Page 1

SCANIA / Michele Marchetti e il suo team alla conquista di Milano e Piemonte SETRA / Il brand di Daimler Buses celebra sette decenni di storia Vega Editrice - Monza, Italy - Anno XXXI - N. 302 - Settembre 2021 - Euro 5,00

IDLE I M ONDO T R A S P O RT I Mensile di Politica, Economia, Cultura e Tecnica del Trasporto - FONDATO

E DIRETTO DA

PAOLO ALTIERI

LA GIOVANE MANAGER ALLA GUIDA DI UN TEAM COESO E MOTIVATO

Alice Pulici, Cavi Diesel scrive un nuovo capitolo ORIGINARIA DI MONZA, BRESCIANA DI ADOZIONE, L’AMMINISTRATORE DELEGATO HA SUPERATO DA POCO I TRENT’ANNI QUANDO PAOLO ZANI, STORICA FIGURA IMPRENDITORIALE DEL TERRITORIO, INTUISCE LE SUE POTENZIALITÀ E LA VUOLE AL SUO FIANCO COME CFO DELL’AZIENDA, DAL 2006 DI PROPRIETÀ DI BRIXIA FINANZIARIA. CON 36 ANNI DI STORIA DI CONCESSIONARIA DAF, DOPO IL BREAK EVEN RAGGIUNTO NEL 2019, ANNO MIGLIORE DI SEMPRE, L’ANNO SCORSO LA NASCITA DI BTRUCKS PER IL RITORNO DEL MARCHIO FORD TRUCKS. Massimiliano Campanella da pagina 4

Poste Italiane Spa -Spedizione in Abbonamento Postale - D.L. 353/2003 (conv. in L. 27/02/2004 N. 46) Art.1, comma 1, DCB Milano

THERMO KING

Cesena: Costa rafforza la rete Altieri a pagina 34

PALLEX A MODENA

Zara e Gottardi, sfida in tandem Campanella da pagina 54

TECNOKAR

Da sette lustri trainato italiano Campanella a pagina 44

KÖGEL TRAILERS

Gruber Logistics: accordo quadro Altieri a pagina 38

EURO CO.M.I. / La Concessionaria sarda presidia Toscana e Liguria

HAM ITALIA / Impianto inaugurato con veicoli Scania

S

CONVOY SPED SCEGLIE IL GREEN LO SBARCO NEL CONTINENTE

Il futuro può essere differente”. Così Francesco Morabito esordisce al taglio del nastro dell’impianto di distribuzione di bio-Lng realizzato da HAM Italia a Ciriè, nei pressi dell’aeroporto di Torino Caselle, dove si è tenuta l’inaugurazione con veicoli del brand Scania al primo rifornimento ecologico. Nel 1983 Morabito smetteva i panni di funzionario ministeriale per avviare un’impresa di trasporto individuale. Nel 2003 con lo sbarco

in Ungheria Convoy Sped inizia un graduale e costante sviluppo che porta alle attuali dimensioni: 110 veicoli e 130 dipendenti. Affiancato da Enrique Enrich e Aldo Bernardini, rispettivamente numeri uno di Italscania e HAM Italia, l’imprenditore manifesta tutta la sua determinazione: “Entro il 2022 avremo solo camion che viaggeranno a biometano”. Servizio da pagina 8

e le necessità aguzzano l’ingegno, le risorse mentali di Pasquale Tau la devono essere particolarmente allenate, viste le condizioni straordinarie nelle quali si è trovato a operare nei suoi primi vent’anni di vita lavorativa. Innamorato della sua terra, della sua famiglia e della sua azienda il giovane imprenditore, classe 1978, ha fin qui dovuto vedersela con un paio di ostacoli di quelli per cui a essere poco meno motivati si cambia strada. Invece il carattere e

le capacità di una famiglia, che negli ultimi cinquant’anni si è affermata come la prima realtà sarda nella rivendita e nel trasporto di carburante sul territorio dell’isola, evidentemente gli appartengono. La concessionaria Euro CO.M.I. ha superato brillantemente i periodi di crisi, e ha forse trovato anche un modo per neutralizzare il disagio di essere nata dalla parte “sbagliata” del Tirreno.

ROSSI VEICOLI

REALTRAILER-CIACCIULLI

TRANS SPEEDY

BLU WAY

IVECO IN CAMPANIA

Stelle dell’Isola d’Elba

Frigo Krone in Puglia

Fraikin va veloce

Offensiva bioLNG

Esposito dealer ideale

Servizio a pagina 6

Basilico a pagina 36

Servizio a pagina 10

Basilico a pagina 26

Servizio da pagina 14

Servizio da pagina 18

Allegato inserto sul mondo dei veicoli commerciali


3URJHWWDWRSHUHFFHOOHUHLQDPELWRXUEDQRPDSHUIHWWDPHQWHDVXRDJLR DQFKHQHOODYRURIXRULFLWWj3RUWHU13RIIUHXQDSRUWDWDWRSLQJRPEUL ULGRWWLHOHYDWDPDQHJJHYROH]]DHPRWRUL]]D]LRQLHFRIULHQGO\

6FRSULO LQWHUDJDPPDYLVLWDLOVLWRVRFRPQXRYDFRP

&21&(66,21$5,$3,$**,2&200(5&,$/ $9(//,12%(1(9(172&$6(57$ 9,$&$53,*1$12*5277$0,1$5'$ $9

7(/&2081,&$=,21,#62&201829$&20


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 3

RENAULT TRUCKS / TUTTE LE MIGLIORIE APPORTATE ALLE GAMME T, T HIGH, C E K

Per primi vengono gli autotrasportatori

U

LINO SINARI ZINGONIA

na doppia strategia sostiene l’aggiornamento delle gamme T, T High, C e K di Renault Trucks: da una parte non abbassare la guardia, anzi, incrementare il livello di affidabilità che contraddistingue il prodotto del marchio francese, dall’altra parte lavorare sul time to market, ovvero velocizzare le evoluzioni, per stare al passo con i tempi e rinnovare i modelli con aggiornamenti a ritmo serrato. “Il mercato italiano - ha dichiarato in conferenza stampa Pierre Sirolli, Amministratore delegato Renault Trucks Italia - è vivace: il 2021 si sta dimostrando un anno di grande ripresa, migliore del previsto, e anche la quota di Renault Trucks sta crescendo. Dal 6,2 per cento del 2019 siamo passati all’attuale 7,2. E non vogliamo certo fermarci qui”. E c’è da pensare che le carte in regola per continuare a salire ci siano visto che l’offensiva Renault Trucks da oggi potrà contare sulla nuo va gamma ripensata dopo un’attenta analisi delle richieste dei clienti. Si è lavorato sul design introducendo uno stile più accattivante, ma soprattutto sul comfort interno, in considerazione delle ore di lavoro che gli autisti passano ogni giorno al volante. “Sia mo passati da un design industriale - ha precisato Sirolli a uno tecnologico”. Esternamente sono stati ridimensionati i fari per aumentare l’area della carrozzeria nella parte inferiore ed è stata inserita una nuova

GRANDE RINNOVAMENTO DELLE FAMIGLIE DEL COSTRUTTORE FRANCESE: DAL PUNTO DI VISTA DEL COMFORT, DELL’ESTETICA E DELLA TECNOLOGIA. “PERCHÉ SIAMO IN FORTE RIPRESA, MA NON CI FERMIAMO CERTO QUI” HA COMMENTATO IL NUMERO UNO DELLA FILIALE ITALIANA

PIERRE SIROLLI.

calandra a nido d’ape. Ma oltre che esteticamente in linea con i desiderata dei clienti, la nuo va gamma è anche confortevole, affidabile ed efficiente. Intanto i veicoli sono dotati di un nuovo sistema di regolazione dello sterzo in tre direzioni, semplice da utilizzare grazie a un comando intuitivo a pavimento. E poi i sedili sono resistenti e confortevoli e propongono la massima flessibilità in termini di regolazione, scelta di combinazioni e opzioni. I veicoli dispongono ora di un supporto per tablet e smartphone: il conducente può accedere con temporaneamente a più dispositivi e ha la possibilità di ricaricarli tramite due prese USB-C, ed è stato aggiunto anche un nuovo cas-

setto portaoggetti, utile per conservare i documenti in formato A4, mentre sul lato passeggero due vani offrono una capacità totale di 7 litri (compreso un vano frigo di 2 litri). Il camion non è solo uno

strumento di lavoro, è anche un luogo di riposo per l’autista. La qualità della cuccetta è, quindi, essenziale. Detto fatto: aumentato del 13 per cento lo spessore del materasso della cuccetta “Serenity” e raddoppiato il

Pierre Sirolli, Amministratore delegato Renault Trucks Italia.

IDEE IN MOVIMENTO

Un’Authority di controllo per il rilancio del Paese

La ripartenza, il rilancio del “sistema Paese”, i nuovi scenari di crescita conseguenti all’approvazione del PNRR occupano ormai da tempo le prime pagine dei giornali e dominano le cronache nazionali. Questo clima di entusiasmo e fiducia è fortemente positivo, ma è altresì necessario procedere con capacità di visione, volontà di riforme e piena consapevolezza di quelle che sono le criticità del Paese, prima tra tutte lo stato di cronica arretratezza in cui versano da molti anni le nostre infrastrutture. Oggi in Italia è sostanzialmente impossibile trovare un asse viario o autostradale non sottoposto a interventi di manutenzione, spesso con cantieri fantasma. In qualità di operatori, affrontiamo quotidianamente pesanti limitazioni non solo in termini di trasporto su strada, ma anche in termini d’intermodalità marittima che riteniamo essere l’unica vera alternativa alla fragilità infrastrutturale del nostro paese. Grazie all’intermodalità e al forte sviluppo della rete di Autostrade del Mare, i porti italiani sono cresciuti esponenzialmente negli ultimi dieci anni. Oggi sono perfettamente in grado di ospitare

di DOMENICO DE ROSA CEO del Gruppo SMET

le mega navi di nuova generazione, come le nuove navi ibride da 500 trailer che hanno fatto recentemente il loro ingresso nella flotta del Gruppo Grimaldi. Siamo invece fortemente carenti nell’ultimo miglio, vale a dire gli assi viari e autostradali che consentono ai mezzi di raggiungere il porto di imbarco o lasciare il porto di sbarco. Proprio su questo argomento, in occasione

della tre giorni di ALIS che si è tenuta a Sorrento nel luglio scorso, abbiamo proposto una riflessione sull’urgenza di creare in Italia una cabina di regia che monitori costantemente lo stato di salute dei porti, delle strade e delle autostrade. Lanciamo quindi un appello alle Istituzioni e alla politica, che ci auguriamo siano consapevoli dell’importanza di una cabina di regia così concepita: un’Authority in cui, attraverso la partecipazione delle associazioni di categoria più rappresentative come ALIS, gli operatori dell’autotrasporto e della logistica siano attivamente coinvolti, con l’obiettivo di usufruire al più presto di un sistema infrastrutturale efficiente e di una rete viaria degna di un Paese moderno. Un’Authority di controllo garantirebbe inoltre una vigilanza attiva sui tempi previsti per gli interventi di manutenzione e per la chiusura dei tratti stradali. Auspichiamo infine una responsabile abolizione del pedaggio autostradale in tutti i tratti sottoposti ad interventi di manutenzione, a parziale risarcimento degli enormi disagi imposti agli operatori del settore trasporti e ai privati cittadini.

numero di molle, per offrire un miglior supporto per il corpo. Infine, per migliorare la qualità dei dispositivi audio in cabina, Renault Trucks si è affidata a Focal, produttore francese di altoparlanti e attrezzature Hi-Fi. Fronte efficienza, tutto concorre ad una concreta riduzione del consumo di carburante. L'aerodinamica della cabina è stata migliorata e sono presenti una nuova versione del sistema di controllo di velocità predittivo “Optivision” e un sistema di controllo della velocità ottimizzato con due modalità di guida selezionabili: “ECO ON” è la modalità predefinita che ottimizza il consumo di carburante regolando alcune procedure di guida: accelerazione, cambio di marcia, regola-

zione della velocità e decelerazione. Stesso obiettivo dietro alla scelta fatta per i nuovi Renault Trucks T e T High, che sono dotati di serie di pneumatici di categoria A, i più efficienti sul mercato. E infine l’assistenza, importantissima. “Renault Trucks - ha concluso Sirolli - ha sviluppato una nuova tecnologia che permette di aggiornare regolarmente il software del veicolo senza intervento in officina. Questa nuova tecnologia è integrata nell'offerta del contratto “Excellence Predict” e consente a Renault Trucks di intervenire prima che si verifichi un guasto, garantendo una maggiore tranquillità ai clienti e assicurando costantemente la disponibilità dei veicoli”.

IL MONDO DEI TRASPORTI

Mensile di Politica, Economia, Cultura e Tecnica del Trasporto Direttore responsabile Paolo Altieri - paolo.altieri@vegaeditrice.it

Comitato di Redazione Fabio Basilico - f.basilico@vegaeditrice.it Max Campanella - m.campanella@ vegaeditrice.it Cristina Altieri - cristina.altieri@vegaeditrice.it Direzione, redazione e amministrazione Via Ramazzotti 20 - 20900 Monza Tel. +39 039 493101 - info@vegaeditrice.it www.ilmondodeitrasporti.com Sede Legale Via Stresa 15 - 20125 Milano Editore Vega Editrice Presidente Luisella Crobu Vice Presidente Michele Stefano Altieri Pubblicità Vega Editrice srl: Via Ramazzotti 20 - 20900 Monza Tel. +39 039 493101 Promozione Piero Ferrari Impaginazione e Fotocomposizione Varano, Busto Garolfo (Milano) Stampa Reggiani Print srl, Brezzo di Bedero (VA) Il Mondo dei Trasporti è registrato presso il Tribunale di Milano numero 327 del 4/5/1991 - Iscrizione al ROC: N. 35164 Abbonamento annuo: Italia Euro 50,00, estero: Euro 150,00 Banca d’appoggio: UniCredit Banca - Agenzia Muggiò; Codice IBAN: IT 21 V 02008 33430 000041141143 - Monte dei Paschi di Siena - Agenzia 5 Milano; Codice IBAN: IT 51 K 01030 01605 000000212676 - Poste Italiane Spa - Sped. in Abbonamento Postale - D.L. 353/2003 (conv. in L. 27/02/2004 N. 46) Art.1, comma 1, DCB Milano - Distribuzione GE.MA Srl: Burago di Molgora (MB).


IL MONDO DEI TRASPORTI

Pagina 4

N° 302 / Settembre 2021

GRUPPO BRIXIA / ALICE PULICI È DA CINQUE ANNI PROTAGONISTA

“Coraggio e fiducia nel team

U

HA POCO PIÙ DI TRENT’ANNI LA MANAGER, ORIGINARIA DI MONZA, BRESCIANA DI ADOZIONE, QUANDO PAOLO ZANI, STORICA FIGURA IMPRENDITORIALE DEL TERRITORIO, INTUISCE LE SUE POTENZIALITÀ E LA VUOLE AL SUO FIANCO COME CFO DELL’AZIENDA, DAL 2006 DI PROPRIETÀ DI BRIXIA FINANZIARIA. CON 36 ANNI DI STORIA DI CONCESSIONARIA DAF, DOPO IL BREAK EVEN RAGGIUNTO NEL 2019, ANNO MIGLIORE DI SEMPRE, L’ANNO SCORSO LA NASCITA DI BTRUCKS PER IL RITORNO DEL MARCHIO FORD TRUCKS.

n’intervista a Alice Pulici, da cinque anni al timone di CAVI Diesel, è tutt’altro che cosa scontata. Giovane Amministratore delegato (ha 38 anni) al terzo mandato, una laurea in Economia completata con Master in Economia e Management alla SDA Bocconi, Alice Pulici è approdata nell’azienda bresciana nel 2014 come CFO (Chief Financial Officer) per volontà del compianto imprenditore Paolo Zani. Figura iconica del territorio di Brescia e provincia, Zani ci aveva visto giusto: dimostrando rara lungimiranza, alla giovane manager assegnava il compito della gestione finanziaria, intuendone le potenzialità. Negli anni, Pulici si è fortemente appassionata al settore. E non esita a scendere in campo, a essere presente in prima persona con i clienti, agli eventi organizzati e tutte le volte che lo ritiene opportuno per rafforzare l’immagine di CAVI Diesel. Anche dal 2016 in poi, quando ha assunto l’incarico di Amministratore delegato. In parallelo, sotto la sua guida l’azienda sta diversificando i rami di business, con l’obiettivo di soddisfare le aziende di trasporto proponendo l’intera filiera di veicoli, dai commerciali ai pesanti stradali passando per l’assistenza. E si va strutturando un’organizzazione manageriale, in un team di persone

af fiatate, motivate e tutte pron te a seguire l’Amministratore delegato nei suoi obiettivi: proseguire e ampliare l’opera di Paolo Zani, crescere per i clienti e con i clienti. In CAVI Diesel tutti lo fanno rimboccandosi le maniche: a Calcinato - dove ha sede l’headquarter - manager dietro la scrivania non ce ne sono, tantomeno l’Ammi-

di MAX CAMPANELLA CALCINATO

nistratore delegato. Originaria di Monza, bresciana di adozione, sposata e grande amante degli animali (i due cani di famiglia rappresentano il suo hobby nel, poco, tempo libero), Pulici ha imparato sul campo giovanissima. Già quando (di necessità virtù) manteneva gli studi lavorando presso studi di commercialisti. Oggi è alla

guida di una storica realtà aziendale: CAVI (Centro Assistenza Veicoli Industriali) Diesel nasce nel 1979 come officina di proprietà della famiglia Freschi. Nel 2006 l’ingresso di Brixia Finanziaria, creatura di Paolo Zani, tra le prime dieci aziende per performance aziendali del territorio di Brescia, operativa nella distribuzione e vendita carbu-

ranti con 650 impianti. Con l’acquisizione da parte di Brixia del cento per cento del capitale sociale, CAVI Diesel diventa di fatto il riferimento della società nel settore automotive. Particolarmente attiva nel sociale, a Brixia fanno riferimento la Fondazione Paolo e Carolina Zani e la Carolina Zani Melanoma Foundation, in memoria della gio-

La sede di Calcinato e, in alto, Alice Pulici con i manager di punta nelle vendite: Cesare Facchetti (a sinistra) e Massimo Portalupi.

vane figlia dell’imprenditore. Da 36 anni Concessionaria DAF per Brescia, Mantova, Cremona e Bolzano, con le sedi di Calcinato e Bolzano (operativa da 13 anni), nel corso degli anni l’azienda è cresciuta con nuove realtà: nel 1989 il mandato Nissan, nel 2000 Piaggio Commercial per Brescia, nel 2017 Isuzu per Milano, brand cui è dedicata la sede di San Giuliano Milanese. L’anno scorso il “gran de ritorno” di Ford Trucks, brand al quale l’a zienda era legata al momento della sua fondazione: con il nuovo sviluppo della Rete FTrucks Italia, viene costituita la società BTrucks che, con il brand Fortruckers, si occupa della vendita dei pesanti del marchio americano per Brescia, Mantova, Bolzano e Milano. La massima attenzione al post vendita ha portato all’ampliamento anche di questo business: oltre a veicoli commerciali e industriali, l’azienda è riferimento per l’assistenza degli autobus Solaris (sin dal 2012), Irizar e VDL. Per il trainato, in partnership con la toscana Bartoli l’azienda propone i semirimorchi ultraleggeri dell’austriaca Berger. Oggi nel Cda accanto a Pulici siedono gli ingegneri Enrico Zamperi e Umberto Cocco. Presidente del Gruppo Brixia e dal 2018 Amministratore Delegato del Gruppo Metra, Zamperi ha ricoperto incarichi di vertice in impor-


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 5

DELLA MASSICCIA ESPANSIONE DELLA DIVISIONE AUTOMOTIVE

le chiavi del vero successo”

tanti aziende a livello nazionale e internazionale in diversi settori, tra cui la Direzione Generale del Policlinico Universitario Gemelli di Roma, la Direzione Generale della Fondazione Poliambulanza Istituto Ospedaliero di Brescia, Amministratore Delegato di Brandt Italia. Nel 1995 ha fondato Logicom (tra le prime società nate in Italia per servizi Internet alle aziende). Attualmente è anche vicepresidente della Fondazione Poliambulanza, della Croce Bianca di Brescia e della Pallacanestro Brescia. Amministratore delegato del Gruppo Brixia e Vicepresidente della “Carolina Zani melanoma foundation”, Cocco è un manager con esperienze pluriennali in vari settori tra cui quello manifatturiero e della sanità: per 15 anni ha fatto parte del direzionale della Fondazione Poliambulanza Istituto Ospedaliero Multispecialistico. Azionista unica del Gruppo Brixia, con una chiara visione aziendale fondata sulla collaborazione e sul fare rete per uno sviluppo e una crescita continua, organica, ora più che mai con l’obiettivo di generare risorse da reinvestire in attività che siano in grado di generare valore per la comunità, Patrizia Ondelli nel 2020 ha costituito “Carolina Zani Melanoma Foundation”, fondazione dal carattere internazionale nel nome e nel ricordo della figlia Carolina. Dei 50 dipendenti, nove sono venditori e fanno riferimento ai Direttori Commerciali Cesare Facchetti per DAF e Piaggio e Massimo Portalupi per Ford e Isuzu. Multi brand e multi sede, il comparto Automotive del Gruppo Brixia conta 15 officine partner sul territorio che,

nell’anno della pandemia, come la capogruppo hanno sempre garantito l’operatività, anche nei mesi più difficili, quando il conto economico avrebbe suggerito la chiusura. “Brescia e provincia - ricorda Pulici - sono una delle aree geografiche più colpite dal Covid-19: nei mesi primaverili gran parte delle attività erano ferme. Il Gruppo ha voluto restare sempre operativa per lanciare un messaggio di vicinanza ai clienti e ai partner, dando il suo contributo alla filiera del trasporto”. Come sta andando il 2021? “È un anno molto positivo. Stiamo affrontando - prosegue l’Amministratore Delegato la congiuntura con l’efficienza che ci deriva dalla solidità e scioltezza di Brixia Finanziaria: nei mesi precedenti il rallentamento dei processi produttivi sono stati acquistati veicoli a stock, consentendoci di affrontare i ritardi nelle consegne a vantaggio dei clienti”. Alice Pulici arriva in CAVI nel 2014: al di là della parentesi pandemica, cos’è cambiato in questi quasi sette anni? “Abbiamo avviato - afferma il numero uno dell’azienda bresciana - un’importante ristrutturazione aziendale, assegnando a CAVI Diesel un’impronta più moderna, e rafforzato la vicinanza al cliente. In termini economici, il 2019 è stato l’anno migliore di sempre: abbiamo raggiunto il break even e festeggiato i quarant’anni di CAVI Diesel. Sul piano personale, questi sette anni per me hanno significato l’autentica riscoperta di un mondo affascinante qual è quello del camion: oggi ho un’opinione completamente diversa dell’autotrasportatore. Soprattutto, amo il mio lavoro: solo se apprezzi quello

che fai puoi farlo bene”. Da AD che non se ne sta dietro le quinte, Alice Pulici è una manager tenace, capace di ascoltare e imparare dall’interlocutore con estrema rapidità. La stessa con la qua le assume le sue decisioni. “Ogni divisione aziendale prosegue - ha un suo responsabile, con il quale mi confronto su base quotidiana, dalle vendite al marketing ai ricambi: i dirigenti hanno molta autonomia e sanno di avere tutto il mio sostegno, sanno di poter contare su di me, che possono coinvolgermi direttamente. Delegare vuol dire trasmettere fiducia alle persone: questo consente la crescita personale e collet-

tiva”. L’espansione del gruppo continua nei numeri e non solo: quali novità ci attendono nel breve e medio termine? “A brevissimo – continua l’Ad Pulici - sarà operativa la nuova sede di Assago di BTrucks. Nel 2022 intendiamo rafforzare l’assistenza su Mantova. Inseriremo nel ventaglio dei prodotti una linea di veicoli elettrici destinati a micro logistica e ecologia. A piccoli passi, com’è nel nostro stile, rafforzeremo l’attività del noleggio”. Con 36 anni di storia DAF, CAVI è riferimento del costruttore olandese, vantando una quota di mercato di circa il 12 per cento, al di sopra

della media nazionale. “La clientela - precisa Pulici - è costituita da aziende di dimensioni medie: fatta eccezione per qualche flotta dimensionata, la fetta maggiore di aziende conta tra 30 e 50 veicoli. I segmenti di mercato sono i più disparati: dal collettame ai rifiuti, passando per il cava-cantiere, che sta registrando una forte ripresa grazie alle agevolazioni per i lavori edilizi e, nel quale, DAF può vantare veicoli molto performanti. Siamo in attesa di capire se, con il decreto cosiddetto “sblocca Italia”, gli 82 miliardi stanziati favoriranno il decollo di lavori per infrastrutture e alta velocità. Non mancano raccolta

XF, l’ammiraglia della famiglia DAF, all’ingresso del quartier generale del dealer bresciano.

agricola, trasporto bestiame e liquidi alimentari: le vendite sono equilibrate tra trattori e motrici”. Qual è l’approccio che differenzia il Gruppo Brixia? “Seguiamo il cliente - continua Alice Pulici - per l’intero processo logistico, dalla costruzione del veicolo all’allestimento alla consegna. Il nostro claim è alzare sempre di più l’asticella del servizio. Su questa lunghezza d’onda si colloca la scelta di nuovi business: pur valutando i fattori di rischio, occorre la giusta intraprendenza per crescere”. Il mondo del trasporto sta vivendo una fase di profonda evoluzione: quale suggerimento sente di dare ai manager under 40 che, come lei, potrebbero essere protagonisti del cambiamento? “L’era digitale - afferma Pulici - non deve far dimenticare che dietro un marchio e un’azienda vi sono le persone con le loro competenze. Saperci “mettere la faccia” è l’invito che rivolgo ai tanti giovani che, con rammarico, mi capita d’incontrare trovandoli incapaci di scelte gestionali: alla base di ogni scelta vi sono dei valori umani. Di questo il team è consapevole e questa è la piattaforma del nostro successo”. Come donna sente che è stato più complicato fare carriera nel mondo dei trasporti? “Oggi - afferma in conclusione - vivo con serenità il ricordo dei primi anni, quando l’interlocutore mi chiedeva “lei è la segretaria o la moglie?” Non è stato facile, ci è voluto un pizzico in più di perseveranza e, nel mio caso, ho avuto la fortuna di avere il supporto di Paolo Zani, al quale devo la mia carriera professionale”.


IL MONDO DEI TRASPORTI

Pagina 6

N° 302 / Settembre 2021

ROSSI VEICOLI / NUOVA COMMESSA A NICOR SERVICE DI VEICOLI MERCEDES-BENZ

Sulle rotte dell’Isola d’Elba NATA NEL 2007 DALL’INCONTRO TRA ERRICO ORLANDI, GIÀ PROPRIETARIO DI UNA PICCOLA AZIENDA DI AUTOTRASPORTI, CON ESPERIENZA NEL SETTORE DA OLTRE 15 ANNI, E NICOLA NARDI SCHULTZE, APPARTENENTE AL GRUPPO NARDI-SCHULTZE, CHE DA BEN 35 ANNI OFFRE SERVIZI INTEGRATI PER CLIENTI PRIVATI E PUBBLICI, L’AZIENDA SI SPECIALIZZA FIN DA SUBITO NEL TRASPORTO E DISTRIBUZIONE DI PRESIDI MEDICI, BIANCHERIA E DISTRIBUZIONE PASTI PER STRUTTURE OSPEDALIERE. QUEST’ESTATE L’AVVIO DI UNA NUOVA COMMESSA NEL SETTORE ALIMENTARE PER LA MICRODISTRIBUZIONE DI MERCE ALIMENTARE FRESCA, FRESCHISSIMA E SURGELATO: “GRAZIE AL PREZIOSO SUPPORTO DELLA CONCESSIONARIA ROSSI SIAMO RIUSCITI A PARTIRE SUBITO CON L’OPERATIVITÀ”, AFFERMA ERRICO ORLANDI.

S

MAX CAMPANELLA CANNARA

pecializzata nel servizio di distribuzione di presidi medici,  strumentario chirurgico, biancheria  e consegna pasti per strutture ospedaliere, Nicor Service, con sede a Ponte San Giovanni e piattaforma logistica in Cannara, in provincia di Perugia, è un’azienda in forte sviluppo. Aprendosi ad una nuova committenza, avvia ed estende quest’anno la distribuzione di alimentare fresco e freschissimo lungo la fascia che, nel litorale Grossetano, arriva all’Isola d’Elba, trovando al suo fianco come partner Rossi Veicoli, Concessionaria con headquarter a Corciano, che a Nicor Service ha consegnato veicoli con un allestimento specifico, affrontando - con e per il trasportatore - le difficoltà di approvvigionamento di veicoli, utilizzando tutte le formule possibili, noleggio compreso. Nicor Service S.r.l. viene fondata nel 2007 grazie all’intuizione di Errico Orlandi, 44 anni, e di Nicola Nardi Schultze, 39 anni; il primo con una esperienza quasi ventennale nel settore dell’autotrasporto e logistica concretizzata nella piccola azienda di autotrasporti di famiglia, il secondo, appartenente alla famiglia Nardi-Schultze, operante dal 1846 nel settore di servizi di lavanolo per il settore turistico-alberghiero e ospedaliero. Dal connubio dei due giovani, nasce l’acronimo Nicor come espressione di un’idea: “Perché non aprirsi ad altri servizi di trasporto?”. Da quel momento, l’azienda inizia ad operare nel settore dell’autotrasporto conto ter zi, prima solo a servizio del Gruppo Nardi-Schultze, poi sviluppando e allargando il proprio raggio d’azione nel settore alimentare e farmaceutico. Oggi Nicor Service conta circa 60 unità tra furgoni, motrici e trattori stradali, diversificando il proprio business tra micro distribuzione, GDO e servizi espressi (entro le 12/24 h) di ogni genere. Per conto di uno dei più grandi gruppi leader nel settore alimentare e della ristorazione, la Nicor Service distribuisce capillarmente i loro prodotti tra Marche, Umbria, Toscana e Lazio, e dal 2020 anche nell’Emilia-Romagna, consegnando ogni giorno pesce fresco, latticini e carni a strutture alberghiere, ristoranti e catering. Per il settore ospedaliero, Nicor Service prosegue ad essere presente in Umbria, Toscana, Lazio, E milia-Romagna e Lombardia trasportando presidi medici (strumentario chirurgico), biancheria e affini per strutture pubbliche e private. La sua forte specializzazione nel servizio di trasporto a temperatura controllata ha permesso all’azienda anche di poter im-

piegare trattori stradali e motrici per la consegna settimanale e giornaliera di carne appesa in tutto il Nord Italia e pesce fresco nel Centro Italia (Toscana, Lazio e Umbria). Altro servizio interessante offerto, sia a livello internazionale che nazionale (con particolare focus su Francia, Belgio, Olanda, Germania e Svizzera), è quello realizzato con motrici e semirimorchi doppio piano (double desk), equipaggiate con sponda racing per facilitare il caricoscarico di tutta la merce delicata, non sovrapponibile, sfruttando in altezza tutto lo spazio disponibile all’interno del mezzo (come arredamenti, rimorchi per imbarcazioni).

Un’attività quella di Nicor Service, molto diversificata, che richiede l’utilizzo di una flotta altrettanto variegata, e che rappresenta allo stesso tempo un grande elemento distintivo per l’azienda, in grado di adattarsi velocemente e in modo dinamico alle singole esigenze dei propri clienti: il parco auto di Nicor Service, misto per tipologia e brand, spazia infatti da furgone con portata da 3,5 t al bilico. Nel 2020, anno della pandemia, Nicor Service prosegue il suo sviluppo, rafforzando il trasporto farmaci (con trasporti eseguiti a livello europeo anche in meno di 24h) e aggiungendo al business tradizionale il trasporto di mascherine, gel

disinfettante e test rapidi per Covid-19 in tutta Europa, isole comprese. È in questa fase che ha inizio una collaborazione con la Concessionaria Rossi che, quest’anno, si rivelerà proficua. “Inizialmente illustra Errico Orlandi - abbiamo acquistato da loro un Actros 1853 nuovo: trattandosi di una Concessionaria ampiamente conosciuta, sapevamo della loro offerta di veicoli nuovi Mercedes-Benz. Quando abbiamo ottenuto la nuova commessa sul Grossetano, si sono rivelati non solo una Concessionaria seria e solida: abbiamo trovato un supporto importante, ci sono stati accanto dandoci la possibilità di partire subito con il

Da sinistra: Andrea Reali, Responsabile Vendite Trucks & Vans Rossi Veicoli; Valentina Fortunati, Responsabile Amministrativa e componente del Cda di Nicor Service; Errico Orlandi, Amministratore dell’azienda di Cannara. In alto, un Mercedes-Benz Actros.

nuovo lavoro”. La commessa, di grande rilevanza e prestigio, richiedeva veicoli speciali. “Si tratta illustra Orlandi - di trasportare merce alimentare (fresco, freschissimo e surgelato) lungo il litorale da Follonica a Piombino passando per Orbetello, Capalbio, Castiglion della Pescaia e l’Argentario fino all’Isola d’Elba e all’Isola del Giglio. Ci servivano veicoli con paratia, doppia temperatura, in grado di raggiungere i centri abitati, in particolare la ristorazione turistica”. È il giugno 2021 e l’intera produzione di veicoli per l’autotrasporto sta subendo ritardi a causa dei rallentamenti nella fabbricazione di accessoristica. “Era dietro l’angolo - prosegue Errico - il rischio di non riuscire a partire subito. Il team di Rossi Veicoli ha tro vato la soluzione giusta, mettendoci in grado di avviare subito la commessa e implementare il nostro business. In quei mesi cruciali ci hanno

Pur nata di recente, la partnership tra le due aziende tro va la sua solidità nel rispetto delle esigenze di entrambi i player, oltre che nella versatilità del prodotto Mercedes-Benz. “La fornitura a Nicor Service - prosegue Reali - è costituita da veicoli “cuciti” ad hoc per il cliente, che han no richiesto competenza anche per l’allestimento. Nicor Service è un’azienda storica, che sta crescendo sviluppandosi sul territorio e dimostrandosi pronta a nuovi sviluppi: Rossi Veicoli è al suo fianco nel cogliere nuove opportunità di business, com’è il caso di questa commessa nei luoghi turistici della Toscana”. Il dealer umbro e la rete MercedesBenz sarà riferimento anche per la manutenzione. Una scelta, quella della Stella, che trova nella passione di Orlandi il punto di svolta. “Ho sempre voluto - dichiara l’imprenditore, autista per vocazione - mezzi con tecnologia avanzata e costi di

NiCor ServiCe

Sede operativa principale: Cannara (PG) Presidente Cda: Errico Orlandi Merce trasportata: Presidi chirurgici, alimentare, arredamenti Flotta: 60 mezzi Dipendenti: 53 Fatturato 2020 (euro): 5,8 milioni di euro Sito internet: nicorservice.net

fornito veicoli a noleggio, in attesa dell’arrivo di quelli nuovi, con i quali oggi stiamo proseguendo con massima soddisfazione del cliente finale: questo ci ha permesso di rispettare il contratto e di non incorrere in problemi con la committenza”. Rossi Veicoli ha consegnato all’azienda umbra quattro Actros, un Atego e un Fuso Canter; tutte motrici con cassa Transcar, con paratia per doppia temperatura (nel posteriore fresco 0-4 gradi, nell’anteriore surgelato a -20), gruppo frigorifero Carrier Transicold e sponda caricatrice Anteo a battuta. Insomma, un allestimento certamente particolare. “Il nostro approccio con Nicor Service - afferma Andrea Reali, Responsabile Vendite Veicoli Commerciali e Industriali di Rossi Veicoli - segue le linee guida che rappresentano il modo di confrontarsi con il cliente di Rossi Veicoli: non siamo venditori, l’obiettivo è trovare la giusta soluzione per il cliente che, a sua volta, deve avere la possibilità di soddisfare le richieste della committenza. In questo caso Orlandi e il suo team rischiavano di subire penali se non riuscivano a partire subito: abbiamo dato loro dei veicoli a noleggio e hanno potuto iniziare subito, senza dover attendere l’arrivo dei veicoli nuovi”.

manutenzione ridotti, il truck Mercedes, a oggi risponde alle esigenze da me richieste essendo veicoli dai ridotti costi manutenzione, con tecnologie innovative, versatili, tut ti Euro VI, quindi adatti per i centri cittadini. Ho avuto l’opportunità di guidare il nuovo Actros e, sul piano tecnologico, è assolutamente all’avanguardia: l’assenza degli specchietti in una prima fase richiede adattamento, ma bastano 10 chilometri per rendersi conto che non togli mai gli occhi dalla strada, puoi guardare senza distrarti, ti basta spostare lo sguardo. Insomma, guadagni in attenzione sulla strada e, quindi, in sicurezza”. Affiancato da Valentina For tunati, componente del Cda e suo “braccio destro”, Orlandi è alla guida di un team giovane e compatto. “Remiamo tutti - afferma in conclusione - nella stessa direzione: dopo 15 anni al volante, so comprendere le esigenze di chi guida e le situazioni che ci si trova ad affrontare. Questo consente di crescere come gruppo. Entro gennaio 2022 andremo a rinnovare tutti i veicoli Euro III e Euro IV, per lo più da 75 q, che sostituiremo con veicoli Fuso, che si stanno rivelando adatti, per la loro manovrabilità, alle consegne negli ospedali più piccoli e nei centri storici”.


Una ricarica di sostenibilità. Il nuovo eActros. Charged & Ready.


IL MONDO DEI TRASPORTI

Pagina 8

N° 302 / Settembre 2021

CONVOY SPED / INAUGURATO CON SCANIA L’IMPIANTO DI

I

Francesco Morabito: “Il

MAX CAMPANELLA CIRIÉ

l coraggio, la tenacia, la determinazione. Infine l’orgoglio. Di essere tra i pri mi in Italia a inaugurare un impianto di bio-LNG ed essere pioniere nell’intermodale a temperatura controllata, alla guida (insieme ai figli) di un’azienda che dà lavoro a 130 persone, con un importante indotto sul territorio piemontese. Ma Francesco Morabito, 68 anni assolutamente ben portati, è rimasto la persona di sempre: semplice, aperta al confronto, modesta e con un sorriso che esprime tut ta la felicità di dare il suo contributo per un trasporto futuro meno impattante sull’ambiente. “I sacrifici non sono mancati, ma il risultato di oggi dimostra che un futuro differente per il trasporto è possibile”, afferma al taglio del nastro, affiancato dai partner al suo fianco: HAM Italia costruttore dell’impianto e Italscania per la fornitura di trattori stradali a LNG. Siamo a Cirié, non distante dall’aeroporto Caselle di Torino, in Piemonte, dove Morabito, calabrese di Palmi, arriva a 28 anni come giovane funzionario del Ministero dei Trasporti. “Per me - racconta l’imprenditore - era un mondo sconosciuto, che ho imparato a conoscere, apprezzare, amare. Soprattutto, ho avuto modo di entrate in contatto con tante aziende e tanti imprenditori: è stata una vera scuola di vita”. La passione prevale e, nel 1983, Morabito lascia il “posto fisso” per aprire una sua azienda di trasporti: parte con un veicolo e negli anni costituisce una flotta. Nel 2003 la ditta viene chiamata Convoy Sped, dal nome di una piccola azienda locale acquisita con la quale Morabito sbarca in Ungheria: su queste rotte Convoy Sped diventa leader indiscussa, affiancando servizi in Germania, Francia e Spagna. Oggi l’attività è gestita dalle tre sedi di Cirié, Vado Ligure e

NEL 1983 SMETTEVA I PANNI DI FUNZIONARIO MINISTERIALE PER AVVIARE UN’IMPRESA DI TRASPORTO INDIVIDUALE. NEL 2003 CON LO SBARCO IN UNGHERIA CONVOY SPED INIZIA UN GRADUALE E COSTANTE SVILUPPO CHE PORTA ALLE ATTUALI DIMENSIONI: 110 VEICOLI E 130 DIPENDENTI. AFFIANCATO DA ENRIQUE ENRICH E ALDO BERNARDINI, RISPETTIVAMENTE NUMERI UNO DI ITALSCANIA E HAM ITALIA, L’IMPRENDITORE MANIFESTA TUTTA LA SUA DETERMINAZIONE: “ENTRO IL 2022 AVREMO SOLO CAMION CHE VIAGGERANNO A BIOMETANO”, AFFERMA CON DETERMINAZIONE MORABITO. Ungheria.Lo sviluppo è favorito dalla profonda conoscenza di Morabito del mercato, dei player, dei protagonisti del trasporto: intuisce che il segmento automotive promette bene e avvia servizi di trasporto per Fiat, Iveco, Michelin, tuttora primo cliente di Convoy Sped. “Dal prodotto finito al semilavorato precisa l’imprenditore - riforniamo buona parte degli stabilimenti Michelin in Germa-

nia e Francia e copriamo totalmente le loro necessità in Ungheria”. Accanto all’automotive, segmento in forte crescita è l’alimentare fresco per il Gruppo Costa, operatore turistico italiano parte del Gruppo Carnival Corporation: “Riforniamo tutte le navi da crociera operative nel Mar Mediterraneo”, afferma Morabito. Tra i committenti Ferrero, Amazon e una serie d’importanti cartiere.

La flotta oggi conta 110 trat tori (il 60 per cento dei quali a metano, per il 90 per cento a marchio Scania) e 360 veicoli per il trainato (furgonati, telonati e frigoriferi) tra semirimorchi, rimorchi e casse mobili. Il gruppo frigorifero viene utilizzato non solo per il trasporto alimentare: “I semilavorati per Michelin - precisa Morabito d’estate richiedono il trasporto a temperatura controllata,

per evitare che lo sbalzo termico ne modifichi le caratteristiche tecniche”. In questo contesto si colloca la scelta intermodale: casse mobili Lam beret con gruppo frigo Carrier 1.550 da 60 ore di autonomia. “Vengono caricate su treno - prosegue Morabito - evitando le problematiche del trasporto su strada soprattutto nelle rotte francesi, dove le altezze delle gallerie non sempre consentono il transito di un autotreno”. Per il lungo raggio su gomma la scelta è l’LNG, evoluta oggi nel bio-LNG, ovvero gas naturale prodotto da scarti agricoli. “Nessuno - afferma determinato Morabito ci ha imposto nulla: si tratta di una scelta che abbiamo assunto in totale autonomia. Cer to, in futuro è del tutto prevedibile che arrivino imposizioni esterne: aver deciso in autonomia, senza forzature, ci ha consentito di procedere con oculatezza. Oggi sia mo orgogliosi di sapere che i nostri veicoli hanno un impatto quasi nullo in termini di emissioni, risultato raggiunto con sacrifici economi-

ci e gestionali, perché sul piano logistico un veicolo a LNG che viaggia in Europa richiede maggiore attenzione: la situazione della rete distributiva sta cambiando, ma vi sono Paesi come Ungheria, Repubblica Ceca, Slovacchia e Romania dove permangono difficoltà nella presenza di impianti”. Cosa significa per Morabito e la sua famiglia inaugurare un impianto a bio-LNG? “È la chiusura del cerchio. Non basta - aggiunge l’imprenditore - acquistare veicoli a LNG: occorre modificare la filiera se vogliamo azzerare la CO2. Abbiamo varcato il pri mo traguardo: entro il 2022 l’obiettivo è avere una flotta che viaggia al cento per cento con bio-LNG. Risultato che raggiungeremo grazie ai nostri partner (HAM e Scania) e grazie ai clienti, che ci sono sempre stati vicini, anche nei momenti difficili, dandoci la possibilità di superarli senza subire contraccolpi. Al lungo raggio con bioLNG affianchiamo le rotte intermodali con casse refrigerate Lamberet. Il mercato

CoNvoy Sped italia

Da sinistra: Sandro Mantella, Amministratore delegato Lamberet Italia; Aldo Bernardini, Amministratore delegato HAM Italia; Francesco Morabito, Amministratore delegato Convoy Sped Italia; Enrique Enrich, Amministratore delegato Italscania.

Sede operativa principale: Cirié (TO) Amministratore: Francesco Morabito Merce trasportata: Alimentare fresco e semilavorato per automotive Flotta: 110 veicoli Dipendenti: 130 Fatturato 2020 (euro): 18 milioni di euro


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 9

CIRIÉ CHE EROGA BIO-LNG REALIZZATO DA HAM ITALIA

futuro può essere differente”

prenda atto che il futuro del trasporto può essere differente”. Prima del taglio del nastro, hanno portato la loro testimonianza le aziende protagoniste dell’operatività dell’impianto di Cirié. “Il bio-LNG spiega Enrique Enrich, Amministratore delegato Italscania - rappresenta la più importante delle tre tappe che Scania ha stabilito nel percorso che porterà a dimezzare la CO2 dei suoi veicoli. La prima è rappresentata dall’evoluzione del motore diesel, tuttora elemento fondamentale nel trasporto su gomma: intervenire per rendere sempre meno impattanti i propulsori a gasolio è fondamentale per dare un contributo alla minimizzazione delle emissioni inquinanti”. Il secondo step del costruttore di Södertälje è rappresentato dall’elettrificazione dei veicoli, “progetto - afferma Enrich - ancora agli albori, considerando l’autonomia e il costo al km”. L’utilizzo dei biocarburanti è il terzo e decisivo focus di Scania.

Il primo rifornimento di bio-LNG presso l’impianto torinese di Convoy Sped, che ha chiuso il 2020 con un fatturato di 18 milioni.

“Considerando il ciclo combinato - prosegue il timoniere di Italscania - con il bio-LNG i valori di CO2 emessa, principale responsabile dell’effetto serra e del surriscaldamento del Pianeta, sono prossimi allo zero”. Un concetto ribadito da Daniel Dusatti, Direttore Vendite Italscania: “Oggi - afferma Dusatti - Convoy Sped possiede 40 veicoli Scania a LNG, numero destinato a salire considerando l’obiettivo annunciato da Morabito. Questo la rende una realtà rara, in Italia e Europa, in grado di dare uno stimolo al mercato e essere di esempio”. Sotto gli occhi dei presenti e con il coordinamento di Simone Martinelli, Business Development Alternative Fuels Italscania, e di Riccardo Piccolo, Responsabile Commerciale HAM Italia, un trattore Scania ha effettuato il primo pieno in 10 minuti. “L’impianto di Cirié - spiega Aldo Bernardini, Amministratore delegato HAM Italia - è molto semplice in termini di infrastruttura: non presenta sistemi di spinta e consente il rifornimento in un tempo assolutamente in linea con quello per veicoli a gasolio. L’apertura dell’impianto è segno evidente che Convoy Sped crede nel bio-LNG e investe. Co sì come ci crede HAM, che sta investendo nel biocarburante: grazie a questi sforzi a breve gli autotrasportatori potranno disporre di elevate quantità di bio-LNG”. Da 22 anni presente nel settore, HAM Italia ha una flotta di cento camion a LNG che viaggeranno tutti a bio-LNG. “Così come il mercato ci ha dato ragione per l’LNG - prosegue Bernardini - lo stesso accadrà per il bio-LNG, che in termini di emissioni batte ogni altro sistema di trasporto”. Affiancato dalla moglie Concetta e oggi dai figli Martina e Alessio, Morabito ha chiuso il 2020 di Convoy Sped con un fatturato di 18 milioni e un utile di 580mila euro. “Abbiamo risentito della pandemia - puntualizza l’imprenditore - pur avendo rafforzato molto il business in Ungheria. Tenendo sotto controllo i costi relativi ai consumi, l’utilizzo dell’LNG contribuisce al risultato positivo in termini di utile. Il 2021 sta andando molto bene: chiuderemo con un fatturato in crescita del 12 per cento e un utile di circa 1,2 milioni”.

PER L’ASSISTENZA IL RIFERIMENTO È L’OFFICINA VDR SERVICE DELLA FAMIGLIA SCHIAVON

Intermodale con casse mobili Lamberet refrigerate Carrier T enuta termica della cassa per ridotto consumo di gasolio è l’obiettivo con cui Lamberet ha fornito a Convoy Sped venti casse mobili con gruppo frigorifero Carrier Transicold. In vetroresina come tutti i veicoli del costruttore francese, sono equipaggiate con quadro in acciaio e supporto rail per intermodale. “Presentano - precisa Sandro Mantella, Amministratore delegato Lamberet Italia - capacità da 33 europallet, equivalente a quella di un semirimorchio standard, e possono essere mono e multi temperatura”. Prodotte nel moderno stabilimento di Saint-Cyr-Sur-Menthon, fanno parte della storica produzione Lamberet, condividendo con gli altri prodotti caratteristiche di robustezza e tenuta nelle operazioni di carico-scarico. “La fornitura Convoy Sped - prosegue Mantella - risponde a precise esigenze emerse nel confronto con i Morabito, che hanno individuato

per ogni cassa mobile un preciso percorso, considerando che le rotte sono caratterizzate da profili diversi, ad esempio per la presenza di gallerie”. Punto di forza delle casse mobili l’autonomia. “Nel caso di un imprevisto - aggiunge il numero uno di Lamberet Italia -viene assicurato il controllo di temperatura per due giorni, anche da remoto con la telematica”. Tra i presenti all’evento inaugurale Valerio Schiavon, fondatore dell’officina VDR Service di Leinì, che oggi dirige con i figli Daniele e Roberto. “Dalla consegna alla manutenzione - spiega Daniele Schiavon - seguiamo i camion Scania di Convoy Sped per l’intera filiera”. Fondata nel 1975, VDR è tra le più storiche officine autorizzate Scania: oggi dà lavoro a 11 dipendenti e mette a disposizione della clientela una sede con 2.500 mq di piazzale e 700 di capannone.


