayapahami,bolehdiberikan atas izin prinsip,” katanya. (b14)

Caleg Partai Demokrat Tak Jadi Mundur Waspada/Abdul Mukthi Hasan

Sulaiman Abda Bicara Soal Aset Kepada Sekretariat Dewan Se-Aceh

Sosialisasi Pencegahan Kebakaran Di Rumah Tangga

LHOKSEUMAWE (Waspada): Industri pembersih lokal, CV S7 Din Chemical Industri di Alue Ie Puteh, Aceh Utara terhambat oleh sulitnya memperoleh izin resmiTanda Daftar Industri (TDI) dari pemerintah setempat. “Sejak Januari saya telah membuat segala kepengurusan dengan bupati, sekda, asisten II, dan Kantor Pelayanan Perizinan Terpadu (KP2T) Aceh Utara, tapi sampai saat ini belum ada kejelasan,”ungkapSafaruddin,Direktur CV S7 Din Chemical Industri, saat

PENGURUS Tidar Bireuen mendeklarasikan pemenangan Capres-Cawapres Prabowo-Hatta diBireuen, Minggu (8/6)


TAKENGEN (Waspada): Ismail, SE alias Aman Nir ,45, dari Partai Demokrat resmi mengajukan surat pengunduran diri dari anggota DPRK Aceh Tengah terpilih periode 2014-2019. Pengunduran diri tersebut diajukan/diserahkan kepada KIP Aceh Tengah pada hari, Sabtu, 31 Mei 2014. Dalam surat pengunduran diri tersebut, Ismail, SE mengatakan, bahwa dirinya sebagai calon legislatif terpilih dari Partai Demokrat untuk periode 2014 – 2019 sesuai dengan apa yang telah ditetapkan oleh KIP Aceh Tengah mengajukan pengunduran diri. “Adapun alasan Ismail mundurdikarenakanmelihatkeadaan fisiknyayangtidaklagiprima,serta saran dari seluruh keluarga besarnya yang fokus dalam pemulihan dan keluarga,” sebut Azanola, SE Komosioner KIP Aceh Tengah kepada Waspada , Selasa (10/6) di kantor KIP. Selanjutnya dalam kalimat surat pengunduran diri bermaterai dan yang ditandatangani

Ismail, SE ini menyebutkan, berdasarkan rapat pleno KIP Kabupaten AcehTengah yang dituangkan melalui surat model EB-4 Nomor : 277/225/KIP-AT.001. 434492/V/2014, perihal : Pemberitahuan penetapan calon terpilih anggota DPRK AcehTengah, Daerah Pemilihan II ( Kecamatan Pegasing, Atu Lintang, Linge dan JagongJeget),menetapkanIsmail, SE adalah merupakan calon anggota legislatif terpilih dari Partai Demokrat No urut 1 untuk periode 2014-2019. Dalam surat tersebut Ismail juga menjelaskan, bahwa dirinya membuatsuratpengundurandiri itutanpaadapaksaan danmengucapkan terimkasih kepada seluruh konstituennya. Tak berapa lama setelah mengajukansuratpengundurandiri, tiba-tiba Sekertaris KIP Aceh Tengah, Fauzan menghubungi Azanola yang saat itu mendapat mandat menangani semua urusan KIP karena ketua KIP Marwansyah keluar daerah. “Menurut Fauzan (Sekertaris

KIP-Red)bahwasuratpengunduran diri Ismail, SE tersebut harus dicabut kembali alias tidak jadi, karena ini adalah perintah Bupati AcehTengah, tampaknya Bupati Aceh Tengah tidak ingin Ismail mundur ,” sebut Azanola, SE kepada Waspada. Saya mengatakan kepada Fauzan,kalausuratpengunduran diri tersebut mau dicabut harus ada surat pencabutan secara tertulis, sesuai dengan prosedur “karena saat saya menerima, saya juga membuat surat tanda terima. Ini namanya administrasi yang baik ,” sebut Azanola. Dijelaskan, setelah kembalinya Ketua KIP Marwansyah dari luar daerah, surat pengunduran diri tersebut diambil kembali oleh Ismail, SE. “Tetapi apakah pencabutan kembali surat tersebut sesuai prosedur, saya juga tidak tau. Karena saat itu Ketua KIP yang menangani langsung.” Ketika Waspada mencoba menghubungi Ketua KIP Aceh Tengah, nomor telefon selulernya tidak aktif.(b33/b32)


SEORANG ibu sedang mempraktekkan cara memadamkan api pada saat terjadi kebakaran yang disebabkan kompor meledak.

Ketua DPP Aceh Sepakat Serahkan Bantuan Kemalangan MEDAN (Waspada) : Ketua DPP Aceh Sepakat Sumatera Utara HM Husni Mustafa menyerahkan bantuan kemalangan kepada keluarga almarhumah Fauziah binti Sanusi, Rp1 juta, pemegang KTA Aceh Sepakat, Selasa (10/6) malam. Penyerahandanasantunanbertepatanmalam ketiga di rumah duka Jln. Rantang no.47 Medan diterima oleh Teuku Fazli, anak almarhumah. HM Husni Mustafa menjelaskan, penyerahan santunan kemalangan perdana kepada anggota AcehSepakatdiAncabIICabangIISewindu,berdasarkan KartuTanda Anggota (KTA) Aceh Sepakat 0576.II.AS.IV/2014. Penyerahan bantuan dana kemalangan tersebut, hasil keputusan Musyawarah Besar (Mubes) ke-10 Aceh Sepakat Sumut setahun lalu di Medan. Pada kesempatan itu hadir juga sekretaris DPP Aceh SepakatTeuku Munthadar, Ubid Azwar Sulaiman dan bendahara Faisal Pawang Leman

dan Ketua Ancab II Sewindu Nasruddin Noer serta pengurus lainnya. Teuku Fadli, selaku keluarga almarhumah menyampaikan terima kasih kepada jajaran DPP Aceh Sepakat Sumut, telah membantu meringankan bebankeluargamerekayangsedangdalamsuasana duka cita. Ketua DPP Aceh Sepakat Sumut pada kesempatan itu menyampaikan takziah agar dapat meningkatkan hubungan silaturahmi sesama warga, terutama masyarakat di tempat tinggal masingmasing, sekaligus dapat menjalin hubungan keakraban satu dengan lainnya. Berkaitan dengan KTA, pengurus DPP Aceh Sepakat terus mendata dan memproses KTA bagi warga Aceh di Medan dan di 33 cabang di Sumut. Bahkan KTA yang sudah diserahkan beberapa belum lama ini hampir mencapai 1.000 KTA. (m32)

Waspada/Abdullah Dadeh

KETUA umum DPP Aceh Sepakat Sumut M Husni Mustafa saat menyerahkan santunan kemalangan kepada Teuku Fazli (tengah), anak almarhumah Hj Fauziah binti Sanusi disaksikan Ketua Ancab II Sewindu Nasruddin Noer (kiri)

Aceh B10 Ketahuan, Janda Muda Sembunyikan Ganja Dalam Rok LHOKSUKON (Waspada): Demi memenuhi pesanan pacar yang sedang meringkuk di penjara, seorang wanita muda nekat menyembunyikan satu ons ganja dalam roknya untuk diselundupkan ke Rumah Tahanan (Rutan) Lhoksukon, Aceh Utara.