IL MONDO DEI TRASPORTI

Pagina 10

N° 302 / Settembre 2021

IL PASSAGGIO GENERAZIONALE DA

FRANCESCO A SALVATORE PAPANDREA È CONCISO CON L’AVVIO DI UNA NUOVA AZIENDA E DI UNA STRUTTURA MANAGERIALE: UN TEAM DI GIOVANI PROFESSIONISTI STA FACENDO CRESCERE

TRANS SPEEDY MOLTIPLICANDO I VOLUMI DI BUSINESS E DIVERSIFICANDO IL PORTAFOGLIO CLIENTI.

“IL NOLEGGIO DÀ AD AZIENDE DINAMICHE COME LA LORO UNA MARCIA IN PIÙ PER APRIRSI A NUOVE COMMITTENZE E ALTRI SEGMENTI DI MERCATO”, AFFERMA

ROBERTO COGO, AREA MANAGER FRAIKIN ITALIA.

FRAIKIN / DUE INTERI BILICI ALLA LOMBARDA TRANS SPEEDY

Più veloci con il noleggio

I

MAX CAMPANELLA

SAN GIULIANO MILANESE

l passaggio generazionale com’è noto è una fase delicata nella storia di un’azienda. In Trans Speedy, l’esperienza della prima generazione, nella persona di Francesco Papandrea, e l’intuizione del figlio Salvatore hanno consentito che tale fase sia coincisa con un’importante evoluzione. Traghettata da una squadra di giovani e motivati manager, l’azienda sta conoscendo una crescita con numeri record anno dopo anno: di pari passo all’aumento dei volumi e del business, cresce la struttura organizzativa e il numero di veicoli. Un trend che prosegue con Fraikin come partner privilegiato: “Il

noleggio consente di rispondere in maniera immediata e positiva a nuove committenze e di ragionare in modo flessibile sugli investimenti”, afferma Salvatore. Trans Speedy è “figlia” dell’attività imprenditoriale di Francesco. Originario di Gioiosa Jonica, a metà strada tra Reggio Calabria e Catanzaro, Pa pandrea ha solo 17 anni quando si avvicina al mondo dei corrieri logistici operando come autista nella cintura milanese. “Il primo camion che ho guidato - racconta l’imprenditore - era un autocarro ribaltabile Renault JP”. Nel 1995 Francesco Papandrea si mette in proprio con una piccola azienda di trasporto. In quel clima di passione per il truck, prim’ancora che

di business, cresce il figlio Salvatore, classe 1978, che a vent’anni è al suo fianco al volante del camion. Il tandem funziona: padre e figlio dimostrano sul campo voglia di lavorare e capacità di rappresentare un riferimento sicuro per il mondo dei corrieri, in co stante sviluppo e trasformazione. Nel 2013 Salvatore Papandrea “scende” dalla cabina: la crisi economica richiede scelte coraggiose, aprirsi a nuovi segmenti di mercato pur rafforzando, nel contempo, il bu siness dei corrieri. “Mio padre - spiega - ha rappresentato e continua a rappresentare un riferimento: la figura di lavoratore instancabile, che ha sempre rispettato i valori umani. Tutto questo è un pa-

Da sinistra: Roberto Cogo, Area Manager Fraikin Italia; il management Trans Speedy: Salvatore Papandrea, Daniela Adamo, Francesco Papandrea, Serena Molinari, Donato Castriotta, la tirocinante Giorgia Campolongo e Diego Pellicioli, Sales Director Fraikin Italia.

trimonio: ma in quelle circostanze occorreva una nuova struttura per far crescere l’azienda, aumentando le competenze con un team di manager”. Al suo fianco arriva Daniela Adamo, che si occupa di amministrazione e contabilità. Nel 2018 i due decidono di rilevare l’azienda paterna: nasce Trans Speedy, con sede legale a Pescara e sede operativa inaugurata quest’anno a San Giuliano Milanese (1.900 mq di capannone, 1.800 mq di piazzale e 450 mq di uffici). L’arrivo come responsabile parco mezzi di Donato Castriotta, manager trentenne con esperienza nel settore, rappresenta un’ulteriore leva di crescita. Entrano nel team Eros D’Amato, coordinatore operativo, Koci Fatmir, capo meccanico, e Serena Molinari in amministrazione. “A quel punto - prosegue Salvatore si costituiva un team di professionisti pronti a nuove sfide: ci siamo aperti al trasporto industriale e a nuove committenze di valore come Columbus e Sennder. Si raggiungeva l’obiettivo che mi ero prefisso: la diversificazione, il passaggio da un solo grande cliente, che oggi continua a rappresentare il 50 per cento dell’attività, a un ventaglio di clienti di diversi settori”. Il 75 per cento del business Trans Speedy è costituito dalle linee notturne per consegne espresso, accanto alle quali si effettuano rotte per trasporto industriale in tutto il Nord Italia: Lombardia, Emilia-Romagna, Piemonte, Liguria. La flotta è costituita da 20 motrici, 22 trattori e 25 semirimorchi (centinati e telonati), ai quali si aggiunge una doz-

zina di terzisti-padroncini. “Stiamo procedendo - precisa Castriotta - a un rinnovamento completo dei veicoli, puntando sull’Euro VI”. In questa strategia si colloca la partnership con Fraikin, leader nel noleggio di veicoli professionali, che ha portato all’acquisizione di due bilici: trattore Renault Trucks T e semirimorchio Krone. “Il canone del noleggio full optional - spiega Daniela Adamo - è com petitivo e ci permette di uniformarci alle esigenze della committenza. L’obiettivo era, ed è, ridurre il numero dei veicoli più datati: quando viene inserito un nuovo veicolo in flotta, occorre fare una valutazione di lungo termine, che consideri anche le spese di manutenzione. I nostri mezzi non si fermano mai: prevediamo sempre veicoli disponibili in caso di necessità, due motrici e un trattore. Con Fraikin il problema è superato: un veicolo occorrente arriva in tempi immediati”. Riferimento per Trans Speedy è Roberto Cogo, Area Manager Fraikin Italia, con il quale il management dell’azienda lombarda si confronta costantemente. “Il noleggio - spiega Cogo - offre ad aziende dinamiche come Trans Speedy una marcia in più per crescere, rispetto ad altre formule che naturalmen-

te richiedono tempi più lunghi”. Non solo. “Trans Speedy - afferma Diego Pellicioli, Sales Director Fraikin Italia è una di quelle aziende guidate da giovani che presentano un potenziale ancora tutto da esprimere: per Fraikin essere al loro fianco vuol dire aiutarli a evolversi, a soddisfare le richieste di una clientela esigente, qual è quella dei big courier, avendo a disposizione la giusta dose di forza contrattuale e flessibilità. Ho avuto modo di apprezzare in Trans Speedy il loro sapersi sedere attorno a un “tavolo rotondo”, dove non c’è un capo al comando ma un team di specialisti che si confrontano con costanza e assiduità, nel rispetto l’uno degli altri”. Nata sulla piattaforma di va lori di Francesco Papandrea, oggi l’azienda dà lavoro a 49 dipendenti, ospita giovani stagisti come la volenterosa Giorgia Campolongo, è passata dai 2,8 milioni di euro fatturati nel 2017 agli oltre 5 del 2020 e si proietta a sfiorare i 6 quest’anno. Senz’affatto escludere nuovi business: con il brand Ghillis viene effettuata l’assistenza dei veicoli di proprietà, di quelli dei terzisti e non solo. Un Mercedes-Benz Sprinter equipaggiato con smontagomme è pronto h 24 per partire al soccorso degli autotrasportatori.

traNS Speedy

Sede operativa principale: San Giuliano Milanese (MI) Amministratore: Salvatore Papandrea Merce trasportata: Corriere espresso e industriale Flotta: 20 motrici, 22 trattori, 25 semirimorchi Dipendenti: 49 Fatturato 2020 (euro): Oltre 5 milioni di euro


Promozione speciale su Ricambi e Fluidi Originali 2 anni di garanzia sulll’intervento Condizioni vantaggio ose sulla manodopera 3HUVRQDOHWHFQLFRDOWDPHQWHTXDOLÀFDWR Attrezzature e tecnolo ogie d’avanguardia ... e ulteriori vantaggi


IL MONDO DEI TRASPORTI

Pagina 12

N° 302 / Settembre 2021

GB TRUCKS / CON INERTI BOMARZO SOLIDA COLLABORAZIONE PER TUTTE LE ESIGENZE

Piena fiducia nei brand AFFERMATA REALTÀ OPERANTE NEL SETTORE DEL MOVIMENTO TERRA E DELL’EDILIZIA, SPECIALIZZATA NELL’ATTIVITÀ DI ESTRAZIONE, LAVORAZIONE E VENDITA DI MATERIALE INERTE E IN OPERE STRADALI E CIVILI, LA SOCIETÀ VITERBESE FONDATA A METÀ DEGLI ANNI SESSANTA E CAPITANATA DA VALENTINO MECOZZI HA CONSOLIDATO UNA PROFICUA COLLABORAZIONE CON IL DEALER GB TRUCKS INIZIATA NEL 2018 CON L’ACQUISTO DELLA PRIMA PALA MECCANICA LIEBHERR

L550 E PROSEGUITO CON L’ENTRATA IN FLOTTA DI TRE TRATTORI STRADALI DAF. NEL 2020 SONO STATE ACQUISTATE ALTRE DUE PALE GOMMATE LIEBHEER E NEL 2021 UN ESCAVATORE CINGOLATO R 922.

I

FABIO BASILICO GRAFFIGNANO

l settore del movimento terra e dell’edilizia è tra i più specializzati ed esigenti per ciò che attiene l’utilizzo di veicoli industriali. Le concessionarie di veicoli industriali che supportano le aziende del settore devono quin di essere in grado di strut turarsi per offrire al cliente trasportatore una gamma di prodotti e servizi completa, costruita intorno al principio della personalizzazione, ovvero la fornitura di un veicolo, e dei servizi annessi, su misura, rispondente alla sua attività, al fine di sod disfare le esigenze della sua committenza. Così agisce il Gruppo Bondatti, riferimento nel Lazio per i veicoli da lavoro e punto di raccordo per le aziende locali operanti nel movimento terra. È il caso della Inerti Bomarzo di Graffignano, in provincia di Viterbo, che con il dealer GB Trucks del Gruppo Bondatti ha un solido rapporto iniziato nel 2018 e consolidatosi negli anni. Chiediamo al titolare dell’azienda viterbese, Valentino Mecozzi, di raccontarci la storia della sua azienda e di spiegarci i motivi che spiegano la proficua relazione instaurata con il dealer di Lariano (RM).

Mdt - Come nasce Inerti Bomarzo e quali le principali tappe del suo sviluppo? Mecozzi - La società Inerti Bomarzo Srl opera nel campo delle cave di inerti sin dalla prima metà degli anni ’60. Da allora a oggi si sono succedute alla guida della società ben 4 generazioni, se consideriamo gli ultimi arrivi di ‘forze giovani’ rappresentate dai miei figli che mi affiancano partecipando allo svolgimen-

to dell’attività. L’azienda si occupava della sola estrazione di materiale inerte e della rivendita del materiale grezzo e successivamente si è dotata di un impianto di frantumazione, selezione e lavaggio degli inerti, avviando così la produzione per i conglomerati cementizi e bituminosi. Ciò ci ha permesso di acquisire clientela tra la maggior parte dei produttori di calcestruzzo e conglomerato bituminoso dell’area provinciale e regionale oltre che tra le imprese edili e i magazzini edili della provincia viterbese, della Regione Lazio e delle Regioni limitrofe. Oltre a svolgere l’attività di estrazione, lavorazione e vendita del materiale inerte abbiamo intrapreso, nel corso del 2018, l’attività di raccolta, recupero e vendita di fresato di asfalto trasformandolo in materie se-

condarie (granulati di asfalto), attraverso l’installazione di un impianto fisso di recupero materiali non pericolosi. L’unita locale di produzione si trova a Graffignano, in località Pisciarello. Dal 2017, Inerti Bomarzo è proprietaria di un impianto di betonaggio, sito in località Poggino, Viterbo, dedito alla produzione di conglomerati cementizi. Ci occupiamo anche di scavi e movimento terra in genere per la realizzazione di opere stradali e civili oltre che di difesa spondale, mediante la costruzione di scogliere e sistemazione idraulica in genere. Entro la fine del 2021 c’è in programma l’apertura di una nuova cava di pozzolana nel comune di Viterbo. Questo nuovo segmento di attività ci permetterà di crescere nel fatturato avendo già ricevuto richieste di fornitura del ma-

teriale da parte di primarie aziende del settore delle cementerie.

Mdt - Com’è costituito il parco mezzi? Mecozzi - Disponiamo tra autocarri, pale meccaniche, dozer ed escavatori di circa una ventina di mezzi piccoli, medi e grandi, tra cui 3 trattori stradali DAF, 3 pale gommate Liebherr L550, 1 pala cingolata Liebherr 624 e un escavatore cingolato R 922. Mdt - Come si è evoluto negli anni il rapporto con GB Trucks? Mecozzi - Il rapporto ha avuto inizio nell’anno 2018 con l’acquisto della prima pala meccanica Liebherr L550 ed è proseguito con l’acquisto dei tre trattori stradali DAF. Nel 2020 abbiamo acquistato altre 2 pale meccaniche Liebherr L550 e nel 2021 un escavatore R 922.

Mdt - Qual è la “chiave di differenza” che convince Inerti Bomarzo nella partnership con GB Trucks? Mecozzi - La differenza essenziale è data dai “brand” rappresentati e trattati da GB Trucks, ma sicuramente conta anche la struttura che affianca la vendita dei mezzi. Il postvendita dedicato alle manutenzioni, sia programmate che straordinarie, riveste per noi un’importanza primaria per gestire con la massima efficacia gli eventuali periodi di fermo macchina. Un altro aspetto del rapporto che riteniamo importate è che esso debba essere basato sulla reciproca fiducia”.

Qui e in alto, panoramica dei mezzi di Inerti Bomarzo.

Mdt - Come si caratterizza la più recente fornitura? Mecozzi - È attualmente in fase avanzata l’acquisto di un escavatore cingolato Liebherr

iNerti BoMarzo

Uffici amministrativi: Loc. Pascolaro, Graffignano (VT) Fondazione: metà anni Sessanta Titolare: Valentino Mecozzi Attività: estrazione, lavorazione e vendita materiale inerte; raccolta, recupero e vendita di fresato di asfalto; betonaggio per la produzione di conglomerati cementizi; scavi e movimento terra; esecuzione lavori pubblici. Flotta: una ventina di mezzi tra autocarri, pale meccaniche, dozer ed escavatori Dipendenti: 20 Fatturato: 3 milioni di euro (2020) Internet: inertibomarzo.it Mail: info@inertibomarzo.it

modello R922, dotato dalla fabbrica di attrezzature e software per la gestione e il controllo della produzione e avente tutte le caratteristiche utili per usufruire delle agevolazioni “Industria 4.0” .

Mdt - Quali sono le attuali dimensioni di Inerti Bomarzo? Mecozzi - Attualmente, la società dispone di una cava sabbia, ghiaia e argilla, di impianti di frantumazione, lavaggio e selezione degli inerti e di recupero del fresato d’asfalto e di un impianto per il preconfezionamento del calcestruzzo, sito nel territorio di Viterbo, in zona industriale Poggino. Il fatturato del 2020, tenuto conto del complesso andamento che ha caratterizzato l’anno a causa della pandemia da Covid-19, si attesta a circa 3 milioni di euro. Il numero dei dipendenti diretto della società è pari a 20 unità.

Mdt - Quali rotte e percorrenze effettuano i trattori stradali? Quali caratteristiche devono avere per soddisfare le necessità dell’azienda? Mecozzi - Le destinazioni dei trattori stradali sono essen-

zialmente mirate alla consegna dei nostri prodotti ai clienti destinatari, prevedono percorsi oltre che nella provincia di Viterbo, sede dell’azienda, anche nelle province limitrofe e nelle Regioni confinanti con il Lazio, quali Toscana e Umbria. La percorrenza media annua è di circa 70mila km. Le caratteristiche dei trattori più apprezzate dall’azienda sono i consumi contenuti e la minore incidenza possibile delle manutenzioni straordinarie, sia in termini di costo sia in termini di frequenza di intervento, visto il lavoro gravoso cui sono sottoposti i mezzi in relazione al tipo di attività svolta.

Mdt - Sono previsti ulteriori investimenti sul parco da qui al 2022? Mecozzi – Prevediamo che nell’esercizio 2022, oltre l’usuale politica della società di rinnovo ciclico delle immobilizzazioni tecniche, intese come attrezzature e mezzi, con l’apertura della nuova cava di pozzolana la società si dovrà dotare di altri autocarri e macchine operatrici, in progressione e in rapporto con il conseguimento di ulteriori fatturati.


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 13

SIFÀ / PARTNERSHIP CON BONERA GROUP PER OFFRIRE SERVIZI DI NOLEGGIO

Vantaggi per i professionisti bresciani

I

FABIO BASILICO BRESCIA

STORICA SOCIETÀ DI CONCESSIONARIE UFFICIALI DI VENDITA E ASSISTENZA AUTO E MOTO DEI PIÙ PRESTIGIOSI MARCHI INTERNAZIONALI, E

SIFÀ (SOCIETÀ ITALIANA FLOTTE AZIENDALI) DEL GRUPPO BPER BANCA SI È CONCRETIZZATA LA POSSIBILITÀ DI OFFRIRE UN SERVIZIO COMPLETO E QUALIFICATO DI VEICOLI A NOLEGGIO, PROGETTATO SU MISURA PER

Da sinistra: Francesco Bonera, titolare di Bonera Group; Stefano Vittorio Kuhn di BPER Banca; Paolo Ghinolfi, Ad di SIFÀ.

tento a intercettare le esigenze di famiglie e imprese del territorio bresciano in termini di innovazione e completezza di offerta, rivolgendosi a interlocutori capaci e innovativi come Bonera Group - dichiara Stefano Vittorio Kuhn, Coordinatore Regionale Lombardia di BPER Banca - Il nostro Gruppo è l’unico che comprende tra le proprie società prodotto un’azienda di noleggio a lungo termine a copertura nazionale: insieme a SIFÀ abbiamo intrapreso un percorso di crescita che ci sta dando grandi soddisfazioni. In BPER Banca riteniamo che anche questo sia essere ‘Vicina. Oltre le attese’”. “Il sodalizio tra SIFÀ e il Gruppo Bonera - commenta Paolo Ghinolfi, Amministratore delegato di SIFÀ - nasce da una condivisione di strate-

gie e visioni comuni. Ci accomuna innanzitutto la vicinanza al territorio. Siamo un’azienda che fa dell’italianità e del servizio sartoriale al clien te i suoi punti di forza distintivi, e con queste premesse ci poniamo l’obiettivo di diventare sempre più un punto di riferimento per garantire alla clientela la migliore esperienza nel percorso di noleggio di una vettura. Siamo grati sia al Coordinatore Commerciale Territoriale per la Lombardia di BPER Banca Stefano V. Kuhn, che ha contribuito con successo alla nascita di questo progetto, sia al Gruppo Bonera con cui la collaborazione è stata da subito molto positiva comprendendo, oltre allo sviluppo di un nuovo business, anche tutta la parte di post-vendita e assistenza al cliente. Grazie a

questa partnership potremo valorizzare i reciproci punti di forza, facendo leva su tutte le risorse disponibili per metterci al servizio del territorio, a beneficio soprattutto del cliente finale”. La grande differenza che la partnership potrà “far toccare con mano” ai futuri fruitori di una vettura a noleggio è che beneficeranno di tutta la competitività dei canoni dei grandi player, senza i disagi dei rapporti di noleggio con gli stessi che, per ovvie economie di scala, si appoggiano a call center e strutture di assistenza non ufficiali o comunque di natura generica. Nello specifico, questo rapporto garantirà la competitività di un grande player nazionale abbinata alla professionalità e cura del cliente di un player locale con la sua copertura

territoriale, a prescindere dal marchio della vettura noleggiata. “È motivo di grande orgoglio e soddisfazione - sottolinea Francesco Bonera, titolare di Bonera Group avere avuto la fiducia di BPER banca e del suo Coordinatore Commerciale Territoriale per la Lombardia, Stefano V. Kuhn, nell’appoggiare con entusiasmo questo progetto per il territorio di Brescia. Ha consentito al Gruppo Bonera di incrociare la propria visione con SIFÀ, player relativamente giovane rispetto ad altri più radicati, ma che si contraddistingue per dinamismo, etica, cura del cliente e social responsibility: valori in cui il Gruppo Bonera si ritrova pienamente. Il motivo che ha spinto a intraprendere una partnership con la sottoscrizione del mandato di

SODDISFARE LE SPECIFICHE NECESSITÀ DI OGNI SINGOLO CLIENTE, DALLE AZIENDE AGLI ENTI PUBBLICI AI PRIVATI.

agenzia è che sicuramente, per il Gruppo Bonera, avere una leva aggiuntiva che consenta di mantenere aperto il rapporto con il tessuto di grandi aziende, Pmi, Partite Iva e privati (che per motivi vari potrebbero anche non scegliere l’attuale portafoglio prodotti del Gruppo) è un plus che può solo rafforzare i rapporti con il tessuto sociale e imprenditoriale”.

www.aceservices.it

l noleggio porta con sé interessanti opportunità di crescita. È stata presentata a Brescia, nella sede del Museo della Mille Miglia, la nuova partnership tra Bonera Group e SIFÀ, società di noleggio a lungo termine del Gruppo BPER Banca. La partnership riguarda l’offerta sul territorio della provincia lombarda di un nuovo servizio di noleggio a lungo termine di veicoli a 360°. Il sodalizio nasce all’insegna della condivisione di valori comuni e di una vicinanza alle realtà del territorio, dalle imprese ai professionisti, alle famiglie, con l’obiettivo di intercettarne le esigenze e mettere a disposizione soluzioni di mobilità personalizzate e innovative. Grazie all’incontro di Bonera Group, storica società di concessionarie ufficiali di vendita e assistenza auto e moto dei più prestigiosi marchi internazionali, e SIFÀ Società Italiana Flotte Aziendali, capillarmente presente su tutto il territorio nazionale, al 100 per cento di BPER Banca - si è concretizzata la possibilità di offrire un servizio completo e qualificato di veicoli a noleggio, progettato su misura per soddisfare le specifiche necessità di ogni singolo cliente. Un servizio pensato per assicurare ad aziende, enti pubblici, professionisti e privati, il massimo gradimento in relazione alle proprie aspettative, che comprende anche tutta la parte, fondamentale, di post-vendita e assistenza al cliente. L’esperienza di SIFÀ, l’affidabilità di BPER Banca e il dinamismo di Bonera Group rappresentano le punte d’eccellenza del nuovo progetto. “Con questa partnership il Gruppo BPER si conferma at-

GRAZIE ALL’INCONTRO DI BONERA GROUP,

IL TUO CARICO IN MANI SICURE 100% ITALIANA TESTATA, SICURA E AFFIDABILE COMPONENTI DI ALTA QUALITÀ

PER IL TUO CARICO SCEGLI ANTEO, SPONDE CARICATRICI DAL 1969

www.anteo.com /AnteoTailLifts

RICAMBI ORIGINALI ENTRO 24H IN TUTTO IL MONDO • OLTRE 130 MODELLI, ANCHE PERSONALIZZABILI • CENTRI DI ASSISTENZA IN EUROPA E NEL MONDO

/ANTEOSALES


IL MONDO DEI TRASPORTI

Pagina 14

N° 302 / Settembre 2021

ESPOSITO / IVECO UNICO BRAND DELLE AZIENDE CHE FANNO

I Partner Ideali per

N

MAX CAMPANELLA MARCIANISE

ei primi Anni Novanta è solo uno dei “ragazzi delle consegne” che, da Marcianise, in provincia di Caserta, raggiungevano tutti i giorni i quartieri di Napoli. Per Giuseppe Gaglione, classe 1966, quella è stata una severa scuola sul campo: al volante dei furgoni tra magazzini e difficoltà di sosta per la consegna della Coca Cola, il giovane Gaglione trova affasci-

nante il lavoro dell’autista, dimostrando tanta buona volontà. È da quella passione che, negli anni, al servizio di BRT (ex Bartolini, oggi azienda del Gruppo DPD), si sviluppa quella che oggi è una holding che, attraverso varie diramazioni societarie, si occupa di servizi logistici (G-Log), trasporti e noleggio (Ideal Partners, Trasporti Capone e EL.AN), contando 80 veicoli, 70 dipendenti e circa 26mila mq suddivisi in tre magazzini. Un’attività per la quale Ga-

glione ha sempre scelto veicoli Iveco, rafforzando dal 2009, quando inizia l’operatività in Toscana, la partnership con la Concessionaria Esposito, trovando in Nicola Di Maio, ven ditore veicoli industriali del dealer, il suo riferimento a 360 gradi, dai Daily per le consegne last mile al medio Eurocargo al trattore per il lungo raggio. La svolta per Gaglione arriva quando, lasciato il posto in fabbrica, inizia come guardia giurata in BRT. “Il caso

volle - spiega l’imprenditore casertano - che, a fronte di un problema proprio su Marcianise, il direttore mi chiese se potevo occuparmi io della con segna. Naturalmente accettai subito”. Tutto inizia da quel “caso”: Gaglione acquista un Iveco Daily 35 Squalo; di notte fa sorveglianza, di giorno le consegne. Il management BRT non può che notare favorevolmente quel giovane, intuendone le potenzialità: “Un’azienda - afferma Gaglione - che mi ha dato e

Nicola Di Maio (a sinistra), Venditore Veicoli Industriali della Concessionaria Iveco Esposito, e Giuseppe Gaglione, Amministratore del Gruppo Ideal Partners. Alle loro spalle, nel riquadro, il mitico Diego Armando Maradona con la maglia del Napoli Calcio.

continua a darmi tanta soddisfazione: BRT cresce facendo crescere i suoi fornitori”. La prima azienda di trasporto che l’imprenditore mette al servizio di BRT è Tonia Trasporti, dal nome della moglie Tonia Maiorino. Quando il business continua a crescere, negli anni al suo posto prendono vita le quattro attuali aziende, nelle quali Gaglione opera con i tre figli Gabriele, 28 anni, Pasquale, 26, e Alessandro, 24. “La crescita - puntualizza l’imprenditore - è tutta dovuta ai dipendenti, alle persone che hanno creduto in me. E sono tante”. Tra queste Carmine Fulgieri, autista da sempre alle sue dipendenze, che volentieri ci porta alla scoperta della nuova fornitura di veicoli Iveco, guidandoli nel piazzale di G-Log. Questa la denominazione con la quale Gaglione oggi si occupa di ser vizi logistici, mentre in Calabria, a Olbia e Marcianise opera la Trasporti Capone, presieduta da Gabriele. Capogruppo della holding è Ideal Partners, che ha sede legale a Casciana Terme, in provincia di Pisa, sede operativa a Capodrise, nel Casertano, e tre filiali in Friuli Venezia Giulia dove opera. Ideal Partners effettua servizi di trasporto e noleggio per l’altra società del gruppo, EL.AN, sede a Marcianise, operativa a Pisa. Il gruppo è uno dei corrieri di riferimento di BRT (controllata per l’85 per cento da La Poste attraverso DPD), per cui effettua servizi di trasporto espresso e di logistica. “Attraverso BRT - precisa Gaglione - serviamo brand quali Caffè Borbone, UCM, Clayton di Essemoda, trasportando dal caffè all’elettronica all’abbigliamento. Al trasporto affianchiamo il servizio di logistica per clienti BRT che,

avendo testato la nostra capacità organizzativa, si affidano a noi consapevoli di fare riferimento a un’azienda strutturata e costituita di persone responsabili: tutti ragazzi davvero eccezionali”. Accanto a Gaglione, una squadra di sei preposti sono a capo delle rispettive divisioni, avendo ciascuno la responsabilità di veicoli e autisti operativi nel proprio reparto. SI PUNTA AL METANO

Ampiamente diversificata la flotta: nelle 80 unità troviamo furgoni da 3,5, motrici con casse in plywood e trattori. “Dalle nostre sedi - continua Gaglione - ogni giorno i veicoli raggiungono le filiali BRT, dove caricano ed escono per le consegne. Con i bilici effettuiamo il ritiro da clienti di partite di grosse dimensioni o il navettaggio tra filiali BRT”. Tra le rotte, i pesanti Ideal Partners viaggiano sulla tratta Pisa-Parma, Marcianise-Roma e tutti giorni raggiungono il CIS di Nola per le spedizioni su pallet. Le motrici, per lo più da 9,5 metri, coprono le zone industriali, mentre i furgoni sono utilizzati per i centri urbani. Azienda particolarmente attenta all’impatto ambientale, BRT punta sull’alimentazione a metano, con un rebranding dei veicoli così alimentati che, dal classico rosso BRT, sono invece totalmente bianchi. Sull’onda di tale focus, Ideal Partners quest’anno ha inserito in flotta cinque mezzi a metano (una motrice Eurocargo e quattro Daily), ai quali si aggiungono, sempre quest’anno, due Daily Euro VI. Una fornitura seguita dalla Concessionaria Esposito, storico riferimento di Gaglione per l’approvvi-


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 15

CAPO ALL’IMPRENDITORE CASERTANO GIUSEPPE GAGLIONE

le consegne espresso CLASSE 1966, GIUSEPPE GAGLIONE INIZIA GIOVANISSIMO NELLE CONSEGNE, LASCIANDO IL POSTO IN FABBRICA PER DEDICARSI AL MESTIERE DI AUTISTA.

DI NOTTE GUARDIA GIURATA, DI GIORNO AL VOLANTE: I SACRIFICI VENGONO RIPAGATI DA UNA CRESCITA COSTANTE CHE, NELL’ULTIMO DECENNIO, HA VISTO TRIPLICARE VOLUMI E PARCO MEZZI.

AL SUO

FIANCO IL DEALER DI

NAPOLI, NELLA NICOLA DI MAIO, CHE CON

PERSONA DI

GAGLIONE CONDIVIDE LA PASSIONE PER I CAMION E NON SOLO.

gionamento di veicoli. “Quale costruttore nazionale - precisa l’Amministratore - Iveco è l’unico brand della flotta. Negli anni con Esposito si è instaurato un rapporto di fiducia e amicizia: grazie alla rete efficiente di Iveco, se c’è un pro blema al veicolo, anche fuori zona, la comunicazione è immediata e veloce e il problema viene risolto subito. Questo è per noi l’aspetto più importante ed è la vera “chiave di differenza” del servizio di Iveco Esposito, oltre all’af-

fidabilità dei mezzi: i nostri veicoli raggiungono anche zone impervie, ad esempio di montagna; di sicuro, un veicolo quando entra nel nostro parco deve dimostrare tutte le sue doti di resistenza e efficienza nel tempo”. Il gruppo Ideal Partners è fortemente cresciuto negli ultimi dieci anni, in termini di business e veicoli. Nel primo caso, il fatturato è praticamente triplicato rispetto al 2010: Ideal Partners ha chiuso il 2020 con 1,5 milioni, Traspor-

ti Capone con 1,2, EL.AN con 800mila euro. E la crescita è tutt’altro che ferma. “Ogni anno - precisa Gaglione - ci attestiamo su un incremento del 20 per cento: quest’anno contiamo sull’ottenimento di un’ulteriore com messa da parte di BRT, che ci porterà a crescere ulteriormente e ad aumentare il numero di veicoli. In particolare ci serviranno dei bilici: l’utilizzo dell’Eurocargo a metano ci permette di sperimentare questo tipo di trazione anche su tragitti più

lunghi e non escludiamo di portare su strada trattori pesanti a LNG”. DALLA TOSCANA CON FURORE

Riferimento della Concessionaria per Ideal Partners è Nicola Di Maio, Venditore Veicoli Industriali di Esposito, che condivide con Gaglione la passione per il calcio (per meglio dire, l’amore per il Napoli), oltre che quella per i camion. “Il rapporto com-

merciale - afferma Di Maio si è rafforzato nel 2009, quando Gaglione ha avviato l’attività in Toscana. In questi anni si è instaurato un rapporto di amicizia. Di certo, il nuovo Daily che, come dice il claim, ha superpoteri come Superman, ha rappresentato per loro la chiave di volta: un mez zo sicuro, affidabile, in grado di andare ovunque. È quello di cui hanno bisogno Gaglione e il suo team, forti co me sono nelle consegne giornaliere”.

Negli anni, Di Maio e il dealer Esposito hanno accompagnato lo sviluppo di Ideal Partners, oggi divenuta realtà di rilievo sul panorama nazionale. “Il punto di forza Iveco - aggiunge Di Maio - è rappresentato da veicoli adatti e versatili, oltre che una Rete che, di fatto, consente a Gaglione di avere la certezza che, ovunque si trovino, in caso di necessità i veicoli sono seguiti dall’assistenza Iveco, quindi il servizio è sempre lo stesso e di alta qualità”.

Al volante di un nuovo Iveco Eurocargo, fornito dalla Concessionaria Esposito, Carmine Fulgieri, autista di Ideal Partners sin dall’inizio della fondazione dell’azienda casertana.

Gruppo ideal partNerS Sede operativa principale: Marcianise (CE) Amministratore: Giuseppe Gaglione Merce trasportata: Corriere espresso e logistica Flotta: 80 mezzi (gruppo) Dipendenti: 70 (gruppo) Fatturato 2020 (euro): 3,5 milioni di euro (solo trasporto)


IL MONDO DEI TRASPORTI

Pagina 16

N° 302 / Settembre 2021

AR98 / IN ROMAGNA I PRIMI CAMION CHE VIAGGIANO SOLO CON BIO-LNG

Rattini si certifica sostenibile D

MAX CAMPANELLA

GLI IVECO S-WAY NATURAL POWER DELLA FLOTTA, GRAZIE ALL’INTEGRAZIONE DI UN ACCORDO CON LA ROMAGNOLA VULCANGAS, D’ORA IN AVANTI VIAGGERANNO A BIOMETANO PRODOTTO DALLA LODIGIANA LUCRA 96. NON SOLO: LA VALIDAZIONE RINA FA OTTENERE CREDITI DI CO2, CHE AR 98 PUÒ RIVENDERE O UTILIZZARE PER BILANCIARE EVENTUALI EMISSIONI INTERNE ALL’AZIENDA. NON NE AVRÀ BISOGNO CONSIDERANDO MULETTI ELETTRICI E PANNELLI SOLARI THERMO KING SUI SEMIRIMORCHI.

SANTARCANGELO DI R.

a “grande inquinante” di CO2, AR98, azienda di trasporti con headquarter a Santarcangelo di Romagna, in provincia di Rimini, diventa addirittura venditrice di carbon credit, certificati dallo Stato italiano per non emettere più CO2 nell’atmosfera. Angelo Rattini, vulcanico fondatore e timoniere dell’azienda romagnola, per primo in Italia ottiene la certificazione di utilizzo esclusivo di BIO-LNG per alimentare i 41 camion della flotta. Il biometano per i veicoli AR98 viene prodotto dalla lodigiana Lucra 96, fornitore certificato per la produzione di biometano sostenibile, mentre la somministrazione avviene a cura di Vulcangas, finora fornitore per AR98 di LNG. Tra le più dinamiche realtà nel trasporto dell’alimentare deperibile nel Centro-Nord Italia, specializzata nel servizio alle maggiori catene della GDO e a grossisti, come sin-

Angelo Rattini, titolare della AR98.

tetizzato nel nome l’azienda nasce nel 1998 per volontà di Angelo Rattini, tuttora alla guida occupandosi di scelte strategiche, acquisti e accordi commerciali; al suo fianco la moglie Francesca, che si occupa della gestione amministrativa, e la figlia Rachele, 25 anni, che dopo il diploma ha iniziato come “tuttofare” per apprendere sul campo, mossa dalla spontanea passione per il settore, e diventare

riferimento della logistica per il parco mezzi (34 trattori e sette motrici) e gli 86 autisti. L’altro figlio Raffaele - una laurea all’Università Cattolica di Milano, conseguita con una tesi sulla nascita di AR98 come esempio virtuoso di capacità imprenditoriale - dopo un breve periodo in azienda ha scelto un percorso da manager finanziario per un’importante realtà immobiliare campana ed è socio di Green

L’azienda di Sant’Arcangelo di Romagna è diventata venditrice di carbon credit, certificati dallo Stato italiano.

Project, start-up fondata per la gestione di un’azienda agricola a chilometro zero del Cesenate, che consegna a domicilio frutta e verdura fresca di sua produzione. Ogni giorno i 41 veicoli di AR 98 trasportano in media 4mila pallet. “Il 2020 - spiega Rachele Rattini - per noi ha significato un anno di lavoro fortemente cresciuto: fatti due conti, ogni giorno abbiamo trasportato alimentari per 4 milioni e mezzo di persone, l’equivalente della popolazione dell’Emilia-Romagna”. L’anno della pandemia si è chiuso con un fatturato di circa 14 milioni di euro, in aumento del 10-12 per cento rispetto al 2019; nei primi sei mesi dell’anno in corso, il trend è in crescita di un ulteriore 18 per cento. Qualità e ecosostenibilità sono i pilastri attorno ai quali si muove AR98 nel suo sviluppo, ottenendo il massimo standard certificativo su scala mondiale per la gestione della salute e della sicurezza sul lavoro. Tra i committenti nomi del calibro di Amadori, Conad, Coop, Carrefour, Lidl, In’s, Pam, Eurospin, Marr. Nel 2016 l’inizio di un percorso “green”, con una flotta di veicoli rinnovati ogni tre anni, in massima parte a marchio Iveco. Oggi l’ammiraglia è S-Way NP (Natural Power), finora alimentata a LNG in collaborazione con Vulcangas, con cui è stato stretto un accordo modificativo del contratto di somministrazione. “Quest’anno - spiega Angelo Rattini - è previsto il ritiro di 20 tonnellate di BIO GNL, ovvero biometano dalla produzione certificata Csqa, sistema nazionale di certificazione della sostenibilità dei biocarburanti e bio liquidi”. Il biometano viene prodotto da Lucra 96, azienda

di Villanova del Sillaro, in provincia di Lodi. “Effettuando un po’ di calcoli sulla flotta - prosegue Rattini - considerando sia veicoli LNG sia veicoli diesel, per 645mila km complessivi, nel primo caso registriamo una riduzione di CO2 di 17.410 kg, che nel secondo salgono a 433.231 kg: ci vogliono 2.900 alberi per assorbire la CO2 addizionale emessa dai veicoli diesel. Se si considerano gli altri inquinanti, i NOx scendono del 44 per cento, il valore del pm è praticamente annullato con -99 per cento”. La riduzione delle emissioni è stata certificata Iso 14064-2, secondo validazione e verifica indipendente del progetto di flotta mezzi a biometano. “È stato possibile illustra l’imprenditore romagnolo - certificare la sostenibilità grazie alla scelta di AR 98 di utilizzare una flotta di mezzi a biometano dando risalto alla riduzione delle emissioni di CO2: abbiamo predisposto ogni documentazione a descrizione del progetto, che è stato validato e verificato dall’ente RINA. Questo ci consente di ottenere crediti di CO2, che possiamo rivendere o utilizzare per bilanciare eventuali emissioni interne all’azienda”. Che in realtà sono sempre meno: i semirimorchi sono equipaggiati con pannelli a energia solare, sulla base di una partnership con il produttore di gruppi frigoriferi Thermo King; per movimentare le merci vengono utilizzati muletti elettrici, totalmente ecologici grazie all’utilizzo di batterie a piombo liquido; sul tetto del capannone di Santarcangelo - acquistato due anni fa - è stato inserito un impianto fotovoltaico, che consente un risparmio di 28 t di CO2 l’anno.

ar98

Sede operativa principale: Santarcangelo di Romagna (RN) Presidente: Angelo Rattini Merce trasportata: Alimentare deperibile Flotta: 34 trattori + 7 motrici Dipendenti: 86 autisti Fatturato 2020 (euro): 14 milioni di euro Sito internet: rattinitrasporti.altervista.org


TAKE CHARGE in carica per un trasporto a prova di futuro

Scopri la nuova gamma Scania di veicoli ibridi ed elettrici. Visita il sito: www.scania.it


IL MONDO DEI TRASPORTI

Pagina 18

N° 302 / Settembre 2021

EURO CO.M.I. / IL GRUPPO SASSARESE DA OGGI PRESIDIA

Dalla Sardegna alla

S

CRISTINA ALTIERI SASSARI

e le necessità aguzzano l’ingegno, le risorse mentali di Pasquale Taula devono essere particolarmente allenate, viste le condizioni straordinarie nelle quali si è trovato a operare nei suoi primi vent’anni di vita lavorativa. Innamorato della sua terra, della sua famiglia e della sua azienda il giovane imprenditore, classe 1978, ha fin qui dovuto vedersela con un paio di ostacoli di quelli per cui a essere po co meno motivati si cambia strada. E invece il carattere e le capacità di una famiglia che negli ultimi cinquant’anni si è affermata come la prima realtà sarda nella rivendita e nel trasporto di carburante sul territorio dell’isola evidentemente gli appartengono. La sua concessionaria ha superato brillantemente i periodi di crisi, e ha forse trovato anche un modo per neutralizzare il disagio di essere nata dalla parte “sbagliata” del Tirreno. “La Sardegna è il posto più bello del mondo dove vivere inizia a raccontare Taula - ma costruire un progetto che abbia un respiro regionale è difficilissimo. Una concessionaria qui deve necessariamente disporre di due se non di tre sedi per presidiare un mercato che in continente non ne giustificherebbe neanche una”. Non poteva non averci pensato il padre Felice, oggi 76 anni, quando nel 2000 lanciava l’intuizione per costituire Euro CO.M.I.: contava presumibilmente sulla bravura del figlio per i capitoli successivi, fiducia che poi si rivelerà ben riposta. Ma dall’inizio: Felice Taula insieme ai due fratelli e al braccio destro Gavino Fresu “l’anello di congiunzione tra

vecchia e nuova guardia” gestisce la Transport, azienda diventata dagli Anni Settanta a oggi leder in Sardegna nel settore della rivendita e del trasporto di carburante. “È il business storico della mia famiglia - spiega Pasquale - è molto conosciuta, ha una rete di impianti in tutta l’isola e movimenta ogni tipologia di carburante: dal gasolio per riscaldamento a quello agricolo, da quello per gli alberghi a quello nautico”. L’idea della

concessionaria si innesta dunque sull’operosità di uomini dalla tempra presumibilmente eccezionale, visto che tra l’altro papà e zii sono tutti “villagrandesi doc”. E cioè? “Cioè sono tutti nati a Villagrande Strisaili, il paese al mondo con la più alta longevità maschile. Oggi hanno 82, 76 e 74 anni e sono tutti e tre al cento per cento operativi. Andiamo d’accordo, ma mio padre è stato molto previdente nel voler creare una realtà se-

parata che permettesse a figli e nipoti di ritagliarsi uno spazio indipendente. Poi chissà per quanto ancora si venderà il carburante, mentre i camion, che siano diesel o elettrici, continueranno a servire”. PASSIONE ORANGE

Papà Felice è innamorato di DAF: la Transport oggi lavora con 40 autobotti, tutte

con il marchio olandese sul frontale, e questo ne fa il cliente più importante in Sardegna. Un territorio sul quale a fine millennio ci si rende conto che manca un concessionario dal lontano 1992. “Nel 2000 - prosegue Pasquale - arriva la proposta di diventare concessionari DAF. La accogliamo e iniziamo il nostro percorso aprendo la prima sede, quella di Sassari. Nel 2003 mi laureo in Economia e Commercio e inizio a

Alcuni veicoli sul piazzale. Nella foto in alto, Pasquale Taula, Amministratore delegato di Euro CO.M.I., con il padre Felice.

lavorare in entrambe le aziende, Transport ed Euro CO.M.I. Ben presto vengo però assorbito dalla concessionaria della quale divento amministratore delegato nel 2007”. All’inizio non è semplice, si tratta per i Taula di un altro mestiere, c’è da organizzare una rete di vendita e soprattutto l’assistenza. “Quando finalmente - riprende Pasquale - la Euro CO.M.I. raggiunge una certa maturità e un buon livello organizzativo, grazie anche al coinvolgimento di flottisti e padroncini già clienti della nostra famiglia, nel 2007-2008 arriva la crisi. Ci investe in pieno: in Sardegna le immatricolazioni di veicoli industriali da circa 650 nei 12 mesi, crollano in quegli anni a meno della metà. Nel 2011 vengono venduti 150 camion. La Euro CO.M.I. prende in considerazione la possibilità di chiudere i battenti. E invece arriva Mercedes”. La Stella in quel periodo sta ristrutturando la rete in tutta Italia e bussa alla porta di Pasquale con una proposta di mandato. “È stato uno stimolo a rialzarci - continua il numero uno dell’azienda - anche perché Mercedes significava non solo truck ma anche van. E così dopo dieci anni siamo di nuovo ripartiti da zero, perché come vendere camion è differente da trasportare carburante, allo stesso modo vendere truck e vendere van sono due attività profondamente diverse”. E infatti i Taula, precorrendo i tempi rispetto a quanto disposto successivamente da casa madre con il progetto “Dedication”, decidono di separare l’ambito industriale da quello commerciale. “Era giunto in azienda mio cugino Marco, con la sua grande esperienza internazio-


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 19

ANCHE SETTE PROVINCE TOSCANE E TRE LIGURI

conquista del Continente PER PROCEDERE CONTROCORRENTE CI VUOLE CORAGGIO E DETERMINAZIONE, DOTI CHE SONO EVIDENTEMENTE SCIVOLATE NEL DNA DI

PASQUALE TAULA DIRETTAMENTE DA QUELLO DEL PADRE

FELICE. CONCESSIONARI DAF E MERCEDES PER LA SARDEGNA, OGGI I TAULA PIANTANO PER IL MARCHIO OLANDESE UN AVAMPOSTO IN

TOSCANA, QUANDO STORICAMENTE SONO LE AZIENDE DELLA PENISOLA AD ATTRAVERSARE IL MARE PER PORTARE LA LORO BANDIERA NEL “POSTO PIÙ BELLO DEL MONDO”.

Qui sopra al lavoro, Marco Taula, Direttore Commerciale Van di Euro CO.M.I..

nale in consulenza strategica: stabiliamo di spartirci la gestione, lui si aggiudica i van e io da “vecchio ca mionaro” (nel 2011 Pasquale ha 33 anni) prendo i truck”. Non tutti sono convinti della scelta di assumersi la responsabilità un altro marchio, ma Pasquale non ha dubbi: bisogna crescere. “Quando abbiamo assunto il doppio mandato qual-

cuno ha storto il naso, i venditori temevano di mettere in imbarazzo il cliente. Ma i due prodotti si posizionano in modo diverso, Mercedes ha una grande expertise nel cava-cantiere, DAF è leader nei trattori. Ho detto: lasciate che sia il cliente a prender la decisione. Devo dire che nessuno ha mai provato il minimo imbarazzo nel poter sce-

gliere tra due marchi tanto validi”. L’azienda cresce. Nel 2013 Euro CO.M.I. apre la sede a Cagliari, la piazza più importante sul territorio sardo, e l’anno dopo viene inaugurato un ufficio commerciale ad Olbia in collaborazione con la concessionaria vetture Autoelegance. “È stato sopratutto per dare supporto ai clienti

van, in quella zona c’è una forte richiesta di Classe V per i servizi turistici: abbiamo posizionato un venditore dedicato che ha fatto ottimi numeri. Oggi i van vanno benissimo, con lo Sprinter endotermico doppiamo gli obiettivi, mentre c’è ancora molta reticenza a passare all’elettrico”. Nel resoconto del “rollercoaster” aziendale manca ancora l’ultimo capitolo, quello interpretato dall’infausto 2020 ma anche qui - lo anticipiamo in barba alla suspence - si va giù e poi si risale. “Dal 2016 al 2019 abbiamo chiuso in modo costante attestandoci sui 19 milioni di euro di fatturato. Nel 2020 abbiamo perso il 20 per cento. Il 2021 è iniziato bene come raccolta ordini, poi però è intervenuto il problema della produzione. Per fortuna i clienti comprendono che non è un problema di DAF o di Mercedes, è che mancano proprio le materie prime. Chi ordina oggi un veicolo nuovo deve attendere almeno fino a fine anno”. E proprio ad inizio pandemia Pasquale inizia a dialogare con DAF relativamente ad un disagio che l’imprenditore sente di aver bisogno di risolvere. “Il mio mal di pancia spiega l’AD di Euro CO.M.I. - era dovuto ad una preoccupazione circa la nostra stessa sopravvivenza. Eravamo per

entrambi i marchi tra le realtà più piccole in Italia, e non certo per volontà o per mancanza di impegno. Avere dimensioni ridotte oggi non è sostenibile, è penalizzante. Nel rapporto con le major è necessario avere i numeri per sedersi al tavolo dove si dialoga, senza dimenticare che i marchi possono ritenere non conveniente aprire un nuovo mandato se il mercato è troppo ristretto e preferiscono magari estenderne uno già esistente. La Sardegna totalizza 250 immatricolazioni all’anno. Assicurandoci una quota del 10-12 per cento noi oggi consegniamo 25-30 camion all’anno a marchio. Nel resto d’Italia è la soglia minima per un venditore, ma noi siamo un’azienda da 40 persone”. Taula inizia quindi il ragionamento con DAF: il brand ha aree libere in continente e propone all’imprenditore sassarese di occuparsi della zona Nord della Toscana per una copertura si 7 province su 10. Si tratta di un territorio importantissimo per l’economia nazionale, un mercato da 1000 mezzi all’anno, tra l’altro contiguo a quello della Sardegna. Taula naturalmente coglie al volo l’occasione e dal 1° giugno la Euro CO.M.I. è concessionaria ufficiale DAF anche per il Nord

della Toscana, con l’impegno a strutturarsi entro l’anno con una sede - già individuata a Pisa - e un numero di venditori e meccanici adeguato. “Mia sorella Anna verrà coinvolta in modo importante nella gestione della filiale di Pisa. Ha un’esperienza pluridecennale nel marketing e si occupa già degli aspetti amministrativi di Ca gliari: vivendo a Parma, a 150 km dalla nostra nuova sede, avrà la possibilità di essere presente con la sua grande competenza”. IL MERCATO SI ALLARGA

“Storicamente sono i concessionari toscani a seguire la Sardegna - aggiunge con una punta di sano orgoglio Pasquale - questa volta succede il contrario. E non è finita qui: DAF, senza che domandassimo nulla, ci ha chiesto di seguire con un nostro commerciale un progetto pilota in Liguria: verrà valutato a medio termine e in un primo momento non apriremo una sede fisica. Il lavoro però sarà importante perché ci occuperemo della vendita dei veicoli in tre province su quattro: è un territorio che vale tutta la Sardegna”. In definitiva tra poche settimane Pasquale, Marco, Anna e i loro team passeranno da un mercato da 300 mezzi a un territorio che complessivamente ne vale 1.600 circa. A regime l’organico della Euro CO.M.I. aumenterà dai quaranta dipendenti di oggi ad una cinquantina mentre, secondo le previsioni, il fatturato dovrebbe crescere dai 19 milioni sui quali si era attestato nel periodo ante Covid19 a 25. “Nel 2021 - conclu-

de Pasquale Taula - abbiamo preso anche il mandato Piaggio Commercial per il Nord della Sardegna. Le vendite stanno procedendo bene, anche qui in particolare nel settore turistico. I prossimi mesi saranno decisivi e impegnativi: tra i vari progetti che stiamo definendo c’è la nuova sede di Cagliari, abbiamo già l’autorizzazione comunale e stiamo per partire”. “Il nostro segreto? Come tutti a ogni bivio abbiamo dovuto prendere una decisione. Carburanti o camion, truck o van, un mandato o due, piccoli o grandi: evidentemente - sorride Pasquale - finora non siamo andati troppo fuori strada. Lo vedo anche nello sguardo soddisfatto di mio pa dre, e questo mi dà una grande gioia. Il merito, se siamo arrivati qui, è soprattutto suo”.

DAF / PIÙ DI MILLE ORDINI PER LA NUOVA GENERAZIONE DI VEICOLI PER LA LUNGA DISTANZA

Tutti pazzi per XF, XG e XG+, ammiraglie che macinano chilometri A meno di un mese dal lancio ufficiale, DAF ha già ricevuto oltre 1.000 ordini per i suoi veicoli XF, XG e XG+ di nuova generazione. La nuova gamma di veicoli per il trasporto a lunga distanza sarà prodotta a partire dal mese di ottobre. Tra le sue caratteristiche un eccezionale coefficiente aerodinamico grazie al design della cabina affusolato, al parabrezza dalla forma arrotondata e ad un allungamento di 16 cm nella parte

anteriore della cabina. Ciò contribuisce ad un notevole miglioramento dell’efficienza nel consumo di carburante fino al 10 per cento, con relative riduzioni di CO2. L’elevata sicurezza è ottenuta anche grazie alle linee inferiori dei finestrini laterali basse, al finestrino addizionale sulla portiera del passeggero che garantisce un’ottima visione diretta, e ai nuovi DAF Digital Vision System e DAF Corner View.

I sedili girevoli, il quadro strumenti completamente digitale, un letto relax, un’illuminazione interna ambientale e uno spazio interno senza precedenti si combinano per offrire grande comfort di guida. Inoltre la piattaforma è completamente nuova, ed è pronta a montare trasmissioni alternative a batteria elettrica e a idrogeno attualmente in fase di sviluppo presso DAF.


IL MONDO DEI TRASPORTI

Pagina 20

N° 302 / Settembre 2021

CONCESSIONARIE / PRIMO DEALER DEL GRIFONE PER TERRITORIO E VOLUMI

La volata di Scania Milano DAL 2018 GUIDATO DAL GIOVANE GENERAL

MANAGER MICHELE MARCHETTI, IL “BRACCIO OPERATIVO” DI ITALSCANIA SU UN TERRITORIO CARATTERIZZATO DA FORTE COMPETIZIONE MACINA NUMERI RECORD. “IN UN MERCATO COMPLESSIVO VICINO AL RADDOPPIO RISPETTO ALLO SCORSO ANNO, CI ATTESTIAMO IN SECONDA POSIZIONE CON UNA QUOTA DEL

12 PER CENTO”, AFFERMA IL DIRETTORE GENERALE. DI QUEST’ANNO L’APERTURA DEGLI UFFICI E MAGAZZINO RICAMBI A TORINO

È

MAX CAMPANELLA LAINATE

la prima Concessionaria Scania in Italia in termini di competenza geografica e per volumi d’immatricolato. Dal 2018 guidata dal Direttore Generale Michele Marchetti, Scania Milano - suddivisa nei due rami operativi Scania Milano e Scania Piemonte - l’anno scorso ha visto accrescere il territorio di riferimento, che oggi comprende: Milano, Monza e Brianza, Varese, Como e Lecco in Lombardia; Torino, Asti, Cuneo, Novara, Vercelli, Verbano-Cusio-Ossola e Biella in Piemonte; Aosta. Scania Milano nasce nel 2010 con l’acquisizione, da parte di Italscania, del cento per cento della proprietà e dell’headquarter di Lainate: uno sbarco diretto, da parte della filiale italiana della Casa del Grifone, con l’obiettivo di rafforzare la presenza in un territorio altamente competitivo e ritenuto strategico. La se de principale è collocata sulla direttrice per la Svizzera, a una manciata di chilometri dallo svincolo dell’A4 Milano Certosa, dallo snodo intermodale della zona industriale dell’aeroporto della Malpensa e dallo svincolo autostradale di Gravellona Toce, che a sua volta si connette al Piemonte. Un’area caratterizzata da aziende di trasporto di ogni dimensione, soprattutto medio-piccole, e attive nei segmenti più disparati: dai rifiuti e rottame al lungo raggio nazionale e internazionale, dalle acque minerali al bestiame (soprattutto nel Cuneese) ai corrieri, passando per alimentari e general cargo. Con la presenza diretta Scania, che ha garantito massima attenzione alle linee guida di Casa Madre, negli anni

ORBASSANO. la crescita nei numeri è stata costante, sospesa nei tre mesi di lockdown per tornare, quest’anno, a un deciso sviluppo: nel 2020 Scania Milano chiude con un fatturato di 31 milioni, che quest’anno saliranno a 50. “Nel nostro distretto spiega Marchetti, classe 1984, in Scania dal 2011, originario di Trento, dove ha conseguito la laurea in Economia e dove vive con Silvia e la loro piccola Alice di un anno e mezzo

- nei primi sei mesi del 2021 il mercato totale dei veicoli industriali mostra dati vicini al raddoppio rispetto all’anno scorso: in questo dinamismo, Scania è protagonista, mantenendo salda la seconda posizione con una quota del 12 per cento. Soprattutto, è molto forte la presenza Scania nelle motrici (a due e tre assi), richieste da autotrasportatori attenti alla qualità del prodotto e del servizio: le motrici rap-

presentano il 60 per cento delle vendite”. Qual è la “chiave di differenza” che consente il successo di Scania Milano? “La nostra forza - afferma Marchetti - è la modularità: Scania è sinonimo di prodotto versatile, a datto a ogni tipologia di cliente, perché “cuce su misura” il veicolo per ogni mission di trasporto. Tutte le Concessionarie Scania offrono un servizio di alto livello,

Il Direttore Generale di Scania Milano Michele Marchetti con lo staff dell’officina di Lainate.

caratterizzato dall’orientamento al cliente. Come Scania Milano, a questo valore affianchiamo una Rete capillare di officine storiche, molto conosciute sul territorio, che fanno tutte un lavoro eccezionale: dieci in Piemonte, quattro in Lombardia (compresa Lainate). E una squadra di venditori appassionati, tra i quali vi sono figure di grande esperienza e competenza, con profonda conoscenza del ter-

ritorio”. Nel 2017 la scelta di dare vita a Scania Piemonte, come ramo differenziato di attività, che oggi ha due sedi: ufficio vendite e magazzino ricambi a Mondovì e, da quest’anno, ufficio vendite e magazzino ri cambi a Orbassano, nei pressi di Torino. “Per dare il massimo servizio al cliente precisa il General Manager garantiamo la presenza in stock di 2-2,5 milioni di ricambi: la scelta di rafforzarne la distribuzione con la sede di Orbassano consente alle officine di approvvigionarsi presso il magazzino più vicino”. In Scania Milano lavorano complessivamente 35 persone, 25 delle quali a Lainate. Il team manageriale è costituito, oltre che da Marchetti - che risponde direttamente all’Amministratore delegato Enrique Enrich ed è Responsabile Commerciale Milano dal Responsabile Finanziario Marco Guglielmi, dal Responsabile Officina Paolo Vanalli, dal Responsabile Ricambi Emiliano De Alessi e dal Responsabile Commerciale Piemonte Gianni Perrone. Sette i venditori: tre su Milano, quattro sul Piemonte, team destinato a crescere ulteriormente. “Prevediamo precisa Marchetti - un importante sviluppo in Lombardia e su Torino, dove intendiamo posizionare unità dedicate, per maggiore vicinanza alla clientela. Stiamo registrando un aumento di richieste in ogni segmento, anche nel cava-cantiere, dove con la gamma XT stiamo facendo un ottimo lavoro nei settori movimento terra e edilizia. Positiva novità che si affianca al successo Scania come brand: il territorio di Cuneo e Asti in particolare è caratterizzato da una passione per il nostro marchio fortemente radicata”.


Pagina 22

IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

CAVI DIESEL / SERATA DI OPEN DAY ALLA SEDE DI CALCINATO

Il team che vince ogni sfida

U

MAX CAMPANELLA CALCINATO

n team coeso, determinato, coordinato da un Amministratore delegato che non esita a scendere in campo con e per i clienti, non poteva che vincere anche la sfida del maltempo. L’invito alla serata di Open Day di Cavi Diesel (Concessionaria Daf, Piaggio Veicoli Commerciali, Isuzu e Nissan), società del Gruppo Brixia, ha avuto il successo atteso, registrando la presenza di rappresentanti di aziende di trasporto e di tanti partner del dealer bresciano. A fare gli onori di casa Alice Pulici, dinamica numero uno della Concessionaria, che ha voluto essere presente in prima persona ad accogliere gli imprenditori intervenuti, insieme alla sua squadra: un team di giovani e di manager con esperienza che hanno dimostrato di saper vincere ogni sfida. La pioggia del tardo pomeriggio avrebbe scoraggiato i più, ma non è stato questo il caso: “Ho la fortuna - il commento di Alice Pulici - di poter contare su un gruppo affiatato e appassionato di persone che hanno in comune la passione e il conseguimento degli obiettivi aziendali”. In campo con l’Amministratore delegato Cesare Facchetti, Sales Manager per i marchi Daf, Piaggio Veicoli Commerciali, Isuzu e Nissan, e Massimo Portalupi, che con il marchio Fortruckers coordina lo sviluppo del business di BTrucks, società del Gruppo che si occupa dell’offensiva Ford Trucks. Instancabilmente all’opera il responsabile marketing Catello Esposito. Tra i presenti molti volti noti, tra i quali Massimiliano Calcinai, Amministratore delegato F-Trucks Italia, distributore esclusivo del marchio Ford Trucks; Giacomo Maurelli, Amministratore delegato del gruppo aziendale che por ta il suo nome, leader nella distribuzione di ricambi; Diego Pellicioli, Sales Director Fraikin Italia, leader nel noleggio di veicoli professionali; Paolo Fadda, Di-

OSPITI ILLUSTRI E RAPPRESENTANTI DELLE AZIENDE DI TRASPORTO DEL TERRITORIO NON HANNO MANCATO L’APPUNTAMENTO DI “PORTE APERTE” PROMOSSO DAL DEALER GUIDATO DA ALICE PULICI. IL MALTEMPO NON HA FERMATO LA SUA SQUADRA, DETERMINATA E COESA NEL RAGGIUNGERE GLI OBIETTIVI DELINEATI DALLA GIOVANE LEADER: “POSSO CONTARE SU PERSONE CHE HANNO IN COMUNE PASSIONE E CONDIVISIONE DELLA MISSION AZIENDALE”, AFFERMA L’AMMINISTRATORE DELEGATO.

Alcune immagini della serata di Open Day a Calcinato. In alto, foto di gruppo del team Cavi Diesel.

rettore Ven dite L’Idealcar, produttore italiano di veicoli per la temperatura controllata. Soprattutto erano presenti numerosi imprenditori di aziende di trasporto del territorio di Cavi Die sel, che comprende Brescia, Mantova, Cremona e Bolzano. Nel piazzale della sede di Calcinato era esposto il meglio delle famiglie dei marchi rappresentati dalle due società. L’ammiraglia Daf XF in diverse configurazioni e i “fratelli minori” LF e CF. All’ingresso della kermesse, il Graelion del produttore abruz zese Tekne, a trazione integrale, che con la Dakar 2021 ha viaggiato con il logo

Cavi Diesel sulle sabbie dell’Arabia Saudita. Un corner ad-hoc era dedicato all’FMax, ammiraglia della gamma Ford Trucks. La pioggia ha infine lasciato campo libero al sereno, con sentendo alle note musicali di accompagnare gli ospiti al buffet fino a tarda ora. “Questa bellissima serata - ha aggiunto Alice Pulici è stata dedicata ai clienti e ai partner, in assoluto clima di allegria e spensieratezza: una volta tanto abbiamo voluto dare l’occasione di un incontro collettivo sen za parlare d’affari, ma in puro spirito di amicizia e positiva convivialità”.


ALLESTIMENTO ALLE ESTIMENTO VEICOLI INDU INDUSTRIALI STRIALI E COMM COMMERCIALI MERCIALI

IL FUTURO F UTURO È VERSO ll’ECONOM l’ECONOMIA ’ECONOM ECONOMMIA CIRCO CIRCOLARE OLARE

PA R T N E R

NO RD-EST

Via Vicenz Vicenza, za, 136 - 36034 S. Tomio T di MMalo alo (Vice (Vicenza) (Vicen nza) - Tel. +39 0445 04445 588110 - Fax +399 0445 588027

www.golo.it www w.golo.it


IL MONDO DEI TRASPORTI

Pagina 24

N° 302 / Settembre 2021

CON MERCEDES-BENZ UPTIME LO SCUDO PROTETTIVO DIGITALE È UNA REALTÀ PER TUTTI GLI OPERATORI

T

Un prodotto service decisamente innovativo ed efficiente ruck Data Center non è solo la base per i numerosi servizi Fleetboard, ma anche per il Mercedes-Benz Uptime, il servizio finalizzato all’incremento sostenibile della disponibilità dei veicoli. Mercedes-Benz Uptime combina un intelligente collegamento in rete dei veicoli e un servizio di assistenza intensivo, offrendo così ai clienti di MercedesBenz Trucks un prodotto Service molto innovativo. L’obiettivo è quello di sup-

portare i trasportatori ad eseguire in modo affidabile i loro ordini, assicurando che i truck trascorrano il maggior tempo possibile su strada. Le soste in officina vengono così ridotte al minimo e pianificate in modo più efficiente. Per ridurre i casi di panne, le esigenze di riparazione vengono identificate con la massima tempestività possibile e i trasportatori vengono supportati nell’organizzazione a breve termine dei lavori necessa-

ri, sempre tenendo conto della loro pianificazione d’impiego. Pacchetti Service configurabili individualmente e soluzioni di leasing, finanziamento e assicurazione su misura completano l’offerta dei servizi per Actros L e garantiscono anche una sicura pianificazione in questi ambiti specifici. Che Mercedes-Benz Trucks punti sempre su soluzioni innovative in questo ambito è dimostrato, ad esempio, dal

contratto di riparazione e manutenzione Mercedes-Benz CompleteMile. Come già Mercedes-Benz Complete, anche questo contratto di riparazione e manutenzione flessibile copre tutti gli interventi in officina, comprese le parti soggette a usura, ma è concepito in modo tale che le rate mensili siano basate sui chilometri effettivamente percorsi. Non ha in tal senso importanza che il cliente operi in un settore ciclico come l’edili-

zia o l’agricoltura o che effettui chilometraggi spesso differenti a causa delle oscillazioni mensili dei volumi d’attività. Mercedes-Benz CompleteMile può quindi contribuire all’ottimizzazione dei flussi di cassa. Il chilometraggio viene trasmesso automaticamente da Mercedes-Benz Uptime ai sistemi IT di Mercedes-Benz Trucks e qui viene elaborato senza soluzione di continuità per la fatturazione digitalizzata.

MERCEDES-BENZ TRUCKS / ACTROS L PREMIUM PER IL LUNGO RAGGIO

Per entusiasmare di più S

PAOLO ALTIERI STOCCARDA

COME MODELLO DI SERIE PIÙ GRANDE E LUSSUOSO DELLA GAMMA, ACTROS L OFFRE UNA VASTA GAMMA DI CARATTERISTICHE E DETTAGLI DI EQUIPAGGIAMENTO PER UNA GUIDA RILASSATA, UNA DIMENSIONE ABITATIVA CONFORTEVOLE E UN LAVORO EFFICIENTE. LA SUA ECCELLENZA SOTTOLINEATA DAI DISPOSITIVI DI SICUREZZA PER LA FRENATA AUTOMATICA FINO ALL’ARRESTO IN CASO DI EMERGENZA.

otto il profilo dell’economicità, della sicurezza e del comfort, fin dal 1996 quando ha debuttato, Mercedes-Benz Actros si è affermato come punto di riferimento nel settore dei truck per il trasporto a lungo raggio e per il servizio di distribuzione pesante. La più recente generazione dell’Actros impone costantemente nuovi standard dal 2018, con numerose innovazioni sul versante della digitalizzazione, del collegamento in rete e della sicurezza. Novità quali la plancia multimediale MirrorCam, funzioni di guida parzialmente automatizzate e sistemi di sicurezza ulteriormente migliorati consentono all’Actros di soddisfare in modo eccellente le esigenze del moderno trasporto merci, fornendo al conducente un supporto duraturo e affidabile nello svolgimento delle sue mansioni. Dopo i due nuovi modelli lanciati da Mercedes-Benz Trucks nel 2021, ovvero Actros F, versione ottimizzata ai fini della massima funzionalità, e l’edizione limitata Actros Edition 2, segue Actros L, il veicolo più grande e lussuoso della fortunata gamma, ordinabile da subito e in produzione dal prossimo novembre. “Nello sviluppo dell’Actros L - afferma Andreas von Wallfeld, Responsabile Marketing, Sales & Services Mercedes-Benz Trucks - ci siamo concentrati in particolare sugli aspetti del comfort per il conducente, della sicurezza, della connettività e del total cost of ownership, al fine di generare ulteriori miglioramenti per i nostri clienti ed i

loro conducenti. Lavorando a stretto contatto con i clienti, sappiamo cosa questi si attendono da un truck premium per le loro aziende e i loro con ducenti. E con Actros L abbiamo voluto rispondere esattamente a queste esigenze, progettando e configurando la nostra nuova ammiraglia sulla base di standard adeguatamente elevati”. A cominciare dalla cabina di guida che, disponibile nelle varianti StreamSpace, BigSpace e GigaSpace, presenta una larghezza di 2,50 metri e offre un ambiente generosamente dimensionato. L’assenza del tunnel motore nella cabina di guida consente di ottenere un pavimento piatto e, conseguentemente, un ambiente estremamente confortevole. L’isolamento acustico migliorato nella cabina non lascia penetrare i rumori inde-

siderati e favorisce così il relax, soprattutto durante i periodi di riposo. Contribuisce all’esperienza di guida rilassante, tra l’altro, la posizione di seduta più bassa di 40 mm, che consente allo stesso tempo una confortevole visuale sulla strada. In questo contesto, i fari a LED, disponibili a richiesta, rappresentano un grande valore aggiunto per la sicurezza, soprattutto in condizioni d’oscurità, poiché oltre a presentare un nuovo design, illuminano in modo eccellente la carreggiata grazie alla loro intensità luminosa superiore rispetto a quella dei fari allo xeno. A ciò si aggiunge un aspetto economico: i fari a LED consumano meno energia e hanno una durata maggiore rispetto alle lampade a incandescenza tradizionali. Il comfort del conducente è ulteriormente

migliorato da dettagli di equipaggiamento quali l’elegante rivestimento dei sedili, il nuovo rivestimento interno delle porte, un comodo materasso che include un topper dello spessore di 45 millimetri e la piacevole sensazione tattile offerta dalla parete posteriore della cabina, nella zona del letto. L’atmosfera di benessere può essere ulteriormente migliorata con i numerosi accessori della Interior Line di Mercedes-Benz Trucks. “In questo modo le aziende di trasporto, scegliendo l’Actros L, hanno in mano un’importante carta vincente, anche in considerazione dell’ormai cronica carenza di conducenti”, afferma von Wallfeld. Coerentemente rispetto ai suoi programmi, anche con Actros L Mercedes-Benz Trucks si pone l’obiettivo di contribuire a una circolazione

stradale priva di incidenti. Grazie ai moderni sistemi di assistenza destinati alla sicurezza attiva, il marchio di Stoccarda si avvicina ancora di più alla visione di una guida a incidenti zero. Esempi concreti in tal senso sono il sistema antisbandamento, l’assistente al mantenimento della distanza e MirrorCam come alternativa agli specchi retrovisori principali e grandangolari, ai quali si aggiungono poi altre numerose dotazioni sul fronte della sicurezza. A richiesta per Actros L è disponibile, ad esempio, il sistema di assistenza alla svolta Mercedes-Benz S1X, con una funzione aggiuntiva rispetto al precedente sistema S1R, che, in determinate circostanze, può salvare la vita. Il sistema Active Sideguard Assist, oltre ad allertare il conducente della presenza di ciclisti o pedoni in movimento sul lato passeggero, può anche effettuare una frenata automatizzata fino al completo arresto del veicolo (in caso di velocità di svolta non superiore ai 20 km/h), se il conducente non reagisce ai segnali di avvertimento. Active Sideguard Assist è in grado di rilevare la necessità di questo intervento frenante sulla base dell’angolo di sterzata e, entro determinati limiti, può evitare una possibile collisione. Un’ulteriore opzione di equipaggiamento per l’Actros L è l’Active Drive Assist di seconda generazione (ADA 2). In determinate condizioni, il sistema supporta attivamente il conducente nella guida longitudinale e trasversale del veicolo e può mantenere automaticamente la distanza, accelerare e sterzare, a condizione che siano

soddisfatti i requisiti di sistema necessari, come un raggio di curva sufficiente o linee di demarcazione della carreggiata chiaramente visibili. Inoltre, la funzione parziale Emergency Stop Assist inclusa nell’ADA 2 è in grado di avviare un arresto di emergenza se il conducente non controlla più il volante nonostante gli avvertimenti ottici ed acustici attivati dal sistema. Una volta che il truck si è fermato, il sistema può inserire automaticamente il nuovo freno di stazionamento elettronico. Inoltre, le porte vengono sbloccate in modo da consentire a paramedici o ad altri soccorritori di raggiungere direttamente il conducente in caso di emergenza medica. Se è prescritto per legge un sistema di assistenza alla frenata d’emergenza, inoltre, Actros L dispone di serie anche di ABA (Active Brake As sist) della quinta generazione con riconoscimento dei pedoni. Si tratta di un sistema che può aiutare ad evitare incidenti causati, ad esempio, da distrazione del conducente, distanza insufficiente o velocità inappropriata, nei quali il truck tampona un veicolo che precede o è fermo sulla carreggiata oppure rischia di urtare frontalmente contro un pedone. ABA 5 opera con una combinazione di radar e telecamere. Se il sistema rileva il pericolo di un incidente che coinvolge un veicolo che precede, un ostacolo fisso o una persona che attraversa provenendo dalla direzione opposta, che si muove nella propria corsia o che si ferma improvvisamente in preda allo spavento, il conducente riceve in prima battuta un avvertimento ottico acustico.

Una serie ancora più ricca di dispositivi tecnologici al servizio dell’autista

Nulla manca per sicurezza, comfort e gestione globale

I

n sinergia con i sistemi di assistenza, impressiona su Mercedes-Benz Actros L anche il funzionamento del controllo intelligente del tempomat e del cambio, denominato Predictive Powertrain Control (PPC - in italiano: controllo proattivo della catena cinematica). In determinate circostanze il sistema può prendere in considerazione la topografia, l’andamento della strada e la segnaletica stradale. In tal modo possono essere evitate inutili frenate, accelerazioni e cambi di marcia. A diffe-

renza dei veicoli senza PPC, grazie a questo sistema l’Actros di ultima generazione consuma gasolio fino al tre per cento in meno sulle superstrade ed in autostrada e fino al 5 in meno sui tratti interurbani. Si inserisce nel tema dell’efficiente consumo di carburante anche il nuovo assistente allo stile di guida Eco Support, che assiste il conducente nell’adozione dello stile di guida più economico possibile. Le attività e le funzioni dei sistemi di assistenza quali ABA 5, ADA 2 o PPC vengono

visualizzate sulla plancia multimediale, dotazione di serie, che offre modalità d’utilizzo facili ed intuitive grazie ai suoi due display a colori che rappresentano il cuore della Human Machine Interface (HMI). Sull’Actros L ciò include come equipaggiamento a richiesta, tra l’altro, l’indicazione del peso totale del veicolo trainante e del rimorchio, nonché il carico sull’asse anteriore, anche sulle motrici per semirimorchio dotate di sospensioni pneumatiche parziali. In tal modo è possibile

tenere sotto controllo in ogni momento il peso per evitare il sovraccarico del veicolo. Scegliendo la plancia multimediale in versione Multimedia Cockpit interactive, è anche possibile accedere rapidamente al Mercedes-Benz Truck App Portal. Le aziende di trasporto possono così sfruttare le nuove possibilità di collegamento in rete e dotare i loro veicoli di app che migliorano l’efficienza e il comfort, come i servizi telematici di Fleetboard.


IL MONDO DEI TRASPORTI

Pagina 26

N° 302 / Settembre 2021

BLU WAY / INIZIA LA DISTRIBUZIONE DI METANO LIQUIDO GREEN

Il bioLNG entra in circolo BLU WAY E TOTAL ITALIA HANNO DATO IL VIA ALLA DISTRIBUZIONE DEL COMBUSTIBILE ECOLOGICO NELLE STAZIONI DEL CIRCUITO BLU FACENTE PARTE DI RETE SPA. L’EVENTO SI È TENUTO IN UNA DELLE STAZIONI DEL NETWORK, QUELLA DI SAN MAURIZIO CANAVESE (TO), A DISTANZA DI POCHE SETTIMANE DALL’AVVIAMENTO DELL’IMPIANTO DI BIO INDUSTRIA DI VEROLANUOVA (BS), NEL QUALE VIENE PRODOTTO IL BIOMETANO LIQUEFATTO DISTRIBUITO ALLE STAZIONI DI BLU WAY DA TOTALENERGIES.

L

FABIO BASILICO

SAN MAURIZIO CANAVESE

’offensiva del biometano liquido entra nel vivo per iniziativa di Blu Way e Total Italia che hanno dato il via alla distribuzione del combustibile green nelle stazioni del circuito Blu facente parte di Rete Spa. L’evento si è tenuto in una delle stazioni del network, quella di San Maurizio Canavese (TO), a distanza di poche settimane dall’avviamento dell’impianto di Bio Industria di Verolanuova (BS), nel quale viene prodotto il biometano liquefatto distribuito alle stazioni di Blu Way (attualmente sono 4 ubicate in Piemonte, nell’area torinese e novarese) da TotalEnergies. Il progetto si colloca in un più ampio disegno strategico che accomuna Blu Way e Total Italia e che si pone l’obiettivo di contribuire sensibilmente alla riduzione dell’intensità media di carbonio emessa dai prodotti energetici utilizzati. “Il programma si pone come particolarmente innovativo nel mercato - ha spiegato Teseo Bastia, Amministratore

delegato di Rete Spa - In primo luogo perché Blu Way sarà il primo operatore in Italia ad assumere l’impegno di distribuire una quota minima percentuale di biometano liquefatto (20 per cento) nelle stazioni del proprio network e in secondo luogo perché Total Italia, attraverso la definizione e l’applicazione di un disciplinare certificato, implementerà un sistema di controllo e monitoraggio della filiera di approvvigionamento del prodotto atto a garantire una verifica puntuale dei quantitativi di biometano liquido consegnati e il rispetto delle quote minime di prodotto di origine bio sulle diverse stazioni di servizio”. Il biometano liquefatto viene realizzato grazie al processo di recupero di effluenti zootecnici e sottoprodotti agricoli, risorse preziose per produrre in modo sostenibile energia rinnovabile e biocarburante di nuova generazione. Dalla digestione anaerobica, il processo di trasformazione delle materie prime in biogas e digestato, si ottengono due prodotti molto importanti per lo sviluppo di un’agricoltura sostenibile:

fertilizzanti bio, ricchi di sostanze organiche vitali per il nutrimento del suolo, e un digestato liquido di alta qualità. Utilizzato sui campi, invece del tradizionale liquame, minimizza lo spandimento e ne riduce l’impatto ambientale. Secondo quanto documentato dal Freight Leaders Council, associazione che riunisce aziende leader delle filiera della logistica, la riduzione stimata di emissioni di CO2 su un mezzo alimentato a bioLNG, rispetto a un Euro VI diesel, arriva fino all’80 per cento, mentre quella verso un mezzo alimentato a LNG di origine fossile fino al 65 per cento; il tutto senza considerare i significativi impatti sulla riduzione di NOx (ossido d’azoto) e polveri sottili. “Siamo lieti di concretizzare il progetto con Blu Way di Rete Spa, le cui basi sono state poste alcuni mesi fa grazie a una partnership per lo sviluppo e la promozione dell’offerta di metano liquido nel nostro Paese - ha sottolineato Filippo Redaelli, Amministratore delegato Total Italia - Total Italia, in linea con gli obiettivi della compa-

gnia, sta realizzando diversi progetti in funzione dell’obiettivo climatico net zero e questo è un altro importante tassello della nostra offerta multi energetica. Ci auguriamo di poter presto dare ulteriori notizie di questo progetto ambizioso che ci vede, insieme, protagonisti della creazione di economia sostenibile a partire dal rispetto del nostro ambiente”. Il valore della progettualità condivisa è stato ulteriormente ribadito da Teseo Bastia: “Il nostro Gruppo ha creduto molti anni fa nel gas naturale liquido quale soluzione concreta e pragmatica per offrire un’alternativa ai combustibili tradizionali. Da qui è iniziato il processo di rinnovamento del nostro Gruppo in un’ottica di diversificazione e innovazione dell’offerta, che ha visto la nascita del progetto Blu nel 2018, recentemente confluito in Blu Way pochi me si fa. Siamo orgogliosi, oggi, di poter essere ancora una volta protagonisti di un percorso ambizioso e innovativo, attraverso il quale il nostro Gruppo dimostra di voler creare un nuovo modello di distribuzione attraverso la

proposizione di carburanti ecosostenibili”. Anche Marco Lucà, Ad di Blu Way Srl, ha rimarcato gli ambiziosi obiettivi del progetto: “L’obiettivo che si pone Blu Way è quello di poter rifornire i mezzi nelle stazioni del proprio network con biometano al 100 per cento, nell’ottica di avere una filiera sempre più virtuosa e di garantire un’economia circolare reale. Come primo passo di questa ‘roadmap’ Blu Way ha scelto di distribuire una quota percentuale di biometano sulle proprie stazioni a marchio Blu LNG, certificando in modo puntuale e accurato tutto il processo con un innovativo sistema di monitoraggio sviluppato grazie alla collaborazione con TotalEnergies. Vogliamo attraverso questo progetto contribuire attivamente e concretamente allo sviluppo di una filiera virtuosa che possa portare in futuro alla decarbonizzazione dei trasporti”. TotalEnergies è una compagnia multi-energetica che produce e commercializza energie su scala globale: petrolio e biocarburanti, gas naturale e gas green, energie rinnovabili ed

energia elettrica. Presente in oltre 130 Paesi, TotalEnergies pone lo sviluppo sostenibile, in tutte le sue dimensioni, al centro dei suoi progetti e operazioni per contribuire al benessere delle popolazioni. Il progetto Blu nasce nel 2017 quando Rete, storica azienda con sede a Torino e leader nel settore della distribuzione carburanti con un network di oltre 60 stazioni di proprietà, decide di costituire una specifica Business Unit nella quale far convergere tutte le attività legate allo sviluppo di carburanti alternativi, con particolare riferimento al metano liquido e al biometano. Con l’obiettivo di dare continuità a questo progetto e di garantirgli un ulteriore slancio, nel 2021 nasce Blu Way, società del Gruppo Rete nella quale convergono le attività di Blu, attuali e future. Il progetto Blu e gli investimenti che ne accompagnano l’introduzione sono il risultato di una programmazione che arriva da lontano: il target è quello di promuovere nuovi combustibili, basati sull’innovazione tecnologica e sullo sviluppo di forme di mobilità alternative ed ecosostenibili.

MARCO LUCÀ, AMMINISTRATORE DELEGATO DI BLU WAY

“DALLE PAROLE PASSIAMO AI FATTI” È

orgoglioso del progetto che l’azienda di cui è Amministratore delegato sta portando avanti con serietà e determinazione. Marco Lucà, numero uno di Blu Way, brand nato da pochi mesi che raccoglie l’eredità di Blu, spiega che la decisione di avviare una massiccia strategia basata sul biometano liquido è più che mai motivata e giustificata. “Il metano liquido di origine fossile non era per noi abbastanza virtuoso - afferma l’Ad - Abbiamo così individuato l’opportunità di trattare un prodotto con caratteristiche diverse, il biometano liquefatto appunto, che si ottiene dalla lavorazione degli scarti agricoli e zootecnici e ha molte più caratteristiche virtuose. Per noi la sostenibilità si traduce nel passare dalle parole ai fatti: avevamo fissato il punto di arrivo nell’avvio della

distribuzione di biometano liquido e ci siamo arrivati, grazie anche alla preziosissima collaborazione di TotalEnergies. Iniziamo a distribuire nelle stazioni Blu una quota del 20 per cento di biometano sul totale di metano liquido fornito. L’obiettivo è arrivare al 100 per cento perché nella nostra vision c’è la distribuzione futura del solo prodotto bio. Il tempo necessario per arrivarci ce lo dirà anche il mercato, che deve recepire la nostra volontà e tradurla nel concreto”. Il biometano liquido di Blu Way viene prodotto in Italia, nell’impianto bresciano di Verolanuova. Da lì viene trasportato da TotalEnergies e distribuito nelle stazioni del circuito Blu. “Siamo in assoluto il primo operatore a proporre questa tipologia di soluzione chiara e trasparente - aggiunge Lucà

- Con TotalEnergies siamo riusciti a costruire un disciplinare molto articolato che ci permette di certificare tutto il processo e renderlo trasparente al cliente. Vogliamo portare valore e farlo in modo professionale e trasparente”. Il bioLNG è una sfida impegnativa ed esaltante. “Il progetto è sfidante per la nostra azienda - spiega Marco Lucà - Il bioLNG ha dei costi differenti rispetto al biometano liquido fossile. La decisione di introdurre il 20 per cento di prodotto bio rappresenta quindi un rischio d’impresa notevole ma lo facciamo perché ci crediamo; è la strada giusta da percorrere e siamo convinti che il mercato ci darà ragione. Del resto, la transazione energetica ha dei costi e nel nostro piccolo dobbiamo accettare questo principio. L’importante è farlo accompagnando la proposta con un meccanismo di certificazione puntuale e serio”.


TRATTALO MALE.

SOVRACCARICALO. 3XzWUDVSRUWDUH¼QRDWRQQHOODWHFRPHVHQLHQWHIRVVH MALTRATTALO. &RVuUHVLVWHQWHFKHQHVVXQDPLVVLRQHRIIURDGqWURSSRGXUD STRESSALO. 3UHVWD]LRQLHDI¼GDELOLWjDOWRSVRQRODQRUPD

NIENTE PUÒ PIÙ FERMARTI ADESSO. LA GAMMA COMPLETA OFF-ROAD È A TUA DISPOSIZIONE.


IL MONDO DEI TRASPORTI

Pagina 28

N° 302 / Settembre 2021

MAN / TEST DRIVE DELLA NUOVA GENERAZIONE

I Leoni dell’offroad ti

N

FABIO BASILICO KALLINCHEN

el 2020 MAN ha presentato la sua nuova generazione di autocarri mostrando al pubblico le potenzialità dei rinnovati TGL, TGM, TGS e TGX. Che non si limitano alla strada ma si manifestano anche sullo sterrato e qualsiasi altro terreno non convenzionale. Siamo andati a conoscere da vicino i Lioni dell’offroad nei dintorni di Berlino, a Kallinchen, dove

sono stati organizzati diversi test drive lungo i percorsi fuoristradistici ricavati all’interno dell’area boschiva in passato inserita nel perimetro occupato da una base militare. I modelli MAN opportunamente e variamente allestiti hanno dimostrato il loro valore come veicoli economici, affidabili e robusti anche nelle applicazioni diverse dall’autotrasporto a lungo raggio. Le soluzioni giuste per i veicoli da cavacantiere, per l’edilizia e per i lavori comunali sono offerte

in tutte le quattro serie in un’ampia gamma di combinazioni da 7,49 a 44 tonnellate, con otto cabine di diverse dimensioni, quattro serie di motori, tre altezze, diversi assali e un’ampia gamma di configurazioni powertrain. MAN TGL rappresenta la gamma di tonnellaggio leggero, che va da 7,49 a 12 tonnellate di peso totale ammesso in configurazione 2 assi. Abbiamo provato il modello 8.220 4x2 in allestimento ribaltabile equipaggiato con il quattro ci-

lindri in linea D08 da 4.580 cc, potenza di 162 kW/220 cv a 2.300 giri/min e coppia massima di 850 Nm a 1.3001.800 giri. Il quattro cilindri D08 copre la gamma di potenze che va da 160 a 220 cv ma c’è la possibilità di usufruire dei 250 cv erogati dalla versione sei cilindri del D08. Sono quattro le nuove cabine tra cui scegliere: compatta CC a due o tre posti, TN con spazio per un letto, TM con tetto alto e la doppia DN a quattro porte che, con la sua comoda

Il TGM 4x4 durante la prova sullo sterrato. In alto, il gruppo dei truck MAN messi a disposizione per i test nell’area di Kallinchen.

panca a quattro posti e due o tre posti nella parte anteriore, offre spazio per un massimo di sette persone con i loro strumenti di lavoro. Ed è un TGL con cabina doppia, allestito appositamente per svolgere attività municipali, che abbiamo testato sulle strade urbane ed extraurbane intorno a Kallinchen. Il nuovo TGM, con peso totale ammesso compreso tra 12 e 26 tonnellate, dispone ora di ancora più varianti. Il veicolo a 2 assi è disponibile anche con trazione integrale; ciò lo rende una scelta ottimale per l’impiego nel settore edile o in ambito municipale. Il veicolo a 3 assi con configurazione 6x2-4 o 6x4 rappresenta un’altra opzione. MAN TGM condivide la stessa gamma di cabine del TGL e il motore a sei cilindri D08 è declinato in tre livelli di potenza: 250, 290 e 320 cv. Il test drive lo abbiamo effettuato a bordo di un TGM 18.320 4x4 allestito con gru e alimentato dal D08 da 235 kW/320 cv a 2.200 giri e coppia di 1.250 Nm a 1.200-1.700 giri. La serie MAN che più spesso viene associata al settore edile e all’impiego comunale è la TGS. La sua ampia schiera di varianti garantisce un’estesa varietà di applicazioni. Il veicolo a 2 assi con peso totale consentito di 18 tonnellate si affianca ai modelli a 3 e 4 assi con peso di 44 tonnellate. I clienti hanno a disposizione configurazioni 4x2, 6x2, 6x4, 8x2 o 8x4, trazione integrale 4x4, 6x6, 8x6 o 8x8 e opzione di trazione idrostatica MAN HydroDrive. Possono inoltre scegliere tra due serie di motori a sei cilindri: D15 da 9 litri con tre livelli di potenza (330, 360 e 400 cv), D26 da 12 litri nelle classi di potenza 430, 470 e 510 cv. La variante di cabina

più popolare è la NN ma proprio come per le serie TGL e TGM ci sono le alternative TN o TM con tetto medioalto. Siamo saliti a bordo di tre TGS che abbiamo testato su percorsi sabbiosi, terreni fortemente accidentati e normali strade asfaltate. Il primo modello testato era il 18.470 4x4 ribaltabile con cabina NN e motore D26 da 346 kW/470 cv a 1.800 giri e coppia massima di 2.400 Nm a 930-1.350 giri, allestito per il servizio invernale e munito di gru Palfinger. Il secondo veicolo è stato il TGS 35.400 8x4 ribaltabile con cabina NN e propulsore D15 da 294 kW/400 cv a 1.800 giri/min con coppia di 1.800 Nm a 1.0001.500 giri. Infine, il TGS 26.470 6x2/4 con cabina NN che abbiamo testato su strade urbane ed extraurbane: motore D26 da 346 kW/470 cv a 1.800 giri e 2.400 Nm a 9301.350 giri, gru Palfinger parte di un allestimento specifico per le attività municipali. Di particolare rilevanza per il settore anche la nuova serie MAN TGX che viene notoriamente impiegata principalmente nel trasporto a lungo raggio e nel trasporto pesante. Il modello è la scelta per gli operatori (compresi quelli del settore construction) che non vogliono rinunciare allo spazio extra e al comfort delle cabine ampie e spaziose o che richiedono l’elevata potenza del motore D38 da 15,2 litri (540, 580 o 640 cv). TGX condivide le due motorizzazioni D15 e D26 del TGS. Oltre ai classici trattori 4x2 e 6x2, sono disponibili anche le varianti 6x4. I trattori per semirimorchi pesanti sono costruiti su telaio a 3 e 4 assi. Se necessario, il trattore per semirimorchio 4x2 può essere ordinato con MAN HydroDrive ed è proprio questa la tipo-


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 29

SIAMO ANDATI A

TRUCK SPECIALIZZATA PER IL SETTORE CONSTRUCTION

CONOSCERE DA VICINO

mettono alla prova

I

LEONI DELL’OFFROAD NEI DINTORNI DI

BERLINO, A KALLINCHEN. I MODELLI MAN TGL, TGM, TGS E TGX OPPORTUNAMENTE E VARIAMENTE ALLESTITI HANNO DIMOSTRATO IL LORO VALORE COME VEICOLI ECONOMICI, AFFIDABILI E ROBUSTI ANCHE NELLE APPLICAZIONI DIVERSE DALL’AUTOTRASPORTO A LUNGO RAGGIO.

LE

SOLUZIONI GIUSTE PER I VEICOLI DA CAVACANTIERE, PER L’EDILIZIA E PER I LAVORI COMUNALI SONO OFFERTE IN TUTTE LE QUATTRO SERIE IN UN’AMPIA GAMMA DI COMBINAZIONI DA

7,49 A 44 TONNELLATE.

logia di veicolo che abbiamo testato su un intricato e non uniforme percorso sabbioso. A bordo del TGX 18.510 4x4H con cabina GN e motore sei cilindri D26 da 375 kW/510 cv a 1.800 giri/min con coppia massima di 2.600 Nm a 930-1.350 giri/min abbiamo potuto constatare le qualità prestazionali del sistema HydroDrive. La cabina lunga e larga è disponibile in tre diverse altezze del tetto e, quindi, in tre altezze interne, da 1,58 a 2,07 metri. L’altezza normale è denominata GN, la

media GM e la extra alta GX. Lanciato nel 2005, MAN HydroDrive ha introdotto nel mercato l’innovazione dell’assale anteriore a trasmissione idrostatica, poi accolta con grande favore in tutti i settori, non solo nel construction. La tecnologia si adatta ai veicoli che svolgono la maggior parte della loro attività di trasporto su strade asfaltate e richiedono solo occasionalmente la trazione integrale. MAN offre HydroDrive in un’ampia varietà di modelli: veicoli a 2, 3 e 4 assi della serie TGS e trat-

tori a 2 assi della serie TGX, in combinazione con i motori D15 e D26. Il conducente può attivare la trazione aggiuntiva del sistema MAN HydroDrive anche a veicolo carico e durante la guida. Se la velocità del veicolo supera i 28 km/h, il sistema si spegne automaticamente. E se la velocità scende sotto i 22 km/h, il sistema si riattiva senza bisogno dell’intervento del conducente. Quello del carico utile è uno dei vantaggi più noti del MAN HydroDrive rispetto a

Il TGS 8x4 e, a destra, il TGX 4x4H dotato di sistema HydroDrive. In alto, il TGL 4x2 su strada.

una trazione integrale convenzionale: può ammontare tra 500 e 750 kg, a seconda della configurazione del veicolo. Il risparmio di carburante è un ulteriore vantaggio: quando il sistema è disattivato, le ruote anteriori ruotano liberamente, come in un veicolo a guida convenzionale. Non è solo durante la guida in salita che le potenti caratteristiche di trazione del MAN HydroDrive entrano in gioco. Durante la guida in discesa, il sistema trasferisce l’effetto del freno motore all’assale anteriore.

Ciò offre sicurezza e stabilità laterale su superfici scivolose, rendendo il veicolo più facile da controllare. La giornata trascorso a Kallinchen ci ha consentito di testare anche la qualità del cambio automatizzato MAN TipMatic, Da decenni TipMatic è una scelta indicata anche per i veicoli impiegati in cava, nel settore edile e in quello dei lavori municipali. Esonera il conducente dal dover cambiare marcia e dal decidere la marcia giusta per le diverse situazioni operative. Il driver

è perciò libero di concentrarsi sulla guida e sul percorso. Il driver può selezionare il programma di guida più appropriato: “Efficiency”, orientato al comfort e al risparmio di carburante; “Performance”, che si concentra maggiormente sulla guida dinamica; “Offroad” per la guida fuoristrada, in cui la strategia del cambio si concentra sulla potenza e sulla velocità del motore per spingere il veicolo; “Manoeuvre”, che fornisce la forza motrice selettivamente durante le manovre.