Apes, aksi itu tercium petugas, dan janda satu anak itu pun harus berurusan dengan polisi. Tersangka berinisial Ros binti Am, 33, warga Dusun Rawa Teubai, Gampong Rayeuk Jawa, Kec. Geureudong Pase, Aceh Utara. Dia ditangkap petugas di pintu masuk rutan, Rabu (11/6) sekitar pukul 11:30 dan kini ditahan bersama barang bukti di Mapolres Aceh Utara, di Lhoksukon. Kapolres Aceh Utara AKBP

Gatot Sujono melalui Kasat Narkoba, AKP Syafran menjelaskan, ganja tersebut dipesan oleh pacar Ros, berinisial EU, 34, narapidana kasus sabu-sabu yang ditangkap Sat Narkoba Polres Aceh Utara 2011 lalu. Rancananya, ganja itu akan dijual atau diedar di dalam rutan. “Ros mengaku butuh uang Rp200ribuuntukwisudaanaknya yang tamat TK. Dia berkeluh ke-

sah via telepon pada EU dan EU lalu minta Ros menyelundupkan 1 ons ganja ke Rutan Lhoksukon. Kalau berhasil, Ros dijanjikan dapat upah Rp200 ribu,” kata AKP Syafran. Menurut Kasat Narkoba, Ros berhasilditangkapkarenagelagatnya mencurigakan. Dia menolak digeledah sebelum masuk ke rutan walau yang menggeledah seorang sipir perempuan. Bahkan,

Ros sempat menyatakan tidak jadi membezuk sehingga sipir itu makincurigadanlangsungmenghubungi Polwan untuk digeledah paksa. “Ketika digeledah Polwan, di dalam celana dalam Ros ditemukansatuonsganjakeringsiapedar. Ganja itu dibungkus dengan kertas warna coklat yang biasa digunakan untuk membungkus nasi,” tutur AKP Syafran. (b19)

100 Peserta Ikuti Pelatihan Jurnalistik NAGAN RAYA (Waspada) : Sebanyak 100 peserta mengikuti pelatihan jurnalistik yang dilaksanakan oleh Humas Setdakab Nagan Raya, peserta terdiri wartawan, mahasiswa, siswa, Kelompok Informasi Masyarakat (KIM) dan PNS berlangsung di Aula Setdakab Nagan Raya, Rabu (11/6). Pelatihan yang dilaksanakan dihadiri pemateri Nashrul Marzuki dari Republika, dibuka langsung Setdakab Nagan Raya T Zamzami TS. Ketua panitia pelaksana Asda Kusuma menjelaskan, pelatihan jurnalistik ini untuk memberi wawasan kepada peserta yang belum mengerti tentang jurnalistik karena selama ini banyak di kalangan baik mahasiswa dan masyarakat belum mengerti tentang hal dunia jurnalis. (cb07)

Waspada/M Ishak


POLISI memperlihatkan barang bukti ganja yang disita dari tersangka Ros, di ruang Sat Narkoba Polres Aceh Utara, di Lhoksukon, Rabu (11/6)

Kapolres Langsa Resmikan Gedung SPK Terpadu LANGSA (Waspada): Kapolres Langsa, AKBP.Hariadi, meresmikan gedung Sentral Pelayanan Kepolisian (SPK) Terpadu Polres Langsa. Peresmian tersebut dihadiri Kabag, Kasat dan sejumlah perwira Polres Langsa sertaTengku Hasim Ibrahim. Rabu (11/6). Kapolres Langsa, menyampaikan peresmian ini sebenarnya sudah terbilang terlambat karena kita sudah memasuki ruangan ini dan sudah mempergunakannya namun demikian tidak ada salahnya karena ini merupakan tradisi daerah kita yang harus kita pertahankan, dan kita ambil sisi positifnya. Dengan pesejuk ini semoga ruang SPKT ini bisa bermanfaatbagikitadanmasyarakat. Dikatakannya, lebih kurang duatahunsetengahsayabertugas

di sini telah banyak yang kita perbaharui dan kita adakan baik bangunan maupun kendaraan, inisemuatujuannyaadalahuntuk kepentingankitadalammenjalankan tugas dan untuk pelayanan kepada masyarakat bukan untuk gagah gagahan dan bukan untuk subligat supaya di bilang hebat. Karenanya, saya berharap agargedunginibisalebihbermanfaat bagi kita dan masyarakat yang datang ke Polres Langsa bisa diberikan pelayanan yang lebih baik lagi. Apalagi, seperti arahan Kapolri yang meminta untuk mengutamakanpembangunanyang langsung bersentuhan dengan kepentingan masyarakat, maka saya berinsiatif untuk membangungedungSPKTini.Kemudian, dalam waktu dekat ini kita akan

Oknum Pamhut Akan Diberikan Sanksi IDI (Waspada): Kadis Kehutanan dan Perkebunan Aceh Timur Saifuddin akan memberikan sanki tegas terhadap oknum Pengamanan Hutan (Pamhut) Aceh Timur yang diduga ikut bermain dalam peredaran kayu illegal logging maupun aksi perambahan hutan di wilayah ini. “Kita akan tindak lanjuti semua informasi tentang hal itu yang telah kita terima dari berdasarkan informasi masyarakat, bahkan pada Kamis (12/ 6) akan digelar apel untuk Pamhut unit Peureulak,” tegas Saifuddin (foto), Rabu (11/6), di kantornya.

Menurutnya, apabila ada yang terbukti oknum Pamhut yang menerima upeti dari para oknum cukong pemain kayu illegal logging tidak tertutup kemungkinanjugaakandiajukan sanki pemecatan. Sedangkan untuk Pamhut Aceh Timur Unit Birem Bayuen selama ini sudah bekerja semaksimalmungkindalampenertiban peredaran kayu yang tidak didukungdokumenlengkap,bahkan telah mengamankan puluhan ton kayu tanpa dokumen lengkap yang akan dibawa keluar daerah. (cri)

BIREUEN (Waspada) : Ketua Tim Independen Universitas Almuslim Peusangan Mamira mengumumkan hasil testing 295 calon siswa lulus masuk sekolah unggul SMAN-1 Bireuen, Selasa (10/6). Kepala Sekolah Unggul SMAN-1 Bireuen Afriadi, Rabu (11/6) membenarkan hal itu. Dikatakan, testing masuk ke sekolah unggul SMAN1 tahun 2014 pertama kali dilakukan oleh tim independen Universitas Almuslim Peusangan

untuk menyeleksi calon siswa unggul masuk di SMAN-1 Bireuen. Menurut Afriadi, testing masuk calon siswa SMAN-1 Bireeuen diikuti 386 peserta lulusan siswa SMP tahun ajaran 2013/2014, 139 laki-laki dan 247 perempuan. Hasil testing tim Independen Universitas Almuslim sebanyak 295 di antaranya lulus testing masuk sekolah unggul SMAN-1 Bireuen terdiri dari 199 jurusan IPA dan 96 jurusan IPS. (b12)

Persiapkan Anak Berakhlak Mulia BANDA ACEH (Waspada) : Sekolah Taman Kanak-kanak Islam Terpadu (TKIT) Aminah Gampong (Desa) Lamlagang, Kecamatan Banda Raya, Kota Banda Aceh melakukan wisuda terhadap 133 murid lulusan TK, dipusatkan di aula SMK Lhong Raya, Banda Aceh, Rabu (11/6). KetuaYayasan Miftahul Jannah,TKIT Aminah Zulkifli dalam pidato sambutannya mengatakan, pendidikan yang diterapkan di TKIT Aminah bernuansa Islami melalui penerapan aqidah dan

pembekalan pengetahuan berbagai keterampilan, dalamrangkamempersiapkananaksedinimungkin taat beribadah dan berakhlak mulia. Karena sistem pendidikan terpadu itulah sehingga membuat banyak orangtua/wali murid mengantarkan anak-anaknya ke TKIT Aminah. “Di TKIT Aminah anak-anak diajarkan dengan perpaduankurikulumnasionaldenganajaranIslam (dunia dan akhirat),” kata Zulkifli. (b09)


KAPOLRES Langsa, AKBP.Hariadi, saat meresmikan gedung SPKT Polres Langsa. Rabu (11/6).

Hukum Adat Damaikan Kasus Pemukulan Di DPRK Aceh Utara

DEWANTARA (Waspada): Dengan adanya pemberdayaan perempuan di Kabupaten Aceh Utara, akan membangun perekonomian. Para perempuan berjiwa entrepreneur (wirausaha), dinilai mampu membawa kemajuan. Demikian ungkap Ketua Ikatan Wanita Pengusaha Indonesia (IWAPI) Aceh Utara, Hj. Nurjannah pada pelantikan pengurus IWAPI Dewantara di balai desa Kecamatan Dewantara, Senin (9/6). Menurutnya, perempuan harus diberdayakan dalam membangun kemandirian ekonomi di Aceh Utara. “Perempuan memegang peranan penting dan memiliki potensi yang besar. Jika mereka berperan akan menjadi entrepreneur yang akan membawa perubahan besar terhadap kemajuan bangsa,” ungkapnya. Jumlah perempuan di Aceh Utara melebihi kaum lelaki. Oleh sebab itu, sudah saatnya perempuan lebih aktif, khususnya dalam membangun kemandirian ekonomi. IWAPI Aceh Utara bertekat mengembangkan potensi perempuan menjadi enterpreneur. Dengan perannya itu, perempuan dapat membantu meningkatkan ekonomi rumah tangganya. “Sekalian perempuan juga harus bisa bersikap profesional dan proposional agar bisa membagi perannya, baik saat menjadi istri, ibu dan sebagai bos dari perusahaan dan karyawannya,” ujar Nurjannah. Sementara Pengurus IWAPI Dewantara priode 2014–2019 yang dilantik sebanyak 34 orang, dengan ketuanya Erni Putri Usman. (b15)

ancaman atau tudingan dan sebagai-nya. Kalau kita berbuatyangbaikpastiadatantangandantantangan itu pasti ada. Cukup banyak yang tidak senang ketika kita berantas perbuatan maksiat,” katanya. Untukitu,jelasMarzuki,bersabarlahdanjangan surut selangkahpun dalam menegakkan syariat. Ulama dan umara tetap mendukung Dinas Syariat Islam. Maka jangan pernah gentar. “Kami tetap memberikan dukungan dan semangat semoga syariat terus bersinar di Kota Langsa,” katanya. Terkait aksi yang terjadi baru-baru ini, mungkin itukesalahpahamansaja.IbrahimLatifdanpersonel WH selama ini telah bekerja maksimal, dan telah banyak perubahan yang terjadi. (m43)

Waspada/Rusli Ismail

MEUREUDU(Waspada):Pengawasandanpenertibanterhadap pedagang kaki lima (PKL) yang tidak kontinu dilakukan Satuan Polisi Pamong Praja (Satpol PP) Kabupaten Pidie Jaya, membuat para PKL itu tetap berjualan di sembarang tempat dan sesuka hati mereka seperti di Pusat Pasar Meureudu. Beberapa pemilik toko yang merasa terganggu akibat aktivitas para PKL, Selasa (10/6) mengatakan, para PKL tetap berjualan di sembarangan tempat tanpa mempedulikan dan menghiraukan kepentingan dan kerugian orang lain. Menurut pemilik toko, hal itu terjadi karena pengawasan dan penertiban pemantauan intensif Satpol PP di lapangan jarang dilakukan. Kasatpol PP dan WH Pidie Jaya Asiah Hasan mengatakan, para pedagang dibenarkan berjualan di kawasan pasar yang telah ditetapkan. (b09)

Membangun Ekonomi Aceh Utara Melalui Pemberdayaan Perempuan

LANGSA (Waspada): Menyikapi berbagai permasalahanpenegakanSyariatIslamyangterjadi akhir-akhir ini,WakilWali Kota Langsa Marzuki Hamid meminta Kadis Syariat Islam Kota Langsa Ibrahim Latif untuk tetap tegar dan sabar menghadapi tantangan dalam penegakan Syariat Islam. Hal itu disampaikan Marzuki Hamid terkait ancaman dan tudingan terhadap pelaksanaan Syariat Islam di Kota Langsa, Rabu (11/6). Marzukimenegaskan,apayangdilakukanoleh petugasDinasSyariatIslamdanpetugasWHselama ini telah sesuai ketentuan yang berlaku. “Jadi, saya mengharapkan Kadis Syariat Islam dan personel WHterusbekerjaoptimaldanjangantakutdengan

KETUAYayasan Miftahul Jannah, Desa Lamlagang, Banda Raya, Banda Aceh Zulkifli menyerahkan STTB kepada seorang murid bernama Fairuzi Alfayizh pada wisuda TKIT Aminah di SMK Lhong Raya, Banda Raya, Kota Banda Aceh, Rabu (11/6)

Pasar Meureudu Jadi Lokasi PKL

Waspada/Rusli Ismail

Kadis SI Diminta Tegar

membangun gedung baru yang di pergunakan untuk Sumber Daya (Sumda) dan staf lain yang akan kita tata ulang nantinya ruangan- ruangannya, karena banyak struktur organisasi yang bertambah tapi masih menggunakan gedung yang lama. Seperti di Bagian Operasi dimana dalam satu ruangan ada beberapa orang perwira. Selain daripada itu, setelah gedungnya selesai di bangun maka saya berharap kepada rekan- rekan untuk menjaga merawatnya. Begitu juga, untuk kenderaan apapun yang ada di lingkungan kita ini mari kita jaga dan dirawat dengan baik karena semuanya ini berasal dari uang rakyat. Sehingga, sudah sepantasnyayangdiberikankepada kita harus dirawat.(cms)

BUPATI Aceh Timur Hasballah HM Thaib memeriksa peserta upacara pada penutupan TMMD Aceh Timur Tahun 2014 di Lapangan Buket Bata, Kecamatan Pante Bidari, Selasa (10/6)

PEDAGANG kaki lima (PKL) berjualan di sepanjang Jalan Ramai yang merupakan jalan utama di Pusat Kota Meureudu.