IL MONDO DEI TRASPORTI

Pagina 30

N° 302 / Settembre 2021

CONTINENTAL / CONTINUA L’ANALISI DELL’OSSERVATORIO SUGLI EFFETTI DELLA PANDEMIA

Anzianità parco circolante: l’Italia è spaccata in due

P

VALENTINA MASSA MILANO

rosegue l’analisi dell’Osservatorio Continental sul comparto del trasporto merci e persone su strada per indagare i macro trend che hanno guidato l’evoluzione del settore durante l’emergenza sanitaria. A venire messi sotto la lente di ingrandimento sono oggi i dati relativi all’anzianità del parco circolante per capire come la crisi economica legata alla pandemia abbia influenzato l’introduzione di veicoli più recenti e sicuri nel nostro Paese. La fascia di anzianità maggiormente rappresentata all’interno del parco circolante di mezzi pesanti per il trasporto merci è quella da 10 a 15 anni (18,9 per cento), seguita dai 15-20 anni (17,9 per cento) e 20-30 anni (15,7 per cento). Anche se risulta ancora basso il dato relativo agli autocarri nuovi di massimo 1 anno, che sono solo il 3,3 per cento del parco circolante, è da sottolineare il fatto che il 33,1 per cento del totale sia rappresentato da veicoli di massimo 10 anni. È invece urgente agire sulle categorie da 30 anni in poi, che rappresentano ancora il 14,2 per cento del parco circolante. La maggior quota di veicoli di oltre 40 anni si ritrovano in Sicilia e Calabria (entrambe al 9,5 per cento). Le percentuali più alte di mezzi nuovi (da 0 a 2 anni) si registrano invece in Valle D’Aosta e Trentino Alto Adige. Dal 2019 al 2020 è leggermente cresciuto il numero di veicoli più recenti (da 0 a 5 anni, +2,6 per cento), mentre sono calate le fasce intermedie (da 5 a 15 anni, -4,8 per cento). Stupisce invece che siano ancora in aumento le categorie di veicoli più vecchie, dai 15 anni in poi (+4,6 per cento). Nel parco circolante di trattori stradali la fascia di anzianità più rappresentata è quella da 2 a 5 anni (22,5 per cento), seguita dal segmento 10-15 anni (19,4 per cento) e da quello 5-10 anni (18,8 per

UNA FOTOGRAFIA COMPLETA DEL SETTORE DEL TRASPORTO MERCI E PERSONE QUELLA SCATTATA DALLO STUDIO DEL MARCHIO DI PNEUMATICI. TRA LE TENDENZE EVIDENZIATE LA GRANDE DISPARITÀ TRA

NORD E SUD DEL PAESE E LA CRESCITA DI MEZZI NUOVI NEL SALTO TRA 2019 E

2020, COMPARTO AUTOBUS A PARTE CHE CONFERMA NEI NUMERI LO STOP AL RICAMBIO.

cento). Anche la fascia di età da 15 a 20 anni supera la soglia del 10 per cento, andandosi a collocare a quota 13,6 per cento. Tra le regioni italiane, in Trentino Alto Adige vi è la maggior percentuale di trattori stradali nuovi in circolazione con la fascia di età da 0 a 1 anno che arriva al 12,7 per cento. Nell’ultimo anno la

fascia da 40 anni in su è quella che ha fatto registrare una crescita maggiore (+22,2 per cento), seguita dai 2 a 5 anni (+14,7 per cento) e dai 20-30 (+10,7 per cento). Il parco di rimorchi e semirimorchi per il trasporto di merci è popolato per lo più dalla fascia 20-30 anni (20 per cento), seguita da 15-20

anni (17,4 per cento) e da 1015 anni (14,7 per cento). Agli estremi di questa classificazione si trovano le categorie da 0 a 1 anno e la fascia di 40 e oltre che raccolgono rispettivamente il 2,2 per cento e il 7,4 per cento. L’evoluzione dell’ultimo anno registra una diminuzione del -13,3 per cento delle categorie più re-

centi da 0 a 2 anni, e un aumento di quelle successive, con un +19 per cento dei veicoli di oltre 40 anni. Come già visto in precedenza, il parco circolante di rimorchi e semirimorchi è mediamente più giovane nelle regioni del Centro Nord (Trentino Alto Adige, Veneto, Friuli Venezia Giulia, Emilia Romagna), mentre il Centro Sud si caratterizza per una prevalenza di veicoli più anziani. Considerando invece il parco autobus emerge che quelli più recenti (da 0 a 5 anni di anzianità) rappresentano il 19,4 per cento del totale; quelli più vecchi, di oltre 20 anni, sono il 25,7 per cento del totale. Nella fascia intermedia da 5 a 20 anni, si colloca la maggior parte del parco circolante (54,4 per cento). Le regioni che hanno in circolazione autobus più recenti sono Valle d’Aosta, Trentino Alto Adige, Friuli Venezia Giulia, Veneto, Liguria ed Emilia Romagna; per contro, le quote più rilevanti di autobus con la maggiore

anzianità sono in Campania, Calabria, Sicilia, Calabria, Sardegna, Basilicata e Puglia. La presenza di autobus con meno di un anno di età continua a scendere. Questo calo è dovuto alla progressiva diminuzione di nuovi autobus immessi nel parco circolante che, iniziata già nel 2018 prima dell’emergenza sanitaria, si è accentuata con la pandemia e ha raggiunto l’apice tra il 2019 e 2020 (-43,5 per cento). Sono invece aumentati gli autobus della fascia tra 2 e 5 anni di anzianità e le categorie più vecchie: in particolare è preoccupante la crescita della quota di autobus di 40 anni e oltre, che dal 2015 al 2020 sono più che raddoppiati e dal 2019 al 2020 hanno registrato un +16,7 per cento. La circolazione di autobus vecchi peggiora sensibilmente la situazione delle emissioni nell’ambiente e la sicurezza della circolazione, ed è per questo che si dovrebbe agire in maniera decisa per accelerarne la sostituzione.

ANCHE DALLA CATEGORIA EURO EMERGONO DUE NAZIONI DIVERSE

VEICOLI PESANTI: DIMMI DI CHE CLASSE SEI E TI DIRÒ DA DOVE VIENI D all’analisi della categoria Euro dei mezzi pesanti per trasporto merci emerge un’importante presenza di veicoli molto recenti (Euro 5 ed Euro 6), che corrisponde al 31,8 per cento del totale; ciò nonostante, quelli più vecchi (Euro 0, Euro 1 ed Euro 2) continuano a coprire una quota superiore (33,3 per cento). La preponderanza delle classi ambientali più datate pone l’accento sulla necessità di accelerare il ricambio di questi mezzi con altri più nuovi, sicuri e meno inquinanti, perché dotati di tecnologie recenti. Nell’ultimo anno, dal 2019 al 2020, gli Euro 6 sono cresciuti del 21,5 per cento, e sono diminuite le categorie inferiori. I mezzi più recenti sono diffusi nelle regioni del

Nord e del Centro Italia (Valle d’Aosta e Trentino-Alto Adige, ma anche Toscana, Lombardia ed Emilia-Romagna); allo stesso tempo le categorie Euro più vecchie ancora in circolazioni si concentrano nel Sud Italia (Campania, Calabria, Sicilia, Sardegna, Basilicata e Puglia). Per quanto riguarda i trattori stradali, le categorie Euro più popolate sono quelle più recenti, e cioè Euro 6 (36,5 per cento del parco circolante) ed Euro 5 (26 per cento), segno che negli ultimi anni è stato fortemente accelerato il ricambio dei mezzi vecchi in circolazione con mezzi nuovi, più sicuri. A questo proposito una considerazione è d’obbligo: se il parco circolante italiano di trattori stradali dimostra di es-

sere composto da una gran parte di veicoli giovani e dotati delle più recenti tecnologie di sicurezza, lo stesso non si può dire per i veicoli esteri che circolano ampiamente sulle nostre strade. Considerando l’evoluzione del parco circolante di trattori stradali, si nota che il numero di veicoli Euro 6 è notevolmente aumentato anno per anno, registrando un +19,1 per cento tra il 2019 e il 2020 e un +1.187,9 nel periodo tra il 2015 e il 2020. La percentuale di autobus appartenenti alle categorie Euro 5 ed Euro 6 si attesta al 38,2 per cento. Vi è però ancora in circolazione un’ampia quota di categorie più vecchie, ed Euro 1,

Euro 2 ed Euro 3 arrivano al 38,6 per cento del totale. Anche in questo comparto però è in atto il processo di ringiovanimento del parco circolante per diminuire le emissioni dei mezzi in circolazione: dal 2019 al 2020 è aumentato il numero di autobus di categoria Euro 5 (0,7 per cento) ma soprattutto Euro 6 (oltre 17,7 per cento). Guardando le differenze regionali, gli autobus di categoria Euro 0 sono ancora fortemente presenti in Campania (27,2 per cento), Calabria (22,2 per cento) e Sicilia (21,2 per cento). Per contro, le categorie Euro 5 ed Euro 6, si distribuiscono maggiormente nel Nord Italia, con i picchi del Trentino-Alto Adige e Friuli-Venezia Giulia.


IL MONDO DEI TRASPORTI

Pagina 32

N° 302 / Settembre 2021

IVECO / ANCHE QUEST’ESTATE RAFFICA DI CONSEGNE

S-Way, il truck dei desideri

DA OFFICINE BRENNERO 15 UNITÀ (OTTO A LNG) ALLA VERONESE BISSOLI. A PIACENZA, CRP CONSEGNA DIECI VEICOLI A LNG PER TRASPORTO INTERMODALE AL PROVIDER F.LLI DI MARTINO. LA PARTNERSHIP CON GRUBER PER LA TRANSIZIONE ENERGETICA INIZIA CON IL PRIMO SCARICO DI BIOMETANO ALL’IMPIANTO HAM ALL’AUTOPORTO SADOBRE. IN SICILIA, LCT AGGIUNGE 30 UNITÀ LNG ALLE 120 ACQUISTATE A NOVEMBRE 2020. IN GERMANIA TRE CAMION ALLA SOCIETÀ DI SUPERMERCATI TEDESCA EDEKA MINDEN-HANNOVER ALIMENTATI CON BIO-LNG. INTANTO IVECO SIGLA UN ACCORDO CON ALPEGA, SOCIETÀ GLOBALE LEADER NEL SOFTWARE LOGISTICO, PER UN UTILIZZO CONGIUNTO DELLE BORSE CARICHI TELEROUTE E WTRANSNET.

L

LINO SINARI TORINO

anciato nel 2019, il pesante stradale Iveco SWay ha dimostrato, nei fatti e nei numeri, la grande attesa sul mercato: sin da subito, l’ammiraglia del costruttore nazionale - che nasce nelle linee del sito di Madrid - ha riscosso successo in termini di ordini, ma anche di em patia, con tanti autotrasportatori che hanno voluto per sonalizzarne la livrea, unendo all’utilizzo del proprio compagno di lavoro un gusto per l’estetica che, per Iveco, rappresenta certamente una novità. Grazie a sistemi avanzati per la connettività e tecnologie all’avanguardia, SWay si dimostra progettato per soddisfare le esigenze del driver, ottimizzare l’esperienza di guida e affrontare al meglio ogni tipo di mission. Le consegne sono proseguite per tutto l’anno 2020, pur con i due mesi di “quasi

fermo” a causa dei lockdown, per riprendersi subito nell’autunno dello stesso anno e proseguire per tutto l’arco del 2021, anche quest’estate. Sono 15 gli S-Way che, presso la sede di Verona di Officine Brennero - concessionaria per le province di Trento, Verona e Mantova - sono stati consegnati a Bissoli Autotrasporti, azienda che si occupa del trasporto in tutto il nord Italia di gas tecnici e merce pericolosa. Alla consegna hanno partecipato, tra gli altri, Roberto e Paolo Bissoli e Alberto Aiello, amministratore delegato Officine Brennero. La fornitura prevede otto veicoli a LNG e sette con motore Cursor 11 da 460 cv. Autotrasporti Bissoli è un’azienda a conduzione familiare che, con entusiasmo e passione, ha trasmesso i valori del marchio Iveco e dei mezzi pesanti alla nuova generazione. In occasione del 25esimo anniversario di Bissoli Autotrasporti, Officine Brennero ha perso-

nalizzato la calandra di uno dei 15 S-Way con dedica e firma di Alberto Aiello, Diego Moreschi, responsabile gamma Heavy, e Andrea Caprini, venditore del dealer. A Piacenza, dieci S-Way LNG sono stati consegnati a F.lli Di Martino, azienda che si occupa di servizi per trasporto e logistica. Alla cerimonia hanno partecipato Fabio Di Martino, Marco Morsia, Iveco Sales Area Manager, e Stefano Repetti, presidente di CRP (Centro Riparazioni Piacentino), concessionaria Iveco per le province di Piacenza, Lodi e Pavia. I dieci veicoli, alimentati a gas naturale, trattori stradali standard da 460 cv, ribassati, con ralla a geometria variabile, verranno impiegati per il trasporto intermodale. F.lli Di Martino è un provider che si occupa di soluzioni personalizzate in vari settori, dal fashion alla GDO, dall’automotive al beverage, dall’immobiliare all’e-commerce. L’a-

zien da si impegna a offrire servizi che rispondano ai più alti standard di sostenibilità, sfruttando il capillare network internazionale per raggiungere ogni destinazione, dal Nord al Sud dell’Europa e attraverso il Mediterraneo. In Alto Adige, partnership per la sostenibilità tra Iveco e Gruber, con gli S-Way alimentati a biometano protagonisti del primo scarico avvenuto in occasione dell’inaugurazione dell’impianto dell’Autoporto Sadobre. Grazie alla collaborazione tra HAM Italia, Gruber Logistics e APS Fuel (Autoporto Sadobre) si dà avvio al primo corridoio verde a emissioni zero d’Europa. Un progetto che ha alla base l’utilizzo di biomasse avanzate per la produzione di carburante e la completa certificazione della filiera, dalla produzione all’utilizzo. Il biometano liquido è ottenuto da biomasse, annullando completamente le emissioni di CO2 nell’atmosfera. Il nuovo

carburante sta pian piano prendendo piede in Europa, ma non esistono ancora soluzioni che possano garantire completamente la tracciabilità della molecola bio. Gli impianti a livello infrastrutturale non sono attrezzati con im-

pianti appositi e pertanto mescolano metano di origine fossile con metano bio. “Siamo orgogliosi - dichiara Fabrizio Buffa, Iveco Italy Market Alternative Propulsions Manager - che Gruber, azienda cui siamo legati per

In alto, i veicoli per LCT; in centro l’impianto Ham di Sadobre; sopra, gli S-Way di F.lli Di Martino; a sinistra, la flotta di Bissoli.


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 33

DELL’AMMIRAGLIA DEL COSTRUTTORE NAZIONALE

e i volumi schizzano in alto

reciproca fiducia e collaborazione, abbia scelto ancora una volta Iveco, investendo con eccellenza e lungimiranza nel biometano, soluzione green in cui crediamo fortemente. Oggi, grazie ai continui investimenti nel prodotto e nella tecnologia, siamo leader a livello europeo delle trazioni alternative, e proprio il metano, nella sua declinazione bio, rappresenta il presente e il futuro del trasporto pesante carbon neutral”. A mettere a disposizione il biometano liquido è HAM Italia, leader nel settore del gas naturale. “Non solo - pre-

cisa Riccardo Piccolo, LNG Sales Manager Italy & Swiss HAM Italia - il bioLNG è un carburante in grado di abbassare le emissioni del 95 per cento rispetto al diesel, ma previene le emissioni di CO2 che deriverebbero dagli scarti delle produzioni agricole, facendone per l’appunto un carburante a zero emissioni”. Electrolux, leader della sostenibilità nel settore degli elettrodomestici, è stata la prima ad effettuare un trasporto con la nuova soluzione bio. In Sicilia LCT (Luigi Cozza Trasporti), azienda lea-

der nel settore della logistica e dei trasporti, incrementa il suo già ricco bacino di mezzi all’avanguardia concentrandosi da tempo sulla sostenibilità. Dopo la fornitura di 120 Iveco S-Way (tra LNG e Euro 6D) effettuata a novembre 2020, sono stati consegnati ulteriori 30 veicoli, posizionando LCT tra le prime aziende con il più alto numero di automezzi green in Italia. L’azienda è in particolare molto attenta all’utilizzo del bio-LNG: la strategia di Luigi Cozza è ottenere un equilibrio tra una flotta moderna, sempre più aggiornata ed effi-

ciente, e l’attenzione alla salvaguardia del Pianeta. La sensibilità e il grande impegno verso questo tema garantiscono un vantaggio competitivo rispetto ad altri operatori del settore. I veicoli LCT sono altamente performanti, soprattutto in virtù dell’ampio raggio di azione della flotta: l’azienda consente il trasporto per il settore alimentare e industriale di beni in tutta Europa, con una copertura capillare di tutto il territorio nazionale, rimanendo fedele al principio di una logistica ecosostenibile. Inoltre, grazie alle numerose partnership con

selezionati spedizionieri esteri, Luigi Cozza Trasporti valica i confini europei: diversi dispositivi tecnologico-informatici, che garantiscono un contatto continuo e diretto sia con i clienti sia con un team di professionisti che monitora h 24 il veicolo in tutte le sue parti, permettono massima efficienza e tempestività del servizio. L’uso del bio-LNG sta prendendo piede anche in Germania dove, nell’ambito di un progetto pilota, Shell fornirà il suo carburante sostenibile a Edeka MindenHannover e ad altri due clien-

ti. Ogni partecipante potrà rifornire tre camion con bioLNG per un anno, con una conseguente riduzione significativa delle emissioni di CO2 durante tale periodo. La società di supermercati tedesca ha scelto tre dei suoi SWay a gas naturale per partecipare al progetto: un impegno per il trasporto a zero emissioni e la riduzione dell’inquinamento nei centri urbani con cui Edeka dimostra l’impegno verso la sostenibilità, con un focus sul rendere la catena di fornitura delle merci il più green possibile. Questo ha portato l’azienda a rendere sostenibile la flotta, attualmente formata da 10 Stralis e 40 S-Way tutti NP (Natural Power), alimentati a gas naturale. Prima della pausa estiva, Iveco ha siglato un accordo con il gruppo Alpega, società globale leader nel software logistico, per un utilizzo congiunto delle borse carichi Teleroute e Wtransnet. Le due società uniscono le forze per mettere a disposizione dei trasportatori italiani e spagnoli strumenti per migliorare la loro produttività. Il progetto verrà poi esteso agli altri mercati europei. Grazie all’accesso agevolato alle borse carichi Teleroute e Wtransnet offerto da Iveco, le imprese di trasporto che lo desiderano avranno la possibilità di gestire in modo più efficiente i veicoli, con l’obiettivo di ridurre i chilometri percorsi a vuoto e la relativa impronta di carbonio. “In questa partnership con Alpega – afferma Fabrizio Conicella, Global Head of Digital & Adv Technology Commercial & Specialty Vehicles – Iveco conferma la volontà di fornire alle aziende di trasporto un’ampia scelta di servizi digitali, disegnati per migliorare il business, aumentare la produttività dei veicoli e ridurre al contempo il consumo e le emissioni di CO2”.

PRODOTTO IL 600MILLESIMO EUROCARGO NELLO STABILIMENTO DI BRESCIA

IL MEDIO PER LE MISSIONI URBANE E LA LEGGE DEI GRANDI NUMERI E urocargo, leader europeo del suo segmento, conferma la bontà del suo progetto macinando record su record. È il caso del raggiungimento di uno storico traguardo: la produzione dell’unità numero 600mila nello stabilimento di Brescia, realtà produttiva iconica per il brand e per tutte le generazioni del medio Iveco, capace di coniugare un glorioso passato con una continua innovazione rivolta al futuro. La fabbrica di Brescia è da sempre il punto di riferimento della produzione di Eurocargo, grazie all’impegno di circa 1.600 persone che si dedicano con passione e dedizione al proprio lavoro. Marco Colonna, Direttore dello stabilimento, ha dichiarato: “È con orgoglio che salutiamo la produzione del 600millesimo Eurocargo, un veicolo la cui quarta generazione sta godendo di un successo continuo che si conferma di anno in anno. Questa pietra miliare non poteva che essere alimentata a gas naturale compresso (CNG), segno tangibile del costante impegno di Iveco per una mobilità sostenibile”. L’Eurocargo, entrato in produzione nel 1991, quindi esattamente 30 anni fa, e disegnato da Bertone, rappresenta uno dei veicoli industriali più innovativi nella sua concezione, come dimostra il successo di vendite raggiunto, essendo sviluppato su una piattaforma

cabina modulabile, che permette di raggiungere elevati livelli di personalizzazione dei veicoli a costi contenuti. “Ci precede una storia importante che ci sostiene nel proseguire sulla strada del miglioramento dei processi e dell’innovazione che, nei prossimi anni, vedrà

l’ulteriore evoluzione del nostro prodotto in chiave sempre più green”, ha ulteriormente precisato Colonna. Il team di Brescia si occupa in maniera sinergica di ogni fase produttiva del veicolo, dall’assemblaggio del telaio alla lastratura

della cabina, alla verniciatura, al montaggio della trasmissione, alla bardatura degli interni, fino al controllo finale. Inoltre, in fabbrica vengono realizzate versioni speciali, destinate ad applicazioni militari e servizi antincendio. Un eclettismo favorito, oltre che dal lavoro di squadra, anche dal World Class Manufacturing, un sistema integrato di produzione introdotto nel 2007 per ridurre a zero difetti, inefficienze, sprechi e incidenti. Un plus che rende l’Eurocargo apprezzabile non solo dal punto di vista estetico, ma anche dal punto di vista prestazionale. Le origini dello stabilimento risalgono al 1903, quando Roberto Züst fonda la Fabbrica Automobili, diventata poi Officine Meccaniche (OM) nel 1928 e acquisita dalla Fiat nel 1968. Dalla produzione iniziale di auto (anche da corsa), la OM è passata al settore agricolo e, infine, a quello dei veicoli industriali. Nel 1975 la OM è tra i “soci fondatori” che danno vita a Iveco. Nel 1991, la fabbrica viene scelta per avviare la produzione di Eurocargo, divenendo così la “casa” del veicolo. Lo stabilimento è particolarmente impegnato nella tutela dell’ambiente e della sostenibilità e nei prossimi mesi vedrà l’installazione di circa 20mila mq di pannelli solari che consentiranno un risparmio di CO2 pari a 1.300 t l’anno.


IL MONDO DEI TRASPORTI

Pagina 34

N° 302 / Settembre 2021

THERMO KING / COSTA EUGENIO ESPANDE LA SUA RETE CON UNA NUOVA SEDE A CESENA

Oggi la filiale è express PIENAMENTE OPERATIVA A PARTIRE DA QUESTO MESE, LA

COSTA EUGENIO HA ORGANIZZATO NELLA PROVINCIA ROMAGNOLA UNA NUOVA SEDE IN POCHE SETTIMANE. RENDENDOSI DISPONIBILE PER I SUOI CLIENTI GIÀ PRIMA DELL’APERTURA UFFICIALE, PER NON LASCIARLI SCOPERTI PROPRIO NELLA STAGIONE PIÙ CALDA DELL’ANNO.

È

CRISTINA ALTIERI CESENA

servita una grande determinazione per riuscire ad aprire una filiale in meno di due mesi, ma la voglia di esserci per assistere i professionisti al lavoro nella stagione più impegnativa dell’anno ha prevalso. E dopo aver firmato il contratto relativo alla sede i primi di aprile, già a fine maggio in officina i tecnici erano in grado di lavorare sui frigoriferi. Prima e dopo una febbrile attività organizzativa che si è completata definitivamente solo nel mese di agosto e che oggi è pronta a confermare il grado di eccellenza nel servizio che ha reso famosa la Costa Eugenio e che ha spinto il marchio Americano a rinnovare la sua fiducia, ancora una volta. Così dopo la sede di Parma e quella di Firenze, l’azienda crea un nuovo avamposto per la vendita, l’installazione e l’assistenza di unità di refrigerazione Thermo King in un territorio strategicamente importante per il trasporto a temperatura controllata. “Thermo King - inizia a raccontarci Cristina Costa, Presidente della Costa

Eugenio - ci ha domandato se eravamo interessati ad allargare la nostra competenza territoriale aprendo una filiale a Cesena, una zona contigua alla nostra. Di fronte al bivio quale impegnarci con tutte le nostre forze e crescere, oppure perdere questa occasione, abbiamo optato per la prima soluzione. Appena abbiamo ricevuto l’ufficialità sono iniziati i lavori. Il nostro impegno con Thermo King era di aprire a settembre ma ci siamo trovati tutti d’accordo sull’idea che non potevamo saltare completamente l’estate”. Già, perché per i mezzi frigo sono i mesi più difficili dell’anno, quelli che richiedono più interventi: i prodotti vengono messi sotto torchio e tutto deve funzionale al meglio e, quando qualcosa va storto, bisogna essere pronti con l’assistenza. Tanto più che l’area di Cesena è molto frequentata. “La filiale si trova a 2 km dall’uscita di Cesena nord interviene Pierluigi Camorali, Responsabile Commerciale della Costa Eugenio - l’area è molto interessante, è sempre stata storicamente un polo del fresco per la presenza di numerose aziende agroalimenta-

Cristina Costa, Amministratore delegato della Costa Eugenio, con Pierluigi Camorali.

ri, e poi siamo posizionati proprio sulla via adriatica, e abbiamo la possibilità di intercettare i trasportatori in arrivo da o in transito verso Balcani e Grecia. Che si sbarchi a Bari o ad Ancona, Cesena può trovarsi al termine del limite orario degli autisti. Inoltre molte aziende hanno sedi logistiche in vicinanza, è un tessuto molto ricco che ha bisogno della giusta assistenza”. Assistenza che, quando si parla di Costa Eugenio, i clienti sono abituati a ricevere in modalità premium. Proprio per questo è stato complicato trovare il giusto equilibrio tra la volontà di aprire il prima

possibile per accompagnare i clienti attraverso l’infuocata estate italiana, e la necessità di farlo con circospezione, misurando i passi, per incaricarsi della giusta quantità di lavoro e portarla a termine rispettando gli standard di qualità e le tempistiche che fanno parte del capitolato che Costa Eugenio assicura ai propri clienti. Anche perché la congiuntura economica è complicata, con l’indisponibilità delle materie prime che rallenta ogni ordine e ogni iniziativa. Oggi la sede di Cesena è pronta con tutto il suo organico operativo, composto da persone già in forza all’azienda, che stanno dedicando parte del loro tempo a questo nuovo impegno, e da nuovo per sonale: Lorenzo Ollari, Coordinatore del Settore Post-vendita e Filiali della Costa, si è occupato del lancio della nuova filiale e del suo allineamento con i nostri standard. Silvia Costa, nostro Responsabile Amministrativo, e il suo staff hanno formato, affiancato e supportato i nuovi colleghi nei complessi meccanismi della macchina amministrativa, fondamentali per il corretto funzionamento dei flussi aziendali. E poi i nuovi dipendenti che lavorano in loco: Sabrina Valzania

al back office e Alberto Roberti a coordinare un team di tecnici per un totale di 5 persone, di cui 4 di grande esperienza e un 19enne fresco di studi. “Questo è un punto che ci piace sempre sottolineare continua Cristina - crediamo fermamente nel binomio e spe rienza-freschezza e cerchiamo di realizzarlo con quanta più frequenza possiamo: diamo spazio ai giovani e vogliamo indirizzarli al meglio. Della formazione del per sonale in tutte le nostre strutture si occupa Monica Costa che ha già stretto rapporti con le scuole del luogo per creare un collegamento tra questi vivai e la nostra realtà”. Al lavoro per la nuova filiale di Cesena è stato messo l’impegno di tutto il team della Costa Eugenio. “Da Parma e Firenze - prosegue Cristina - sono arrivati tecnici per mostrare ai nuovi colleghi i procedimenti e uniformarli. Poi c’è la parte commerciale che in questi mesi ha verificato e studiato i database delle a ziende della nuova area riuscendo poi, covid permettendo, solo nell’ultimo periodo a incontrare le aziende per un confronto diretto. L’area di nostra competenza si estende ad Abruzzo, Marche e Moli-

se: non sono per noi zone familiari e quindi c’è un lavoro importante da svolgere, ma i nostri interlocutori si stanno dimostrando interessati alle iniziative della Costa, soprattutto in considerazione dei servizi che siamo in grado di offrire nella prosecuzione del rapporto di assistenza con i contratti di manutenzione”. In base a quello che sarà il volume della richiesta, la strut tura di Cesena è eventualmente pronta ad ampliarsi e non solo con l’inserimento di nuove figure professionali: “L’edificio che abbiamo scelto - continua Cristina Costa si presta per un’evoluzione futura con alcuni locali che potrebbero diventare operativi in un secondo momento. La struttura è molto funzionale, copre una superficie di 600 mq dedicati agli uffici e 2.200 ai locali tecnici, e ha un’area esterna di 4.000 mq utile sia per lavorare all’aperto che per mettere a disposizione dei clienti un parcheggio agevole. Anche Cesena diventerà sede di collaudo per l’immatricolazione di nuovi veicoli, attività svolta da anni a Parma e che ci permette di garantire ai nostri clienti tempi certi per il ritiro di targhe e aggiornamento libretti circolazione. Fra l’altro, nella nostra struttura di Cesena è presente una piattaforma, che abbiamo riattivato, in grado di pesare anche semirimorchi”. “Siamo un’azienda che ha dedicato tantissime energie a potenziare il servizio - conclude Cristina Costa - e questa ennesima conferma di Thermo King ci fa pensare di essere sulla buona strada. Questa prima estate “in sordina” è andata molto bene, ma dobbiamo continuare a lavorare sodo: assistere i professionisti e non fargli perdere neanche un istante di freddo è la nostra missione”.


IL MONDO DEI TRASPORTI

Pagina 36

N° 302 / Settembre 2021

REALTRAILER / L’AZIENDA AMPLIA LA FLOTTA CON NUOVI SEMIRIMORCHI TEDESCHI

Ciacciulli rinnova con Krone

ALL’INTERNO DELLA FLOTTA DI SEMIRIMORCHI DELL’AZIENDA SPECIALIZZATA NEL TRASPORTO DI ALIMENTARI A TEMPERATURA CONTROLLATA, KRONE HA UN RUOLO DI PRIMO PIANO. “LA MAGGIORANZA DEI VEICOLI FRIGORIFERI SONO A MARCHIO KRONE E SIAMO MOLTO SODDISFATTI DELLA SCELTA OPERATA CONFERMA IL TITOLARE PIERO CIACCIULLI - SONO DIVERSI I PUNTI VINCENTI DEL PRODOTTO KRONE, DAL PUNTO DI VISTA TECNICO E FUNZIONALE. IN PIÙ, SIAMO AVVANTAGGIATI DALL’AVERE COSTRUITO UN BUON RAPPORTO UMANO E PROFESSIONALE CON REALTRAILER, FIN DALL’INIZIO, NEL 2015”.

A

FABIO BASILICO

SANTERAMO IN COLLE

zienda pugliese con la vocazione all’innovazione e alla crescita in nome della qualità, la Ciacciulli Srl con quartier generale a Santeramo in Colle (BA), fondata nel 1972 da Angelo Ciacciulli e oggi capitanata dal figlio Piero, affiancato dalla figlia Marika e dal genero Francesco Fiorino, specializzata nella distribuzione di alimentari a temperatura

controllata, ha trovato in Krone e nel suo importatore italiano Realtrailer, due partner di riferimento per la gestione ottimale delle attività aziendali. “Mio padre ha iniziato l’attività negli anni Settanta operando nei trasporti per il settore dell’edilizia del movimento terra - racconta Piero Ciacciulli - Negli anni l’azienda è cresciuta e si è strutturata per poter accedere a un processo di diversificazione iniziato negli anni Novanta e che l’ha portata oggi a

essere una realtà affermata nella distribuzione di prodotti alimentare freschi e congelati su rotte nazionali e soprattutto internazionali in tutta Europa”. All’interno della flotta di semirimorchi Ciacciulli Krone ha un ruolo di primo piano. “La maggioranza dei veicoli adibiti al trasporto a temperatura controllata nonché i nostri centinati sono a marchio Krone e siamo molto soddisfatti della scelta operata - conferma il titolare Sono diversi i punti vincenti del prodotto Krone, dal punto di vista tecnico e funzionale. In più, siamo avvantaggiati dall’avere costruito un buon rapporto con Realtrailer, fin dall’inizio, nel 2015. In totale contiamo su 35 semirimorchi tra frigoriferi, centinati e ribaltabili. I veicoli a marchio Krone sono più di venti. Nel 2021 abbiamo già ritirato 6 semirimorchi frigo Krone da Realtrailer, tra cui un’unità che ha una decorazione speciale inspirata al mondo dei cavalli, mia grande passione, curata dalla stessa Realtrailer. Non escludiamo che nella seconda parte dell’anno se ne possano introdurre altri, tenuto anche conto che solitamente cambiamo almeno una decina di mezzi all’anno”. La flotta Ciacciulli dispone anche di 30 trattori Iveco, di cui 2 alimentati a LNG. Il legame con Iveco e con la concessionaria barese Di Pinto & Dalessandro ha consentito all’azienda di Piero Ciacciulli di avviare una precisa politica per la sostenibilità che si applica anche nella scelta dei

Nella pagina, il semirimorchio Krone con la speciale livrea voluta da Piero Ciacciulli.

se mirimorchi. “Il costante rinnovo della nostra flotta, sia che si tratti di trattori che di se mirimorchi, è giustificato dalle linee guida che da sempre ci contraddistinguono, ovvero affidabilità, professionalità e sostenibilità”. Le qualità tecniche del prodotto Krone sono state di recente nuovamente attestate dall’assegnazione del premio tedesco “Green Truck Innovation Award 2021”. Insieme al partner olandese THT Krone ha ottenuto il prestigioso riconoscimento per il Cool Liner “THT New Cool”. Per ottenere la massima sostenibilità possibile nel trasporto refrigerato, Krone ha pianificato la conversione del Cool Liner per assecondare l’operatività elettrica in collaborazione con lo specialista

THT. La conversione prevede che il secondo asse del rimorchio diventi asse di recupero in grado di alimentare con energia elettrica un pacco batterie montato longitudinalmente sotto il rimorchio. L’unità di terza generazione di accumulo dell’energia, che pesa solo 320 kg, rifornisce l’unità di refrigerazione elettrica con il supporto di

un’elettronica di controllo intelligente. Cool Liner “THT New Cool” ha un peso totale equivalente a quello di un rimorchio refrigerato convenzionale. Ciò riduce significativamente il consumo di carburante le emissioni inquinanti. Un altro effetto positivo è la minore emissione di rumore dell’unità di refrigerazione elettrica.

CiaCCiulli

Sede: Vicinale Caporizzi 6, Santeramo in Colle (BA) Fondazione: 1972, Angelo Ciacciulli Amministratore: Piero Ciacciulli Flotta: 30 trattori stradali, 35 semirimorchi Dipendenti: 45 Servizi: trasporto alimentare a temperatura controllata Fatturato: 8 milioni di euro


(&&2&Ζ

ODQRVWUDQXRYDILOLDOHD &HVHQDªSURQWDDGDFFRJOLHUWL &RQFHVVLRQDUL7KHUPR.LQJGDO 9HQGLWDHDVVLVWHQ]DXQLW¢IULJR $IILGDWLDOPHJOLRDVVLVWHQ]DK JLRUQLVXRQVLWH 9LDVSHWWLDPRLQ9LD00LQJKHWWL&HVHQD)& &RQWDWWDFLWNFHVHQD#WKHUPRNLQJLW ZZZWKHUPRNLQJLW

6HGL 3DUPD )LUHQ]H &HVHQD 2IILFLQHDIILOLDWH &DJOLDUL 5HJJLR(PLOLD $VFROL3LFHQR


IL MONDO DEI TRASPORTI

Pagina 38

N° 302 / Settembre 2021

KÖGEL / ACCORDO QUADRO CON L’ALTOATESINA GRUBER LOGISTICS PER MEZZI E SERVIZI

Le visioni sono coincidenti NON SOLO FORNITURA DI SEMIRIMORCHI: QUELLA TRA KÖGEL E GRUBER LOGISTICS DIVENTA UNA PARTNERSHIP A TUTTO TONDO. “SONO CLIENTI CHE CI PIACCIONO PERCHÉ PARLANO LA NOSTRA STESSA LINGUA” HA COMMENTATO

MICHELE MASTAGNI, COUNTRY MANAGER ITALY DEL PRODUTTORE DI

BURTENBACH. “E’ LA LINGUA DEL RISPARMIO PER IL CLIENTE E DELLA SOSTENIBILITÀ AMBIENTALE”.

M

CRISTINA ALTIERI BOLZANO

olto più di una fornitura: quella tra Kö gel e Gruber Logistics è una comunanza di visioni sul settore del trasporto che ha portato ad un accordo a 360 gradi. È un suggello che giunge al termine di un lavoro importante: quello svolto da Kögel che ha già fornito in tempi recenti 80 semirimorchi e oggi ne pianifica un numero considerevole nei prossimi anni, e quello di Gruber, che ha messo a punto nel corso della sua lunga storia aziendale una visione lucida di come debba funzionare il trasporto. “Ci sembrava limitativo intrattenere con Gruber solo un normale rapporto

cliente-fornitore - ha iniziato a raccontarci Michele Mastagni, Country Manager Italia di Kögel - e ci siamo impegnati per stabilire le basi che portino ad una partnership su molteplici livelli. Il primo capitolo, quello più visibile, sarà la fornitura di semirimorchi. Gruber ha un programma di crescita, e quindi di investimenti, sia per quanto riguarda i trattori, che per ciò che concerne il rinnovo del parco semirimorchi. Ci saranno poi una serie di altri servizi e ambiti nei quali potremo trovare una felice sinergia”. Il tutto illuminato da un punto di vista comune. “Abbiamo la stessa visione - continua Mastagni - sulla sostenibilità: produrre noi e utilizzare loro semirimorchi efficienti per far risparmia-

re costi all’azienda e all’ambiente, e impiegarli su rotte intermodali, che sappiamo essere una soluzione dall’alto profilo green. Nei prossimi 4-5 anni tra incremento del parco e sostituzione dei veicoli usati forniremo all’azienda di Ora circa 1.000 semirimorchi. La Gruber ha sposato questa idea, molto comune all’estero, un po’ meno in Italia dove il parco circolante dei semirimorchi ha un’età media di 14 anni: costituire una flotta giovane e moderna, e quindi sicura ed ecologica”. È una scelta di sostanza che ha indubbiamente una valenza sociale, visti i risparmi in termini di emissioni e il contributo alla sicurezza delle strade che veicoli nuovi riescono a garantire. Questo si declina

Da sinistra: Michele Mastagni, Country Manager Italia di Kögel; Martin e Christian Gruber, Eschey Thomas, Board Kögel DE, e Michele Sartori.

anche in un vantaggio per l’azienda che oltre a poter contare su un importante risparmio quando si tratta di fare rifornimento, spende anche meno alla voce manutenzione. È vero infatti che inizialmente i semirimorchi non hanno bisogno di interventi particolari, e a maggior ragione se vengono utilizzati nell’intermodale perché di fatto percorrono meno chilometri all’anno. Gruber Logistics organizza già il 20 per cento di tutti i carichi in modo intermodale. L’obiettivo è una quota del 40 per cento, da raggiungere entro due anni. “Possiamo centrare questo obiettivo solo con l’attrezzatura di trasporto adeguata” ha dichiarato Stefan Knapp, responsabile International Fleet di Gruber Logistics. “Non vendiamo solo pezzi di ferro con carrozze-

ria - riprende Michele Mastagni - ma abbiamo in mente di implementare anche altri servizi, come il full service, la telematica, e soprattutto il buy back, per il quale dopo 3 o 5 anni riprendiamo in consegna il veicolo, e aiutiamo la flotta dell’azienda a rimanere giovane. Abbiamo stabilito un canale di comunicazione diretto, ci confrontiamo sul mercato europeo e la Gruber si anche resa disponibile come tester per le prossime innovazioni che introdurremo in gamma. E ne introdurremo prestissimo”. Nelle prossime settimane arriveranno alla Gruber altri 240 veicoli, e dopo gli 80 appena consegnati, il ritmo rimarrà nei prossimi anni più o meno invariato, fino ad arrivare alla cifra tonda di 1.000 semirimorchi. “Gruber diventerà così nei prossimi tempi uno dei nostri maggiori clienti in

Italia. È un partner con il quale abbiamo piacere di lavorare perché parliamo la stessa lingua”. Il tedesco? “No, non è una questione di idioma sorride Mastagni - ma di mentalità. E infatti l’appoggio dei vertici di Kögel su questo grande impegno che ci siamo assunti è totale. Gruber ha una visione corretta del nostro mondo, non guarda solo all’aspetto economico, ma al contenuto del pacchetto”. Ma come si è arrivati a un accordo così importante? “Ho avuto un’intuizione - ci rivela Mastagni - quella di mettere a loro disposizione un nostro uomo-chiave, Michele Sartori, Afeter Sales Manager Italia. È chiaro che l’assistenza è tut to per un’azienda di grandi dimensioni, e siamo stati in grado di dimostrare sul campo che sapevamo prenderci cura di loro”.


La forza per andare più lontano Lunghi viaggi. Strade solitarie. Lo stress nel consegnare il carico nei tempi previsti. Quando lavori, hai bisogno di una forza interiore per andare avanti 24 ore su 24, 7 giorni su 7. PETRONAS Urania con tecnologia StrongTechTM è progettato per resistere più a lungo formando una pellicola di fluido eccezionalmente forte per estendere gli intervalli di cambio dell’olio e la vita del motore, aumentare al massimo le prestazioni, la redditività e darti la forza per continuare a lavorare.

Stronger for longer

Scopri il “core strength”. Visita www.pli-petronas.com/it-it/petronas-urania


IL MONDO DEI TRASPORTI

Pagina 40

N° 302 / Settembre 2021

SAF-HOLLAND ITALIA / GIORNATA DEDICATA ALLE OFFICINE AUTORIZZATE DEL NORD-EST

Service Partner ben motivati ALLA GIORNATA ORGANIZZATA NELLA SUGGESTIVA CORNICE DELLA CANTINA ROCCA SVEVA DI SOAVE HANNO PARTECIPATO NORD-EST, UNA QUARANTINA DI OPERATORI SUI 145 SERVICE PARTNER TOTALI A CUI IL PRODUTTORE E FORNITORE LEADER DI COMPONENTI SI APPOGGIA IN ITALIA. “LA GIORNATA - SPIEGA CRISTIANO STURARO, GENERAL MANAGER SAF-HOLLAND ITALIA - È STATA ORGANIZZATA INTORNO A UN CORSO DI FORMAZIONE IN CUI SONO STATI TRATTATI DIVERSI TEMI, COSTITUENDO COSÌ UNA PREZIOSA OCCASIONE DI INCONTRO E CONFRONTO PER CONSOLIDARE I RAPPORTI CON LA NOSTRA RETE”. LE OFFICINE AUTORIZZATE SAF-HOLLAND DEL

L

FABIO BASILICO SOAVE

a suggestiva cornice della Cantina Rocca Sveva e del borgo medievale di Soave (VR) ha ospitato la prima giornata che SAF-Holland Italia ha dedicato alle officine autorizzate del Nord-Est Italia. In totale una quarantina di operatori sui 145 Service Partner totali a cui SAF-Holland si appoggia in Italia. “La giornata spiega Cristiano Sturaro, General Manager SAF-Holland Italia - è stata organizzata intorno a un corso di formazione in cui sono stati trattati diversi temi, costituendo così una preziosa occasione di incontro e confronto per consolidare i rapporti con la nostra rete Service Partner”. Gli argomenti al centro dell’attenzione erano diversi, a cominciare dalle novità prodotto del produttore e fornitore leader di componenti, sistemi e applicazioni digitali per rimorchi e semirimorchi, camion e autobus (21 siti produttivi nel mondo, tra cui Flero e Nave, in provincia di Bre scia, 47 filiali e circa 10mila ricambisti e officine). Quindi si è parlato e discusso di termini di garanzia, attrezzatura e strumentazione per l’officina, ricambi originali e Sauer Quality Partes (il brand di seconda fascia dell’universo SAF), utilizzo del catalogo online PoD, utilizzo dell’App SH-Connect e infine le linee guida Service Partner 2021. La mattinata si è conclusa con il pranzo presso il ristorante annesso alla Cantina e la consegna degli attestati di partecipazione. “Siamo intenzionati a organizzare quanto prima altre giornate di formazione dedicate ai partner del NordOvest e del Centro-Sud - dice Sturaro - Le officine sono la nostra prima interfaccia con il cliente. Ci rappresentano e se ci rappresentano bene ci rappresentano meglio. Con queste giornate di formazione vogliamo dare loro tutte le informazioni e le nozioni necessarie per rappresentarci meglio sul mercato”. L’assistenza post-vendita è al centro delle strategie SAF-

Holland, che attraverso l’opera dei partner sul territorio arriva al cliente finale, la flotta di autotrasporto, sotto forma di un servizio di primaria qualità. Il motto e il principio con cui opera la divisione Service Post-Vendita SAFHolland illustra sinteticamente il concetto: “Focus Point, End Customer”. “Un cliente soddisfatto non è solo sinonimo di qualità del proprio prodotto, ma anche dell’efficienza dei servizi a esso collegati

e un cliente fidelizzato, grazie al passaparola positivo, porterà nuovi possibili acquirenti e possibilità di sviluppo”, aggiunge Sturaro. Complessivamente, il network di assistenza post-vendita SAF-Holland conta oltre 5mila officine autorizzate in tutto il mondo, di cui ben 1.899 in Europa, 740 delle quali attive con servizio 24H. Dei 145 centri autorizzati italiani, 80 forniscono il servizio 24H, 7 giorni su 7. Inoltre, è possibile contattare

il centralino per le emergenze, sempre attivo, disponibile in 21 lingue, italiano compreso. Dal 2015, Michel Nardelli è a capo del Team Service Post-Vendita SAF-Holland Italia che assieme a due collaboratori, Giacomo Ballini e Corrado Zivelonghi, gestiscono questa divisione garantendo alle flotte di autotrasporto tutto l’ausilio necessario. Il Team Flotte & Aftermarket è invece formato da Salvatore

Il team di SAF-Holland Italia a Soave. Terzo da sinistra, il General Manager Cristiano Sturaro.

Rinaldo, Fleet Area Manager Centro-Sud, Enrico Cerpelloni, Fleet Area Manager Centro-Nord, e Luca Dispinzieri, Responsabile Ricambi Aftermarket. “Per poter entrare a far parte della rete dei centri autorizzati SAF-Holland continua Cristiano Sturaro - è necessario rispondere a precisi requisiti di qualità e professionalità, come garantire ad esempio i tre principali sistemi di diagnosi (Knorr, Wabco e Haldex), e avere una specifica esperienza nel comparto del trainato. Le nostre officine autorizzate vengono infatti adeguatamente formate con corsi frequenti per far sì che le stesse siano sempre aggiornate sull’evoluzione dei nuovi prodotti”. Notevole importanza riveste l’innovazione digitale. SAF-Holland ha sviluppato l’App gratuita SH Connect, disponibile in 13 lingue, che supporta tutti i clienti e le officine. Tramite l’app è possibile trovare facilmente un’officina autorizzata o un rivenditore di ricambi nel raggio di 500 km, incluse tutte le informazioni di contatto necessarie. È inoltre possibile scansionare il QR-Code presente

SI AMPLIA IL RAGGIO D’AZIONE DEL SECONDO BRAND DEL GRUPPO SAF-HOLLAND

sui prodotti SAF-Holland per accedere al catalogo digitale PoD (Parts on Demand) e identificare iul ricambio necessario corretto. Infine, con un semplice click sul menu dell’app sono a disposizione H24 e 7 giorni su 7 i contatti più importanti per l’assistenza post-vendita, per l’aftermarket e per il centralino. La piattaforma PoD è stata aggiornata e migliorata. Grazie al nuovo design, gli utenti possono visualizzare a colpo d’occhio più informazioni sul prodotto e ottenere tutti i dettagli tecnici. È inoltre possibile customizzare individualmente parti dell’interfaccia utente per personalizzare l’esperienza di navigazione sulla piattaforma. L’intera gamma di parti di ricambio del marchio secondario Sauer Quality Parts è integrata nel catalogo elettronico PoD. La sezione Sauer consente di effettuare una ricerca incrociata OEM: è sufficiente inserire il codice del prodotto di primo equipaggiamento e il sistema guida automaticamente l’u tente al ricambio corrispondente del brand secondario. In una fase successiva, il catalogo verrà ampliato con i com ponenti del fornitore V.Orlandi, acquisito da SAFHolland nel 2018. L’azienda italiana produce componenti come ganci, traverse e occhioni per rimorchi e veicoli industriali speciali. Il 99 per cento della distribuzione di ricambi SAF-Holland in Italia viene gestito dal magazzino di Verona, con evasione degli ordini che in media richiede non più di 3 giorni. SAF-Holland si interfaccia direttamente con 35 distributori italiani. “Due anni fa è stato inaugurato il nuovo centro logistico di Aschaffenburg, dove c’è il quartier generale di SAF-Holland, che segue l’intero mercato dell’area Emea - dice ancora Cristiano Sturaro - Ogni filiale europea ha poi la sua gestione logistica specifica, che nel nostro caso fa riferimento al magazzino ricambi della sede italiana di San Giovanni Lupatoto (VR) da dove viene gestita la fornitura di ricambi ai distributori che a loro volta si interfacciano con l’officina”.

Con Sauer ricambi convenienti e di qualità per il veicolo da lavoro S AF-Holland espande ulteriormente il suo secondo brand Sauer Quality Parts in risposta al costante aumento della domanda di parti di ricambio alternative, per garantire una seconda vita al rimorchio e all’autocarro. Con il marchio Sauer SAF-Holland offre parti di ricambio per tutti i veicoli industriali più comuni. Oltre alle classiche parti soggette a usura nelle sospensioni o nel sistema frenante, la gamma del brand venduto in tutto il mondo comprende anche serbatoi d’aria, sollevatori telescopici e cerchi ruota in acciaio.

Molte regioni e Paesi si concentrano fortemente sul costo per l’acquisto di parti di ricambio e veicoli usati, utilizzando sempre meno parti di ricambio originali per le riparazioni, specialmente sui veicoli più datati. Con la sua linea secondaria, SAF-Holland si occupa della fornitura di ricambi durante l’intero ciclo di vita dei veicoli e offre ai suoi clienti attenti al prezzo una qualità affidabile per autocarri e rimorchi. I ricambi Sauer Quality Parts sono disponibili in Europa, Asia e Medio Oriente attraverso la rete distributiva SAF-Holland. Vengono prodotti

da fornitori certificati e selezionati e sono soggetti a stringenti controlli qualitativi. “La seconda linea equivale per noi a dire seconda vita del veicolo - dichiara Cristiano Sturaro, General Manager SAF-Holland Italia - È pensata per quando il veicolo è ormai fuori dai termini di garanzia e desidera utilizzare ricambi che costino leggermente meno. Dal punto di vista qualitativo, con Sauer abbiamo la certezza di poter fornire un prodotto di rilievo e naturalmente più competitivo. In genere, vengono utilizzati gli stessi fornitori del prodotto originale”.


MA ST

PE ER LA TU C I F CC

ER

SE A LE

MASTER START

Leasing esclusivo per diluire nel tempo il costo dei pneumatici e dei servizzi.

MASTER CARE

FLOTT TA O IN 4!

Prodotti e servizi su misura per rispondere ai bisogni della tua flotta.

Il sistema di gestione ne programmata dei pneumatici della flotta.

ER

ET E FL

Canone all inclusive per una manutenzione senza pensie eri.

MA S T L’’offer ta 4 MA STER offre 4 soluzioni esclusive di assistenza e manutenzione pneumatici cr eate su misu r a p e r og ni e sig e nz a d ella vo s t r a f lot t a au to c a r r o o t r asp o r to leg g e r o. + Tarif fe uniche e trasparenti su tut to il territorio nazionale + Fat turazione centralizzata + Omogeneità degli stand dard operativi + Suppor to costante del Customer Care Euromaster + Soccorso stradale 24h e 7gg su 7 Per saperne di più chiamaci 02 00664521 o scrivi a gestione.flot te@euromaster.com EUROMA STER , il par tner della tua mobilità

IN BU UONE MANI eurom master-pneumaticci.it


IL MONDO DEI TRASPORTI

Pagina 42

N° 302 / Settembre 2021

TN SERVICE / NUOVA SEDE PER L’OFFICINA PUNTO DI RIFERIMENTO DEL TRASPORTO

È sempre più tempo di network LA RETE DELL’OFFICINA CON QUARTIER GENERALE A MONTORO

(AV) COMPRENDE ORA LE SEDI DI MERCATO SAN SEVERINO (SA), PIACENZA E SAN GIOVANNI LUPATOTO (VR). ANCHE NELL’AREA VERONESE, SNODO NEVRALGICO DEI TRASPORTI E DELLA LOGISTICA DELL’ITALIA SETTENTRIONALE, L’AZIENDA CAMPANA GARANTISCE PRESENZA E SUPPORTO COSTANTE AL MONDO DEI PROFESSIONISTI DEL TRASPORTO SU GOMMA ATTRAVERSO UN AMPIO VENTAGLIO DI SERVIZI DEDICATI A TRUCK, VAN, MOTRICI E

U

FABIO BASILICO

SAN GIOVANNI LUPATOTO

n nuovo centro servizi specializzato. TN Service apre la nuova sede di San Giovanni Lupatoto, in provincia di Verona, e allarga la sua presenza sul territorio italiano qualificandosi sempre più come punto di riferimento per i professionisti dell’autotrasporto. Il network dell’officina con quartier generale a Montoro (AV) comprende le sedi di Mercato San Severino (SA), Piacenza e appunto quella di San Giovanni Lupatoto. Anche nell’area veronese, snodo nevralgico dei trasporti e della logistica dell’Italia settentrionale, l’azienda campana garantisce presenza e supporto costante al mondo dei professionisti del trasporto su gomma attraverso un ampio ventaglio di servizi dedicati a truck, van, motrici e semirimorchi di ogni tipologia: le attività di assistenza, manutenzione e riparazione comprendono an che gli interventi su pneumatici e quelli di soccorso stradale

SEMIRIMORCHI DI OGNI TIPOLOGIA. in Italia e nel resto d’Europa, H24 e 7 giorni su 7. Non solo: TN Service è molto più di una semplice officina, dal momento che all’interno della sua vasta offerta sono pre visti anche i servizi di ven dita e noleggio (a breve e lungo termine), gestione pratiche e sinistri, rinnovo triennale della certificazione ATP e magazzino ricambi multibrand. “Da sempre Verona è un punto strategico per tutto il

L’officina mobile di TN Service nella nuova sede di San Giovanni Lupatoto.

mondo dei trasporti e della logistica - dichiara Gennaro Del Regno, General Manager TN Service - Con il Quadrante Europa, che si colloca tra i principali corridoi logistici europei, rappresenta uno snodo fondamentale per i trasporti verso l’Est Europa e non solo. Ecco perché la scelta di TN Service è mirata e con un obiettivo ben definito: restare fedeli alla mission aziendale e confermare il ruolo

di TN Service come ‘alleata dei trasporti’. Questa definizione è motivata dal fatto che attraverso i nostri servizi riusciamo a offrire un supporto concreto a tutti gli interlocutori del mondo truck”. La nuova sede di San Giovanni Lupatoto è costituita da 2mila mq di officina e 8mila mq di piazzale esterno: uno spa zio fisico moderno e attrezzato che in breve tempo ospiterà un team di 10 tecnici specializzati pronti a dare assistenza totale agli autotrasportatori. “Siamo entusiasti di aver aggiunto alle sedi di Montoro, Mercato San Severino e Piacenza, quella di San Giovanni Lupatoto - aggiunge Del Regno - L’apertura a Verona rappresenta il percorso naturale di TN Service: grazie alla sua posizione geografica strategica, infatti, Verona ci fornisce la possibilità di esprimere al meglio la nostra mission e di supportare i protagonisti del mondo truck”. Professionalità, familiarità, presenza costante, sono le caratteristiche che da sempre caratterizzano l’operato dello staff TN Service. Esperienza, formazione, intuizione e utilizzo di sofisticate strumentazioni guidano e supportano i tecnici TN Service nell’esecuzioni di tutte le attività oggi contemplate nelle complesse attività di assistenza ai veicoli da lavoro. In particolare, corsi di aggiornamenti in sede e presso le Case costruttrici consentono ai tecnici di restare sempre aggiornati e fornire in modo costante e continuativo un servizio di qualità pre mium, a garanzia delle performance dei veicoli e della profittabilità delle aziende di trasporto clienti. Nel 2019 TN Service ha attivato TN Service Shop, il negozio online degli autotra-

tN ServiCe

Mission: TN Service, società del Gruppo Torello, è un’officina specializzata in assistenza, manutenzione e riparazione di veicoli industriali e commerciali: truck, van, motrici e semirimorchi di ogni tipologia. Attività: assistenza elettronica e meccanica, allineamento assi, servizio pneumatici, gestione sinistri, rinnovo certificazione ATP, officina mobile H24 per soccorso stradale in Italia ed Europa, veicolo sostitutivo, Service Shop online, noleggio a breve e lungo termine di truck e van con TN Service Rent. Sedi: Montoro (AV) - via Laura snc Tel: +39 0825 502796 info@tnservicesrl.it Mercato San Severino (SA) - via Pizzone 11/5 Tel: +39 089 9358920 info.carrozzeria@tnservicesrl.it Piacenza - via Bartolomeo Riva 16 Tel: +39 0523 1729423 pc.info@tnservicesrl.it

San Giovanni Lupatoto (VR) - Via Monte Comun 17 Tel: +39 045 5549099 vr.info@tnservicesrl.it Contatti Assistenza: assistenza@tnservicesrl.it Assistenza H24: tel. +39 347 091 3009

Internet: tnservicesrl.it - tnservice.shop

sportatori. Si tratta di un dettagliatissimo portale dedicato alla vendita e al noleggio. Con due cataloghi dettagliati, lo store dispone anche di un vastissimo assortimento di ricambi originali e aftermarket per veicoli industriali e commerciali. “La nostra vision è essere al servizio del cliente, alleati dei trasporti - spiega Alfonso Bianco, Marketing & Communication Specialist di TN Service - Con TN Service Shop, infatti, abbiamo dato vita a una vetrina online pensata proprio per i professionisti del trasporto, per rispondere alla loro richiesta di imme-

diatezza e praticità: con foto e schede tecniche chiare e dettagliate, vendiamo e noleggiamo veicoli di ogni tipologia, in Italia e all’estero”. Per quanto riguarda la vendita di veicoli industriali e commerciali, su TN Service Shop sono proposti trattori, semirimorchi, motrici, furgoni, van, vetture di ogni tipologia, tutte in ottime condizioni. Al noleggio a breve e lungo termine di truck e van provvede TN Service Rent, sezione del portale che offre tutte le informazioni per la locazione anche di semirimorchi frigo, centinati e furgonati.


N° 302 / Settembre 2021

ALLISON TRANSMISSION / XFE PER TRUCK MEDI

Dopo gli autobus è l’ora dei camion

IL NUOVO È GRANDE E LEGGERO. BECAUSE WE CARE!

COLLAUDATA IN TUTTO IL MONDO SUGLI AUTOBUS, LA TRASMISSIONE A RISPARMIO DI CARBURANTE E RIDUZIONE DELLE EMISSIONI DEL PRODUTTORE AMERICANO ORA OFFRE ANCHE AGLI AUTISTI DI VEICOLI INDUSTRIALI UN CONVENIENTE TRAMPOLINO DI LANCIO SULLA STRADA VERSO L’ELETTRIFICAZIONE. IL CAMBIO ALLISON XFE AUMENTA L’EFFICIENZA DEL CARBURANTE BLOCCANDOSI A VELOCITÀ INFERIORI, CONSENTENDO AL MOTORE

A

DI TRASCORRERE PIÙ TEMPO A MARCE SUPERIORI E A GIRI MOTORE INFERIORI.

LINO SINARI SLIEDRECHT

llison Transmission ha introdotto nella regione EMEA due nuove versioni della trasmissione completamente automatica xFE per autocarri medi. Già disponibili, i modelli 3000 xFE e 3200 xFE sono progettati per motori che erogano fino a 370 cv e 1.695 Nm (a seconda dell’applicazione) e per veicoli dal peso lordo fino a 28,5 t. Rispetto alle trasmissioni standard delle serie 3000 e 3200, le nuove 3000 xFE e 3200 xFE possono ridurre le emissioni di CO2 e il consumo di carburante fino al 3,7 per cento. I maggiori risparmi sono ottenuti a velocità inferiori a 32 km/h (a seconda del rapporto al ponte) e superiori a 72 km/h. Anche la pendenza, cioè la

logico, sulla strada verso l’elettrificazione e altri sistemi di propulsione non a combustibile fossile, per i quali abbiamo anche soluzioni di propulsione adatte”. La trasmissione xFE è collaudata da milioni di chilometri di servizio su migliaia di autobus urbani e interurbani in tutto il mondo. Allison xFE aumenta l’efficienza del carburante bloccandosi a velocità inferiori, consentendo al motore di trascorrere più tempo a marce superiori e giri mo tore inferiori. Oltre a ridurre il consumo di carburante e le emissioni, questo riduce anche la dispersione del calore del motore, migliorando le prestazioni. I nuovi Allison 3000 xFE e 3200 xFE portano avanti questa strategia di successo applicando il lock up in prima marcia, invece che in seconda, e ren-

fiche dei punti di cambio marcia in base a fattori quali il peso del veicolo, la pendenza della strada, la frequenza di stop-start e l’uso dell’acceleratore. L’efficienza della trasmissione xFE di Allison può sommarsi, attraverso una flotta di veicoli, a benefici ambientali di sorprendente importanza. Allison ha fornito un esempio di simulazione del l’impatto utilizzando il Vecto (Vehicle Energy Consumption Calculator Tool) sviluppato dalla Commissione Europea, per un tipico camion per la raccolta rifiuti e un ciclo di lavoro. Sulla base di un risparmio del 3,7 per cento di carburante e di CO2, i risultati hanno mostrato che, su un solo camion, il risparmio annuale di 533 euro sul costo del carburante - durante la percorrenza di 20.100 km -

KÖGEL LIGHT PLUS

9 meno emissione di CO 9 più carico utile 9 più efficienza

* 2

*

dendo le marce overdrive più lunghe, migliorando l’intervallo dei rapporti di trasmissione da 5,37 a 5,91. Questi cambiamenti sono stati ottenuti senza alcun bisogno di alterare la forma esterna, il montaggio, il programma di manutenzione o il peso della Serie 3000. Entrambi i modelli 3000 xFE e 3200 xFE sono offerti con o senza un retarder, ed entrambi sono dotati del pacchetto Allison FuelSense 2.0: controlli intelligenti per bilanciare con precisione risparmio di carburante e prestazioni. FuelSense 2.0 dispone delle seguenti funzionalità: Neutral at Stop, che mette in folle l’automatico dopo che il veicolo è fermo da qualche secondo, per ridurre o eliminare il carico sul motore a veicolo fermo; Acceleration Rate Management (gestione dell’accelerazione) per mitigare la guida aggressiva controllando automaticamente la coppia del motore; algoritmo intelligente DynActive Shifting, per avviare sottili modi-

è equivalente all’eliminazione delle emissioni di CO2 di 3,8 barili di petrolio, 65 sacchi di rifiuti riciclati invece che messi in discarica, o 195.600 ricariche di smartphone. Dato che le normative per un’aria più salubre in tutto il mondo riducono progressivamente le emissioni di CO2 consentite, tali risparmi saranno non solo desiderabili, ma necessari. Costruttori di autobus di tutto il mondo hanno scelto le trasmissioni xFE di Allison sin dal loro lancio nel 2015. Inoltre, l’xFE è già stato sviluppato per alcune applicazioni su veicoli industriali: ad esempio, l’autocarro leggero Hyundai Mighty è allestito con una trasmissione Allison 1000 xFE per l’uso in applicazioni di raccolta e consegna, speciali, rifiuti e antincendio nel mercato interno coreano e per l’esportazione in Australia. Nel 2020, Allison ha lanciato la trasmissione completamente automatica 3414 Regional Haul Series, basata sulla tecnologia xFE, per il Nord America.

Maggiori informazioni su: www.koegel.com/CO2

TH E

capacità del veicolo a pieno carico di salire un pendio a velocità costante senza dover scalare e far lavorare di più il motore, migliora sotto i 48 km/h. Queste caratteristiche rendono le nuove trasmissioni particolarmente adatte alle applicazioni urbane a bassa ve locità e a cicli di lavoro stop-start come la raccolta rifiuti. “Le flotte di logistica spiega Sjoerd Vos, Direttore Marketing EMEA Allison Transmission - sono ovunque sotto pressione legislativa per ridurre le emissioni, e naturalmente tutti vorrebbero ridurre i costi per il carburante. Le nuove trasmissioni xFE potrebbero essere uno strumento fondamentale per aiutare gli OEM e le flotte a ridurre le emissioni di CO2 del 15 per cento entro il 2025 e del 30 per cento entro il 2030, come richiesto dalle normative europee sulle emissioni dei veicoli pesanti. Fare molto di più con l’efficiente tecnologia diesel di oggi è un trampolino di lancio, economico ed eco-

*

XT G NE

ENERATI

ON

NOVUM OF TRAILERS

e o k . w ww

it . l ge


IL MONDO DEI TRASPORTI

Pagina 44

N° 302 / Settembre 2021

INTERVISTA / FAUSTO MARTINELLI, DIRETTORE COMMERCIALE TECNOKAR TRAILERS

Da sette lustri l’orgoglio del vero “Made in Italy” TRENTACINQUE ANNI FA NASCEVA, PER VOLONTÀ DEI TRE SOCI GRAZIANO LUZZI, FAUSTO MARTINELLI E FABRIZIO PICCIONI, QUELLO CHE NEGLI ANNI AVREBBE ASSUNTO IL RUOLO DI PRODUTTORE ITALIANO DOC DI VEICOLI PER IL TRAINATO. TUTTORA GUIDATA DAI TRE FONDATORI, CON IL SUPPORTO DI NUOVE LEVE, TECNOKAR CONTINUA A MIGLIORARE LA QUOTA DI MERCATO E PUNTA A NUOVI TRAGUARDI: “RAFFORZEREMO LA CAPACITÀ PRODUTTIVA PER CONFERMARCI LEADER NEI SEGMENTI NEI QUALI SIAMO PRIMI E POSIZIONARCI IN UN MERCATO INTERNAZIONALE”, AFFERMA FAUSTO MARTINELLI.

S

MAX CAMPANELLA

to riguarda la capacità produttiva, si producono 1.500 semirimorchi l’anno. L’ampliamento dei siti produttivi è previsto per la fine del 2021 e per il 2022, seguito da un’espansione territoriale su cui stiamo lavorando duramente, in modo da posizionare Tecnokar in un mercato internazionale. Tutto questo porterà al 10-15 per cento di aumento della produzione.

SPOLETO

ono trascorsi esattamente 35 anni da quel 1986 che vedeva tre imprenditori umbri - Graziano Luzzi, attuale Presidente del Grup po, Fausto Martinelli, Direttore Commerciale, e Fabrizio Piccioni, Responsabile Produzione e Qualità - dare vita a una realtà produttiva nel settore del trainato. È qui, tra le colline, gli uliveti e i vigneti di Spoleto, in provincia di Perugia, che Tecnokar Trailer metteva a frutto le competenze dei tre soci. Negli anni, pur tra le altalene del mercato, l’azienda umbra ha sempre tenuto salde le radici nel territorio, arrivando anche a esportare, dando lustro al “made in Italy” (la Francia è primo mercato estero) e tenendo salda la posizione di leader nelle casse in ferro e nei ribaltabili per cava-cantiere, ampliando anno dopo anno il ventaglio di prodotti. Oggi, con una struttura manageriale che si rafforza con l’arrivo delle seconde generazioni e di nuove risorse, Tecnokar è sinonimo di un’am pia produzione per il trainato, dai semirimorchi ribaltabili a quelli da rottame e asfalto, passando per mezzi di linea (cisterne e trasporto container) e i piani mobili Legras, di cui è importatore esclusivo. Fatta eccezione per questi ultimi, che nascono negli stabilimenti francesi di Legras, tutto il resto della produzione è rigorosamente italiana.

Mdt - Com’è costituita oggi, nel suo complesso, la gamma di prodotti Tecnokar? Martinelli - Oggi Tecnokar Trailers ha una gamma di prodotti che supera i 20 modelli e che raggiunge vari settori del trasporto stradale, quali cava-cantiere, polivalente, rottame, trasporto container, telai, prodotti di linea e speciali: ogni modello copre una specifica esigenza. Non solo: il cliente ha la possibilità di personalizzare completamente il prodotto, potendo scegliere tra un’ampia gam-

ma di accessori per far fronte alla tipologia del lavoro che dovrà essere svolto. C’è, inoltre, un’ulteriore sezione di prodotti che fanno parte del Gruppo Tecnokar: Emilcamion, Adige e Legras. Emil-

camion è un’azienda leader negli allestimenti su motrice, che è stata rilevata da TKE, società del Gruppo Tecnokar, con l’obiettivo di ampliare la gamma prodotti per soddisfare le richieste dei clienti a 360

Fausto Martinelli, Direttore Commerciale Tecnokar Trailers.

gradi. Adige è un brand entrato nella famiglia dei prodotti Tecnokar dal 2014, che produce semirimorchi, rimorchi, ribaltabili su motrice e allestimenti di veicoli commerciali. Il rapporto con Legras, invece, prevede la distribuzione di veicoli a piano mobile per l’Italia. Nel 1996 con Supertop F1 siamo stati i primi in Italia a realizzare un semirimorchio ribaltabile a vasca tonda con sospensione pneumatica: siamo stati i pionieri di questo modello e tutti ce lo hanno imitato!

Mdt - Quali sono le ultime novità lanciate? Martinelli - Il 2019 è stato l’anno in cui è uscita TecnokAPP, l’app di Tecnokar che consente al trasportatore di attivare le funzioni di gestione del trailer e di monitorarne in tempo reale lo stato operativo. È stato messo a punto un sistema di rilevazione della temperatura dell’asfalto trasportato TTM (Tecnokar Thermo Monitoring), che permette di rilevare la temperatura al momento del carico e monitorarne lo stato durante il trasporto, fino al momento della posa in opera. Il cliente che sceglie TecnokApp riceve un tablet per la gestione del trailer, una stampante mobile per lo scontrino di consegna dell’asfalto, una centralina

per la gestione e il controllo del trailer e un portale flotte, per monitorare la propria flotta in tempo reale. Di futura realizzazione l’apertura di un nuovo sito produttivo a Spoleto: TKM Frame & Body, che sorgerà non lontano dalle sedi Tecnokar, nella vecchia sede delle Industrie Minerva. Lo stabilimento, ora in ristrutturazione, sarà il primo costruito in un’ottica di Industria 4.0, con macchinari interconnessi e tecnologicamente avanzati, un sistema di automazione, smart factory, Iot, personale altamente qualificato e tanto altro.

Mdt - In quali stabilimenti avviene la produzione e qual è la relativa capacità produttiva? Martinelli - Attualmente i siti produttivi di Tecnokar sono quattro: TK1-2-3 si trovano a Spoleto e TK4 a Foligno. Tecnokar 1 ospita il comparto produttivo di telai, finitura e verniciatura; Tecnokar 2 ospita la produzione delle casse quadre; Tecnokar 3 la manutenzione; Tecnokar 4 produce le casse tonde e l’alluminio. Dopo la ristrutturazione dello stabilimento TKM e un ulteriore ampliamento adiacente all’attuale stabilimento Tecnokar 1, Tecnokar vanterà una superficie coperta totale di circa 50mila mq. Per quan-

Mdt - Quali sono oggi le dimensioni del Gruppo Tecnokar? Martinelli - Per quanto riguarda i volumi di vendita e quota di mercato, Tecnokar Trailers nel 2020 ha consuntivato vendite di 1.200 semirimorchi, con una quota di mercato del 33 per cento nel settore ribaltabile posteriore con PTT oltre le 3,5 t. Il fatturato del gruppo nel 2020 è attestato sui 50 milioni di euro, i dipendenti sono 315. Nonostante la pandemia e i mesi di lockdown, in termini di produzione il 2020 è stato l’anno migliore di sempre e quest’anno contiamo di fare ancora meglio: con il mese di settembre abbiamo superato i numeri del 2020 e ci attesteremo su posizioni superiori al target previsto a inizio d’anno. Le vendite estere nel 2020 hanno raggiunto circa il 30 per cento del totale. Di queste buona parte sono avvenute in Francia, le altre nel Nord Europa. Mdt - Come è organizzata Tecnokar sul piano della vendita e assistenza sul territorio nazionale?

Martinelli - La rete vendita in Italia è affidata a nove venditori esperti che hanno varie zone di riferimento, coprendo tutto il territorio, da nord a sud comprese le isole. Il cliente ha la possibilità di interfacciarsi con il venditore di zona per ogni esigenza. Per quanto riguarda la rete di assistenza, in Italia sono presenti oltre 180 centri specializzati, che consentono agli autotrasportatori maggiore tranquillità nel caso in cui necessitino di assistenza.

IMPORTANTE NOVITÀ NEI PRODOTTI PER UTILIZZO POLIVALENTE

DELFINO, VASCA IN ALLUMINIO CON CHIUSURA DELLA SPONDA ANCORA PIÙ SICURA S i chiama Delfino la novità del 2021 che va a ampliare e completare la gamma Tecnokar. Vasca in alluminio che nasce nelle line del sito di Spoleto, Tecnokar Delfino presenta un

meccanismo brevettato di chiusura per la sponda posteriore, innovazione che permette una chiusura della sponda sicura al 100 per cento e che diventerà di serie in tutti i Delfino in al-

luminio. “Si tratta - illustra Fausto Martinelli - di un modello polivalente, che si adatta a una vasta tipologia di utilizzo: trasporto di rifiuti (secco e umido), cereali, cippato ecc. Una famiglia

completa, che va dai 9 agli 11,5 metri, per clienti che apprezzano la qualità di un prodotto frutto della competenza Tecnokar”. Da sempre presente nel segmento delle vasche in al-

luminio, finora il produttore umbro realizzava questa tipologia di veicoli su telaio di produzione propria e casse provenienti da fornitori tedeschi. “Oggi - precisa il Direttore Commerciale -

l’intero modello viene prodotto da noi: il segmento rappresenta già oggi il 20-25 per cento delle vendite Tecnokar. Con Delfino puntiamo ad ampi margini di miglioramento”.


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 45

VOITH / SOLUZIONI SEMPRE PIÙ AVANZATE E PARTNERSHIP VINCENTI PER L’ELETTRICO

Sulla strada della nuova mobilità LO SPECIALISTA TEDESCO È FORTEMENTE ATTIVO NEL PROGETTARE SISTEMI DI TRAZIONE ELETTRICA CHE RISPONDANO CON LA MASSIMA EFFICACIA AL CENTRO DELLA STRATEGIA E-MOBILITY C’È L’AVANZATO SISTEMA DI TRAZIONE ELETTRICA VEDS (VOITH ELECTRICAL DRIVE SYSTEM), IDEALE PER AUTOBUS E TRUCK.

ALLE RICHIESTE SEMPRE PIÙ PRESSANTI IN TEMA DI MOBILITÀ SOSTENIBILE PROVENIENTI DAL SETTORE DEI TRASPORTI MERCI E PERSONE.

A

FABIO BASILICO REGGIO EMILIA

ffermato specialista della driveline intelligente, Voith è fortemente attiva nel progettare soluzioni e sistemi di trazione elettrica che rispondano con la massima efficacia alle richieste sempre più pressanti in tema di mobilità sostenibile provenienti dal settore dei trasporti merci e persone. Voith ha stretto un accordo con Orten ElectricTrucks che ha l’obiettivo di fornire un valido supporto ai fleet operator nel processo di conversione alla mobilità zero emission. La soluzione di emobility proposta dalle due aziende consente il retrofit con l’avanzato sistema di trazione elettrica Voith (VEDS, Voith Electrical Drive System) su autobus e truck leggeri e medi. Con l’opzione retrofit, facile da realizzare e conveniente, Voith e il partner Orten danno un sensibile contributo alle politiche ecologiche delle aziende e nel contempo rendono ancora più appetibili le soluzioni green da applicare in contesti particolari come le città. Sviluppato appositamente per le esigenze del trasporto

Il sistema di trazione elettrica Voith Electrical Drive System.

pubblico, il Voith Electrical Drive System è costituito da un motore elettrico da 340 kW ad alta efficienza energetica in grado di alimentare anche autobus a due piani e articolati così come truck a elevato chilome-

traggio. Un inverter raffreddato ad acqua assicura una densità di potenza molto elevata, mentre l’unità di gestione intelligente controlla tutti i componenti del sistema e il recupero di energia. Inoltre, il VEDS in-

clude inverter ausiliari e una scatola di distribuzione ad alta tensione. Tutti i componenti sono perfettamente abbinati per ottenere la massima efficienza possibile. La driveline elettrica è fornita da Voith, mentre Orten

si occuperà dell’integrazione del sistema sul veicolo. I clienti possono scegliere di installare il kit retrofit VEDS presso la propria sede o di far eseguire l’integrazione presso le sedi Orten. “Con la rete globale di vendita e assistenza Voith e l’esperienza pluriennale di Orten Electric-Trucks nell’elettrificazione di veicoli commerciali, la partnership strategica tra le due aziende offre agli operatori l’intera gamma di servizi per la conversione all’elettrico”, afferma Robert Orten, CEO di Orten Electric-Trucks. Il VEDS può essere utilizzato anche in modo flessibile su varie piattaforme. Il concetto supporta i sistemi di batterie di un’ampia gamma di produttori ed è anche abilitato per l’uso nelle trasmissioni di veicoli elettrici a celle a combustibile. Dalla sua introduzione nel 2019, il Voith Electrical Drive System ha già dimostrato la sua affidabilità ed efficacia in diverse applicazioni del trasporto pubblico, qualificandosi come soluzione innovativa per il passaggio alla mobilità elettrica. Con la nuova versione MD (medium duty), Voith ha aggiunto al suo portfolio una seconda opzione motore che in-

clude l’apposito inverter. La nuova opzione da 260 kW con coppia massima di 2.850 Nm è progettata per autobus e camion fino a 19 tonnellate ed è ottimizzata per un uso prettamente urbano. Rispetto alla versione HD (heavy duty) esistente, il nuovo motore MD pesa 50 kg in meno e consente una maggiore autonomia. Il più potente 340 kW con coppia massima di 3.100 Nm esegue garantisce impressionanti performance, specialmente con autobus a due piani o articolati e con truck oltre le 26 tonnellate, ed è particolarmente adatto anche per l’impiego interurbani. La nordirlandese Wrightbus è stato il primo produttore di autobus a scegliere di integrare la più recente proposta motoristica Voith nella sua seconda generazione di autobus a batteria elettrica (BEV) e a celle a combustibile (FCEV), distribuiti in Europa. Già nell’agosto 2021, Wrightbus ha consegnato la prima unità di un totale di 80 autobus a due piani StreetDeck BEV dotati di VEDS alla Translink, il più grande operatore di trasporto pubblico dell’Irlanda del Nord, che prevede di utilizzare i nuovi autobus a due piani a Belfast e Derry.

KRONE PROFI LINER

SCANSIONA

A D ES S O r il codice QR pipeù! saperne di

Importatore per l’ Italia: REALTRAILER SRL, Via Marocchi 2/a, 46029 SUZZARA MN, Tel. 0376/536809, info@realtrailer.it, www.realtrailer.it

13:41:49


IL MONDO DEI TRASPORTI

Pagina 46

N° 302 / Settembre 2021

MERCEDES-BENZ TRUCKS / ANTEPRIMA MONDIALE DEL TRUCK ELETTRICO A BATTERIA

Con eActros la distribuzione è più efficiente L’AVVIO DELLA PRODUZIONE IN SERIE DELL’EACTROS È PREVISTO PER LA SECONDA METÀ DELL’ANNO NELLO STABILIMENTO DI WÖRTH AM RHEIN. GLI SVILUPPATORI DI MERCEDES-BENZ TRUCKS HANNO ATTRIBUITO GRANDE IMPORTANZA ALLA “CUSTOMER CO-CREATION”, OVVERO ALLA STRETTA COLLABORAZIONE CON I CLIENTI TRUCK NELLO SVILUPPO DEL PRODOTTO.

M

I PROTOTIPI DELL’EACTROS SONO STATI SOTTOPOSTI A TEST INTENSIVI PRESSO I CLIENTI GIÀ DAL 2018.

FABIO BASILICO STOCCARDA

ercedes-Benz Trucks parla di nuova era nel presentare l’anteprima mondiale del suo eActros, l’elettrico a batteria per il servizio di distribuzione pesante. E non c’è dubbio che il primo truck a trazione elettrica della Stella costruito in serie sia destinato a segnare un passaggio storico nell’evoluzione sostenibile dei trasporti. L’avvio della produzione in serie dell’eActros è previsto per la seconda metà dell’anno nello stabilimento di Wörth am Rhein. Lungo la strada che conduce al veicolo di serie, gli sviluppatori di Mercedes-Benz Trucks hanno attribuito grande importanza alla “Customer co-creation”, ovvero alla stretta collaborazione con i clienti truck nello sviluppo del prodotto. I prototipi dell’eActros sono stati sottoposti a test intensivi presso i clienti già dal 2018. In questo modo, gli esperti di Mercedes-Benz Trucks hanno potuto prendere tempestivamente in considerazione anche i feedback sull’e-truck offerti dagli utilizzatori e integrarli direttamente nei lavori di sviluppo. Nel frattempo, i prototipi hanno già percorso più di mezzo milione di chilometri su strade pubbliche. Inoltre, gli ingeneri Mercedes-Benz Trucks addetti alla sperimentazione hanno sottoposto l’eActros a test intensi-

vi, al fine di assicurare i consueti standard MercedesBenz, come sempre molto elevati. Dieci prototipi eActros, che costituivano la cosiddetta “flot ta dell’innovazione” di Mercedes-Benz Trucks, sono stati affidati dal 2018 a diversi utilizzatori in Germania e in altri Paesi europei; hanno dimostrato il loro valore nell’ambito di un impiego continuativo. In due fasi di test, quasi 20 clienti hanno utilizzato nella loro flotta l’eActros anziché un truck convenzionale. Nella versione da 18 o 25 tonnellate, l’eActros ha padroneggiato attività impegnative nei più differenti settori d’impiego. Il veicolo, tra l’altro, ha trasportato generi

alimentari deperibili in allestimenti isotermici ad alimentazione elettrica per l’approvvigionamento di filiali di supermercati, ha movimentato componenti per la produzione all’interno dello stabilimento, ha svolto il servizio di sostituzione di cassonetti per la raccolta rifiuti e ha trasportato ceneri volatili in un allestimento a cisterna silos per la produzione di calcestruzzo. Al di fuori della Germania, hanno testato il truck elettrico a batteria anche clienti in Svizzera, Belgio e Paesi Bassi. Ancor prima che siano giunti al termine i test di impiego continuativo del prototipo, una cosa è già chiara: nel traffico urbano, in auto-

strada o su strade extraurbane, eActros non ha nulla da invidiare a un truck diesel tradizionale in termini di versatilità e prestazioni. E questo con buona pace degli autisti, entusiasti della costante disponibilità della coppia nell’intera gamma di velocità, oltre che dell’esperienza di gui da silenziosa piacevolmente rilassata. A ciò si deve aggiungere che, con uno stile di guida prudente e attento ai consumi, il veicolo è in grado recuperare energia elettrica. L’eActros di serie sarà però notevolmente superiore al prototipo attuale della “flotta dell’innovazione” per quanto concerne alcune caratteristiche centrali, quali ad esempio l’autonomia, la potenza di

trazione e la dotazione di sicurezza. Mercedes-Benz Trucks inoltre integrerà il veicolo in un ecosistema complessivo che comprende anche offerte di consulenza clienti sulla mobilità elettrica. Non diversamente da quanto avviene con i truck convenzionali, prima della produzione di serie dell’eActros gli svi luppatori hanno eseguito test per garantire la sicurezza, le prestazioni e la lunga durata del nuovo veicolo. Il sistema di raffreddamento per la ricarica e il climatizzatore, entrambi ad alimentazione elettrica, hanno dimostrato di funzionare in modo affidabile sia in condizioni di estremo calore che in condizioni invernali. Gli ingegneri addetti

Nel traffico urbano, in autostrada o su strade extraurbane, eActros non ha nulla da invidiare a un truck diesel tradizionale.

alla sperimentazione hanno messo a dura prova l’eActros anche nel test invernale. Particolare attenzione è stata dedicata al comportamento delle batterie e della catena cinematica elettrica in condizioni meteorologiche avverse. Inoltre, eActros è stato sottoposto a ulteriori tipi di controlli, come ad esempio la misurazione del livello di rumorosità su un banco di prova per rumorosità esterna e il test di compatibilità elettromagnetica (CEM) in un padiglione appositamente predisposto. I risultati lo dimostrano: eActros è adatto per l’impiego quotidiano e soddisfa i requisiti im posti dalle condizioni d’utilizzo reali. Daimler Truck AG persegue una strategia aziendale sostenibile ed entro il 2039 mira a offrire in Europa, Giappone e America del Nord solo veicoli nuovi che, durante la marcia (“tank-towheel”), abbiano emissioni di CO2 pari a zero. Già entro il 2022, nelle principali regioni di vendita Europa, Stati Uniti e Giappone, la gamma di veicoli Daimler Truck AG dovrà comprendere veicoli di serie dotati di propulsione elettrica a batteria. A partire dal 2027 l’azienda intende integrare la sua offerta con veicoli di serie dotati di propulsione a celle di combustibile a idrogeno. L’obiettivo finale è realizzare un trasporto su strada a zero emissioni di CO2 entro il 2050.

DAIMLER TRUCKS / AVVIATI I TEST INTENSIVI DEL TRUCK A CELLE A COMBUSTIBILE

GENH2 TRUCK, SPERIMENTAZIONE CLIENTI DAL 2023 E CONSEGNE DAL 2027 P er l’elettrificazione dei suoi veicoli industriali destinati a impieghi flessibili e impegnativi nel trasporto a lungo raggio, Daimler Trucks punta sulle celle a combustibile a idrogeno. L’obiettivo è raggiungere percorrenze pari o superiori a 1.000 chilometri, senza che occorrano soste per il rifornimento. Già ad aprile, il costruttore ha iniziato i test intensivi sulla prima nuova versione ulteriormente migliorata del prototipo MercedesBenz GenH2 Truck presentato nel 2020, ponendo così un’importante pietra miliare sulla strada che conduce al prodotto di serie. Gli sviluppatori di Daimler Trucks stanno mettendo a dura prova il veicolo a celle a combustibile. L’ampia serie di test, con i quali il veicolo e i suoi componenti vengono sottoposti a grandi sollecitazioni, si concentra sull’eserci-

zio continuo, su diverse condizioni meteorologiche e stradali e su varie manovre di guida. Il piano di sviluppo di Daimler Trucks prevede test su strade pubbliche già nel corso di quest’anno. Le sperimentazioni presso i clienti dovrebbero iniziare nel 2023 e i primi esemplari di GenH2 Truck prodotti in serie dovrebbero essere consegnati ai clienti dal 2027. GenH2 Truck è un veicolo concepito completamente ex novo e dotato di componenti altrettanto radicalmente nuovi, a cui gli sviluppatori prestano particolare attenzione durante i test. Questi includono il sistema di celle a combustibile, la catena cinematica completamente elettrica e tutti i sistemi associati, come ad esempio lo speciale raffreddamento. Daimler Trucks preferisce l’idrogeno liquido, poi-

ché il vettore energetico in questo stato di aggregazione ha una densità energetica notevolmente superiore in relazione al volume rispetto all’idrogeno gassoso. Di conseguenza, un truck a celle a combustibile riempito con idrogeno liquido può fare affidamento su serbatoi molto più piccoli e, grazie alla pressione più bassa, molto più leggeri. Ciò consente ai truck un maggiore spazio di carico e un peso del carico utile più elevato. Allo stesso tempo, il rifornimento di idrogeno sarà superiore, aumentando notevolmente l’autonomia. Questo rende il GenH2 Truck di serie adatto ai trasporti a lungo raggio per diversi giorni, solitamente difficili da pianificare e dove la portata giornaliera di energia è elevata, proprio come i truck diesel tradizionali.


Assistenza Mobile 50 negozi mobili per un servizio a domicilio

Negozi

Alta Sartoria

17 negozi a tua disposizione

Manutenzione predittiva per i tuoi pneumatici

Assistance

Ricostruzione

Servizio H24 in tutta Europa per i soccorsi pneumatici e meccanica

Massima sostenibilità ed efficienza costo chilometrica

Il partner strategico delle aziende di trasporto www.rigomma.it


IL MONDO DEI TRASPORTI

Pagina 48

N° 302 / Settembre 2021

EUROMASTER / ILARI TRASPORTI BENEFICIA DEI VANTAGGI DEL CANONE ALL INCLUSIVE

Una gestione al top con Master Fleet “MASTER FLEET È UNA SOLUZIONE OTTIMALE DI GESTIONE CHE ABBIAMO SUBITO ADOTTATO PER LA NOSTRA FLOTTA DICE FRANCESCO ILARI, CHE, INSIEME AL FRATELLO PAOLO, HA RACCOLTO L’EREDITÀ DI PAPÀ FABRIZIO, CHE HA FONDATO LA SOCIETÀ NEL 1978 ED È ANCORA PRESENTE IN AZIENDA - SI TRATTA DI UN CANONE MENSILE ALL INCLUSIVE ELABORATO SULLA BASE DI UNA PRECISA E DETTAGLIATA PIANIFICAZIONE DEI COSTI EFFETTUATA DA EUROMASTER ANALIZZANDO IL NOSTRO PARCO MEZZI E IL NOSTRO FABBISOGNO IN TERMINI DI PNEUMATICI E DELLE RELATIVE ATTIVITÀ DI GESTIONE”.

Q

FABIO BASILICO MONTAPPONE

uello del trasporto di a nimali vivi è un settore specifico che ve de protagoniste aziende solide e fortemente competitive, in grado di assicurare un servizio di elevata qualità per venire incontro alle esigenze della committenza. È il caso della marchigiana Ilari Fabrizio con sede legale a Montappone, in provincia di Fermo. Attiva sia in Italia che nel resto d’Europa e al di fuori del vecchio continente, con rotte che giungono fino in Asia, la ditta individuale fondata nel 1978 da Fabrizio Ilari e che presto assumerà la denominazione di Ilari Trasporti Srl testimoniando nei fatti un processo continuo di crescita, è oggi caratterizzata da una gestione attenta di tutti gli aspetti concernenti le attività di trasporto di bovini, suini, ovini e caprini e i mezzi utilizzati. Al centro dell’attenzione della ditta di Mon-

biamo già constatato”. Serietà, professionalità e affidabilità contraddistinguono Ilari Trasporti, attiva da sempre nel settore del bestiame, con il commercio prima e con il trasporto poi. “Io e mio fratello Paolo siamo entrati in azienda nel 2009 - racconta Francesco Ilari - Mio fratello si occupa principalmente dell’organizzazione dei mezzi ed è anche autista, mentre io sono responsabile della gestione amministrativa e dello sviluppo aziendale. Oltre alla sede legale di Montappone, dove è stata fondata l’azienda, disponiamo da tre anni di una sede operativa a Massa Lombarda, in provincia di Ravenna. Le sedi, estese su un terreno di 5-6mila mq, di cui almeno un migliaio coperti, dispongono di officina, lavaggio, rimessa, locali per autisti e magazzino ricambi”. IN ITALIA E OLTRE

tappone ci sono ovviamente an che gli pneumatici. Grazie alla collaborazione con Euromaster, Ilari Trasporti ha implementato Master Fleet, il canone all inclusive per la manutenzione pneumatici che il net-

work leader in Europa per la vendita e la manutenzione di pneumatici di tutti i comparti, dalle auto ai veicoli industriali, mette a disposizione delle flotte delle aziende di trasporto. “Master Fleet è una solu-

zione ottimale di gestione che abbiamo subito adottato per la nostra flotta - ci dice Francesco Ilari, che, insieme al fratello Paolo, ha raccolto l’e redità di papà Fabrizio, ancora presente in azienda - Si tratta di un canone mensile all inclusive elaborato sulla base di una precisa e dettagliata pianificazione dei costi effettuata da Euromaster analizzando il nostro parco mezzi e il nostro fabbisogno in termini di pneumatici e delle relative attività di gestione. Il budget annuale viene suddiviso mese per mese e ogni sei mesi viene effettuato un check che, se necessario, permette anche di apportare modifiche del canone in base alla concreta attività gestionale effettuata”. VANTAGGI IMMEDIATI

Paolo Ilari, alla guida dell’azienda di famiglia insieme al fratello Francesco.

Tra i vantaggi assicurati al le aziende da Master Fleet rientrano le tariffe trasparenti e uniche su tutto il territorio nazionale, l’omogeneità degli standard operativi, la fatturazione centralizzata e il supporto costante a cura del Customer Care Euromaster. “Abbiamo scelto Master Fleet anche perché siamo rimasti particolarmente soddisfatti dalla competenza dei consulenti Euromaster e dalla possibilità di avere a disposizione dei veri specialisti disposti a seguirti passo per passo - ag giunge Ilari Grazie a Euromaster disponiamo anche di un Fleet Operator che viene in azienda per eseguire il check completo dello stato di usura di tutti gli pneumatici della flotta, propone il piano dei lavori di sostitu-

zione e manutenzione, pianifica e monitora i tempi degli interventi e genera report di immediata consultazione. Inoltre, usufruiamo di Master Fleet On Road per il monitoraggio su strada di pneumatici e camion. Non manca poi l’importantissima assistenza su strada H24 e 7/7 in Italia e all’estero grazie a EIA”. Euromaster International Assistance è l’innovativa formula erogata dalla rete Euromaster per l’assistenza su strada. EIA rappresenta il top della proposta di assistenza Euromaster dedicata alle a ziende di trasporto che hanno sempre più bisogno di delegare la gestione dei veicoli e, nel delegare, di aumentare la produttività della flotta riducendo al minimo il fermo dei mezzi. “Ci interfacciamo con le officine del network Euromaster sapendo di avere dei punti di riferimento ben distribuiti sul territorio e in grado di intervenire quando i nostri mezzi ne hanno bisogno - ammette Francesco Ilari - Noi viaggiamo molto anche di notte, la domenica e nei periodi festivi: poter contare su un servizio H24 è quanto mai importante. Il servizio è efficiente sia in Italia che all’estero e lo ab-

Dalle Marche, i trattori con semirimorchio e le motrici con il logo Ilari Trasporti si muovono su rotte nazionali, in prevalenza nel Centro-Nord Italia, e, una volta valicati i confini, su tragitti internazionali europei ed extraeuropei. “Il 5060 per cento del fatturato è originato in Italia”, spiega Francesco Ilari. La flotta è composta attualmente da 12 mezzi, tra trattori con semirimorchio specifico per trasporto animali vivi e motrici. “La clientela che serviamo comprende grandi macelli, allevatori, commercianti, importatori continua Ilari - In flotta disponiamo di mezzi all’avanguardia e di un team competente ed efficiente. Abbiamo sempre creduto nell’importanza della formazione dei dipendenti e investiamo costantemente in tale ambito con corsi di formazione e aggiornamento”. Il periodo della pandemia ha influito sul settore della carne. “Non ci sono stati cali nel settore della Grande Distribuzione Organizzata perché i supermercati sono rimasti aperti mentre il mondo della ristorazione e del turismo ha risentito pesantemente delle chiusura forzate - conclude Francesco Ilari - Dall’inizio dell’emergenza Covid-19 ci siamo attrezzati implementando una specifica strategia che ci ha permesso di crescere pur in presenza della crisi: abbiamo investito su servizi diversi e nuove rotte. Il calo proveniente dalle at tività tradizionali è stato compensato dalle novità introdotte che ci hanno permesso di aumentare il fatturato e di incrementare nel complesso il nostro business”.

ilari traSporti

Sede legale: Via San Giorgio 9/D - Montappone (FM) Sede operativa: Via Montefiorino 5/6 - Massa Lombarda (RA) Fondazione: 1978, Fabrizio Ilari Amministratori: Francesco e Paolo Ilari Attività: trasporto animali vivi, nazionale e internazionale Flotta: 12 veicoli, trattori, motrici, semirimorchi Dipendenti: 14 Fatturato: 3 milioni di euro Internet: ilaritrasporti.com


ITA ContiTruck_WhiteDesign_Headlines_255x390.indd 1

22/07/21 09:49


IL MONDO DEI TRASPORTI

Pagina 50

N° 302 / Settembre 2021

INTERVISTA

I

FULVIO SAVIO MARKETING MANAGER ITALY PETRONAS LUBRICANTS

ncrementare l’efficienza dei veicoli e ridurre i consumi con un occhio di riguardo alla sostenibilità: questa è la mission specifica dei prodotti Petronas, multinazionale incamminata ormai da tempo verso le emissioni zero, traguardo che raggiungerà entro il 2050. Abbiamo rivolto qualche domanda a Fulvio Savio sull’utilità di servirsi di un olio performante come quelli della gamma Urania e sulle ultime novità dell’universo Petronas.

senta il centro tecnologico e il cuore delle nostre attività di ricerca e sviluppo nel mondo. Ospita infatti il Centro Globale di Ricerca e Tecnologia Petronas, grazie al quale la filiale è considerata il polo di riferimento nel mondo dei lubrificanti ad alto contenuto tecnologico. La designazione ufficiale di Santena a quartier generale EMEA ci rende molto fieri e, oltre a confermare il fondamentale ruolo strategico che l’Italia ricopre nel piano industriale internazionale di PLI, rappresenta anche l’introduzione di un nuovo modello organizzativo in grado di rendere l’azienda più agile, veloce e reattiva nel rispondere alle richieste dei nostri clienti e del mercato in costante evoluzione. Il nostro centro direzionale torinese ve de aumentare il numero complessivo dei dipendenti sia a livello internazionale che nazionale. In particolare, dei 551 dipendenti italiani, 120 sono a Santena, 59 a Napoli e 372 a Villastellone.

Mdt - Quali sono le voci di risparmio per il bilancio di una flotta assicurate dalla gamma Urania? Savio - La scelta del lubrificante può avere un impatto positivo sui costi complessivi delle flotte: sebbene infatti i costi dei lubrificanti rappresentino solo l’1 per cento circa dei costi totali, essi possono avere un impatto su carburante (incidenza del 30 per cento sulle spese) e su manutenzione e riparazione (5 per cento). Risparmiare ad esempio l’1-2 per cento sul carburante potrebbe significare fino a 500 euro risparmiati per ogni camion all’anno (a seconda ovviamente dei km percorsi e del costo del carburante). Inoltre, proteggendo le parti critiche del motore, il lu-

Mdt - Il Roadshow Unstoppable Heroes arriverà anche in Italia, di cosa si tratta e quali sono le tappe previste nel nostro paese? Savio - Il Roadshow Petronas è partito dal Regno Unito, e toccherà numerose località

La formula italiana che fa bene ai motori DA

ATTENZIONE AI COSTI DELLE FLOTTE E SOSTENIBILITÀ AMBIENTALE, SONO QUESTE LE DIRETTIVE SEGUITE PETRONAS LUBRICANTS NEL METTERE A PUNTO I PROPRI PRODOTTI A VANTAGGIO DELLE AZIENDE DI TRASPORTO. TUTTO QUESTO E L’IMPORTANZA DELLA SEDE ITALIANA NELLE RISPOSTE DEL MANAGER FULVIO SAVIO.

brificante giusto ne prolunga la vita - consentendo un recupero tra 1 e 12 giorni di manutenzione per camion ogni anno - e ne preserva l’efficienza, rendendo peraltro l’esperienza di guida più piacevole anche in termini di potenza e coppia del motore, in salita o in accelerazione.