Kamis 12 Juni 2014

Testing Masuk Di SMAN-1 Bireuen

TMMD Di Aceh Timur Ditutup LHOKNIBONG (Waspada): Selama berlangsungTNI Manunggal Membangun Desa (TMMD) Tahun 2014 sejak 21 Mei- 10 Juni di Kabupaten Aceh Timur, TNI sukses membangun 5 kilometer jalan dan tiga gorong-gorong serta jembatan di Desa Blang Gleum, Kecamatan Julok dan Desa Buket Bata, Kecamatan Pante Bidari, Kabupaten Aceh Timur. Hal tersebut sebagaimana dikatakan Kasdim 0104 AcehTimur, Mayor Inf H Nassrul Nasution, Selasa (10/6) di sela-sela penutupan TMMD Tahun 2014 di Lapangan Buket Bata, Kecamatan Pante Bidari, Aceh Timur. Kasdim menambahkan, selain fisik, selama TMMD pihaknya juga melaksanakan penyuluhan kesehatan, pertanian, hukum dan bela negara terhadap mantan kombatan GAM dan masyarakat setempat. (b24)


ACEH UTARA (Waspada): Abdullah Hasbullah, Sekretaris Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Utara, Selasa (10/6) mendamaikan kasus perkelahiansesamapegawaihonorer dengan hukum adat. Proses perdamaiandilaksanakandengan tepung tawar (peusijeuk) yang dilaksanakan oleh tiga orang tengku. Ke dua pegawai honorer yang terlibat perkelahian akibat persoalan kecil itu yakni Diana dan Fitri, setelah ditepungtawari ke duanya saling minta maaf dan berpelukan dengan linangan air

mata. Menyelesaikan perkara dengan menggunakan hukum adat, dapat mempererat hubungan kekeluargaan dengan masing-masing pihak yang bertikai dan tidak meninggalkan dendam yang membara. Berbeda menyelesaikan kasus dengan menggunakan hukum positif. “Kalau kasus diselesaikan dengan hukum positif, maka si terhukum belum tentu terima dengan keputusan hukum tersebut dan keretakan diantara mereka tetap terjadi dan mungkin menyimpan dendam. Berbeda dengan hukum adat. Hukum adat

ini diselesaikan dengan cara-cara islami,” kata Abdullah Hasbullah dalamsambutannyausaitepungtawar. Dalam sambutannya, Abdullahjugamengatakan,upayamendamaikankeduapegawaihonorer itu sesuai dengan perintah Allah yang artinya apabila melihat keumungkaran maka diminta untuk dicegah kalau ada pertikaian maka damaikanlah. Hadir dalam acara tersebut keluarga dari ke dua pihak yang bertikai, tokoh masyarakat, dan sejumlah undangan dari sekretariat DPRK Aceh Utara. (b18)

27 Siswa Ikuti Olimpiade Sains KUTACANE (Waspada) : Sebanyak 27 siswa SMA dari berbagai sekolah di AcehTenggara, Senin (9/6) diberangkatkan mengikuti Olimpiade Sains (OSN) tingkat provinsi, di Banda Aceh. Kabid Pendidikan Menengah Dinas Dikpora Aceh Tenggara Indra Utama didampingi Kasi Tenaga dan Tekhnis, Aswin di ruang kerjanya, Senin (10/6) mengatakan, 27 siswa SMA yang diberangkat mengikuti Olimpiade Sains diantaranya, 8 orang dari SMAN 1 Kutacane, 4 orang dari SMAN 1 Lawe Sigalagala. Dua orang dari SMAN Percontohan dan Keistimewaan Aceh (Perisai) Kutacane, 3 orang dari SMAN 1 Badar, 2 orang dari SMAS Darul Iman, SMAN 2 Kutacane, 2 orang dari SMA Swasta Panti Harapan dan 2 orang dari SMAN 2 Lawe Sigalagala dan dari SMAS Pelita Nusantara. Adapun siswa yang dipercayakan mengikuti Olimpiade Sains seleksi tingkat Provinsi Aceh tersebut , untuk mata pelajaran Kebumian,Weni Hartati (SMAN 1 Badar), Rianawati Saragih (SMAS Panti

Harapan) dan Agung Prawoto (SMAN 1 Lawe Sigalagala), mata pelajaran Mate-matika yakni,Wahidin, Chintami Dewi (SMAN 1 Kutacane) dan Rehjelina (SMAN 1 Lawe Sigalagala). Mata Pelajaran Fisika diwakili, RapentaTambunan , Annisa dan Oki Oktavianus P.Ginting, Pelajaran Kimia diwakili Cahaya Annisa, Juliani dan Gita Marwah Pratiwi, mata pelajaran Biologi Nanda Putri Napitupulu, Cut Putri Amalia dan Sri Devi, mata pelajaran Komputer yakni, Miftahul Jannah, Muhammad Habibi dan Martha Tilaar. Mata Pelajaran Astronomi diwakili, Indah Sundari, Mhd. Khadafi Desky dan Maya Nirwana, mata pelajaran ekonomi diwakili Rinaldi, FitriWulandari, Putri Haryati, Geografi diwakili Ramona Simorangkir, Nurul Afni dan M.Ridho Hidayat. Kadis Dinas Dikpora SyahrizaL melalui Kabidnya Sudirman mengatakan, Olimpiade Sains merupakan kesempatan bagi siswa SMA sederajat untuk menunjukkan prestasi dan nama sekolah maupun nama harum daerah. (b26)

Jufri Tutup TMMD Ke-92 MANGGENG RAYA (Waspada) : Bupati Aceh Barat Daya Jufri Hasanuddin bertindak selaku inspectur upacara penutupan TNI Manunggal Membangun Desa (TMMD) Ke-92 di lapangan bola kaki Desa Ie Merah, Kecamatan Babahrot, Selasa (10/6). Dalam kesempatan itu, Jufri menyampaikan ucapan terima kasih kepada Pangdam Iskandar Muda dan khususnya kepada anggota TNI Kodim 0110/Abdya, anggota Polri yang sudah

memberikan sumbangsih tenaga dalam Kegiatan TMMDiniberlangsungdiDesaIeMerah,Kecamatan Babahrot, meliputi sasaran kegiatan fisik maupun non fisik. Dandim 0110/Abdya Letkol Inf Suhartono melalui laporan yang dibacakan Kasdim 0110/ Abdya Mayor Inf M Ramdhan, mengatakan, sasarannya yakni penyucian parit kiri kanan sepanjang 2000meter,pengerasanjalansepanjang2.000meter. (cza)

SDN 1 Keude Siblah Gelar Pameran Waspada/Maimun Asnawi

SATU dari tiga orang tengku sedang menepungtawari Dina dan Fitri yang sempat berkelahi beberapa waktu lalu akibat mis komunikasi diantara mereka. Setelah ditepungtawari ke duanya akrab kembali. Foto diabadikan, Selasa (10/6).

MANGGENG RAYA (Waspada) : SDN 1 Keude Siblah, Kecamatan Blangpidie, Kabupaten Aceh Barat Daya, Selasa (10/6) menggelar kegiatan pentas seni dan pameran kreatifitas anak didik di kompleks sekolah setempat. Kepala SDN 1 Keude Siblah, Gusvizarni mengatakan, kegiatan tersebut bertujuan untuk meningkatkan kreatifitas anak, serta sebagai upaya

meningkatkan mutu dan kualitas pendidikan di Abdya. AsistenIIIBidangAdminstrasiUmumSetdakab Abdya, Bustamam ketika membuka kegiatan tersebut menyampaikan, pentas seni dan pameran kreatifitas anak diharapkan bisa menjadi acuan untuk memotivasi anak terhadap minat belajarnya. (cza)


WASPADA Kamis 12 Juni 2014

1.700 Tenaga Pendidik Ikut Pelatihan K-13

Butuh Dana Miliaran Rupiah Tangani Erosi LANGSA (Waspada) : Guna menangani erosi secara representatif yang terjadi pada tebing Krueng Langsa atau tepatnya di Gampong Teungoh, Kecamatan Langsa Kota, membutuhkan biaya miliaran rupiah. Namun,

Pemerintah Kota Langsa tidak mampu untuk menganggarkannya, tapi dengan adanya bantuan dana dari pemerintah pusat dan Pemprov Aceh masalah erosi dapat terselesaikan. “Kita berharap ini akan men-

Hutan Pidie Masih Baik SIGLI (Waspada): Bupati Pidie, Sarjani Abdullah, menilai kondisi hutandiKabupatenPidie,saatinimasihbaikdantersimpanbermacam kekayaanalambaikfloramapunfauna,sertasumberminerallainnya. “ Dan ini merupakan asset berharga yang perlu dijaga, dirawat dan dikelola dengan baik, sehingga keberlangsungan akan sumber daya alam hayati dan sumberdaya alam non hayati tetap terjjaga sampaianakcucu”demikiandisampaikanbupatiPidieSarjaniAbdullah, pada acara seminar percepatan rancangan qanun tata kelola hutan secara adat, di Oproom, kantor bupati setempat, Rabu (11/6). Menurut dia, masyarakat Aceh memiliki kearifan lokal dalam pengelolaan Sumber Daya Alam (SDA), termasuk didalamnya hutan adat. Sebab, bagi mereka sangat mustahil masyarakat di luar, mau menjaga dan melindungi hutan di Aceh. Begitupun sebut dia, masyarakat adat memiliki pengetahuan bagaimana memelihara dan memanfaatkan Sumber Daya Hutan (SDH) yang ada, demikian juga masyarakat Aceh memiliki hukum adat untuk ditegakkan yang mengatur interaksi harmonis antara mereka dengan ekosistem hutan. “ Harapan kami, agar kita semua menjaga hutan dengan baik agar kita terhindar dari bencana alam. Seperti, tanah longsor dan banjir badang” katanya.(b10)

Rocky Terima Penghargaan Presiden IDI (Waspada): Bupati Aceh Timur Hasballah HM. Thaib atau Rocky dianugerahi Penghargaan Satyalancana Wira Karya yang diserahkan langsung oleh Presiden Republik Indonesia Susilo Bambang Yudhoyono (SBY). Penghargaan itu diberikan Aceh Timur dinilai oleh Pemerintah Pusat memiliki niat dan serius serta mampu mengembangkan sumber daya alam (SDA) bidang pertanian dan kelautan khususnya kedelai. Tanda Penghargaan ke Bupati Rocky disematkan langsung oleh Presiden RI Susilo BambangYudhoyono (SBY) dalam Acara Pembukaan Pekan Nasional KontakTani Nelayan Andalan (PENASKTNA) Ke 14 di Stadion Kanjuruhan, Kepanjen, Kabupaten Malang, Jawa Timur, Sabtu (7/6) akhir pekan lalu. Kepala Dinas Pertanian, Tanaman Pangan dan Holtikultura AcehTimur, Ir. H Sanusi kepadaWaspada Rabu (11/6) mengatakan, dasar diberikan tanda penghargaan itu oleh Presiden SBY karena Bupati Rocky sangat komit dengan pembangunan pertanian di daerah Aceh Timur. “Bupati Aceh Timur selama ini berkomitmen terhadap pengembangan kedelai, peningkatan produksi beras, pertanian dan ketahanan pangan serta pengembangan kelompok tani serta kelomok nelayan,” katanya. Bupati Aceh Timur, lanut H Sanusi, dinilai memiliki perhatian dan komitmen yang besar terhadap pemgembangan pertanian yang terus digalakkannya selama ini. “Sehingga sangat wajar Bupati Aceh Timur memperoleh tanda penghargaan tersebut yang diserahkan langsung oleh Presiden SBY,” ujar H Sanusi. (b24).

jadi perhatian serius bagi pemerintah pusat dan Pemprov Aceh sehingga dapat segera dikerjakan meskipun secara bertahap,” kata WakilWali Kota Langsa Marzuki Hamid didampingi Kadis Pekerjaan Umum (PU) setempat, Said Mahdum dan Kepala Badan Penanggulangan Bencana Daerah (BPBD)setempat,IskandarSyukri, saat meninjau lokasi erosi, Senin (9/6). Menurutnya, jika ini tidak segera dikerjakan dikhawatirkan pada musim penghujan kawasan ini akan tergerus erosi, dan akan mengakibatkan bocornya tebing Krueng Langsa serta bencana banjir dapat mengancam permukiman rumah warga yang berada di sepanjang Daerah Aliran Sungai (DAS). Karenanya, untuk sementara pemerintah menanganinya dengan cara membuat cerocok dari

IDI (Waspada): Kemerosotan mutu pendidikan di Aceh khususnya di Aceh Timur semata-sematadipengaruhikualitas guru yang sangat anjlok. Olehkarenanya,DinasPendidikan setempat meminta, Kepala Sekolah (Kepsek) dan guru kedepan tidak lagi lagi lengah dalam melaksanakan tugas dan fungsinya sebagai tenaga pendidik. “Masalah anljoknya mutu pendidikan akibat rendahnya kualitas tenaga pendidik. Dengan adanya pelatihan Kurikulum 2013 (K-13) diharapkan kedepan guru semakin besar tanggungjawabnya disekolah,” ujar Kepala Dinas Pendidikan Aceh Timur Abdul Munir melalui Kabid Dikdas Agussalim (foto) disela-sela Penutupan Pelatihan K-13 di SDN 5 Idi, Rabu (11/6). Dia mengajak, teman-teman tenaga pendidik termasuk Kepsek untuk menerapkan K-13 di sekolahnya dengan tujuan agar mutu pendidikan dimasa mendatang dapat didongkrak. “Dalam kurikulum ini terdapat pendekatan-pendekatan


WAKIL Wali Kota Langsa Marzuki Hamid, saat meninjau lokasi erosi di Gampong Teungoh, Selasa (10/6) bambu dan goni berisikan pasir serta kayu yang ditaruh atau ditanamkan di pinggir bibir tebing sungai.