Mdt - Quali impieghi mettono maggiormente alla prova la resistenza di un lubrificante? Savio - Sono diverse le situazioni che mettono alla prova la resistenza di un lubrificante: pressioni sempre crescenti sul motore, scadenze sempre più serrate, condizioni ambientali difficili sono solo alcune delle sfide da affrontare ogni giorno. PETRONAS Ura nia è dotato della nuova tecnologia StrongTech che garantisce maggior protezione durante tutto l'intervallo di cambio: il fluido è in grado di bloccare i depositi nocivi, proteggere dall’ossidazione e dalla perdita di viscosità e ri-

durre il contatto metallo-metallo anche a temperature estreme. In termini di motore abbatte i consumi dovuti ai viaggi sempre più lunghi ed ha anche un’elevata resistenza alle alte temperature. Il veicolo funziona di conseguenza più a lungo anche in condizioni esterne difficili o sotto sollecitazioni di diversi

stili di guida.

di CRISTINA ALTIERI SANTENA

Mdt - Quante persone hanno lavorato alla realizzazione della formula? Quali sono stati gli investimenti? Savio - Sono state circa 12 le persone che hanno preso parte al processo di realizzazione della formula; bisogna infatti considerare che per arrivare

al prodotto finale sono state coinvolte varie funzioni che vanno dal GTM (Group Management Team), PM (Project Manager), LAB, fino alla parte relativa al Mechanical Testing oltre che agli OEM (Original Equipment Manufacturers). Per quanto invece riguarda gli investimenti, bisogna tenere conto delle diverse

fasi attraversate per arrivare alla formulazione definitiva: se consideriamo quindi gli studi di laboratorio, i vari test sui motori e le diverse approvazioni finali raggiungiamo circa il mezzo milione di euro di investimento in sviluppo.

Mdt - La formula è stata studiata a Santena per il mercato globale? Savio - Sì, sia le formule sia le tecnologie della gamma Urania sono state studiate nella nostra sede di Santena che ospita infatti il Centro Globale di Ricerca e Tecnologia Petronas - da un team di lavoro globale e multinazionale. Le formule sono rivolte al mercato globale, anche perché le materie prime non sono disponibili in tutte le Regioni. Mdt - Quanto è importante la filiale di Santena nell’universo PLI? Quante persone lavorano nella sede torinese? Savio - La sede di Santena, inaugurata tre anni fa, rappre-

europee tra cui Spagna, Portogallo, Turchia e anche l’Italia, in cui verrà organizzata una tappa-evento il 12 ottobre. ‘Unstoppable Heroes’ è un Roadshow che porta con sé il concetto di forza e capacità di resistenza davanti a qualsiasi tipo di ostacolo: il prodotto Petronas Urania con tecnologia StrongTech ne è il principale protagonista, in quanto progettato per affrontare le condizioni di viaggio più severe offrendo un'affidabilità estrema e restando in buone condizioni nonostante uno stress sempre crescente. L’attenzione all’ambiente è un’altra delle caratteristiche del Roadshow, progettato per essere il più autosufficiente possibile in termini di consumo: Petronas Urania è infatti progettato pensando alla riduzione di CO2, il consumo di carburante e le emissioni nocive. L’intera gamma, infatti, è in grado di soddisfare i più severi standard internazionali in termini di qualità e impatto ambientale.


LOGISTICA E DISTRIBUZIONE INDUSTRIALE Spedizioni merci su bancali in Italia ed Europa Trasporto a carico completo

Groupage Nazionale / Internazionale Deposito merci C/T Scarico Container Trasporti in ADR Servizio sponda Custodia merci

SPEDIRE IN SVIZZERA SENZA PENSIERI

La Svizzera è vicina ma ha le sue regole. È classificata come area extra Schengen, al pari dei paesi non europei.

Lo Stato elvetico possiede leggi speciali per l’importazione e le merci sono sottoposte a scrupolose procedure doganali.

È importante sapere quali errori evitare. Un ritardo alla frontiera può essere fonte di gravi disagi per il cliente finale oltre ad altre problematiche.

Concessionari per Reggio Emilia e Provincia

Via Papa Giovanni XIII, N.16 42020 San Polo D'Enza (RE) 0522 / 718019 info@zaraline.it


LOGISTICA

IL MONDO DEI TRASPORTI

Pagina 52

N° 302 / Settembre 2021

INTERVISTA / GABRIELE FACCHINETTI, CHIEF FINANCIAL OFFICER DI BRACCHI

“Competenza prima di tutto, in ogni segmento di business”

S

MAX CAMPANELLA FARA GERA D’ADDA

torica azienda fondata nel 1928, Bracchi Srl è sinonimo di trasporto e logistica tecnica: dai macchinari agricoli (trattori e mietitrebbie) all’ascensoristico, dove la caratteristica è il fuori sagoma, i veicoli Bracchi sono noti per essere pronti per ogni dimensione. Capacità basata su anni di presenza nel settore, che l’hanno vista trasformarsi, nel 1968, da azienda familiare a re-

altà di riferimento nazionale: una svolta voluta dall’imprenditore Tranquillo Annoni, protagonista di un’espansione proseguita negli anni e che, nel 2016, ha registrato un ulteriore impulso con l’ingresso, nella compagine societaria, del fondo di private equity IGI Srl. Sono seguite una serie di acquisizioni: nel 2018 del Gruppo BAS, azienda veneta leader nella gestione di trasporti e logistica nel settore lifestyle (moda e prosecco); l’anno scorso della parmense Peterlini, rife-

rimento nei trasporti eccezionali, con cui Bracchi ha completato la diversificazione delle attività. Di pari passo, il supporto attivo di IGI ha portato a una struttura manageriale, con dirigenti di punta nelle varie ramificazioni di business. Gabriele Facchinetti, Direttore Finanziario dal 2016, è tra i protagonisti di uno sviluppo che ha portato l’azienda dai circa 80 milioni di fatturato del 2016 a chiudere il 2020 con un giro d’affari di circa 140 milioni e 520 dipendenti (120 dei quali all’estero), ai

quali si aggiungono un altro centinaio di persone che operano per Bracchi in maniera indiretta. Pur nella diversificazione, una parte qualificante del business dell’azienda è l’ascensoristica: Bracchi opera per i player globali del settore con hub logistici in Italia, dove l’headquarter resta a Fara Gera d’Adda, in provincia di Bergamo, Germania e Slovacchia. L’ascensore e tutti i suoi componenti (cabina, por te, guide, apparati elettronici e meccanici ecc.) vengono custoditi negli

hub per partire su richiesta del cliente, raggiungendo il cantiere attraverso re-loading point, ovvero “magazzini satellite”. Attività tutt’altro che semplice e scontata. “La capacità di maneggiare ogni componente, di ottimizzare gli spazi di carico e rendere ogni carico stabile e sicuro - afferma Facchinetti - non si apprende in pochi giorni: è frutto di formazione e preparazione. I clienti si rivolgono a Bracchi con la consapevolezza che tale tipologia di lavoro non s’improvvisa, richiede competenza tecni-

PRIMO REBRANDING TOTALE, DAI TELI DEI CAMION ALLE DIVISE DEI MAGAZZINIERI

INIZIA UNA NUOVA ERA COMUNICATIVA DOPO NOVANT’ANNI DI STORIA R innovare l’identità di un’azienda che vanta oltre 90 anni di attività e che opera tra Italia, Germania, Slovacchia e Polonia non è semplice. Definire un progetto che unisca sotto un unico tetto un’azienda per la quale lavorano oltre seicento persone, un’organizzazione che con le recenti acquisizioni ha portato il fatturato a oltre 140 milioni  e si muove all’unisono tra hub e magazzini dislocati a mi-

gliaia di chilometri di distanza è impresa ambiziosa. Ebbene, Bracchi ne era consapevole e per questo ha lavorato più di un anno per portare a termine il primo, storico rebranding aziendale. Bracchi si è concentrata inizialmente nel ricostruire il nuovo logo, pensato in modo più essenziale e moderno. Logo che adesso sarà visibile ovunque: dai teli dei camion alle divise dei magazzinieri, dai badge azien-

dali alla carta intestata, arrivando alla cartellonistica dei magazzini e persino alle penne bio-degradabili e alle borracce anti-spreco pensate per clienti e dipendenti. La rappresentazione digitale dell’azienda è stata prioritaria. Il sito internet è stato completamente rinnovato e reso fruibile a livello internazionale su piattaforme mobile. Sono poi state definite le linee guida strategiche per la comunicazio-

ne sui social network di riferimento, da Facebook a Linkedin. Inoltre, ci si è concentrati sullo sviluppo della versione pro di Truckpooling.it, spin off innovativo di Bracchi. Obiettivo era un’identità comune per la vasta gamma di servizi e soluzioni di business che il gigante di Fara Gera d’Adda propone al mercato della logistica e dei trasporti, soluzioni che vanno dai trasporti eccezionali fino a 100 t, alla

supply chain del fashion, dai trasporti speciali per il settore ascensoristico e agricolo al mercato delle vendite on line. “Il settore della logistica e dei trasporti - dichiara Lorenzo Annoni, Sales & Marketing Director in Bracchi non sempre spicca dal punto di vista del marketing e della comunicazione: ci tenevamo a rappresentare in modo adeguato la qualità e la specializzazione dei ser-

vizi offerti dalla nostra azienda. Abbiamo deciso di dare una svolta alla nostra immagine coordinata per collegare le varie anime dell’azienda, con uno stile che faccia emergere la dimensione internazionale, innovativa, tecnologica e sostenibile. Il tutto è spiegato in un “brand book”, linee guida di comunicazione che siamo orgogliosi di aver inserito tra gli asset intangibili della nostra azienda”.


N° 302 / Settembre 2021

IL MONDO DEI TRASPORTI

Pagina 53

BraCChi

Sede operativa principale: Fara Gera D’Adda (BG) Amministratore: Ing. Umberto Ferretti Merce trasportata: Trasporti eccezionali e ultimo miglio Flotta: 100 veicoli di proprietà Dipendenti: 520 Fatturato 2020 (euro): 140 milioni di euro Sito internet: bracchi.it

L’INGRESSO NELLA COMPAGINE SOCIETARIA, NEL 2016, DEL FONDO DI PRIVATE EQUITY IGI HA DATO UN FORTE IMPULSO ALLA CRESCITA DEL COLOSSO DELLA LOGISTICA DI BERGAMO. GABRIELE FACCHINETTI È UNO DEI MANAGER PROTAGONISTI DELL’INCREDIBILE SVILUPPO CHE HA PORTATO A CHIUDERE IL 2020 CON UN FATTURATO DI 140 MILIONI DI EURO. “LE ACQUISIZIONI DEL GRUPPO BAS E DI PETERLINI HANNO COMPLETATO LA DIVERSIFICAZIONE E PORTATO BRACCHI A CONFRONTARSI CON UNA CLIENTELA DIFFERENTE. PIATTAFORMA COMUNE? L’ECCELLENZA DEL SERVIZIO”, AFFERMA IL CFO DELLA SOCIETÀ LOMBARDA.

ca. L’acquisizione di Peterlini ha completato la competenza di Bracchi: oltre ai trasporti fuori sagoma e di peso contenuto, con Peterlini abbiamo acquisito competenza nei pesanti con scorta”. La società bergamasca muo ve circa 800 camion al giorno, puntando fortemente sulla terziarizzazione, ovvero affidando servizi ad aziende di trasporto terze, con alto livello di fidelizzazione. “La flotta di proprietà illustra Facchinetti - conta circa cento veicoli ed è garanzia di un servizio di qualità: serviamo il cliente non come fornitore, piuttosto come una gioielleria offre il suo prodotto di qualità alla clientela; non è raro che, per progetti nuovi relativi a carichi particolarmente complessi i tecnici di Bracchi si rechino presso il cliente per organizzare il layout di carico. La gestione diretta di una flotta ci rende consapevoli e preparati nella scelta dei terzisti partner: dalla flotta dimensionata al padroncino mo noveicolare, sono tutti player fidelizzati, che sanno come muoversi”. Cosa ha significato, invece, l’acquisizione del Gruppo BAS? “Effettuare consegne a negozi anche al dettaglio – prosegue Facchinetti – ha richiesto da parte di Bracchi l’acquisizione di ulteriori competenze: quel segmento richiede puntualità e capacità di raggiungere l’ultimo miglio, di trasportare con veicoli adatti allo scopo”. Qual è la “chiave di differenza” con cui Bracchi si approccia sul mercato? “L’obiettivo - aggiunge il CFO - è scegliere la migliore soluzione per il cliente. Su questa lunghezza d’onda si colloca il servizio Truckpooling, che quest’anno sarà ulteriormente rafforzato con investimenti in tecnologia e risorse dedicate, e che ci sta già dando grande soddisfazione: chiuderemo il 2021 con un giro d’affari derivante dal Truckpooling di circa due milioni. Permette a privati e aziende di trovare le migliori tariffe per spedire pacchi online, confrontando con pochi click le offerte dei principali corrieri espressi. La piattaforma è in crescita verticale, durante i mesi della pande-

mia ha riscontrato un vero e proprio boom di accessi”. A proposito di 2020, com’è andata, nel complesso, nell’anno della pandemia? “Abbiamo raggiunto il target previsto. Dopo un mese di aprile negativo - continua Facchinetti - abbiamo registrato una graduale ripresa che, nel secondo semestre, è stata decisamente importante. La pandemia ha consentito di ricordare all’intera collettività che il trasporto e la logistica sono parte integrante della filiera produttiva di un bene, non rappresentano parti accessorie: a che servono i processi di produzione se la merce non raggiunge la sua destinazione?” Classe 1965, una laurea in Giurisprudenza e Master in Finanza & Controllo, prima di approdare in Bracchi Facchinetti ha vissuto un’esperienza professionale presso un’azienda spagnola di trasporto veicoli, tra bisarche, piazzali e terminal portuali. Qual è il suo bilancio di quasi un quinquennio in Bracchi? “Le acquisizioni e l’integrazione con altre società - afferma il CFO - rappresentano una grande sfida, ma sono anche un momento affascinante, che richiede la capacità di trovare le giuste soluzioni a difficoltà completamente nuove. Le acquisizioni di

BAS e Peterlini hanno portato Bracchi a relazionarsi con una clientela differente, ciò ha richiesto una decisa apertura mentale. La piattaforma comune era l’eccellenza del servizio: da questa siamo partiti per tracciare una nuova filiera di servizi per la clientela, dal trasporto alla logistica”. Di quest’anno l’apertura del nuovo hub di 24mila mq, dedicato al fashion, a Oppeano, in provincia di Verona: “La competenza acquisita rende Bracchi un polo d’attrazione: avevamo bisogno di un nuovo sito per soddisfare le richieste della clientela”, aggiunge Facchinetti. In totale, Bracchi dispone in Europa di magazzini per 220mila mq, oltre a 50mila mq di piazzali attrezzati, con spazi predisposti per il posizionamento dei semirimorchi per il carico. L’hub in Germania, di 24mila mq, è dedicato all’ascensoristica ma si sta aprendo anche ad altri mercati. Due gli hub in Slovacchia, dedicati all’ascensoristica e all’igiene personale. In Italia il sito di Fara occupa 58mila mq, il secondo bergamasco, a Osio, ne occupa 12mila. Quattro gli hub nel Veneto: a Bassano del Grappa, Schio, Tombolo e Oppeano. Importante anche la sede polacca dedicata all’attività di trasporto.

Gabriele Facchinetti, dal 2016 CFO (Chief Financial Officer) di Bracchi Transport & Logistics, che ha sede principale a Fara Gera D’Adda.


IL MONDO DEI TRASPORTI

Pagina 54

N° 302 / Settembre 2021

PALLEX / GOTTARDI TRASPORTI E ZARA LINE FONDANO LA NUOVA CONCESSIONARIA

GZ-LOG, LA STORICA SVOLTA DI MODENA

F

DALL’UNIONE DI DUE IMPRESE STORICHE, FONDATE E GUIDATE DA FAMIGLIE IMPRENDITORIALI DETERMINATE E CON UNA SOLIDA ESPERIENZA SUL CAMPO, NASCE UNA NEWCO PRONTA A RAPPRESENTARE IL NETWORK, SOSTENERE LO SVILUPPO DELL’APPENNINO MODENESE E NON SOLO. “SEGUENDO I VALORI FONDANTI DELLE AZIENDE SOCIE, PROCEDIAMO UN PASSO ALLA VOLTA, MA CON GRANDI AMBIZIONI: L’OBIETTIVO È RAGGIUNGERE UNA QUOTA DI CINQUANTAMILA PALLET MOVIMENTATI L’ANNO ENTRO TRE ESERCIZI”, AFFERMA ALESSANDRO MELE, AMMINISTRATORE DELEGATO GZ-LOG.

MAX CAMPANELLA VIGNOLA

oriero dello sviluppo economico del Paese, il territorio modenese è caratterizzato dalla presenza di numerose imprese che, nate dall’intuizione di artigiani del posto, negli anni si sono evolute in importanti realtà produttive, che spesso esportano nel mondo l’eccellenza italiana. Dalla metalmeccanica all’automotive, dalla ceramica all’alimentare, si contano tante aziende produttive che, pur affrontando momenti di crisi, hanno sempre registrato performance di crescita. VOLONTÀ DI FERRO

Per soddisfare la loro necessità di distribuzione e logistica, per le materie prime e i prodotti finiti, sono cresciute in parallelo aziende di trasporto anch’esse nate per volontà di famiglie imprenditoriali. È il caso di Gottardi Trasporti, fondata da Rodolfo Gottardi e oggi guidata dalla seconda generazione, nelle persone dei figli Giovanni e Gianfranco che, di fronte al profondo cambiamento in atto nel mondo del trasporto, investono in un nuovo progetto, mettendo in campo la specializzazione nella logistica e nella gestione dei carichi groupage completi per offrire, alla clientela, il servizio espresso su pallet. Una scelta che vede i fratelli Gottardi uniti a un’altra azienda familiare, la Zara Line di San Polo d’Enza, in provincia di Reggio Emilia, fondata da Livio Ferrari e

oggi guidata dai cugini Massimiliano e Marco Ferrari, con una profonda conoscenza e esperienza del trasporto espresso su pallet, segmento nel quale è operativa sin dal 2009, tra i primissimi concessionari del network Pallex. Dall’unione di due eccellenze emiliane che “parlano la stessa lingua”, che condividono valori e visione aziendale nasce GZ-Log, Concessionaria Pallex, che ha nel nome e nel logo le iniziali delle due famiglie imprenditoriali con i colori delle aziende: G rossa e Z nera. Per rivendicare che, pur dedicandosi a business differenti, le due aziende mettono insieme capacità dimostrate sul campo in tanti anni di presenza: Gottardi Trasporti dal 1956, Zara Line dal 1959. Imprese con una storia e numeri di tutto rispetto, in termini di volumi e dimensioni: un centinaio i veicoli Gottardi Trasporti che circolano, 90 quelli di Zara Line. Timoniere dell’ambizioso progetto è Alessandro Mele, manager con una lunga esperienza professionale e un’autentica passione per il mondo dei veicoli industriali, che assume il ruolo di Amministratore delegato. GZ-Log ha sede a Vignola, in provincia di Modena, in un capannone di mille mq con piazzale, completamente ristrutturato, collocato all’interno dell’area di proprietà Gottardi. Beneficiando del knowhow di Zara Line, che quest’anno arriverà a movimentare 60mila pallet l’anno con una flotta dedicata a Pallex di 20 veicoli, GZLog mette anch’essa a di-

sposizione della clientela veicoli dedicati, dal furgone al bilico, automezzi ADR e con sponda idraulica. “GZ-Log - spiega Mele - si trova in una posizione strategica, in un’area a forte intensità industriale, collegata alla nuova Pedemontana e a venti minuti da Bologna Valsamoggia. Non solo: GZ-Log intende essere parte dello sviluppo in atto nell’Appennino modenese, che registra performance importanti, con specifiche dinamiche di crescita e produttività. Intendiamo rivolgerci a clienti di Gottardi Trasporti e Zara Line, che abbiano la necessità di trasportare dal singolo pallet al carico completo, nonché a nuovi clienti,

aziende che operano su questo territorio e abbiano la stessa necessità distributiva. Naturalmente, come prevede il modello Pallex, GZ-Log è riferimento del territorio per la distribuzione delle merci provenienti dalle altre Concessionarie del network”. Il “modello Pallex” vede come baricentro del nord l’hub di Bologna, inaugurato di recente: dalle più di 200 Concessionarie italiane, la merce viene immessa nel network, raggiunge l’hub di Bologna da dove i mezzi GZ-Log la prelevano per effettuare la consegna nel territorio assegnato; viceversa, le merci provenienti dal territorio di GZLog vengono immesse nel

network per essere consegnate ovunque in Italia e in Europa attraverso l’hub di Bologna; a questi, si aggiungono clienti diretti Pallex. L’Appennino modenese vede la presenza di realtà aziendali che mantengono la sede sul territorio pur avendo filiali e siti produttivi in altre aree del Paese: da qui la necessità di affidarsi a specialisti per il “navettaggio” tra gli stabilimenti. “Sul piano logistico – affermano i cugini Ferrari - ci proponiamo come partner per colmare le distanze e affrontare le difficoltà morfologiche, sostenendo lo sviluppo della clientela. GZ-Log offre loro un servizio a 360

Da sinistra: i fratelli Giovanni e Gianfranco Gottardi; Alessandro Mele, Amministratore delegato GZ-Log; i cugini Massimiliano e Marco Ferrari di Zara Line.

gradi, per dare il suo contributo ad aziende autoctone che si sono sviluppate negli anni e che, oggi, hanno una presenza nazionale o addirittura esportano all’estero: chi produce tende ad azzerare le scorte magazzino e ha la necessità di un modello distributivo e per le consegne al quale intendiamo rispondere”. OFFERTA SPECULARE

Elevati standard qualitativi è la parola d’ordine della Newco. “L’offerta di GZ-Log - aggiunge Gianfranco Gottardi - è speculare a quella delle aziende protagoniste della sua nascita: dal cliente che richiede la consegna di un singolo collo alla grande industria, garantiamo servizi di qualità, dal trasporto alla gestione di grossi carichi, con l’utilizzo del nuovo magazzino. Zara Line e Gottardi Trasporti sanno bene come si fa logistica: GZ-Log è tutt’altro che improvvisazione. La nuova società nasce su solide basi e sulla consapevolezza che ci si sta preparando per fare tutto per il meglio nell’interesse dei clienti”. Capitalizzata dalle due aziende, GZLog parte con un team di sei persone. “Volutamente – afferma Giovanni Gottardi – avviamo la società in sordina, procedendo un passo per volta, ma presto daremo uno slancio commerciale, con una struttura in grado di assicurare performance adeguate: l’obiettivo è chiudere il 2022 con 25mila pallet movimentati per raggiungere i 50mila entro tre anni”.


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 55

VGP / POSATA LA PRIMA PIETRA DEL POLO LOGISTICO DI SORDIO CON GLS ITALY

Partner in nome di qualità ed efficienza V

QUANDO SONO DUE LEADER AD INCONTRARSI, IL RISULTATO NON PUÒ CHE ESSERE UN SERVIZIO ECCELLENTE A VANTAGGIO DEL CLIENTE FINALE. LA GRANDE ESPERIENZA NEL REAL ESTATE LOGISTICO DI VGP E L’IMPORTANZA DI GLS ITALY NEL SETTORE DEL CORRIERE ESPRESSO DANNO VITA A UN NUOVO HUB POSIZIONATO IN UN LUOGO STRATEGICO DELLA PIANURA PADANA, ALLA CONVERGENZA TRA LA BREBEMI E LA A1.

VALENTINA MASSA LODI

GP, azienda paneuropea nel settore Real Estate che realizza e fornisce parchi logistici e semi industriali di alta qualità, e GLS Italy, uno tra i principali player di corriere espresso in Italia, hanno dato il via ai lavori per la realizzazione del nuovo polo logistico internazionale di Sordio. La posa della prima pietra si è tenuta alla presenza di Agostino Emanuele, Country Manager di VGP Italy, di Davide Barbagallo, Director International Sales & Operations di GLS Italy, e dei rappresentanti istituzionali tra cui Salvatore Iesce, Sindaco di Sordio. Con il nuovo hub GLS Italy ha l’obiettivo di acquisire un ruolo sempre più centrale al fianco delle PMI supportandole con servizi efficienti e di qualità nel commercio internazionale. Il nuovo centro, che dopo l’investimento iniziale firmato da VGP a settembre scorso vedrà la luce nel gennaio 2022, disporrà di un’area coperta di 12.034 mq divisa tra uffici, magazzino e strutture accessorie.

GLS Italy, inoltre, ha previsto un investimento di 8 milioni di euro per dotare lo stabilimento di un elevato standard tecnologico e di automazione che consentirà lo smistamento di oltre 21.000 colli all’ora. L’hub sorge in una posizione strategica grazie anche ad ottimi collegamenti stradali: si trova a soli 500 metri dall’uscita Vizzolo Pre-

dabissi della Brebemi, e in prossimità dell’autostrada A1. “Oggi celebriamo un importante successo per l’intera amministrazione comunale ha dichiarato Salvatore Iesce, Sindaco di Sordio. “È per noi motivo di orgoglio avere due società come VGP e GLS sul territorio. Siamo fiduciosi che il nuovo hub internazionale di Sordio costituisca un’oppor-

tunità che si rifletterà in nuovi posti di lavoro e nella riqualificazione ambientale dell’area grazie alla particolare attenzione di VGP alla sostenibilità con i suoi immobili green”. In linea con gli impegni di sostenibilità di VGP e con il programma Climate Protect di GLS Italy, il centro logistico di Sordio offrirà infatti spazi flessibili in base

alle esigenze del cliente con elevati standard di sostenibilità, compresa la certificazione BREEAM “Very Good” (Building Research Establishment Environmental Assessment Method). Si prevede inoltre che l'edificio venga dotato di pannelli fotovoltaici su tutta la superficie del tetto. Inoltre, di pari passo con gli obiettivi del Comune di Sordio, si avranno più di 4.000 m² di spazio verde e un progetto per la piantumazione di varie specie, tra cui circa 80 alberi. “Siamo orgogliosi di celebrare un altro importante traguardo per VGP Italy con la posa della prima pietra del parco logistico di Sordio insieme a GLS Italy - ha affermato Agostino Emanuele, Country Manager VGP Italy. “Grazie alla collaborazione con il nostro partner e al supporto delle istituzioni locali, possiamo già considerare que sto progetto un grande successo”. VGP Italy attualmente comprende quattro business parks di proprietà Val samoggia (BO), Calcio (BG), Sordio (LO) e Padova e ha in cantiere altri sviluppi nel centro e nord Italia. “Pun-

tiamo su partnership-ha continuato Emanuele - con i comuni e i tenant per creare soluzioni creative e sostenibili per le loro esigenze immobiliari. Guardiamo al futuro senza tralasciare i valori che da sempre contraddistinguono il nostro operato, fatto di persone e professionalità e progetti innovativi”. “Oggi iniziamo un nuovo percorso che ci rende particolarmente fieri del contributo che riusciremo a dare al tessuto produttivo del territorio lombardo - conferma Klaus Schädle, Group Area Managing Director di GLS Italy S.p.A. - Visto l’aumento dei volumi internazionali riteniamo che questo progetto possa rappresentare un tassello fondamentale della nostra più ampia strategia di crescita e sviluppo che mira a posizionare GLS Italy al fianco delle piccole e medie imprese che esportano i prodotti del Made in Italy all’estero. Negli ultimi anni abbiamo investito in modo significativo e continueremo a farlo per offrire ai nostri clienti e agli utenti finali uno standard di servizio sempre più capillare, efficiente e di alta qualità”.

S copr i di più su: fassi.com e faceb o ok .com/fassigruspa


IL MONDO DEI TRASPORTI

Pagina 56

N° 302 / Settembre 2021

A-SAFE / MAGAZZINI AL SICURO CON LE PROTEZIONI DELLA MULTINAZIONALE INGLESE

L’importanza di chiamarsi polimero DAL 1984 L’AZIENDA È LEADER NELLA PRODUZIONE DI PROTEZIONI PER OGNI AMBIENTE IN CUI SI MUOVANO PERSONE E MACCHINARI.

E NON SI

TRATTA DI COMUNI ELEMENTI IN FERRO: IL

MEMAPLEX, SVILUPPATO INTERNAMENTE, ASSICURA DURABILITÀ, RESISTENZA E ANCHE UN OTTIMO IMPATTO ESTETICO.

N

CRISTINA ALTIERI ARCORE

on ha rinnegato completamente la sua e stra zione e neppure fatto un salto nel buio Alessandro Boccolini, quando nel 2013 si è lasciato convincere da Marco Chiavarini, oggi Amministratore delegato dell’azienda, a portare insieme a lui il brand inglese A-Safe sul mercato italiano. L’iscrizione all’Albo degli Architetti certamente gli rendeva congeniale occuparsi di organizzazione di spazi e, quanto al rischio calcolato, i numeri hanno da subito anticipato come il magico polimero di David Smith - il signore che ebbe l’idea di utilizzare in modo alternativo i film avvolgibili che produceva - avrebbe trionfato in campo antifortunistico sul vetusto ferro. “Numeri” scrivevamo, sì, come quelli considerati dal Pas 13, il codice di condotta britannico per le barriere di sicurezza all’interno degli ambienti di lavoro a cui la multinazionale si adegua dal 2017. O come quelli indicati dalla normativa che sta per entrare in vigore in Italia: il nostro Paese è infatti, anche grazie all’impulso dei vertici di questa azienda, il primo mercato a dotarsi di una specifica tecnica UNI sul tema. Classificherà i prodotti in commercio in base al grado di protezione che sono in grado di offrire tenuto conto di masse in gioco e carichi, velocità e angoli d’impatto. “Noi possiamo dichiarare la nostra capacità di tenuta inizia a raccontarci Boccolini che in A-Safe Italia Srl ricopre la qualifica di Business Development Manager - e a testimoniare i numeri che dichiariamo ci sono le certificazioni Tüv Nord. Quando forniamo un prodotto siamo si-

curi che gestirà l’eventuale impatto”. Non si comporta allo stesso modo il ferro, che fino ad oggi è stato assoluto protagonista nel settore delle protezioni: spesso viene utilizzato senza studi preliminari ed è destinato a spezzarsi quando sottoposto a un urto che non è in grado di gestire, con tutte le conseguenze immaginabili per strutture, mezzi e soprattutto persone. Diverso il punto di vista di ASafe, casa madre in Inghilterra e ben 15 filiali sparse in tut to il globo, che non solo mette sul mercato sistemi di protezione avanzati, ma inter-

viene con la logica del consulente sia in fase di ristrutturazione che in situazioni di new building, e quindi studiando eventi, routine e forze in gioco per mappare gli ambienti e disporre le barriere nel modo corretto. In ambiti di tutti i tipi, da quelli industriali agli aeroporti, al meraviglioso mondo del la logistica, protagonista negli ultimi mesi di un impulso straordinario grazie all’ecommerce. “La questione pandemica - prosegue Boccolini - ha comportato un incremento degli spazi dedicati allo stoccaggio della merce

Alessandro Boccolini, Business Development Manager di A-Safe Italia. Nelle altre foto, i prodotti del brand inglese.

nei magazzini, e quindi della richiesta nei confronti del nostro prodotto sia da parte dei clienti finali che degli operatori logistici. Si tratta di un ambito delicato perché da una parte dobbiamo evitare che avvengano sovrapposizioni tra persone, carrelli e strutture, e dall’altra c’è l’assoluta esigenza di non sottrarre centimetri preziosi ai flussi di lavoro”. Ma veniamo al dunque: cosa rende il prodotto A-Safe tanto sicuro e prestazionale? “I nostri elementi di protezione - risponde Boccolini sono costituiti da un polimero

sviluppato internamente. Si chiama Memaplex. È convincente sia dal punto di vista della sicurezza che da quello dei costi: non solo non si rompe, ma non necessita neppure di manutenzione, un problema molto sentito dalla logistica”. E gli interlocutori sembrano essere sensibili ad entrambi gli argomenti visto che A-Safe, globalmente ma anche e soprattutto in Italia, sta facendo i salti mortali per fronteggiare le richieste di forniture. “Il mercato italiano delle protezioni sulle aree di lavoro - continua il numero due dell’azienda - vale circa

160 milioni di euro all’anno. Il nostro concorrente è il ferro, ma quando entrerà in vigore la specifica UNI sarà finalmente molto chiaro il posizionamento dei vari prodotti: il ferro si strappa mentre il Memaplex ha un effetto bump, dopo l’urto ritorna allo stato iniziale, anche in condizioni estreme, come quando si trova sotto azione di forca. In fase d’investimento il ferro può anche costare meno ma poi la manutenzione richiede un impegno economico che il polimero non necessita. Il nostro investimento in ricerca e sviluppo è importante e guardiamo sempre avanti. Stiamo per lanciare un prodotto rivoluzionario che elimina completamente ogni parte metallica, anche le lastre ancora presenti che servono per collegare l’elemento di protezione al suolo”. Il livello di performance della filiale italiana è talmente elevato che casa madre ha deciso di investire ulteriormente acquistando un terreno da 20.000 mq in Brianza, vicino alla sede attuale, tra Arcore e Concorezzo: lì verrà costruita la nuova sede, con uffici e un magazzino organizzato per lotti. Ma il coinvolgimento del Belpaese nei piani di espansione della multinazionale non finisce qui. “Si sta discutendo se spostare parte della produzione proprio qui in Italia. Oggi gli impianti sono tutti dislocati in Inghilterra ma due terzi dei macchinari sono italiani”. Un bel lavoro dunque quello che attende A-Safe Italia e il suo staff. Oggi è già ben articolato su una ventina di commerciali, tre amministrativi, tre tecnici, due magazzinieri e due responsabili marketing, ma è facile immaginare che presto questi “numeri”cresceranno. Al prossimo capitolo!


AV VERE TUTTO SI PUÒ.

btsadv.com

SICUREZZA. EFFICIENZA. VERSAT TILITÀ À.

TASSO LEASING 2,5% E V VAL ALORE DI RISCAT RISCATTO GARANTITO GIÀ DAL DAL 3° ANNO*

VERSATILITÀ VERSA TILITÀ STRAORDINARIA Architettura modulare personalizzabile per il servizio navvetta, feriale, festivo e sostitutivo.

CAPA ACITÀ SUPERIORE 3 Fino a 12 m di capacità bagagli, cappelliere incluse, I½RSETEWWIKKIVMGSQSHMIWMGYVM

AFFIDABILITÀ COLLAUDAT TA A Esclusiva tecnologia Euro 6 HI-SCR senza bisogno di rigenerazione attiva.

REDDITIVITÀ GARANTITA ARANTITA Miglior TCO della categoria, bassi consumi, manutenzione ridotta.

Offer Off er ta valida fino al 30/11/2021 sulla gamma Evadys Classe III su nuovi ordini e modelli a stock salvo esaurimento scor te, su valori di fornitura fino a 230.000€ e sog getta a condizioni. Esempio di fornitura fornitura 230.000€ e leasing a 36 mesi: anticipo 10%, valore finale di riscatto 45%, 36 canoni mensili a 3.432,54€ comprensivi polizza Incendio e Fur to, Ta Tasso Leasing 2,50%. Spese pratica, IVA IVA , traspor to e messa su strada escluse. Salvo approvazione IVECO CAPIT APITAL AL (CNH Industrial Capital Europe S. A .S.). Polizza Fur to e Incendio obbligatoria ed è inclusa in canone. Prima di aderire al finanziamento è necessario prendere visione delle Condizioni Contrattuali e dei Fogli informativi informativi disponibili presso le concessionarie aderenti. Possibilità di personalizzare l’off offer er ta con altri impor ti direttamente in concessionaria. Immagine a puro scopo illustrativo. Messaggio pubblicitario con finalità promozionale. *


MOBILITÀ

IL MONDO DEI TRASPORTI

Pagina 58

N° 302 / Settembre 2021

SETRA / IL COSTRUTTORE DELLA GALASSIA DAIMLER BUSES FESTEGGIA

Settantesimo da IL RINOMATO MARCHIO DI DAIMLER BUSES CON SEDE A ULM HA REGOLARMENTE FISSATO GLI STANDARD NELL’INDUSTRIA EUROPEA DELLA COSTRUZIONE DI AUTOBUS E HA AVUTO UN’INFLUENZA DECISIVA SULLO SVILUPPO DEL SETTORE. LA PRESENZA

SETRA INIZIA A 1951

MANIFESTARSI NEL

QUANDO LA FABBRICA

KÄSSBOHRER DI ULM S8E

PRODUCE IL MODELLO

CONTEMPORANEAMENTE CONFERISCE AL MARCHIO LA DENOMINAZIONE

SETRA,

ABBREVIAZIONE DI

“SELBSTTRAGEND”, TERMINE TEDESCO CHE SI TRADUCE IN

I

“AUTOPORTANTE”.

FABIO BASILICO NEU-ULM

70 anni di Setra si traducono in un totale di sei serie di modelli. Il rinomato marchio di Daimler Buses con sede a Ulm ha regolarmente fissato gli standard nell’industria europea della costruzione di autobus e ha avuto un’influenza decisiva sullo sviluppo del settore. I fe-

steggiamenti per lo storico anniversario sono stati organizzati presso il Setra Customer Center di Neu-Ulm. La presenza Setra inizia a manifestarsi nel 1951 quando la fabbrica Kässbohrer di Ulm produce il modello S 8 e contemporaneamente conferisce al marchio la denominazione Setra, abbreviazione di “selbsttragend”, termine tedesco che si traduce in “autoportante” e fa riferi-

mento alla costruzione monoscocca del bus. S 8 è il primo autobus prodotto in serie con carrozzeria autoportante, motore montato posteriormente e trazione diretta sull’asse posteriore, presentato all’International Motor Show di Francoforte. I primi autobus Setra hanno fatto sì che il rivoluzionario principio del design autoportante godesse di una rapida penetrazione nel mercato. L’S 10 è

stato il secondo modello Setra succeduto all’S 8 e diventato un vero best-seller. Il primo sistema modulare Setra viene lanciato nel 1959 e per l’epoca rappresenta una soluzione ingegneristica completamente nuovo nell’ambito del design degli autobus. Grazie a questo ben congegnato principio modulare, è stato possibile produrre veicoli in modo particolar-

mente efficiente arrivando anche a quattro unità al giorno. Il passaggio dalla serie di modelli Setra 10 alla serie di modelli 100 avviene nel 1967 e segna un ulteriore sviluppo nell’industrializzazione della costruzione di autobus presso l’azienda tedesca. Tutti e nove i modelli della serie 100 sfruttano numerose parti comuni provenienti dal secondo sistema modulare di Setra.

OMNIPLUS COMPIE VENTICINQUE ANNI DI SERVIZIO A FIANCO DEGLI OPERATORI DEL TRASPORTO PASSEGGERI

LA CONCENTRAZIONE SU AUTOBUS E UTILIZZATORI È TOTALE C ompie 25 anni il brand di servizi Omniplus dedicato ai veicoli Mercedes-Benz e Setra. Nel 1996, poco dopo la creazione di EvoBus, ovvero la società di riferimento dei bus Mercedes-Benz e Setra, Omniplus inizia a rivoluzionare il mondo dei servizi nel settore dei veicoli adibiti al trasporto passeggeri. Allora come oggi, l’idea di base è quella di fornire un servizio efficace e “busoriented” partendo da un unico fornitore per entrambi i marchi Mercedes-Benz e Setra. La forza innovativa di Omniplus è continuata senza sosta fino a oggi, come dimostrano le innovazioni connesse con l’impiego della tecnologia di stampa 3D o il rivoluzionario mondo dei servizi digitali Omniplus On. I servizi per gli autobus iniziano con le classiche attività di manutenzione e riparazione. Nel 1996 Omniplus si impone all’attenzione proponendo un avanzato network di centri di assistenza e soluzioni innovative come la ServiceCard e i nuovi tipi di pacchetti di manutenzione chiamati ServiceCheck. Inoltre, fin dall’inizio Omniplus offre corsi di formazione per

conducenti. A due anni dalla sua costituzione, il brand, con i nuovi contratti di servizio, fissa ancora una volta nuovi standard per i servizi specifici per autobus. Allo stesso tempo, nel magazzino centrale di Neu-Ulm, riorganizza la gestione unica dei ricambi per Mercedes-Benz e Setra, in precedenza organizzata in modo autonomo per ciascun brand. Nello stesso periodo, Omniplus professionalizza il commercio di autobus usati (più tardi, nel 2013, questa sezione è diventata una divisione aziendale separata con il marchio BusStore). Omniplus ha percorso sin dall’inizio la strada della digitalizzazione. Già nel 2004 è disponibile un elenco di servizi online. Allo stesso tempo, Omniplus ha svolto un lavoro pionieristico creando il suo negozio online che le aziende possono utilizzare per acquistare facilmente ricambi per le proprie officine. Sempre nel 2004, Omniplus introduce un sistema “multistrato” di centri servizi. In tutta Europa, questi sono classificati in base alla loro gamma di servizi, come BusWorld e Bus World Home,

BusPort o Bus Point. Dieci anni dopo il lancio di Omniplus, ammontano a circa 540 i centri di assistenza di tutta Europa che si prendono cura delle aziende e dei loro autobus, ovvero la più grande rete di servizi dedicata ai bus presente nel vecchio continente. Dal 2008, poi, tutti i centri di assistenza sono riforniti dal grande e moderno centro logistico per ricambi

di Neu-Ulm, dove sono immagazzinati circa 130mila articoli. Per le piccole riparazioni, nello stesso anno Omniplus introduce il servizio SmallRepair rapido e a prezzi ragionevoli. Nel 2009 viene avviato il primo sistema di gestione della flotta specifico per autobus, chiamato BusFleet. Nel contempo, viene rinnovata la ServiceCard con l’in-

troduzione dei livelli ServiceCardBasic e Premium. Analogamente, dal 2012 Omniplus adegua i propri contratti di servizio con le versioni base e premium. Nel 2015 Omniplus fa notizia con un altro servizio: con il nuovo BusDepot Management i centri di assistenza autorizzati, e quindi il personale Omniplus, erogano servizi direttamente presso le offici-

ne dei clienti. Un’altra novità sono i contratti di servizio per gli autobus da turismo usati dei marchi MercedesBenz e Setra. Con il nuovo programma BestAge Repair, l’azienda fornisce anche servizi per gli autobus più vecchi adeguati all’attuale valore residuo. Nell’autunno 2017, Omniplus presenta un mondo di servizi completamente nuovo: l’obiettivo è collegare tra loro veicolo, conducente, azienda e servizio, creando così un valore aggiunto per i clienti. Il riferimento è Omniplus On con la sua ampia gamma di servizi digitali raggruppati in un unico portale. Omniplus On integra servizi esistenti e nuove offerte come Omniplus Uptime che controlla lo stato dei sistemi del veicolo in tempo reale. Oggi Omniplus garantisce un servizio completo per gli autobus Mercedes-Benz e Setra. Se un autobus dovesse incontrare problemi durante il percorso, il Servizio 24H è disponibile 7 giorni su 7. Più di 600 centri di assistenza, dal Circolo Polare Artico alla Sicilia e dall’Irlanda alla Russia, formano la fitta rete Omniplus Service.


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 59

SETTE DECENNI DI STORIA E UN TOTALE DI 6 SERIE DI MODELLI

premium brand

Nel 1976 viene lanciata la serie Setra 200 con sei diversi modelli. I veicoli della terza generazione Setra impressionano il pubblico con un’eleganza classica nelle linee del design, orientato sia al mantenimento del valore sia alla praticità. Curve morbide, transizioni lisce e contorni chiari sono conformi ai principi elementari del design dei veicoli che emergono in quell’epoca. Gli autobus della serie 200 sono inoltre dotati di ventilazione e riscaldamento funzionanti separatamente per il conducente e l’abitacolo, con incluso il disappannamento intensivo del parabrezza. Il 1991 è l’anno del lancio della serie 300, presentata a Ulm dopo sei anni di sviluppo. Una delle caratteristiche più accattivanti dei nuovi autobus è la linea ampia e distintiva dietro l’area cockpit e il sistema di specchietti integrali completamente riprogettato che conferisce alla serie

un “volto” distintivo. Un’altra caratteristica significativa è il cockpit con design ergonomico in cui i singoli strumenti più importanti sono posizionati nel campo visivo primario del conducente. Mentre gli autobus da turismo della serie 300 si affermano sul mercato europeo, gli sviluppatori Setra lavorano al lancio di autobus polivalenti per rotte di servizio regolare, linee interurbane ed escursioni. Il principio di progettazione modulare consente di realizzare tre diverse varianti di bus sulla base di un unico modello. Tutti sono dotati della stessa carrozzeria e delle stesse sospensioni ma hanno diversi vani passeggeri. A partire dalla serie di modelli 300, la gamma viene classificata nelle categorie TopClass, ComfortClass e MultiClass al fine di semplificare la panoramica dei modelli offerti. Nel 2001, Setra introduce il TopClass 400, imponendo una nuova di-

mensione nel design dei turistici che garantisce viaggi di altissimo livello sia per il conducente che per i passeggeri. La gamma è stata ampliata nel 2004 con gli autobus da turismo ComfortClass 400. Infine, nel settembre 2005 sono stati lanciati gli autobus interurbani della serie MultiClass 400. La serie 400 comprende un totale di oltre 20 modelli. Il Setra ComfortClass 500 è stato presentato nel 2012 dopo una fase di sviluppo durata quattro anni. Con questa serie di modelli innovativi, il premium brand di Daimler Buses stabilisce nuovi parametri di riferimento in termini di efficienza economica, qualità, comfort e sicurezza. I nuovi autobus da turismo premium convincono per il design aerodinamico ottimizzato. Nel 2014 arrivano gli eleganti modelli TopClass 500. L’attuale ammiraglia della gamma TopClass 500 è il due piani S 531 DT, lanciato nel 2019.

pietre Miliari e iNNovazioNi 1951

Viene presentato il primo autobus con carrozzeria autoportante, il Setra S 8

1959

Primo sistema modulare Setra e primo combi-bus articolato autoportante in Europa

1964

Setra diventa il primo produttore di autobus a montare un rallentatore

1967

Presentazione della serie 100 e introduzione di serie delle sospensioni a ruote indipendenti con sospensioni pneumatiche

1981

Setra presenta il primo autobus a due piani, il turistico S 228 DT.

1992

Il Setra S 315 HDH viene votato “Coach of the Year 1993”

2001

Setra presenta la TopClass 400: tecnologia, design e dotazioni stabiliscono nuovi parametri di riferimento.

2003

Il modello S 417 per il mercato nordamericano viene presentato alla fiera UMA (United Motorcoach Association) a Orlando, Florida

2005

A bordo degli autobus da turismo TopClass 400 e ComfortClass 400 vengono presentati i nuovi sistemi di sicurezza autonomi per il controllo automatico della velocità (AICC) e il limitatore di frenata continuo (DBL).

2012

Presentazione della generazione di autobus da turismo ComfortClass 500 completamente nuova e introduzione della tecnologia del motore Euro 6 “Blue Efficiency Power”.

2013

La nuova generazione di autobus da turismo Setra TopClass 500 festeggia la sua prima mondiale.

2018

Con S 531 DT a due piani, Setra presenta il primo autobus da turismo al mondo dotato di serie di un impianto antincendio nel vano motore.

2021

Daimler Buses contribuisce al contenimento della pandemia da Coronavirus. La stazione di vaccinazione mobile si basa su un S 415 LE business e combina un concetto interno intelligente con una procedura di vaccinazione completamente digitalizzata. Il Setra S 80 del 1975. In alto, il modello S 515 HD edizione 70 anni. Nell’altra pagina, il bus S 8 del 1951.


IL MONDO DEI TRASPORTI

Pagina 60

N° 302 / Settembre 2021

MERCEDES-BENZ DRIVING EXPERIENCE / INTEGRALMENTE RIPROGETTATO

Intouro, il tuttofare che

INIZIALMENTE, INTOURO USCIRÀ NEL SUO SEGMENTO PRINCIPALE PER VOLUMI DI VENDITA, CIOÈ L’EXTRAURBANO. DUE LE VERSIONI PREVISTE: 12,18 METRI (51 POSTI) E M DA 13,09 METRI (59 POSTI). ENTRAMBI SONO AUTOBUS A DUE ASSI CHE SI PRESTANO ALL’IMPIEGO UNIVERSALE. SEGUIRANNO INTOURO K (LUNGO 10,75 METRI) E IL TRE ASSI INTOURO L DA 14,88 METRI. MENTRE INTOURO K (47 POSTI) SI PRESTA SOPRATTUTTO AI VIAGGI IN REGIONI MONTANE, SU STRADE TORTUOSE E PER ESCURSIONI DI PICCOLI GRUPPI, INTOURO L (71 POSTI) È LA SOLUZIONE IDEALE PER LE LINEE EXTRAURBANE CON ELEVATO NUMERO DI PASSEGGERI O PER IL TRASPORTO DI PERSONALE AZIENDALE.

È

FABIO BASILICO ULM

un tuttofare e lo dimostra. Sottoposto a una riprogettazione integrale, il Mercedes-Benz Intouro alza l’asticella degli standard di riferimento per gli autobus extraurbani e turistici. Le parole d’ordine del rinnovato autobus tedesco sono flessibilità, redditività e sicurezza. Per conoscerlo siamo andati a Ulm, quartier generale EvoBus, per una driving experience organizzata per la presentazione ufficiale alla stampa specializzata. Come tutti i Mercedes-Benz, il tuttofare è leader tecnologico nel proprio segmento, ad esempio grazie agli innovativi componenti per la climatizzazione e per la plancia, nonché per lo straordinario sistema di assistenza per la frenata di emergenza disponibile a richiesta, l’Active Brake Assist 5 con riconoscimento dei pedoni, e per il Sideguard Assist, il sistema di

assistenza alla svolta. Intouro si presenta con una gamma di versioni estremamente ampia. Dall’autobus extraurbano a pianale rialzato con vano bagagli all’utilizzo come scuolabus e come navetta, per giungere al servizio di trasporto del personale aziendale o come autobus da turismo per le piccole gite e i viaggi del fine settimana. Altrettanto variegata è la gamma di versioni disponibili. Per la prima volta, Intouro vie ne proposto anche nella maneggevole versione compatta e nella variante a tre assi da 14,88 metri di lunghezza. Inizialmente, Intouro uscirà nel suo segmento principale per volumi di vendita, cioè l’extraurbano. Due le versioni previste: 12,18 metri (51 posti) e M da 13,09 metri (59 posti). Entrambi sono autobus a due assi che si prestano all’impiego universale. Seguiranno Intouro K (lungo 10,75 metri) e il tre assi Intouro L da 14,88 metri. Mentre Intou-

ro K (47 posti) si presta soprattutto ai viaggi in regioni montane, su strade tortuose e per escursioni di piccoli gruppi, Intouro L (71 posti) è la soluzione ideale per le linee extraurbane con elevato numero di passeggeri o per il trasporto di personale aziendale. In ordine crescente troviamo quindi Intouro K, Intouro, Intouro M e Intouro L. Tutte e quattro le versioni presentano un’altezza del pianale, in corrispondenza del corridoio centrale, di 860 mm e coprono pertanto il classico segmento degli autobus extraurbani a pianale rialzato. Il vano bagagli soddisfa le esigenze delle escursioni a corto raggio con pernottamento. SOBRIA E FUNZIONALE

La carrozzeria di Intouro è sobria e funzionale: qualità che si notano nel parabrezza, che si staglia verticale sopra la mascherina del radiatore e i

fari (gli stessi utilizzati dai truck della Stella), riuniti in un gruppo unico secondo uno stilema tipico del marchio. E si ritrovano anche nelle fiancate squadrate, quasi completamente prive di giunzioni. Anche la parte posteriore del bus presenta una linea essenziale, come rivela lo sportello del vano motore privo di fessure di sfiato. Se Intouro è utilizzato anche per viaggi a corto raggio con frequente percorrenza di tratti autostradali, è consigliabile scegliere la funzione di abbassamento della carrozzeria alle alte velocità, disponibile a richiesta. Questo stratagemma per abbattere il consumo di carburante si era già rivelato efficace nell’autobus da turismo a pianale rialzato Tourismo. Sempre per ottimizzare l’aerodinamica, il peso del veicolo è stato ridotto in media di circa 300 kg rispetto al modello precedente, ad esempio grazie all’adozione di una scocca completamente riprogettata.

La configurazione dei sedili si distingue per la massima versatilità: le aziende possono scegliere tra la funzionalità dei sedili Inter Star Eco (ISE) per il servizio di linea extraurbano e il comfort dei sedili da turismo Travel Star Eco (TSE). In entrambi i casi, i sedili sono di produzione interna e vengono proposti in numerose varianti. L’offerta spazia dalla dotazione economica per il servizio extraurbano all’allestimento di pregio per l’impiego turistico. Sui veicoli adibiti a scuolabus, sot to i sedili sono presenti del le staffe di fissaggio per gli zaini. La qualità della plan cia portastrumenti è di grande pregio: dall’aspetto estetico agli elementi di comando, dagli strumenti ai display a colori, il livello è in tutto e per tutto quello di un autobus da turismo. Ciò implica anche una netta valorizzazione della postazione di lavoro del conducente rispetto ai comuni autobus extraur-

bani. La ricca dotazione del posto di guida comprende un volante multifunzione e include sempre anche un sensore pioggia e luce che, oltre a essere di grande aiuto per il conducente, contribuisce a una maggiore sicurezza. Sul lato sinistro della plancia portastrumenti il driver trova una porta USB e il pomello del freno di stazionamento elettronico di serie, che coniuga facilità d’uso e sicurezza. SEI CILINDRI COMPATTO

Nella parte posteriore del due assi troviamo il compatto sei cilindri in linea MercedesBenz OM 936 da 7.7 litri di cilindrata. Il propulsore è disponibile nelle classi di potenza da 220 kW/299 cv e 1.200 Nm di coppia e da 260 kW/354 cv e 1.400 Nm. Intouro L a tre assi è equipaggiato di serie con il sei cilindri in linea Mercedes-Benz OM 470, cilindrata di 10.7 litri,

Posto guida e area passeggeri del Mercedes-Benz Intouro (anche in alto).


IL MONDO DEI TRASPORTI

N° 302 / Settembre 2021

Pagina 61

IL NUOVO MODELLO ALZA L’ASTICELLA DEGLI STANDARD DI RIFERIMENTO

non lascia a desiderare anche quando rileva la presenza di ostacoli fissi, come una palina semaforica o un paracarro. Il sistema fornisce inoltre assistenza quando il conducente si sposta nella corsia di destra a velocità superiori ai 36 km/h. In questo modo il Sideguard Assist coadiuva le manovre di cambio corsia, ad esempio per superare un ciclista in extraurbano o per spostarsi in un’altra corsia. Il nuovo Intouro ha a propria disposizione l’intero programma di servizi Omniplus per sfruttare al meglio le sue prerogative tecnologiche: dai flessibili contratti di servizio per la riparazione e manutenzione ai training personalizzati per autisti, che insegnano ad adottare uno stile di guida particolarmente sicuro o attento ai consumi. UNA GAMMA MODERNA

potenza di 290 kW/394 cv e coppia corposa di 1.900 Nm. Tutti i motori sono conformi alla variante attualmente più severa del livello di emissioni Euro VI. Per l’anno prossimo è previsto un modulo energia di recupero, che sarà offerto per Intouro come e quipaggiamento a richiesta. I condensatori elettrici del modulo, detti anche supercap, accumulano la corrente generata in fase di rilascio e la mettono a disposizione degli utilizzatori secondari. È in programma anche una variante ibrida di Intouro. In questo caso il parsimonioso motore diesel potrà attingere alla potenza motrice supplementare fornita da un compatto modulo ibrido. Un motore elettrico da 14 kW trasforma l’energia frenante in corrente elettrica e la utilizza per coadiuvare il motore diesel in partenza. Entrambe le tecnologie hanno già dato ottimi risultati a bordo del Mercedes-Benz Citaro, riducendo nettamente il con-

sumo di carburante, soprattutto nel servizio di linea caratterizzato da frequenti frenate e ripartenze. La depurazione dei gas di scarico è affidata al consolidato sistema con filtro anti-particolato e tecnologia SCR con iniezione di AdBlue. UNA RICCA SCELTA

Per il cambio le aziende han no a disposizione una scelta molto ricca. In abbinamento al motore OM 936 è previsto di serie un cambio manuale a sei marce. Per il livello di potenza da 354 cv è disponibile a richiesta il cambio a otto marce completamente automatizzato Mercedes GO 250-8 PowerShift, specifico per gli autobus. Questo cambio è di serie in abbinamento al motore OM 470 di Intouro L. Per tutte e tre le varianti di motore Mercedes-Benz offre a richiesta anche un cambio automatico, a scelta di marca Voith o ZF.

Di quest’ultimo viene installata la variante più recente ZF Ecolife 2. Il nuovo Intouro è il primo autobus della Stella ad adottare una piattaforma elettrica/elettronica evoluta, che costituisce tra l’altro il presupposto per accogliere a bordo l’ultima generazione di sistemi di assistenza alla guida. Con questa dotazione, Intouro fissa nuovi standard, e non soltanto nel suo segmento. È, ad esempio, il primo autobus Mercedes-Benz equipaggiato con Active Brake Assist 5 (ABA 5). Dalla prima presentazione a bordo di un autobus da turismo Mercedes-Benz nel 2008, l’Active Brake Assist è stato costantemente perfezionato ed è riuscito anche con l’attuale quinta generazione a superare di nuovo se stesso. ABA 5 sfrutta per la prima volta l’azione combinata di sistema radar e telecamere. Disponibile a richiesta, il sistema di assistenza alla guida è in grado di eseguire,

I moderni sedili dell’Intouro M (anche in alto) e, a destra, la pedana per i passeggeri con disabilità.

entro i propri limiti intrinseci, una frenata a fondo automatica fino all’arresto del veicolo quando rileva ostacoli fermi o in movimento. ABA 5 è inoltre il primo sistema di assistenza alla frenata per autobus al mondo in grado di eseguire una frenata a fondo anche in caso di rilevamento di pedoni in movimento. Rileva anche le persone che si fermano all’improvviso. SEGNALI VITALI

Di fronte al pericolo di investire un pedone, l’Active Brake Assist 5 allerta il conducente dell’autobus con un segnale visivo e acustico e avvia contemporaneamente una frenata parziale. Se l’autista non reagisce, segue una frenata di emergenza automatica fino all’arresto del veicolo. Altrettanto prezioso è il sistema di assistenza alla svolta Sideguard Assist con riconoscimento dei pedoni, disponi-

bile a richiesta. La sua funzione di assistenza è fondamentale soprattutto nel servizio extraurbano: il sistema aiuta il conducente nelle svolte, soprattutto nei centri abitati, e protegge in modo efficace anche gli utenti della strada più indifesi, come pedoni e ciclisti. I componenti essenziali del sistema sono i due sensori radar a corto raggio sul lato passeggero. In presenza di un oggetto in movimento all’interno dell’area di monitoraggio, sul lato passeggero si illumina, all’altezza degli occhi del conducente, una spia a Led gialla di forma triangolare. Se i sensori rilevano il rischio di un impatto, la spia diventa rossa, lampeggia più volte con maggiore intensità luminosa e dopo due secondi resta accesa a luce fissa rossa. Il sistema prevede inoltre l’attivazione di una vibrazione di avvertimento nel sedile dell’autista. Sideguard Assist emette un segnale di avvertimento nelle svolte

Con una gamma di modelli notevolmente ampliata, Intouro sostituisce la serie precedente, che era costituita da tre autobus extraurbani a due assi. Da questa evoluzione Daimler Buses ha preso spunto per riorganizzare la propria offerta di autobus extraurbani: le precedenti serie MultiClass 400 UL e UL business Setra vengono sostituite dal nuovo Intouro. La serie MultiClass 400 LE business continua invece a rientrare nella gamma di veicoli Setra. Questa riorganizzazione ha consentito di modulare scrupolosamente l’offerta: il segmento degli autobus extraurbani a pianale rialzato viene coperto da Intouro, quello degli autobus Low Entry da Setra LE business. Con il loro pianale ribassato nella parte anteriore per agevolare la salita e rialzato in quella posteriore a vantaggio del comfort, gli autobus Low Entry (LE) sono da cinque anni una presenza consolidata presso le aziende di trasporto di tutta Europa. In alternativa Mercedes-Benz propone il Citaro LE/LE Ü. Le esigenze di una versione a pianale integralmente ribassato per il segmento dei trasporti extraurbani sono soddisfatte da Mercedes-Benz con il Citaro Ü. Entrambi riprendono il Citaro, l’autobus urbano a pianale ribassato che ha dato infinite volte prova delle sue qualità.


IL MONDO DEI TRASPORTI

Pagina 62

N° 302 / Settembre 2021

SOLARIS / URBINO IBRIDI ED ELETTRICI PER LE PUBBLICHE AMMINISTRAZIONI ITALIANE

Una luce verde illumina la sostenibilità urbana IL COSTRUTTORE POLACCO HA APPENA VINTO DUE LOTTI NELL’AMBITO DELLA GARA INDETTA DA

CONSIP: MERITO DELL’ESPERIENZA NEL CAMPO DELLE PROPULSIONI ELETTRIFICATE E DELLA TECNOLOGIA OFFERTA DAI SUOI URBINO 12 IN VARIANTE IBRIDA ED ELETTRICA.

S

CRISTINA ALTIERI ROMA

i è aggiudicato due importanti commesse Solaris, costruttore leader nel settore bus da sempre impegnato a realizzare il sogno di una mobilità urbana sostenibile. A credere nel progetto del brand con casa madre in Polonia e gestito in Italia dalla sede di Roma, è questa volta CONSIP, la società partecipata dal Ministero dell’Economia e delle Finanze che si occupa degli acquisti per la Pubblica Amministrazione. In particolare, nella gara indetta dall’ente per autobus Classe I, hanno partecipato 13 costruttori, tra aziende europee ed extraeuropee, per la fornitura di un numero di oltre 1.000 veicoli, suddivisi in 8 lotti ed equipaggiati con vari sistemi di propulsione (dal tradizionale diesel all’elettrico). “In questo contesto così competitivo - ha commentato Francesco Tusino, Direttore commerciale di Solaris Italia Srl - il nostro brand si è aggiudicato, risultando primo in graduatoria, il lotto 7 con 140 autobus Urbino 12 hybrid e quello 8 con 120 autobus Urbino 12 electric”. Per quanto riguarda il lotto 7, Solaris, con il veicolo Full Hybrid, è risultato essere l’unico partecipante al bando: la circostanza evidenzia la speciale importanza che viene data dal marchio a una transizione ecologica che sia reale e pertanto utilizzi, come ponte tra la propulsione tradizionale e quella elettrica, un veicolo con ibridizzazione spinta. “In merito al lotto 8 - ha pro seguito Tusino - che ha visto una partecipazione più larga, l’elemento principale del successo ottenuto è da attribuirsi al contenuto tecnico offerto dal modello. La nostra

esperienza si è sviluppata nel corso degli anni e si è consolidata grazie a un numero elevato, a livello europeo, di veicoli elettrici effettivamente circolanti. Difatti, Solaris ha ottenuto anche il punteggio

tecnico più alto rispetto agli altri otto partecipanti alla gara. Che utilizzo verrà fatto della flotta acquisita da CONSIP? “La specificità della gara - ha risposto Tusino non consente di determinare a

priori le modalità di utilizzo degli autobus. Per quanto riguarda la nostra esperienza è possibile ipotizzare che, in virtù della loro versatilità, potranno essere acquisiti sia da aziende del TPL neofite nel-

l’ambito delle propulsione alternative, sia da aziende che, già operanti con prodotti analoghi, abbiano piani di ulteriore sviluppo. In entrambi i casi si tratta di autobus 12 metri con 3 porte dalla portata massima di 100 passeggeri, tutti equipaggiati con illuminazione interna ed esterna full-led, innovativo sistema di fissaggio dei mancorrenti, climatizzazione integrale con canalizzazione per una distribuzione ottimale dei flussi dell’aria, sospensioni anteriori indipendenti a doppio braccio oscillante, sistema antibeccheggio ed antirollio e telaio realizzato in acciaio inox. “Per quanto riguarda i modelli ibridi il motore endotermico diesel che lavora insieme all’elettrico è

Elettrici e ibridi i motori e all’interno tanta tecnologia per gli innovativi Solaris Urbino consegnati a CONSIP.

stato opportunamente ridimensionato al fine di ridurre i consumi di carburante e di conseguenza i gas di scarico inquinanti. Questo propulsore aziona un generatore elettrico per l’alimentazione del motore elettrico di trazione. Il sistema denominato “ibrido serie” consente di non avere alcun collegamento meccanico tra motore endotermico e assale di trasmissione”. I veicoli sono anche equipaggiati con supercapacitori a doppio strato elettrico che consentono la modalità full electric (senza ausilio del motore endotermico) in arrivo alle fermate ed in ripartenza dalle stesse. Queste due importanti commesse vanno ad arricchire il portafoglio 2021 di Solaris in Italia che comprende anche 19 filobus Solaris Trollino 12 e Trollino 18 ad ATC Esercizio La Spezia e, ancora in fase di aggiudicazione, 30 Solaris Urbino 12 electric a AMT Genova. “Annoveriamo - conclude Tusino - tra le consegne del 2021 anche 80 autobus InterUrbino 12 nell’ambito dell’accordo quadro con COTRAL Roma, 85 autobus Solaris Urbino 12 electric nell’ambito dell’accordo quadro sottoscritto con ATM Milano e 12 Solaris Urbino 12 Hydrogen a SASA Bolzano. Solaris, nonostante la fase di difficoltà dell’economia dovuta alle conseguenze dell’emergenza sanitaria tuttora in corso, già nel 2020 è riuscita a raggiungere una quota di mercato a livello nazionale con riferimento a veicoli elettrici pari al 70 per cento, e anche nel 2021 sta riuscendo grazie a prodotti innovativi e a un’organizzazione di vendita e post vendita efficiente, a incrementare le propria presenza sia a livello nazionale che europeo”.


DIREZIONE Urbino 12 electric


C

M

Y

CM

MY

CY

CMY

K


IDLE I M ONDO T R A S P O RT I Mensile di Politica, Economia, Cultura e Tecnica del Trasporto FONDATO E DIRETTO DA PAOLO ALTIERI

VEICOLI COMMERCIALI

FORD-LAMBERET / Nieddittas pioniera nell’ibrido refrigerato

TRANSIT PER LA PESCA GREEN LA COOPERATIVA DI PESCATORI DEL GOLFO DI ORISTANO PER PRIMA PORTA SU STRADA UN CUSTOM PHEV, FURGONE MEDIO DEL COSTRUTTORE AMERICANO, IN VERSIONE PLUG-IN CON ALLESTIMENTO EASYFIT DI LAMBERET E GRUPPO FRIGORIFERO KERSTNER COOLJET 106 A. LA CONSEGNA EFFETTUATA A MILANO, DOVE COZZE, VONGOLE E PESCATO POTRANNO VIAGGIARE ANCHE IN AREA C IN TUTTE LE ORE, MANTENENDO INTATTA LA FRESCHEZZA DELLE ACQUE CRISTALLINE DEL MAR DI SARDEGNA. IL VEICOLO NON PROVOCA RUMORI MOLESTI E NON EMETTE GAS NOCIVI. Cristina Altieri da pagina IV

ALLESTIMENTI / INTERVISTA AL NEO DIRETTORE VENDITE MORENO SPONDA

FIAT PROFESSIONAL / IN PISTA CON L’OTTAVA GENERAZIONE DEL VAN

LO SVILUPPO SOCIALE DI GEMA

DUCATO VIAGGIA A TUTTO SPRINT

V

eronese, dal 1° luglio Moreno Sponda (nella foto) affianca l’Amministratore Delegato Alessandro Lulli nella gestione di una delle aziende a maggior fattore di crescita del settore degli allestimenti. Grazie alla semplicità dell’alluminio estruso, che mantiene inalterate doti di robustezza, la capacità produttiva di Gema risponde, oggi, a un’importante commessa di kit annui fino al 2025. Ma lo stabilimento di Pieve a Nievole è pronto a crescere di due nuovi hub.

S

ono quattro le linee guida che hanno ispirato le scelte e le valutazioni di ingegneri e designer quando si sono trovati a dover ripensare un veicolo vincente come il Fiat Professional Ducato. Doveva diventare ancora più connesso, sicuro, confortevole ed efficiente. Obiettivo centrato? Dopo una giornata a salire e scendere dalle varie versioni del mezzo, ci sentiamo di rispondere di sì. Il Ducato ottava generazione ha imboccato la corsia di sorpasso e si è messo avanti a tutti soprattutto in termini di tecnologia.

Campanella a pagina III

DAIMLER BUSES

Mercedes-Benz Sprinter con il know-how minibus

Basilico da pagina VI

N° 302 / Settembre 2021

MAN TGE

Altieri da pagina X

THERMO KING

In anticipo sulle normative in difesa dell’ambiente

Servizio a pagina VIII

MERCEDES-BENZ

WEBASTO

Freddo a zero emissioni per il centro di Helsinki

Massa a pagina XIV

Con eCarry e Goriziane elettrico a portata di mano

Servizio a pagina XIV

Vito, un quarto di secolo all’insegna dell’efficienza

Basilico a pagina XIII

Pagina I


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI INTERVISTA

MORENO SPONDA

A

DIRETTORE VENDITE & MARKETING GEMA

una manciata di chilometri c’è chi licenzia con un’email. Qui si proietta il futuro, una logistica per l’e-commerce con un “modello sociale” e un focus fortemente legato al territorio. Del resto Gema nasce come start-up per volontà di manager profondamente legati al territorio toscano. Oggi, nella nuovissima sede di Pieve a Nievole, presso l’ex calzaturificio Balducci, su un’area di 57mila mq e un capannone di 13mila (destinati a ultra raddoppiare con nuovi progetti), lavorano 120 persone, il 20 per cento delle quali appartenenti a categorie protette (ex lavoratori rimasti fuori dal mercato) e con molte giovani donne. A Pieve a Nievole, all’uscita autostradale di Montecatini Terme, in provincia di Pistoia, si realizzano 120 kit di allestimento per ogni turno (di 7,5 ore): la semplicità dell’estruso di alluminio, utilizzato come materia prima seguendo il “genio creativo” di Giancarlo Camellini, consente a chiunque di far parte della filiera produttiva. Un investimento, quello sull’ex Balducci, fortemente voluto dall’Amministratore delegato Alessandro Lulli, che in parallelo sta rafforzando la struttura manageriale, con il compito di assegnare a Gema la leadership indiscussa, in Italia ed Europa, dei furgoni allestiti per corrieri espresso, segmento al quale è completamente dedicata la fabbrica pistoiese. Al nuovo sito si affianca lo storico headquarter di Campi Bisenzio, nella cintura di Firenze, dove altre 30 persone lavorano alla produzione “tailor made”, ovvero di allestimenti su misura che vengono prodotti e montati in sede; mentre i kit realizzati nell’ex Balducci vengono spediti alle piattaforme logistiche, dove la clientela - i big player dell’espresso e dell’e-commerce - provvede a farli montare sui furgoni di grandi dimensioni (segmento C/D). Tra i costruttori, decisamente preziosa la partnership con Volkswagen Veicoli Commerciali. “La presenza del nostro allestimento nel listino Volkswagen - afferma Lulli - ha assegnato a Gema un’importante visibilità: grazie a Volkswagen Italia oggi Gema è premium partner della Casa Madre tedesca, con cui abbiamo stretto rapporti eccezionali”. RUOLO DI PUNTA

Nella nuova struttura manageriale di Gema ruolo di punta assume Moreno Sponda, dal 1° luglio scorso Direttore Vendite e Marketing. Classe 1977, veronese, Sponda vanta un curriculum di tutto rispetto nel settore specifico dei veicoli commerciali destinati ai corrieri espresso. Nel 2000 è in BPW, produttore tedesco di assali, dove sfrutta la conoscenza linguistica occupandosi degli acquisti e della ricerca di fornitori. Per tre anni è KAM (Key Account Manager) della gamma leggera e pesante (trainato), mantenendo i rapporti con la Casa Madre. Nel 2008 è Area Manager in Volkswagen Veicoli Commerciali, occupandosi dapprima delle Concessionarie per poi specializzarsi nel segmento Courier e Logistic, settore che sviluppa portando il brand di Hannover a detenere quote di mercato che sfiorano il 90 per cento, dedicandosi in prima persona alle gare globali dei principali big logistici e mantenendo le relazioni con la fabbrica tedesca. Nel 2017 incontra Gema e ne

N° 302 / Settembre 2021

segue lo sviluppo fino a quest’anno quando, dopo l’acquisizione dell’ex Balducci, l’AD Lulli gli chiede di affiancarlo assegnandogli l’incarico di confrontarsi direttamente con i costruttori di veicoli commerciali italiani e esteri, con l’obiettivo di portare l’allestimento Gema in primo impianto, ovvero completato direttamente in fabbrica: realizzato a Pieve a Nievole, il kit - per i segmenti Courier e officina mobile raggiunge lo stabilimento produttivo del costruttore, sulle cui linee nasce un veicolo pronto per il ritiro da parte del cliente. “L’obiettivo -spiega Moreno Sponda - è aprirsi al dialogo con tutti, costruttori globali noti ma anche start-up che stanno nascendo per soddisfare la richiesta del moderno trasporto professionale. Penso a costruttori impegnati nella trazione elettrica, per i quali Gema è già pronta: pur garantendo pari performance di robustezza, rispetto ad altre tipologie di materie prime l’alluminio estruso è un materiale che non impatta sul peso, quindi sui consumi, contribuendo alla filiera delle zero emissioni, obiettivo che tutti i costruttori si pongono nei prossimi anni”. ACCORDO CON I BIG

Gema, massiccio sviluppo “sociale” VERONESE, DAL 1° LUGLIO MORENO SPONDA AFFIANCA L’AD ALESSANDRO LULLI NELLA GESTIONE DI UNA DELLE AZIENDE A MAGGIOR FATTORE DI CRESCITA DEL SETTORE DEGLI ALLESTIMENTI.

GRAZIE ALLA SEMPLICITÀ DELL’ALLUMINIO ESTRUSO,

CHE MANTIENE INALTERATE DOTI DI ROBUSTEZZA, LA CAPACITÀ PRODUTTIVA DI GEMA RISPONDE, OGGI, A UN’IMPORTANTE COMMESSA DI KIT ANNUI FINO AL 2025.

MA LO STABILIMENTO DI PIEVE A NIEVOLE È PRONTO A CRESCERE DI DUE NUOVI HUB. di MAX CAMPANELLA PIEVE A NIEVOLE

Sposato, amante delle attività sportive soprattutto all’aria aperta, mettendo a disposizione di Gema l’esperienza fin qui maturata, Sponda si occuperà inoltre della gestione degli accordi con i big multinazionali della logistica. “La capacità produttiva - afferma il Direttore Vendite & Marketing - non è un problema per Gema: l’alluminio estruso è assolutamente semplice da manipolare. Al momento, proseguendo lungo un percorso in fasi, a Pieve a Nievole ci stiamo strutturando per rispondere a grandi commesse fino a tutto il 2025 e siamo pronti a considerare ulteriori commesse. È in fase di approvazione un progetto di ampliamento con l’edificazione di due nuovi hub, ciascuno di 8mila mq”. Oggi l’ex Balducci ospita al primo piano gli uffici direzionali, mentre il piano terra è dedicato alla produzione, suddiviso in due comparti: il primo destinato esclusivamente ad area taglio, da dove le sagome di alluminio raggiungono le postazioni del secondo comparto per dare vita alle porte; file specifiche sono dedicate alla lavorazione delle componenti (una per plastica, gomma e alluminio) e degli attrezzi necessari per l’assemblaggio. Non da ultimo, la linea produttiva si chiude con la verifica tecnica: due manager dedicati verificano che il montaggio corrisponda ai criteri di qualità in ogni parte del kit; in caso contrario, si torna in produzione per le necessarie modifiche. “Gema conclude Sponda - si prepara a essere riferimento del mondo dell’ecommerce che richiede qualità, semplicità e sicurezza: la pandemia ha accelerato un processo che era già in atto, oggi un po’ tutti i player hanno dovuto adeguarsi a questo trend. Se consideriamo che nell’annus horribilis 2020 i big del settore Courier sono cresciuti del 35 per cento, ci rendiamo conto di quanto siano importanti gli investimenti di Gema tesi a rafforzare la produzione, rispondendo a quelle che sono le caratteristiche peculiari del settore in Italia: l’allestimento non è uguale per tutti, ma prevede specificità, dall’estetica ai dispositivi antifurto”.

Pagina III


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

FORD E LAMBERET/ CONSEGNATO A NIEDDITTAS IL PRIMO TRANSIT PLUG-IN

Dal mare al centro città

I

CRISTINA ALTIERI

un uso cittadino. Percorre fino a 50 km in modalità totalmente elettrica e grazie a questa caratteristica può entrare nei centri storici senza temere blocchi. In Area C a Milano non solo può entrare ma non deve neppure preoccuparsi di pagare il ticket di accesso. L’autonomia totale poi è di 500 km per rispondere a qualsiasi esigenza, anche di chi abbia medie di percorrenza alte: su questo nessun compromesso, sono necessità fondamentali per chi utilizza un vei-

Pagina IV

La consegna del primo Transit Plug-In Hybrid avvenuta presso la concessionaria milanese Ford Ambrostore.

MILANO

l van è elettrificato e l’allestimento pure. Un accordo prima o poi non poteva che arrivare tra Ford e Lamberet che hanno prodotto, personalizzato e consegnato il primo veicolo ibrido allestito per il trasporto a temperatura controllata. Lo utilizzerà un’azienda che ha improntato alla sostenibilità le proprie linee guida: specializzata in miticoltura e pesca, Nieddittas dal Golfo di Oristano arriva fino al centro di Milano e di Roma senza mai allentare l’attenzione nei confronti dell’ambiente. Lo fa da oggi dunque anche grazie al nuovo Ford Transit Custom allestito Lamberet, con il quale il servizio “Nieddittas a domicilio”, istituito ad inizio pandemia per consolare i forzati del lockdown con prelibatezze ittiche di ogni tipo, recapita a zero emissioni nel cuore del capoluogo lombardo il pesce confezionato poche ore prima in Sardegna. La storia di Nieddittas inizia nel 1967, quando nove pescatori dell’Oristanese si riuniscono per dare vita alla Cooperativa Pescatori Arborea. In questi cinquant’anni l’azienda è diventata una delle più importanti realtà italiane del settore: guidata da Caterina e Claudio Murgia, Nieddittas ha chiuso il 2020 con un fatturato di 32 milioni di euro e dà lavoro a circa centosessanta persone. Un leader dunque nell’allevamento, nella pesca e nella distribuzione dei prodotti del mare che oggi alleggerisce ulteriormente l’impatto della propria attività scegliendo un veicolo ibrido con un allestimento elettrico. Ford è un brand che vanta un’ampia offerta di modelli elettrificati e nel prossimo futuro accoglierà una nuova importantissima variante a zero emissioni del suo best seller.“Il Transit Custom è compatto ci spiega Marco Buraglio, Direttore Veicoli Commerciali Ford Italia presente alla consegna del van all’azienda sarda - e dunque adatto ad

colo per lavoro. L’idea di Ford è quella di avvicinare le aziende all’elettrificazione senza chiedere loro di dover effettuare delle rinunce. D’altra parte abbiamo una gamma van che risponde a tutte le necessità: si va dal mild hybrid al plug-in e il prossimo anno debutterà la versione 100 per cento elettrica del Transit. Siamo in pieno sviluppo e il mercato ci viene dietro con una domanda che si fa sempre già importante”. L’allestimento Lamberet è il per-

fetto complemento di questo veicolo quando la sua missione è quella di mantenere alla giusta temperatura gli alimenti trasportati. Intanto non prevede interventi di tipo strutturale sul mezzo, con la silhouette del Custom che resta quella disegnata del costruttore. In questo modo vendono garantite le stesse performance in termini di aerodinamica e silenziosità in cabina, la stessa altezza interna del vano di carico e pari capacità di rigenerazione della batteria

con recupero dell’energia in frenata o in discesa. “Abbiamo semplicemente ascoltato - ha precisato Ismaele Iaconi, Sales & Marketing Director Lamberet Italia - ciò che ci ha chiesto il cliente, per fornirgli un mezzo efficiente ed adatto a questa specifica missione. Sul Ford Custom PHEV a temperatura controllata è montato il sistema Easyfit by Lamberet, che assicura il massimo isolamento termico salvaguardando portata e spazio del furgone: compressore e condensatore sono sotto al telaio, mentre un evaporatore ultrapiatto è integrato nel tetto all’interno del vano di carico”. Il gruppo frigorifero è un Kerstner Cooljet 106 A, prima unità frigo integrata cento per cento elettrica, in grado di assicurare freddo positivo (8-12 e 15-25 gradi) fino a un massimo di 5 m3. Il frigo viene alimentato su questo modello attraverso una presa di corrente fornita ad hoc da Ford. “Il consumo energetico - precisa Iaconi - è pari in media a 25 A, con picchi da 45. La presa fornisce 60 A quindi questa configurazione non va a impattare sull’autonomia del veicolo”. Dunque cozze al sicuro per tutta la loro vita, e se gli ultimi istanti sono curati nel modo appena visto, anche le fase precedenti sono gestite da Nieddittas con un livello di attenzione fuori dall’ordinario. Perché il mare della Sardegna è fondamentale per portare in tavola cozze gustose e di qualità, ma questo non basta per assicurare un prodotto sempre sano e sicuro. L’allevamento delle cozze della specie “Mytilus galloprovincialis” è tra le attività principali della società: la sua capacità produttiva si estende per 86 ettari di vivai a mare nel Golfo di Oristano, mentre il centro di depurazione e spedizione copre un’area di 3mila metri quadrati. Ma come funziona l’allevamento? Una volta immerse nelle acque e disposte nei caratteristici filari, le cozze continuano a crescere sotto la sorveglianza dei pescatori. Alla fine del processo di crescita le

N° 302 / Settembre 2021


HYBRID ALLESTITO PER IL TRASPORTO A TEMPERATURA CONTROLLATA

nel rispetto dell’ambiente DA OGGI A MILANO CI SARÀ UN CUSTOM PHEV DEL COSTRUTTORE AMERICANO A RECAPITARE AD AMANTI DI COZZE, VONGOLE E PESCATO I PRODOTTI DEL GOLFO DI

ORISTANO. CHE ENTRERANNO DUNQUE IN

AREA C SENZA FARE RUMORE E SENZA EMETTERE GAS NOCIVI, NEL RISPETTO DI UN CIRCOLO VIRTUOSO E SOSTENIBILE CHE INIZIA NELLE ACQUE CRISTALLINE DEL MARE SARDO.

Nieddittas vengono raccolte dalle barche e portate nello stabilimento di Corru Mannu dove inizia la fase successiva: la depurazione. Le cozze vengono infatti reimmerse in grandi vasconi isotermici riempiti con acqua di mare debatterizzata. A quel punto le Nieddittas vengono confezionate e preparate per la spedizione alle piattaforme ittiche. I grossisti e i responsabili della Grande distribuzione organizzata possono ritirare il prodotto dalle piattaforme per distribuirlo nelle pescherie.

“Tutta la nostra filiera - ci spiega Giovanni Giugnini, Responsabile della Comunicazione di Nieddittas è improntata alla sostenibilità. Naturale che fossimo portati a scegliere un furgone ibrido per le consegne in città, questa è la direzione che terremo nei prossimi anni. Corru Mannu si trova davanti al Golfo di Oristano, in una zona umida protetta e l’intero compendio di pesca è stato affidato a Nieddittas che è responsabile della sua salvaguardia. Per la qualità e l’efficacia di questa azione

di tutela, l’azienda è considerata una best practice. A conferma della nostra attitudine all’innovazione e alla sostenibilità, da settembre 2019, abbiamo siglato un Memorandum d’intesa con MEDSEA, Mediterranean Sea and Coast Foundation, con l’obiettivo di promuovere iniziative e progetti che favoriscano la conoscenza e la valorizzazione degli ecosistemi marino-costieri del Mediterraneo. Gli ultimi progetti realizzati riguardano il riutilizzo dei gusci dei mitili per la costruzione di isolotti

artificiali presso lo stagno di Corru Mannu per sostenere l’insediamento e la nidificazione di alcune specie di uccelli. Inoltre, abbiamo un programma di economia circolare per ideare e progettare soluzioni di ecodesign attraverso il recupero e riuso di materiali plastici di scarto della lavorazione, come ad esempio la retina utilizzata per il confezionamento”. Nieddittas è inoltre il primo tra i big player in questo settore ad utilizzare per il confezionamento dei

propri prodotti un sacchetto compostabile: la retina biodegradabile, creata con amido di mais, può essere smaltita nell’umido così come l’etichetta. Il cerchio si chiude. Al termine della cerimonia di consegna del veicolo arriva l’autista che sale al volante e parte per il suo primo giro in centro. Le cozze stanno arrivando sulle tavole dei milanesi: la maggior parte di loro saranno ignari della filosofia che ha dato loro vita, ma lo capiranno comunque dal gusto che sentiranno in bocca.

FORD / Nuovo capitolo nella sperimentazione dei veicoli a guida autonoma

Consegne puntuali e senza stress

L

VALENTINA MASSA ROMA

e consegne a domicilio sono diventate parte integrante della nostra vi ta, ma il modo in cui i pacchi arrivano ogni giorno nelle nostre case potrebbe cambiare. Ford, infatti, ha annunciato un nuovo programma di ricerca dedicato ai veicoli a guida autonoma che ha l’obiettivo di aiutare le aziende europee a capire come trarre vantaggio dalle nuove soluzioni del settore. Hermes, azienda leader nel Regno Unito per le consegne a cliente finale, sarà la prima a collaborare con Ford nel nuovo programma. La ricerca, che prevede l’utilizzo di un veicolo commerciale Ford personalizzato, mira a verificare in che modo gli utenti della strada interagirebbero con un furgone per le consegne apparentemente senza autista. Lo speciale Ford Transit appositamente modificato è provvisto di sensori che simulano l’aspetto di un furgone con guida autonoma e di un particolare sedile sul lato guida in grado di nascondere il conducen-

N° 302 / Settembre 2021

te: la persona al volante è, infatti, nascosta da un finto sedile, fa cendo credere agli altri u ten ti della strada che non vi sia nessuno alla guida. “Per introdurre sulle strade i veicoli a guida autonoma - ha dichiarato Richard Balch, Director Autonomous Vehicles and Mobility di Ford Europa - è importante concentrarsi non solo su come rendere la tecnologia utilizzabile, ma anche su come può essere utile alle aziende dei nostri clienti. Ovviamente, per capire in che modo i clienti dovranno adattarsi alle nuove so luzioni, non c’è modo migliore che effettuare delle prove in un contesto reale”. E Ford agisce nel settore da una posizione privilegiata, visto che da sei anni è leader del mercato europeo dei veicoli commerciali. Sfruttando l’esperienza accumulata e combinandola con le competenze delle aziende di logistica dunque, Ford intende individuare nuove opportunità e stabilire nuovi modelli di utilizzo per i veicoli commerciali, prestando particolare attenzione a come cambierebbe l’interazione con le

persone se ai processi attuali venissero affiancati i veicoli con guida autonoma. Le responsabilità dell’autista si estendono talvolta ben oltre il semplice spostamento da un luogo a un altro. In un’azienda che si occupa di consegne o logistica, per esempio, l’autista potrebbe avere anche il compito di organizzare e caricare i pacchi, consegnarli a mano ai destinatari o ricaricarli sul furgone qualora non sia possibile consegnarli. Nell’ambito di questa ricerca l’autista avrà, invece, un ruolo totalmente passivo e si limiterà a guidare il veicolo. Il furgone per le consegne verrà supportato da una squadra di corrieri che si muovono a piedi e sono provvisti di un’app per smartphone che permette loro di far accostare il veicolo e di sbloccare da remoto il portellone di carico quando il veicolo è parcheggiato in modo sicuro a bordo strada. All’interno del furgone, le istruzioni vocali e su schermo digitale indicano al corriere il vano contenente i pacchi da consegnare. Capire e guidare l’interazione degli esseri

umani con il veicolo consentirà alle aziende di proseguire le proprie attività in sicurezza an che senza un autista. Il progetto di ricerca, in collaborazione con Hermes, durerà due settimane e porterà avanti il lavoro iniziato con le prove di consegna ai clienti finali effettuate da Ford a Londra, durante le quali una squadra di corrieri ha prelevato i pacchi da un furgone per consegne e ha coperto l’ultimo tratto a piedi, rendendo più rapide, sostenibili ed efficienti le consegne in città. I veicoli utilizzati per il progetto consentiranno a Hermes e ad altre aziende di iniziare ad analizzare i possibili scenari in cui i dipendenti lavorano fianco a fianco con i veicoli a guida autonoma. Per Hermes, nella fase di progettazione della ricerca è stato necessario sviluppare un’app che consentisse ai corrieri di accedere al furgone per prelevare i pacchi: si tratta di un’attività di cui normalmente si occupa l’autista. “Siamo entusiasti di collaborare con Ford in questo esperimento pionieristico, che punta so-

prattutto a comprendere il potenziale dei veicoli a guida autonoma e scoprire se a lungo termine giocheranno un ruolo importante nel settore delle consegne - ha spiegato Linsey Aston, responsabile del reparto Product, Innovation and Onboarding. “Innoviamo costantemente per sviluppare ed esplorare idee come questa e non vediamo l’ora di avere i primi risultati della ricerca, che si riveleranno senza dubbio utili a tutto il settore”. I ricercatori di Ford sono già al lavoro per sviluppare un linguaggio visivo basato su segnali luminosi che consenta a questi veicoli di comunicare in anticipo il proprio comportamento a pedoni, ciclisti e conducenti di altri

veicoli. Ford ha messo alla prova la tecnologia di guida autonoma in alcune grandi città statunitensi e intende arrivare a un investimento dedicato a questi veicoli di circa 7 miliardi di dollari nell’arco di 10  anni (fino al 2025, con 5  miliardi di dollari investiti dal 2021 in poi) nell’ambito delle iniziative Ford Mobility. In collaborazione con la partner Argo  AI, specialista in tecnologie di guida autonoma, Ford utilizza ogni giorno veicoli di prova in sei città degli Stati Uniti. Lo scorso anno, il sistema di guida autonoma targato Argo AI ha reso possibile la consegna porta a porta di generi alimentari e prodotti per uso scolastico tramite un ente di beneficenza di Miami, in Florida.

Pagina V


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

MERCEDES-BENZ DRIVING EXPERIENCE / I NUOVI SPRINTER MINIBUS CONIUGANO LE

Eroi dei due mondi

C

FABIO BASILICO

ma dei minibus adibiti al trasporto di linea. L’autobus di linea è lungo 8,5 metri, può accogliere fino a 38 passeggeri e rappresenta pertanto la soluzione intermedia tra i minibus e il fratello maggiore Citaro. La sua originale sovrastruttura riprende sapientemente le linee essenziali dello Sprinter e le due fiancate presentano una linea asimmetrica. Anche il vano passeggeri dello Sprinter City è in versione Low Entry e presenta una configurazione molto versatile nella zona a pianale ribassato. Qui trovano spazio un massimo di cinque sedili ribaltabili sul lato guida e altri due sul lato porte; sul lato sinistro in direzione di marcia possono essere sistemati in alternativa una sedia a rotelle e/o un passeggino. Sul lato guida è inoltre possibile installare un sistema di cambio rapido per un massimo di tre sedili doppi. All’originalità del design si af-

Pagina VI

Il posto e l’area passeggeri degli Sprinter Minibus sono stati progettati per il massimo comfort e l’elevata funzionalità.

ULM

oniugare le rinomate caratteristiche del Mercedes-Benz Sprinter con l’ampio knowhow della Casa tedesca nel settore autobus. Un compito assolto con facilità dalla nuova gamma Sprinter Minibus, veri eroi dei due mondi che completano la gamma dei grandi autobus urbani, extraurbani e da turismo della Stella con una serie di modelli completa, adatta a tutti i tipi di impiego. Nella nuova generazione le serie rimangono inalterate: Sprinter City, Sprinter Transfer, Sprinter Mobility e Sprinter Travel. Le denominazioni fanno riferimento al tipo di impiego: servizio di linea, navette versatili, veicoli destinati al trasporto di passeggeri a mobilità limitata e veicoli da turismo. Rivestono un ruolo di spicco lo Sprinter Travel 75 e lo Sprinter City 75, che si presentano con un’estetica e una dotazione tecnologica esclusive. Li abbiamo provati nel corso della driving experience organizzata da EvoBus a Ulm. I minibus basati sullo Sprinter fanno parte da oltre 20 anni della gamma di autobus Mercedes-Benz e dominano il mercato europeo nel segmento con massa totale a terra superiore alle 3,5 tonnellate. Sprinter City è l’esperto del trasporto di linea. Il modello base della serie è lo Sprinter City 45, che misura 7,4 metri di lunghezza. Caratteristiche come il display di indicazione della destinazione sopra il parabrezza o la porta di accesso a due battenti con ampia vetratura evidenziano il suo settore di impiego. Il vano passeggeri nella configurazione Low Entry è suddiviso in un’ampia piattaforma a pianale ribassato disposta tra gli assi e da un settore rialzato con sedili nella parte posteriore. Come veicolo di categoria A, Sprinter City 45 trasporta fino a 22 passeggeri, mentre in categoria I può accogliere fino a 28 persone. Mercedes-Benz Sprinter City 75 è l’emble-

fianca quella della concezione tecnica dello Sprinter City 75. La piattaforma è l’autotelaio dello Sprinter, ma solo fino al montante centrale. A valle, infatti, viene accoppiata l’ossatura integrale autoportante del minibus. L’autobus urbano si caratterizza anche per il passo di 5.100 millimetri. Il due assi ha una massa totale a terra di 6,8 tonnellate, che garantisce ampie riserve ed è resa possibile dall’asse posteriore per carichi gravosi con sospensioni pneumatiche, progettato specificamente per i minibus Mercedes-Benz. I passeggeri salgono a bordo attraverso una porta a traslazione esterna a due battenti e a comando elettrico, posta a valle dell’asse anteriore. Come per la porta posteriore a battente semplice, il comando è collegato alla rete a 12 volt dello Sprinter. Il vano passeggeri dispone di accesso Low Entry. Due gradini molto bassi a monte dell’asse posteriore conducono nella zona sedili posteriore. Grazie ai nuovi sedili Inter Star Sprinter pensati per il trasporto extraurbano, adesso lo Sprinter City 75 è ancora più confortevole. Dispongono di uno schienale alto e fisso e convincono, oltre che per la comoda imbottitura, anche per le cinture di sicurezza a tre punti, che garantiscono la massima sicurezza per tutti i posti a sedere. Gli abbinamenti cromatici sono molto invitanti e prevedono cuscini e schienali in nero/arancio, imbottiture laterali color antracite, poggiatesta in Composition grigio ferro, bordini in Composition color grenadine e schienale in feltro. La configurazione dei sedili e, conseguentemente, la disposizione dei posti a sedere dello Sprinter City 75 nella versione Interurban sono ripresi dallo schema degli autobus urbani: dodici sedili sono disposti nella zona a pianale rialzato, mentre altri sette si trovano nella parte anteriore a pianale ribassato. In questa zona, i sedili doppi sono fissati con un sistema di cambio rapido. Possono quindi essere

N° 302 / Settembre 2021


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI CARATTERISTICHE DEL VAN SPRINTER CON IL KNOW-HOW AUTOBUS DELLA CASA

NELLA NUOVA GENERAZIONE LE SERIE RIMANGONO INALTERATE:

SPRINTER CITY, SPRINTER TRANSFER, SPRINTER MOBILITY E SPRINTER TRAVEL. LE

DENOMINAZIONI FANNO RIFERIMENTO AL TIPO DI IMPIEGO: SERVIZIO DI LINEA, NAVETTE VERSATILI, VEICOLI DESTINATI AL TRASPORTO DI PASSEGGERI A MOBILITÀ LIMITATA E VEICOLI DA TURISMO.

RIVESTONO UN

RUOLO DI SPICCO LO

SPRINTER TRAVEL 75 E LO SPRINTER CITY 75, CHE SI PRESENTANO CON UN’ESTETICA E UNA DOTAZIONE TECNOLOGICA ESCLUSIVE.

LI ABBIAMO

PROVATI NEL CORSO DELLA DRIVING EXPERIENCE

EVOBUS NELLA TEDESCA ULM.