Cara tersebut untuk menghindari terjadi erosi berkelanjutan ketika aliran arus air sungai besar pada saat hujan turun. (cms)

Dinas Pendidikan Lhokseumawe Terapkan Kurikulum 2013 LHOKSEUMAWE (Waspada): Guna mencegah kemerosotan dan meningkatkan kualitas dunia pendidikan, Rabu (11/6) Dinas Pendidikan Kota Lhokseumawe menerapkan kurikulum 2013 sebagai acuan dalam proses belajar dan mengajar pada seluruh sekolah. Hal itu diungkapkan Kadis Pendidikan, Pemuda dan Olah Raga (Dispenpora) Kota Lhokseumawe Rusli Ismail melalui Kepala Bidang Pendidikan Menengah (Dikmen), Nasruddin kepada Waspada kemarin. Nasruddin mengatakan, tentang kurikulum 2013 ini sebenarnya telah lama disosialisasikan darijauhharisebelumnya.“Sekarang seluruh sekolah sudah menggunakanKurikulum2013,”ujar Nasruddin. Langkah penerapan Kurikulum 2013 itu bertujuan penting untuk mendongkrak kemajuan

dankebangkitanpendidikanlebih baik dari sebelumnya. Nasruddin menjelaskan, Kurikulum 2013 memiliki banyak perbedaan dengan kurikulum yang lama, seperti siswa dituntut lebihberperandanbisamengembangkan dirinya. Selain itu prakteknya pun harus lebih banyak ketimbang teori dalam penyerapanmatapelajaranilmupengetahuan sekolah. Disebutkannya, dalam sejarah dunia pendidikan Indonesia, sejak lama Kota Lhokseumawe telah menjadi barometer dunia pendidikan di Aceh. Sehingga sepantasnyaposisitersebutharus sepadan dengan perkembangan terbaru yang harus dikecapi para pelajar zaman sekarang. “Bahkan kita ingin kualitas pendidikan kita bisa lebih maju. Minimal bisa masuk urutan ke sepuluh besar di peringkat nasional, karena pendidikan sangat


penting bagi kita,” tuturnya. Akan tetapi untuk mewujudkan harapan dan tujuan tersebut, maka sangat dibutuhkan sokongandandukungandarisemua lapisan masyarakat menengah ke atas atau menengah ke bawah. Selain itu, mengenai peningkatan kualitas guru, terang Nasruddin, pihaknya akan terus berupaya dengan segala cara, antara lain melalui pelatihan-pelatihan dan bimbingan khusus. Karena kualitas SDM para guru pun sangat berpengaruh besar bagi para pelajar yang ditempa menjadicalongenerasipemimpin bangsa di masa mendatang. Setidaknya,denganbekalkurikulum 2013, diharapkan dalam pelaksanaan Ujian nasional 2015 mendatang,angkakelulusanpelajar SMP/ SMA sederajatnya di Aceh bisa mencapai 100 persen. (b16)

yang dapat merangsang peserta didik termotivasi dengan bahan ajar. Kesukaan peserta didik terhadap guru menjadi sebab peserta didik memiliki keinginan untuk belajar dengan guru yang bersangkutan. Oleh karenanya, ciptakan suasana sekolah itu dengan penuh keseriusan, tapi dalam pelaksanaan terlihat santai,” ujar Agussalim. Pelatihan K-13 Tingkat SD se Aceh Timur diikuti 1.700 guru dan Kepsek dilaksanakan sejak 7-11 Juni 2014 sejak pukul 08:00 –17:00.Mengingatjaraktempuhyangjauhdiseluruh pelosok Aceh Timur maka Dinas Pendidikan membagikan 10 titik pelaksanaan yakni SDN Bandar Baru, SDN 1 Simpang Ulim, SDN 1 Kuta Binjei, SDN 5 Idi, SDN Peudawa Puntong, SDN 5 Peureulak, SDN 2 Peureulak, SDN 3 Ranto Peureulak, SDN 1 Sungai Raya dan SDN Birem Bayeun. “Kegiatan ini kita laksanakan juga dalam ragka meningkatkan pro-fesonalitas guru dalam implementasi K-13 tahun pembelajaran 2014/ 2015,” demikian Agussalim. (b24)

Kontingen OSN SMA Bireuen Ikuti OSN Provinsi Aceh BIREUEN (Waspada): Kadis P dan K Bireuen utusan SMAS Sukma Bangsa Cot Keutapang. Drs NasrulYuliansyah M Pd melepas keberangAstronomi diikuti satu utusan SMAN-1 Simkatan kontingen OSN SMA Kabupaten Bireuen pang Mamplam, satu SMAN-2 Peusangan dan di halaman Dinas P dan K setempat untuk mengisatu SMAS Sukma Bangsa Cot Keutapang. Kimia, kuti Olimpiade Sains Siswa Nasional tingkat Prodiikuti satu utusan SMAS Sukmna Bangsa Cot vinsi Aceh Selasa (10/6). Keutapang dan dua utusan SMAN-1 Bireuen. Pelepasan 27 peserta kontingen OSN SMA Matematika, diikuti satu utusan SMAN-2 BiBireuen turut dihadiri, Kabid Dikmenjur Dinas reuen,satuSMAN-1BireuendansatuSMASSukma P dan K Drs T Syukri M Pd, para Kepala Sekolah Bangsa Cot Keutapang. Kebumian, diikuti tiga SMA yang siswanya berhasil meraih juara I,2,3 utusan SMAS Sukma Bangsa Cot Keutapang. OSN tingkat Kabupaten Bireuen. Fisika, diikuti i dua utusan SMAN-3 Bireuen Kadis P dan K Drs Nasrul Yuliansyah M Pd dan satu utusan SMAS Sukma Bangsa Cot Keutadalam pengarahannya menyampaikan pengpang. Geografoi, diikuti satu utusan SMAN-1 hargaan kepada para Kepala SMA dan guru pemBireuen, satu SMAS Sukma Bangsa Cot Keutapang bina yang telah berhasil membina siswanya di dan satu SMAN-1 Peulimbang. tingkat Kabupaten berhasil lolos mengikuti OSN Biologi,diikutisatuutusanSMASSukmaBangsa tingkat Provisi Aceh. Dikatakan, para kontingen OSN Bireuen yang Cot Keutapang,satu SMAN-1 Bireuen dan satu dilepas ke Provinsi Aceh bukan lagi sebagai utusan utusan SMAN-2 Bireuen. (b12) mewakili sekolahnya akan sebagai utusan Kabupaten Bireuen. Nasrul berharap para kontingen SMA Bireuen nantinya akan berhasil meraih prestasi untuk menghaumkan nama Kabupaten Bireuen mudahmudahan akan lolos mewakili Aceh ke tingkat nasional nanti, pintanya. Mata pelajaran yang diperlombakan dalam OSN tingkat Provinsi Aceh komputer diikuti Waspada/H.AR Djuli satu utusan siswa SMAN-2 BiKONTINGEN OSN SMA : Kadis P dan K Bireuen Drs Nasrul reuen, satu siswa SMAN-1 Peusangan,dansatuutusanSMAN- Yuliansyah M Pd, Kabid Dikmenjur Drs T Syukri, M Pd, para kepala SMA foto bersama dengan para kontingen saat dilepas 2 Peusangan. Ekonomi diikuti dua utu- keberangkatnnya untuk mengikuti OSN tingkat Provinsi Aceh san SMAN-1 Bireuen dan satu di halaman Dinas P dan K setempat Selasa (10/6).


B12 07:30 DAHSYAT 10:30 INTENS 11:00 SILET 12:00 SEPUTAR INDONESIA SIANG 12:30 SINEMA SIANG 14:15 CEK & RICEK 14:45 SEPUTAR INDONESIA 15:15 ISL 2014 17:30 ANAK - ANAK MANUSIA 18.00 Siti Bling Bling 19.00 Kau Yang Berasal Dari Bintang 20.00 Catatan Hati Seorang IStri 21.30 TUKANG BUBUR NAIK HAJI THE SERIES 22.30 Bukan Talent Biasa


08:45 Halo Selebriti 10:00 SCTV FTV Pagi: 3 Monsters and A Princess 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SCTV FTV Sore 16:30 SL: Liputan 6 Petang 17:00 ABG Jadi Manten 18:30 Diam-Diam Suka 19:45 Ganteng Ganteng Serigala 21:00 Emak Ijah Pengen Ke Mekah 22:30 FTV SCTV Utama

07:00 Upin & Ipin The Movie 08:30 Filmtv2 10:30 Pose 11:00 Diantara Kita 11:30 Lintas Siang 12:00 Animasi Spesial 13:00 Layar Keluarga 14:30 Tuntas 15:00 Lintas Petang 15:30 Filmtv Premier 17:00 Animasi Spesial 17:30 Animasi Spesial4 18:00 Kontes Dangdut Indonesia 2014 21:00 Raden Kian Santang 22:30 Sinema Spesial 00:30 Midnite Great Sale

07:55 Angry Birds Toons 08:25 The New Adv of Tom & Jerry 08:55 Gon 09:25 Sinema Siang : Scooby Doo Where Are You 11:25 Topik Siang 11:55 Seputar Obrolan Selebriti 12:55 Little Krishna 13:25 The New Adv of Tom & Jerry 13:55 Bima Sakti 14:25 Little Krishna 14:55 Bernard Bear 15:10 Oddbods 15:25 Curious George 15:55 Marsha & The Bear 16:55 Pesbukers 18:55 Super Deal 20:25 Mahabharata 20:55 Campur-Campur 22:25 Sinema Spesial

07:30 Semarak Sinema Spesial 08:30 Sinema Pagi 10:30 KISS Pagi 11:30 Patroli 12:00 Sinema Pintu Taubat 14:00 Hot Kiss 15:00 Fokus 15:30 D’Quiz 17:00 New Famili 100 18:00 D’T3rong Show 23:00 Hot Issue

08:05 8 Eleven Show 12:00 Metro Siang 13:00 Wideshot 15:00 Metro Sore 16:00 Wideshot 17:00 Metro Hari Ini 18:00 Prime Time News 19:30 Suara Anda 20:05 Mata Najwa 21:30 Otoblitz 22:00 Top 9 News 22:30 Stand Up Comedy Show 23:05 Realitas 23:30 Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

WASPADA Kamis 12 Juni 2014

07:30 Sketsa 08:15 Mission X 09:15 YKS Best Moment 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Insert Investigasi 14:45 Slide Show 15:45 Show Imah 17:00 Reportase Sore 17:30 Berita Islami Masa Kini 18:00 YKS 22:00 Oh Ternyata 23:00 Bioskop TransTV 01:00 Harta Tahta Wanita 01:30 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar 10:00 Live Coffee Break 11:30 Live NewsKabar Siang 13:30 Live Ruang Kita 1 4 : 3 0 L i v e Ne w s Kabar Pasar Sore 15:30 Live News Kabar Pemilu 16:30 Sorotan Kasus 1 7 : 0 0 L i v e Ne w s Kabar Petang 19:00 Live Gestur 20:00 Live News Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir

07:30 Spongebob Squarepants 08:00 Space Dogs 3D 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 4S (Siang Seru Sama Sule) 13:30 Seleb On Cam 14:30 Fokus Selebriti 15:00 Mas Boy dan Lemon 15:30 Impianku 16:00 Ada Ada Aja 17:30 Spongebob Squarepants 18:30 Spongebob Squarepants 19:00 Judy Moody And The Not Bummer Summer 21:00 Big Movies 23:00 Big Movies

07:30 Selebrita Pagi 08:15 Spotlite 09:15 Syafa’at 10:00 Ceplas Ceplos LIVE 11:30 Redaksi Siang 12:00 Selebrita Siang 12:45 Laptop Si Unyil 13:15 Bocah Petualang 13:45 Dunia Binatang 14:15 Tau Gak Sih 14:45 Redaksiana 15:15 Jejak Petualang 15:45 Orang Pinggiran 16:15 Redaksi Sore 17:00 Opera Van Java 18:30 Hitam Putih 19:30 On The Spot 20:30 CCTV 21:15 ILK (Indonesia Lawak Klub) 22:15 Bukan Empat Mata 23:30 Gosip Politik **m31/G

Motivasi Menyehatkan Olivia Jensen TAK seperti biasanya, aktris serba-bisa Olivia Jensen kurang percaya diri bahkan sempat deg-degan ketika didapuk sutradara merangkap produser Delon Tio menjadi pemeran utama wanita film “Mari Lari”. Pemucunya, dalam film diputar di bioskop tanah air mulai 12 Juni 2014 mendatang, untuk kali pertama dara cantik kelahiran Denmark, 11 April 1993 ini main film bergenre olahraga. “Faktor utama membuat saya sempat kurang percaya diri lantaran dalam film produksi Nation Pictures tersebut, tak sekedar piawai berlari. Tapi, lewat serangkaian adegan dalam film Mari Lari harus mampu memberi motivasi menyehatkan kepada Dimas Aditya – pemeran tokoh Rio maupun masyarakat luas,” papar Olivia Jensen Lubis

kepada Waspada usai preview film Mari Lari di Epicentrum XXI Kuningan Jakarta Selatan, baru-baru ini. Kendati begitu, berkat ketekunan mempelajari sinopsis dan arahan sutradara plus lebih giat berlatih lari, semua kendala tehnis maupun non-tehnis dapat diatasinya. “Berkat menghayati betul peran Annisa dan chemistry maksimal dengan tokoh utama pria –Rio, saya kembali penuh percaya diri berakting di depan kamera”, ujarnya. Bahkan dirinya dan Dimas Aditya bisa menularkan virus positif pada seluruh pendukung film mulai dari sutradara, produser, penulis naskah, pemain film, soundtrack hingga tambah giat menyalurkan hobi mereka berlari,” jelas Olivia pertama merambah layar lebar lewat film Bu-

kan Cinta Biasa (2009) dan terakhir membintangi film “Slank Tak Ada Matinya” (2013). Film “Mari Berlari” juga dibinangi Donny Damara, Ira Wibowo, Ibnu Jamil, Amanda Zevannya, Verdy Solaiman, Dimas Argobie dan Edwin, berkisah tentang pemuda Rio yang tak pernah menyelesaikan apa pun dalam hidupnya. Namun, lewat ajang lari marathon 42 km di pegunungan Bromo – Rio mendapatkan kesempatan emas membuktikan dirinya mampu masuk finish dalam event bergengsi tersebut. “Film ini menyuguhkan kisah menarik dan sangat identik dengan cerita di bidang olahraga - from zero to hero,” komentar Yan Wijaya, pemerhati industri film nasional maupun asing. * (AgusT)

Aksi 2NE1 di Jakarta

2NE1 Berikan Kejutan Untuk Blackjack Indonesia

Olivia Jensen

L a w o f T h e Ju n g l e , Selebriti KoreaBelajar Hidup Primitif Di Brazil Korea merupakan salah satu negara dengan industri hiburan paling meriah beberapa tahun belakangan. Popularitasnya merata di segala aspek, tak hanya musik Kpop, serial drama, film, dan bahkan program variety shownya diminati banyak kalangan. Bicara soal variety show, sejak Oktober 2011 lalu ada sebuah tayangan berjudul Law of the Jungle mengedepankan konsep baru dengan memadukan reality-variety television, dokumenter alam, dan drama kehidupan manusia dalam satu tayangan menarik. Para selebriti pengisi acara diharuskan berkunjung ke berbagai pelosok pedalaman dan primitif, untuk bertahan hidup dan mendapatkan pengalaman bersosialisasi dengan penduduk dari suku setempat. Hampir empat tahun berke-

lana, Law of the Jungle sudah keliling dunia mengunjungi berbagai lokasi seperti Namibia, Papua, Vanuatu, Siberia, Madagaskar, Amazon dan Galapagos, Selandia Baru, Himalaya, Karibia dan Hutan Maya, Savanna, Micronesia dan Borneo. Borneo usai, memasuki musim ketiga, Law of the Jungle berpindah ke negara tuan rumah piala dunia tahun ini: Brazil. Bagaimana keseruan para anggota bergulat dengan kehidupan primitif di sana dapat disaksikan dalam Law of the Jungle tayang tiap Kamis pukul 22:45 mulai tanggal 5 Juni 2014 di saluran TV ONE dapat disaksikan di Indovision ch. 164 Law of the Jungle edisi Brazil awalnya mengajak Onew SHINee dan Lee Min Woo Shinhwa bergabung sebagai pengisi acara. Onew sebelumnya juga telah bergabung dengan tim edisi Bo-

Law of The Jungle

rneo kembali diajak. Deretan selebriti bergabung bersama Onew dalam edisi Brazil yaitu Lee Min Woo, Ye Ji Won, Bong Tae Gyu, Oh Jong Hyuk, dan penyiar kondang Bae Sung Jae, dan merupakan kali pertama untuk Lee Min Woo dan Bae Sung Jae ikut dalam program Law of The Jungle diproduksi SBS. Tim Law of The Jungle sudah berangkat ke Brazil sejak ta-

Grup idola asal Korea Selatan, 2NE1, sempat memberikan kejutan pada para Blackjack Indonesia (sebutan untuk penggemar 2NE1) di akhir-akhir pergelaran konser. Berselang sekitar 10 menit setelah CL menyebut Go Away sebagai lagu penutup, disusul aksi membungkukkan badan pada seluruh penonton, para personel 2NE1 akhirnya kembali tampil di panggung. Riuh teriakan penonton masih berada di dalam ruangan

konser pun menggema. Konser belum benar-benar berakhir. Seiring dengan dilantunkannya lagu Lonely, para personel 2NE1 turun dari panggung. Mereka menyapa para Blackjack sambil sesekali bersalaman dan menerima pemberian. Histeria penonton pun tak terelakkan. “Apakah kalian menikmati pertunjukan malam ini?,... Kami akan merindukan kalian,” ujar CL disambut riuh antusiasme penonton. “Saya akan kembali ke sini,” kata Minzy.

“Saya akan merindukan kalian dan terima kasih,” ujar Bom. “Saya suka nasi goreng. Saya cinta padamu (dalam Bahasa Indonesia),” tambah Dara. Tak lama, mereka pun melantunkan lagu Got the be you, disusul Can’t Nobody. Lagu terakhir ini merupakan lagu penutup konser 2NE1 bertajuk All or Nothing di Jakarta, Minggu malam. Grup idola asal Korea Selatan, 2NE1, tampil energik dalam pergelaran konser perdananya

bertajuk All or Nothing (AON) di Jakarta, Minggu malam. Hampir sepanjang konser berlangsung, para personil 2NE1 bernyanyi diiringi koreografi membuat mereka terus bergerak ke sana-ke mari. Para penonton umumnya adalah Blackjack, sebutan untuk penggemar 2NE1 hampir tak mungkin duduk diam. Mendengar irama musik beat, mereka ikut menggerakkan anggota tubuh sambil ikut bernyanyi. Selama hampir satu sete-

ngah jam, grup digawangi empat orang perempuan yakni CL, Minzy, Bom dan Dara ini membawakan sekitar 21 buah lagu umumnya diiringi koreografi penuh energi serta dukungan tata cahaya, suara dan panggung. Ke 21 lagu ini sebagian besar merupakan lagu-lagu dalam full album ke dua mereka, Crush. Kemudian ditambah, beberapa lagu hits mereka, seperti Fire, Lonely, I Am the Best dan Ugly.(ant)

nggal 10 Maret lalu, namun pada tanggal 17 Maret Onew dan Lee MinWoo terpaksa harus kembali ke Korea karena bentrok dengan jadwal manggung sehingga mereka hanya akan melakukan syuting untuk beberapa episode saja di Brazil sebelum digantikan selebriti lain. Kenyataan ini membuat penggemar Onew dan Lee Min Woo menyesalkan hal ini karena mereka tak bisa lebih lama melihat idolanya mengikuti acara penjelajahan di Brazil. Lee Min Woo sendiri tak kalah kecewa. “Saya juga kecewa karena harus kembali ke Seoul untuk konser

Shinhwa. Tapi saya dapat pelajaran penting selama tinggal di hutan. Saya bertekad untuk lebih mencintai diri sendiri dan berterima kasih atas makanan yang kita makan setiap hari. Dan meski kami harus syuting siang malam serta menghadapi banyak masalah, untungnya saya bisa beradaptasi. Mungkin karena saya juga terbiasa tumbuh di alam dan melakukan aktifitas seperti menangkap ikan dan membuat api unggun,” kenangnya. Posisi Onew dan Lee Min Woo digantikan Kangin Super Junior dan Hyuk VIXX. “Kangin

dan Hyuk akan menggantikan Onew dan Lee Min Woo yang harus kembali ke Korea pada 17 Maret karena ada kegiatan lain,” ujar perwakilan dari SBS untuk program Laws of The Jungle. Edisi Brazil kini tayang di ONE ini tetap menampilkan Kim Byung Man sebagai pemimpin tim. Hadir juga Ye Ji Won, Bong Tae Gyu, Bae Sung Jae dan Oh Jong Hyuk. Lee Min-woo, Onew, Kangin dan Hyuk mengikuti format Relay Survival, di mana Lee Min-woo dan Onew berpartisipasi untuk minggu pertama saja, kemudian kembali ke Korea, dan dilan-

jutkan Kangin dan Hyuk untuk sisanya. Sebagai salah satu member Super Junior pertama kali ikut dalam acara Laws of the Jungle, Kangin sebelumnya pernah ke Brazil untuk konser bersama Super Junior menceritakan pengalamannya bertahan hidup di alam liar Brazil. “Awalnya saya berpikir karena bisa dibilang belum lama ini saya menyelesaikan militer, maka saya pasti bisa menjalankan tantangan di acara Laws of the Jungle ini dengan mudah. namun ternyata sangat berbeda dan di luar dugaan,” ungkapnya

dalam sesi konfrensi pers. Berangkat selama seminggu lebih menuju pedalaman hutan di Brazil merupakan pengalaman baru awalnya sempat Kangin remehkan. Tapi karena pada dasarnya ia sosok yang ambisius, Kangin pun tidak takut menantang berbagai medan sulit dan berusaha tetap tenang. Lucunya, Kangin sempat diledek temannya di Super Junior. Maklum, saat kembali kulitnya terbakar gosong. “Mereka bilang: Untuk apa kau kembali lagi ke sini? Sudah tinggal saja di sana.”(m19)

Waspada, kamis 12 juni 2014  
Waspada, kamis 12 juni 2014