ORGANIZZATA DA

smontati rapidamente quando si necessita di un maggior numero di posti in piedi. Rimuovendo soltanto i primi dei tre sedili doppi nella sezione a pianale ribassato con l’ausilio del sistema di chiusura rapida, si ottiene uno spazio sicuro per una sedia a rotelle. Il vano passeggeri è valorizzato da aste di sostegno in acciaio inossidabile, porte USB per terminali portatili e monitor TFT da 18,5 pollici. Il collaudato Sprinter City 75 è ora disponibile anche in versione Interurban. Grazie ai nuovi sedili Inter Star Sprinter pensati per il trasporto extraurbano, l’autobus urbano si rivela ancora più versatile nella versione interurbana. Questi sedili dispongono di un’imbottitura sagomata che segue il profilo del corpo e di uno schienale alto fisso, a scelta con cinture di sicurezza a due o a tre punti. La versione extraurbana dello Sprinter City 75 può essere allestita con un massimo di 19 sedili per i passeggeri. Sono inoltre disponibili per Sprinter City 75 numerosi equipaggiamenti di nuova introduzione. Di serie sono presenti un freno di fermata e una leva per comandare manualmente il retarder. L’elenco degli equipaggiamenti a richiesta comprende una rampa estraibile a comando elettrico, in alternativa alla rampa basculante, finestrini laterali a doppi vetri e finestrini ribaltabili per la ventilazione del vano passeggeri. Un impianto antincendio nel vano motore rende l’autobus ancora più sicuro. Un serbatoio supplementare, disponibile a richiesta, porta il volume di carburante a 96 litri. Sprinter City 75 è equipaggiato con motore quattro cilindri Mercedes-Benz Om 651 Euro VI da 2.143 cc, potenza massima di 120 kW/163 cv e coppia massima di 360 Nm. Il cambio è l’automatico MercedesBenz 7G-Tronic Plus. Per i lunghi tragitti, è pronto lo Sprinter Travel. Travel 75 è l’emblema esclusivo dei minibus Mercedes-Benz adibiti al trasporto turistico. Lungo 8,5 metri,

N° 302 / Settembre 2021

L’utile e funzionale sportello sollevabile del vano bagagli posteriore caratterizza lo Sprinter Travel 75.

il minibus offre un massimo di 21+1 posti e va a completare la gamma dei grandi autobus da turismo Mercedes-Benz. Analogamente allo Sprinter City 75, anche lo Sprinter Travel 75 dispone di un’ossatura specifica. La cabina di guida e la sovrastruttura, combinate tra loro, conferiscono al veicolo un aspetto armonico. Mentre anteriormente le superfici vetrate della sovrastruttura sono decisamente affusolate, a partire dall’asse posteriore la linea dei finestrini si protende verso l’alto. La parte posteriore di Sprinter Travel 75 presenta una linea originale in stile autobus da turismo. Lo sportello sollevabile del vano bagagli posteriore nasconde un generoso vano di stivaggio da 2 metri cubi, al quale si aggiungono, a destra e a sinistra, due vani di stivaggio laterali, ciascuno protetto da uno sportello girevole e con una capacità di 0,3 metri cubi. Il vano passeggeri colpisce per il soffitto interno di eleganza pari a quella di un vero e proprio au-

tobus. In esso sono integrati i vani portabagagli con condotti dell’aria laterali e listelli con luci a Led, gruppi di comandi per i passeggeri con bocchette di ventilazione regolabili e spot di lettura a Led. I sedili Travel Star Xtra sono disponibili in numerose varianti. Grazie al frigorifero disponibile a richiesta e disposto a destra davanti alla prima fila di sedili, Sprinter Travel 75 offre la possibilità di dissetarsi con una bevanda fresca. La piattaforma del modello è ripresa dall’autotelaio di Sprinter ma solo fino al montante centrale. A valle, infatti, viene accoppiata l’ossatura integrale autoportante del minibus. L’autobus da turismo si caratterizza anche per il passo di 5.100 millimetri, che supera di 775 millimetri il passo più lungo dello Sprinter. Alla base dell’elevata massa totale a terra, che arriva adesso a 6,8 tonnellate, c’è un asse posteriore per carichi gravosi con sospensioni pneumatiche che è stato progettato

appositamente per i minibus Mercedes-Benz e trova impiego anche nello Sprinter City 75. Sprinter Travel 75 offre numerosi equipaggiamenti a richiesta di nuova introduzione. In alternativa ai tavolini ribaltabili montati sugli schienali è disponibile anche una versione con braccio portante. La dotazione di sistemi di intrattenimento può essere completata a richiesta con uno Smart Panel Bosch, un monitor per il vano passeggeri da 19 pollici e porte USB per dispositivi portatili. La botola sul tetto è ora disponibile in opzione anche con comando elettrico. Il retarder di serie si attiva come al solito con il comando a pedale, ma a richiesta è possibile installare una leva nella plancia portastrumenti. La dotazione di sicurezza di serie comprende sistema di assistenza in presenza di vento laterale, sistema antisbandamento, Preventive Brake Assist, luci di marcia automatiche, cinture di sicurezza a due punti su tutti i sedili. L’ampio equipaggiamento di

serie può essere completato a richiesta con sistema di assistenza attivo alla regolazione della distanza, sistema di assistenza abbaglianti, sistema di riconoscimento automatico dei segnali stradali, cinture di sicurezza a tre punti nel vano passeggeri e un impianto di segnalazione d’incendio nel vano motore. Sprinter Travel 75 è la soluzione ideale per piccoli gruppi, viaggi esclusivi, trasporto di VIP e per l’impiego su strade strette e tortuose. A bordo del veicolo, lungo 8,5 m, tutto è esclusivo: il design originale, la tecnologia e l’equipaggiamento confortevole. L’originale design della carrozzeria rende il veicolo inconfondibile e il vano passeggeri è molto invitante e accogliente. Ogni passeggero ha a disposizione sul proprio sedile una porta USB per terminali portatili e due porte USV per alti terminali. L’autobus conta in totale 18 sedili per passeggeri del tipo Travel Star Xtra. La plancia fissa nuovi standard. Un tratto tipico dei minibus è l’ordinato gruppo di comandi sopra la consolle centrale per le funzioni proprie di un autobus. La colonna portante della catena cinematica è il turbodiesel a sei cilindri Mercedes-Benz OM 642 in regola con la normativa Euro Vi. Questo propulsore high-tech da 2.987 cc eroga 140 kW/190 cv e 440 Nm e colpisce per la silenziosità di funzionamento e l’elevata elasticità. La trasmissione di forza è affidata al cambio automatico 7G-Tronic Plus. L’asse posteriore motore è una soluzione progettata ad hoc per gli autobus. Munito di sospensioni pneumatiche e pneumatici gemellati, questo asse sopporta una carico massimo di 4,8 tonnellate. Oltre all’ampio equipaggiamento di serie, il veicolo può disporre di sistema di assistenza attivo alla regolazione della distanza Distronic e di sistema anti-sbandamento attivo. Una telecamera per la retromarcia assistita agevola le manovre, proiettando l’immagine sul monitor del sistema MBUX.

Pagina VII


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

OPEL / CINQUE GENERAZIONI DEL COMBO, PREMIATO COME “VAN OF THE YEAR 2019”

Nato per essere un riferimento NEGLI ANNI ’80 DEL SECOLO SCORSO, CON L’INTRODUZIONE DELLA QUINTA GENERAZIONE DI OPEL KADETT, ALLA FURGONETTA VIENE AFFIANCATA LA VERSIONE COMBO, RICONOSCIBILE PER IL CARATTERISTICO IL TETTO RIALZATO DI CIRCA 25 CM IN CORRISPONDENZA DEL VANO DI CARICO E PER IL PORTELLONE POSTERIORE A DOPPIO BATTENTE. INIZIA COSÌ L’AVVENTURA DI UN’AUTENTICA ICONA DEL SETTORE, INTRODOTTA PER LA PRIMA VOLTA IN ITALIA NEL 1985.

T

GIANCARLO TOSCANO MILANO

rentacinque anni di onorata carriera fanno di un veicolo un’icona. Punto di riferimento dei derivati commerciali Opel, Combo festeggia le sue cinque generazioni e continua sulla strada tracciata nel passato, ribadita nel presente e foriera di ulteriori successi nel futuro. All’inizio degli anni ’80, cessata la produzione degli autocarri Blitz, Opel decide di rientrare nel mercato dei derivati commerciali e sulla base della Kadett-D Station Wagon realizza una versione Van pensata per i servizi di assistenza tecnica e per la consegna delle merci in ambito urbano. Un ulteriore passo avanti in questa direzione viene compiuto quando, con l’introduzione della quinta generazione di Opel Kadett, alla furgonetta viene affiancata la versione Combo, riconoscibile per il caratteristico il tetto rialzato di circa 25 cm in corrispondenza del vano di carico e per il portellone posteriore a doppio battente. Introdotta in Italia nel novembre 1985, la prima edizione di Opel Combo ha un vano di carico di 2,3 mc, una portata di 600 kg, un motore diesel di 1.6 litri da 54 cv (40 kW) e una parete divisoria dietro i sedili che dimostra come la sicurezza sia già una priorità. La divisione tra i sedili e il vano di carico può anche essere costituita in opzione da una rete o una porticina in modo da aumentare la lunghezza del piano di carico fino al parabrezza. Con la seconda generazione commercializzata in Italia nell’ottobre 1993, Combo cessa di essere una semplice versione di Kadett e diviene un modello a sé stante. Disponibile con due motori a benzina di 1.4 e di 1.6 litri e con un 1.7 diesel, Combo-B è realizzato sul pianale della seconda generazione di Opel Corsa e sviluppa il tema del tetto rialzato in corrispondenza del vano di carico con un originale “roof box” di colore nero posto sopra la cabina di guida. Con una capacità di carico complessiva di

Due generazioni a confronto: il Combo-A con il caratteristico tetto rialzato e, in alto, l’attuale Combo Cargo XL.

3.130 litri Combo-B è uno dei veicoli più spaziosi della sua categoria. Più di 270mila esemplari venduti in otto anni sono il metro di misura del successo commerciale della seconda generazione di Combo. A fine estate 2001 arriva la terza generazione, realizzata sulla base della terza generazione di Corsa e ottenibile con tre economici motori di potenza compresa tra 65 cv (48 kW) e 87 cv (64 kW). Oltre che nella classica versione Cargo a 2 posti per trasporto merci, Combo è disponibile anche in versione Tour, un pratico multispazio 5 posti concepito per le famiglie e il tempo libero. Dal 2012, con la commercializzazione della quarta generazione, i clienti possono scegliere per la prima volta veicoli di due lunghezze diverse. Il nuovo Opel Combo-D è infatti disponibile in versione 5 posti a passo corto o lungo, con tetto normale e tetto alto, porte scorrevoli di serie e portellone oppure due porte posteriori a battente. La quarta generazione è disponibile con un 1.4 a benzina da 95 cv, un 1.4 turbo da 120 cv e con alimentazione bi-fuel metano-benzina, un 1.3 da 90 cv, un 1.6 da 90 cv e da 105 cv, il 2.0 CDTI da 135 cv. Nell’estate del 2018 è stata introdotta l’attuale quinta generazione di Opel Combo. Disponibile nelle versioni a passo normale o a passo lungo, le lunghezze sono rispettivamente pari a 4,4 e 4,7 metri. La versione Cargo caratterizzata da una capacità di carico di 4,4 mc si è aggiudicata l’”International Van of the Year 2019”, mentre il gemello Combo Life (disponibile nelle versioni a 5 e 7 posti) è stato votato Best Buy Car of Europe 2019 dalla giuria internazionale di Auto Best. Grazie al nuovo approccio seguito durante lo sviluppo, la nuova generazione di Opel Combo offre oggi un numero di tecnologie innovative e sistemi di assistenza alla guida senza eguali nel segmento, sia nella versione per il trasporto di passeggeri sia nel veicolo commerciale.

MAN TRUCK & BUS / Sempre in prima fila nella difesa dell’ambiente

TGE anticipa la normativa più rigida

A

LINO SINARI VERONA

spettando l’elettrico, l’intero settore dei trasporti sta vivendo una fase di profonda trasformazione. Molto presto, l’impiego di un veicolo commerciale con propulsore elettrico sarà considerato normale come lo è già poter disporre di un computer portatile ad alte prestazioni. Ma in questa lunga fase di transizione, il motore a combustione svolge ancora un ruolo molto importante e per questo è stato ulteriormente sviluppato e migliorato. In casa MAN i motori diesel, attualmente utiliz-

Pagina VIII

zati, sono ancora più puliti, economici e rispettosi dell’ambiente in cui vengono utilizzati. Dal 1° gennaio 2022, tutti i veicoli di classe N1 di nuova immatricolazione all’interno dell’Unione Europea, dovranno essere conformi alla norma EU6D sulle emissioni. Il test RDE (Real Driving Emissions) misura gli inquinanti emessi dai veicoli durante la guida su strada. L’introduzione dell’RDE ha visto due fasi di attuazione; la prima nella quale i costruttori hanno dovuto ridurre il divario tra le emissioni di ossido di azoto (NOx) prodotte durante i test in laboratorio

e quelle prodotte in condizioni reali (in strada) ad un fattore di conformità di massimo 2,1. Successivamente il divario è stato ridotto al valore at-

tuale che è di 1,43 per i motori Eu6D. Il nuovo motore EU6D promette infatti miglioramenti significativi nelle emissioni

di CO2, ma soprattutto nei consumi. Ad esempio, con un furgone 3,5t L3H3 con una potenza di 140CV (103kW) e un motore EU6D si ha una riduzione di CO2 di 23 grammi medi rispetto al medesimo veicolo EU6d-Temp, che significa un conseguente miglioramento nei consumi tra il 9 e 10 percento, pari a 0,8 litri medi per 100km. Rispetto alla serie precedente, i nuovi motori EU6D sono stati migliorati in molti aspetti e grazie all’innovativo sistema SCR con tecnologia “twin dosing” è possibile ridurre in maniera significativa le emissioni di ossido di azoto. Questo risultato si ottiene grazie

alla tecnologia SCR (Selective Catalytic Reduction) con doppia iniezione. Nella tecnologia a doppio dosaggio, l’agente riducente AdBlue viene iniettato in due catalizzatori disposti in serie sull’impianto di scarico. Il processo di dosaggio doppio richiede un secondo catalizzatore SCR posizionato nel sottoscocca del veicolo. Grazie alla presenza di due punti d’iniezione dell’AdBlue, si riesce a gestire meglio la temperatura e quindi a far lavorare l’SCR sempre in condizioni termiche ottimali durante i molteplici utilizzi del veicolo. Oltre al motore diesel da 2,0 litri, ora ancora più economico, il MAN TGE è disponibile anche in versione 100 per cento elettrica, MAN eTGE, e sta ottenendo riscontri molto positivi presso i numerosi clienti europei che lo stanno impiegando in condizione di reale utilizzo.

N° 302 / Settembre 2021


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

FIAT PROFESSIONAL / SULLE LEGGENDARIE PISTE DI BALOCCO

Ecco il Ducato migliore di

S

UN MOTORE TUTTO NUOVO E UNA BELLA INIEZIONE DI TECNOLOGIA E DI COMFORT RENDONO LA NUOVA GENERAZIONE DEL VAN BEST SELLER IN EUROPA UN CAMPIONE DI EFFICIENZA E DI COMFORT AL SERVIZO DEGLI UTILIZZATORI PROFESSIONALI E DELLE LORO MISSION OPERATIVE. UNA VERSIONE PERFETTA PER FESTEGGIARE UN ANNIVERSARIO IMPORTANTE: LANCIATO NEL 1981, NEL 2021 IL DUCATO COMPIE 40 ANNI.

CRISTINA ALTIERI BALOCCO

ono quattro le linee guida che hanno ispirato le scelte e le valutazioni di ingegneri e designer quando si sono trovati a dover ripensare un veicolo vincente come il Fiat Professional Ducato. Doveva diventare ancora più connesso, sicuro, confortevole ed efficiente. Obiettivo centrato? Dopo una giornata a salire e scendere dalle varie versioni del mezzo, avendo a disposizione per i test la pista Langhe e la Durability Track del Proving Groung di Balocco, il più grande centro prove del variegato universo Stellantis, ci sentiamo di rispondere di sì. Il Ducato ottava generazione ha imboccato la corsia di sorpasso e si è messo avanti a tutti soprattutto in termini di tecnologia, proponendo oggi un ambiente in grado di comunicare con il guidatore e soprattutto di aiutarlo a trascorrere le proprie giornate sulla strada nel modo più sicuro possibile.

cato sembra aver realizzato l’ambizioso progetto. Dispone di un cruscotto digitale, chiaro e intuitivo, interamente configurabile a seconda delle preferenze del guidatore, e dotato di mirroring per la copiatura delle funzioni dello smartphone sul display. A propo-

sito di schermi, le opzioni in gamma sono tre: si va dall’entry level da 5’’ a colori con gestione integrata della telecamera posteriore, al display da 7’’, fino al top di gamma da 10’’ con voice recognition. Il sistema di infotainment UConnect offre dal canto suo una

serie di servizi, dalla chiamata di emergenza, al supporto dato alla gestione delle flotte dal Fleet Manager System. C’è la tecnologia che facilita la vita a chi passa tante ore in abitacolo, e c’è quella che la salva, e questa generazione del Ducato

realizza con i dispositivi di assistenza di cui è dotato un livello di guida autonoma 2. Tra le sue capacità, sterza, accelera e frena da solo, con il guidatore che deve sempre mantenere il controllo della strada e la presa sul volante, pena il disinserimento della fun-

PROGETTO VINCENTE

Un argomento al quale i professionisti al lavoro sono particolarmente sensibili, considerate le ore che passano al volante. Quanto più il veicolo è in grado di assumersi parte del carico di lavoro, che non significa solo condurre il mezzo, ma anche vivere al suo interno, restare concentrati, essere facilitati nelle operazioni di carico, meglio è. Ma andiamo con ordine. Quanto alla connettività, l’obiettivo di Fiat Professional era di tornare a diventare un leader: il nuovo Du-

Pagina X

N° 302 / Settembre 2021

Il nuovo Ducato propone un’ambiente in grado di comunicare con il guidatore e soprattutto di supportarlo adeguatamente nella guida su strada.


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI AL VOLANTE DELL’OTTAVA GENERAZIONE DELL’AMMIRAGLIA VAN

sempre (ma non l’ultimo)

zione se il sistema si accorge della distrazione dell’autista. questo comportamento del van è reso possibile dall’azione combinata di vari dispositivi quali l’Adaptive Cruise Control con stop and go, il Lane Centering che mantiene il mezzo al centro della corsia di percorrenza, e il Traffic Jam Assist che ha la capacità di far cambiare corsia al veicolo se questa viene invasa all’improvviso da un altro mezzo. Inoltre, meraviglia delle mera-

viglie, lo specchietto retrovisore digitale risolve il problema della visibilità posteriore in caso di versione furgonata. Una comodità impareggiabile. A proposito di comfort, anche questo è un argomento che è stato trattato con dovizia di particolari. I dispositivi che facilitano la vita del conducente sono numerosi: dalla panca eat and work per consumare il pasto con agio, al sistema di ingresso in auto keyless, al wireless charger per caricare i dispositivi

smartphone senza utilizzare cavi, al parabrezza riscaldato e alla presa da 230 V per far recuperare energia ad eventuali strumenti di lavoro. BRIO E REATTIVITÀ

E infine il nuovo motore, che abbiamo testato a fondo e che si è dimostrato, anche nella versione meno potente (tra quelle disponibili con trasmissione automatica),

quella da 140 cv, un campione di brio e reattività. Parliamo del propulsore diesel Multijet 3 Power, basato sulla nuova architettura H3 Power sviluppata da Stellantis per Fiat Professional. Un nome che fa riferimento ai tre ambiti sui quali il Ducato ha saputo incrementare le sue prestazioni: efficiency, durability e comfort. Vanta un peso ridotto e un’autonomia maggiorata, a fronte di una capacità di carico e di un volume inalterato rispetto alla generazione preceden-

te. Disponibile è, come anticipavamo, sia il cambio manuale che la trasmissione a 9 rapporti sviluppata da Stellantis su progetto ZF dai passaggi di marcia fluidi e ineccepibili. Alla prova sui percorsi in pista il Ducato, tanto nella versione trasporto persone, quanto in quella furgonata, entrambi caricati con 500 kg, si sono dimostrati leggeri, maneggevoli e reattivi, un equilibrio perfetto per i professionisti al lavoro.

FIAT PROFESSIONAL / Le migliorie tecnologiche del Ducato pensate per l’utilizzo leisure

Eric Laforge: “Diciamo grazie ai camperisti”

Vi tolgo subito due dubbi. Il primo: sono francese ma parlo perfettamente fiatese, visto che sono in questa azienda da 31 anni. Secondo: pur essendo francese ho tifato Italia nella finale degli Europei contro l’Inghilterra”. Eric Laforge, Head of LCV di Stellantis apre la conferenza stampa di presentazione del nuovo Ducato facendo sorridere i giornalisti. Un manager al servizio dei marchi FCA dal lontano 1990 e che non sembra aver perso l’entusiasmo e la freschezza nel corso della sua lunga salita al vertice aziendale. Oggi Laforge vive da protagonista la nascita di Stellantis, un colosso da 400mila dipendenti in tutto il mondo e 14 brands, di cui molti ultracentenari. La sua competenza si estende su sei marchi, tanti sono quelli che possiedono una gamma LCV, di cui due interamente dedicati ai commerciali, Fiat Professional,

N° 302 / Settembre 2021

appunto, e RAM. Nel 2020 i marchi oggi appartenenti a Stellantis hanno venduto 1.921.000 LCV, conquistando il secondo posto sul podio dei più bravi al mondo. “Per trovarci un obiettivo da raggiungere - commenta Laforge - abbiamo dovuto impegnarci pochissimo: imprimo era diventare i numeri uno ovviamente. I dati di fine giugno hanno decretato che siamo già riusciti a raggiungere il risultato”. E il Ducato ha dato una mano importante ad ottenere questo obiettivo. “Si tratta di un mezzo con una doppia anima - ha proseguito Laforge - da una parte è chiaramente votato ad un impiego professionale, dall’altra è la base camper più utilizzata di sempre, e quindi abbiamo introdotto le novità sia in ottica last mile delivery che in quella camper. Il risultato è eccezionale. Mi sento di dire che questa è la migliore versione di

sempre del Ducato, pur non essendo sicuramente l’ultima. Il Ducato continuerà ad esistere anche negli anni a venire, arriveranno nuove generazioni che sapranno accompagnare il progresso tecnologico e renderlo disponibile per chi vorrà utilizzare il nostro mezzo per lavorare o per andare in vacanza”. “Sappiamo - prosegue Eric Laforge - che i camperisti non accettano compromessi quando si tratta del loro veicolo, per loro è un’estensione della casa dove abitano, vogliono il meglio. È partendo soprattutto dalle loro esigenze che abbiamo formulato la lista di equipaggiamenti tecnologici che avremmo voluto inserire sull’ottava generazione del Ducato i cui benefici, a cascata, ovviamente ricadono oggi anche sui clienti professionali”. Tra le specificità del Ducato, sul sistema UConnect c’è anche l’opzio-

ne di configurare le dimensioni del veicolo, per adattare le indicazioni stradali alle specifiche del mezzo, e non consigliare itinerari difficoltosi o impraticabili in considerazioni degli ingombri. E quanto alle propulsioni alternative ai motori endotermici il manager spiega molto bene la posizione di Fiat Professional e del resto del Gruppo. “Entro il 2025, come anticipato dal nostro Presidente Carlos Tavares conclude Laforge, - un terzo degli LCV venduti saranno elettrici, mentre entro il 2030 la quota passerà al 7080 per cento. Vedo nel futuro soprattutto l’idrogeno, che introdurremo a fine anno sui veicoli dei marchi ex PSA. Non saremo follewers, ma su questa tecnologia saremo in prima linea. Con i nostri marchi d’ora in poi saremo in prima linea su tutti gli argomenti che interessano i professionisti al lavoro”.

Pagina XI


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

RENAULT / GAMMA DI VEICOLI A CELLE A COMBUSTILE COMPLEMENTARE ALL’ELETTRICO

L’idrogeno si fa strada con Hyvia I

GUIDO PRINA

BASANDOSI SUI PUNTI FORTI E SULLE COMPETENZE DI DUE LEADER, GRUPPO RENAULT E PLUG POWER (LEADER MONDIALE PER LE SOLUZIONI A IDROGENO), HYVIA ASSEMBLERÀ LE CELLE A COMBUSTIBILE E LE STAZIONI DI RICARICA A IDROGENO NELLO STABILIMENTO FRANCESE DI FLINS. INOLTRE, OFFRIRÀ, ENTRO FINE 2021, UN’AMPIA GAMMA DI VEICOLI COMMERCIALI LEGGERI RENAULT A CELLE A COMBUSTIBILE: MASTER VAN H2-TECH, MASTER TELAIO CABINATO H2-TECH E MASTER CITYBUS H2-TECH.

ROMA

l Gruppo Renault accelera sull’idrogeno in linea con la grande offensiva lanciata nell’elettrico. È un passo obbligato per la Losanga, protagonista di un percorso intensivo sulla mobilità alternativa nel settore dei veicoli da lavoro. La nuova strada per la mobilità a idrogeno si chiama Hyvia, dove “Hy” sta per idrogeno e “Via” per strada. Si parla di mobilità de-carbonizzata con la proposta di un eco-sistema completo e unico. Al centro di tutto c’è l’idrogeno verde, cioè ottenuto per elettrolisi dell’acqua, che consente una mobilità a zero emissioni di CO2, una maggiore autonomia e tempi di ricarica di pochi minuti. Hyvia proporrà la produzione, lo stoccaggio e la distribuzione dell’idrogeno verde, in particolare, con stazioni di ricarica a idrogeno entro fine 2021, per soddisfare il più possibile le esigenze dei suoi clienti. Inoltre, complementare alla mobilità elettrica, offrirà, sempre entro fine 2021, un’ampia gamma di veicoli commerciali leggeri Renault a celle a combustibile: Master Van H2-TECH, grande furgone per il trasporto merci, con un volume utile di 12 mc e un’autonomia fino a 500 km; Master Telaio Cabinato H2-TECH, grande furgone per il trasporto delle merci più voluminose, con un volume utile di 19 mc e un’autonomia di circa 250 km; Master Citybus H2-TECH, minibus urbano per il trasporto di 15 persone, con un’autonomia di circa 300 km. Tutti questi veicoli sono dotati di batteria da 33 kWh, cella a combustibile da 30 kW e serbatoi con una

capienza da 3 a 7 kg di idrogeno, in funzione delle versioni. Il sistema a celle a combustibile comprende le celle e tutti i sottosistemi necessari per il buon funzionamento: alimentazione e regolazione dell’aria e dell’idrogeno, umidificazione dei gas e raffreddamento. Basandosi sui punti forti e sulle competenze di due leader, Gruppo Renault e Plug Power (leader mondiale per le soluzioni a idrogeno che ha già sviluppato una rete di

oltre 100 stazioni in grado di distribuire più di 40 tonnellate di idrogeno al giorno), Hyvia, che ha sede in Francia con quattro siti a disposizione (tra cui Batilly dove viene prodotto Master e dove sarà prodotto il Master per Hyvia), assemblerà le celle a combustibile e le stazioni di ricarica a idrogeno nello stabilimento di Flins. Le stazioni di ricarica possono essere acquistate o prese a noleggio. La sua offerta sarà disponibile in tutta Europa.

“Per rispondere alle sfide della mobilità a idrogeno, è necessario proporre veicoli a celle di combustibile per tutti gli utilizzi intensivi, ma anche prendere in considerazione l’ecosistema nel suo complesso ha dichiarato David Holderbach, Presidente di Hyvia - Hyvia offre soluzioni di mobilità chiavi in mano con la produzione, lo stoccaggio e la distribuzione d’idrogeno verde nonché un’ampia gamma di veicoli commerciali. Soluzioni che rispondono alle nuove esigenze di aziende, grandi clienti, flotte ed enti pubblici, per intraprendere insieme la strada della transizione energetica”. Hyvia si avvale delle competenze del Gruppo Renault, leader dei veicoli commerciali elettrici in Europa e pioniere dei veicoli commerciali a idrogeno circolanti su strada dal 2014. Per rispondere alle esigenze dei clienti, Hyvia abbinerà all’offerta veicolare i servizi di finanziamento (come il leasing delle stazioni di ricarica a idrogeno e dei veicoli) e la manutenzione a cura della rete di concessionari Renault, capillarmente diffusa in tutta Europa.

Nuovo Kangoo TPMR a disposizione delle persone a mobilità ridotta e del loro diritto a muoversi liberamente

CON RENAULT TECH LA MOBILITÀ INCLUSIVA È UN’OPPORTUNITÀ CONCRETA R enault Tech svela il nuovo Kangoo TPMR per il Trasporto di Persone a Mobilità Ridotta (TPMR). Il progetto è basato su tre punti forti: mobilità inclusiva, comfort e modularità. Prodotto in Francia nello stabilimento di Heudebouville, in Normandia, il veicolo sarà commercializzato questo autunno in Francia e nel resto d’Europa e proposto con motorizzazione benzina da 100 e 130 cv e trasmissione manuale o automatica. In esclusiva su Kangoo TPMR è montata una rampa di accesso scorrevole posizionata a livello di sottoscocca, una novità assoluta per il mercato europeo dei veicoli TPMR. Quest’innovazione consente all’occupante in sedia a rotelle di disporre di un ambiente libero da ogni elemento di intralcio visibile e di ridurre i rumori ambientali causati dalle vibrazioni della rampa riposta nell’abitacolo. Il passeggero in sedia a rotelle può contare anche su un livello di sicurezza ottimale, grazie ai sistemi di fissaggio BraunAbility che consentono di bloccare il

Pagina XII

posizionamento della sedia a rotelle nel veicolo. Per accrescere il comfort, Renault Tech propone un pianale orizzontale, antiscivolo e lavabile, meno inclinato per consentire all’utente di avere una buona visibilità della strada, ridurre il “mal d’auto” e essere più vicino agli altri passeggeri, rendendo così il veicolo più conviviale. Inoltre, l’ottimizzazione dello spazio disponibile nell’abitacolo grazie ai tre sedili posteriori individuali, sviluppati da Renault Tech in sostituzione dell’originaria panchetta, conferisce a Kangoo TPMR una preziosa modularità. È anche possibile disporre di varie configurazioni dei sedili e di modulare il numero dei passeggeri nello stesso veicolo: 3 sedili individuali + 1 sedia a rotelle, 4 sedili individuali + 1 sedia a rotelle o 5 sedili individuali senza sedia a rotelle. Renault Tech vanta un’esperienza di oltre 30 anni negli allestimenti TPMR. Il primo veicolo Express TPMR è stato commercializzato nel 1987. Renault Tech è pioniere e leader in Francia nel

mercato dei veicoli TPMR e uno dei primi allestitori in Europa; progetta, produce e commercializza allestimenti per tutto il Gruppo Renault su richiesta di clienti privati,

di operatori professionali e grandi aziende. Oltre a Kangoo, la gamma TPMR si avvale di Trafic e Master. Di recente, il nuovo Kangoo si è aggiudicato 4 stelle ai test

sulla sicurezza Euro NCAP. Un punteggio che pone l’ultimissimo multispazio di Renault al top del segmento. Kangoo si distingue per i sei airbag, le cinture di sicurezza

con pretensionatori pirotecnici e limitatori di carico nonché i tre ganci Isofix per i sedili anteriori lato passeggero e posteriori laterali. Il punteggio Euro NCAP valuta la stabilità della struttura dell’abitacolo e il livello di protezione degli occupanti nei crash test. La protezione risulta ottimale su tutti i segmenti del corpo nei test effettuati con i manichini 6-10 anni. A livello di equipaggiamenti di sicurezza attiva, i test Euro NCAP pongono l’accento sull’efficacia della frenata di emergenza attiva con riconoscimento di ciclisti, pedoni e veicoli, di giorno e di notte, ma anche sull’utilità di nuovi dispositivi come l’assistenza attiva di mantenimento nella corsia e il riconoscimento della segnaletica stradale con alert di eccesso di velocità, che si aggiungono al regolatore e limitatore di velocità con frenata in discesa. Con nuovo Kangoo, Renault offre gli equipaggiamenti di serie più recenti per una maggiore sicurezza dei suoi occupanti e di tutti gli utenti della strada.

N° 302 / Settembre 2021


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

LA STELLA HA LANCIATO SUL MERCATO LA VARIANTE ELETTRICA DI VITO NEL LUGLIO 1996, SOLO ALCUNI MESI DOPO L’ANTEPRIMA MONDIALE DELLA SERIE CON MOTORE A COMBUSTIONE DISPONIBILE ALL’EPOCA.

VITO 108 E È IN GRADO DI OSPITARE FINO A OTTO PERSONE E IL SUO CARICO UTILE TOCCA I 600 CHILOGRAMMI.

A LIVELLO DI

PRESTAZIONI COLPISCONO LA VELOCITÀ MASSIMA CHE SI ATTESTA SU 120 KM/H E L’AUTONOMIA FINO A

170 CHILOMETRI. IL VEICOLO MONTA UN MOTORE ASINCRONO TRIFASE RAFFREDDATO AD ACQUA IN GRADO DI EROGARE UNA POTENZA DI

40 KW/ 54 CV.

MERCEDES-BENZ VANS / VENTICINQUE ANNI FA IL DEBUTTO DEL VITO 108 E

Avanguardia dei van elettrici

M

FABIO BASILICO ROMA

obilità urbana a emissioni zero? Non è una esclusiva dei nostri tempi. I veicoli elettrici sono da sempre al centro delle attenzioni dei costruttori automotive. E’ il caso di Mercedes-Benz che 25 anni fa presenta il Vito 108 E, veicolo elettrico a batteria basato sulla serie W 638. La Stella ha lanciato sul mercato la variante elettrica di Vito nel luglio 1996, solo alcuni mesi dopo l’anteprima mondiale della serie con motore a combustione disponibile all’epoca. Un bollettino informativo ne descriveva le potenziali applicazioni, aggiungendo: “Essendo un veicolo piccolo, compatto e agile che può essere parcheggiato senza problemi in qualsiasi garage, Vito elettrico è perfetto per la distribuzione e il trasporto passeggeri in centro città”. Vito 108 E è in grado di ospitare fino a otto persone e il suo carico utile tocca i 600 chilogrammi. A livello di prestazioni colpiscono la velocità massima che si attesta su 120  km/h e l’autonomia fino a 170  chilometri. Il veicolo monta un motore asincrono trifase raffreddato ad acqua in grado di erogare una potenza di 40  kW/ 54  cv. Da fermo fino a 2.000  giri/min sviluppa una coppia di 190 Nm. La potenza viene trasferita da un cambio manuale meccanico che comprende cinque marce avanti e una retromarcia. Una batteria ZEBRA (Zero Emission Battery Research Activities) è installata nella parte posteriore, dietro la panca, e funge da accumulatore di energia. Questa batteria è già stata utilizzata due anni prima in un veicolo sperimentale su base MercedesBenz Classe C (serie 202). L’accumulatore di energia al sodio/cloruro di nichel genera una tensione nominale di 280 volt e vanta una capacità di 35,6 kWh. Grazie al caricabatteria integrato, con Vito 108 E è possibile raggiungere metà della carica in 30 minuti nel corso di un processo di ri-

N° 302 / Settembre 2021

carica rapida. In movimento, anche il motore di azionamento ricarica l’accumulatore per effetto del recupero di energia, per esempio in fase di frenata. La batteria pesa 420 chilogrammi. Il van innovativo viene prodotto nel “Centro di competenza per la mobilità a emissioni zero” (KEM), situato nello stabilimento di Mannheim. Il KEM installa sistemi di guida alternativi in truck e van. Per quanto riguarda i veicoli elettrici, la maggior parte delle richieste proviene da aziende che si affidano alla mobilità a emissioni zero per motivi commerciali. È il caso di Deutsche Post AG, uno dei servizi postali della Germania, che utilizza Vito 108 E per le attività quotidiane. Dal 1999, l’azienda impiega cinque van a Brema e all’Expo 2000 di Hannover per le attività di consegna della posta. La serie successiva di Vito (W 639) è disponibile anche con sistema di trazione elettrico a batteria. Oggi gli sviluppi della mobilità elettrica hanno fatto passi da gigante. Mercedes-Benz Vans offre quattro potenti veicoli elettrici a batteria prodotti in serie: EQV, eVito Tourer, eVito Panel Van ed eSprinter. Sono

disponibili diverse varianti di ogni veicolo, così è possibile configurare quello più adatto a una serie specifica di applicazioni. Tutte le configurazioni hanno una caratteristica in comune: viaggiano a emissioni zero a livello locale. Con eDrive@VANs, Mercedes-

Benz Vans accelera l’elettrificazione della sua gamma di prodotti con una serie di motori elettrici a zero emissioni locali, dando così un importante contributo alla mobilità sostenibile nella distribuzione delle merci e nella circolazione delle persone. Tutto è iniziato con eVito Furgone

Il Vito E-CELL e, sopra, la gamma degli elettrici della Stella e il Vito 108 E.

nel 2018, seguito da eVito Tourer. Quest’ultimo riprende l’estetica del fratello con motore a combustione, anche se sotto il frontale dinamico con collegamento di ricarica nella parte sinistra del paraurti anteriore si nasconde la catena cinematica elettrica (eATS) che aziona le ruote anteriori con una potenza di picco di 150 kW. Il motore elettrico, il cambio con rapporto di trasmissione fisso, l’impianto di raffreddamento e l’elettronica di potenza creano un’unità compatta. L’energia viene accumulata in una batteria agli ioni di litio nel sottoscocca del veicolo. La sua posizione bassa e centrale ha effetti positivi sul comportamento di marcia di eVito Tourer. La velocità massima di serie è pari a 140 km/h ed è incrementabile, con un equipaggiamento a richiesta, a 160 km/h per assicurare rapidità di spostamento anche al di là del traffico urbano. La batteria con una capacità utilizzabile di 90 kWh consente un’autonomia di oltre 400 chilometri. A fine 2019 è partita la produzione di eSprinter a Düsseldorf. E sempre nel 2019, con EQV la Casa tedesca ha presentato la sua prima monovolume premium con trazione esclusivamente elettrica. Il veicolo garantisce un’autonomia di oltre 400 km, accompagnata da un uso estremamente versatile dell’abitacolo, in linea con gli standard a cui Stoccarda ci ha abituati. Mercedes-Benz Vans ha annunciato una versione elettrica anche per il prossimo modello di Citan, confermando ancora una volta l’obiettivo di elettrificare tutte le serie. Il costruttore si impegna per trovare una soluzione elettrica globale che non solo alleggerisca il carico di stress su città e ambiente, ma offra anche un vero valore aggiunto ai clienti. L’elettromobilità Mercedes-Benz va dunque ben oltre il veicolo stesso. La Casa di Stoccarda offre infatti un intero ecosistema che viene sviluppato in stretta collaborazione con gli utilizzatori finali per garantire un risultato su misura per il rispettivo settore.

Pagina XIII


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

WEBASTO / INSIEME A GORIZIANE PER LA MOBILITÀ ELETTRICA DEI CENTRI CITTADINI

Alle batterie ci pensiamo noi

GREEN-G, COSTRUTTORE DI VEICOLI E SISTEMI ELETTRICI, È IMPEGNATO A GARANTIRE MINORE INQUINAMENTO NELLE AREE URBANE CON L'ECARRY A ZERO EMISSIONI E WEBASTO SUPPORTA L'AZIENDA ITALIANA CON LA SUA TECNOLOGIA DI BATTERIE E ARIA CONDIZIONATA.

I

VALENTINA MASSA GILCHING

n tempi di cambiamento climatico e sostenibilità Green-G, divisione della Goriziane Holding Spa, è focalizzata sullo sviluppo di veicoli e sistemi elettrici. Tra questi ecarry, veicolo commerciale leggero completamente elettrico, sviluppato appositamente per le società di servizi e gli enti pubblici attivi nelle zone urbane. Le aree ideali di impiego includono i servizi di smaltimento dei rifiuti, le attività di giardinaggio, la logistica cittadina e le conse-

gne dell’ultimo miglio. Il veicolo ha all'incirca le dimensioni di un furgone convenzionale e quindi garantisce la massima manovrabilità. Questo light truck ha l’omologazione N1, pesa un massimo di 3,5 tonnellate e raggiunge la velocità di 80 chilometri all’ora. La versione standard dell’ecarry è dotata di una batteria al litio nichel manganese cobalto di Webasto da 35 kWh. L’ecarry premium funziona con due batterie dalla potenza totale di 70 kWh: in questa configurazione può percorrere oltre 250 chilometri senza bisogno di ricarica. “Vogliamo arricchire

Tra Goriziane e Webasto partnership all’insegna della tecnologia avanzata.

il mondo - ha dichiarato Alessandro Della Torre, Project Leader di Green-G - con soluzioni tecnologiche innovative che siano in armonia con la sostenibilità ecologica. Con Webasto abbiamo al nostro fianco un partner di altissimo livello nel settore delle batterie e della gestione termica”. Green-G si affida a Webasto anche per la tecnologia di climatizzazione della cabina dell’ecarry. Per riscaldare l’interno del veicolo è stato installato un riscaldatore elettrico ad alta tensione. Esso converte la corrente continua in calore con disper-

sione prossima allo zero. Un sistema di aria condizionata integrato nel veicolo fornisce il necessario raffreddamento dell’abitacolo dell’ecarry. Poiché tutte le funzioni associate alla gestione termica consumano generalmente molta energia, gli ingegneri di Webasto hanno sviluppato una speciale strategia di controllo per l’ecarry, che consente di risparmiare maggiore energia, anche in funzione delle condizioni meteorologiche. Il sistema di climatizzazione dell’ecarry è completato da un’unità di controllo, che regola tutti i dispositivi dell'HVAC (vento-

la, elettroventilatore, pompa di raffreddamento dell’acqua e dispositivi ad alta tensione) in base alla modalità di funzionamento richiesta in quel momento. “Non vediamo l’ora di accompagnare ulteriormente Green-G nel suo viaggio - afferma Manuel Kagelmann, Manager Product Management Batteries, Customized Solutions in Webasto - fornendo i nostri prodotti e i relativi pacchetti di servizi. Attraverso le informazioni che acquisiamo integrando i nostri prodotti nell’ecarry, possiamo reagire alle esigenze del mercato in modo ancora più flessibile. Questa collaborazione ci offre l’oppotunità di continuare a crescere nel mercato”.

THERMO KING / SOLUZIONI PER IL TRASPORTO REFRIGERATO ELETTRICO A DOMICILIO

Fino alla porta di casa, freschi e puliti

T

VALENTINA MASSA HELSINKI

hermo King, azienda lea der nelle soluzioni di controllo della temperatura per il trasporto e marchio di Trane Technologies, ha annunciato che A to B Finland Oy ha ampliato il suo parco veicoli per le consegne a domicilio con nuovi mezzi a emissioni zero completamente elettrici: si tratta di Mercedes-Benz eSprinter equipaggiati con l’unità di refrigerazione E200 e Peugeot E-Expert equipaggiati con l’unità B-100 ECO. L’unità E-200 dispone inoltre di un gruppo batterie agli ioni di litio di Thermo King per aumentare l'autonomia del veicolo e garantire il mantenimento della capacità durante le consegne. Nel corso dell’ultimo decennio, A2B è stata pioniera nel trasporto ecologico in Finlandia, offrendo un servizio di trasporto locale rispettoso dell’ambiente e privo di emissioni. Nell'ambito dei suoi sforzi più recenti per realizzare consegne totalmente prive di CO2, A2B ha aggiunto i nuovi furgoni elettrici Mercedes-Benz eSprinter e Peugeot EExpert al suo parco veicoli operante nell’area di Helsinki. Per garantire un ambiente a temperatura controllata nei veicoli e rafforzare il proprio impegno per la sostenibilità, A2B ha collaborato con Thermo King e il suo concessionario ufficiale per la Finlandia VTA Tekniikka. “Il nostro parco veicoli è interamente alimentato da combustibili rinnovabili, compresi i mezzi azionati con biogas prodotto dai rifiuti ed elettricità generata dall'energia eolica. In questo modo, ogni anno è

Pagina XIV

IL MARCHIO DI TRANE TECHNOLOGIES FIRMA LE UNITÀ DI REFRIGERAZIONE DEI NUOVI MEZZI A BATTERIA CHE ENTRERANNO IN SERVIZIO NELLA FLOTTA DI A TO B FINLAND OY PER LE CONSEGNE A DOMICILIO NELL’AREA DI HELSINKI: PER UN TRASPORTO A ZERO EMISSIONI EFFICIENTE FINO ALL’ULTIMO MIGLIO.

possibile risparmiare 400.000 chilogrammi di CO2 rispetto all’uso di veicoli diesel equivalenti. Con le nostre operazioni, stiamo dando un esempio di quel che è possibile fare in termini di lotta al cambiamento climatico e alle emissioni locali”,

ha dichiarato Tero Kakko, CEO di A2B Finland. “Abbiamo una profonda fiducia in Thermo King e VTA Tekniikka che, nel corso degli anni, ci hanno aiutato a ottenere un vantaggio competitivo con le loro soluzioni di refrigerazione sosteni-

bile e il loro servizio. È stata una decisione naturale per noi sfruttare i sistemi elettrici di Thermo King in questo nuovo progetto”. “La consegna a domicilio continua a espandersi e le tecnologie pulite sono fondamentali per affronta-

re le sfide ambientali e ridurre le perdite di alimenti e medicinali. Siamo orgogliosi di collaborare con aziende come A2B Finland e di creare una distribuzione a emissioni zero”, ha affermato Francesco Incalza, presidente di Thermo King in Europa, Medio Oriente e Africa. “Thermo King continua a far progredire l’elettrificazione del trasporto refrigerato per ridurre gli inquinanti, le emissioni e il rumore durante il trasporto delle merci lungo la catena del freddo. Continueremo a lavorare a stretto contatto con i nostri clienti per soddisfare le loro esigenze e sostenere i loro sforzi per trasporti e consegne sostenibili”. Furgoni elettrici come il Mercedes-Benz eSprinter, insieme a Thermo King E-200, soddisfano con sicurezza gli obiettivi di sostenibilità attuali e futuri. Essendo azionate da inverter, le unità E-200, a differenza delle tipiche soluzioni a trasmissione diretta progettate per i motori a combustione diesel, offrono una capacità costante e possono funzionare agevolmente con veicoli ad alimentazione elettrica. Il gruppo batterie agli ioni di litio sfrutta l’alimentazione brevettata delle unità E200, per minori consumi di energia, maggior autonomia del veicolo ed efficienza e affidabilità superiori. L’unità B-100 ECO di Thermo King è stata sviluppata per soddisfare il consumo energetico estremamente basso richiesto dai veicoli elettrici più piccoli come Peugeot E-Expert. La batteria ausiliaria standard da 12 V del veicolo elettrico è sufficiente per alimentare l’unità B-100 ECO e non sono necessarie batterie aggiuntive sul furgone elettrico.

N° 302 / Settembre 2021


DOPPIO ZE Z RO O ANTICIPO ZERO + T TA ASSO ZERO

3 ANNI

IN PIÙ DI MANUTENZIO ONE ORDINARIA

&

3° ANN NO

DI GARANZIA A ESTESA SULLA CAT TENA CINEMAT T TICA

I NCL USI N NEL PREZ ZZO! ZO! -P (EMP] YR´IZSPY^MSRI GLI cambierà la prospettiva al tuo o business 9RE RYSZE KEQQE HM QSXSVM TIV KIWXMVI PE XYE EXXMZMXk MR QSHS sostenibile s e SUR¼FXR 9R ambiente di lavoro TVSHYXXMZS I YRE WIVMI HM sistemi s di guida assistitaa TIV YR´IWTIVMIR^E GSQTPIXEQIRXIRYSZE9RRYSZSPMZIPPSHMconnettivitàGLIXMETVIYRQSRHSHMservizii personalizzati -P(EMP]rHEZZIVSPEWSPY^MSRIHMXVEWTSV XSTM€GSQTPIXEIWYQMWYVETIVMPXYSFYWMRIWW

CORRI IN CONC CESSIONARIA O CHIAMA SUB BITO IL NUMERO VERDE ! lun-ven 8-20 / sabato 8-12

IVECO. L’ IT TALIA CHE VINCE. 3JJIV XE ZEPMHE ½RS EP  WY XYXXE PE KEQQE (EMP] 1= *YVKKSRM I 'EFMREXM VYSXE WMRKSPE WY ZEPSVM HM JSVRMXYVE ½RS E º I WSKKIXXE E GSRHM^MSRM )WIQTMS HM JSVRMXYVE º PIEWMRK E  QIWM ERXMGMTS ^IVS ZEPSVI ½REPI HM VMWGEXXS   GERSRMQIRWMPMHEºGSQTVIRWMZMHM4SPM^^E*YV XSI-RGIRHMS8EWWS0IEWMRK 7TIWITVEXMGE-:%XVEWTSV XSIQIWWEWYWXVEHEIWGPYWI7EPZSETTVSZE^MSRI-:)'3'%4-8%0 '2,-RHYWXVMEP'ETMXEP)YVSTI7%7 4VMQEHMEHIVMVIIEP½RER^MEQIRXSrRIGIWWEVMS TVIIRHIVIZMWMSRIHIPPI'SRHM^MSRM'SRXVEXXYEPMIHIM*SKPMMRJSVQEXMZMHMWTSRMFMPMTVIIWWSPIGSRGIWWMSREVMIEHIVIRXM4SWWMFMPMXkHMTIVWSREPM^^EVIIP´SJJIV XEGSREPXVMMQTSV XMIHYVEXIHMVIIXXEQIRXIMRGSRGIWWMSREVME0´SJJIV XEGSQTVIRHIMPTEGGLIXXS00MJIHYVEXEQIWM TIVZIMGSPMGSRTIVGSVVIR^EERRYEQEWWMQEHMOQ STTYVIGSRQEWWMQSOQXSXEPM -PTEGGLIXXS0PMJIGSQTVIIRHIP´IWXIRWMSRIHMKEVER^MEEQIWMWYPPEGEXIREGMRIQEXMGEIQIWMHMQERYXIR^MSRIGSQITVIZMWXSHETMERSQERYXIRXMZS4IVMHIXXEKPM WYMGSRXIRYXMIWYPPIGSRHM^MSRMJEVIVMJIVMQIRXSEPGSRXVEXXSHMQERYXIR^MSRIIVMTEVE^MSRIVIITIVMFMPITVIWWSXYXXIPIGSRGIWWMSREVMIEHIVIIRXM-QQEKMRIETYVS SWGSTSMPPYWXVEXMZS1IWWEKKMSTYFFPMGMXEVMSGSR½REPMXkTVS SQS^MSREPM


Profile for Vega Editrice

Il Mondo dei Trasporti - Settembre 2021  

Il Mondo dei Trasporti - Settembre 2021  

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded