Page 1

Fiway / Telematica nel trasporto refrigerato: un team di giovani lancia Reyesol EvoBus / Trasparenza ed efficienza: Michele Maldini lancia la sua sfida nel TPL Vega Editrice - Monza, Italy - Anno XXIX - N. 284 / NOVEMBRE 2019 - Euro 5,00

IDLE I M ONDO T R A S P O RT I Mensile di Politica, Economia, Cultura e Tecnica del Trasporto - FONDATO

E DIRETTO DA

PAOLO ALTIERI

Intervista esclusiva al fondatore dell’azienda di Acquaviva delle Fonti

CON IFAC, AMODIO FA VINCERE IL SUD NATO IL 4 AGOSTO 1953, ANGELO AMODIO È DEL SEGNO ZODIACALE DEL LEONE E LO DIMOSTRA GIORNO PER GIORNO CON DEDIZIONE E DETERMINAZIONE, AL TIMONE DELL’AZIENDA CHE HA COSTRUITO DAL NULLA POCO MENO DI 40 ANNI FA E CHE OGGI È LEADER EUROPEO NEL SETTORE DEI FURGONI E KIT ISOTERMICI DISTRIBUITI IN TUTTO IL MONDO. IFAC È APPREZZATA PER L’ATTENZIONE ALLA TECNOLOGIA, L’INNOVAZIONE, LA CURA DEL DESIGN, LA QUALITÀ ELEVATISSIMA E LA MASSIMA CURA DEL CLIENTE.

Poste Italiane Spa -Spedizione in Abbonamento Postale - D.L. 353/2003 (conv. in L. 27/02/2004 N. 46) Art.1, comma 1, DCB Milano

Paolo Altieri a pagina 2

FRAIKIN / Dieci trattori a DLM Coop, operativa nei liquidi industriali

LEIBALLI & CUZZUOL / La concessionaria del Grifone è sempre più dinamica

IL NOLEGGIO VARCA UN’ALTRA FRONTIERA

GRIGOLIN TRASPORTI CRESCE CON SCANIA

I

trattori con portacontainer vanno e vengono nell’hub di Solero: scaricano gli e nor mi tank cisterne che iniziano il loro viaggio per lo scarico, la pulizia, il ripristino e il collaudo finale. Intanto i prodotti finali vengono depositati in attesa di iniziare il loro viaggio verso la destinazione finale, su gomma o su nave. Siamo alle porte di Alessandria; sembra di essere all’interno della stiva di un’imbarcazione in continuo movimento, nella quale non si

MERBAG

smette mai di lavorare, con merce che va e che viene. Eppure siamo nella sede principale della Cooperativa DLM, acronimo dedicato a Don Luigi Merola, famoso prete anticamorra. Arrivano anche dieci trattori a noleggio, consegnati da Fraikin Italia, filiale italiana del leader europeo nel noleggio di veicoli industriali.

VIBERTI RIMORCHI

Servizio da pagina 38

MAN CENTER

La Stella brilla su Lainate Il City per Dorica Express Il Leone di Rescaldina

Campanella da pagina 8

Servizio a pagina 42

Servizio da pagina 16

N

ello sguardo, nelle parole, semplici come semplice è la gente del posto, dei fratelli Luciano Antonio e Giorgio Grigolin ritroviamo la genuinità di chi nel lavoro mette da sempre anima e corpo. Di chi nelle difficoltà non si è tirato indietro, determinato a portare avanti quello che il padre ha iniziato. La forza di Autotrasporti Grigolin è tutta qui, nel l’innata capacità di darsi da fare, unita all’intuizione di trovare nuove strade quando il

REALTRAILER

trend del mercato lo richiede. Nell’unità della famiglia, ieri come oggi. E, non da ultimo, nell’avere accanto partner che credono in questa forza, come Leiballi & Cuzzuol, Concessionaria Scania con cui il rapporto risale ad Antonio Cuzzuol, uno dei tre fondatori, ed è proseguito con il figlio Claudio per continuare, oggi, con il nipote Adriano.

DIESEL TECHNIC

Offensiva Emmeffedi Car I clienti in primo piano

Servizio a pagina 54

Servizio a pagina 34

Basilico a pagina 50

Allegato inserto sul mondo dei veicoli commerciali


Pagina 2

IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

INTERVISTA ESCLUSIVA

ANGELO AMODIO LA GRANDE AVVENTURA DEL FONDATORE DI IFAC LEADER NEI FURGONI E KIT ISOTERMICI

Il Leone ruggisce sempre NATO IL 4 AGOSTO 1953, ANGELO AMODIO È DEL SEGNO ZODIACALE DEL LEONE E LO DIMOSTRA GIORNO PER GIORNO CON DEDIZIONE E DETERMINAZIONE, AL TIMONE DELL’AZIENDA CHE HA COSTRUITO DAL NULLA POCO MENO DI 40 ANNI FA E CHE OGGI È LEADER EUROPEO NEL SETTORE DEI FURGONI E KIT ISOTERMICI DISTRIBUITI IN TUTTO IL MONDO. IFAC È APPREZZATA PER L’ATTENZIONE ALLA TECNOLOGIA, L’INNOVAZIONE, LA CURA DEL DESIGN, LA QUALITÀ ELEVATISSIMA E LA MASSIMA CURA DEL CLIENTE, TUTTI ELEMENTI CHE SONO ALLA BASE DELLA CONTINUA CRESCITA E DEL SUCCESSO IFAC.

A

ngelo Amodio è un uomo di poche parole, abituato com’è a lavorare sodo e a concretizzare sempre nuove idee e iniziative. È merito suo, e dell’efficiente team che guida come Amministratore unico, a cominciare dai figli Giusi e Vito, rispettivamente responsabile amministrativo e responsabile commerciale, se IFAC Spa è oggi un’azienda leader europea nel settore dei furgoni e kit isotermici. IFAC, acronimo di Impianti Frigoriferi Amodio Castellana, è un’eccellenza made in Sud che testimonia al meglio quali siano le capacità imprenditoriali che il Meridione d’Italia è in grado di esprimere a livello nazionale e internazionale. Nato il 4 agosto 1953, Angelo Amodio è del segno zodiacale del Leone e lo dimostra giorno per giorno con dedizione e determinazione, al timone dell’azienda che ha costruito dal nulla poco meno di 40 anni fa e che ha sede centrale e stabilimento in località Acquaviva delle Fonti, in provincia di Bari. “IFAC è stata fondata nel 1981 a

di PAOLO ALTIERI

ACQUAVIVA DELLE FONTI

Uno dei clienti più importanti della IFAC è la brianzola Brivio & Viganò, cui l’azienda pugliese ha consegnato ben trentadue motrici in meno di nove mesi. Una commessa importante che testimonia l’elevata qualità del prodotto firmato IFAC.

Castellana Grotte, in provincia di Bari, e successivamente si è trasferita a Conversano - esordisce Angelo Amodio - Nel 2007 abbiamo costruito il nuovo stabilimento di Acquaviva delle Fonti con l’acquisizione di impianti di ultima generazione e sistemi robotizzati per un’estensione di 30mila mq coperti e altri 30mila mq di parcheggio esterno”. Arrivati ad Acquaviva del le Fonti è impossibile non notare il quartier generale del la IFAC, che solo come di mensioni ben rappresenta la forza e il valore dell’azienda pugliese, che sul mercato italiano ed estero è conosciuta e apprezzata per l’attenzione alla tecnologia, l’innovazione, la cura del design, la qualità elevatissima e la massima cura del cliente. IFAC è anche attenzione all’ambiente, al sociale e alle proprie risorse umane. “Quella attuale è il terzo stabilimento che ho creato, sempre più in grande - continua Angelo Amodio - In tutte e tre le volte sentivo di realizzare il sogno che avevo da ragazzo, quello di


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

avere a zienda di livello come IFAC. Posso quindi dire di essere un uomo soddisfatto del proprio lavoro, che, insieme alla famiglia, rappresenta la mia vera passione. Produciamo furgoni isotermici e kit semilavorati per clienti in diverse parti del mondo, perfino in Australia e Nuova Zelanda. Il portfolio prodotti va dal piccolo furgone alle motrici fino al semirimorchio, anche se quest’ultima tipologia rappresenta meno del 10 per cento del totale. Il nostro range va dai 3 ai 10 metri, la fascia media. Curiamo anche tutta la distribuzione dei nostri prodotti e vantiamo clienti di piccole, medie e grandi dimensioni. Uno dei nostri ultimi clienti più importanti è la brianzola Brivio & Viganò, a cui abbiamo con segnato 32 motrici in meno di nove mesi”. “L’azienda l’ho creata che avevo 26 anni - aggiunge A modio - Provenendo da un’esperienza da riparatore di gruppi frigoriferi. sono arrivato a costruire gruppi frigoriferi, quindi coibentazioni e successivamente furgoni isotermici. Un percorso lungo fatto di tanti anni di lavoro, sacrifici e buona volontà. Grazie all’aiuto dei miei figli e di tutti i collaboratori, che oggi sono ben 120 con età media di 40 anni, siamo arrivati a una realtà industriale solida e proiettata al futuro. Abbiamo creato tutto dal nul la: qui da noi e in tutto il Sud non esistevano competitor da cui potevamo imparare. L’attività ce la siamo inventata da zero, costruendo la specializzazione in furgoni isotermici. Quando nel 1988 siamo diventati concessionaria Thermo King per il Sud Italia abbiamo lasciato la produzione di gruppi frigoriferi e ci siamo concentrati sulla furgonatura isotermica, creando la Tecnofrigo srl.”. I punti di forza dei prodotti IFAC sono tecnologia, progettazione e design. “I pannelli isotermici IFAC sono frutto di anni di esperienza, ricerca e sviluppo spiega Amodio - Vengono prodotti utilizzando materiali High Performance, resine LSC (Low Styrene Content), applicando il metodo wet on wet, una tecnologia che conferisce ai pannelli grossi vantaggi: il 15 per cento in più d’isolamento termico, ideale in multi temperatura poiché non conduttore; altamente resistente agli impatti; facile ed economico da ripara-

re; assenza di metallo che evita il rischio di corrosione; impermeabilità all’acqua e al vapore; completa realizzazione in fibra di vetro e poliuretano”. Tutte le realizzazioni IFAC si contraddistinguono anche per l’utilizzo del sistema di progettazione Solidworks, un software altamente sofisticato, ideale per integrare le differenti fasi del processo di calcolo del furgone, con l’utilizzo di materiali d’avanguardia con elevate caratteristiche strutturali. “Il nostro obiettivo è il perfetto connubio tra funzione e stile, rigorosamente made in Italy - dice ancora Angelo Amodio - Le nostre sono soluzioni studiate su mi sura. Ogni richiesta da parte del cliente trova la risposta vincente grazie a un team specializzato che, in

Pagina 3 tut te le fasi del progetto, tiene conto di ogni minimo dettaglio fino ad arrivare a una soluzione semplice ed efficace”. Con una produzione di circa 1.300 furgoni all’anno, IFAC è una realtà industriale di tutto rispetto. “Siamo maniacali nella cura dei dettagli, nell’attenzione riservata al cliente, nella qualità - continua orgoglioso Amodio - Il settore della carrozzeria isotermica è una nicchia ma IFAC è riuscita a ricavarsi un ruolo internazionale di rilievo grazie alla qualità, all’impegno e alla cura del cliente. Dal nostro stabilimento escono veicoli completi di tutto, pronti per il lavoro. Solo in determinati mercati forniamo semilavorati o furgoni direttamente

contribuisce a una crescita economica sostenibile, che sia vantaggiosa per l’a zienda, i clienti e la società in generale. L’azienda si impegna, infatti, ad assicurare, quotidianamente, lungo tutta la filiera produttiva, la best practice in tema di tutela dell’ambiente e dei lavoratori, e di sicurezza del consumatore. I valori di rispetto etico e responsabilità sociale da sempre fanno parte della filosofia IFAC. “I momenti critici non sono mancati, ma li abbiamo superati con la determinazione, l’impegno e anche un pizzico di fortuna - ricorda Angelo Amodio - Gli anni tra 2007 e 2015 sono stati particolarmente difficili per le aziende del no-

al carrozziere e non al cliente finale. L’assistenza ai furgoni si avvale della collaborazione di officine indipendenti mentre per i gruppi frigo il riferimento è la rete Thermo King”. IFAC si avvale della part nership di altre due aziende del Gruppo, per conferire il massimo servizio nell’ambito dell’isotermia: Tecnofrigo Srl, dealer Thermo King per vendita e assistenza, e Tecnorent per il noleggio di furgoni isotermici. L’intero Gruppo

stro comparto. Il nostro fatturato è arrivato anche a ridursi del 50 per cento. Abbiamo tenuto duro fino a quando abbiamo iniziato a vedere la luce alla fine del tunnel, con il rilancio iniziato nel 2015. Per l’anno in corso prevediamo una chiusura positiva, in leggera crescita rispetto al 2018. Il fatturato dovrebbe attestarsi intorno ai 20 milioni di euro”. Nel corso degli anni alla IFAC non sono mai mancati gli investimenti, compreso il recente stanziamento di fondi (5 milioni di euro) per l’ampliamento del reparto produzione che sarà pronto l’anno prossimo e che porterà la pro duzione totale a circa 2.000 pezzi annui. “Per il futuro - conclude Angelo Amodio - mi aspetto di continuare a fare quello che faccio oggi. Crescere progressivamente, passo dopo passo: è questo ciò in cui credo. Noi lavoriamo con i concessionari, sono a loro che i clienti chiedono esplicitamente un prodotto IFAC. Questo vuol dire che il nostro è un prodotto di qualità apprezzato dai professionisti. E dobbiamo essere orgogliosi delle nostre capacità per vincere il pregiudizio sul Sud improduttivo. Da meno di un anno la nostra attività commerciale si è ampliata anche al nord Italia do ve stiamo ottenendo ottimi riscontri”. Una sfida che la famiglia Amodio e il suo team è come sempre intenzionata a vincere. Due numeri stanno a confermarlo: dal 1981 IFAC ha prodotto e venduto un milione di metri quadri di pannelli e ben 50.000 furgoni.

La produzione IFAC comprende soprattutto piccole e medie furgonature, oltre a kit di montaggio per i mercati esteri.

Angelo Amodio con i figli Giusi e Vito entrambi colonne dell’azienda avviata ai 40 anni di attività.


IL MONDO DEI TRASPORTI

Pagina 4

N° 284 / Novembre 2019

ANTEO / LA SPONDA RETRATTILE FUTURA ALLA QUARTA GENERAZIONE

Più leggera, robusta e compatta

P

LINO SINARI MOLINELLA

iù leggera, più robusta e più compatta che mai. Presentata al Transpotec 2019, la novità di quest’anno nella famiglia di sponde Anteo è la nuova retrattile Futura 4, frutto di una progettazione del Reparto Ricerca & Svi luppo del produttore di Molinella, alle porte di Bologna, che la rende più veloce nell’installazione e con spazi di montaggio più ridotti rispetto alla precedente generazione F3. La quarta generazione della retrattile Anteo è pensata per i professionisti che esigono facilità d’installazione e ridotto spazio per il montaggio, senza però rinunciare alle caratteristiche di robustezza, in modo da impiegare la sponda per ogni applicazione di caricoscarico. Le capacità di carico sono pari a 1.700 kg e 2.200 kg con baricentro a 600 mm oppure 1.500 kg e 2.000 kg con baricentro a 750 mm. “I nuovi profili e il design migliorato - spiega Ilmer Maietti, Direttore Generale Anteo -hanno permesso di ridurre lo spazio di montaggio di almeno 130 mm rispetto alle sue sorelle F3 con scorrimento cro mato. Le staffe di montaggio sono pre forate in modo da facilitarne e velocizzarne l’installazione sulla maggior parte dei telai a C. Il gruppo principale, invece, viene fornito con manicotti e gruppo motore idraulico pre assemblati. Tutto ciò permette un’installazione della sponda montacarichi in tempi veramente molto brevi”.

PRESENTATA AL TRANSPOTEC, LA NUOVA F4 SBARCA SUL MERCATO DOPO SEVERISSIMI TEST EFFETTUATI DAL

CENTRO RICERCA & SVILUPPO DI MOLINELLA, IMPIANTO IN CUI VIENE REALIZZATA CON L’IMPIEGO DI COMPONENTISTICA DI ALTISSIMA QUALITÀ.

“PERMETTE UN’INSTALLAZIONE FACILE E IN TEMPI MOLTO BREVI, SENZA RINUNCIARE ALLE CARATTERISTICHE DI AFFIDABILITÀ E DURABILITÀ”, AFFERMA

ILMER MAIETTI, DIRETTORE GENERALE.

Anteo, conosciuta in tutto il mondo come produttore di sponde montacarichi di gamma premium, rinomata in particolare per la sua gamma retrattile, oggi con la quarta generazione della linea Futura ha una tra le più vaste gamme di sponde sotto telaio, rispondendo a necessità di professionisti del trasporto di ogni dimensione, sia che utilizzino vei-

coli commerciali leggeri sia che abbiano mezzi di grande portata. “Anteo - precisa Maietti - produce la più vasta gamma di sponde montacarichi, con 130 modelli e oltre 30mila differenti configurazioni. Anche la nuova Futura 4 risponde alle rigide specifiche Anteo”. Anche l’ultima nata, prima dello sbarco sul mercato ha dovuto rispondere in

modo più che affidabile agli stressanti test (oltre 50mila) cui è stata sottoposta. “Questo è stato possibile - aggiunge il Direttore Generale - anche grazie a una speciale lega realizzata su nostre specifiche e basata su un design del pianale, messo a punto dopo anni di esperienza dal reparto Ricerca & Sviluppo. Oltre a tutto questo vi sono altri fattori che rendono la

sponda Anteo altamente affidabile e duratura nel tempo: una costante ricerca di nuove tecnologie costruttive robotizzate, l’integrazione di sistemi progettuali e produttivi e la continua attenzione alla sicurezza delle persone e delle merci”. La nuova F4, come tutte le sponde Anteo, è prodotta interamente in Italia, nello stabilimento di Molinella.

IL MONDO DEI TRASPORTI

Mensile di Politica, Economia, Cultura e Tecnica del Trasporto Direttore responsabile Paolo Altieri - paolo.altieri@vegaeditrice.it

Comitato di Redazione Fabio Basilico - f.basilico@vegaeditrice.it Max Campanella - m.campanella@ vegaeditrice.it Direzione, redazione e amministrazione Via Ramazzotti 20 - 20900 Monza Tel. +39.039.493101 - info@vegaeditrice.it www.ilmondodeitrasporti.com Sede Legale Via Stresa 15 - 20125 Milano Editore Vega Editrice Presidente Luisella Crobu Vice Presidente Michele Stefano Altieri Direttore editoriale Cristina Altieri Condirettore editoriale Vincenzo Lasalvia Pubblicità Vega Editrice srl: Via Ramazzotti 20 - 20900 Monza Tel. +39.039.493101 - Fax +39.039.493103 Promozione Piero Ferrari Impaginazione e Fotocomposizione Varano, Busto Garolfo (Milano) Stampa Reggiani spa, Brezzo di Bedero (VA) Il Mondo dei Trasporti è registrato presso il Tribunale di Milano numero 327 del 4/5/1991 - Abbonamento annuo: Italia Euro 50,00, estero: Euro 150,00 - Banca d’appoggio: UniCredit Banca - Agenzia Muggiò; Codice IBAN: IT 21 V 02008 33430 000041141143 - Monte dei Paschi di Siena - Agenzia 5 Milano; Codice IBAN: IT 51 K 01030 01605 000000212676 Poste Italiane Spa - Sped. in Abbonamento Postale - D.L. 353/2003 (conv. in L. 27/02/2004 N. 46) Art.1, comma 1, DCB Milano - Distribuzione GE.MA Srl: Burago di Molgora (MB).

La quarta generazione della sponda retrattile Anteo Futura, robusta e più facile da installare.

“La produzione Anteo - aggiunge Maietti - prevede l’impiego di componentistica di altissima qualità, fornita da aziende che producono particolari a disegno e specifiche Anteo. La nuova sponda è già stata apprezzata in oltre 56 paesi in tut to il mondo e sta trovando sul mercato nazionale un riscontro veramente positivo”.


NIENTE PUÒ FER RMARMI (SSoloo una buona raagiionne)

DRIVE THE NEW WA WAY. PIÙ COMFORT, PIÙ CONNETTIVITÀ, PIÙ SERVIZI DI SE CON IVECO S-W WA AY NIENTE POTRÀ FERMARTI. Un po’ di riposo, un buon piatto caldo, un caffè al volo e, naturalmente, un bel tramonto da ammirare lungo la strada.. Nient’altro potrà interrompere il tuo viaggio. Siamo orgogliosi di presentare IVECO S-W WAY, il camion più confortevole e connesso che abbiamo mai progettato. Un ffedele edele compagno com mpagno di ZMEKKMSGLIWEVkEPXYS½ERGSMRSKRMSGGEWMSRIIHSZYRUYIHSZVEMERHEVI


IL MONDO DEI TRASPORTI

Pagina 6

N° 284 / Novembre 2019

DAF / INCORONATI “TOP DELL’ANNO” IL MEDIO LF E IL CF CONSTRUCTION

Trionfo olandese in Cechia

I VEICOLI DEL COSTRUTTORE DI EINDHOVEN PREMIATI RISPETTIVAMENTE PER DESIGN, VISIBILITÀ E BASSI COSTI DI GESTIONE LF HA LA MIGLIOR OFFERTA DEL SEGMENTO, CF È PRONTO PER AFFRONTARE QUALSIASI SFIDA”, HA DICHIARATO MICHAL STENGL, EDITORE DELLA RIVISTA “TRANSPORT A LOGISTIKA” E PRESIDENTE DELLA GIURIA. “VALIDA RICONOSCENZA DEL MERCATO”, HA COMMENTATO RICHARD ZINK, DIRETTORE MARKETING & VENDITE DAF TRUCKS.

E ROBUSTEZZA E LEGGEREZZA. “LA SERIE

L

Il premio Top Czech Transport 2019 è un’iniziativa della rivista “Transport a Logistika” e delle tre associazioni ceche Cesmad Bohemia, Svaz Spedice a Logistiky CR e Ceská Logistická Asociace. “DAF ha dichiarato Michal Stengl, editore della rivista “Transport a Logistika” e Presidente della giuria - ha già convinto in passato i trasportatori sull’essere in grado di costruire i migliori trattori stradali disponibili sul mercato. Oggi, con la serie LF e con la serie CF Construction ha dimostrato

MICHELE S. ALTIERI EINDHOVEN

a serie DAF LF è stata incoronata “Top Truck of the Year” in Repubblica Ceca. Operatori e autisti hanno identificato il DAF LF come il miglior veicolo medio per la distribuzione, grazie a eccellente design, ottima visibilità e bassi costi di gestione. In aggiunta, DAF CF Construction è stato premiato “Top Construction Truck of the Year” per robustezza, elevata portata e bassi costi di gestione.

anche la propria posizione leader in altri segmenti di mercato. DAF LF fornisce la miglior offerta nel segmento dei veicoli medi, progettati per fornire servizi di trasporto urbano e per servizi municipali. Offre un’eccellente visuale dalla cabina, il minor diametro di sterzata del mercato e un design decisamente robusto grazie anche ai paraurti in acciaio. L’ampia offerta di combinazioni tra motori e trasmissioni e la sua elevata portata rendono la serie LF la miglior scelta per ogni applicazione”. Pronto per affrontare ogni sfida il modello della Casa olandese che compete nel segmento del cava-cantiere. “L’industria della Repubblica Ceca - ha proseguito Stengl - ha una chiara opinione su chi sia il vincitore tra i veicoli del settore delle costruzioni: CF Construction è robusto e pronto ad affrontare ogni sfida in condizioni dure, pur rimanendo estremamente leggero per garantire una grande portata. In aggiunta, i nuovi si stemi di controllo, i potenti motori e gli assali a elevata escursione assicurano un’ottima dinamica di guida nell’off-road”. Naturalmente i due premi hanno riempito di soddisfazione il management DAF Trucks, società sussidiaria della compagnia americana Paccar. “È strabiliante - ha commentato Richard Zink, Direttore Marketing & Vendite DAF Trucks - aver vinto due premi di Miglior Camion Dell’Anno in un colpo solo. Questo ci rende molto fieri e orgogliosi del nostro lavoro. I premi sono il risultato della validità dei nostri prodotti, riconosciuta da un numeroso gruppo di operatori ed esperti del settore. Questi riconoscimenti sottolineano il fatto che i nostri veicoli medi, pesanti e del settore costruzioni sono allo stesso livello di eccellenza dei nostri trattori stradali: molto efficienti, estremamente affidabili e confortevoli”.

Presentato in esclusiva a Kortrijk il nuovo modello FAW

Per il settore costruzioni trazione eccellente e servizi dedicati

P

resentato in esclusiva mondiale a Matexpo, mostra biennale dell’edilizia e costruzioni tenutasi alla fiera di Kortrijk, in Belgio, con il modello CF FAW 8x4, adatto per una grande varietà di applicazioni, DAF dimostra la propria capacità di fornire servizi personalizzati anche al settore delle costruzioni. Il nuovo veicolo era esposto nel Salone belga accanto a un LF Construction 19 t per servizi locali e regionali e, per il trasporto pesante, a un esemplare dell’ammiraglia XF con cabina Super Space. Il nuovo modello FAW disponibile per CF e XF monta un gruppo assali tri-

dem composto da un tandem motore, per avere una trazione eccellente sui terreni difficili, e un assale trascinato sterzante, per ottenere un diametro minimo di sterzata di 15,6 metri e una manovrabilità al top per il tipo di veicolo. Il telaio, inoltre, si presta ottimamente per allestimenti di cassoni ribaltabili, betoniere e ganci scarrabili. “Con una quota di mercato del 20 per cento - afferma Richard Zink, Direttore Sales & Marketing DAF Trucks DAF è primo costruttore europeo nel segmento dei trattori stradali. Abbiamo anche la miglior offerta nel settore delle costruzioni: DAF è in

grado di fornire una vasta gamma di macchine per ogni applicazione. Il nuovo modello FAW è testimone della nostra ambizione a crescere nel mercato del settore costruzioni. Con lo scopo di fornire la miglior offerta commerciale, DAF fornisce anche servizi specifici per questo settore”. Tra questi i contratti di riparazione e manutenzione DAF Multi Support, che offrono “Pacchetti Uptime”, che forniscono una disponibilità garantita della macchina durante il proprio ciclo di vita utile. In aggiunta, DAF Academy eroga training specifici per gli autisti del settore costruzioni.


Pagina 8

IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

MERBAG / DUE GIORNATE DI FESTA NELLA SEDE DELLA CONCESSIONARIA MERCEDES-BENZ

La Stella illumina Lainate IL DEALER LOMBARDO HA RINNOVATO L’APPUNTAMENTO ANNUALE CON L’OPEN

WEEKEND. NOVITÀ DEL 2019 UNA FLOTTA DI HARLEY DAVIDSON DISPONIBILI PER UN TEST DRIVE.

PROVE SU

STRADA CON L’AMMIRAGLIA ACTROS, CON L’UNIMOG E L’INTERA GAMMA DEI

VANS. “UN EVENTO NON ESCLUSIVAMENTE COMMERCIALE: DIAMO A CLIENTI E PARTNER L’OCCASIONE DI TRASCORRERE QUALCHE MOMENTO CON NOI IN ASSOLUTA SPENSIERATEZZA”,

CARLO SOMMARIVA,

AFFERMA

I

MAX CAMPANELLA LAINATE

l nuovo Actros accoglie i visitatori subito all’arrivo, varcato il cancello principale dell’ingresso nella sede di Lainate: in fila, una serie di unità della nuova ammiraglia Mercedes-Benz danno l’idea di essere in uno dei punti di riferimento della Casa della Stella in Italia. Poco distanti, la conferma arriva dai Fuso Canter e dalla gamma Mercedes-Benz Vans, presente con tutti i suoi gioielli Sprinter, Vi to, Citan passando per Classe V, Classe X e Marco Polo per gli amanti dell’avventura. Tra una flotta e l’altra, un’esposizione di allestitori ci accompagna per l’intero piazzale, terminando con i giochi gonfiabili, i salterelli, le Harley Davidson e infine la cucina tipica. Siamo alla Merbag, dove è di casa l’ospitalità oltre che la passione per il trasporto. Dopo l’esordio dell’anno scorso, la Concessionaria

Carlo Sommariva, Responsabile Vendite smart e Responsabile Marketing di Merbag Italia.

Mercedes-Benz ha rinnovato quest’anno l’appuntamento con l’Open Weekend, una due-giorni organizzata per toccare con la mano le ultime novità della Stella. In primis il nuovo Actros, con le impareggiabili mirrorcam al posto degli specchietti e una tecnologia di bordo che supera ogni rosea previsione per chi non è mai salito a bordo della nuova ammiraglia di Stoccarda: con il PPC, oggi il camion si guida da solo, tenendo costante la velocità prevista dalle norme stradali, tenendo il veicolo in corsia, a debita distanza da chi precede; il tutto senza mai dimenticare all’autista che le mani vanno te nute sul volante perché è lui, e lo sarà a lungo, a tenere il controllo del mezzo. Scesi dall’Actros si sale sull’Unimog, sinonimo di sicurezza, eccellenza e brillanti prestazioni su strada e fuoristrada. Ma Merbag è anche Mercedes-Benz Vans, quindi immancabile la gamma media, rinnovata l’anno scorso: Clas-

se V, shuttle vip per chi desidera un veicolo di lusso, facile da guidare e confortevole per i passeggeri, e Vito, disponibile anche a trazione elettrica. Merbag ha dato la possibilità a clienti e appassionati di effettuare un test drive sull’intera gamma, com preso il furgone grande Sprinter, lanciato l’anno scorso nell’attuale generazione. Tante le attrazioni per i piccoli visitatori: come da tradizione svizzera, l’Open Weekend di Merbag è un evento per le famiglie, quindi non possono mancare giochi, truccabimbi e un’area espositiva interamente dedicata al Marco Polo con la possibilità per i più piccoli di giocare all’aperto. Per papà (e mam ma), un giro in moto grazie allo stand di Harley-Davidson Gate32 Milano. Per terminare con un buffet a base di prodotti tipici. Il tutto inframmezzato dal concorso a premi, con “gratta e vinci” e in palio weekend al mare, telefoni cellulari, videocamera e

RESPONSABILE MARKETING DI MERBAG IN ITALIA.

scooter elettrici. Accompagnati da Oliver Marinkovic, Direttore Vendite Veicoli Commerciali e Industriali Merbag Italia, abbiamo visitato la carrozzeria di Lainate, con i suoi spot repair, la tirabolli e nanotecnologie per il parabrezza. “La nostra carrozzeria - spiega Marinkovic - è la più grande in Italia ed è stata concepita e realizzata per fornire la migliore qualità, grazie a un team specializzato: le risorse umane sono la forza di Merbag”. Quella dell’Open Weekend è una tradizione profondamente radicata in Merbag, società svizzera con una storia che risale al 1912. “La logica dell’Open Weekend - spiega Carlo Sommariva, in Mercedes-Benz dal 2006, dal 2016 Responsabile Vendite smart e, da Settembre 2017, Responsabile Marketing di Merbag in Italia - non è solamente commerciale: l’intento è quello di realizzare un momento conviviale con clienti e partner, accompagnati dalle

Oliver Marinkovic (a sinistra), Direttore Vendite Veicoli Commerciali e Industriali Merbag Italia, e Fabio Migliore, Direttore Tecnico Fraikin Italia.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

loro famiglie, ritrovarsi una volta l’anno per toccare con mano le ultime novità di prodotto, con l’obiettivo di stare bene insieme e, perché no, di u sufruire delle promozioni pen sate appositamente per l’occasione”. Il pacchetto completo di “esposizione-festa” funziona, trova l’apprezzamento delle famiglie, che trascorrono in Merbag qualche ora in assolu-

ta spensieratezza. “In questo evento - prosegue Sommariva - coinvolgiamo diversi allestitori con i quali abbiamo una partnership consolidata. A loro chiediamo la stessa logica: mettere in secondo piano per due giorni la motivazione commerciale e, nello spirito di un mondo al servizio del cliente, creare per quest’ultimo un clima che lo faccia sentire bene e a suo agio”.

Qual è la “chiave di differenza” con cui Merbag si propone sul mercato italiano? “Merbag - afferma Sommariva - è un’azienda svizzera e come tale intende raggiungere il livello più elevato in termini di valori riconosciuti al mondo svizzero: qualità, puntualità, attenzione ai dettagli. Il tutto accompagnato dalle caratteristiche del servizio Mercedes: accanto a un valo-

re del prodotto riconosciuto ai massimi livelli, cortesia nell’accoglienza da parte di chi lavora e qualità nel livello del servizio”. Quali sono, oggi, i punti di forza con i quali MercedesBenz si posiziona sul mercato italiano? “Da sempre - risponde il Responsabile Marketing Merbag Italia - Mercedes-Benz è marchio riconosciuto per l’attenzione alla si-

Pagina 9

curezza. Oggi questo valore è estremizzato nel nuovo Actros, la cui tecnologia a bordo è sviluppata per la sicurezza di chi trasporta e degli altri utenti della strada. Actros integra tecnologie quasi fantascientifiche per ridurre i rischi d’incidenti oltre che per limitare i consumi. Stesso con cetto viene applicato al nuovo Sprinter: lo immagino al servizio dei corrieri, sempre costretti al telefono; ebbene oggi possono raggiungere la loro destinazione senza usare il telefono e potendosi concentrare sulla guida. Oggi, confermando le doti di motore e affidabilità dei mezzi, Mercedes la differenza la fa con la tecnologia che migliora la vita lavorativa delle persone”. Lo spirito del “momento piacevole” per sé e la famiglia è stato condiviso da tanti clienti, tra i quali abbiamo incrociato Fraikin Italia, leader nel noleggio di veicoli industriali: Fabio Migliore, Diret-

tore Tecnico, era presente con il figlio Francesco, 10 anni. “Con Merbag - afferma Migliore - abbiamo un rapporto che va al di là del cliente-fornitore: per Fraikin Merbag è l’espressione di MercedesBenz in tutti i suoi aspetti, a 360 gradi. Inoltre, è prezioso il loro lavoro di consulenza nella definizione dei veicoli necessari alle esigenze della nostra flotta”. Una vicinanza tra le due aziende figlia anche della prossimità tra le due sedi, che distano tra loro meno di dieci chilometri. “Tra i progetti che ci vedono insieme - conclude Migliore quello più recente riguarda il settore dell’ecologia, con l’allestimento di Fuso Canter specifici per questo segmento. Un progetto che vogliamo estendere a tutta la gamma Mercedes: faremo motrici e allestimenti su base Antos e Actros per i pesanti stradali e su Vito e Sprinter per la componente di veicoli commerciali”.

Una gru svetta da un Atego, un Actros con ribaltabile e il condizionatore da parcheggio

T

Riconferma per Fassi e Cantoni, debutto di Dometic

ra i partner dell’Open Weekend 2019 di Merbag a Lainate, Fassi Gru Milano ha confermato la propria presenza con una Fassi F85A023 a quattro stabilizzatori montata su motrice Mercedes-Benz Atego e cassone fisso da 100 q. “Si tratta - spiega Mauro Moschi di Fassi Gru Milano - di un veicolo adatto per materiali edili, utilizzato per il carico-scarico merci, nel caso specifico di piastrelle. Pur essendo una gru leggera, è adatta anche per carichi pesanti ed è disponibile anche con radiocomando”. La partnership con Merbag è oltremodo facilitata dalla vicinanza tra le due sedi: quella di Fassi Gru Milano è ubicata a Lainate, praticamente

nei pressi di Merbag. “La collaborazione con Mercedes-Benz afferma Moschi - è storica, basata su tanti prodotti che vengono equipaggiati con le gru Fassi. Con l’arrivo di Merbag stiamo proseguendo la collaborazione se possibile implementandola, soprattutto alla luce di un approccio alla clientela basato sullo sviluppo di veicoli adhoc, specifici per le necessità del professionista”. All’interno, subito accanto alla reception, ecco spuntare il corner di Dometic, con un climatizzatore per camion montato sul tetto. “Il nostro punto di forza - spiega Paolo Gilli, Sales Manager Commercial & Passenger Vehicles Dometic Italy è rappresentato dai climatizzatori da parcheggio dal consumo

Andrea Cantoni, Responsabile Commerciale dell’omonima azienda di Boffalora sopra Ticino.

Mauro Moschi di Fassi Gru Milano.

molto basso. Il modello esposto funziona, a motore spento, fino a 12 ore, consentendo il raffreddamento di notte per il riposo o di giorno durante le soste, ad esempio nei piazzali di caricoscarico. Il modello è perfettamente adatto al nuovo Actros ed è certificato ADR per il trasporto di merci pericolose”. Produttore anche di telecamere, grazie alla partnership con MercedesBenz e al rapporto diretto con Merbag Dometic ha sviluppato un prodotto che s’interfaccia con i monitor di bordo dei veicoli della Stella senza dover installare monitor aggiuntivi, con meno costi e plancia integra. Nella gamma, anche i frigo portatili delle dimensioni giuste per essere posizionati tra i sedili del Vito e la linea di inverter per avere a bordo la tanto richiesta

tensione a 230 V. Con sede centrale in Svezia, magazzino europeo centralizzato e centro Ricerca & Sviluppo nei pressi di Münster, in Germania, Dometic conta 57 siti produttivi nel mondo, 6mila dipendenti e un fatturato globale di 1,7 miliardi di euro. La filiale italiana, con sede a Forlì e 30 distributori, ha chiuso il 2018 con un fatturato di circa 25 milioni complessivi. Torniamo all’esterno e, tra i veicoli, due Mercedes-Benz Sprinter e altrettanti Fuso Canter sono allestiti con ribaltabile Cantoni, che al suo corner sul piazzale espone anche un nuovo Actros 8x4 con ribaltabile posteriore a vasca tonda da 18 mc. “Si tratta - spiega Andrea Cantoni, Responsabile Commerciale - di uno degli standard più popolari e diffusi in Italia, pari

all’80 per cento delle richieste, un veicolo adatto a lavori di ogni genere, dall’asfalto al movimento terra. Anche quello dei veicoli commerciali presenti è un allestimento classico, un trilaterale adatto a piccole imprese operative nei centri urbani. Viene prodotto in differenti versioni: con sponde in acciaio o alluminio o con sistema di sollevamento elettroidraulico o meccanico con pompe a presa di forza”. Con headquarter e sito produttivo a Boffalora sopra Ticino, in provincia di Milano, Cantoni realizza il suo fatturato per il 90 per cento all’estero: i veicoli possono nascere già allestiti, grazie alle partnership con le Case costruttrici, o possono essere trasformati con appositi kit di montag-

gio presso il proprio dealer o carrozziere di fiducia. “Con Merbag - afferma Cantoni condividiamo l’approccio finalizzato a prevedere veicoli disponibili a stock: subito dopo la vendita ne viene preparato un altro in sostituzione, in modo da accelerare i tempi di consegna. È una formula vincente, che sta riscontrando il favore degli operatori”. Con circa 90 dipendenti, Cantoni modula la capacità produttiva annuale della fabbrica lombarda in funzione dei trend del mercato. “Oggi - conclude il Responsabile Commerciale - siamo a circa 800 unità per il cava-cantiere, 1.300 per i van da 3,5 a 7 t e circa un centinaio per la gamma medio-pesante come il Mercedes-Benz Atego”.

Paolo Gilli, Sales Manager Commercial & Passenger Vehicles Dometic Italy.


IL MONDO DEI TRASPORTI

Pagina 10

N° 284 / Novembre 2019

MAN / ESPOSTI ALLA FIERA MARMOMAC DI VERONA UN TGE E UN TGS

Resistenti come pietre LA FILIERA DEI MARMI E GRANITI RICHIEDE UN TRASPORTO QUALIFICATO. IL COSTRUTTORE DI

MONACO HA GIOCATO IN CASA A VERONA FIERE, CON DUE MODELLI DELLA GAMMA PARTICOLARMENTE VOTATI ALLE APPLICAZIONI DEL SETTORE, DALL’ESTRAZIONE IN CAVA ALL’UTILIZZO NEI CANTIERI.

SULLO

STAND ILLUSTRANO LE CARATTERISTICHE DEI VEICOLI FRANCESCO

TURATI, SALES STEERING & MARKETING

T

MAX CAMPANELLA VERONA

ra prodotti grezzi, semilavorati e finiti, macchinari e tecnologie per la lavorazione, showroom del le possibili applicazioni della pietra, nell’architettura e nel design, nel piazzale di Marmomac 2019, manifesta-

zione che rappresenta l’intera filiera dell’industria del settore litico (marmi e graniti), fanno sfoggio di sé un MAN TGE 4x4 e il fratello maggiore il TGS 8x4. Del resto la sede della kermesse è Verona Fiere e la filiale italiana del costruttore del Leone “gioca in casa”. Ma la presenza a Marmo-

mac è frutto di qualcosa di più che la semplice appartenenza alla città di Verona. MAN sceglie di essere presente laddove sono presenti i professionisti e, nel caso della kermesse dedicata alla lavorazione della pietra naturale, questo significa proporsi come partner per operatori di un settore specifico. MAN ha e-

Da sinistra: Giacomo Lago, Salesman Van, e Francesco Turati, Sales Steering & Marketing Intelligence del reparto New Truck Sales.

sposto due veicoli della propria gamma che rappresentano il giusto completamento della filiera, per un trasporto di qualità, frutto dello storico dna della Casa di Monaco, che nasce come brand di riferimento per veicoli cava-cantiere. Negli anni la gamma si è completata con un’offerta prodotto per ogni applicazione, ma resta “in nuce” quella vocazione alle mission estreme in cui il ruolo in primo piano di MAN è riconosciuto, dai player del settore nonché dai numeri, che vedono il marchio del Leone costantemente tra i primi costruttori nella classifica del segmento cava-cantiere. “Dopo il Transpotec spiega Francesco Turati, Sales Steering & Marketing Intelligence del reparto New Truck Sales questa è la seconda fiera a cui partecipa MAN. Non è un caso: Verona, oltre a essere la nostra città, è un territorio storicamente legato all’attività di estrazione del marmo, con tante cave dislocate nel nord est. Ci è parso naturale essere presenti”. Al suo esordio al Marmomac MAN ha esposto il TGE, ultimo arrivato nella gamma a completare la famiglia, dei veicoli del marchio del Leone. “Il veicolo proposto pre-

cisa Giacomo Lago, Sales man Van - è in versione doppia cabina a sette posti e trazione 4x4, ideale per i professionisti di questa fiera, adatto per aziende i cui veicoli operano in situazioni difficili. È allestito dal nostro partner friulano Chiarvesio con cassone fisso in lega leggera, equi paggiato con motore da 140 cv e portata da 35 q. La trazione integrale è quella di ultima generazione, che consente di procedere con trazione anteriore quando il veicolo viaggia su strada: quando si affronta un terreno accidentato il sistema in automatico inserisce la trazione integrale, lasciando il conducente sicuro di guidare con la massima efficienza su ogni percorso”. Come si colloca il TGE nel la più ampia famiglia MAN dedicata al settore di scavi e costruzioni? “La proposta - risponde Lago - è com pleta, dal trattore TGX scendendo di portata nei leggeri come il TGM, tutti 4x4. Fino al 2017 restava scoperta la componente di veicoli al di sotto delle 6 t, gap colmato con l’arrivo del TGE, da 3,5 a 6 t e soluzioni adatte a ogni tipologia di artigiani, aziende strutturate, dai flottisti che operano su lungo raggio al padroncino che effettua lavori nei tratti urbani”.

INTELLIGENCE DEL REPARTO NEW TRUCK SALES, E GIACOMO LAGO, SALESMAN VAN.

Quello dei veicoli commerciali è un segmento molto competitivo: qual è la “l’aspetto di caratterizzazione” con cui MAN propone il TGE? “Per MAN - afferma Lago - il TGE è un veicolo da lavoro, che viene configurato per lavorare e l’intera filiera della manutenzione lo considera come tale: i MAN Center, le officine e le Concessionarie MAN si occupano del TGE mettendo a disposizione dei clienti tutta l’expertise, la capacità tecnica e la consolidata esperienza che abbiamo in ambito truck, dagli spazi disponibili alla strumentazione diagnostica al personale costantemente aggiornato. È questo il nostro focus, autentico pilastro attorno al quale ruota la strategia MAN”. Elemento in comune tra TGE e il resto della gamma? “La robustezza - conclude il Salesman Van - che si traduce in pacchetti di manutenzione tra i più vantaggiosi del mercato: MAN garantisce qualità e durabilità, di cui è certa al punto di tenere contenuto il costo dei pacchetti di manutenzione. Questo per gli operatori del cava-cantiere è un notevole punto di forza”. Accanto al TGE, a Verona era esposto un MAN TGS con motore da 500 cv e ribaltabile della veronese Andreoli. “Si tratta - precisa Francesco Turati - di un modello sviluppato come mezzo d’opera e da cantiere, in questa fiera assolutamente adeguato per le esigenze del settore del le escavazioni del marmo e delle costruzioni. È equipaggiato con cambio manuale per rispondere alle richieste degli operatori del settore, che preferiscono la trasmissione manuale soprattutto quan do affrontano strade strette, ma è disponibile anche con cambio automatico”.


IL MONDO DEI TRASPORTI

Pagina 12

N° 284 / Novembre 2019

VOLVO TRUCK / A ECOMONDO 2019 NUOVO CONCETTO DI EFFICIENZA

Gas ed elettrico, ma non solo LA FIERA DI RIMINI È STATA L’OCCASIONE PER VEDERE DA VICINO IL NUOVO VOLVO FH CON I-SAVE, EFFICIENTE SOLUZIONE A LUNGO RAGGIO: UN PROPULSORE SVILUPPATO COME NUCLEO DI UN PIÙ COMPLESSO SISTEMA CHE, TRA SOFTWARE, CAMBIO OTTIMIZZATO E SPEGNIMENTO IN FOLLE, RISPARMIA CARBURANTE E RIDUCE LE EMISSIONI. IN ESPOSIZIONE LA GAMMA

P

DEDICATA A RACCOLTA RIFIUTI E RICICLAGGIO COME L’EFFICIENTE E FUNZIONALE

FABIO BASILICO RIMINI

FE IN VERSIONE LEC CON POSIZIONE DI GUIDA RIBASSATA.

unto di riferimento in Europa per innovazione tecnologica, economia circolare e mobilità sostenibile, Ecomondo è la vetrina idea le per Volvo Trucks per presentare soluzioni che portano a un livello superiore il concetto di efficienza. Il rispetto per l’ambiente è un valore storico del brand, progettare veicoli sempre meno inquinanti è per Volvo un impegno continuo. D’altra parte la prima scadenza degli obiettivi dell’Unione Europea è vicina: i veicoli pesanti dovranno tagliare le emissioni di CO2 del 15 per cento entro il 2025,

per arrivare al 30 per cento entro il 2030. Per raggiungere questi risultati, Volvo Trucks sta lavorando da un lato sui combustibili alternativi come l’LNG (gas naturale liquefatto), che riduce le emissioni del 20 per cento, dall’altro sui veicoli elettrici, adatti ai contesti urbani, già operativi in alcune città europee a partire dallo scorso febbraio. La seconda via per essere in linea con il regolamento europeo passa attraverso l’efficientamento energetico. I motori di nuova immatricolazione sono tutti Euro 6 Step D, con un taglio del tre per cento sulle emissioni. Con il pacchetto I-Save arriva mediamente al sette per

cento la riduzione di consumi ed emissioni e le prime evidenze portano a risparmi anche maggiori. Volvo FH con I-Save, presente a Ecomondo, è un concentrato di tecnologia e funzionalità all’avanguardia. Merito innanzi tutto del motore D13TC con unità Turbo Compound, progettato per garantire potenza e massima efficienza. I pistoni hanno una forma interna sinusoidale brevettata, che migliora la combustione e riduce la perdita di energia sotto forma di calore. L’energia in eccesso viene recuperata dalla turbina aggiuntiva Turbo Compound e trasferita all’albero motore. Sfrut tando al meglio tutta

Avanzate tecnologie integrate con il nuovo motore sono alla base del Volvo FH con I-Save, soluzione a lungo raggio della Casa.

l’energia disponibile in ogni fase, il motore D13TC produce una coppia più elevata e offre una maggiore efficienza a tutti i regimi. Il nuovo motore è integrato con avanzate tecnologie Volvo Trucks, come il software ISee, basato su mappe ad alta risoluzione, che utilizza la conoscenza delle strade per sfruttare l’energia cinetica su percorsi collinosi. In più, ICruise con I-Roll, cambio IShift ottimizzato, spegnimento del motore in folle e pompa del servosterzo con cilindrata variabile: ogni caratteristica di I-Save è stata progettata per risparmiare carburante e ridurre le emissioni. Volvo Trucks porta a Ecomondo anche la gamma dedicata al settore Waste & Recycling, veicoli che garantiscono versatilità, efficienza nei consumi e massima sicurezza, in cantiere e nei contesti urbani. In particolare, da segnalare la presenza del Volvo FE

LEC con funzione di “kneeling”, per un ingresso più comodo in cabina. La posizione di guida ribassata migliora la visibilità e consente a chi guida di stabilire un contatto visivo con gli utenti più vulnerabili della strada, essenziale in città sempre più congestionate dal traffico. Inoltre, l’abbassamento della cabina permette agli autisti di lavorare in modo più efficiente, riducendo il rischio di lesioni nel continuo salire e scendere dal veicolo, per esempio durante le operazioni legate alla raccolta urbana. Volvo Trucks sbarca a Eco mondo in sinergia con Vol vo Construction Equipment, leader internazionale nella produzione di macchine movimento terra, Volvo Penta, azienda specializzata nella produzione di motori marini e industriali, e Volvo Financial Services, fornitore di servizi finanziari globali per il Gruppo Volvo.

VOLVO TRUCKS IN PRIMA LINEA CON UN OBIETTIVO CHIARO: ZERO INCIDENTI

S

CORSI DI GUIDA SICURA: IMPEGNO SUL CAMPO PER LA SICUREZZA STRADALE

econdo l’Istat, in Italia nel 2018 si sono verificati 172.344 incidenti, con 3.325 vittime e oltre 242.621 feriti. Se nell’incidente è coinvolto un mezzo pesante, le conseguenze per conducenti e altri utenti della strada si aggravano, soprattutto per quelli più vulnerabili, come pedoni e ciclisti. La distrazione dell’autista è la principale causa d’incidente, seguita dal mancato rispetto della precedenza e dalla velocità troppo elevata. Per ridurre il numero d’incidenti sulle strade, Volvo Trucks si muove su più fronti. Da una parte, ha migliorato i sistemi e le dotazioni di sicurezza sui veicoli, come la frenata d’emergenza, il controllo della corsia di marcia, il cruise control adattativo, il supporto alla stabilità. Ha aumentato la visibilità della cabina e la sua capacità di assorbire gli urti, ha affinato la guidabilità, progettando un cambio sempre più intelligente che permette all’autista di concentrarsi sulla strada. Nel 2018 ha portato per la prima volta in Italia Stop Look & Wave, pro-

getto dedicato alla consapevolezza e alla sicurezza stradale, partito dalla Svezia e rivolto a bambini e ragazzi. Obiettivo è far comprendere ai piccoli utenti della strada, i più vulnerabili, l’importanza di creare un contatto visivo con i conducenti prima di un attraversamento pedonale. Il progetto nel 2019 ha coinvolto complessivamente 2.500 scuole primarie, 800 secondarie inferiori e 500 secondarie superiori. Terzo fronte su cui Volvo Trucks si sta muovendo è la formazione dei conducenti, per sensibilizzarli sull’importanza di essere prudenti alla guida, senza assumere rischi inutili per sé e per gli altri. Progettato da Driver Development, organizzazione di Volvo Trucks dedicata alla crescita professionale degli autisti, il nuovo corso di guida sicura ha esordito in anteprima con un gruppo di partecipanti speciali: gli istruttori di guida del comando provinciale dei Vigili del Fuoco di Milano hanno mostrato di apprezzare sia l’utilità sia la funzionalità del corso.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 13

EFFICIENZA, DISCREZIONE, ELETTRIFICAZIONE: LA RIVOLUZIONE DEL FURGONE FRIGO

PER I COMMERCIALI LEGGERI ARRIVA IL NUOVO GRUPPO KERSTNER COOLJET N el segmento dei veicoli commerciali leggeri, Lamberet conta di rivoluzionare il panorama dei frigoriferi con il lancio del nuovo gruppo frigorifero Kerstner CoolJet 106, frutto di uno sviluppo interno, iniziato per tenere conto dell’impatto della nuova norma WLTP. I primi prototipi sono in uso da due anni con piena soddisfazione. Caratteristica inedita, il condensatore è installato sotto il telaio del veicolo e non è quindi posizionato sul soffitto: estetica, aerodinamica e le caratteristiche di omologazione WLTP originali del furgone sono pienamente conservate. Altro punto innovativo, la gestione della potenza sfrutta le competenze sviluppate per Frigovan H2, primo veicolo frigorifero a cella a combustibile, presentato da Lamberet nel 2017 e premiato con la medaglia d’oro del Premio per l’Innovazione Solutrans. Esso offre il miglior rendimento energetico sul mercato: i picchi di tensione durante le fasi di richiamo di po-

tenza, quali l’avvio, sono mitigati e il consumo è sufficientemente basso per eliminare pacchi batteria pesanti e costosi, tradizionalmente necessari per i gruppi elettrici. Kerstner CoolJet 106 è quindi particolarmente adatto ai veicoli commerciali a energia alternativa, come Ford Custom ibrido, Mercedes-Benz e-Vito e i futuri Citroën Berlingo e Peugeot Partner elettrici. “Kerstner CoolJet 106 - afferma Erick Megéan - è un’innovazione rivoluzionaria di prima categoria. È rivolto al crescente mercato dei furgoni frigoriferi, che rappresenta già un volume di 20mila unità l’anno in Europa, di cui circa tremila in Francia. I veicoli commerciali devono rispettare i vincoli della norma WLTP, diventano elettrici e sono sempre meno adatti all’alimentazione dei gruppi puleggia-motore. Il nuovo gruppo frigo Kerstner risponde a queste sfide, offrendo allo stesso tempo agli utilizzatori un alto livello di affidabilità, qualità del freddo e ergonomia”.

LAMBERET / TANTE LE NOVITÀ AL SALONE SOLUTRANS

Il leader del freddo scalda il mercato DOPO AVER ANNUNCIATO, NEL PRIMO SEMESTRE DEL 2019, L’AVVIO DELL’AMPLIAMENTO DEL SITO DI PRODUZIONE STORICO DI SAINT-CYR-SUR-MENTHON CON L’AGGIUNTA DI 40MILA METRI QUADRATI, IL CARROZZIERE DELLA BRESSE PUNTA ALLO SVILUPPO DI NUOVI PRODOTTI. “A LIONE ESPORREMO LA PIÙ VASTA GAMMA DI CARROZZERIE FRIGORIFERE MAI OFFERTA PRIMA, CON UN DENOMINATORE COMUNE: L’ECOLOMIA”, RIASSUME ERICK MEGÉAN, DIRETTORE GENERALE LAMBERET. MICHELE S. ALTIERI

A

SAINT-CYR-SUR-MENTHON

pochi mesi dall’annuncio dell’investimento sullo storico sito produttivo di Saint-Cyr-sur-Menthon, nella Bresse, in fase di ampliamento per complessivi +40mila mq, Lamberet sbarca al Salone Solutrans, in calendario a Lione dal 19 al 23 novembre, con tutta una serie di novità di prodotto. Il denominatore comune sarà “l’Ecolomia, ovvero - per utilizzare le parole di Erick Megéan, Direttore Generale Lamberet - costruiamo soluzioni concrete per il trasporto frigorifero, con ripercussioni economiche positive, per permettere ai nostri clienti di raggiungere i loro obiettivi in termini di rispetto dell’ambiente e di competitività”. A Lione i semirimorchi saranno ospiti d’onore. Per la prima volta sarà presente allo stand tutta la gamma Lamberet: X-City con assi sterzanti, Heavy-Duty per la distribuzione intensiva, Green Liner il semirimorchio frigorifero più leggero sul mercato - per le lunghe distanze, e SuperBeef, dedicato al trasporto di carne appesa. Questa nuova generazione di SR2 inaugura le ultime innovazioni sviluppate da Lamberet: fari ribaltabili anti-rottura Safelight presenti su tutti i veicoli, spoiler aerodinamici automatici Aerotail previsti in optional sulle porte, versioni multi temperatura dotate della parete Ergowall, il cui concetto è stato premiato dall’IAA Trailer Innovation Award 2019. Il catalogo degli equipaggiamenti inaugura anche la nuova serranda posteriore au-

tomatica Distri+. “Questo prodotto cen to per cento Lamberet - afferma Megéan apre nuove prospettive nella distribuzione combinando il miglior rapporto altezza utilealtezza totale, il passaggio più largo sul mercato con 2,42 m e il pri mo pannello

isolante ideato appositamente per le applicazioni in freddo negativo”. Lamberet è affermato per le sue carrozzerie sui camion di oltre 12 t, il che è confermato da una quota di mercato del 40 per cento su tale segmento, esclusi i noleggi isti-

tuzionali. Solutrans segnerà il lancio di una nuova gamma che copre il segmento inferiore da 7 a 12 t. “Questo - spiega il Direttore Generale - risponde a una crescente domanda su questi carichi, offrendo tutti i punti forti di riferimento Lamberet: design,

Erick Megéan, Direttore Generale Lamberet.

robustezza, isolamento di qualità superiore, leggerezza ed ergonomia”. Le carrozzerie per i veicoli da 12 a 26 t non saranno da meno, grazie all’arrivo dell’offerta di connettività Multiplex, basata sull’utilizzo generalizzato di un Can-Bus

AeroSR2 Concept sintetizza le competenze e la capacità innovativa di Lamberet quale fornitore di soluzioni di trasporto refrigerato.

multiplex. Sistema assolutamente innovativo, Multiplex permette di controllare e bloccare tutte le funzioni di un camion da distribuzione: gestione avvio-arresto motore e interazioni con il gruppo frigorifero, sponda, aperture e funzioni della carrozzeria. Que sto sviluppo integra un’app che si associa al camion via bluetooth e permette di stabilire una comunicazione bidirezionale con i sistemi telematici. Lamberet si è imposto nel trasporto di carne a temperatura controllata a partire dalla commercializzazione del suo SR2 SuperBeef - premio per l’innovazione Solutrans 2011 - con soluzioni innovative in termini di resistenza e stabilità. “Al Solutrans 2019 - afferma Megéan - Lamberet dedicherà una parte dello stand ai trasportatori di carne, poiché la filiera dell’allevamento necessita di continui sviluppi per aumentare la sua produttività. Il semirimorchio frigo SuperBeef esposto ne sarà la dimostrazione, con guide per ganci di nuova generazione con scambi assistiti, frutto di un lavoro congiunto con lo specialista Norman”. Lamberet presenterà inoltre un nuovo braccio idraulico Beef Lift, 100 per cento “made in Lamberet”, destinato alla movimentazione assistita delle carcasse. Infine, guest star del “polo carne” sarà un pianale-cabina Citroen HY modello 1968. “La sua carrozzeria porta-carne Lamberet - conclude Megéan - ha resistito perfettamente nel tempo, dimostrando in questo modo valori cari a questo marchio: qualità e durevolezza”.


IL MONDO DEI TRASPORTI

Pagina 14

N° 284 / Novembre 2019

SU STRADA / MERCEDES-BENZ ACTROS CON ACTIVE DRIVE ASSIST E ACTIVE BRAKE ASSIST

Il camion è intelligente e lo dimostra AL CENTRO DELLA NOSTRA ATTENZIONE DUE SISTEMI DI SICUREZZA CHE RENDONO LA NUOVA GENERAZIONE DELL’AMMIRAGLIA TRUCK DI STOCCARDA UN VERO PUNTO DI RIFERIMENTO NEL SETTORE: ACTIVE DRIVE ASSIST E ACTIVE BRAKE ASSIST. CON IL NUOVO ACTIVE DRIVE ASSIST LA GUIDA PARZIALMENTE AUTONOMA A QUALSIASI ANDATURA È REALTÀ APPLICATA MENTRE L’ACTIVE

BRAKE ASSIST 5 È LA NUOVA AVANZATISSIMA GENERAZIONE DEL POPOLARE SISTEMA DI ASSISTENZA ALLA FRENATA D’EMERGENZA,

U

ORA IN GRADO DI REAGIRE IN MODO ANCORA PIÙ EFFICACIE IN PRESENZA DI PERSONE, GRAZIE ALL’INTERAZIONE DEL RADAR E DELLA TELECAMERA.

FABIO BASILICO VITTUONE

n test drive speciale quello che abbiamo avu to l’occasione di compiere a bordo del nuovo Mercedes-Benz Actros. Al centro della nostra attenzione due sistemi di sicurezza che rendono la nuova generazione dell’ammiraglia truck di Stoccarda un vero punto di riferimento nel settore: Active Drive Assist e Active Brake Assist. Accompagnati dal dri-

ver Roberto Spelta abbiamo percorso un centinaio di chilometri tra autostrade e strade statali testando in presa diretta i vantaggi dei due sistemi. Con il nuovo Active Drive Assist la guida parzialmente autonoma a qualsiasi andatura è realtà applicata. Non è un caso quindi che il nuovo ADA rappresenti una pietra miliare nella produzione di veicoli industriali. Il sistema si orienta autonomamente in base alla segnaletica orizzontale avvalendosi di una tele-

camera e, in determinate condizioni, assume il controllo della guida del truck fornendo assistenza all’autista con il controllo della marcia in senso longitudinale e laterale, con l’intervento automatico sul sistema frenante e sull’acceleratore e il mantenimento del veicolo all’interno della car reggiata. L’Active Drive Assist è in grado di sterzare, frenare e accelerare automaticamente il veicolo in specifiche circostanze. Per la prima volta in un truck prodotto in

serie, il sistema permette una guida parzialmente automatizzata in tutti i range di velocità: un primo importante passo verso la guida autonoma. Tuttavia, l’Active Drive Assist è pur sempre un sistema di assistenza che non solleva i conducenti dalla responsabilità di tenere costantemente sotto controllo il com portamento del veicolo nel traffico. Un aspetto che il no stro driver non ha mai smesso di sottolineare. Il sistema si è dimostrato

vantaggioso sia in condizioni di traffico rallentato che durante i viaggi più lunghi e monotoni. L’ADA mantiene il veicolo all’interno della cor sia intervenendo sullo ster zo e, con l’ausilio della telecamera, il sistema controlla la traiettoria del veicolo rispetto alla segnaletica orizzontale, e il mantenimento attivo della corsia rimane vigile anche se è stato disattivato l’Active Drive Assist, aumentando la sicurezza. In caso di abbandono involontario della

corsia di marcia, il sistema automatico interviene automaticamente sullo sterzo del veicolo, riportandolo in traiettoria. L’Active Drive Assist sfrutta l’innovativo servosterzo elettronico, la cui coppia viene aumentata a seconda del le necessità (ad esempio in fase di manovra), migliorando la maneggevolezza. Quando l’Active Drive Assist è in funzione, il conducente visualizza sul display centrale della plancia multi-


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Al volante della nuova generazione Mercedes-Benz Actros si ha la concreta sensazione di avere tutto sotto controllo.

mediale l’icona di colore blu di un volante e le linee di demarcazione della corsia. Anche l’eccessivo avvicinamento al veicolo che precede viene indicato e il sistema rallenta automaticamente il truck. Quando la distanza dal veicolo che precede è di nuovo sufficiente, il sistema

spetto al modello precedente grazie alla funzione migliorata del Tempomat e del controllo della trasmissione, il Predictive Powertrain Control (PPC). Oltre a un sistema di localizzazione satellitare, i sistemi di nuova generazione utilizzano mappe stradali digitali precise che contengono

dati sulla topografia, il percorso, gli incroci, rotatorie e sul la segnaletica stradale. Pertanto il sistema ottimizza lo stile di guida non solo in presenza di salite o discese, ma anche su tratti extraurbani con molte curve, dove fino a oggi non era possibile l’utilizzo del Tempomat in modo

ottimale, tutto ciò con l’obiettivo di garantire il maggior risparmio di carburante possibile, supportando al meglio il conducente. Inoltre l’interazione tra Predictive Powertrain Control e il sistema di mantenimento della distanza migliora l’efficienza dei consumi: il sistema di manteni-

Pagina 15 mento della distanza fornisce informazioni sui veicoli che precedono, affinché il Predictive Powertrain Control possa pianificare in modo ideale le operazioni di cambio delle marce e le variazioni di velocità. Il sistema beneficia della nuova modalità di guida Economy+ del cambio automatico PowerShift 3, realizzato per garantire uno stile di guida ancora più parsimonioso. Il PPC può ora essere utilizzato anche nei trasporti interurbani. La riduzione dei consumi di carburante è stata possibile grazie all’introduzione di varie misure, tra cui il miglioramento dell’aerodinamica: le nuo ve performanti MirrorCam, che sostituiscono gli specchietti retrovisori esterni tradizionali con un sistema di telecamere, riducono la resistenza aerodinamica grazie alle dimensioni compatte e ridotte. E campione d’efficienza è il motore sei cilindri 12.8 litri OM 471 da 390 kW/530 cv a 1.600 giri/min con coppia massima di 2.600 Nm a 1.100 giri/min. L’Active Brake Assist 5 è la nuova avanzatissima generazione del popolare sistema di assistenza alla frenata d’emergenza predisposto da Mercedes-Benz. ABA 5 è ora in grado di reagire in modo ancora più efficacie in presenza di persone, grazie all’interazione del radar e della telecamera. Le già note capacità del sistema precedente rimangono inalterate: a prescindere dalla presenza di una persona o di un veicolo fermo o che precede, l’Active Brake Assist 5 fornisce supporto al conducente in caso di rischio di collisione intervenendo, al-

L’interno della cabina è ben strutturato in termini di comfort, ergonomia e sicurezza.

accelera fino a raggiungere la velocità impostata. La distanza desiderata rispetto al veicolo che precede può essere impostata a livelli diversi. L’Active Dri ve Assist aiuta anche il conducente nelle situazioni di traffico rallentato poiché basato sul collaudato Proximity Control Assist con funzione stop-and-go. Va anche sottolineato che tutti i sistemi di assistenza del nuovo Actros operano sinergicamente: l’Active Drive Assist sfrutta il radar avanzato e la telecamera dell’innovativo Active Brake Assist 5 per monitorare il traffico e rilevare la segnaletica orizzontale. Inoltre, opera sempre secondo le specifiche del cruise control intelligente e del sistema di controllo della trasmissione Predictive Powertrain Control, per garantire una marcia quanto più efficiente possibile in termini di costi. A questo proposito ricordiamo che il consumo di carburante del nuovo Actros è stato ulteriormente ridotto ri-

I sistemi di assistenza alla guida di Mercedes-Benz Actros sono pensati per garantire un trasporto efficiente e protetto.

l’occorrenza, anche con una frenata d’emergenza automatica fino al completo arresto del veicolo. Anche in questo caso, l’avvertenza è che l’Active Brake Assist 5 è semplicemente un sistema di assistenza alla guida e che il conducente continua ad avere la piena responsabilità per quanto riguarda la guida sicura del veicolo. A riprova dell’efficacia del sistema, la risposta in caso di presenza di persone a una velocità inferiore a 50 km/h è stata migliorata. Entro i limiti del sistema, l’ABA 5 è in grado di effettuare una frenata d’emergenza qualora sia rilevata la presenza di pedoni che attraversano la strada, che si avvicinano frontalmente, che camminano lungo la strada o che si arrestano improvvisamente. Se l’Active Brake Assist 5 rileva un rischio di collisione con un veicolo che precede, un ostacolo fisso o una persona, il conducente vie ne avvertito del pericolo da un sistema di avvertimento in tre fasi. Se il conducente non reagisce, vengono emessi un avvertimento visivo e un segnale acustico e viene quindi attivata una frenata parziale. Se il conducente continua a non reagire, entro i suoi limiti, il sistema interviene sull’impianto frenante e a una velocità inferiore a 50 km/h, attivando il sistema di luci d’emergenza per la segnalazione ai veicoli che seguono. Una volta arrestato il veicolo viene infine inserito il freno di stazionamento elettronico. Dal punto di vista dell’analisi dei dati e delle informazioni, è senza dubbio vero che un sistema come l’Active

Brake Assist 5 sia in grado di rilevare le situazioni di pericolo spesso in modo più efficace rispetto anche a un driver esperto e di conseguenza reagire tempestivamente. Ma è nel contempo corretto porre in rilievo la specifica intelligenza reattiva di fronte all’imprevisto non calcolato pro pria dell’essere umano. Inoltre, l’ABA 5 non è compatibile con la guida autonoma che permetterebbe al conducente di non prestare attenzione al traffico. Di conseguenza, la responsabilità, in qualsiasi momento durante la marcia, resta, come previsto dalla legge, del conducente, che dovrà adeguare la velocità alle condizioni del traffico e in particolare monitorare costantemente la distanza di sicurezza e la velocità. Resta comunque il fatto che un sistema così avanzato sia in grado di supportare efficacemente il driver rendendo il suo lavoro più sicuro e confortevole e in definitiva più profittevole.


IL MONDO DEI TRASPORTI

Pagina 16

GUIDATI DA GIANDONATO PEDRAZZINI E ANDREA ROTA, ANDIAMO ALLA SCOPERTA DELLA SEDE DI

MILANO OVEST,

APERTA NEL DICEMBRE

N° 284 / Novembre 2019

A MENO DI UN ANNO DALL’APERTURA INTERVISTA

Radicati nel territorio:

2018. MAGAZZINO E OFFICINA DISPONGONO DI SPAZI AMPI E RISORSE FORMATE E AGGIORNATE SECONDO I SEVERI STANDARD DEL COSTRUTTORE DI

MONACO. “OBIETTIVO È FARCI CONOSCERE DAI CLIENTI, RENDERLI CONSAPEVOLI CHE ESISTE UN PUNTO DI RIFERIMENTO DEDICATO A LORO”, AFFERMA PEDRAZZINI.

MISSION COMPIUTA CONSIDERANDO I PRIMI MESI:

“NELL’ASSISTENZA LAVORIAMO A PIENO RITMO SU MOTRICI, TRATTORI, VAN E BUS”, AFFERMA ROTA.

A

MAX CAMPANELLA RESCALDINA

cquistare o ritirare un veicolo MAN nuovo, avere un riferimento per manutenzione o riparazione, sapere a chi rivolgersi per un intervento di assistenza, per scegliere e ritirare un veicolo usato. Tutto questo, e anche di più, sono i servizi che il cliente può trovare presso un MAN Center, struttura di vendita e assistenza del produttore di Monaco. A distanza di meno di un anno dall’apertura, siamo andati a vedere come funziona la sede di Milano Ovest, esattamente a Rescaldina, nella cintura au -

tostradale che collega Como e Milano con la Svizzera passando dall’aeroporto della Malpensa. Crocevia che rende il punto MAN vicino ai trasportatori dell’area di Milano, Como e provincia nonché per i conducenti stranieri che, provenienti da Austria e Svizzera, sono diretti nel nostro Paese. Al timone del MAN Center di Rescaldina troviamo Giandonato Pedrazzini, dinamico Retail Sales Manager, che a dicembre 2018 Giampaolo Dal Lago, Own Retail Director MAN Truck & Bus Italia, ha scelto per guidare l’affermazione della sede

lom barda, nel suo contatto con clienti e allestitori. Al suo fianco Andrea Rota, 57 anni, Responsabile dell’assistenza tecnica, in MAN da febbraio 2018 ma da molti anni nel settore. Uomo dell’assistenza a 360 gradi, responsabile del magazzino, dei ricambi (sia nuovi sia dei revisionati di fabbrica, chiamati Ecoline) e dell’accettazione, Rota ci accompagna alla scoperta dell’area dedicata ai lavori di officina. Sposato con due figlie e nonno di due nipoti, uno di tre anni e una piccolissima di un mese, con lui effettuiamo un vero e proprio tour della

sede di Rescaldina: Rota si rivela una guida in grado di “dialogare” con estrema facilità con ogni tipo di motore, dal van all’autobus. Ancora in fase di completamento, il magazzino è la pri ma area di accesso una vol ta lasciati gli uffici: 520 mq disposti su due piani e un’area di 350 mq, per complessivi 870 mq di area utilizzabile. “I ricambi ordinati precisa Rota - arrivano al massimo entro due giorni: se l’ordine viene trasmesso entro le 14.30 il mattino successivo il ricambio è disponibile nel nostro magazzino”. In totale, l’edificio del

MAN Center copre una superficie di 2.400 mq dei quali 1.350 dedicati a officina e un piazzale di ulteriori 2.500 mq. Vi lavora un team che, accanto ai due responsabili, è costituito da sei meccanici, un magazziniere e un accettatore, oltre al Responsabile Vendite autobus che periodicamente utilizza la sede come riferimento per l’incontro con i clienti o la preparazione documentale per gare pubbliche. Al MAN Center si effettua assistenza sull’intera gamma, dal TGE ai veicoli pesanti agli autobus. L’officina opera con elevatori mobili, seguendo il layout MAN che non

prevede la presenza delle tradizionali buche, ritenute pericolose. “L’elevatore mobile pre cisa Rota - consente di sollevare il veicolo all’altezza che si ritiene necessaria per il tipo d’intervento”. Sempre seguendo il layout MAN, ogni intervento effettuato al MAN Center è garantito due anni, inclusa la manodopera. “Garanzia - afferma Rota - che possiamo dare perché utilizziamo solo ricambi originali e perché, interfacciandoci con la Casa Madre, operiamo seguendo le sue linee direttive: dalle tempistiche al costo del servizio tutto è precisamente stabilito

DALL’AMMIRAGLIA TGX ALLE MOTRICI ISOTERMICHE E AI TRATTORI CON MOTORE D15

AMPIA DISPONIBILITÀ IN PRONTA CONSEGNA, ANCHE DI VEICOLI ALLESTITI O ltre all’organizzazione strutturata, in officina e magazzino, colpisce al MAN Center la disponibilità di veicoli in pronta consegna. Sul piazzale, accompagnati da Giandonato Pedrazzini e Andrea Rota, abbiamo l’opportunità di constatare la presenza dell’intera gamma del Leone. Al nostro ingresso due autobus Lion’s City sono in attesa di verifiche diagnostiche, mentre dietro di essi si apre il piazzale, autentico showroom esterno, in cui troviamo anche veicoli allestiti, come una motrice TGX a tre assi con cassa Lamberet, gruppo frigorifero Thermo King e sponda caricatrice Anteo. Al suo fianco in pronta consegna un fratello minore: un TGS da 9 t cabina stretta. “È assolutamente adatto - spiega Pedrazzini - per lavori in cava o per la distribuzione, lo immagino anche con ribaltabile, gancio con gru o con una betoniera”. Il TGS lo troviamo anche equipaggiato con il nuovo motore ultraleggero D15, ultimo nato in casa MAN, destinato al breve e medio raggio anche per trasporto isotermico. “Il grande vantaggio in questo caso spiega Pedrazzini - lo si ottiene sfruttando la portata, quindi può andar bene per trainare un centinato o anche come trasporto carburanti: più lo si utilizza maggiore è il risparmio”.

Sul piazzale non manca il TGL, nel suo caso come modello destinato a diventare un ribaltabile. “Una volta su strada - afferma Pedrazzini con un pizzico di orgoglio - sarà una sorta di piccolo mulo, pronto a andare ovunque viste le sue dimensioni e ad affrontare impegni onerosi, come lavori per un’impresa edile, scavi ecc.” Ogni camion MAN è collegato con ServiceCare, sistema - completamente gratuito per l’autotrasportatore - con il quale giornalmente si può verificare, attraverso un portale web, la posizione del veicolo, ricevere alert qualora vi sia necessità d’intervento ecc. “È questa - afferma Andrea Rota - la chiave di differenza del servizio MAN: entrare in contatto con il cliente partendo dalla consapevolezza di quello che veramente gli occorre in quel preciso istante e, insieme, trovare il modo per affrontare e risolvere i problemi”. Non da ultimo, qualunque sia il guasto, il personale tecnico d’intervento del MAN Center è disponibile sette giorni su sette, h 24 per 365 giorni l’anno. È il servizio Mobile 24, dedicato ai trasportatori, così come BusTopService è il servizio dedicato ai professionisti del trasporto persone: un team di tecnici specializzati nel settore Bus che si trova in ogni MAN Center.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 17

ESCLUSIVA PRESSO IL MAN CENTER DI RESCALDINA

la missione del MAN Center

dalle linee guida della sede centrale di Monaco”. Diamo qualche dato: quanto lavora il MAN Center Milano Ovest a meno di un anno dalla sua apertura? “Sul piano dell’assistenza - risponde Rota - il personale lavora a pieno ritmo: chi viene da noi si aspetta un servizio di qualità e, dopo aver sperimentato il nostro servizio, il cliente torna. Il nostro lavoro è fornire assistenza, con l’obiettivo di soddisfare e fidelizzare il cliente. Motivo per cui se un professionista si rivolge a noi, nostro compito è risolvere il problema al suo mezzo: effettuiamo le nostre diagnosi dopodiché, se si tratta di un veicolo di un altro brand, di un semirimorchio, di un assale o pneumatico, se non possiamo intervenire gli diamo dei consigli, se possibile interfacciandoci con il produttore. Non lasciamo a piedi nessun cliente, lo accompagniamo e

seguiamo sempre”. Il nostro viaggio prosegue tra le postazioni fisse: tre totem sui quali i meccanici immettono tutte le informazioni dalla diagnostica del veicolo. “In questo modo spiega Rota - disponiamo dell’intera filiera manutentiva del veicolo, oltre a registrare il lavoro di ciascun dipendente”. Tra i veicoli si muovono cinque strumenti diagnostici di cui tre per i camion e uno ciascuno per bus e TGE. Non da ultimo, ogni meccanico dispone di un carrello attrezzato con tutta l’utensileria necessaria. “Il personale - afferma Pedrazzini - viene formato pres so l’Academy MAN a Verona, che assicura aggiornamento continuo. Abbiamo aperto una linea di apprendistato per far crescere giovani leve come futuri specialisti: oggi e in futuro serviranno sempre più esperti in meccatronica. Accanto a figure con

truck, di cui al momento mi occupo io con due venditori, uno sull’area di Como l’altro su quella di Milano. L’obiettivo è far crescere la squadra, per contribuire all’affermazione del marchio. Per farlo, Pedrazzini sta usando tutte le leve a sua disposizione, a partire dal progetto Future Lions, lanciato da MAN per formare Sales Area Manager: due anni di formazione teorica e sul campo in affiancamento a venditori esperti. “L’obiettivo - afferma Pedrazzini - è avere una forza vendita competente: così come gli apprendisti crescono per diventare operai specializzati, questi giovani possono diventare Area Manager”. Un’altra leva è la vicinanza alle flotte, di cui si occupa un Sales Specialist della sede di Verona. “Il MAN Center spiega Pedrazzini - si occupa del retail, ma non dimentica il mondo delle flotte che, dal calcestruzzo all’isotermico, caratterizza l’area di MilanoComo, territorio di fervente at tività edilizia. Per l’assistenza abbiamo tante richieste di lavori su motrici e veicoli per il medio raggio, mentre per la vendita l’ammiraglia indiscussa è il TGX. Il TGE è ancora al suo esordio, è un ottimo prodotto deve solo farsi

Giandonato Pedrazzini, Retail Sales Manager.

capacità e esperienza, vogliamo assicurare continuità alla nostra attività e garantire la soddisfazione del cliente: per farlo occorre avere figure iperspecializzate”.

Tra pc e carrelli, gli operai al MAN Center si muovono nel totale rispetto delle norme di sicurezza. “Non importa se un lavoro richiede dieci minuti in più - precisa Pedrazzi-

Andrea Rota, Responsabile dell’assistenza tecnica.

ni - l’importante è che esso sia svolto in modo che non com porti alcun tipo di rischio”. Sposato con due figli di 32 e 28 anni, rispettivamente Valeria e Marco, Pedrazzini è volto noto nel mondo dei camion. Al suo attivo un’esperienza di 36 anni, iniziata in Autostar come capo servizio addetto ai carrelli elevatori e proseguita in Mercedes-Benz come direttore vendite e aftermarket della filiale di Milano. Pedrazzini, guarda anche al futuro. “Il MAN Center spiega - è responsabile direttamente delle vendite di van e

L

L’officina opera con elevatori mobili, seguendo il layout MAN che non prevede la presenza delle tradizionali buche.

conoscere”. Dal punto di vista dei tempi, qual è l’attesa per il raggiungimento degli obiettivi di affermazione del MAN Center Milano? “MAN - afferma in conclusione Pedrazzini non ha fretta e non abbiamo il fiato sul collo. L’obiettivo è far conoscere ai clienti la nostra attività, il servizio di qualità che offriamo, diventare un loro riferimento per tutto quanto concerne vendita e assistenza, nuovo e usato. Il grafico dei volumi è in salita e siamo soddisfatti, soprattutto della percezione di qualità del servizio che ha il cliente.

Prossime APerture

a struttura di vendita e assistenza organizzata in MAN Center in Italia ha iniziato a ramificarsi nel 2017, seguendo la strategia avviata dal produttore di Monaco a partire dalla Germania per avviarsi in tutta Europa. Nel nostro Paese l’apertura della prima sede è stata quella di Brescia, cui ha fatto seguito il MAN Center di Roma; nel 2018 a Venezia e Milano Ovest (Rescaldina); quest’anno a Forlì e, prossime tappe, Bologna (Valsamoggia) e Milano Sud (San Giuliano Milanese) .


IL MONDO DEI TRASPORTI

Pagina 18

N° 284 / Novembre 2019

CNH / ANNUNCIATA LA DIVISIONE IN DUE, DAL 2021 SPIN-OFF PER IVECO E FPT

Nuovi ambiziosi progetti

C

GUIDO PRINA LONDRA

NH si divide in due. A par tire dal 2021 l’attuale Gruppo sarà scorporato: le attività saranno divise in parte agricola, costruzioni e veicoli speciali, definita “Off-Highway” (Case IH, New Holland Agriculture, Steyr, Case, New Holland Construction, Astra, Magirus, Iveco Defence Vehicles) e par te stradale con veicoli commerciali e powertrain denominata “On-Highway” (Iveco, Iveco Bus, Heuliez Bus e FPT Industrial). Quest’ultima parte verrà scorporata dall’attuale CNH e quotata separatamente in Borsa a partire dal primo trimestre del 2021. L’operazione è stata annunciata dal Ceo di CNH, Hubertus Muhlhauser e dalla Presidente Suxanne Heywood al Capital Market Day di New York. Il piano dei prossimi cinque anni prevede che la divisione in due produca un aumento del fatturato complessivo dei due gruppi del 5 per cento ogni anno, investimenti complessivi di 13 miliardi di dollari nei cinque anni del piano e il raddoppio dei margini attuali entro il 2024. La nuova società che viene scorporata e che comprende Iveco e la parte motori (Ftp) sarà quotata a Wall Strreet come CNH e avrà anch’essa sede le gale ad Amsterdam. Non sono stati specificati per ora i piani di ristrutturazione che conseguiranno alla separazione anche se il comunicato ufficiale afferma che si “realizzeranno azioni di ristrutturazione mirate”. In Italia, lo scorporo delle attività di Iveco e Fpt coinvolgerà in tutto 11.500 dipendenti (6.300 Iveco e 5.200 Fpt). Commentando l’operazione il Presidente di Exor, John Elkann, ha garantito il “massimo appoggio a un piano ambizioso che presenta potenziali benefici per tutti gli azionisti”. Exor manterrà il controllo sia su CNH sia sulla nuova società di Iveco e Fpt che nascerà nel 2021 e continuerà a essere l’azionista di riferimento di entrambe le società. Lo scorporo avverrà nel 2021 con la distribuzione di un’azione della nuova società per ogni azione CNH posseduta. Il nuovo ambizioso piano strategico quinquennale

DAL 2021 L’ATTUALE GRUPPO CNH SARÀ SCORPORATO: LE ATTIVITÀ SARANNO DIVISE IN PARTE AGRICOLA E DIFESA,

“OFF-HIGHWAY” (CASE IH, NEW HOLLAND AGRICULTURE, STEYR, CASE, NEW HOLLAND CONSTRUCTION, ASTRA, MAGIRUS, IVECO DEFENCE VEHICLES) E PARTE STRADALE

“ON-HIGHWAY” (IVECO, IVECO BUS, HEULIEZ BUS E FPT INDUSTRIAL). 2020-2024 si chiama “Transform 2 Win” (“Cambiare per vincere”) e propone una dettagliata strategia per trasformare la struttura e la performance del Gruppo così da consentire ai suoi cinque segmenti operativi di esprimere il loro pieno potenziale. Il pia no è basato su robuste e det tagliate strategie di segmento e di funzione da realiz-

zarsi attraverso una serie di iniziative strategiche che includono opportunità di crescita nelle vendite, azioni di semplificazione delle performance e delle attività, efficienze nell’ottimizzazione degli asset e programmi di coinvolgimento e sviluppo dei talenti. CNH Industrial ridurrà i costi operativi e aumenterà l’efficienza dell’insieme delle

proprie attività attraverso la realizzazione di azioni di ristrutturazione mirate e altre voci, riunite in un Programma di Efficienza e altre specifiche iniziative che includono il processo di semplificazione se condo la metodologia 80/20, avviato nell’ultimo trimestre del 2018. La completa attuazione di questo Programma è prevista per la fine del

Nel piano di riorganizzazione di CNH le attività nel settore agricolo saranno divise da quelle relative alla parte stradale. Sopra, una mietitrebbia New Holland Agriculture e, in alto, l’Iveco S-Way.

2022. Il “Transform 2 Win” include l’importante separazione dei business “On-Highway” (stradale) e “Off-highway” (non stradale), una decisione che fa seguito al completamento di un approfondito processo di revisione del portafoglio, dopo aver valutato considerazioni di carattere strategico, relative agli investitori e alle sinergie. Questa valutazione ha e vi denziato che i business “OnHighway” e “Off-Highway” hanno differenti requisiti in termini di regolamentazione e di clientela e sono influenzati diversamente dai megatrend di settore, in costante accelerazione, relativi a digitalizzazione, automazione, propulsioni a basse o zero emissioni e “servitizzazione”, ovvero la sempre mag giore enfasi sull’offerta di servizi, correlati e specifici, in parallelo all’offerta di prodotti. Il gruppo “Off-Highway”, con un fatturato pro-forma delle attività industriali del 2018 pari a 15,6 miliardi di dollari, sarà principalmente un’azienda produttrice di macchine per l’agricoltura (75 per cento dei ricavi), sostenuta dal business delle macchine per le costruzioni (19 per cento dei ricavi). I veicoli speciali (6 per cento dei ricavi) rimarranno nel gruppo “Off-Highway”. Il

gruppo “On-Highway” di nuova quotazione, con un fatturato pro-forma delle attività industriali di 13,1 miliardi di dollari, comprenderà i marchi Iveco, Iveco Bus e Heuliez Bus (69 per cento dei ricavi), insieme alle attività motoristiche di FPT Industrial (31 per cento dei ricavi). FPT Industrial continuerà a offrire soluzioni di motorizzazione ai vertici del mercato e accelererà lo sviluppo di soluzioni a propulsioni alternative. Inoltre, rimarrà un fornitore chiave del business “Off-Highway”, tramite un accordo di fornitura a lungo termine. Nel settore agricolo, è stato anche dato l’annuncio dell’accordo per l’acquisizione da parte di CNH Industrial della società AgDNA, leader nei sistemi informativi per la gestione delle aziende agricole, o FMIS (Farm Management Information Systems). Collegata con la telematica di gestione delle flotte dei brand agricoli di CNH Industrial, la soluzione congiunta fornirà ad agricoltori e grandi aziende agricole la forza necessaria per consolidare in un’unica piattaforma un’ampia gamma di flussi di dati agronomici, a partire dagli input forniti dalle macchine, così da facilitare processi decisionali tempestivi.

CNH INDUSTRIAL FIRMA UN ACCORDO STRATEGICO CON L’AMERICANA NIKOLA CORPORATION

VAN PESANTI A FUEL CELL DESTINATI A NORD AMERICA ED EUROPA C NH Industrial ha annunciato l’intenzione di sottoscrivere un accordo strategico e su base esclusiva nel settore dei veicoli commerciali pesanti con Nikola Corporation, società con sede a Phoenix, in Arizona, per accelerare la trasformazione verso le zero emissioni nel settore dei van pesanti (di categoria Class 8 per gli Stati Uniti) in Nord America e in Europa. I veicoli commerciali pesanti a zero emissioni di Nikola, alimentati da tecnologia proprietaria a fuel cell (celle a combustibile) a idrogeno e batterie elettriche, saranno i primi a entrare in produzione. L’innovativo modello di business di Nikola prevede una modalità di leasing tutto compreso, anteprima assoluta per il settore, che include il veicolo, il servizio e le spese di manutenzione e rifornimento, offrendo un costo totale di esercizio a lungo termine equivalente o inferiore a quello del diesel. CNH Industrial, come lead investor nel round D di sottoscrizione, acquisirà una partecipazione strategica nel capitale di Nikola, a fronte di un impegno pari a 250 milioni di dollari, comprensivo di un investimento in cassa per 100 milioni di

dollari e di un conferimento, per altri 150 milioni di dollari, in servizi, quali sviluppo prodotto, ingegneria di produzione e altro supporto tecnico, oltre alla fornitura di componenti chiave per accelerare la tempistica di produzione dei modelli Nikola TWO e Nikola TRE. La valutazione ante investimento era stata fissata a 3 miliardi di dollari. Nikola prevede di raccogliere oltre 1 miliardo di dollari con il round D di sottoscrittori, con l’attribuzione di circa il 25 per cento di proprietà ai nuovi investitori e business partner, inclusa CNH Industrial. Iveco e FPT Industrial, rispettivamente i marchi di veicoli commerciali e di motori di CNH Industrial, forniranno supporto con la propria esperienza negli ambiti dell’ingegneria e della produzione per industrializzare i veicoli a fuel cell e batterie elettriche di Nikola. Nikola ONE è un mezzo pesante di tipologia “sleeper” (con compartimento notte in cabina) conforme allo standard Class 8 per i mercati NAFTA; Nikola TWO è di tipologia “day-cab” (cabina diurna) conforme allo standard Class 8 per i mercati NAFTA; Nikola TRE è un mezzo pesante

a cabina avanzata conforme agli standard europei. La tecnologia fuel cell è il successivo logico passo in avanti rispetto ai motori alimentati a gas naturale liquefatto (LNG), dal momento che si sviluppa a partire dalla rete di rifornimento esistente, consentendo la produzione in loco di idrogeno nelle stazioni stesse. FPT Industrial, negli ultimi vent’anni e oltre, è stata all’avanguardia nelle soluzioni a propulsione alternativa, avendo prodotto a oggi circa 50mila motori a gas naturale. Iveco è il leader assoluto in Europa per quanto riguarda i mezzi a gas naturale, con circa 28mila tra veicoli commerciali e autobus alimentati da motori FPT Industrial. Nel lungo termine, una joint-venture europea si occuperà sia di veicoli a batteria elettrica (BEV, battery electric vehicles) sia di veicoli elettrici alimentati a fuel cell (FCEV, fuel-cell electric vehicles), da lanciare nell’ultimo trimestre del 2022. Nikola ha intenzione di utilizzare la rete di vendita europea di Iveco, così come i servizi di assistenza e i canali di garanzia, per accelerare il proprio ingresso nel mercato europeo.


CAMBIA PROSPETTIVA A AL TUO BUSINE ESS

NUOVO DAIL LY FU FULL ULL OPTIONAL A

TUO A 23.900€ 2 € IINCLUSI 3 ANNI O 120.000 KM DI GARANZIA A COMPLET TA E MANUTENZIONE N ORDINARIA*

E IN PIÙ Ù SU TUTTO IL RESTO DEL LLA GAMMA DAILY Y SUP PERVA ALUTA AZ ZIONE

FINO A 5.0 000€

**

Radio DAB B Bluetooth con comandi al volante, Business UP e Connectivity box per essere sempr mpre attivi e connessi. Ser vosterzo elettrico con modalità CITY Y, ST TAR RT&ST TOP P, Cr uise Control, Freno di stazionamento o elettrico, Crosswind Assist, Hill H Descent e Traction Plus pe er viaggiare rilassati e sicuri. Cl Clima, ima,, Sensori di parcheggio e Q Quadro str umenti TFT per il massimo comfort di guidaa e di manovra. E in più, nuovi uovi motori e nuovi servizi perrsonalizzati. Il Nuovo Daily è daavv vvero la soluzione di trasp por to più completa e su misuura per il tuo business.

CORRI IN CONCESSIONARIA O CHIAMA SUBITO IL NUMERO VERDE ! lun-ven 8-20 / sabato 8-12

3JJIV XE ZEPMHE TVIWWS PI GSRGIWWMSREVMI -:)'3 EHIVIRXM I WEPZS IWEYVMQIRXS WGSV XI ½RS EP :EPSVI HM JSVRMXYVE º WY QSHIPPS 7: TEWWS  , GSR 'PMQEXM^^EXSVI QERYEPI 6EHMS (%& &PYIXSSXL GSR GSQERHM EP ZSPERXI I &YWMRIWW94'SRRIGXMZMX]FS\:ERSETIV XSGSR97&HMVMGEVMGE7IV ZSWXIV^SIPIXXVMGSGSRQSHEPMXk'-8=78%68 78347IHMPIEYXMWXEÂ&#x201E;PMFIV XkQSPPIKKMEXS'V YMWI'SRXVSP5YEHVSWXV YQIRXM8*8%MVFEKKYMHEXSVI7IRWSVMHMTEVGLIKKMS4SV XITSWXIVMSVM GSRETIV XYVEÂ&#x201E;8IV^SWXSTGSRPYGIWTSX6YSXEHMWGSV XE4SV XEV YSXEHMWGSV XEIWXVEMFMPI*VIRSWXE^MSREQIRXSIPIXXVMGS*IRHMRIFFME'VSWW[MRH%WWMWX,MPPHIWGIRXI8VEGXMSRTPYWRIMGSPSVMHMWIVMI7TIWITVEXMGEIVA, traspor to e messa su strada IWGPYWI  0´SJJIV XE MRGPYHI MP GSRXVEXXS HM QERYXIR^MSRI I VMTEVE^MSRI <00MJI   ERRM S  OQ XSXEPM EP VEKKMYRKMQIRXS HIP TVMQS HIM HYI PMQMXM  4VMQE HIPPE WSXXSWGVM^MSRI r RIGIWWEVMS TVIRHIVI ZMWMSRI HIPPI 'SRHM^MSRM 'SRXVEXXYEPM I HIM Set Inffor ormativi,, disponibili presso le concessionarie aderenti allâ&#x20AC;&#x2122;iniziativa. ** -RTMÂ&#x20AC;WYTIV ZEPYXE^MSRIHIPXYSYWEXS)YVS)YVS)YVS)YVS)YVSI)YVS½RSEHYRQEWWMQSHMºMRGEWSHMEGUYMWXSHMYR(EMP]2EXYVEP4S[IVI½RSEHYRQEWWMQSHMºMRGEWSHMEGUYMWXSHMYR(EMP](MIWIPEWIGSRHEHIPPE XMTSPSKMEIHIPPIGSRHM^MSRMHIPZIMGSPS3JJIV XEZEPMHEWYMZIMGSPMMRTVSRXEGSRWIKREIRSRGYQYPEFMPIGSRPITVSQS^MSRMETVI^^SRIXXS-QQEKMRIETYVSWGSTSMPPYWXVEXMZS1IWWEKKMSTYFFPMGMXEVMSGSR½REPMXkTVSQS^MSREPI *


IL MONDO DEI TRASPORTI

Pagina 20

N° 284 / Novembre 2019

tutte le operazioni e tutti i processi tengono conto e mirano alla sostenibilità ambientale, al minor consumo possibile di carburanti e al corretto trattamento di tutti i rifiuti derivanti dalla nostra attività. Abbiamo sviluppato l’ot timizzazione gestionale del percorso e sistemi di controllo di guida per i nostri con ducenti, che ci aiutano sempre in questo importante

compito”. Alla domanda su quale sia la chiave di differenza che distingue l’azienda portoghese dai principali competitor, Stefano Santini spiega che “la cultura di Laso è questa: superare qualsiasi ostacolo per i nostri clienti. Andiamo ovunque sia possibile, affrontando le sfide che ci pone il mercato internazionale dei trasporti, anche con soluzioni intermo-

dali. Abbiamo la grande disponibilità di una flotta moderna e completa, che ci consente di fornire servizi in modo più efficiente e competitivo, affidata a un team di oltre 1.000 dipendenti esperti. Siamo presenti in 2 continenti e in 8 paesi, per un totale di 14 uffici che lavorano come giocatori di un’unica squadra. Inoltre, grazie alle competenze e alle capacità dei nostri collaboratori, riusciamo a garantire economia di tempi e risorse anche nella gestione dei permessi e delle scorte necessarie al trasporto eccezionale, assicurando servizi veloci e professionali che tutelano sempre la consegna delle merci”. Quali sono le ambizioni e aspettative relativamente allo sbarco in Italia? “Laso Italia Srl con la sua sede di Firenze ci permette di essere più vicini ai clienti, e di seguirli direttamente proponendo soluzioni ancora più competitive afferma Santini - Abbiamo l’obiettivo di aumentare il numero dei servizi e il volume di affari che abbiamo in Italia, con investimenti che ci faranno essere sempre più efficienti. Attualmente, la sede di Laso Italia è composta sia da personale amministrativo che commerciale, con la previsione di raddoppiare lo staff entro la fine del prossimo anno, per poi completare nel 2021 lo sviluppo della struttura con l’acquisizione di mezzi in loco e sezioni specifiche per logistica e manutenzioni”. Come si organizzerà Laso Italia sul piano dell’assistenza? “Rispondiamo alle richieste dei nostri clienti - conclude Stefano Santini - attraverso il nostro team di vendita internazionale, di cui fa parte il team Italia, con la nostra flotta e con una rete di partner non solo internazionali ma anche locali, che ci consente di offrire qualsiasi soluzione di trasporto eccezionale e logistica pesante, servizi di movimentazione carichi, groupage e trasporti espressi diretti”.

ni e che sia straordinariamente divertente da guidare”, ha dichiarato Maurizio Calugi, Direttore Customer Services&Parts Mercedes-Benz Trucks e Fuso. Il monopattino è caratterizzato da un telaio di colore grigio siderale: sul tubo del manubrio c’è in risalto la Stella Mercedes-Benz e il claim

“Trucks you can trust”. Le ruote ammortizzate garantiscono stabilità e guida sicura su ogni tipo di superficie, adattandosi perfettamente a qualsiasi terreno in un contesto urbano. Raggiunge una velocità massima di 25 km/h e vanta un’autonomia di 25 km. Il telaio ripiegabile in un solo movimento per mette di

portarlo con sé sul truck ma anche sul treno, sul tram e nel bagagliaio dell’auto. È progettato per evitare sprechi energetici e inquinamento ambientale, oltre a essere dotato della funzione di cruise control e di un’app dedicata per definire i settaggi del mezzo e monitorare l’autonomia della batteria.

LA MULTINAZIONALE PORTOGHESE SCOMMETTE SUL NOSTRO PAESE

Italia presa al Laso NATA NEL 2007 E OGGI LEADER EUROPEO NEL SETTORE DEI TRASPORTI ECCEZIONALI, IN GRADO DI FORNIRE QUALSIASI LASO SCOMMETTE SULL’ITALIA INAUGURANDO LA SUA PRIMA SEDE TRICOLORE NEL TERRITORIO DI FIRENZE, IN QUEL DI CALENZANO. “I NOSTRI FATTORI CRITICI DI SUCCESSO SONO TRE: LE MIGLIORI E PIÙ MODERNE ATTREZZATURE AL MONDO, ECCELLENTI SISTEMI GESTIONALI, UN TEAM DI STRAORDINARI PROFESSIONISTI FORTEMENTE MOTIVATI”, AFFERMA CONVINTO STEFANO SANTINI, RESPONSABILE COMMERCIALE DI LASO ITALIA.

TIPOLOGIA DI SOLUZIONE INTERMODALE,

D

FABIO BASILICO CALENZANO

alle coste dell’Oceano Atlantico a quelle del Mediterraneo. La multinazionale portoghese Laso, leader europeo nel settore dei trasporti eccezionali e in grado di fornire qualsiasi tipologia di soluzione intermodale con un parco veicolare davvero ragguardevole, scommette sull’Italia inaugurando la sua prima sede tricolore nel territorio di Firenze, in quel di Calenzano. Stefano Santini, Responsabile commerciale di Laso Italia, ed Edgar Monteiro, Responsabile strategia e sviluppo di Laso, rispondono alle nostre domande. Quali sono le origini di Laso e quali i principali step della sua evoluzione? “Laso è nata il 2 maggio 2007 a seguito della fusione di due società, Lamarão e Solenha, con l’obiettivo di essere la migliore compagnia di trasporto merci e trasporti eccezionali in Portogallo - risponde Stefano Santini, Sales Manager che ha maturato varie esperienze in ambito commerciale, nel settore dei trasporti e delle soluzioni per la logistica - Gli anni seguenti fino al 2012 hanno visto la crescita e il consolidamento del business in Portogallo. Il 2013 segna invece l’inizio dell’in-

ternazionalizzazione dell’azienda, in Spagna e Africa (Mozambico, Marocco e Senegal) con la costituzione di società proprie o attraverso partnership: tutto il knowhow acquisito nel corso degli anni ha permesso a Laso di espandersi nei mercati più esigenti d’Europa, e nel 2019 Laso ha inaugurato le proprie sedi in paesi come Germania, Olanda e appunto Italia”. “I nostri obiettivi principali continua Santini - sono la crescita dell’azienda e la massima soddisfazione dei nostri clienti: sono loro la nostra forza e il nostro futuro, ed è proprio la volontà di essere più vicini a loro che ci ha convinti a sviluppare questo processo d’internazionalizzazione. I nostri fattori critici di successo sono tre: le migliori e più moderne attrezzature al mondo, eccellenti sistemi gestionali, un team di straordinari professionisti fortemente impegnati e motivati”. Qual è attualmente la composizione della flotta? “Al mo mento - spiega Edgar Monteiro - disponiamo di una flotta di oltre 700 veicoli, di varie tipologie e caratteristiche, che ci consentono di fornire infinite soluzioni di trasporto e movimentazione del carico. Collaboriamo con Mercedes-Benz e Volvo per le motrici, con Noteboom e

Goldhofer per i rimorchi”. Anche in Italia, dunque, Laso è pronta a fornire soluzioni per qualsiasi tipo di carico, indipendentemente dalle dimensioni e dal peso. “Abbiamo un dipartimento specializzato nei progetti di trasporto legati al settore energetico (trasformatori, parchi eolici e pannelli solari), vantando l’assemblaggio della maggior parte dei parchi eolici esistenti nella penisola iberica e dei maggiori trasporti effettuati in Portogallo - continua Monteiro - I nostri tecnici possono soddisfare le esigenze di una vasta gamma di settori di attività, tra cui industria metalmeccanica pesante, edilizia civile e lavori pubblici, calcestruzzo prefabbricato, componenti del vento, trasformatori, aeronautica”. Sul piano della sostenibilità ambientale quali sono le scelte di Laso relativamente alla flotta e al tipo di rotte? “Laso - risponde Santini - si impegna ogni giorno, in ogni sfida, per lavorare con valori condivisi e sistemi di controllo: qualità certificata e garantita, sicurezza, ambiente e responsabilità sociale sono parti integranti della sua cultura aziendale, nonché elementi indiscutibili per il miglioramento continuo dei servizi forniti e per la soddisfazione dei propri clienti. Pertanto,

MERCEDES-BENZ / Arriva il monopattino Segway

Città amica degli autisti N egli ultimi due anni Daimler Trucks ha investito mediamente oltre 2,5 miliardi di euro in attività di Ricerca & Sviluppo, di cui più di 500 milioni di euro destinati a temi come connettività, guida autonoma ed elettrificazione. L’obiettivo è offrire i migliori prodotti e servizi per una mobilità urbana delle merci e delle persone sempre più innovativa e sostenibile. In questo contesto, Mercedes-Benz Trucks Italia porta sul mercato italiano una soluzione di trasporto ecofriendly per i propri autisti, offrendo la possibilità, arrivati a

destinazione, di muoversi agevolmente su un monopattino elettrico nelle aree meno servite dal trasporto pubblico. Già da quest’estate, per la prima volta, è stato possibile acquistare il monopattino Segway firmato “Mercedes-Benz” presso la rete ufficiale Mercedes-Benz Trucks. Il monopattino elettrico modello Ninebot by Seg way Kickscooter ES2 è un mezzo di trasporto alternativo per il settore dei veicoli industriali pensato proprio per l’autista del truck, per agevolare la sua vita dopo una giornata di lavoro. È possibile inoltre ricaricare il mono-

pattino all’interno del veicolo. Il monopattino elettrico si sta diffondendo rapidamente nei grandi centri urbani, migliorando la mobilità nei piccoli spostamenti e offrendo una valida alternativa all’automobile. Ninebot by Segway brandizzato “Mercedes-Benz Trucks” è frutto di un’iniziativa ideata e voluta dal reparto Customer Services&Parts di Mercedes-Benz Trucks Italia. “Come possiamo contribuire al miglioramento della vita dei nostri autisti? Offrendo loro uno strumento di mobilità che li agevoli nei piccoli spostamenti, che non inqui-

Stefano Santini, Responsabile commerciale di Laso Italia.


Gli altri parlano. Uno solo passa ai fatti. Il nuovo Actros. Portiamo il futuro sulla strada, grazie a numerose innovazioni come MirrorCam, Active Drive Assist, Multimedia Cockpit e Predictive Powertrain Control, che stanno rivoluzionando il trasporto a lungo raggio. Scopri il nuovo Actros da MERBAG o su merbag.it

MERBAG S.p.A. Concessionaria UďŹ&#x192;ciale di Vendita e Assistenza Mercedes-Benz Veicoli Industriali LAINATE - Via Scarlatti, 1 - SAN GIULIANO M.SE - Via Pedriano, 37 Tel 02 3025.1 - www.merbag.it


IL MONDO DEI TRASPORTI

Pagina 22

N° 284 / Novembre 2019

BRIDGESTONE EUROPE / Nasce Webfleet Solutions dopo l’acquisizione di Tomtom Telematics

Nuove competenze digitali A SEGUITO DELL’ACQUISIZIONE DI TOMTOM TELEMATICS, BRIDGESTONE EUROPE HA RESO OPERATIVO IL NUOVO NOME SOLUTIONS”. L’ACQUISIZIONE DI TOMTOM TELEMATICS CONFERMA L’AMBIZIONE DI BRIDGESTONE DI RAFFORZARE LE PROPRIE COMPETENZE DIGITALI, COME PARTE DEL SUO PROCESSO DI TRASFORMAZIONE DA PRODUTTORE DI PNEUMATICI PREMIUM A LEADER NELLE SOLUZIONI PER LA MOBILITÀ. BRIDGESTONE FORNISCE OLTRE 1,2 MILIONI DI VEICOLI NELL’AREA EMEA CON SOLUZIONI AVANZATE DEDICATE ALLE FLOTTE E SERVIZI DI MOBILITÀ IN ABBONAMENTO. DELL’AZIENDA, “WEBFLEET

P

LINO SINARI VIMERCATE

rosegue a ritmi serrati lo sviluppo digitale di Bridgestone. Il produttore fornisce oltre 1,2 milioni di veicoli nell’area EMEA con soluzioni dedicate alle flotte e servizi di mobilità in abbonamento. Un ruolo leader ribadito dopo l’acquisizione di TomTom Telematics, avvenuta lo scorso 1° a pri le 2019, iniziativa che ha portato Bridgestone Europe a rendere operativo il nuovo no me dell’azienda, “Webfleet Solutions”, ufficializzato dal 1° ottobre. L’acquisizione di TomTom Telematics conferma l’ambizione di Bridgestone di rafforzare le proprie compe-

tenze digitali, come par te del suo processo di trasformazione da produttore di pneumatici premium a leader nelle soluzioni per la

mobilità. La nuova azienda del Gruppo Bridgestone è il provider numero uno in Europa di soluzioni per le flotte, un’in dustria che

vanta tassi di crescita a doppia cifra. Il processo consolida il ruolo di Bridgestone nel settore delle soluzioni di mobilità basate sull’acquisizione di dati, che rendono la gestione delle flotte più efficace ed efficiente. Webfleet Solutions - il nome trae ispira-

zione dalla piattaforma Webfleet, leader nelle soluzioni telematiche per le flotte da oltre 20 anni - riflette l’ambizione del produttore di fornire ai propri clienti una vasta gamma di soluzioni per la mobilità digitale e per le flotte, consolidando così la propria lea-

dership a livello globale. Il CEO e Presidente di Bridgestone EMEA, Paolo Ferrari, commenta così questo importante annuncio: “Quando abbiamo acquisito Webfleet Solutions all’inizio dell’anno, abbiamo creato un punto di riferimento internazionale per le soluzioni dedicate alle flotte. Insieme, abbiamo le competenze per essere leader in quello che pensiamo essere un settore di grande interesse e in fortissima ascesa. Abbiamo ambizione, infrastrutture e risorse, dati, idee e un gruppo di persone con una conoscenza impareggiabile in questo ambito. In un mondo sempre più caratterizzato da un concetto di mobilità connessa e autonoma, Bridgestone e Webfleet Solutions insieme faranno in modo che i nostri clienti possano approfittare di tutti i vantaggi di questa nuova era”. Proprio come avvenuto sin dalla conferma di questa acquisizione, i team di Bridgestone e Webfleet Solutions continueranno a esplorare nuove opportunità e a innovare insieme, per garantire la crescita del business e portare un valore aggiunto ai clienti.

ALLISON / Prodigi norvegesi con gli Scania G500 6x6 dotati di trasmissione Serie 4500

Mezzi d’opera versus dumper

L

MARCO CHINICÒ

CRESCIUTI DI DIMENSIONI E SONO

HØYANGER

a Norvegia è alle prese con i giganti del trasporto. Nel corso degli anni, i dumper sono cresciuti di dimensioni e sono diventati troppo grandi per essere guidati sulle strade pubbliche. Nell’efficiente Paese scandinavo, il problema è stato risolto affiancando i dumper con potenti mezzi d’opera. È quanto accaduto alla Per A Øren di Høyanger, azienda di trasporti che ha investito in Scania G500 6x6 equipaggiati con trasmissioni Allison Serie 4500 completamente automatiche con rallentatore idraulico. Finora, sono tre i veicoli di questo tipo operativi e altri sono in arrivo. Høyanger è un piccolo comune con circa 4mila abitanti, ma con una realtà industriale molto sviluppata. La Per A Øren è stata fondata nel 1925 e oggi si è trasformata in un’a zienda di trasporti versatile, in grado di offrire una gamma di servizi completa. Per molto tempo, i servizi di trasporto sono stati i più richiesti ma, dal 2009, le attività nel settore delle costruzioni sono le più importanti. Lasse Øren è a capo del reparto Construction: “In passato, avevamo molti dumper in azienda, ma quando sono diventati troppo grandi per funzionare sulle strade pubbliche, abbiamo cercato delle alternative. Stangeland, una ditta di trasporti molto grande, aveva gli stessi nostri problemi e li aveva risolti insieme a Scania. Qualche anno fa, abbiamo avuto modo di vedere il loro nuovo G500 6x6 con ruote extralarge in una fiera del settore e abbiamo pensato che sarebbe stato perfetto anche per noi”.

NEL CORSO DEGLI ANNI, I DUMPER SONO

DIVENTATI TROPPO GRANDI PER ESSERE GUIDATI SULLE STRADE PUBBLICHE. IN

NORVEGIA, IL PROBLEMA È STATO RISOLTO AFFIANCANDO I DUMPER CON POTENTI MEZZI D’OPERA.

È QUANTO A ØREN DI HØYANGER,

ACCADUTO ALLA PER

AZIENDA DI TRASPORTI CHE HA INVESTITO IN

SCANIA G500 6X6 EQUIPAGGIATI CON TRASMISSIONI ALLISON

SERIE 4500 COMPLETAMENTE AUTOMATICHE CON RALLENTATORE IDRAULICO.

Oggi, Per A Øren dispone di tre mezzi da cantiere che svolgono lo stesso compito dei restanti dumper. L’interesse tra gli altri trasportatori è grande e l’azienda riceve spesso richieste di informazioni sui nuovi mezzi d’opera. “Si può quasi parlare di una nuova tendenza - commenta Øren - Vedo molti vantaggi, soprattutto il fatto che gli Scania possono funzionare sulle strade pubbliche. Sono più economici dei dumper sia a livello di prezzo sia nel funzionamento, hanno un’elevata altezza da terra e sono più veloci da caricare e scaricare. La trasmissione completamente automatica Allison garantisce l’avvio a

pieno carico anche su una salita ripida. Il consumo di carburante è inferiore e i costi di manutenzione della trasmissione sono minimi. In realtà sono previsti solo interventi di servizio per la sostituzione dell’olio e dei suoi filtri”. Uno dei veicoli è stato testato anche con ruote standard piuttosto che extralarge. “Funziona perfettamente e offre caratteristiche stradali come ogni altro autocarro da cantiere”, precisa Lasse Øren. I nuovi autocarri sono i primi nella storia dell’azienda a essere equipaggiati con trasmissioni completamente automatiche Allison. Altri veicoli del l’azienda sono dotati di

cambi manuali automatizzati, i cosiddetti AMT. “Siamo molto soddisfatti del funzionamento delle trasmissioni conclude Øren - Sono molto affidabili e cambiano le marce in modo fluido e piacevole. Anche se il comfort del con ducente nei moderni dumper è diventato migliore, c’è ancora molta strada da fare per arrivare ai nostri nuovi Scania. Abbiamo appena ricevuto un nuovo incarico per cui questi veicoli da cantiere sarebbero perfetti. Non mi sorprenderebbe se entro un anno investissimo in un altro paio di questi mezzi d’opera. Naturalmente, saranno dotati di automatici Allison”.


IL MONDO DEI TRASPORTI

Pagina 24

N° 284 / Novembre 2019

LUCIANO TRASPORTI / IL FONDATORE RAFFAELE GUERRA RACCONTA L’ESCALATION DELL’AZIENDA BARESE

Servizio impeccabile sulle rotte europee ATTIVO NEL MONDO DEL TRASPORTO FIN DAGLI ANNI OTTANTA, RAFFAELE GUERRA, “LUCIANO” PER AMICI E CONOSCENTI, È UN AUTENTICO SELF-MADE MAN, UNA PERSONA IL CUI SUCCESSO SOCIALE E PROFESSIONALE È DOVUTO ALLA SUA FORZA DI VOLONTÀ E AL SUO SPIRITO DI SACRIFICIO. OGGI LUCIANO TRASPORTI È UNA DELLE REALTÀ PIÙ DINAMICHE NEL COMPETITIVO SETTORE DEI TRASPORTI A TEMPERATURA CONTROLLATA. PARTENDO DALLA PUGLIA, I TRUCK DELL’AZIENDA DI CAPURSO DI BARI PERCORRONO LE ROTTE NAZIONALI E INTERNAZIONALI GARANTENDO AI CLIENTI UN SERVIZIO DI QUALITÀ.

S

PAOLO ALTIERI CAPURSO DI BARI

u strada i truck hanno ben in vista il nome di un’azienda pugliese, la Luciano Trasporti, che in oltre trent’anni di attività ha saputo conquistarsi un posto di primo piano nel settore dei trasporti a temperatura controllata. In realtà, il fondatore e titolare della Luciano Trasporti Srl si chiama Raffaele Guerra, imprenditore originario di Triggiano (Ba) che da pic colo veniva chiamato “Raffaelluccio” e da grande soprannominato “Luccio”, da cui poi è derivato “Luciano”. Miracoli del dialetto e coincidenze fortuite del destino. Raffaele Guerra, classe 1964, è uno che la passione per i camion ce l’ha nel sangue e che con identica consapevole determinazione svolge quotidianamente il suo lavoro all’insegna della professionalità e della qualità del servizio. Lo dimostrano i risultati della Luciano Trasporti, attiva sia su rotte nazionali che internazionali, e la lista di clienti che si rivolgono con fiducia all’azienda con sede operativa a Capurso (Ba) - dotata di officina interna e carrozzeria - e sede legale a Triggiano. E sempio di dedizione e umiltà, Raffaele Guerra è riuscito nel l’altrettanto difficile impresa di trasmettere la “voglia di fare questo mestiere” ai suoi trenta collaboratori, in primis ai due figli Toni e Luca che sono già entrati in azienda e agli altri due, Giovanni e Fabio, che lo saranno in futuro. Siamo andati a Capurso, comune a pochi chilometri da Bari, per incontrare Raffaele Guerra e farci raccontare la sua storia e quella della Luciano Trasporti. “Mi sono impegnato in questa attività per mia iniziativa personale, visto che mio padre Giovanni faceva tutt’altro - esordisce Raffele Guerra - Ho iniziato a fare l’autotrasportatore sicuramente per passione ma anche per necessità. Nel 1986 comprai il mio primo camion, un Volvo FL usato, con il quale facevo consegne. Poi piano piano, l’attività si è ampliata, sono arrivati i clienti e oggi la Luciano Trasporti, vanta una flotta di 120-130 tra motrici e trattori multimarca con una netta prevalenza di Volvo, a cui vanno aggiunti oltre cento tra rimorchi e semirimorchi, in prevalenza Schmitz. Gli ultimi due-

tre anni l’attività ha subito una profonda evoluzione a seguito del forte aumento della richiesta. Lavoriamo bene e i clienti grazie a Dio non mancano”. La scelta di avvalersi soprattutto di veicoli Volvo Trucks e Schmitz Cargobull non è casuale, ma frutto di attenta valutazione. “Era un Volvo il primo camion che ho avuto, naturale che sviluppassi una sincera passione per il brand. Per quanto riguarda Schmitz Cargobull è stata ed è tuttora una scelta di qualità: ci troviamo bene e conosciamo bene il prodotto”. Raffaele Guerra ironizza sul suo cognome e dice che la sua è una “quotidiana battaglia lavorativa, impegnato come sono su tutti i fronti”. Gli chiediamo di spiegarci quali sono oggi le principali difficoltà e le sfide che un imprenditore dei trasporti è costretto ad affrontare in un contesto economico profondamente mutato e senza dubbio più complesso rispetto al passato. “Innanzitutto si deve tener conto che i clienti sono molto più esigenti e hanno tutte le ragioni per esserlo - risponde

Guerra - Oggi per sta re in linea si deve fornire un servizio impeccabile. Per questo ti devi avvalere di collaboratori efficienti, a cominciare dagli autisti: non è facile trovarli ed è ancora più difficile avere la garanzia della massima professionalità. Ci sono persone che bussano alla porta per cercare un posto di autista ma non hanno esperienza e io non posso certo per mettermi di metterli su strada al volante di

Raffaele Guerra, fondatore e titolare della Luciano Trasporti. Sotto, Toni Guerra, uno dei figli.

un truck mettendo a rischio la loro vita e quella degli altri. In generale, poi, il sistema economico è oggi estremamente competitivo e questo richiede una grande capacità di gestione e controllo della propria attività. Tutto sommato però riusciamo ad andare avanti. Mi difendo cercando di mantenere l’unità della squadra anche grazie ai corsi di formazione su guida economica e guida sicura gestiti da Volvo -

lavorando sodo e tenendo sotto controllo la committenza. ”. Luciano Trasporti incrementa il suo fatturato di anno in anno. Nel 2018 sono stati consuntivati quasi 14 milioni di euro e nel 2019 l’azienda prevede di crescere ancora. “Nel periodo più difficile della crisi abbiamo fatto quadrato e puntato sulle migliori risorse che un’azienda familiare come la nostra è in grado

di generare - dice con orgoglio Raffaele Guerra - La mia famiglia è tutta impegnata in azienda: io mi occupo di amministrazione, mio figlio Toni, che ha 29 anni, è il responsabile dell’officina, l’altro figlio, Luca di 25, gestisce il traffico. Due altri figli al momento studiano ma prima o poi entreranno in azienda apportando da laureati nuove energie propositive: Giovanni ha 32 anni, Fabio è all’ultimo anno di Liceo. In azienda lavora anche mio nipote Marcello, che per me è come un figlio. Mia moglie Maria invece si occupa della contabilità ed è un pilastro fondamentale per tutta la nostra attività”. Il poco tempo libero Raffaele Guerra lo dedica proprio alla famiglia, alla quale è legatissimo. La sua giornata è ovviamente in gran parte dedicata alla sua creatura e al massimo impegno per soddisfare i numerosi clienti, tra cui alcune aziende di rilevanza internazionale del settore alimentare, come le italiane AIA, Sterilgarda e Orchidea Frutta o l’olandese Frankort & Koning. “Uno dei momenti più esaltanti che ricordo è quando mi chiamò l’azienda AIA di Verona che aveva individuato la Luciano Trasporti come trasportatore di riferimento - racconta commosso Raffaele Guerra - Quel riporre in noi tanta fiducia mi ha riempito di orgoglio. Con AIA lavoro da trent’anni senza alcun problema e con la massima dedizione, assicurando un servizio completo a livello nazionale, internazionale e anche locale. Disponiamo infatti anche di una piccola flotta di mezzi compatti che utilizziamo per le consegne locali. Si tratta di Iveco Daily allestiti per trasporto a

temperatura controllata”. Nei prossimi mesi, per la precisione da ottobre 2019 ad aprile 2020, si concretizzerà la fornitura di ben 30 nuovi Volvo FH 500 che entreranno a far parte di una flotta costantemente aggiornata. “Ci sono preoccupazioni di cui o gni giorno devo tener conto - ammette Raffaele - Innanzitutto soddisfare al meglio i clienti e poi avere la forza di portare avanti questa che è una vera e propria missione. Mi rendo conto che non posso più tornare indietro ma anche se lo potessi fare non ci riuscirei. Questa è la mia vita, sono appassionato di questo la voro che amo profondamente”. Da ragazzo Raffaele Guerra sognava di fare il pilota d’aereo: “Ricordo che un giorno, avevo sedici anni, andai alla Fiera del Levante dove, approfittando dello stand allestito dall’Aeronautica, feci domanda insieme ad altri due amici per diventare pilota. Dopo due mesi i due amici furono chiamati mentre a me non era arrivata nessuna comunicazione. Solo molto tempo dopo trovai in un cassetto la lettera di convocazione: mia madre l’aveva nascosta perché non voleva che andassi via. Il destino...”. A Raffaele è rimasta la voglia di volare alto e di non smettere mai di credere nella possibilità di esprimere al meglio le proprie potenzialità. “Ho studiato fino alla terza media e ho imparato tutto dalla strada commettendo errori che mi hanno fatto crescere - racconta ancora - Considero tuttavia lo studio e l’istruzione fondamentali per riuscire a costruire qualcosa di valido e di durevole”. E la Luciano Trasporti ne è valido esempio: “Siamo arrivati a essere la più grande azienda di trasporti a temperatura controllata della Puglia e questo ci sprona a fare ancora di più e meglio - continua Raffaele Guerra - Oltre alla sede operativa di Capurso abbiamo una sede distaccata al Nord, a Cerea (Vr), con un ufficio, due dipendenti, un capannone di 1.000 mq con 6 ribalte e 12mila mq di piazzale. La sede veronese ha richiesto un investimento di 500mila euro. Prossimamente, indicativamente nel 2020, prevediamo di aprire una sede in Germania, nella zona di Stoccarda”. Amante dello sport, juventino di ferro, Raffaele Guerra è attento anche alla realtà locale della sua terra e da qualche tempo sponsorizza il Rugby Bari dove milita uno dei suoi figli. “Consolidarsi e crescere è assolutamente necessario e noi ce la mettiamo tutta - conclude Raffaele Guerra - C’è voglia e volontà di andare avanti da parte di tutti, con umiltà e dedizione. Non sono mai stato invidioso dei miei concorrenti, anzi li ammiro e li prendo da esempio, soprattutto se sono più grandi di me. In questo mestiere non si finisce mai di imparare”.


IL MONDO DEI TRASPORTI

Pagina 26

N° 284 / Novembre 2019

PER SFRUTTARE AL MEGLIO LE INNOVAZIONI TECNOLOGICHE DEL MARCHIO TEDESCO

Gli autisti di Cedica Logistica ai corsi di MAN ProfiDrive

A

VALENTINA MASSA

GUIDONIA MONTECELIO

utisti professionisti in grado di sfruttare al meglio tutte le innovazioni tecnologiche presenti sui veicoli MAN. Sono queste le motivazioni che hanno spinto Cedica Logistica, che vanta nella sua flotta 14 trattori e motrici MAN TGX, a partecipare al corso MAN Pro fiDrive volto a spiegare agli autisti come viaggiare più sicuri, ridurre i consumi di carburante e lo stress rispettando la meccanica dei veicoli. Cedica Logistica è una giovane azienda di Guidonia Mon tecelio, alle porte di Roma. Sono nove anni, per la precisione dal 2010, che tre intraprendenti autotrasportatori l’hanno creata e fatta crescere, al punto che oggi conta ben 130 dipendenti, magazzini per un totale di 7000 mq e una flotta di un centinaio di veicoli, sia commerciali che industriali. Chi ha avuto l’intuizione per dare vita a questa impresa è Federico Di Carlo, 46 anni, che opera mondo del trasporto da quando ne aveva 20 co me autista e magazziniere. “È stata mia l’idea di coinvolgere Giuliano Cerrone e Giuseppe Caucci in

questa avventura - spiega Di Carlo - Tutti lavoravamo come autotrasportatori nell’ambito di alcune cooperative, ma mi sono accorto che i grandi committenti, soprattutto nel comparto della GDO, preferivano operare con referenti solidi, aziende consolidate, ma soprattutto davano all’attività logistica un ruolo sempre più preminente. È così che ho pro posto ai miei due soci di costituire una Srl e sviluppare, al fianco del trasporto, anche servizi logistici. Eravamo alla vigilia di una piccola rivoluzione nell’ambito della di stri buzione, soprattutto a medio e corto raggio, e noi ci siamo fatti trovare pronti”. È facile intuire come il nome della società sia l’acronimo delle iniziali dei tre fondatori, ma è anche interessante notare come la prima fortunata intuizione sia stata poi seguita da altre scelte imprenditoriali azzeccate. “Fin dall’inizio abbiamo puntato sulla qualità e puntualità del servizio prosegue Di Carlo - Il nostro veicolo più vecchio ha solo 36 mesi di servizio e non esitiamo ad allestire modelli su misura per le singole mission: per esempio, per garantire le consegne nel centro di Roma anche di notte, abbiamo

AL CORSO MAN

PROFIDRIVE VOLTO A COME VIAGGIARE PIÙ SICURI, RIDURRE I CONSUMI DI CARBURANTE E LO STRESS RISPETTANDO LA MECCANICA DEI VEICOLI.

LA FLOTTA DI CEDICA LOGISTICA

COMPRENDE TRATTORI E MOTRICI TGX.

sviluppato dei gruppi frigoriferi autonomi grazie a batterie tampone molto silenziose”. “Ovviamente siamo attenti all’impatto ambientale delle nostre attività - continua Di Carlo - anche per ché lo sono anche i nostri com mittenti, quindi cerchiamo sempre di creare il minore disagio possibile alla popolazione. Scegliamo veicoli a basse emissioni, silenziosi e af fidabili per arrivare alla con segna sempre puntuali. Non vedo l’ora di poter mettere alla prova i nuovi MAN eTGE

ed eTGM elettrici co me stanno già facendo alcuni nostri colleghi austriaci, perché per noi il trasporto sostenibile non è solo uno slogan ma la realtà quotidiana”. La sede operativa e amministrativa della Cedica Logistica si trova a Guidonia Mon tecelio, presso il CAR (Centro Agroalimentare di Roma), a pochi chilometri dalla capitale e da qui partono gran parte delle consegne per la città. “La maggior parte dei nostri trasporti sono di generi alimentari a temperatura controllata per conto di varie catene della GDO spiega Di Carlo - Il nostro raggio operativo è prevalentemente in Centro Italia, in Lazio, Toscana, Umbria, Marche e Abruzzo, ma abbiamo anche due piccoli distaccamenti a Novara e Padova, perché cerchiamo di gestire tutto attraverso la nostra filiera interna, quindi con prese in tutta Italia e distribuzione prevalentemente nelle regioni citate. Proprio per garantire i collegamenti sulle lunghe tratte abbiamo recentemente inserito nella no stra flotta 10 trattori MAN TGX 18.500 e quattro motrici MAN TGX 18.460 con allestimento isotermico. Si tratta di veicoli su misura per le nostre esigenze, sono equipaggiati con sospensio-

ni pneumatiche e tutte le più recenti dotazioni di sicurezza, dal cruise control ACC al sistema di frenata d’emergenza EBA, per garantire ai nostri autisti di viaggiare nel massimo comfort e sicurezza”. Sistemi di supporto alla gui da evoluti che bisogna però utilizzare al meglio e qui si inseriscono i corsi MAN ProfiDrive ai quali un buon numero di autisti di Cedica Srl ha già preso parte, alcuni nelle due sessioni che si sono svol te presso il MAN Center Roma e altri in quella che gli esperti formatori MAN ProfiDrive hanno tenuto direttamente presso la sede della nostra azienda. “Come dicevo all’inizio prosegue Di Carlo - vogliamo curare ogni dettaglio del nostro servizio. Se i veicoli sono importanti, altrettanto importante è che chi li guida conosca tutte le potenzialità delle moderne tecnologie di bordo. È per questo che ho molto apprezzato i corsi ProfiDrive di MAN e ho accettato con entusiasmo l’offerta di tenerne uno presso la nostra sede, personalizzato sul le nostre esigenze. L’ottimo Pagina 3/3 bilanciamento tra la teoria in aula e la pratica alla guida del camion, permette all’autista di conoscere tutte le opportunità offerte dai sistemi in dota-

La nuova MAN Driver App valido supporto per conducenti e aziende

M

DECISO DI PARTECIPARE

SPIEGARE AGLI AUTISTI

I MAN TGX trattori e motrici rispondono efficacemente alle esigenze di Cedica Logistica.

La connessione che facilita il lavoro

AN ha messo a disposizione del pubblico la sua nuova Driver App, valido e moderno supporto a disposizione di autisti e aziende per semplificare le quotidiane attività di guida e di gestione dei trasporti e delle consegne. La MAN Driver App è una preziosa alleata prima, durante e al termine di ogni viaggio. Ancor prima di accedere in cabina l’autista, utilizzando la funzione “controlla” della app, può rilevare l’eventuale presenza di danni o anomalie al veicolo. Informazioni dettagliate sul danno o sull’anomalia rilevati possono essere inviate in tempo reale alla propria azienda, la quale, tramite il collegamento alla piattaforma RIO, può tenere sempre monitorato lo status dei propri veicoli. Dopo una velo-

LA GIOVANE AZIENDA DI GUIDONIA MONTECELIO, ALLE PORTE DI ROMA, HA

ce valutazione del veicolo esternamente, l’autista accede in cabina per iniziare la giornata di lavoro. Una volta a bordo, può utilizzare un’altra utile funzione: cliccando sulla voce “manual” può ricevere tutte le informazioni tecniche relative ai pulsanti presenti sulla strumentazione di bordo così come delle eventuali spie luminose. Per ottenere informazioni o validi suggerimenti è sufficiente scansionare il pulsante o la spia. Sapere di poter sempre contare sul supporto tecnico di un’officina MAN, ovunque ci si trovi, è garanzia di tranquillità e consente di svolgere il proprio lavoro in modo più rilassato: sulla app l’autista può individuare, alla voce “trova MAN Service”, tutte le officine MAN presenti sul percorso

che deve compiere. Nel caso in cui si verifichi un guasto che non consenta all’autista di raggiungere autonomamente l’officina MAN più vicina, questi può utilizzare la MAN Driver App per contattare il servizio di assistenza MAN Mobile24, attivo tutti i giorni dell’anno 24 ore su 24. Una volta attivata la richiesta di soccorso, l’autista può seguire direttamente dalla app l’aggiornamento sui tempi di arrivo del veicolo di assistenza. La MAN Driver App, sviluppata appositamente per autisti e aziende titolari di veicoli MAN, consente di registrare, gestire e monitorare fino a 20 veicoli. È gratuita, semplice e intuitiva da utilizzare ed è disponibile sia nella versione iOS che Android.

zione al veicolo, senza stress, ma sensibilizzandolo e stimolandolo ad accrescere le proprie competenze. Posso affermare con certezza che dalle prime due e sperienze (la terza è troppo recente, ma sono tranquillo sui positivi risultati) abbiamo ottenuto dei riscontri oggettivi che hanno coinvolto un po’ tutti gli aspetti del nostro lavoro. Da una sensibile riduzione dei consumi, a un’ottimizzazione dello stile di guida dell’autista, più sicuro e rilassato, grazie all’utilizzo corretto e consapevole delle tec nologie di bordo e degli ausili alla guida, alla maggiore soddisfazione degli autisti che si sono sentiti gratificati di questa attenzione nei loro confronti e nei confronti della loro professionalità”. “Quest’ultimo aspetto uma no passa troppo spesso in secondo piano ma io che nasco come autista - conclude Di Carlo - capisco come la valorizzazione del ruolo del driver sia molto importante, anche solo per ridurre una possibile conflittualità aziendale, ma soprattutto per dar loro coscienza dell’importanza del ruo lo facendoli crescere professionalmente. Ritengo che questo sia un ulteriore aspetto positivo dei MAN ProfiDrive da tenere in grande considerazione”.


“Trasporto intelligente: freddo garantito grazie alle nostre soluzioni telematiche.” Jan Hermeling, KRONE Telematics

Il nostro Cool Liner e KRONE Telematics sono un team perfetto che vi toglie tante preoccupazioni per i vostri trasporti. L’interazione intelligente di trailer e KRONE Telematics vi consente di registrare facilmente online in qualunque momento posizione e temperatura dei vostri trasporti e persino di intervenire sul refrigeratore per effettuare delle modifiche. In questo modo, siete sempre in grado di documentare che le merci delicate affidatevi sono sempre in ottime mani. In sintesi, grazie alle nostre soluzioni, potete risparmiare sia sui tempi che sui costi e, anche nelle situazioni di stress, avete gli strumenti per tenere tutto sotto controllo.

Codice Cooler per informazioni.

Importatore per l’ Italia: REALTRAILER SRL, VIA DONELLA 2, 46029 SUZZARA MN, Tel. 0376/536809, info@realtrailer.it, www.realtrailer.it


IL MONDO DEI TRASPORTI

Pagina 28

N° 284 / Novembre 2019

EV INDUSTRIAL / CENTINATI KÖGEL E PIANI MOBILI TMT PER L’AZIENDA DI BRUSIO

Ferrari e l’arte del legno MULTINAZIONALE CON SEDI IN SVIZZERA E A TIRANO, POGGIA LE SUE RADICI NELL’ATTIVITÀ DI

PIETRO FERRARI, CHE NEGLI ANNI CINQUANTA INTRAPRENDE IL MESTIERE DI TAGLIABOSCHI.

CON

L’ARRIVO DEL FIGLIO ENNIO SI RAFFORZA LA COMPONENTE DI TRASPORTO PER L’EDILIZIA.

OGGI CON

LA TERZA GENERAZIONE

FERRARI ENNIO E PIERO È

AL TIMONE

UN RIFERIMENTO

M

MAX CAMPANELLA BRUSIO

uli, cavalli e motoseghe. È la vita del tagliaboschi, antico mestiere di chi abitava (e abita) in montagna, di chi pratica l’arte di vivere nei boschi. Ed è quello che faceva Pietro Fer rari nel lontano 1950 in quel di Brusio, nella zona mon tana al confine della Svizzera che guarda verso l’Italia. Già il bisnonno Ferrari, di

PER L’INTERA FILIERA DEL LEGNO.

o rigini bergamasche si era trasferito nel Canton Grigioni per dedicarsi al lavoro di boscaiolo. Ferrari Pietro tagliava la legna che poi consegnava alle segherie, che ai tempi funzionavano ad acqua. “La prima distribuzione a marchio Ferrari - racconta oggi Piero, 42 anni, nipote del fondatore - è iniziata con i cavalli, quando il nonno portava la legna alle segherie tra Brusio e Tirano”. Classe 1949, Ennio Ferrari, seconda generazione, af-

fianca il padre e negli Anni Settanta si mette alla guida dei primi camion con i quali viaggiavano i tronchi. In pieno boom dell’edilizia ha l’intuizione: perché non ampliare la flotta e portare il materiale a chi serve per costruire case? “Da quel momento - prosegue Pie ro sono arrivati i ribaltabili per l’edilizia, che tuttora rappresenta uno dei business dell’azienda”. È il 1977 quando nasce Ferrari Legnami & Costruzioni, specializzata nella

distribuzione di legname in Valposchiavo e nella vicina Valtellina per le segherie e di materiale di legno e derivati occorrente a tutte le aziende che operano nell’edilizia. Nel 1998, con l’arrivo della terza generazione, l’azienda si focalizza sempre più sul trasporto e il commercio di legname. Oggi Ferrari muove un volume di circa 50mila mc di legname e 150mila mc di cippato annui, grazie anche all’apporto di operai specializzati e macchinari al-

l’avanguardia, diventando così leader a livello europeo. La ditta Ferrari è operativa su tutto il territorio nazionale e internazionale (Italia, Germania e Austria). “Il nostro modus o pe randi - afferma Piero Ferrari - è garantire ai clienti una seria e puntuale fornitura di legna, legname e cippato, che parte dal bosco e arriva direttamente a domicilio: segheria, impianto di teleriscaldamento, magazzino edile o centrale di energia”. L’azienda è fornitore del-

l’intera filiera del legno, dal tronco al segato alle biomasse. Come impresa edile collabora ad esempio con Ferrovia Retica, occupandosi della manutenzione dei tratti ferroviari. La flotta è diversificata per effettuare molteplici lavorazioni, dallo scavo eseguito con mini escavatori a movimenti terra più ampi, dal trasporto di materiali di qualsiasi grandezza e peso (legno, fer ro, prefabbricato ecc. Il parco veicoli è costituito da tre trattori e 15 motrici, con Volvo Trucks come marchio principale. Per il trainato Ferrari utilizza sei piani mobili TMT per il trasporto legname e un centinato Kögel, cui si aggiungono veicoli di trazionisti esterni. L’anno scorso a Gera Lario, in occasione del Truck Team in the Valley, l’incontro con EV Industrial, Concessionaria Kögel e TMT per Lombardia, Emilia-Romagna, Piemonte, Val d’Aosta e Liguria. “Nel corso del 2018 - pre cisa Ferrari - abbiamo acquistato quattro TMT Conchiglia e due pianali, tutti in servizio sulla rotta Reggio Emilia-Valtellina. L’esperienza di EV Industrial con flotte di maggiori dimensioni e la preparazione e disponibilità del Direttore Commerciale (Alessandro Mele, ndr) ci hanno da to subito fiducia. Con loro c’è oggi un rapporto di amicizia: per quante trattative si possano fare, alla fine siamo entrambi interessati a dare al cliente finale un prodotto-servizio migliore possibile. Quan do si ha in comune quest’obiettivo la quadra si trova sempre”.

Da sinistra: Alessandro Mele, Direttore Commerciale EV Industrial; Piero, Matthias e Ennio Ferrari; Demes Ziliani e Michele Varamo, rispettivamente timoniere e Area Manager EV Industrial.

TRA I DIPENDENTI VOLTI DI PERSONE PRESENTI IN AZIENDA DA SEMPRE

PIERO FERRARI: “SIAMO UNA FAMIGLIA UNITA DALLO SPIRITO DI SERVIZIO” D al 2011 Ferrari si è costituita come società SA prendendo il nome definitivo di Ferrari Ennio e Piero e, aperta l’unità locale in Italia a Tirano, in provincia di Sondrio, si è consolidata come realtà multinazionale. Oggi l’azienda dà lavoro a 44 dipendenti oltre a 50 persone che, per conto di terzisti, operano esclusivamente per Ferrari.

Il gruppo aziendale nel suo complesso ha chiuso il 2018 con un ottimo risultato. “Quest’anno - afferma Piero Ferrari - prevediamo di aumentare ancora, considerato che il trend è positivo. Per la manutenzione abbiamo una nostra officina interna e ci serviamo della rete di officine autorizzate EV Industrial”. Grande appassionato di volo, nel 2011

Piero Ferrari - dopo aver studiato di notte e lavorato di giorno - ha conseguito il brevetto di pilota di elicotteri e oggi l’azienda utilizza gli elicotteri per il trasporto di legname da boschi e zone forestali. Punto di forza dei Ferrari, la presenza in azienda di persone che vi lavorano da sempre. “Lavorano con noi - dichiara Piero Ferrari

con orgoglio - persone che mi hanno visto crescere da bambino. Mio padre è sempre al nostro fianco con la sua grinta e oggi è con noi mio figlio Matthias di 14 anni. Siamo una famiglia unita e con spirito di servizio: mia mamma Nanda e mia moglie Francesca lavorano insieme negli uffici e rappresentano un riferimento per tutti noi”.


IL MONDO DEI TRASPORTI

Pagina 30

N° 284 / Novembre 2019

SCANIA / SEMPRE PIÙ FORTE LA PARTNERSHIP TRA DEALER E OFFICINA

ORVI Scandicar, tandem vincente

LA SEDE DI BERGAMO, ACCANTO A QUELLA DI

FIORENZUOLA D’ARDA, NASCE PER VOLONTÀ DI

CARLO CATTADORI, 78 ANNI, PERSONAGGIO CARATTERIZZATO DA UN’INNATA PASSIONE PER L’ASSISTENZA AI CAMION.

OGGI AL

TIMONE DELL’AZIENDA AL SUO FIANCO LA FIGLIA ALESSANDRA E DUE FIGURE DI RIFERIMENTO IN OFFICINA: IVO

FIANDRI

E IL NEO CAPOFFICINA

FERDINANDO TERRANOVA. “LA CHIAVE DI DIFFERENZA LA FACCIAMO CON LA DISPONIBILITÀ: NON CI TIRIAMO MAI INDIETRO DI FRONTE AL PROBLEMA DEL CLIENTE”, AFFERMA

I

MATTEO GALIMBERTI ORIO AL SERIO

n un mondo del trasporto che continua a evolversi, che chiede continuamente ai player di rivedere il proprio modello organizzativo, restano alcune certezze, alcuni pilastri fondamentali che i protagonisti hanno imparato ad apprezzare. “L’unione fa la forza” potrebbe dirsi, che nel caso di ORVI (Officina Riparazioni Veicoli Industriali) e Scandicar è qualcosa di

IVO FIANDRI. più: servire il trasportatore mettendo a frutto la propria esperienza e capacità, ciascuno nel suo ruolo. L’obiettivo è comune: soddisfare le esigenze del cliente, fare in modo che egli trovi il servizio Scania che si aspetta, quando acquista il veicolo così come quando gli serve assistenza. È un tandem che funziona, quello tra ORVI, storica officina del Grifone, e la Concessionaria Scandicar, che condividono la sede di Orio al Se-

rio, a pochi passi dall’aeroporto orobico. In un’area che si estende su una superficie complessiva di 11.500 mq, tro vano spazio 2.800 mq di area coperta destinata al servizio di officina e, accanto, gli uffici di Scandicar, con i suoi venditori truck e, ultimo acquisto, per il marchio Scania Bus. Le origini di ORVI risalgono a un giovanissimo Carlo Cattadori, classe 1940, che a 15 anni scalpita per fare il meccanico. Altri tempi, si di-

rebbe. In realtà tutta quella passione fanciullesca la si ritrova in questo straordinario personaggio che ha vissuto da protagonista gli anni evolutivi del trasporto su gomma nel nostro Paese. Primo figlio di un camionista di Cortemaggiore, in provincia di Piacenza, cresce con la passione per il veicolo industriale: i genitori lo mandavano a scuola in bicicletta, ma lui preferiva la via del ritorno quando, fatti dieci chilometri, andava a riparare i Lancia. “È stato -

racconta l’imprenditore - un marchio che mi ha accompagnato per lunghi anni. Quando mio fratello Franco è tornato dalla leva, con l’aiuto di mio padre abbiamo messo su l’officina a Fiorenzuola d’Arda. Mio padre ci ha lasciato im provvisamente: abbiamo dovuto rimboccarci le maniche e proseguire da soli”. L’anno cruciale è il 1974. Scania muove i primi passi di una nuova organizzazione che, alla sede Italscania di Trento, affianca una rete di

Da sinistra: Ivo Fiandri, Carlo e Alessandra Cattadori, il dottor Giuseppe Gardoni, Presidente Scandicar.

dealer. Carlo Bussetti in qualità di titolare e presidente del Cda da vita a Scandicar, società rilevata nel frattempo dalla Intercar, holding parmigiana del dottor Gian Ernesto Gandini, Concessionaria del marchio del Grifone da Reggio Emilia a Sondrio. Incrocia Cattadori e da quel momento nasce un tandem indissolubile, che si rafforza negli anni, man mano che cresce il business e va strutturandosi in Italia una nuova “mappa geografica” del trasporto su gomma. Nasce ORVI, con sede a Fio renzuola d’Arda, e una chiara mission: occuparsi dell’assistenza Scania a 360 gradi. “Bussetti - spiega Cattadori - aveva bisogno di un’officina autorizzata che gli garantisse alti livelli sul piano del servizio. Io e mio fratello Franco (tuttora responsabile e figura storica dell’officina di Fiorenzuola, ndr) credevamo nel marchio Scania, siamo an dati in Svezia a seguire i necessari corsi e tutto è cominciato da lì”. Il 1974 è, per Cattadori, anche l’anno della nascita della figlia Alessandra, che la madre Teresita por ta in fasce nella sede di Fiorenzuola: cresciuta in un mondo di appassionati dell’officina per camion, oggi è accanto al padre al timone dell’azienda. Il 1974 è anche l’anno dell’arrivo in ORVI di Ivo Fiandri, autentica colonna portante dell’assistenza: oggi è il riferimento per giovani che vogliano crescere professionalmente nell’assistenza ai camion. La successiva svolta nel 1984, quando Scania - affermatasi come marchio in Italia - cerca un’officina nell’area di Milano. Trova un riferimento in Cattadori, che apre la seconda sede di ORVI a Caponago, per spostarsi nel 1991 a Orio al Serio. “Abbiamo dovuto - spiega Fiandri riorganizzare il nostro modello di assistenza: a Milano il grosso della clientela era costituito da trasportatori di passaggio, molti dei quali stranieri; oggi in gran parte si tratta di aziende medio-piccole, fidelizzate, che trovano in noi estrema disponibilità. Non ci tiriamo indietro: qualunque sia il problema o l’orario, il cliente viene prima di tutto”. Oggi ORVI Bergamo conta su 14 unità, di cui 12 meccanici. “Quest’anno - spiega Alessandra Cattadori - registriamo una crescita del fatturato del 5-6 per cento, grazie soprattutto al successo del veicolo a LNG (gas naturale liquido, ndr). C’è grande interesse per l’eco sostenibilità e Scania è sulla strada giusta: da parte nostra saremo impegnati a garantire manodopera specializzata. L’obiettivo è far crescere giovani risorse: stiamo collaborando con scuole del territorio per far rientrare l’apprendistato da noi nel percorso di studi”.

GIUSEPPE GARDONI: “LA QUALITÀ DEL SERVIZIO ALLA BASE DELLA FORMULA VINCENTE

BERGAMO CAPUT MUNDI: VOLANO LE VENDITE DEL GRIFONE, IMPAZZA L’LNG L a centralità del cliente è elemento primario su cui si fonda il tandem ORVI-Scandicar. “La scelta di affiancare - spiega Giuseppe Gardoni, Presidente Scandicar - alla riparazione di qualità di ORVI il servizio di vendita, post vendita e ricambi di Scandicar è alla base del successo della formula vincente. Il legame con ORVI è proseguito sempre, anche quando, nel 1991, siamo arrivati nella nuova sede di Orio che era praticamente immersa nel nulla, circondata com’era solo da campi. Oggi le due aziende sono un riferimento per tanti

trasportatori e trovano un supporto in funzione dei trend del mercato: siamo passati dagli anni del boom dell’edilizia a una profonda diversificazione del settore”. Qual è oggi la quota di mercato di Scania a Bergamo e provincia? “Se consideriamo il dato di settembre - illustra Gardoni - siamo al 24,4 per cento rispetto all’11 per cento dello stesso mese del 2018, una crescita cui ha dato notevole impulso il camion a LNG, con consegne importanti come 50 unità a Koinè e 14 a Italtrans, entrambe effettuate da Casa

Madre, e alcune realizzate da Scandicar come dieci trattori e due motrici a Gi.Ma Trans e tre trattori eccezionali e una motrice 8x4 con autogru a Rondi Trasporti. Il territorio bergamasco è in grande dinamismo: se consideriamo il volume complessivo di autocarri nell’area di Scandicar, tutte le province sono in calo tranne Bergamo, che cresce del 2,3 per cento”. In generale qual è il trend di Scania nell’area di competenza di Scandicar? “Sull’intero distretto - risponde il Presidente - abbiamo una quota in media del 19 per cento, rispetto

alla media che si attesta sul 17. Diverse flotte storiche, nonché aziende meno dimensionate, stanno valutando l’opportunità di inserire un veicolo LNG, sul quale credo molto. Inoltre puntiamo su Scania Bus, marchio su cui ORVI effettua assistenza: Bergamo è un’area caratterizzata da tante aziende di servizio che ruotano attorno all’aeroporto. Per rafforzare le vendite abbiamo inserito nel team una nuova figura di venditore, che condividiamo con Scania Milano, specializzato nel settore del trasporto passeggeri”.


‘‘Centro assistenza Carrier Transicold’’

Assistenza gruppi frigoriferi genset e sponde idrauliche per autocarri

Ale-Fri - Viale Einstein, 3 - 15053 - Castelnuovo Scrivia


IL MONDO DEI TRASPORTI

Pagina 32

N° 284 / Novembre 2019

SPEZZANO TRASPORTI / LA SCELTA DI SCANIA LNG PER LA DISTRIBUZIONE DI OROGEL

Il surgelato viaggia green L’AZIENDA DI CORIGLIANO CALABRO HA DECISO DI ARRICCHIRE LA FLOTTA CON VEICOLI DEL GRIFONE ALIMENTATI A METANO LIQUIDO. UNA SCELTA OROGEL CHE FA DELLA NATURALEZZA E QUALITÀ DEI SUOI VEGETALI FRESCHI SURGELATI UN TRATTO DISTINTIVO DEL PROPRIO BUSINESS. “OROGEL È IN FORTE ESPANSIONE CON ESIGENZE OGNI GIORNO PIÙ ELEVATE NELL’OTTICA DI GARANTIRE AL CONSUMATORE FINALE SALUTE E CIBO SANO - DICE CARMINE SPEZZANO - PER FARE QUESTO HA BISOGNO DI PARTNER E MEZZI AFFIDABILI”.

PONDERATA DALLA VOLONTÀ DI ASSICURARE UN TRASPORTO GREEN A

PAOLO ALTIERI CESENA

È nel segno della sostenibilità la proficua collaborazione instaurata tra Scania e Spezzano Trasporti di Corigliano Ca labro (Cs) che da alcuni anni è una delle aziende di riferimento per la distribuzione di Orogel, azienda produttrice di punta nel settore dei vegetali freschi surgelati. Spezzano ha deciso di arricchire la sua flotta multimarca, dove oggi gli Scania sono in maggioranza, con veicoli del Grifone alimentati a metano liquido. Una scelta ponderata dalla precisa volontà di assicurare un trasporto green a Orogel che fa della naturalezza, freschezza e qualità dei suoi prodotti un tratto distintivo del proprio business. A Cesena, nel quartier generale di Orogel, incontriamo Carmine Spezzano, fondatore e titolare della società che porta il suo no me e che dal 1980 opera nel settore del trasporto per conto terzi su tutto il territorio nazionale e internazionale e negli anni si è specializzata

nel settore alimentare. “Questa collaborazione spie ga Carmine Spezzano nasce fin da quando ho deciso di lavorare solo nel comparto dell’alimentare e con aziende primarie del settore. Orogel è un’azienda molto strutturata e con precisi valori e principi di riferimento. Negli anni abbiamo costruito un rapporto basato sulla reciproca fiducia e sulla massima professionalità.

La collaborazione è così stretta e proficua che con loro, e con l’allestitore emiliana A.s.t.a. Car, abbiamo predisposto un veicolo chiamato Valteco, semirimorchio con al ta tenuta termica che dà precise garanzie per la qualità e il mantenimento del prodotto in tutta la catena del freddo, a garanzia della salute dei consumatori finali. Siamo riusciti anche a ridurre il consu-

Franco Fenoglio, Presidente e Ad di Italscania (primo a destra) con i vertici di Spezzano Trasporti e Orogel.

mo di gasolio del 50 per cento. Inoltre, con lo specialista Kögel abbiamo lavorato sul telaio arrivando ad avere una soluzione molto scorrevole che consente al trattore di fare meno fatica nell’operazione di traino e quindi di consumare meno”. La forte propensione all’innovazione di Spezzano Trasporti ha portato il management calabrese a incrociare il gas naturale. “Insieme a Franco Fenoglio e a Italscania abbiamo iniziato questo percorso già da tempo - dice Carmine Spezzano - Anche se adesso con le nuove motorizzazioni Euro 6d le emissioni dei diesel sono fortemente diminuite parecchio. Quella del gas naturale, e in particolare del metano liquido che dà precise garanzie in termini di autonomia, è stata una scelta motivata che alla lunga si rivelerà vincente. La scelta di Scania è altrettanto ben motivata dal momento che i truck del Grifone hanno dato prova di essere affidabili nel tempo. Orogel è un’azienda in forte espansione con esigenze ogni

giorno più elevate nell’ottica di garantire al consumatore finale salute e cibo sano. Per fare questo ha bisogno di partner e mezzi affidabili. La prima consegna Scania è datata 2015. Era presente Franco Fenoglio in persona. Ho apprezzato molto il fatto che il Presidente e Amministratore delegato di una Casa costruttrice fosse venuto a casa mia. Non mi era mai successo. Logico quindi che dovevo ricambiare il favore”. La flotta Spezzano è attualmente composta da circa 200 trattori e 215 semirimorchi. Per l’assistenza l’azienda si avvale principalmente delle reti che fanno capo ai costruttori. “Svolgiamo attività soprattutto nel settore alimentare dal gelo al fresco fino al secco - aggiunge Carmine Spezzano - Il segreto è il servizio: se sono puntuale nelle consegne, le aziende vendono di più e c’è più lavoro anche per me. Dato che lavoriamo solo con aziende primarie, anche i nostri dipendenti sono garantiti. Proprio l’autista deve essere incentivato a essere puntuale

perché è loro garanzia. Più siamo bravi, più Orogel vende e più noi lavoriamo”. Gli anni della crisi non hanno impensierito Carmine Spezzano e i suoi 250 dipendenti. “Ci siamo sempre affidati ad aziende primarie nel settore alimentare e abbiamo investito in queste aziende dice il timoniere della Spezzano Trasporti - Questo ci ha permesso di affrontare gli anni della crisi avendo come punto di riferimento la volontà e la passione di continuare a fare al meglio il nostro lavoro. Un’azienda del Sud deve dimostrare nei fatti di saper fare le cose, ci vuole tanta volontà. I pregiudizi? Si superano facendo vedere quanto lavoriamo e la qualità del nostro lavoro”. Aveva 21 anni Carmine Spezzano quando decide di creare dal niente la sua azienda: “Mio padre aveva un’attività di ingrosso di polli vivi e io mi sono comprato un camion per fare il trasporto. Poi, quando l’attività con i polli è terminata ho continuato a fare il camionista. I truck mi sono sempre piaciuti, fin da ragazzino”. Tra gli aneddoti della sua lunga carriera professionale, Carmine Spezzano ricorda con orgoglio quando fece pub blicità all’interno dello stadio del Cesena calcio, ottenendo un’immediata e ampia visibilità. “Rispetto per i clienti e per i fornitori - commenta Carmine Spezzano Sono i nostri punti di forza che si traducono in un servizio di altissimo livello. Otto anni fa avevo 13 camion, oggi sono arrivato a quota 200. Con dedizione e impegno, tanto sacrificio e anche qualche rinuncia, non solo da parte mia ma da tutta l’azienda, comprese le mie due figlie”. Spezzano Trasposti ha due sedi, a Milano e quella centrale di Corigliano Calabro. In futuro sarà pronta la terza, a Modena. “Abbiamo voglia di crescere naturalmente ma mai venendo meno ai nostri principi. Nel 2019 contiamo di superare il fatturato 2018 e arrivare a superare i 25 milioni di euro”, conclude Spezzano.

GIANNI SINTUCCI, RESPONSABILE TRASPORTI E LOGISTICA ESTERNA DI OROGEL

“LA NOSTRA OSSESSIONE È LA QUALITÀ” O rogel è la prima azienda produttrice italiana nel settore dei vegetali freschi surgelati. “Le sue origini risalgono al 1967, quando 11 produttori di Cesena decidono di unirsi in una Cooperativa ortofrutticola denominata Copa (Cooperativa Agricola Produttori Ortofrutticoli). Saranno seguiti nell’esempio da altre cooperative, con cui creeranno il Consorzio Fruttadoro - ci spiega Gianni Sintucci, Responsabile trasporti e logistica esterna di Orogel Quando si dice Orogel si pensa innanzitutto a salubrità e qualità. La

nostra è una società nata dalla passione e dalla volontà di fare le cose in modo eccelso. È formata da soci produttori che conferiscono il loro prodotto per la surgelazione. Parliamo di prodotti ortofrutticoli”. La grande svolta avviene negli anni ’90 quando Orogel punta al mercato della Grande Distribuzione Organizzata. “Il fatturato aggregato del 2018 è di quasi 800 milioni di euro, con il comparto surgelati che ha totalizzato 270 milioni di euro; la superficie coltivata è di oltre 12mila ettari e 142mila sono le tonnellate

di prodotto commercializzato”, aggiunge Sintucci. Trasporti e logistica sono due assi strategici per Orogel. “In qualsiasi economia odierna il trasporto è una problematica comune e trasversale - commenta Sintucci - Va da sé che il trasporto dei surgelati per tutta la filiera ha la necessità del mantenimento della catena del freddo, cosa che si ottiene solo con seri professionisti sensibili al problema, con la qualità e l’efficienza dei mezzi”. È ciò che garantisce Spezzano Trasporti. “Abbiamo iniziato la collaborazione qualche

anno fa quando si è deciso di ottimizzare il trasporto dallo stabilimento di Policoro in Basilicata fino a Cesena - racconta Gianni Sintucci - Per gestire la distribuzione dei nostri prodotti dobbiamo avvalerci di interlocutori qualitativamente elevati e Spezzano è un valido esempio. Il leit motiv è il mantenimento della catena del freddo. Noi garantiamo tutto il trasporto fino al cliente finale, ne siamo responsabili”. “Per il futuro ci sono prospettive di sviluppo per la parte legata ai magazzini e agli stabilimenti produttivi - conclude Sintucci - Quello che però preme a Orogel è lo stretto legame con la natura che è la nostra fonte prima-

ria. Il nostro unico conservante è il freddo e quindi il principio del green è d’importanza primaria. Per questo motivo è rilevante il progetto avviato con Spezzano e i camion a LNG di Scania. Basti pensare che Orogel opera per ridurre i numeri dei viaggi e lavorare sulla saturazione dei mezzi, arrivata oggi a quota 85 per cento”. Orogel Spa vanta oltre 1.500 soci e quasi 2mila dipendenti. Il Gruppo si avvale di 11 stabilimenti produttivi. I siti dedicati alla surgelazione sono tre: Cesena, Ficarolo (Ro) e Policoro (Mt). Più di un quarto dei surgelati consumati in Italia proviene dagli stabilimenti del Gruppo.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 33 nuovo Scrivia (Al), inaugurata nel gennaio 2016 e ubicata in un punto strategico a ridosso dello svincolo autostradale sulla A7 Milano-Genova. “Specializzata negli interventi sui semirimorchi, questa officina serve sia le nostre esigenze ma, essendo aperta al pubblico, è punto di riferimento per tutti - spiega Giovanni Segotta, che proprio a Castelnuovo Scrivia ha il suo ufficio di riferimento - A Castelnuovo ci occupiamo praticamente di tutto, dalla manutenzione e assistenza per semirimorchi e trattori stradali al noleggio di semirimorchi e ribaltabili nuovi e usati e alla vendita di trailer usati”. Nella generale strategia di espansione di TIP rientra anche la recente firma dell’accordo per l’acquisizione di Pema, ex primo concorrente europeo con un parco veicoli di circa 30mila unità tra autocarri e trailer di marchi leader. Si tratta di un passo molto importante per il percorso di crescita delineato nel 2016 e chiamato “Progetto TIP 2020”. L’acquisizione di una società rinomata e ben gestita come Pema contribuirà a crea re una piattaforma TIP ancora più forte. Inoltre, que-

TIP TRAILER SERVICES / GIORGIO NOCE E ROBERTO SEGOTTA ILLUSTRANO L’OFFENSIVA IN ITALIA ED EUROPA

Assistenza di qualità per tutti IL FORNITORE DI SERVIZI DI NOLEGGIO ALLARGA IL SUO RAGGIO D’AZIONE E METTE A DISPOSIZIONE ANCHE DEI PRIVATI PROPRIETARI DI FLOTTE L’ACCESSO ALLA VASTA RETE DI CENTRI DI ASSISTENZA CHE, IN TUTTA EUROPA, ITALIA COMPRESA, GIÀ ASSICURA UN EFFICIENTE E PUNTUALE SERVIZIO DI MANUTENZIONE E PRONTO INTERVENTO PER TUTTE LE TIPOLOGIE DI SEMIRIMORCHI MESSI A DISPOSIZIONE PER IL NOLEGGIO. LA MULTINAZIONALE DEL NOLEGGIO SI QUALIFICA COSÌ ANCHE PLAYER DI PRIMO PIANO NELLO STRATEGICO COMPARTO DELL’ASSISTENZA DI TUTTO CIÒ CHE RIGUARDA IL SEMIRIMORCHIO.

L

FABIO BASILICO MILANO

’efficienza di un rimorchio e di un semirimorchio passa attraverso un adeguato servizio di assistenza. Adeguato perché è la merce contenuta nel trainato che fa il valore del trasporto. Lo sa bene TIP Trailer Services, nome di riferimento europeo nei servizi di noleggio che già assicura ai propri clienti un valido e puntuale servizio di assistenza per i veicoli noleggiati in tutta Europa tramite una rete di officine certificate. Ora, TIP ha deciso di estendere la sua competenza assistenziale anche ai clienti che non direttamente usufruiscono del noleggio di semirimorchi ma sono privati proprietari di flot te che in ogni caso hanno necessità di un’assistenza con tinua non solo per la manutenzione programmata ordinaria o gli interventi straordinari ma anche e soprattutto per le situazioni di vera e propria emergenza su strada. Per conoscere nel dettaglio la grande offensiva lanciata da TIP Trailer Services abbiamo intervistato Giovanni Roberto Segotta, Sales Manager per Piemonte, Liguria, Emilia-Romagna, Triveneto e Marche di TIP Italia. Incontriamo Segotta nel quartier generale milanese di TIP Trailer Services, nel centralissimo Corso Buenos Aires. Con Segotta c’è anche il General Manager di TIP Italia, Giorgio Noce. “Uno dei prodotti che TIP offre ai clienti è l’assistenza su strada a livello europeo di ce Giovanni Segotta - Il vantaggio è che ora questo

servizio può essere applicato anche alla flotta privata del cliente, quindi non solo quella noleggiata da TIP. Il principale beneficio è avere a disposizione una rete di officine coordinate da un unico centro multilingue con sede in Belgio, il TIP Roadside Assistance, che prende in gestione l’intervento dall’inizio fino al la sua conclusione, informando costantemente il cliente sull’andamento dei lavori. Se il veicolo può circolare vie ne mandato nell’officina più vicina, mentre se non è in grado di muoversi la centrale operativa provvede a contattare la prima officina disponibile per il servizio di assistenza mobile. Il servizio è garantito 7 giorni su 7, 24h su 24, in Italia e nel resto d’Europa”. Particolare molto interessante, il servizio di assistenza non prevede alcun abbonamento, dal momento che si paga all’occorrenza. “La fatturazione gestita a livello centrale da TIP Roadside Assistance - prosegue Segotta viene poi veicolata al cliente tradotta nella sua lingua e dettagliata in tutte le voci di spesa e intervento. Per i clienti italiani, il riferimento è TIP Italia che si interfaccia direttamente con Roadside”. Roadside è un servizio che mira alla risoluzione rapida del problema. “Quindi l’obiettivo principale di chi interviene è far conoscere al cliente il problema, dargli tempi certi di risoluzione e rimettere il veicolo su strada dice ancora Segotta - La velocità di intervento per la riduzione del fermo macchina è uno dei punti qualificanti di Roadside. Il 75 per cento de-

gli oltre 100mila interventi an nuali ha una risoluzione immediata a brevissimo termine. La rete di officine è formata da strutture qualificate e di primo livello. Sia in Italia che all’estero sono coinvolte le oltre cento officine del la nostra rete diretta di proprietà, quelle di reti parallele con cui TIP ha già stipulato accordi e, molto raramente e solo per casi eccezionali, altre strutture. In Italia contiamo su circa un centinaio di riferimenti, che diventano migliaia oltre confine. Occorre anche tenere presente che siamo attivi nel Maghreb, in Turchia e in Russia, dove TIP assicura interventi in partnership con centri di intervento locale”. TIP ha già acquisito diversi grossi clienti che hanno a derito al servizio perché hanno compreso che si tratta di

un’opportunità che possono utilizzare regolarmente o in casi estremi, quando ne hanno bisogno. “Ci rivolgiamo a tutti le aziende di trasporto e logistica, alle piccole, medie e grandi flotte - spiega Giovanni Segotta - Ci sono clienti che hanno già una parte della propria flotta noleggiata con TIP e un’altra parte di proprietà su cui decidono di applicare il nostro servizio di assistenza. Ovviamente, la flotta a noleggio TIP è già di default nel programma di assistenza”. Il servizio può essere utilizzato sotto forma di pacchetti d’intervento: “ci sono clienti che lo utilizzano solo per gli interventi di meccanica, altri per la meccanica e i gruppi frigo, altri solo per gli pneumatici”, precisa Segotta. Gestendo complessivi 70mila veicoli a livello euro-

peo, per TIP era naturale approntare un qualificato servizio di assistenza, che nato come complemento al noleggio, si apre ora a una nuova fase di implementazioni anche presso i clienti che non hanno noleggiato, facendo di TIP un attore di primaria importanza anche in ambito assistenziale e manutentivo. “Costi chiari, trasparenza sulla fattura finale, tempi certi intervento. Sono questi i nostri asset - dice ancora Giovanni Segotta - Abbiamo accordi con fornitori di primaria importanza per tutti i componenti del trailer, dalle gomme agli assali, ai gruppi frigo. Assicuriamo sempre un qualificato servizio di manutenzione programmata e di assistenza in emergenza”. Una delle officine rappresentative della qualità del servizio TIP è quella di Castel-

Giovanni Roberto Segotta, Sales Manager per Piemonte, Liguria, Emilia-Romagna, Triveneto e Marche di TIP Italia, e, Giorgio Noce, General Manager di TIP Italia.

sta acquisizione - che ci completerà nei primi mesi del prossimo anno - consentirà a TIP di diversificare ulteriormente la sua presenza geografica e rafforzare la posizione in Germania, una delle economie più solide d’Europa. L’acquisizione di Pema darà anche un’ulteriore spinta alla diversificazione di TIP nel settore grazie all’introduzione di leasing e noleggio di autocarri e alla presenza di personale altamente specializzato. Lanciata nel 1976, oggi Pema opera in 7 paesi europei, tra cui Germania, Polonia, Repubblica Ceca, Svizzera, Belgio, Danimarca e Svezia. Ha 18 sedi e impiega circa 440 dipendenti, di cui circa 200 sono meccanici. “TIP è in forte crescita in Europa e in Italia - conclude Giovanni Segotta - L’Italia, dove siamo presenti dal 2012, è un Paese che offre enormi potenzialità di crescita anche tenendo conto che la percentuale di veicoli noleggiati sul totale del parco circolante è di appena il 3-4 per cento, mentre in altri Paese la percentuale è ben più alta. I primi importanti risultati li stiamo ottenendo e le prospettive sono più che buone. Attualmente disponiamo di circa 3.000 veicoli, siamo i primi del mercato. I clienti stanno progressivamente comprendendo i molteplici benefici del noleggio, dal punto di vista economico fino a quello di poter focalizzarsi sul proprio core business lasciando la gestione dei veicoli ad altri. Quest’anno chiuderemo con un business plan in crescita del 9 per cento, in linea con il 2018 che aveva già consuntivato un +10 per cento”.


IL MONDO DEI TRASPORTI

Pagina 34

N° 284 / Novembre 2019

OLTRE IL 90 PER CENTO DELLA FLOTTA HA IL MARCHIO DEL

GRIFONE, SULLA BASE DI UN RAPPORTO

ANTONIO CUZZUOL, UNO DEI

INIZIATO CON

TRE FONDATORI DELLA

CONCESSIONARIA TREVIGIANA. ALLO STORICO BUSINESS DEL SETTORE EDILE, OGGI L’AZIENDA DI SAN MICHELE DI PIAVE AFFIANCA UN SERVIZIO DI LINEA AD AMPIO RAGGIO, DIVERSIFICANDO IL SUO RAGGIO D’AZIONE.

A DISPOSIZIONE DEI CLIENTI UNA FLOTTA ARTICOLATA IN CUI IL COSTRUTTORE DI

SÖDERTÄLJE RAPPRESENTA UNA COSTANTE SIN DAL

1989.

AUTOTRASPORTI GRIGOLIN / CLIENTE PRIVILEGIATO DI LEIBALLI & CUZZUOL E DI SCANIA

La forza della tradizione e della serietà

N

MAX CAMPANELLA

SAN MICHELE DI PIAVE

ello sguardo, nelle parole, semplici come sem plice è la gente del posto, dei fratelli Luciano Antonio e Giorgio Grigolin ritroviamo la genuinità di chi nel lavoro mette da sempre anima e corpo. Di chi nelle difficoltà non si è tirato indietro, determinato a portare avanti quello che il padre ha iniziato. La forza di Autotrasporti Grigolin è tutta qui, nel l’innata capacità di darsi da fare, unita all’intuizione di trovare nuove strade quando il trend del mercato lo richiede. Nell’unità della famiglia, ieri come oggi. E, non da ultimo, nell’avere accanto partner che credono in questa forza, come Leiballi & Cuzzuol, Concessionaria Scania con cui il rapporto risale ad Antonio Cuzzuol, uno dei tre fondatori, ed è proseguito con il figlio Claudio per continuare, oggi, con il nipote Adriano. Grigolin è un nome la cui storia è legata tutt’uno con San Michele di Piave, a nord di Treviso, frazione di Cimadolmo. È in questo fazzoletto di terra che, nell’immediato dopoguerra, Mario Grigolin inizia a recuperare i gaswagen abbandonati dai tedeschi. Fino a quel momento utilizzava i cavalli per trasportare i sassi dal Piave alle fornaci di Roncadelle, che li utilizzavano per le calci: scoprire che il ca mion a legna o carbone consentiva di agevolare e incrementare il lavoro è la prima chiave di volta per il futu-

ro dell’azienda. Accanto al padre, Luciano Antonio e Giorgio, oggi 73 e 70 anni, arrivano subito dopo la leva e mettersi al volante è la cosa più naturale per quei due giovani. A soli 14 anni, entra in azienda anche la sorella Maria Luisa, che diventa ne gli anni riferimento indispensabile sul piano amministrativo: man mano che il business cresceva occorreva una persona di polso a ricoprire un ruolo decisivo per lo sviluppo aziendale. “Abbiamo iniziato a lavorare tanto - racconta Giorgio - con il trasporto di segatura: facevamo viaggi fino a Roma e Napoli e fino alla

confinante Austria, ad esempio per i quattro stabilimenti di Della Valentina. Ai tempi non c’erano le gru: dopo il trasporto occorreva procedere con lo scarico a mano”. CORAGGIO E DETERMINAZIONE

Inizialmente l’avventura imprenditoriale di Mario, con due Lancia - un Esatau e un 3RO - avviene insieme al fratello Giambattista, fino a quando i due decidono di intraprendere due strade diverse: il primo diversifica la tipologia di trasporto, il secondo si focalizza sul settore edi-

le, dando vita a un altro filone imprenditoriale, con il quale non mancano sinergie. “Il legno - prosegue Luciano Antonio - era il settore principale per noi: trasportavamo dalla materia prima ai pannelli truciolati fino al macinato di scarto, con viaggi dal Friuli al Mantovano al Trentino”. Dopo la separazione, Autotrasporti Grigolin inizia ad affermarsi come riferimento nel trasporto di linea a tutto tondo. Una diversificazione destinata ad accentuarsi con l’arrivo della terza generazione: a metà degli Anni Novanta arrivano Luca, 41 anni, figlio di Luciano Antonio, insieme a Christian, 43 anni, figlio di Giorgio, e successivamente la sorella Lisa, 45 anni. A quel pun to, complice il boom dell’edilizia, Autotrasporti Grigolin inizia ad assumere i contorni di flotta strut-

Da sinistra: Luciano Antonio e Luca Grigolin, Adriano Cuzzuol, Christian e Giorgio Grigolin.

turata: il parco conta già venti unità, ma la domanda è talmente importante e immediata che si procede con rapidi acquisti di veicoli nuovi e usati per soddisfare la clientela. Il costruttore di Södertälje fa breccia nell’azienda nel 1989. “Ero un ragazzo - ricorda con un sorriso Luca quando Antonio Cuzzuol propose il veicolo. Ai tempi arrivavano le prime cisterne e con Scania gli autisti si trovavano decisamente meglio. Quando sono entrato in azienda abbiamo acquistato lo Scania 143 da 470 cv, che utilizzavamo per la logistica e spres so e che conserviamo tuttora in ottime condizioni”. Oggi il marchio del Grifone supera il 90 per cento della flotta Grigolin, con una dozzina di mezzi della nuova generazione, sulla base di un

rapporto con la Concessionaria di San Fior che si è consolidato con l’intera organizzazione del dealer. “Con Claudio Cuzzuol in particolare precisa Luciano Antonio - il rapporto non è mai stato quello di cliente-venditore: è sempre stato qui da noi come una persona di famiglia. È questa la differenza tra chi vuole vendere e poi sparisce e chi invece cerca di essere d’aiuto, soprattutto quando si presenta una difficoltà”. Il momento difficile arriva negli Anni Duemila, quando il settore dell’edilizia conosce una profonda crisi che dura tuttora. “Oggi - afferma Luca - oltre al settore edile, in cui lavoriamo con realtà come il Gruppo Grigolin, Suprema e SuperBeton Calcestruzzi, siamo presenti nel trasporto rottame e ferroso, nel cemento sfuso, nel recupero degli scarti di legname e nel vetro, segmento nel quale operiamo al servizio dell’azienda di famiglia San Michele Vetri, ma an che per altre realtà come Zignago Vetro. Abbiamo chiuso il 2018 con un fatturato di circa 8,5 milioni di euro, un dato stabile nel corso degli anni: preferiamo mantenere l’e quilibrio, soddisfare la clientela puntando su un servizio di qualità piuttosto che fare volume a tutti i costi”. Autotrasporti Grigolin dà lavoro a 70 dipendenti, 60 dei quali autisti, e dispone di una flotta molto articolata. A disposizione della clientela una dozzina di cisterne Omeps per cemento, dieci vasche Menci per l’inerte, una ventina di centinati tra cui anche bighe, dieci piani mobili e due motrici gru. Un’officina interna pianifica gli interventi e la necessità di pezzi di ricambio, ma per la manutenzione il riferimento è Leiballi & Cuz zuol, che quest’anno ha consegnato all’azienda veneta cinque trattori e una motrice. “Nel 2020 - conclude Luca Grigolin - prevediamo di aggiungere altre cinque unità, proseguendo il rinnovamento della flotta nell’ordine del dieci per cento del parco ogni anno”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 35

HANKOOK / NEGLI INDICI DJSI WORLD PER LA QUARTA VOLTA CONSECUTIVA

IL PRODUTTORE DI PNEUMATICI PREMIUM

Lâ&#x20AC;&#x2122;ambiente vale la quaterna

I

MICHELE S. ALTIERI NEU-ISENBURG

l produttore di pneumatici premium Hankook è stato inserito nel Dow Jones Sustainability Index World per la quarta volta con secutiva, dimostrando ancora una volta di essere una delle aziende leader mondiali nel campo della sostenibilitĂ . Il DJSI World 2019 comprende 318 aziende, che rappresentano il 12,6 per cento delle principali 2.526 aziende al mondo. Nel 2019 Hankook ha ricevuto ottime valutazioni in Cittadinanza aziendale e Filantropia, Gestione della catena di distribuzione e Rilevanza per il suo continuo impegno in materia di sostenibilitĂ . Il produttore di pneumatici, attraverso sette comitati interni per la ResponsabilitĂ  sociale di impresa, comunica ai suoi dipendenti la propria visione sostenibile e promuove un miglioramento continuo delle attivitĂ  CSR a livello aziendale. â&#x20AC;&#x153;Il nostro inserimento nel DJSI-World per il quarto anno di fila - afferma Han-Jun Kim, Presidente di Hankook Tire Europa - dimostra che i nostri continui sforzi volti a migliorare la sostenibilitĂ  stanno lasciando il segno e

vengono riconosciuti. Continueremo a mantenere il nostro forte impegno a favore della responsabilitĂ sociale dâ&#x20AC;&#x2122;impresa e continueremo a sviluppare le nostre attivitĂ  sostenibili, in particolare in Europaâ&#x20AC;?. Nel 2018 il produttore di pneumatici ha adottato linee guida specifiche volte a garantire la sostenibilitĂ  economica, ecologica e sociale della catena del valore della gomma naturale. Da allora, lâ&#x20AC;&#x2122;azienda ha lavorato con diverse catene di distribuzione al fine di migliorare continuamente fattori come i diritti umani, la protezione ambientale e la trasparenza, la produttivitĂ  e la qualitĂ  della gomma naturale. Questâ&#x20AC;&#x2122;anno, Hankook ha ricevuto anche lo status di azienda esemplare nel quadro del Progetto di scambio delle emissioni UE-Corea. Il riconoscimento riflette i continui sforzi del produttore di pneumatici premium per ridurre le proprie emissioni di gas serra in risposta al cambiamento climatico e di tenere in considerazione lâ&#x20AC;&#x2122;inquinamento quando vengono prese decisioni di investimento interne. Hankook partecipa inoltre a numerosi progetti sociali in tutto il mondo. Dal 2012, ad esempio, numero-

Ă&#x2C6; PRESENTE NEL FAMOSISSIMO DOW

JONES SUSTAINABILITY INDEX WORLD DAL 2016 E CONTINUA A DIMOSTRARE LE SUE COMPETENZE IN MATERIA DI SOSTENIBILITĂ&#x20AC;. HANKOOK Ă&#x2C6; Lâ&#x20AC;&#x2122;UNICA AZIENDA NEL SETTORE CON SEDE IN ASIA A FAR PARTE DEL DJSI

WORLD. â&#x20AC;&#x153;I NOSTRI CONTINUI SFORZI VOLTI A MIGLIORARE LA SOSTENIBILITĂ&#x20AC; STANNO LASCIANDO IL SEGNOâ&#x20AC;?, AFFERMA HAN-JUN

KIM, PRESIDENTE HANKOOK TIRE EUROPA.

se organizzazioni no-profit, tra cui la Croce Rossa, i servizi di protezione civile e il servizio nazionale di ambulanze, hanno ricevuto gratuitamente gli pneumatici dallo stabilimento europeo sito in Ungheria. Negli

ultimi sette anni, sono stati donati piĂš di 16mila pneumatici a piĂš di 1.300 organizzazioni no-profit. La filiale inglese Hankook Tyre UK ha supportato lâ&#x20AC;&#x2122;organizzazione internazionale Transaid per 13 an-

ni al fine di sviluppare ulteriormente le infrastrutture nei paesi in via di sviluppo. Il DJSI è il principale indice per la sostenibilità e gli investimenti al mondo. Assegna i certificati alle aziende che eccellono valu-

tando in modo completo le attivitĂ della gestione a ziendale dal punto di vista finanziario, ecologico, etico e sociale. Ă&#x2C6; stato sviluppato in modo congiunto da S&P Dow Jones Indices e da RobecoSAM.

ÂźÂ&#x2020;Âźy§y Â&#x2020;Â&#x2014; yrÂ&#x153;Â&#x2018;Â&#x153;Â&#x192;Â&#x2020;g  *(+)4.-'"-0++*$'/-.+*-/$($ )/ *) )0./-$' )$*'$$ /-"''Ň&#x160;Ń&#x2021;Ń&#x201E;ĐżŃ&#x20AC;Ń&#x2026;$ /-"''Ň&#x2014;Ň&#x2DC; $Ńľ "-$)$Ň&#x160;*) )0./-$' .. // Ň&#x160;Ń&#x192;Ń&#x2021;Ń&#x20AC;Ń Ń&#x201A;1 ))Ň&#x2014;Ň&#x2DC; $*)'*'-$Ň&#x160;*) )0./-$' Ň&#x160;Ń&#x192;ппŃ&#x2026;Ń&#x2C6;*'- *.Ň&#x2014;Ň&#x2DC; / 'ѾпŃ&#x2C6;Ń&#x2020;Ń&#x20AC;Ń&#x2C6;Ń&#x192;Ń&#x192;Ń ĐżŃ&#x20AC;Ň&#x160;!3ĐżŃ&#x2C6;Ń&#x2020;Ń&#x20AC;Ń&#x2026;Ń&#x192;ĐżŃ Ń&#x192;Ň&#x160;$)!*Ň˝ */-.#Ńľ$/Ň&#x160;222Ńľ */-.#Ńľ$/


IL MONDO DEI TRASPORTI

Pagina 36

N° 284 / Novembre 2019

RANGONI & AFFINI / RECORD DI PARTECIPANTI A TRUCK LOOK 2019

Sfilata di camion a Bussolengo LA FINALE VINTA DALLA FRANCESE TRANSPORTS PETIGNAUD, PREMIO “IL MONDO DEI TRASPORTI” PER L’AZIENDA F.LLI PADOVANI, CHE HA DEDICATO IL TRATTORE

SCANIA AL COMPIANTO ADRIANO, NOTO COME “IL CUBANO”. PRESENTI 153 AUTOTRASPORTATORI PROVENIENTI DA TUTTA

EUROPA E CON TRATTORI DI TUTTI I MARCHI. “È IL RICONOSCIMENTO A CHI LAVORA PER NOI SENZA ESSERE NOTATO, ALLA SUA PASSIONE E AL SUO SACRIFICIO”, AFFERMA L’INGEGNER

NATALINO AFFINI.

G

MAX CAMPANELLA BUSSOLENGO

razioso borgo in provincia di Verona, nell’entroterra rispetto alle rive del Garda, Bussolengo non è certo avvezza alle invasioni di camion. Ma la gente del posto, e anche tanti turisti presenti nei dintorni tra Bar-

dolino e la città di Romeo e Giulietta, ha dimostrato di apprezzare le luci colorate, i clacson, le radio a tutto volume, la gastronomia tipica e la vivacità che caratterizza i raduni di autotrasportatori. Tanto da convincere il sindaco, Roberto Brizzi, ad assicurare che “Bussolengo nel 2020 è pronta a tornare a ospitare

Truck Look 2019, concedendo più spazio ai suoi partecipanti”. È su queste premesse che Rangoni & Affini, Concessionaria Scania e Volkswagen, ha organizzato la finale dell’annuale manifestazione con cui invita gli autotrasportatori dell’area di Mantova, Verona e Brescia a unirsi per un

Il vincitore del 2019 e, in alto a destra, il trattore premiato da Il Mondo dei Trasporti.

weekend di festa e assegnare una serie di riconoscimenti, con l’obiettivo di promuovere sul campo l’autotrasporto ricordando come esso sia un settore vitale per la nostra economia. Oggi alla kermesse Truck Look di Rangoni & Affini, organizzata con la direzione artistica di Mirko Zapparoli, arrivano camion da tutta Europa e l’edizione 2019 ha raggiunto il numero record di 153 partecipanti. “Il trasporto - ha affermato l’ingegner Natalino Affini al dibattito introduttivo - è fondamentale per il nostro benessere: basterebbero pochi giorni senza il trasporto per fermare l’intero sistema-Paese. Oggi a questo e vento sono presenti tante persone che lavorano per noi, lavoro del quale spesso non ci rendiamo conto: eventi come questo intendono far sapere al grande pubblico l’importanza dell’autotrasporto, rappresentare un piccolo riconoscimento per chi lavora per noi mettendoci

passione e tanto sacrificio”. Tra i presenti accanto all’ingegner Affini tra gli altri Luca Bedin, Direttore Volkswagen Veicoli Commerciali Italia, e Giancarlo Perlini, Responsabile Marketing Italscania. I finalisti hanno raggiunto Bussolengo gradualmente, po sizionandosi nella piazza principale del paese, che nel giro di mezza giornata si è riempita di camion di tutte le marche. Giocando in casa naturalmente ha avuto la meglio il marchio Scania, ma erano presenti trattori di tutti i brand. Lo spazio non ha consentito di esporre anche i semirimorchi, tranne per i primi arrivati, che sono riusciti a fermarsi in piazza con l’intero bilico. All’ingresso, faceva sfoggio di sé lo Scania XT che ha accompagnato in Africa la mis sione Overland 20182019: trasformato dalla veneta Austeras Trade, con sede nel la vicina Lazise, che ha realizzato l’intera sovrastrut-

tura del controtelaio per il trasporto del container adibito a officina mobile, il mezzo ha percorso ogni tipo di avventura su ogni tipo di terreno, mantenendo la sua integrità originale. Alla fine la giuria del Truck Look ha assegnato il premio Best in Show 2019 allo Scania della francese Transports Petignaud. Per la prima volta presente come media partner dell’evento, “Il Mondo dei Trasporti” ha assegnato un riconoscimento all’azienda “F.lli Padovani”, il cui trattore Scania - uno dei due esposti - era dedicato al compianto Adriano Padovani, nell’ambiente dei trasportatori noto come “il cubano”. Con headquarter a Nuvolera, nella cintura est di Brescia, lungo il fiume Chiese, “F.lli Padovani” è specializzata nel trasporto di materiali ferrosi, rottami e carichi completi, servizi con i quali ha consolidato una clientela storica e prestigiosa, costituita so prattutto da aziende del Nord e Centro Italia.


VIENI A SCOPRIRE I NUOV VI FUORICLASSE IVECO

Â&#x153;Â&#x2030; ø ø ))

PIÃ&#x2122; COMFORT, PIÃ&#x2122; CONNE ETTIVITÃ&#x20AC;, PIÃ&#x2122; SERVIZI DI SEMPRE..

Ti aspettiamo in concessio onaria a Molteno il 15 Novembre daalle 19.00 per presentarti i due nuovi arrivati nella n famiglia IVECO: S-WAY S WAY e new DAILY MY2019.

Durante lâ&#x20AC;&#x2122;evento street food per tutti e spettacolari acrobazie!


IL MONDO DEI TRASPORTI

Pagina 38

N° 284 / Novembre 2019

FRAIKIN / DIECI TRATTORI CONSEGNATI ALLA COOPERATIVA DLM, ACRONIMO DEDICATO

Il prete in trincea e il terminal

I

MATTEO GALIMBERTI SOLERO

trattori con portacontainer vanno e vengono nell’hub di Solero: scaricano gli enormi tank cisterne che iniziano il loro viaggio per lo scarico, la pulizia, il ripristino e il collaudo finale. Intanto i prodotti finali vengono depositati in attesa di iniziare il loro viaggio verso la destinazione finale, su gomma o su nave. Siamo alle porte di Alessandria; sembra di essere al l’interno della stiva di un’imbarcazione in continuo movimento, nella quale non si smette mai di lavorare, con merce che va e che viene. Eppure siamo nella sede principale della Cooperativa DLM, acronimo dedicato a Don Luigi Merola, famoso prete anticamorra. Arrivano anche dieci trattori a noleggio, consegnati da Fraikin Italia, filiale italiana del leader europeo nel noleggio di veicoli industriali. Ma che c’entra un sacerdote con il trasporto su gomma?

Foto di gruppo per i dipendenti del sito di Solero della Cooperativa DLM con Diego Pellicioli e Andrea Magugliani, rispettivamente Sales Director e Area Manager Fraikin Italia. Nell’hub alle porte di Alessandria lavoreranno i dieci trattori a noleggio.

C’entra eccome. Perché i protagonisti di DLM, tutti, dal fondatore all’attuale timoniere comprendendo dipendenti, autisti e terzisti, vivono del trasporto e lo fanno con estrema passione, in un clima di armonia, che fa quasi dimenticare (ma solo all’osservatore) che siamo in un terminal logistico nel quale viaggiano anche merci pericolose, che richiedono capacità, dimestichezza e attenzione nel movimento. DLM nasce nel 2012 sulla base di una consolidata esperienza nel trasporto di Corrado Sensi, 66 anni, che cresce sul camion accanto al padre Giuseppe. In quel di Genova quest’ultimo possiede una pic cola azienda di autotrasporto con cisterne alimentari: sei autotreni effettuano la tratta Genova-Lecce-Genova trasportando soprattutto olio d’oliva. Il trend del settore, non proprio entusiasmante, nel lontano 1959 convince l’autotrasportatore genovese a entrare con una piccola partecipazione in un camion nel Gruppo Marcevaggi, dove effettua trasporto di gpl. Dopo alcuni anni il trasferimento a Napoli, quando Corrado ha 21 anni e inizia il suo percorso nella stessa azienda, conseguendo tutte le patenti e specializzandosi nel trasporto di sostanze infiammabili, tossiche, esplosive dall’acido fluoridrico anidro all’ammoniaca, all’ossido di etilene. Ancora non lo sa, ma quel giovane sta iniziando una carriera professionale che sarà brillante e che lo porterà, conseguita la laurea in Economia, a soli 33 anni alla direzione di uno stabilimento di gas liquido per Novogas (oggi Liquigas) e poi per Q8. Dopo una parentesi di tre anni con un tentativo di ritorno nel trasporto alimentare (quando la passione è passione!) è direttore commerciale a Brindisi per l’operatore francese Rubis. Incarico che Corrado Sensi lascia quando torna quell’innata passione. Sensi punta a un’idea che lasciamo spiegare al diretto interessato. “Credevo e credo tuttora fortemente - spiega Corrado nello spirito cooperativistico, come modello aziendale che cresce e si sviluppa sulla base della partecipazione di chi voglia aderire al progetto”. Nel frattempo al suo fianco arrivano i figli Claudio e Silvia, rispettivamente 38 e 34

CORRADO SENSI NOMINATO AGENTE DI SICUREZZA DEL SACERDOTE ANTICAMORRA

SEMPRE ACCANTO A DON LUIGI, SOPRATTUTTO NEI MOMENTI DIFFICILI I l nome stesso della cooperativa capitanata dalla famiglia Sensi rende l’idea che quello con don Luigi Merola è un rapporto che va ben al di là degli aspetti professionali e sociali. Già parroco del difficilissimo quartiere napoletano di Forcella, don Luigi è definito dalla stampa il “prete anticamorra” per le sue battaglie per la legalità. Memorabile l’episodio del killer assoldato per ucciderlo che, a due passi dall’altare, si ferma ascoltando le sue parole dal pulpito. Scomodo testimone dell’assassinio di una bambina, don Luigi è rimasto sotto scorta per alcuni anni, per ritrovarsi un bel mattino senza più alcuna protezione. È lui stesso a raccontare in tivù quanto accade qualche gior-

no dopo quando, travolto da uno scooter, si ritrova in ospedale con qualche frattura e le costole rotte. A quel punto il rapporto di stima e amicizia con Corrado Sensi si trasforma in qualcosa di più: DLM trova un modo per sostenere la fondazione “A’ voce de’ criature”, nata allo scopo di accogliere, togliere dalla strada e dare un futuro ai ragazzi dei più difficili quartieri napoletani. A proteggere don Luigi e accompagnarlo nei suoi spostamenti in tutta Italia è Corrado in persona che, a 66 anni, veste i panni dell’autista e, con DLM, mette a disposizione a titolo gratuito se stesso e una vettura protetta. “La Prefettura di Napoli - spiega il fondatore di DLM Coop - mi ha nominato agente di

pubblica sicurezza: per me è un privilegio affiancare don Luigi”. È tutt’altro che l’unica modalità con cui DLM sostiene la fondazione. “Su segnalazione di don Luigi, che, a titolo gratuito, fa parte del Cda - spiega Claudio Sensi - alcuni ragazzi accolti dalla fondazione seguono un percorso di formazione che li porta a essere inseriti e assunti come dipendenti nella struttura organizzativa di DLM. Uno dei modi con cui sosteniamo la fondazione è la possibilità, per i ragazzi che don Luigi individua, di essere formati e istruiti per lavorare da noi come autisti, magazzinieri o gruisti: è un lavoro molto particolare, che richiede serenità e pacatezza, ma anche grande disponibilità”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 39

A DON LUIGI MEROLA, FAMOSO SACERDOTE ANTICAMORRA

per i liquidi industriali

SI CHIAMA DLM LA COOPERATIVA, CON FILIALE A POLLENA TROCCHIA, IN PROVINCIA DI NAPOLI, E SEDE LEGALE E OPERATIVA A SOLERO, ALLE PORTE DI

ALESSANDRIA, CHE DÀ LAVORO A 50 DIPENDENTI, OLTRE A UN IMPORTANTE INDOTTO. TRASPORTO

PER IL DLM

UTILIZZA TERZISTI E UNA FLOTTA SEMPRE PIÙ GRANDE, CRESCIUTA CON IL NOLEGGIO DI CINQUE

MERCEDES-BENZ ACTROS, TRE IVECO STRALIS E DUE RENAULT TRUCKS T. LA FORNITURA SEGNA LO SBARCO DEL NOLEGGIATORE FRANCESE NEL SEGMENTO DEI PRODOTTI CHIMICI: “LA VERSATILITÀ È IL NOSTRO PUNTO DI FORZA”, AFFERMA DIEGO PELLICIOLI, SALES DIRECTOR FRAIKIN ITALIA. Attività quotidiana nell’hub di Solero, dove la Cooperativa DLM opera come player a 360 gradi nella logistica di prodotti liquidi, chimici e industriali.

anni. Con otto soci lavoratori, tra i quali il socio storico Antonio Liccione, e il supporto di don Luigi, 47 anni, consigliere e Padre Spirituale, nel 2012 si dà vita alla DLM Coop, presieduta da Liccione fino allo scorso 31 agosto, quando egli ha ceduto il timone a Claudio Sensi, mentre la sorella Silvia è responsabile dell’ufficio trasporti. In DLM Corrado, affiancato da una squadra di persone che, come lui, credono nel nuovo progetto, riversa tutto il suo know-how e le risorse acquisite negli anni, scommettendo sulla forza cooperativistica. Mentre il quartier generale della DLM Coop che è nell’immediato interland napoletano, vicino alla sede della fondazione “A’ voce de’ creature” di Don Luigi Merola, la sede legale e operativa è nell’hub di Solero ed è proprio in questa location che DLM si posiziona come player a 360 gradi nella logistica di prodotti liquidi, chimici e industriali. A Solero il deposito occupa una superficie di 15mila mq esterni e 4mila coperti; ad esso si affiancano quattro depositi satellite (due al nord e altrettanti al sud), ma è alle porte di Alessandria che avvengono tutte le operazioni richieste dai cisternisti: scarico, lavaggio, ripristino e collaudo. “Qui a Solero – spiega Claudio Sensi – curiamo la logistica di terra per conto dei principali player operativi nell’import e export di prodotti chimici e liquidi industriali: DLM si posiziona come anello nella filiera intermodale dei trasporti in cisterna”. Sul piazzale è tutto un andirivieni di bilici: trattori che trainano portacontainer

(OMT-Gruppo Gavio ma anche Broshuis e D-Tec) carichi di enormi cisterne; le lasciano dove indicato dagli operatori, su apposite strutture, e tornano per la loro strada. Le cisterne seguono un iti nerario preciso e studiato nei dettagli: il contenuto spesso riscaldato con tubazioni a serpentina per passare da stato solido (ad esempio cera, acidi grassi, oli) a liquido ven gono svuotate presso i clienti finali poi pulite, ispezionate, sistemate e collaudate prima della loro ripartenza. I prodotti solidi o liquidi in

IBC che arrivano su container box vengono depositati su bancali (su uno spazio ad hoc di 2.800 mq); Intanto il contenuto parte per il suo viaggio. “I liquidi industriali - prosegue Claudio Sensi - raggiungono il cliente finale, solitamente un’industria che li utilizza come materiale base per la sua lavorazione, caricati su normali centinati. DLM effettua anche il servizio di trasporto finale, ma il cliente può scegliere se affidarsi a noi, ad altri operatori o, in qualche caso, se utilizzare una sua flotta in conto

proprio”. Clienti di DLM sono generalmente i proprietari dei tank cisterna (al 99 per cento a ziende straniere), compagnie di navigazione e trader che commercializzano i liquidi industriali in import e export. Il servizio di DLM è dunque a 360 gradi nella filiera dei liquidi industriali cisternati, compresi magazzino e trasporto. “Abbiamo - precisa il Presidente - una flotta di 25 trattori, quasi tutti MercedesBenz, dell’età media di due an ni, cui abbiamo aggiunto quest’anno dieci unità a no-

leggio con Fraikin: cinque Mercedes-Benz Actros, tre Ive co Stralis e due Renault Trucks T. Tutti i nostri camion hanno una percorrenza di circa centomila km l’anno. Il noleggio per DLM è molto conveniente sui trattori: il costo certo, la manutenzione garantita e l’assistenza h 24 riducono il costo iniziale. Con Fraikin abbiamo iniziato un rapporto che ci consente, gradualmente, di strutturare la nostra flotta, riducendo le tratte affidate a terzisti. Con alcuni di questi, fidelizzati, prosegue il rapporto lavorativo: la

Il noleggio per DLM è molto conveniente: il costo certo, la manutenzione garantita e l’assistenza riducono il costo iniziale.

scelta di far crescere il nostro parco è funzionale alla necessità di avere personale preparato, che sa come agire su una cisterna e, soprattutto, sul tipo di contenuto che riguarda la nostra attività”. Due officine si occupano del servizio di manutenzione dei veicoli del parco, nel quale sono presenti anche due Iveco Daily. DLM oggi viaggia su un fatturato annuo di circa cinque milioni di euro e dà lavoro a 50 dipendenti, cui si somma un importante indotto. La fornitura DLM segna lo sbarco di Fraikin in un nuovo segmento di mercato, proseguendo la precisa strategia delineata dall’amministratore delegato della filiale italiana Claudio Gariboldi: posizionare Fraikin come riferimento nel noleggio a 360 gradi. Timoniere della strategia Diego Pellicioli, Sales Director, che con il suo team commerciale ha messo a segno importanti forniture nel settore dell’igiene urbana, nel quale Fraikin Italia da quest’anno opera con una Business Unit dedicata, in quello del trasporto a temperatura controllata così come in quello del trasporto eccezionale, senza escludere affatto motrici e veicoli commerciali allestiti. “La forza e la chiave di differenza del ser vizio Fraikin - afferma Pellicioli - sta proprio nella versatilità della sua offerta. La consegna a DLM, operativa in un settore particolare quale quello dei prodotti chimici, ne è ulteriore dimostrazione. Proseguiremo su questa strada, continuando a sostenere aziende di trasporto di ogni segmento: oggi Fraikin è riconosciuto come leader e mette a disposizione flotta, expertise e persone in grado di soddisfare ogni esigenza di trasporto professionale”.


Pagina 40

IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

TN SERVICE SUPPORTA LA CRESCITA DELL’AZIENDA DI FAGNANO OLONA

L’autentico decollo di Drosi NATA NEL 2017 DALLA PASSIONE DI GABRIELE DROSI E CINZIA PROVASI, IN DUE ANNI DA PICCOLA REALTÀ ASSUME I CONTORNI DI FLOTTA STRUTTURATA. OGGI IL PARCO CONTA VENTI UNITÀ E CONTINUA A CRESCERE, COSÌ COME FATTURATO E PERSONALE. DROSI SRL TRASPORTA ROTTAME NEL NORD E NEL CENTRO ITALIA E RAGGIUNGE IL SUD CON I CENTINATI, CONTINUANDO A INVESTIRE SULLA FLOTTA CON VEICOLI GIOVANI E PERFORMANTI.

Q

MAX CAMPANELLA FAGNANO OLONA

uella di Gabriele Drosi e Cinzia Provasi e della loro Drosi Srl è la storia di un’azienda che, mossa dalla forte passione dei titolari, conosce in tempi recentissimi un vero e proprio decollo grazie alla partnership con TN Service, che ha messo a loro disposizione tutto il suo know-how e le diverse articolazioni dell’azienda (noleggio, manutenzione, assistenza e ricambi). Grazie a un sodalizio che si rafforza sempre più, Drosi Srl è passata da realtà aziendale di piccolo padroncino a dimensioni di flotta strutturata, con una crescita che vede raddoppiare nel giro di pochi anni parco veicolare, business e organizzazione. Nata nel 2017, con headquarter a Fagnano Olona, alle porte dell’aeroporto milanese della Malpensa, Drosi ha origine dalla passione innata di Gabriele Drosi, 42 anni, figlio d’arte di Salvatore, che inizia l’attività di trasportatore negli Anni Settanta in quel di Davoli Marina, in provincia di

Il veicolo sostitutivo del servizio Courtesy Truck di TN Service, azienda operativa nella vendita e noleggio che quest’anno varca la soglia dei dieci anni di attività.

Catanzaro. È il 1980 quando Salvatore Drosi acquista il primo camion e, da classico padroncino, con la sua motrice lunga, trasporta collettame verso il Nord Italia. Intuisce che il trasferimento a Brugherio, alle porte di Milano, può incrementare la sua attività e da lì, tutte le settimane, effettua la tratta Piemonte-Lombardia-Sicilia. Quando nasce il primogenito Gabriele, il padre ce la mette tutta per convincerlo a desistere dal mettersi al volante del camion: è dura la vita del camionista, sempre lontano da casa. Ma c’è poco da fare: sin da ragazzino Gabriele dimostra il suo talento, la passione per il camion. A 19 anni inizia da autista di linea per arrivare al trasporto di rottame. Quest’ultimo rappresenta un settore che resterà e lemento stabile nella sua vita. Quando il titolare dell’azienda per cui lavora decide di chiudere, con un socio Gabriele rileva la licenza, in quel di Borgomanero, in provincia di Novara, e al trasporto unisce un’indubbia capacità relazionale, che mette a frutto nella vendita del materiale trasportato. “Si trattava - spiega Gabriele Drosi - di materiale pregiato, supervisionato: ac-

ciai che avevano un discreto valore sul mercato, se consegnato alla clientela giusta”. Poi arriva una parentesi che lo tiene lontano dal camion, fino a quando l’incontro con l’attuale compagna, Cinzia Provasi, sfocia nella nuova sfida imprenditoriale. Stavolta Gabriele è mosso, ol tre che dalla passione, dalla necessità di portare avanti la famiglia: Federico, 10 anni, e Noemi, due e mezzo, dipendono da lui. Nasce Drosi Srl, nella cui società entrano Gabriele e Cinzia, rispettivamente direttore operativo e responsabile amministrativa, che inizialmente si specializza nell’intermediazione di rottami e trasporto rifiuti in conto terzi con tre veicoli: un bilico, una motrice e un furgone. La svolta quando, a Zingonia, Drosi incrocia TN Service, officina meccanica specializzata nella manutenzione e assistenza di veicoli industriali e commerciali, operativa nel noleggio a breve e lungo termine con TN Service Rent e nella vendita dell’usato garantito con lo store online dedicato TN Service Shop. “Erano disponibili - racconta Drosi dieci bilici per il trasporto rottame: abbiamo colto l’occasione ed è così che è iniziata

la nostra collaborazione. Era esattamente il 15 ottobre 2018 quando abbiamo stretto l’accordo con TN Service e da quel momento abbiamo iniziato una crescita che prosegue e che continuerà nel 2020”. Nel giro di un anno la flotta Drosi Srl raggiunge le ven ti unità, tra cui due motrici e un furgone con cassone scarrabile, un cassone fisso, tre bilici, di cui due per il trasporto rottame e un cassone con ragnogru e, per il trainato, semirimorchi centinati. Per trattorimotrici nel parco troviamo Scania, Volvo Trucks e ultimamente Mercedes-Benz, di cui la TN Service è Officina Autorizzata; le vasche da rottame sono soprattutto dell’umbra Tecnokar. Una flotta naturalmente giovane, considerando l’età stessa dell’azienda, che continua a crescere. “Gradualmente - prosegue Gabriele Drosi - sostituiamo i mezzi e aumentiamo il numero di veicoli grazie all’ampia offerta TN Ser vice. Oggi ci occupiamo di trasporto rottame con rotte in Lombardia, Piemonte, Veneto, Friuli ma anche Umbria e Emilia-Romagna. Con i centinati arriviamo fino a Caserta e Napoli”.

UNA PERFORMANCE BASATA SUL RAPPORTO UMANO TRA LE DUE REALTÀ AZIENDALI

“TN SERVICE HA CREDUTO IN NOI SIN DALL’INIZIO, QUESTO CI HA PERMESSO DI CRESCERE” D rosi Srl dà lavoro a 27 dipendenti e ha chiuso il 2018 con un fatturato di circa 540mila euro, che nel 2019 salirà a circa tre milioni. “Nel corso del 2020 - afferma Gabriele Drosi - puntiamo a continuare a crescere del 50 per cento in termini di flotta e fatturato, e naturalmente assumendo personale”. Con TN Service si è creato nel tempo un particolare rapporto umano. “Andiamo - precisa Drosi - al di là del contratto scritto: basta guar-

darci negli occhi. Del resto la nostra crescita è dovuta a loro, che ci vengono incontro con prodotti validi e con l’assistenza. Se siamo riusciti ad avviare, partendo dal nulla, la nostra attività, è perché abbiamo avuto TN Service al nostro fianco come partner che ha creduto in noi: io e Cinzia abbiamo deciso di scendere in campo, loro hanno deciso di stare accanto a noi. Proseguiremo su questa strada: continueremo a investire sulla flotta cambiando i veicoli e acquisen-

do mezzi sempre più recenti”. TN Service, che quest’anno compie il decennio di attività, ha una sede a Montoro, in provincia di Avellino, e una a Piacenza. “Con loro - dichiara Drosi - i problemi si risolvono subito: ci si siede al tavolo, ci si confronta e i problemi si risolvono sempre, con correttezza e senza nascondersi dietro formalità burocratiche. È questa la chiave di differenza che ci ha consentito di crescere così rapidamente nel giro di due

anni”. Oltre al noleggio, Drosi in TN Service ha un riferimento per ricambi e pneumatici e per servizi di manutenzione e assistenza su strada h 24. “Il buon lavoro di officina - conclude Drosi - è l’elemento che arriva subito dopo l’autotrasportatore quanto a importanza: maggiori controlli vuol dire maggiori performance e quindi meno consumi, ma anche minori emergenze e spese improvvise”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 41

BRIDGESTONE / LA RETE AUTOCARRO OTTIENE LA CERTIFICAZIONE QUALITÀ DEL NETWORK

Mugione: “Raggiunto un altro traguardo di eccellenza” LA CERTIFICAZIONE SI PONE DIVERSI OBIETTIVI, TRA CUI MIGLIORARE LA QUALITÀ DEI SERVIZI OFFERTI AL CONSUMATORE FINALE, ACCOMPAGNARE I DEALER NELLO SVILUPPO DELLE PROPRIE COMPETENZE DIGITALI, SVILUPPARE LA RETE BRIDGESTONE ATTRAVERSO ACTION PLAN AD HOC PER OGNI SINGOLO PUNTO VENDITA, E INFINE CREARE UN NETWORK PAN-EUROPEO COERENTE E OMOGENEO, IN GRADO DI RISPETTARE LE LINEE GUIDA PROVENIENTI DA BRIDGESTONE.

Q

VALENTINA MASSA VIMERCATE

qualificazione 2019-2020, ottenendo la Certificazione di Qualità del Network. A conferma della rilevanza di questa certificazione, e del servizio esclusivo offerto da Bridgestone, vi è il riconoscimento da parte di SGS, leader mondiale nei servizi di Ispezione, Verifica, Analisi e Certificazione. La certificazione si pone diversi obiettivi, tra cui migliorare la Qualità dei servizi offerti al consumatore finale, accompagnare i Dealer nello sviluppo delle proprie

Competenze Digitali, sviluppare la rete Bridgestone attraverso Action Plan ad hoc per ogni singolo punto vendita, e infine creare un Network pan-europeo coerente e omogeneo, in grado di rispettare le linee guida provenienti da Bridgestone. Attualmente i clienti coinvolti nella Certificazione ed appartenenti al Network First Stop e i Bridgestone Partner sono 75 in Italia e 85 all’estero, tra Slovenia, Croazia, Serbia, Bosnia ed Erzegovina, Montenegro, Romania, Bulgaria e Macedonia. I vantaggi per tutti i Partner certificati sono molteplici, come la garanzia di offrire ai propri clienti standard e qualità professionale di alto livello, premi e incentivi al raggiungimento di determinati obiettivi e la consapevolezza di essere parte di una struttura che ha come obiettivo la crescita del business - attraverso la digitalizzazione e la differenziazione dai competitor. “Un altro obiettivo importante e un altro tra-

guardo di eccellenza raggiunto da Bridgestone”, ha dichiarato Elena Mugione, Brand & Trade Marketing Manager di Bridgestone EMEA South Region. “La Certificazione garantisce uno stimolo per la Rete volto a un miglioramento del servizio offerto, in modo da aumentare la qualità dei punti vendita Bridgestone. Per noi è fondamentale consolidare il rapporto con i Partener e continuare a offrire loro sempre qualcosa di diverso, con uno strumento che li accompagni nello sviluppo e che permette non solo la crescita, ma anche una netta differenziazione rispetto alla concorrenza”. Ricordiamo che SGS è l’azienda leader nel mondo per i servizi di ispezione, verifica, analisi e certificazione. SGS è riconosciuta come il punto di riferimento globale per la qualità e l’integrità. Con oltre 97.000 dipendenti, SGS gestisce una rete di oltre 2.600 uffici e laboratori in tutto il mondo.

I vantaggi per tutti i Partner certificati sono molteplici, come la garanzia di offrire ai propri clienti standard e qualità professionale di alto livello, premi e incentivi al raggiungimento di obiettivi.

www.aceservices.it

uanto sia importante il lavoro e la qualità dei servizi di assistenza anche e soprattutto per le aziende che operano nel settore dei trasporti è di facile comprensione. Ancor più per i costruttori di pneumatici ai quali è affidata soprattutto la sicurezza dei veicoli che devono potersi muovere sulle strade in condizioni di massima efficienza per tutelare

sia gli autisti che gli altri occupanti della strada. Bridgestone è particolarmente sensibile a questo argomento mettendo in campo non solo pneumatici, frutto delle più moderne tec nologie, ma anche dedicando le migliori attenzioni a chi è preposto all’assistenza. A tal proposito merita di essere segnalato che la Rete Bridgestone Autocarro, di cui fanno parte i Bridgestone Partner e il Network First Stop, ha superato con successo il processo di

Elena Mugione, Brand & Trade Marketing Manager di Bridgestone EMEA South Region.

IL TUO CARICO IN MANI SICURE 100% ITALIANA TESTATA, SICURA E AFFIDABILE COMPONENTI DI ALTA QUALITÀ

PER IL TUO CARICO SCEGLI ANTEO, SPONDE CARICATRICI DAL 1969

www.anteo.com /AnteoTailLifts

RICAMBI ORIGINALI ENTRO 24H IN TUTTO IL MONDO • OLTRE 130 MODELLI, ANCHE PERSONALIZZABILI • CENTRI DI ASSISTENZA IN EUROPA E NEL MONDO

/ANTEOSALES


IL MONDO DEI TRASPORTI

Pagina 42

N° 284 / Novembre 2019

VIBERTI RIMORCHI / L’INCREDIBILE PERFORMANCE DI DORICA EXPRESS GROUP

Il City vince la sfida Dorica L’AZIENDA ANCONETANA, CHE PRENDE IL NOME DAL VIRTUOSO ATTRIBUTO ASSEGNATO ALLA POPOLAZIONE DEL CAPOLUOGO MARCHIGIANO, NASCE NEGLI ANNI DELLA CRISI COME RISPOSTA ALLA NECESSITÀ DI UN NUOVO MODELLO ORGANIZZATIVO DEL TRASPORTO MERCI. IN DIECI ANNI DI CRESCITA HA RAGGIUNTO LE DIMENSIONI DI FLOTTA STRUTTURATA. “PER IL TRAINATO STIAMO SOSTITUENDO LE MOTRICI CON I CENTINATI URBANI, CHE ASSICURANO PIÙ CARICO E PARI FACILITÀ

I

MAX CAMPANELLA ANCONA

l termine “dorica” da sempre fa da attributo alla città di Ancona. Storicamente fa riferimento alla forza del popolo del capoluogo marchigiano sin dai tempi dell’imperatore Traiano, che ebbe gli anconetani al suo fianco nella guerra contro Annibale. Quello spirito, quella capacità di pro porsi come baluardo nel rispondere alle avversità è rimasto intatto. Riprova ne è la storia della giovane Dorica Ex press Group, oggi riferimento nei trasporti, con 30 trattori, 66 semirimorchi e circa 50 dipendenti, ma nata solo dieci anni fa sull’onda di una crisi economica che ha letteralmente devastato il trasporto su gomma, piegando molte realtà del Centro Italia. Da quella situazione di estrema difficoltà, dalla tenace volontà e dall’esperienza di Massimo Albamonte, Direttore Generale, che ha riunito alcune realtà imprenditoriali, è nato un gruppo aziendale che, entrato nel network di Pallex Italia, oggi rappresenta un riferimento in tutta Italia. E che ha avuto al suo fianco, accompagnata nel suo sviluppo, Viberti Rimorchi e, in particolare, il suo centinato cittadino, autentico “cavallo di bat taglia” del produttore di Tocco da Casauria. Dorica Express Group nasce sulla base di realtà operative nel trasporto industriale che effettuavano carichi completi. Quando, nel biennio 2008-2009, la crisi ha portato all’impennata della domanda di carichi frazionati, difficile per flotte, seppure ben strutturate, far fronte alle spedizioni come singola azienda. Come soddisfare quella domanda? Quale poteva essere il giusto modello organizzati-

DI GUIDA”, AFFERMA

vo? Massimo Albamonte, 42 anni, cercava una risposta sin dagli albori della crisi. Cresciuto con la passione per il ca mion sin da bambino, da gio vane appena possibile consegue tutte le patenti occorrenti e inizia a fare l’autista. “Il camion e la logistica racconta - hanno sempre avuto un certo fascino per me, entusiasmo che resta tuttora intatto”. Dalla guida, alla gestione del magazzino, alla responsabilità di reparto, Albamonte cresce nel settore fino ad assumere la posizione di Direttore Generale in un’importante azienda di trasporto. È in quelle vesti che si rende conto che ben presto il mondo del trasporto vivrà un periodo di forte trasformazione. L’idea innovativa inizia ad accendersi quando, nel 2007, arriva sulla sua scrivania una lettera di Pallex Italia, net -

work specializzato nella distribuzione merci su pallet. Albamonte si confronta con tre aziende di trasporto che effettuavano carichi industriali e propone la sua idea: “Puntiamo sulla distribuzione

cittadina, di piccole dimensioni e capillare”. Gli imprenditori accolgono l’idea e, considerando quella un’autentica sfida, si decide per il nome Dorica, cui viene unito Express per indicare la

Angela Dal Zovo e Massimo Albamonte, Amministratore delegato e Direttore Generale Dorica Express Group. L’azienda di Ancona è nata dieci anni fa.

rapidità con cui avvengono le spedizioni. Negli anni il legame con Pallex si rafforza, fino al punto che oggi Dorica Express Group è Polo di smistamento del Centro Italia nonché uno dei sette Hub nazionali e concessionario ufficiale Pallex Italia per le province di Ancona e Pesaro. “Il nostro core business - afferma Albamonte - è rappresentato dalla distribuzione capillare nell’ultimo miglio. Per effettuare il servizio, e quindi poter fare ogni manovra in città, accanto ai semirimorchi lunghi le opzioni erano due: mettere su strada una motrice o scegliere il semirimorchio city di Viberti. Rispetto a una motrice di sei metri, il centinato urbano di Viberti è lungo 10,5 metri che, in termini di portata, vuol dire più del doppio: con il semirimorchio raggiungiamo le 22 t, con la motrice al massimo 10. Non vi erano dubbi: ottimizzare la giornata di lavoro, il costo di personale, carburante e autostrada era ed è per noi molto più conveniente”. La flotta di trailer di Dorica Express Group oggi conta otto unità del city di Viberti. “Il primo - spiega Massimo Albamonte - è stato acquistato otto anni fa subito dopo aver stretto la partnership con Pallex Italia. Considerata la soddisfazione, abbiamo proseguito fino a sei mesi fa quando sono arrivate le ultime due unità. Nel 2020 contiamo di inserirne nel parco almeno altri due, che andranno a sostituire in maniera migliorativa le motrici”. Oltre al prodotto, l’azienda marchigiana ha messo alla prova il servizio di assistenza del costruttore di Tocco da Casauria. “La prontezza nelle risposte - afferma Albamonte - è fondamentale: se abbiamo l’esigenza operativa di dover

MASSIMO ALBAMONTE.

realizzare il veicolo adatto a noi, Viberti ci dà un supporto attivo. Questo vale ancora più nel post vendita: in caso di pro blemi intervengono, con progettisti specializzati, che si adoperano e trovano una soluzione, non si nascondono dietro assurde gerarchie”. L’azienda dorica possiede 30 moderni trattori (Mercedes-Benz, DAF e Volvo Trucks), dell’età media compresa tra due e tre anni, ai quali all’occorrenza possono essere agganciati i semirimorchi Viberti o quelli di maggiori dimensioni, in funzione del tipo di carico. La sede di Ancona si sviluppa su 4mila mq, comprensivi di un magazzino per attività di logistica. “Oggi - afferma Albamonte - contiamo più di 450 clienti attivi per provincia al mese, per i quali trasportiamo vino, carta, ferro, food, vernici, prodotti per edilizia, accessoristica di vario tipo, alimenti non freschi (prodotti secchi, bibite e salse) tutti con distribuzione capillare. Grazie alla partnership con Pallex Italia raggiungiamo tutta la Nazione: ritiriamo la merce presso le sedi dei nostri clienti e, in base alle esigenze di trasporto richieste, decidiamo se immetterle nei vari hub nazionali, dove verranno poi smi state e consegnate dagli altri concessionari del net work, o se effettuare consegna diretta tramite la nostra flotta”. Dorica Express Group nel 2018 ha sviluppato un fatturato di circa cinque milioni di euro, +14 per cento rispetto al 2017; una crescita che proseguirà nel 2019, che viaggia intorno al +9 per cento. “Anche per il 2020 - prosegue Albamonte - il trend positivo proseguirà perché Italia e Europa richiedono sempre con più frequenza la distribuzione di piccole partite di merci”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 43

SAF-HOLLAND / AD ASCHAFFENBURG NUOVO MAGAZZINO PER L’AFTERMARKET

Maxi sito per l’icona dell’assale GRANDE, SPAZIOSO, ECOLOGICO, TECNOLOGICO, EFFICIENTE E DOTATO DI UNA POMPA DI CALORE CHE CONSENTE UN RISPARMIO NOTEVOLE DI ENERGIA CON CONSEGUENTE RIDUZIONE DELLE EMISSIONI DI CO2. IL NUOVO MAGAZZINO HA IL COMPITO DI FORNIRE ASSISTENZA A TUTTI I CLIENTI E LE FILIALI CHE, PER I LORO VEICOLI, HANNO BISOGNO DEI PEZZI DI RICAMBIO PER ASSALI, SISTEMI DI ACCOPPIAMENTO E SOSPENSIONI.

S

MARCO CHINICÒ ASCHAFFENBURG

AF-Holland è uno dei pochi produttori e fornitori, presenti sul mercato, con un ventaglio completo di assali, sistemi di accoppiamento, sospensioni, ralle, perni ralla e sollevatori telescopici. Tutti materiali che vengono installati per rendere efficienti e produttivi spostamenti e movimenti di camion, rimorchi, semirimorchi, autobus e pullman. Con headquarter e Centro Ricerca & Sviluppo ad Aschaffenburg, nella Baviera, SAF ha chiuso il 2017 con un fatturato di circa 1.140 milioni di euro e dà lavoro nel mondo a 4.400 dipendenti. Per sostenere la crescita e puntando a soddisfare la clientela, il “re degli assali” potenzia uno dei settori più importanti - l’aftermarket - con l’apertura e l’inaugurazione di un nuovo magazzino proprio nella città di Aschaffenburg. Il nuovo magazzino - collocato in un’area che si estende complessivamente su circa 16mila mq - avrà il compito di fornire i pezzi di ricambio a tutta la clientela che deve sostituire vecchi, usurati assa-

li o sospensioni con materiale nuovo, di qualità e d’avanguardia. All’interno del magazzino gli operatori di settore che si affidano all’eccellenza di SAF troveranno 6mila codici articolo del marchio SAF-Holland, 900 articoli della partner Orlandi e altre merci sempre del Gruppo SAF. La nuova sede dell’Aftermarket consente al produt-

tore tedesco di ampliare i centri dedicati allo smistamento e allo stoccaggio. Fino a qualche anno fa, le posizioni di stoccaggio erano 4.250, oggi possiamo parlare di 6.800 posizioni. Le caratteristiche principali che permettono di descrivere questo nuovo punto dedicato all’aftermarket, al di là della sua grandezza e spazio-

sità, sono il suo essere ecologico, efficiente e attrezzato sot to l’aspetto tecnologico. Altrettante differenze, rispetto al vecchio magazzino, sotto l’aspetto logistico: il nuovo sito dispone di maggiori strade che consentono l’accesso all’area. Il soffitto è illuminato con potenti fari LED e, per quanto riguarda l’aspetto prettamente termico, l’intera

struttura è isolata. La pompa di calore, in confronto al vecchio punto aftermarket, consente un notevole risparmio di energia con conseguente, notevole riduzione delle e missioni. La particolare struttura di questo magazzino permette a SAF anche un risparmio dei costi per la gestione e il trasporto delle acque reflue. Essendo collegato a un sofisticato sistema di separazione delle acque reflue, tutta la quantità di acqua non piovana scorre direttamente verso il fiume Meno, situato a pochi passi. I vertici di SAF tengono sempre al corretto svolgimenti dei controlli, dell’impacchettamento e imballaggio delle merci. Grazie a una bobinatrice automatica, tutte le operazioni d’imballaggio sono rigorosamente controllate affinché i prodotti richiesti dalla clientela non siano contaminati o danneggiati da fattori ambientali esterni. Il sistema di gestione e controllo di tutto il lavoro giornaliero, all’interno del magazzino, è moderno, consentendo così la tracciabilità di tutte le operazioni di stoccaggio, imballaggio e spedizione degli articoli. “SAF-Holland - dichiara

Markus Prößler, a capo del reparto Product ManagementQuality Aftermarket Europe sta crescendo. Era quindi giunto il momento di un grande magazzino per il post-vendita. Nel nuovo sito, stiamo au mentando le posizioni di stoccaggio delle merci del 60 per cento, da 4.250 a 6.800. Durante la costruzione del magazzino, abbiamo prestato particolare attenzione ai consumi energetici, agli elevati standard ambientali e a processi logistici ideali. Il nuovo sistema d’imballaggio - prosegue Prößler - utilizza ceste su ruote che vengono automaticamente guidate fino alla fine del processo. Ciò rende il traffico dei carrelli elevatori molto più efficiente”. Altri aspetti che rendono, in questo magazzino, i processi di logistica più efficienti sono i sistemi automatici di pe satura che sono integrati, di rettamente, nella linea di confezionamento e controllano continuamente il peso della merce in uscita. Un secondo sistema automatico trasferisce i pallet, direttamente, al raccoglitore permettendo così un non indifferente risparmio di tempo.

Tr ans por t Management Sol ut i ons LASOLUZI ONEI NTELLI GENTECHESEMPLI FI CA LAGESTI ONEDELTRASPORTO Sat el l i t ar e, c ons umi , or egui dar es i due, al t as i c ur ez z aedes i t az i onedel l ec ons egne. Ununi c as ol uz i oneper f et t ament ei nt egr at a c oni t er mi nal i di bor dodegl i aut i s t i ei l ges t i onal edel l az i enda.

AUTOMATI ZZARE RI SPARMI ARE SEMPL I FI CARE www. s ui t et ms . i t


IL MONDO DEI TRASPORTI

Pagina 44

N° 284 / Novembre 2019

FIWAY / UN TEAM DI GIOVANI INGEGNERI NELLA TELEMATICA PER IL TRASPORTO

Freddo sicuro con Reyesol CAPITANATA DA EDOARDO ANGELINI E FRANCESCA AMISANO, LA SOCIETÀ È NATA NEL 2017 INCROCIANDO, QUASI PER CASO, IL MONDO DEI TRASPORTI FRIGORIFERI E HA PORTATO SUL MERCATO UN PRODOTTO CHE NASCE, SI SVILUPPA E SI REALIZZA PER LA LOGISTICA A TEMPERATURA CONTROLLATA, ANDANDO A

L

SODDISFARE LE RICHIESTE DI TRASPORTATORI E COMMITTENTI, CHE POSSONO COSÌ CERTIFICARE L’INTERA FILIERA, COMPRESA LA FASE DISTRIBUTIVA.

MATTEO GALIMBERTI ALESSANDRIA

a telematica applicata al trasporto diventa sempre più essenziale, per garantire sicurezza al conducente, che sa di poter contrare su strumenti di diagnostica che lo allertano in caso di necessità; al committente, che può tenere tracciata l’intera filiera, garantendo la sicurezza del suo prodotto an che nella fase del trasporto; al gestore della flotta, che sa immediatamente quando occorre intervenire su un veicolo, pri m’ancora che il danno avvenga o prima che esso abbia con seguenze peggiori. Tra i player posizionati in questo scenario, Fiway è nata come autentica startup da una squadra di giovani ingegneri di Alessandria, specializzati nel settore della connessione dati attraverso internet che, supportati da partner strategici, lungo la loro strada hanno incrociato il mondo del trasporto.

mande ha inizio una nuova sfida. “La nascita di Fiway -precisa l’ingegner Amisa-

no - è frutto dell’idea di realizzare un prodotto che avesse caratteristiche fun-

zionali alle esigenze dei trasportatori: abbiamo iniziato con interviste ai diret-

dimensione. Re ye sol è un prodotto che nasce nel trasporto frigo e si sviluppa nel trasporto frigo e in due anni ha acquisito caratteristiche che lo rendono un prodotto completo”. Quali sono le caratteristiche che distinguono Reyesol da altri prodotti presenti sul mercato? “Estrema facilità di utilizzo e flessibilità. Il nostro prodotto - risponde Angelini si adatta alle diverse esigenze di ciascun trasportatore o cliente, per il quale sviluppiamo un progetto ad hoc”. PIENO CONTROLLO

CONNETTIVITÀ PER IL TRASPORTO

Capitanata da Edoardo Angelini, 30 anni, Amministratore Unico, affiancato dal Direttore Tecnico Francesca A misano, Fiway nasce nel 2017 dalla volontà di trasferire l’esperienza acquisita nella connettività al mondo del trasporto professionale, a partire da quello refrigerato (alimentare, farmaceutico ecc.). L’incontro con il trasporto è nato quasi per caso: il team era alle dipendenze di una società, operante nel settore, che aveva ricevuto da alcuni operatori del settore l’incarico di studiare un progetto specifico per il segmento del trasporto a temperatura controllata. “Era la prima volta - spiega l’ingegner Angelini - Avevamo tut ti esperienza di impianti telematici e trasferimento dati da remoto, ma installarli su veicoli da trasporto richiedeva un progetto preciso: quali erano le istanze, le richieste di quel settore? Quali le attese relative alla telematica? In che modo potevamo soddisfare le esigenze degli operatori?” Sulla base di queste do-

ti interessati e agli operatori del settore del trasporto a temperatura controllata,

che ci hanno permesso di ulteriormente approfondire gli aspetti tecnici del settore, per portare sul mercato un prodotto che rispecchiasse pienamente le esigenze delle aziende di trasporto nel settore del freddo”. Da quei confronti nasce Reyesol, sistema telematico che oggi Fiway produce e fornisce ed è specifico per il settore del trasporto frigorifero. “Oggi - aggiunge Angelini - Fiway presenta il prodotto più completo su questa fetta di mercato, rivolgendosi a flotte di ogni

I due giovani ingegneri Francesca Amisano e Edoardo Angelini, al timone di Fiway.

Che cosa consente di monitorare Reyesol a distanza? “Una volta installato il sistema telematico spiega Amisano - da remoto possiamo controllare tutto quello che ac cade al prodotto: Reyesol si basa su tecnologie di alta qua lità, certificata ISO9001, che garantiscono la sicurezza del dato trasmesso. Possiamo controllare tutto quello che è installato sulla cella frigo: tem perature, stato di funzionamento del gruppo frigorifero, manutenzione dei prodotti, assali del trailer in termini di usura, freni, carichi complessivamente trasportati dal semirimorchio, accessi. Non da ultimo, elemento importante per le aziende di trasporto, possiamo controllare e verificare l’intero impianto di gasolio, dagli accessi ai consumi autorizzati. Il monitoraggio consente, in caso di necessità, l’intervento tempestivo per evitare danni alla merce o al veicolo prima che si verifichi un evento di maggiori conseguenze”. Fiway si rivolge al trasportatore, ma in qualche caso è l’azienda committente, ovvero che produce alimenti o farmaci, che ha l’interesse a monitorare il suo prodotto nel trasporto, per garantire all’utilizzatore finale che esso è stato trasportato in modo controllato. In questo modo l’intera filiera può essere garantita direttamente al produttore, che chiede l’installazione del prodotto telematico sul veicolo per poter controllare la distribuzione.

UNICO MONITOR E UNICO PORTALE: L’INTEGRAZIONE ALLA BASE DEL SUCCESSO

IL TREND IN CRESCITA: PRONTI NUOVI PROGETTI E IDEE PER IL TRASPORTO L a mission di Fiway oggi va al di là del freddo. “Stiamo ampliando il raggio d’azione dei nostri sistemi telematici - afferma l’ingegner Francesca Amisano - al trasporto del secco, del farmaceutico, per rispondere alle richieste che provengono dalla stessa clientela. La telematica oggi consente di agire da remoto su ogni componente del veicolo, diventando strumento fondamentale per il TCO e l’efficienza del trasporto”. Per l’assistenza, Fiway si avvale di una Rete di officine, di-

slocata sul territorio, che sa come intervenire sull’impianto installato, qualunque sia la tipologia di trasporto. “Il trend - afferma l’ingegner Edoardo Angelini - è in forte crescita, il prodotto è ben recepito perché rispetta le esigenze del trasportatore. Sono in cantiere nuovi progetti per nuovi prodotti, sempre più performanti e sempre più rispondenti alle esigenze specifiche della clientela”. Qual è la “chiave di differenza” di Fiway rispetto ai suoi

competitor? “Oltre alle caratteristiche di semplicità d’impiego e flessibilità - conclude Angelini - il prodotto Fiway si integra perfettamente con i principali sistemi gestionali utilizzati dai trasportatori nello svolgimento delle loro attività: se si utilizza, ad esempio, un monitor per stabilire le rotte e organizzare il traffico in base a prese e scambi da effettuare, lo stesso monitor potrà essere utilizzato per gestire e verificare il funzionamento del gruppo frigorifero”.


IL MONDO DEI TRASPORTI

Pagina 46

N° 284 / Novembre 2019

TRANSFRIGOROUTE / A NAPOLI IL MEETING DEGLI OPERATORI EUROPEI DEL SETTORE

Sono epocali le sfide degli attori del freddo “ABBRACCIARE I NUOVI TREND PER ANTICIPARE IL FUTURO”. QUESTO IL TITOLO DELLA 64ESIMA ASSEMBLEA ANNUALE DELL’ORGANIZZAZIONE CHE A LIVELLO EUROPEO RAPPRESENTA L’INTERA FILIERA DEL FREDDO. “IL SETTORE VA MESSO AL CENTRO DELLE POLITICHE ITALIANE ED EUROPEE CON TUTTA L’ATTENZIONE CHE MERITA E PER QUESTO IL DIALOGO TRA IMPRESE E ISTITUZIONI, TRA PRODUZIONE E TRASPORTO, NONCHÉ TRA NOI IMPRENDITORI, È FONDAMENTALE PER ASSICURARE AL SETTORE UNA CRESCITA SOSTENIBILE NON SOLO IN TERMINI AMBIENTALI, MA ANCHE ECONOMICI”, HA DICHIARATO NEL SUO APPASSIONATO INTERVENTO UMBERTO TORELLO, PRESIDENTE DI TRANSFRIGORUOTE ITALIA.

I

FABIO BASILICO NAPOLI

l mondo del trasporto a temperatura controllata si è riunito a Napoli per il Meeting generale annuale di Transfrigoruote International, l’organizzazione, nata nel 1955, che riunisce 11 associazioni di altrettanti Stati membri UE che raggruppano migliaia di imprese tra trasportatori, costruttori e allestitori del la cold supply chain. Si tratta dell’unica organizzazione a livello europeo che rappresenta l’intera filiera del fred do. Un pubblico d’eccezione che è stato ospitato nei suggestivi spazi di Castel Dell’Ovo, nel cuore del capoluogo partenopeo. Dal 2017 è Anita (Associazione nazionale imprese trasporti automobili-

stici) la nuova casa di Transfrigoroute Italia. Introdotta da Umberto Torello, titolare di Torello Trasporti, Presidente di Transfrigoruote Italia, la 64esima Assemblea annuale di Transfrigoroute aveva come titolo “Abbracciare i nuovi trend per anticipare il futuro”. il dibattito è stato declinato in tre panel di discussione: “L’ecommerce del freddo e la distribuzione urbana”, “Alimentazioni alternative per i veicoli frigoriferi” e “Il coordinamento tra la produzione e il trasporto legati alla cold chain”. “È un immenso piacere per noi aver ospitato quest’anno i colleghi di tutta Europa per dialogare insieme sul futuro del trasporto e della logistica del freddo: un’occasione unica di confronto tra tutti gli attori della filiera in un periodo di

cambiamenti epocali e di nuovi paradigmi che influenzano profondamente il modo di fare impresa - ha dichiarato Umberto Torello nel suo intervento - Il settore va messo al centro delle politiche italiane ed europee con tutta l’attenzione che merita e per questo il dialogo tra imprese e Istituzioni, tra produzione e trasporto, nonché tra noi imprenditori, è fondamentale per assicurare al settore una crescita sostenibile non solo in termini ambientali, ma anche economici”. Torello Trasposti è una delle molte aziende attivamente e a vario titolo protagoniste dei trasporti e della logistica a temperatura controllata che hanno partecipato all’Assemblea annuale Transfrigoroute 2019 in qualità di sponsor a diversi livelli. Tra queste se-

gnaliamo Thermo King - Frigoblock, Carrier Transicold, Kögel, Maurelli Group, Mercedes-Benz, Iveco, KnorrBremse, Krone, TMT tanks and trailers, Transics. Nel suo intervento in rappresentanza del platinum sponsor Thermo King, Marco Tosi, Sales Manager Thermo King Italy & Israel, ha sottolineato l’impegno costante dell’azienda parte del Gruppo Ingersoll Rand nella sostenibilità. “Ther mo King si è sempre caratterizzata per la capacità di introdurre soluzioni sostenibili in anticipo sulle normative. Nel 2015 Thermo King ha tra l’altro acquisito l’azienda Frigoblock, che produce unità com pletamente elettriche con mercati di riferimento nel Nord Europa e progressiva diffusione anche nel Sud Europa”. “Al

centro delle ultime novità di prodotto nel segno della sostenibilità del trasporto frigorifero - ha aggiunto Tosi - c’è l’innovativa soluzione mono e multitemperatura per semirimorchi SLXi Hybrid, che ben esemplifica la concretizzazione del know-how Thermo King e Frigoblock. Il risultato è la prima unità per semirimorchio veramente ibrida del settore, che offre tutti i vantaggi del diesel e dell’energia elettrica. La modalità diesel e l’alimentazione elettrica hanno vantaggi diversi e specifici. Combinandole in modalità ibrida, avremo la garanzia che l’applicazione sarà completamente adattabile ai requisiti ambientali attuali e futuri. SLXi Hybrid offre un costo totale di proprietà e un impatto ambientale ridotti al mini-

mo sia per la distribuzione urbana sia per il trasporto su lunga distanza”. In pratica, l’inverter Frigoblock, che è produttore leader con 40 anni di esperienza nel settore dei sistemi di trasmissione con alternatore, trasforma l’elettricità dell’alternatore in energia per l’u nità di refrigerazione SLXi. Ciò consente di avere tensione e frequenza costanti all’unità indipendentemente dalla velocità del motore del veicolo oltre che la garanzia di avvio rapido dell’unità con sollecitazione meccanica ridotta. L’unità di refrigerazione diesel-elettrica Thermo King può operare con alimentazione completamente elettrica o funzionamento autonomo a motore diesel. Senza contare che la modalità ibrida è disponibile per tutte le applicazioni.

Il palco dei relatori e la platea all’interno dei suggestivi spazi di Castel dell’Ovo a Napoli.

L’intervento del Presidente di Transfrigoroute Italia

Torello: “Insieme per vincere la sfida della sostenibilità” “

Siamo molto ambiziosi”. Così ha esordito nell’intervento inaugurale dell’Assemblea annuale di Transfrigoroute Umberto Torello, Presidente della sezione italiana dell’organizzazione europea degli operatori del trasporto refrigerato. “Motivo di orgoglio per tutti noi di Transfrigoroute Italia e di Anita, di cui da due anni fa parte, è la centralità dell’Italia e delle aziende della catena del freddo in ambito europeo - ha dichiarato Torello - Catena del freddo che è centrale per l’integrità e la qualità dei prodotti alimentari e farmaceutici. Proprio in ragione di questo fondamentale ruolo nel sistema economico, sentiamo come operatori del settore la responsabilità di seguire l’evoluzione tecnologica e le più recenti soluzioni per rendere sempre più sostenibile il trasporto e la logistica del freddo”.

Umberto Torello ha anche parlato di Industria 4.0 che, come parte integrante della trasformazione digitale delle imprese, ha cambiato profondamente il modo in cui le imprese fanno business. “La realtà virtuale, l’intelligenza artificiale, l’internet delle cose e la manutenzione predittiva sono già diventati concetti conosciuti in molti settori dell’economia ha detto il Presidente di Transfrigoruote Italia Nel cuore della moderna impresa, la digitalizzazione della supply chain è un passo fondamentale per implementare ulteriormente questi concetti. Il futuro sarà fatto da aziende e industrie digitalmente interconnesse, officine avanzate e operazioni logistiche che riducono i costi di stoccaggio delle merci e conseguentemente vadano incontro con maggiore efficienza alle esigenze del cliente finale”.

Alla luce dei cambiamenti in atto, per Umberto Torello il messaggio è chiaro: le aziende del trasporto devono essere pronte per il futuro, dove l’innovazione sarà sempre più strettamente legata alle tematiche ambientali e la sostenibilità ambientale non potrà che essere anche sostenibilità economica. “In un settore come il nostro, che è di estrema importanza per la qualità dei prodotti commercializzati e consumati, trasporti e logistica non possono e non devono essere visti come costi da comprimere - ha spiegato Torello - Al contrario, le nostre aziende sono da considerarsi partner indispensabili del processo produttivo e parte integrante dell’efficienza della distribuzione, in particolare in ambito urbano, dove le esigenze ambientali sono particolarmente pressanti”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 47

INTERVISTA

F

ondata nel 1921, e quindi con quasi cento anni di attività alle spalle, Sirti si è sempre qualificata come player innovativo e partner tecnologico d’eccellenza. Oggi è leader nazionale e internazionale nella progettazione, realizzazione, manutenzione, integrazione di sistemi e gestione di infrastrutture di rete. I settori di riferimento in cui opera sono altamente strategici e fortemente attuali: telecomunicazioni, soluzioni digitali per le aziende, energia e trasporti ferroviari. Proprio in quest’ultimo ambito è attiva la Business Unit Transportation, di cui è Vice President Roberto Chieregati. A lui chiediamo innanzitutto quale sia lo stato di avanzamento della strategia di Sirti nel settore dei trasporti: “Sirti da sempre è stata capace di interpretare efficacemente le dinamiche di mercato e da anni ormai ha deciso di spostare il focus del business, e quindi del proprio portafoglio di offerta in ambito Trasporti, da attività tradizionali come la trazione elettrica e l’alta tensione, verso la digitalizzazione delle reti ferroviarie e delle tecnologie del se gnalamento ferroviario spiega Roberto Chieregati - I nostri investimenti program-

ROBERTO CHIEREGATI DIRETTORE BU TRASNPORTATION DI SIRTI

nata tratta T3) costituita da 2,8 km di galleria a doppio bi nario e da due stazioni (Am ba Aradam/Ipponio e Fori Imperiali). In particolare Sirti gestirà la pianificazione e realizzazione di tutti i sistemi di telecomunicazione, degli impianti di videosorveglianza, dei sistemi di informazioni al pubblico e di diffusione sonora, e in generale delle tecnologie funzionali al completamento dell’opera. Nell’ambito di questo progetto, Sirti Transportation, nel ruolo di System Integrator, effettuerà l’integrazione dei nuovi impianti nel cuore tecnologico del Posto Centrale di Metro C presso “Deposito Graniti”, dove sarà possibile monitorare, diagnosticare e comandare i nuovi sistemi. “Dopo aver conseguito con successo altri lavori della Metro C di Roma, della Metro 4 di Milano e della Tramvia di Firenze, siamo orgogliosi di poter continuare a mettere a disposizione il know-how e la nostra esperienza per la città di Roma, a beneficio dei cittadini che potranno in futuro usufruire di un miglior servizio di trasporto urbano”, precisa Chieregati. La Business Unit Sirti Transportation era presente alla nona edizione di EXPO

Sui binari della digitalizzazione “LA NOSTRA FORZA È LA CAPACITÀ DI ESSERE SYSTEM INTEGRATOR CON UN PORTAFOGLIO TRA I PIÙ ESTESI E AMPI DEL MERCATO E DI COSTRUIRE SOLUZIONI ‘TAILOR MADE’ - AFFERMA IL MANAGER DELLA BU TRANSPORTATION DI SIRTI - IN UN SETTORE FERROVIARIO SEMPRE PIÙ TECNOLOGICO, SI È PASSATI DA UNA REALTÀ IN CUI LA RETE DI TELECOMUNICAZIONI ERA INDIPENDENTE DA QUELLA DELL’ENERGIA O DEL SEGNALAMENTO, A UNA REALTÀ IN CUI C’È SEMPRE PIÙ FUSIONE, INTEGRAZIONE E INTERDIPENDENZA. BISOGNA SAPER COSTRUIRE ARCHITETTURE DI SISTEMA CHE CONSENTANO DI GESTIRE TUTTE QUESTE RETI E IMPIANTI OPERATIVI TENENDOLI ALLINEATI A STANDARD DI SICUREZZA AI MASSIMI LIVELLI, CON SERVIZI ADEGUATI A UN MONDO SEMPRE PIÙ SMART”. mati da tempo, non si limitano alla progettazione e realizzazione di un singolo prodotto, ma sono orientati alla definizione di una nuova piattaforma tecnologica che fornirà un livello superiore di offerta nel campo del segnalamento ferroviario. Il mercato italiano dei prossimi anni sarà interessato da un consistente pia no di investimenti nel mondo digitale delle reti. Sirti è stata lungimirante nel comprendere le dinamiche a venire: la nostra strategia ci consente oggi di intercettare efficacemente e prontamente i bisogni dei clienti. Nel 2019 abbiamo continuato lo sviluppo di nuovi prodotti innovativi e proseguito nelle attività tradizionali a supporto di RFI (Rete Ferroviaria Italiana), in particolare per quanto riguarda l’attivazione di diverse stazioni ferroviarie. Inoltre, continua il nostro ruolo di partner per la realizzazione dell’Alta velocità nelle varie tratte”. In Italia permane il tema delle infrastrutture. “Il forte bisogno di una mobilità efficace, efficiente e soprattutto più vicina alle esigenze di un’intera società in continuo movimento, richiede un intervento importante sulle infrastrutture - dice Chieregati -

sono due i possibili approcci in questo senso: realizzare nuove infrastrutture, o “iniettare” tecnologia nelle infrastrutture esistenti. Ad oggi è quest’ultima è la strategia più quotata e implementabile. L’Alta Velocità è un’ottima soluzione sulle lunghe distanze e oggi è una realtà consolidata, mentre solo dieci anni fa era ritenuta quasi superflua; sulle tratte ferroviarie più tradizionali, i moderni sistemi di segnalamento consentono una gestione del traffico che rende più densi i treni tra di loro, dunque una maggiore disponibilità di circolazione, e garantiscono percorrenza per più passeggeri nell’unità di tempo. Questo è un dato molto importante in un Paese come il nostro che ha una superficie sfruttabile limitata.’’ “In Europa - aggiunge Roberto Chieregati - Sirti è membro di Unife e Unitel, associazioni europee dedicate ai temi di settore, e partecipa, in qualità di membro esperto, ai panel di discussione. Ci siamo aggiudicati diverse call di ricerca a livello europeo, proprio perché crediamo che il dotarci di un approccio innovativo nelle soluzioni tecnologiche ci permetta di dare il nostro contributo come sog-

di FABIO BASILICO MILANO

getti portatori di grande esperienza e di poter intercettare i cambiamenti in atto con grande tempestività. Il settore dei trasporti cambierà molto nel futuro, perché cambieranno gli standard tecnologici che ci consentiranno di realizzare architetture ancora più complesse. Il tutto, tenendo ovviamente conto che nel mondo ferroviario i cambiamenti richiedono il loro, tempo proprio perché gli standard, in particolare quelli legati alla sicurezza, sono molto critici da gestire”. “La ferrovia ha cambiato pelle in modo importante, si è aperta all’innovazione - dice ancora Roberto Chieregati Per esempio, l’interoperabilità tra diversi operatori del settore ha comportato l’iniezione di tecnologie e le aziende han no così sposato il trend con investimenti importanti. Questo percorso virtuoso ha generato servizi migliori per i passeggeri e supportato la crescita di operatori e aziende; negli anni inoltre, questo processo ha consentito di rafforzare diverse realtà. È altresì chiaro che risentiamo delle oscillazioni che provengono dal mondo politico-istituzionale e ciò non aiuta le aziende che hanno invece bisogno di

stabilità e di una visione di medio-lungo periodo per pianificare gli investimenti. L’ideale sarebbe poter contare su un’idea di progetto condivisa e che questa idea successivamente fosse giudicata solo in base alla capacità di essere messa in atto. Purtroppo non è sempre così”. Anche sul tema dell’intermodalità Sirti dice la sua mettendosi in gioco come solutions provider ad alto valore ag giunto, in particolare per quanto riguarda la digitalizzazione e le telecomunicazioni, su cui vanta competenze trasversali dovute all’integrazione funzionale tra le diverse aree operative aziendali. E per quanto riguarda la specificità del trasporto urbano, Roberto Chieregati ricorda il forte im-

pegno di Sirti nei progetti di metropolitana che interessano diverse città italiane: “Siamo coinvolti nei principali progetti di metro italiana. La domanda di mobilità urbana è assolutamente maggiore della risposta che probabilmente le città riescono a dare. Principalmente è un problema finanziario. I progetti si scontrano con problematiche finanziarie che non sono così semplici da risolvere. Quel che è certo è che non ci mancano le competenze: parlo in generale, come italiani siamo bravi a fare queste cose”. Ad esempio, Sirti, proprio con la BU Transportation, si occuperà della realizzazione del prolungamento verso il centro città della Linea C della Metropolitana di Roma (denomi-

Ferroviaria 2019 a Fiera Milano, la vetrina più autorevole per le imprese che si occupano di innovazione tecnologica nel comparto ferroviario. Sirti Transportation ha presentato la propria offerta di soluzioni e servizi, una delle più complete, multidisciplinari e innovative del settore. Elemento di punta - che completa il portafoglio tecnologico offerto da Sirti nel mercato del trasporto ferroviario - è l’innovativo ACC-Multistazione, Apparato Centrale Computerizzato denominato Compact SIS-4, che rappresenta l’a vanguardia dei sistemi di segnalamento multistazione. Interamente computerizzata, que sta soluzione integra le funzioni di comando locale di stazione e di distanziamento dei treni con quelle di gestione del segnalamento ferroviario. Impiegata con successo in diverse tratte nazionali, sta trovando rapidamente collocazione anche a livello internazionale. Per le sue particolari caratteristiche di intercambiabilità, scalabilità e compattezza, che permettono una riduzione dei costi operativi e di manutenzione, l’ACC-Multistazione SIS-4 è tra i sistemi più avanzati e sofisticati sul mercato.


IL MONDO DEI TRASPORTI

Pagina 48

N° 284 / Novembre 2019

AUTOSTRADE / INAUGURATI NEL NORD DUE DISTRIBUTORI DI GAS NATURALE

A Brebemi piace il metano CONTINUA L’IMPEGNO “GREEN” DELLA SOCIETÀ PRESIEDUTA DA FRANCESCO

BETTONI, CHE CONTRIBUISCE AL RAPIDO SVILUPPO DELLA RETE DI STAZIONI DI RIFORNIMENTO.

LE

NUOVE APERTURE DEI DUE IMPIANTI, PRESSO LE AREE DI SERVIZIO

ADDA NORD E ADDA SUD A CARAVAGGIO, IN CONCESSIONE A

SOCOGAS, CONSOLIDANO LA POSIZIONE DI LEADERSHIP DELL’ITALIA NEL CONTESTO EUROPEO DEL GAS.

ALL’EVENTO

INAUGURALE PRESENTI

C

PAOLO ALTIERI CARAVAGGIO

on l’inaugurazione di due distributori di LNG (gas naturale liquefatto) e CNG (Compressed Natural Gas o metano per vetture), nelle aree di servizio di A35 Brebemi Adda Nord e Adda Sud a Caravaggio, in concessione a Socogas, storico operatore del settore petrolifero ed energetico, prosegue a gran velocità lo sviluppo della rete di stazioni di rifornimento di gas. Le nuove aper ture consolidano ulteriormente la posizione di leadership dell’Italia nel contesto eu ropeo del gas naturale (più noto tra gli autotrasportatori come metano liquido). L’evento inaugurale si è svolto alla presenza dell’Assessore alle infrastrutture, trasporti e mobilità sostenibile di Regione Lombardia Claudia Maria Terzi, dell’Assessore allo Sviluppo Economico Alessandro Mattinzoli, del Presidente di

IVECO E SCANIA CON I PESANTI STRADALI

A35 Brebemi Francesco Bettoni e del Presidente di Socogas Renzo Zucchi. “Nei giorni immediatamente successivi al summit dell’ONU a New York sul clima, in cui diversi Paesi hanno preso l’impegno di abbassare nei prossimi anni le

emissioni inquinanti - ha dichiarato Bettoni - questa inau gurazione diventa un passo importante in questa direzione: guardare sempre avanti, valutando e cogliendo ogni possibilità d’innovazione per uno sviluppo economico e sociale rispet-

toso dell’ambiente, sono solo alcuni dei valori che A35 Brebemi sta perseguendo e che stanno dando risultati positivi per quanto riguarda sia i numeri (traffico e fatturato) sia le ricadute sul territorio. I distributori di LNG e CNG, i primi

Il taglio del nastro all’inaugurazione dei due nuovi distributori di LNG e CNG sulla A35 Brebemi.

CON SOCOGAS PARTNERSHIP ALL’INSEGNA DELLA MOBILITÀ ECOSOSTENIBILE

nel centro-nord Italia su un’autostrada, in due moderne aree di servizio, sono stati voluti nel solco di questa politica con il partner Socogas”. In rappresentanza delle Case costruttrici erano presenti Iveco e Scania con i rispettivi trattori stradali alimentati a LNG. Per Iveco erano presenti Fabrizio Buffa, Gas Business Development Manager, e Alessandro Zanardi, titolare di Autoindustriale Bergamasca, Concessionaria di riferimento di zona, che ha messo a disposizione per il primo ri fornimento un Iveco S-Way NP (Natural Power), pesante stradale entrato dallo scorso luglio a rinnovare la gamma. Anche Scania, rappresentata da Paolo Carri, Direttore Business Support & Development, ha messo a disposizione un veicolo LNG da 13 litri, 410 cv e 2.000 Nm per effettuare la dimostrazione di rifornimento. Prodotto economico e a

ALIMENTATI A

LNG.

bas so impatto ambientale che viene sempre più utilizzato in diversi settori, in particolare per il trasporto stradale pesante, il gas naturale liquefatto, usato per le flotte di mez zi, permette una riduzione di emissioni di CO2 del 15 per cento rispetto ai carburanti tradizionali, degli ossidi di a zo to del 50 per cento e arriva a zero emissioni per il particolato e gli ossidi di zolfo, oltre a permettere un fondamentale risparmio di costi del 43 per cento rispetto al gasolio. In Italia sono oltre duemila i camion in circolazione alimentati a LNG e la sua diffusione è stata molto rapida negli ultimi anni, in particolare per il trasporto stradale pesante, con una crescita velocissima della rete delle stazioni di rifornimento (erano 38 a fine 2018) oltre ad aver ottenuto diverse manifestazioni d’interesse per sviluppare nuove infrastrutture nelle aree portuali per servire anche le navi.

BETTONI: “BREBEMI IN PRIMA LINEA NELL’ECONOMIA CIRCOLARE D’EUROPA” L e due stazioni di rifornimento, che sorgono una di fronte all’altra nel tratto autostradale, sono state costruite nel 2017 e potenziate nel corso dell’ultimo anno con la formazione di una vera e propria “isola truck” che eroga sia diesel sia LNG, quest’ultimo prelevato da due serbatoi criogenici ad asse verticale da 40 mc ciascuno, dove viene stoccato. Nell’area dedicata ad autovetture e LCV una colonnina multidispenser a due pistole permette invece il rifornimento di CNG, in aggiunta ai carburanti tradizionali, già disponibili. Completano l’offerta un’area di ristoro, un ampio parcheggio per camper, bus e truck, nonché un servizio docce. “Queste aperture che prevedono l’avvio della distribuzione di carburanti “green” sia per mezzi pesanti sia per vetture - afferma il Presidente di A35 Brebemi, Francesco Bettoni - sono un ulteriore passo avanti concreto verso la de-carbonizzazione, nel solco di quel proces-

so di innovazione e attenzione all’ambiente che A35 Brebemi sta perseguendo dalla sua progettazione e che, grazie ad altri progetti “green” in corso, la vedono in prima linea per poter diventare, nel giro di qualche anno, la prima autostrada a economia circolare d’Europa”. Azienda italiana fondata nel 1967, proprietaria di una rete di circa cento stazioni di servizio, il Gruppo Socogas è da sempre attento alle nuove tecnologie. “L’obiettivo - dichiara Renzo Zucchi, Presidente Socogas - è preparare un futuro in cui la mobilità ecosostenibile dovrà correre parallela allo sviluppo economico. Nelle aree di servizio di A35, in cui era imprescindibile il metano gassoso per le auto, abbiamo ritenuto necessario inserire anche l’LNG per gli automezzi pesanti, in perfetta linea con le politiche innovative da sempre condivise con Brebemi”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 49

KITA / UNICO MARCHIO DEL TRAINATO PER NEW TRANSPORT GENERATION

Con Serin carico facile e veloce SOCIETÀ FAMILIARE FONDATA E GUIDATA DAI FRATELLI IAROPOLI, L’AZIENDA DI TORTONA DÀ LAVORO A SETTANTA DIPENDENTI, DISPONE DI UNA

N

FLOTTA DI CINQUANTACINQUE TRATTORI E UN CENTINAIO DI SEMIRIMORCHI, METTENDO A DISPOSIZIONE DI TRE OPERATORI LEADER NELLA LOGISTICA INTERMODALE L’INARRESTABILE PASSIONE EREDITATA DAL PADRE LUIGI.

LA PROFICUA COLLABORAZIONE CON IL PRODUTTORE TURCO HA PORTATO SULLE STRADE IL VEICOLO TRASFORMATO PER LE LORO SPECIFICHE ESIGENZE, REALIZZATO SU MISURA DIRETTAMENTE IN FABBRICA.

MAX CAMPANELLA

l’export, servizio che ci distingue e che rappresenta la nostra “chiave di differenza”. In attesa che il porto sia operativo, i container possono essere depositati da noi: servizio per il quale disponiamo di apposita gru. La clientela ci conosce bene, sa che da noi trova qualità, puntualità e professionalità: con tutti e tre il rapporto è consolidato e basato su reciproca stima”. A disposizione dei tre colossi New Transport Generation mette una flotta moderna, costituita da 55 trattori stradali, in prevalenza DAF, Renault Trucks e Volvo Trucks, marchio che recentemente ha collocato nel parco due nuovi FH 16 da 750 cv, in gran parte a noleggio. Per il trainato i semirimorchi so no un centinaio, in massima parte portacontainer tra fissi e allungabili e due centinati. Il tutto a marchio Serin, produttore turco importato in Italia da KITA, con il quale l’azienda di Tortona ha realizzato un vero e proprio veicolo su mi-

TORTONA

ew Transport Generation è oggi una realtà che dà lavoro a 70 dipendenti. Serve clienti di rilievo puntando su qualità del servizio e fornitori affidabili, tra i quali KITA e il marchio Se rin per i portacontainer. Guidata dalla famiglia Iaropoli, guarda al futuro con la passione per il mestiere del trasportatore, con il giusto ottimismo ma con i piedi per terra. Una strategia che ha radici lontane: i quattro fratelli, e con loro mogli e cugini, non dimenticano che tutto è nato dal sacrificio di Luigi Iaropoli. Il quale avrebbe forse per i figli preferito un’altra professione, ma di loro sarebbe orgoglioso, non foss’altro perché hanno coronato un sogno che egli aveva nel cassetto: dare vita a un’azienda di trasporto tutta sua. Soprattutto Vincenzo, 43 anni, il fratello maggiore cui è dovuta la nascita dell’azienda, ben ricorda gli anni dell’infanzia quando il padre era di frequente lontano da casa: Luigi Iaropoli operava da dipendente per mantenere la famiglia, ai tempi abitante a Cit tanova, in provincia di Reggio Calabria. Il primogenito, e con lui Luciano, 41 anni, Giuseppe, 38, e Stefano, 28, mai hanno dimenticato il “sogno nel cassetto” del padre di coltivare appieno la pas sione da camionista con una ditta tutta sua. Il sogno s’interrompe prima di prendere forma nel 2003, quando l’uomo scompare per un malore al volante del truck. Per la moglie Nunziata e i figli è uno shock: mettersi con il camion sulla strada? Non se ne parla. Nel giugno 2004 la passione prende il sopravvento: Vincenzo prende il primo camion, un Iveco Eurostar da 470 cv, e inizia a operare presso il porto di Gioia Tauro. In pieno agosto, mette a disposizione quanto gli aveva insegnato il padre: essere operosi, sempre; rimboccarsi le maniche per arrivare dove altri si fermano.

“Al porto - ricorda Vincenzo Iaropoli - avevano estrema ne cessità di movimentare i container verso il Nord Italia ma non c’erano trasportatori disponibili e mi sono fatto avanti”. È l’inizio di una nuova storia per la famiglia Iaropoli. Passano due mesi e arriva il secondo veicolo. A dicembre 2004 la ditta, New Transport Generation, si stabilisce a Tortona, crocevia logistico delle merci. Nel 2005 arriva il primo trattore nuovo: un Iveco Stralis. Nel 2006 s’insedia nell’attuale capannone, in fase di ampliamento per arrivare a 300 mq di uffici open space, sala riunioni e ristoro di pendenti e 4mila mq di piaz zale e officina interna. Nel biennio 2007-2008 l’azienda arriva a 40 unità, caratterizzando il parco con una tipica livrea rosa, camion che iniziano a coprire rotte in tutto il Nord Italia e la Toscana. Il container è da sempre la specializzazione di New Transport Generation, che pe-

Da sinistra: Vincenzo e Stefano Iaropoli, che stringe la mano a Pietro Tondello, Responsabile Marketing KITA, e Giuseppe Iaropoli, tre dei quattro fratelli al timone di New Transport Generation.

rò gli Iaropoli propongono come servizio completo e organizzato, avendo come clienti operatori logistici di rilievo con i quali il rapporto è diretto: Hannibal, MTO (Operatore per il Trasporto Multimodale) del Gruppo Con-

tship; MedLog Italia, divisione logistica italiana di MSC; Truck Rail Container (Gruppo Gavio). “A disposizione dei clienti - spiega Stefano Iaropoli - mettiamo le nostre strutture h 24, compresa la pesa per container diretti al-

sura che, nato sulla base delle sue esigenze, rappresenta oggi un riferimento per il mercato italiano. Gli Iaropoli, affiancati dal responsabile officina Marino Buscarini e dalla sua trentennale esperienza, si sono recati presso lo stabili-

mento con il Sales Manager KITA Adem Oksuz per studiare le modifiche necessarie. “Due anni fa abbiamo portato su strada le prime cinque unità. Dopo averle usate per un anno - spiega Giuseppe Iaropoli - abbiamo chiesto di apportare migliorie per lavorare meglio, ad esempio installando il sistema radiocomandato per evitare all’autista di scendere e salire dal mezzo tutte le volte che occorre allungare o accorciare il porta container in base al box da caricare: con questo sistema l’operazione richiede non più di 20 secondi”. In questo modo il veicolo adatto a New Transport Generation esce dalla fabbrica direttamente. “Per noi - afferma Giuseppe Iaropoli - KITA è un fornitore importante, oggi è l’unico per i semirimorchi. C’è una buona intesa e un’ottima collaborazione. Con loro e con i nostri partner intendiamo proseguire: il trend degli ultimi anni è positivo. Potrebbe esserci una stasi nel 2020, ma noi puntiamo a fare quello che ci riesce meglio e che facciamo con la passione ereditata da nostro padre: curare il cliente al di là del servizio di trasporto”. Serin è uno dei brand dell’ampia famiglia importata da KITA. “Il nostro ventaglio di prodotti - afferma Pietro Tondello, Responsabile Marketing - va dal centinato al trasporto eccezionale passando per segmenti di nicchia quale quello di New Transport Generation. Aver soddisfatto l’esigenza del cliente è quanto ci distingue rispetto a costruttori di grosse dimensioni. Non ci limitiamo a piccole modifiche: come nel caso degli Iaropoli il veicolo è stato costruito insieme sin dall’inizio”. “Con Serin - afferma A dem Oksuz - stiamo crescendo in Italia puntando su un prodotto di qualità, costituito com’è di componenti sviluppate in Europa e sul servizio post vendita: siamo sempre vicini al cliente supportandolo nelle sue necessità prima, durante e dopo la consegna del veicolo”.

SOLUZIONI PERSONALIZZATE PER SODDISFARE LE SPECIFICHE RICHIESTE DEL CLIENTE

YALCIN, SPECIALI PER MISSIONE È

nel segno della specializzazione la nuova offensiva per il mercato italiano di KITA Srl. Come è stato spiegato in occasione del Salone GIS 2019 di Piacenza da Adem Oksuz, Sales Manager, KITA intende adattare completamente la sua offerta alle caratteristiche del mercato italiano, che a differenza di quelli esteri dove è prioritaria l’opzione dell’allestimento standard, ha la netta propensione per il veicolo speciale, cioè personalizzato secondo le specifiche esigenze del singolo utilizzatore. E proprio alle Giornate italiane del sollevamento, con Yalcin, marchio dei trasporti eccezionali, KITA ha dimostrato quanto sia capace di venire incontro ai trasportatori italiani. “Riteniamo che oggi il

mercato italiano chieda qualcosa di diverso rispetto al resto d’Europa - spiega Adem Oksuz - Il trasportatore italiano ha richieste speciali e non tanto di livello standard. Ed essendo il GIS una fiera dedicata soprattutto al settore del trasporto eccezionale, abbiamo voluto essere presenti con i nostri veicoli speciali Yalcin, nello specifico i carrelloni eccezionali sia ribassati che allungabili e il carrellone per il trasporto veicoli. In questi ultimi cinque anni l’impegno di KITA è stato quello di realizzare veicoli speciali su misura per il trasportatore italiano. Non siamo solo importatori di marchi e prodotti, vogliamo capire il mercato italiano e le sue esigenze, modificare i nostri veicoli di conseguenza

e quindi venderli. Lo facciamo per tutti gli otto marchi del nostro portafoglio”. La politica aziendale di KITA ha subito una rivoluzione a 360 gradi, passando dal veicolo standard a quello speciale. “Il nostro

vantaggio è dato dal fatto che per noi non esiste il prodotto standard ma singole unità specifiche per ciascun cliente - aggiunge Oksuz - È una prerogativa competitiva che ci differenzia dalla concorrenza”.


IL MONDO DEI TRASPORTI

Pagina 50

N° 284 / Novembre 2019

DIESEL TECHNIC / GRANDE KERMESSE CON I CLIENTI AL KARTODROMO DI FRANCIACORTA

Partner Academy un successo

N

FABIO BASILICO CASTREZZATO

on c’era luogo migliore per celebrare un incontro all’insegna della spontaneità e del divertimento. Il Kartodromo dell’Autodromo di Franciacorta ha ospitato la tappa bresciana della Partner Academy di Diesel Technic, evento organizzato in collaborazione con il distributore Record Ricambi, punto di riferimento Diesel Technic per le province di Brescia e Bergamo, con il preciso obiettivo di incontrare i clienti finali della filiale italiana del Gruppo tedesco leader internazionale nella distribuzione di ricambi per veicoli industriali e commerciali. “Partner Academy è un programma mondiale riservato a tutte le filiali Diesel Technic che prevede una serie di incontri e momenti di scam bio tra distributori e cliente finale - spiega Walter Schiavi, General Manager di Diesel Technic Italia - Lavorando, per filosofia aziendale, nel pieno rispetto della filiera distributiva e rivolgendoci quindi solo ai distributori, è importante per noi poter incontrare i loro clienti per avere il loro feedback diretto, da riportare alla Casa madre. Al

Kartodromo di Franciacorta abbiamo previsto una serie di gare di kart, seguite da una sessione tecnica di aggiornamento sul prodotto e sulle novità Diesel Technic e, per chiudere, una cena con la premiazione dei vincitori delle competizioni”. All’Autodromo di Franciacorta sono intervenuti circa sessanta clienti, accompagnati dal loro distributore Diesel Technic di fiducia, Giuseppe Bullini, titolare e amministratore unico della Record Ricambi di Brescia. “Si è trattato di un evento volutamente ludico, che ci ha permesso di creare sintonia e una relazione umana spontanea e costruttiva - spiega Walter Schiavi - Per poter organizzare al meglio la giornata, abbiamo lavorato insieme a Record Ricambi, il nostro riferimento nella zona, che ci ha supportato egregiamente”. Nell’ambito della Partner Academy, assieme ai distributori del marchio Diesel Technic vengono proposte diverse occasioni formative, inclusi i workshop per meccanici professionisti. Il programma di formazione della Partner Academy viene ampliato costantemente, all’insegna del motto di Diesel Technic “Cre scere insieme ai nostri

IL KARTODROMO DELL’AUTODROMO DI FRANCIACORTA HA OSPITATO LA TAPPA BRESCIANA DELLA

PARTNER ACADEMY DI DIESEL TECHNIC, EVENTO ORGANIZZATO IN COLLABORAZIONE CON IL DISTRIBUTORE

RECORD RICAMBI, PUNTO DI RIFERIMENTO

DIESEL

TECHNIC PER LE PROVINCE DI BRESCIA E BERGAMO, CON IL PRECISO OBIETTIVO DI INCONTRARE I CLIENTI FINALI DELLA FILIALE ITALIANA DEL GRUPPO TEDESCO LEADER INTERNAZIONALE NELLA DISTRIBUZIONE DI RICAMBI. Walter Schiavi, General Manager di Diesel Technic Italia.

distributori”. “Il Partner Program - aggiunge Schiavi - è nato con l’intento di creare relazioni di successo e strategie condivise. Gli obiettivi sono lo sviluppo e il consolidamento di una partnership fidelizzata e a lungo termine, a vantaggio dei nostri distributori, i relativi clienti delle officine e naturalmente del Gruppo Diesel Technic”. Negli ultimi tre anni Diesel Technic Italia ha raggiunto dimensioni inattese, che hanno superato le più rosee a spettative del management tedesco. La filiale italiana è par tita nel novembre 2016 con la sede di Verona che oggi vanta già importanti ampliamenti, con obiettivi di crescita anche oltreconfine. I ricambi a marchio DT Spare Parts rappresentano il 95 per cento dell’attività dell’azien-

da, cui si aggiunge il 5 per cento relativo al marchio Siegel Automotive. Un’offerta di ricambi per veicoli industriali e commerciali dall’ottimo rapporto prezzo-qualità e adatta alle diverse tipologie di mezzi. A Verona arrivano i distributori - circa 80 presenti in modo capillare su tutto il territorio italiano - per rifornirsi di quello che occorre loro per svolgere al meglio il proprio lavoro. Considerando che il 98 per cento degli ordini in Diesel Technic arriva dal portale web, praticamente tutti i passaggi nel magazzino di Verona vengono monitorati dalla sede centrale di Kirchdorf (entrate, picking, ordini evasi, ecc.) ed è lo stesso sistema che garantisce la costante giacenza di articoli a magazzino. Restano fonda-

mentali il ruolo del team di Customer Care e del Product Manager per l’inserimento a sistema di nuovi clienti o di eventuali richieste urgenti o specifiche. Il 2019 di Diesel Tecnic Italia si chiuderà con un fatturato superiore alle aspettative e 18mila codici disponibili a magazzino. “Oggi - afferma Walter Schiavi - il mercato ci riconosce come fornitore importante in ogni segmento: se nei primi anni Diesel Technic era identificata come riferimento nella ricambistica per truck, rimorchi e bus, oggi abbiamo sempre più richieste da professionisti che, testata la qualità dei ricambi, effettuano ordini di articoli per veicoli commerciali, settore che continua a crescere e che oggi rappresenta una fetta importante del fatturato”.

GIUSEPPE BULLINI, TITOLARE E AMMINISTRATORE UNICO DI RECORD RICAMBI

“VINCENTE È ANCORA IL RAPPORTO PERSONALE INSTAURATO CON IL CLIENTE” È

dopo la gara di kart che Giuseppe Bullini, titolare al 50 per cento e am ministratore unico della Record Ricambi di Brescia, accetta di essere intervistato e di raccontare la storia e l’evoluzione dell’azienda che oggi è distributore di riferimento per Diesel Technic nelle province di Brescia e Bergamo. “La nostra avventura – esordisce Bullini - inizia con la vecchia società Record che, nata nel 1956 per iniziativa di altri imprenditori, dopo il fallimento del 2010 viene rilevata l’anno successivo da me insieme a due soci. L’abbiamo ribattezzata Record Ricambi e le abbiamo riservato una nuova moderna sede, sempre a Brescia”. Record Ricambi si occupa in maggioranza di ricambi per truck e rimorchi, un settore che rappresenta l’80 per cento del fatturato che oggi è complessivamente di oltre 11 milioni di euro. Il restante 20 per

cento è suddiviso tra ricambi automotive e lubrificanti. Il magazzino di Brescia si estende su 3.000 metri quadrati totali; Record Ricambi impiega una quarantina di dipendenti e gestisce circa 28mila articoli. Aggiunge Giuseppe Bullini: “La nostra clientela è varia, tra officine, autotrasportatori, enti pubblici e industrie. Non serviamo direttamente i privati perché non abbiamo la vendita al dettaglio. I nostri clienti sono solo aziende. Con Diesel Technic abbiamo iniziato a rapportarci nel 2016, l’anno in cui si è insediata la filiale italiana. Conoscevamo già l’azienda, ma proprio quando ha aperto la filiale di Verona abbiamo ritenuto opportuno servirci da loro, beneficiando di quelli che sono gli indubbi vantaggi dell’offerta Diesel Technic: vastità della gamma prodotti, disponibilità di magazzino e soprattutto ottimo rapporto

qualità/prezzo”. “La nostra offerta con tinua Bullini - è multimarca e comprende solo prodotti di brand premium originali e rigorosamente certificati, nuovi o al massimo revisionati. Con una flotta di 26 furgoni distribuiamo il prodotto ovunque e costantemente”. Negli ultimi anni il mondo della distribuzione ricambi si è trasformato. “L’avvento delle nuove tec-

nologie ha cambiato le cose - ammette Giuseppe Bullini - Oggi, qualunque operatore può entrare in internet per trovare un articolo ma senza la sicurezza della disponibilità esatta del pro dotto e soprattutto con il limite dell’attesa di qualche giorno. Noi abbiamo implementato la disponibilità e il prodotto lo consegniamo poche ore dopo l’ordine. Fondiamo il nostro lavoro sul servizio di distribuzione. Il cliente chiede la massima disponibilità di prodotto ma cerca anche qualità e professionalità. I miei banconisti sono costantemente formati e hanno a disposizione i mezzi tecnici per diminuire la percentuale di errore che influisce anche sul lavoro del cliente. Il fatto di avere una persona di riferimento fa ancora la differenza. Il ricambio ordinato online che si rivela sbagliato è un problema che richiede alcuni giorni per essere risolto, men-

tre noi ne assicuriamo la risoluzione nel giro di un’ora”. Record Ricambi fa anche parte del Consorzio G6 Autoparts con altri cinque ricambisti. La nuova realtà consortile è nata con l’intento di rafforzare l’attività dei player coinvolti grazie alla condivisione delle singole competenze. Spiega Bullini: “Il Consorzio ha sede a Perugia e attualmente conta sei aziende che presto potrebbero arrivare a dieci o dodici per coprire tutta l’Italia. Attualmente, copriamo Lombardia, Triveneto, Umbria e Friuli-Venezia Giulia. Uniamo le forze ci scambiamo esperienze e know-how. Con un fatturato superiore agli 80 milioni di euro destinato ad arrivare ad almeno 100 milioni con i nuovi soci possiamo fare massa critica e prepararci alle sfide del futuro. Bisogna prepararsi alle nuove tecnologie e un’azienda singola non è in grado di farlo da sola”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 51

FASSI GRU / PIÙ TECNOLOGIA E FUNZIONALITÀ NELLE NOVITÀ PRESENTATE AL GIS 2019

L’arte del sollevamento I

“LE NOVITÀ DI RILIEVO CHE HANNO CARATTERIZZATO LA PRESENZA DI FASSI GROUP AL SALONE DI PIACENZA - DICHIARA SILVIO CHIAPUSSO, RESPONSABILE COMUNICAZIONE E PR DI FASSI - RIGUARDANO IL DEBUTTO IN PRIMA ASSOLUTA DELLA ‘PICCOLA’ FASSI F30M E LA PRESENTAZIONE IN ANTEPRIMA MONDIALE DEL ‘DRIVE BY FASSI’, PRIMO PASSO VERSO NUOVE FRONTIERE NELLA GESTIONE DELL’ASSIEME CAMION/GRU. AL GIS ABBIAMO VOLUTO INCONTRARE I NOSTRI CLIENTI E QUELLI POTENZIALI CHE OPERANO IN SETTORI NEI QUALI I NOSTRI PRODOTTI SONO MOLTO APPREZZATI”.

GUIDO PRINA PIACENZA

n forte crescita per numero di visitatori e di espositori, il Salone GIS 2019 di Piacenza dedicato al mondo del sollevamento e dei trasporti eccezionali ha visto l’importante presenza di un player di primo piano come Fassi Gru, che nei due stand di complessivi 900 mq ha esposto 10 gru Fassi tutte allestite su carri, uno scarrabile Mar rel e due piattaforme ATN. Molto clamore ha inoltre suscitato la presentazione dell’avanzato sistema “Drive by Fassi”. “Fassi Group ha voluto cogliere l’opportunità offerta dal GIS per presentare una serie di novità e al contempo sfruttare l’unico appuntamento italiano dedicato al mondo del sollevamento e dei trasporti eccezionali, ambiti nei quali i prodotti Fassi sono particolarmente apprezzati e coprono un ruolo di primo piano - spiega Silvio Chiapusso, Responsabile comunicazione e PR di Fassi Le novità di rilievo riguardano il debutto in prima assoluta della ‘piccola’ Fassi F30M e la presentazione in anteprima mondiale del ‘Drive by Fas si’, primo passo verso nuove frontiere nella gestione dell’assieme camion/gru. L’obiettivo è quello di incontrare i nostri clienti e quelli potenziali che operano in settori nei quali i nostri prodotti sono molto apprezzati. In particolare per le gru dalle 50 tm in su i campi di utilizzo sono svariati, non solo nel sollevamento, ma anche per il posizionamento e montaggio di macchinari e altri materiali in luoghi chiusi e con limiti in altezza come i capannoni industriali”. La gru di gamma leggera Fassi F30M, grazie all’impiego di acciai speciali e a diverse soluzioni progettuali, ha permesso una notevole riduzione del peso, dato molto sensibile in fase di particolari allestimenti. Si tratta quindi di una soluzione ideale per i veicoli commerciali che, garantendo una portata utile mag giore, possono offrire un’opportunità in più sia agli utilizzatori che ai noleggiatori di queste attrezzature. “La gru F30M che al GIS abbiamo esposto su un compatto veicolo Isuzu M21 Spring è una soluzione ideale che intercetta le esigenze di coloro che hanno necessità di utilizzare mezzi piccoli con gru piccole per avere maggiore mobilità e spazio di manovra in spazi ridotti, come per esem pio nei centri storici precisa Chiapusso - Un’altra categoria che seguiamo con molto interesse sono i noleggiatori ai quali siamo in grado di proporre proprio la nuova gru F30M unitamente allo scar rabile Marrel AL3PA i deale anch’esso per le movimentazioni nei centri urbani e ovunque ci siano spazi ristretti”.

Silvio Chiapusso, Responsabile comunicazione e PR di Fassi, intervistato sullo stand allestito in occasione del GIS 2019.

La rivoluzionaria tecnologia “Drive by Fassi” abbinata all’interfaccia Volvo “Exster” nasce dalla proficua collaborazione tra Fassi e Volvo Trucks Italia. “Drive by Fassi” è la nuova tecnologia integrata e sicura che permette all’operatore di manovrare i camion Volvo Trucks a distanza, da terra all’esterno della cabina. “Fassi è da sempre all’avanguardia nel mondo dell’automazione e dell’innovazione - commenta Silvio Chiapusso - L’ultimo step di questo processo evolutivo è costituito dalla nuova tecnologia ‘Drive by Fassi’, grazie alla quale l’operatore può eseguire da terra piccoli spostamenti del suo Volvo con l’ausilio del radiocomando Fassi V7, quindi senza essere in cabina. ‘Drive by Fassi’ rappresenta l’evoluzione del sistema di comunicazione Fassi FX-Link, per cui oggi, oltre alla possibilità di gestire alcune funzionalità del veicolo dal proprio radiocomando

della gru e verificare le condizioni della gru direttamente dal cruscotto del camion, l’operatore può manovrare a bassa velocità il proprio truck a distanza, senza essere diret-

tamente al volante”. Grazie all’interfaccia Exster (External Steering Remote Control) di Volvo Trucks, la tecnologia “Drive by Fassi” è parte di un sistema integrato, affidabile e sicuro, sviluppato in collaborazione con Volvo Trucks Italia. Una soluzione integrata al radiocomando della gru e del camion fin dalla loro produzione, quindi “on board” e collaudati già all’arrivo dell’attrezzatura dai dealer. “In pratica aggiunge Chiapusso - questo significa: configurazione garantita nel suo funzionamento dalle case madri produttrici; efficienza nativa pronta all’uso; affabilità certificata all’origine; predisposizione all’utilizzo in sicurezza conforme agli standard di produzione di Fassi e Volvo Trucks”. “Drive by Fassi” è parte integrante di un sistema ingegnerizzato da Fassi e Volvo Trucks per essere proposto e commercializzato a partire da fine 2019 senza alcun costo d’intervento e

messa a punto successive alla consegna e senza sorprese nelle tempistiche di produzione dichiarate dai produttori. Di fatto una tecnologia che arricchisce le potenzialità d’utilizzo dell’insieme camion/gru, studiata per essere facilmente utilizzabile in sicurezza dall’operatore e diventare un valido aiuto per migliorare la sua operatività. Al GIS 2019 è stato possibile vedere in azione il “Drive by Fassi”: un Volvo FH 500 8x2 allestito con gru Fassi F820RA.2.27 L426 e dotato di sterzo assistito Volvo Dynamic Steering è stato movimentato direttamente dal radiocomando Fassi V7 della gru all’interno di un corridoio di 25x8 m opportunamente transennato. “La tecnologia ‘Drive by Fassi’ è stata ideata e collaudata per funzionare in qualsiasi condizione operativa di spostamento del camion - spiega Chiapusso - L’obiettivo è aiutare gli operatori nella fase di posizionamento del veicolo nei cantieri prima

di predisporre gli stabilizzatori della gru e movimentare il carico. Il sistema, così come è stato sviluppato da Fassi e Volvo Trucks, nasce con una serie di accorgimenti che minimizzano ogni tipo di rischio e garantiscono un utilizzo in totale sicurezza. Infatti, con ‘Drive by Fassi’ il veicolo può raggiungere una velocità massima di 5 km/h e, in caso di pericolo, sono previsti pulsanti di stop su ogni lato. Non è previsto il suo utilizzo con stabilizzatori aperti e tantomeno con la gru in funzione. ‘Drive by Fassi’ è quindi i deale per manovrare in aree ad accesso limitato, in luoghi angusti dove da terra si ha una visione più completa degli ingombri, per la movimentazione di grandi carichi e per le situazioni nelle quali è necessario spostare il veicolo frequentemente. Un esempio può essere la movimentazione di grandi macchinari all’interno dei capannoni, dove lo spostamento del camion in spazi angusti e limitati diventa decisamente più controllabile da un punto prossimo agli ostacoli o agli spazi di manovra invece che dalla cabina, evitando così di avere persone che dall’esterno comunicano all’operatore la vicinanza di ostacoli. In questa condizione si intuisce come questa tecnologia aiuti a lavorare con maggiore sicurezza, perché la precisione e la rapidità dell’operatore sono direttamente intermediate”. In Italia, il settore del sollevamento sta evolvendo velocemente. Come conferma Chiapusso, “in questi anni si è spostato in modo importante verso il comparto del trasporto eccezionale, in crescita rispetto al passato. Uno scenario che sostituisce quello precedente dominato dal settore dell’edilizia, che si è ridimensionato dopo la crisi iniziata nel 2008. Oltre all’edilizia, quindi, si stanno espandendo le applicazioni in comparti come trasporti eccezionali, ferrovia, marina, perforazione, ispezioni geologiche; settori che rappresentano quote di mercato importanti in rapporto a quella che era la situazione in passato. I trasportatori eccezionali stanno apprezzando il nostro prodotto anche perché in Italia Fassi, oltre al prodotto affidabile e di qualità, offriamo a questa clientela un pacchetto service ad alto valore aggiunto. Questa clientela, che ha bisogno di avere macchine performanti e fermi macchina minimi, richiede un servizio post-vendita altamente qualificato. È il valore aggiunto che Fassi riesce a dare sul mercato italiano. Non solo nell’ambito dei trasporti eccezionali ma anche nei settori dove la macchina diventa protagonista, crea valore solo quando è attiva e quindi c’è necessità di creare un servizio post-vendita continuativo. Il cliente l’ha capito e il mercato ce lo riconosce”.


IL MONDO DEI TRASPORTI

Pagina 52

N° 284 / Novembre 2019

CONTINENTAL / IMPORTANTI NOVITÀ PER IL SETTORE PORTUALE E LA LOGISTICA

La moderna movimentazione

P

FABIO BASILICO PIACENZA

rodotti e servizi, ovvero soluzioni complete per la mobilità. Continental era presente al GIS 2019 di Piacenza, le Giornate italiane del sollevamento e dei trasporti eccezionali - l’unico evento italiano dedicato agli utilizzatori di gru, piattaforme aeree, sollevatori telescopici, carrelli elevatori, macchine e attrezzature per la movimentazione industriale e portuale, logistica meccanizzata e il tra sporto pesante - dove ha presentato importanti novità nel segno dell’offerta completa di prodotti e servizi in grado di soddisfare le esigenze specifiche degli operatori. A cominciare dall’anteprima italiana della nuova gamma di pneumatici radiali per le applicazioni portuali. “Con questa nuova gamma di prodotti, progettata per supportare le operazioni di carico e scarico, Continental si propone come fornitore di soluzioni a 360° per le operazioni nei porti di chiara Simone Alciati di Continental Commercial Vehicle Tires - I container sono trasportati per chilometri, negli immensi spazi dei porti internazionali. Per le impegnative applicazioni di carico e scarico, gli pneumatici radiali rappresentano la soluzione idea le, perché garantiscono una generazione di calore piuttosto contenuta e un profilo piatto che assicura resistenza e durata anche su lunghe distanze. Con il lancio di tre nuovi pneumatici per le applicazioni portuali - il ContiRT20 nella misura da 24”, il ContainerMaster Radial e lo StraddleMaster Radial - Continental dà inizio a una nuova fase della sua storia nel settore portuale. Questi pneumatici si adattano perfettamente ai vari tipi di veicoli usati nelle operazioni di carico e scarico, inclusi, fra gli altri, i carrelli elevatori pesanti, i movimentatori di container vuoti, i carrelli per la movimentazione di container, le macchine per lo stoccaggio dei container, i

ALL’ULTIMA EDIZIONE GIORNATE

DEL GIS, LE

ITALIANE DEL SOLLEVAMENTO E DEI TRASPORTI ECCEZIONALI, CONTINENTAL HA PRESENTATO IN ANTEPRIMA ITALIANA UNA NUOVA GAMMA DI PNEUMATICI RADIALI PER LE APPLICAZIONI PORTUALI.

SPAZIO

ANCHE AL PORTAFOGLIO DI COPERTURE IN GOMMA PIENA CON NUOVA MESCOLA E A

CONTICONNECT, LA PIATTAFORMA DIGITALE PER IL MONITORAGGIO DEGLI PNEUMATICI.

trattori portuali e altri ancora”. Al GIS Expo 2019 sono sta ti presentati anche gli pneumatici realizzati con mescola Port Plus, ideali per le operazioni d’impilaggio. Nelle operazioni di carico e scarico di container, i mezzi percorrono brevi distanze a bassa velocità trasportando carichi molto pesanti e compiendo svolte con angoli molto stretti. La costruzione degli pneumatici Continental con cintura V.ply offre una buona stabilità, mentre i fianchi rinforzati, la mescola a elevata aderenza e la struttura resistente agli urti li rendono la soluzione ideale per questa tipologia di attività. “Con l’ampliamento della sua

gamma per il settore portuale - aggiunge Alciati - Continental è in grado di offrire la soluzione più efficace per ogni combinazione di veicolo/applicazione. Sia che il veicolo sia utilizzato per operazioni d’impilaggio sia che sia destinato a operazioni di carico e scarico, o magari per entrambi gli usi, gli operatori possono fare affidamento sull’esperienza e sulla specializzazione di Continental”. “La filosofia di Continental - precisa Simone Alciati - è andare dal cliente, analizzare le sue esigenze e fornirgli la soluzione migliore, quindi soddisfarlo sia in termini di prodotto specifico che di servizi collegati”. Continental ha anche esposto le sue soluzioni digitali per il monitoraggio della pres sione degli pneumatici, sviluppate sia per singoli veicoli sia per flotte. Soluzioni che contribuiscono a garantire sicurezza ed efficienza nelle operazioni portuali. Si chiama ContiConnect la piattaforma digitale di Continental per il monitoraggio degli pneumatici per flotte di veicoli industriali, portuali, movimento terra e commerciali. “ContiConnect consente di massimizzare l’efficienza delle flotte e di inviare messaggi di allarme se la pressione degli pneumatici si allontana dal valore stabilito spiega Alciati - Grazie a queste informazioni, la flotta beneficia di un numero ridotto di avarie, di costi di manutenzione più bassi e di un aumento della produttività, con la conseguente creazione di valore. ContiConnect permette ai fleet manager di agire in maniera proattiva, senza dover risolvere in modo reattivo pro blemi relativi non solo a un unico veicolo ma a flotte intere”.

Simone Alciati di Continental Commercial Vehicle Tires.

ContiConnect rappresenta il trampolino di lancio affinché Continental diventi un partner fondamentale per i servizi di comunicazione dei dati relativi agli pneumatici. La piattaforma digitale di monitoraggio degli pneumatici ha consentito al produttore tedesco di fare un grande passo in avanti nella sua evoluzione da produttore leader nel settore degli pneumatici a solution provider a 360° per flotte di veicoli industriali, portuali, movimento terra e commerciali. La piattaforma digitale è costituita da diversi componenti che possono essere combinati in molteplici modi, a cominciare dal sensore dello pneumatico (per misurare pressione e temperatura) che lo collega all’ambiente esterno ed è montato sullo spessore interno. Lo pneumatico intelligente made in Continental dispone di un sensore preinstallato che rende più facile e comodo l’avvio del monito-

raggio degli pneumatici nel caso di flotte e al contempo garantisce che l’alloggiamento sia montato correttamente nello pneumatico fin dall’inizio. C’è poi la Yard Reader Station, ovvero la stazione per il ricevimento dei dati dal lo pneumatico. Questo stru mento legge i dati dei sensori non appena il veicolo sosta accanto al ricevitore e trasmette questi dati al backend che li analizza e li interpreta. La stazione di lettura può essere installata nei punti di maggior contatto della flotta, come impianti di lavaggio, stazioni di rifornimento o altri tipi di check-point. Il portale web è invece l’interfaccia tramite la quale i fleet manager possono monitorare e tracciare proattivamente lo stato de gli pneumatici e le prestazioni di tutti i veicoli facenti parte della propria flotta. Inoltre, ContiConnect fornisce notifiche ai fleet manager via e-mail o SMS e propone misure correttive,

ove necessario. Le notifiche consentono ai fleet manager una migliore pianificazione della manutenzione degli pneumatici e assicurano che vengano tempestivamente segnalate possibili deviazioni. Per l’intera flotta ciò si traduce in maggiore produttività e minore manutenzione. Continental ha recentemente arricchito il suo portafoglio relativo alle coperture in gomma piena per applicazioni industriali. La nuova gamma è stata immessa sul mercato da gennaio. I quattro modelli, SC20+, CS20+, CSEasy SC20+ e SH12+, sono caratterizzati da una nuova mescola denominata “Plus” (che si identifica con un “+” affiancato al nome del disegno battistrada). La mescola “Plus” unisce i vantaggi di un’ot tima resa chilometrica in termini di percorrenza con una bassa resistenza al rotolamento. Di recente, Continental e Toyota Material Handling hanno unito le loro forze in un accordo strategico. Tutti i carrelli elevatori Traigo80 e Traigo48 del costruttore giapponese sono equipaggiati con gomme piene Continental SC20+. I costi di servizio e di manutenzione e il consumo di energia dei carrelli elevatori e quipaggiati con gomme SC20+ sono più bassi. Le SC20+ uniscono il meglio di due mondi: non solo offrono durata e chilometraggio, ma permettono anche di risparmiare energia su superfici abrasive. Queste gomme sono dotate di un nuovo composto che combina un alto chilometraggio e una bassa resistenza al rotolamento. Sono particolarmente resistenti e brillano per perfomance intensive sia indoor che outdoor su superfici irregolari come lastre di pavimentazione o ciottoli.


IL MONDO DEI TRASPORTI

N° 282 / Settembre 2019

Pagina 53

AON / ARRIVA LA PRIMA POLIZZA A COPERTURA DELLA RESPONSABILITĂ&#x20AC; SOLIDALE

Il committente è sempre piÚ protetto

I

MAX CAMPANELLA MILANO

n Italia è molto diffusa la consuetudine di esternalizzare: affidare allâ&#x20AC;&#x2122;esterno lavori che non rientrano nel proprio core business è cosa piĂš che naturale, vuoi per il desiderio di affidarsi a â&#x20AC;&#x153;mani esperteâ&#x20AC;?, vuoi perchĂŠ trattasi di scelta spesso meno onerosa. Quello del trasporto è uno dei settori chiave dellâ&#x20AC;&#x2122;esternalizzazione, sia come protagonista - ovvero come appaltatore, si pensi alle grandi flotte che assegnano rotte a terzisti - sia perchĂŠ esso stesso è soggetto scelto da dei committenti. E se nella filiera dellâ&#x20AC;&#x2122;appalto qualcosa non va per il verso giusto e i lavoratori non do vessero essere pagati? Se condo la normativa vigente, i committenti sono tenuti a rispondere in solido non solo con lâ&#x20AC;&#x2122;appaltatore, ma con ciascuno degli eventuali subappaltatori per gli importi dovuti ai lavoratori, a prescindere dal fatto che il corrispettivo dellâ&#x20AC;&#x2122;appalto sia giĂ stato regolarmente saldato. Aon, primo gruppo in Italia e nel mondo nella consulenza dei rischi e delle risorse umane, nellâ&#x20AC;&#x2122;intermediazione assicurativa e riassicurativa, lancia sul mer-

cato italiano una polizza a copertura della responsabilitĂ solidale committenteappaltatore: una soluzione assicurativa che risponde allâ&#x20AC;&#x2122;esigenza di tutela da par te dei committenti, in particolare nellâ&#x20AC;&#x2122;ambito dei contratti di trasporto in conto terzi. â&#x20AC;&#x153;In questo settore - spiega Massimo Germani, Vicepresidente di Aon - il fenomeno dei subappalti è molto frequente e non consente di avere il controllo totale delle attivitĂ  esternalizzate. Recenti decisioni giurisprudenziali - in particolare la sentenza 254/2017 della Corte Costituzionale, che ha equiparato il contratto dâ&#x20AC;&#x2122;appalto al contratto di subfornitura, e il Decreto Legge 25/2017, che ha abolito il beneficio della preventiva escussione del debitore principale - hanno ampliato ulteriormente le responsabilitĂ  dei committenti, generando una situazione di responsabilitĂ  senza colpaâ&#x20AC;?. Insomma, è sempre il com mittente che deve pagare i lavoratori qualora risultasse un debito nei loro confronti. â&#x20AC;&#x153;Con la nuova polizza - precisa Germani la compagnia assicuratrice protegge il committente dalle eventuali somme che deve pagare: stipendi, trat-

tamenti retributivi (compreso il Tfr), contributi previdenziali, premi assicurativi ecc. riferiti al periodo di esecuzione dei lavori o di

prestazione del servizio previsti dal contratto di appalto. Non solo: lâ&#x20AC;&#x2122;assicurato è protetto anche per le spese legali che dovrebbe

Massimo Germani, Vicepresidente di Aon.

* OĆłOJ U F  F T J H F O[ F  J OĆłOJ U F  T PM V[ J POJ

7* #&35*  3* .03$)*  4  3   4 U B CJ M J NF OU P  EJ  1 S P EV[ J P OF   7J B  5 J CVS U J OB  7B M F S J B  L N          5 P D D P  EB  $B T B VS J B  1 &

1 * 7 "  * 5         3& "1 &        F  NBJ M   J OG P!W J CF S U J  J U  ]  U F M  

        ]  G BY  

        XXX W J CF S U J  J U

sostenere per affrontare lâ&#x20AC;&#x2122;eventuale iter giudiziarioâ&#x20AC;?. Lâ&#x20AC;&#x2122;idea del team di Aon guidato da Massimo Germani è nata per rispondere alle nuove esigenze del mercato. â&#x20AC;&#x153;Abbiamo ricevuto richieste di tutela in questâ&#x20AC;&#x2122;ambito da aziende della Gdo, da vettori che affidano il contratto verbalmente, da aziende che fanno logistica di magazzino e ne esternalizzano la gestione. Lâ&#x20AC;&#x2122;interesse è di tutte le a ziende coinvolte nella filiera di un appalto, che può essere lungo considerando tutti i possibili subappalti: lâ&#x20AC;&#x2122;a nello considerato â&#x20AC;&#x153;for teâ&#x20AC;?, e quindi il responsabile in solido, è sempre il committenteâ&#x20AC;?. Non è la prima volta che Aon porta sul mercato soluzioni innovative, studiate analizzando le esigenze del mercato. â&#x20AC;&#x153;E non sarĂ lâ&#x20AC;&#x2122;ultima: quello del trasporto afferma in conclusione Germani - è un settore che conosce bene i rischi a cui è soggetto, sui quali ha lâ&#x20AC;&#x2122;esigenza di confrontarsi con chi ha le competenze necessarie. Abbiamo lavorato due anni a questo progetto e vogliamo continuare a investire e crescere in questo settore, che richiede una gestione molto attenta e articolataâ&#x20AC;?.

IN CASO DI APPALTO DI OPERE O DI SERVIZI Ă&#x2C6; DIETRO Lâ&#x20AC;&#x2122;ANGOLO IL RISCHIO DI DOVER CORRISPONDERE AI LAVORATORI TRATTAMENTI RETRIBUTIVI, CONTRIBUTI PREVIDENZIALI, PREMI ASSICURATIVI DOVUTI IN RELAZIONE AL PERIODO DI ESECUZIONE DEL CONTRATTO DI APPALTO.

AON LANCIA PER PRIMA IN ITALIA

UNA SOLUZIONE CHE TUTELA I COMMITTENTI ANCHE NELLâ&#x20AC;&#x2122;AMBITO DEI CONTRATTI DI TRASPORTO IN CONTO TERZI.


IL MONDO DEI TRASPORTI

Pagina 54

N° 284 / Novembre 2019

REALTRAILER / POSITIVI I RISULTATI DELLA PARTNERSHIP CON EMMEFFEDI CAR

Triennio di successo per Krone LA SOCIETÀ DI MODUGNO SI È RITAGLIATA UN RUOLO DI PRIMARIA RILEVANZA NEL SETTORE DEL COMMERCIO, ASSISTENZA E VENDITA DI RIMORCHI E CHIAVE DI VOLTA IL RAPPORTO CON L’IMPORTATORE DI SUZZARA, AVVIATO NEL 2016. “I MARCHI KRONE E STAS RAPPRESENTANO UN VALORE STRATEGICO, CONSENTENDOCI DI PORTARE SUL MERCATO PRODOTTI DI PRIMO LIVELLO SU BASE INTERNAZIONALE”, AFFERMA GENNARO CARMOSINO.

SEMIRIMORCHI.

D

MICHELE S. ALTIERI MODUGNO

alla Puglia alla Basilicata, dal Molise alla provincia di Cosenza, territorio strategico per la logistica delle merci dell’intero Belpaese, aziende di autotrasporto di ogni dimensione stanno investendo sulla propria flotta: archiviata la crisi economica, l’obiettivo è avere parchi di veicoli moderni, dal trattore al semirimorchio. Per la com ponente del trainato, decisamente strategica si è rivelata la scelta di Realtrailer - azienda di Suzzara che importa in Italia la famiglia di prodotti Krone e Stas, oltre a commercializzare i marchi Van Hool e Broshuis - di avviare nel 2016, una partnership con Emmeffedi Car, giovane società nata nel 2014 con l’obiettivo di ritagliarsi un ruolo di primaria rilevanza nel settore del commercio, assistenza e vendita di rimorchi e semirimorchi. Dopo i primi mesi dedicati alla ricerca della migliore localizzazione della struttura commerciale e industriale, nonché di partner commerciali necessari come volano per la crescita d’impresa, nel 2015 Emmeffedi Car acquisisce la disponibilità dell’immobile sito a Mo dugno, in provincia di Ba ri, lungo la Provinciale Andriese Coratina, ubicazione dal carattere strategico straordinario: arteria stradale importante a livello regionale e interregionale, la SP 231 collega Modugno e Cerignola, in provincia di Fog gia. L’immobile è di proprietà della Car and Car, con la quale nasce una solida partnership commerciale. “I risultati economici - afferma Gennaro Carmosino -

sono stati subito sorprendenti, con un trend in continua e sostanziale crescita grazie all’ulteriore partnership sviluppata con Realtrailer. L’azienda è in continua crescita e in evoluzione e sono attualmente allo studio del management ulteriori operazioni di aggregazione e sviluppo di sinergie strategiche, per consolidare e incrementare la propria posizione di rilevanza sul mercato degli autotrasporti”. Particolarmente esteso l’ambito geografico in cui è operativa Emmeffedi Car, che per la sua attività punta molto sulle tecnologie dell’informazione e della comunicazione. “In alcuni casi - prosegue Carmosino - le vendite si concretizzano con clienti al di fuori del territorio nazionale. In merito ai servizi di lavorazione e assistenza, per ragioni chiaramente logistiche, il fatturato viene sviluppato con clienti principalmente del territorio regionale e di quello lucano. Tuttavia, nell’ottica del coin volgimento globale del cliente in un piano di assistenza pluriennale, sono attualmente allo studio ipotesi di partnership con soggetti terzi che ci consenta lo sviluppo dell’assistenza sui mezzi anche su territori più lontani ed estesi”. L’incontro con Realtrailer nel 2016, ad Hannover, al Salone IAA, quando viene avviato il rapporto per la com mercializzazione dei pro dotti Krone e Stas per Puglia, Basilicata, Molise e la provincia di Cosenza. “La partnership sviluppata con Realtrailer - afferma l’imprenditore pugliese - rappresenta sicuramente un valore strategico aggiunto, in quanto ci consente di offrire sul mercato un prodotto

Enzo Carmosino di Emmeffedi Car con Giuseppe Loconsole della ditta Blu Logis.

completo, affidabile, di primo livello su base internazionale. La fidelizzazione del cliente d’altronde e gli ottimi risultati di feedback ottenuti, anche grazie alla personalizzazione del mezzo e all’assistenza post vendita, ci raccontano una realtà consolidata a livello commerciale, base per sviluppi settoriali interessanti e prolifici”. Con un fatturato di oltre quattro milioni di euro, Emmeffedi Car si è attestata sulla vendita di un centinaio di veicoli l’anno tra nuovi e usati (permute ritirate e ricondizionate prima di essere rimesse sul mercato). “Chiave di volta” del successo della società barese il servizio post vendita. “La mission aziendale - dichiara Gennaro Carmosino - è non esaurire il rapporto commerciale con l’autotrasportatore con la singola vendita del mezzo, ma instaurare con il cliente una relazione commerciale di lunga durata attraverso l’assistenza post vendita, consistente in manutenzioni periodiche, revisioni, riparazioni e personalizzazioni. Una relazione che passa anche attraverso la ricerca del miglior partner finanziario per l’effettuazione dell’operazione. Insomma, una concezione di soddisfazione e fidelizzazione della clientela a 360 gradi, perché la vendita del prodotto è solo l’inizio e non la fine della relazione commerciale”. Recentissime le forniture in pronta consegna di otto semirimorchi centinati Krone, in allestimento per trasporto combinato strada-ferrovia, alla ditta Cascione di Ruvo di Puglia, sei semirimorchi frigo per la distribuzione alimentare all’azienda Guglia di Guglionesi, in provincia di Campobasso e quattro semirimorchi isolati a due assi per la distribuzione di collettame, tutti del marchio Krone. In fase di consegna semirimorchi isolati alla Blu Logis di Modugno. Massima la soddisfazione di Realtrailer per la collaborazione commerciale sviluppata con Emmeffedi Car. “La famiglia Carmosino afferma Elisa Pigozzi, Amministratrice della società di Suzzara - proviene da una lunga tradizione di costruttori di semirimorchi, ha una conoscenza e un’esperienza nel settore che rappresentano un valore aggiunto impagabile, nell’espletazione del ruolo commerciale. Questo in parte grazie ai numerosissimi rapporti instaurati sul territorio e in secondo luogo per la professionalità tecnica consolidata negli anni. Insieme a Enzo e Gennaro Carmosino, confidiamo di costruire una partnership di lunga durata e di sempre maggior penetrazione del territorio di loro competenza”.


LOGISTICA

IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 55

SALERNO TRASPORTI / RINNOVO DELLA FLOTTA CON MERCEDES-BENZ E RENAULT TRUCKS

Per nuovi orizzonti

PRESENTE DA VENT’ANNI SUL MERCATO DEI TRASPORTI E DELLA LOGISTICA NAZIONALE E INTERNAZIONALE, L’AZIENDA CAMPANA AMPLIA IL PARCO MEZZI CON UN MASSICCIO INVESTIMENTO: ARRIVANO SESSANTA UNITÀ DI

SPRINTER, IL VELOCISTA DELLA STELLA, E SETTE DEL MASTER, IL LEGGERO DELLA LOSANGA. “SARANNO TUTTI IMPIEGATI PER FEDEX E SDA, OPERATIVI RISPETTIVAMENTE NELLE

RHO E NEL TRIVENETO”, SPIEGA GIOVANNI CAMMAROTA, PROJECT MANAGER SALERNO TRASPORTI.

PIATTAFORME DI

S

MAX CAMPANELLA SALERNO

alerno Trasporti, nata dalla passione e dalla caparbietà dell’imprenditore Giovanni Cammarota, vanta una flotta di oltre 1.200 automezzi e gestisce importanti portafogli di clienti nazionali e internazionali. L’attenzione al cliente pone l’azienda salernitana tra le leader sul mercato nazionale e internazionale del trasporto e della logistica distributiva. Per sostenere la sua strategia di rinnovamento del parco mezzi e soddisfare le esigenze della clientela con una flotta giovane ed efficiente, Salerno Trasporti ha avviato un importante investimento con l’acquisto di 60 Mercedes-Benz Sprinter, il furgone grande della Stella, compagno di lavoro ideale per i corrieri e garanzia di massima affidabilità in tutte le attività di distribuzione. A essi si affiancano sette nuovi Renault Trucks Master, il veicolo commerciale gradino d’ingresso della gamma del costruttore della Losanga. L’azienda vanta una posizione geografica strategica, in una location ad alta visibilità commerciale, nel cuore della zona industriale di Salerno, nelle vicinanze dell’uscita della

tangenziale e dell’autostrada Salerno-Reggio Calabria. I centri spedizione sono collocati strategicamente al sud, centro e nord Italia, contando sulla capacità organizzativa di circa

mille uomini e donne. La continua crescita strutturale è accompagnata da un comparto di Ricerca & Sviluppo che continuamente integra le ultime tecnologie informatiche, al fine

di migliorare le condizioni di lavoro e ottimizzare i processi logistici. “La gestione delle basi logistiche - afferma Giovanni Cammarota, Project Ma nager Salerno Trasporti - è un

La consegna di sette Renault Trucks Master a Salerno Trasporti, rappresentata da Giovanni Cammarota e Maurizio Longo, da parte di Carmine Longobardi di LR Truck, Concessionaria Renault Trucks.

aspetto sul quale poniamo particolare attenzione, grazie al lavoro meticoloso di addetti al magazzino altamente specializzati e grazie ad attrezzature speciali, che garantiscono un livello di rendimento elevato durante il carico e lo scarico della merce”. Il servizio di packaging e imballaggio merci dimostra ulteriormente come Salerno Trasporti sia vicina alle esigenze dei clienti. “In base alle varie esigenze e alla categoria merceologica dell’azienda cliente - spiega Cammarota - diamo vita a una filiera d’imballaggio ad hoc per tutelare al meglio il prodotto durante la spedizione”. Il grande successo di Salerno Trasporti è stato ottenuto grazie al lavoro a stretto contatto con le maggiori piattaforme espresso, attraverso la partnership con i maggiori network nazionali e internazionali, una rete distributiva in grado di gestire un flusso medio di circa due milioni di spedizioni mensili. Oggi l’azienda porta in strada esattamente 1.253 veicoli, dei quali 924 da 35 q, due van elettrici e la parte restante pesanti con portata oltre i 35 q. Il 60 per cento dei veicoli sono a noleggio, i restanti di proprietà. “Tutti i nuovi veicoli - spiega Cammarota saranno destinati per FedEx e SDA, operativi rispettivamente per le piattaforme di Rho e nel Triveneto, territorio nel quale abbiamo la maggiore concentrazione di appalti. Oggi Salerno Trasporti è presente in Italia in 57 appalti, da nord a sud, ed è partner dei principali network logistici: FedEx-TNT, Amazon, UPS, BRT e SDA. Dal privato alle grandi aziende, abbiamo clientela di ogni tipologia e dimensione”.

ALLESTIRE PONENDO IN PRIMO PIANO AFFIDABILITÀ E COSTI DI GESTIONE

CAMMAROTA: “CONTINUEREMO A INVESTIRE CON NOLEGGI E INTEGRAZIONI” P resentato l’anno scorso al Salone IAA nella terza generazione, Mercedes-Benz Sprinter entra da protagonista nella catena logistica di Salerno Trasporti. Tutti in versione Furgone, i 60 Sprinter verranno utilizzati sulla principale rete di corrieri nazionali e internazionali. “Siamo orgogliosi - ha dichiarato Dario Albano, Managing Director Mercedes-Benz Vans (a destra nella foto) - che Salerno Trasporti abbia deciso d’investire sul nostro bestseller, un veicolo che nel corso degli anni è diventato sinonimo di affidabilità, sicurezza, efficienza e innovazione. Sprinter diventerà elemento strategico all’interno della flotta di questo importante player nel mercato della distribuzione, semplificando la comunicazione tra gestore e autisti”. “La scelta d’integrare la nostra flotta con 60 Mercedes Sprinter - ha dichiarato Giovanni Cammarota - rappresenta per noi un’ulteriore affermazione di valori quali eccellenza e inno-

vazione, punti di forza della nostra azienda che da sempre pone in primo piano le esigenze dei clienti. La scelta dei veicoli Mercedes è frutto dell’esperienza diretta: si tratta di mezzi di elevata affidabilità, che arrivano quasi ad azzerare i fermi tecnici”. “Efficienza, affidabilità e costi di gestione - dichiara Maurizio Longo, Presidente CdA di Salerno Trasporti - sono i requisiti più importanti nella scelta di un veicolo. Tramite l’acquisto presso la concessionaria LR Truck, Renault Trucks ha dimostrato disponibilità, professionalità e il giusto rapporto qualitàprezzo. Da qui la decisione di testare sette Master”. Sono previsti nel 2019-2020 ulteriori acquisizioni di nuovi veicoli? “Certo che sì, sia - risponde Cammarota - come sostituzione per noleggi in scadenza, sia come integrazioni, con una scelta che ci vede orientati sempre su furgoni e telai da allestire”.


IL MONDO DEI TRASPORTI

Pagina 56

N° 284 / Novembre 2019

INTERVISTA

A

l Forum Economico Eu rasiatico, che si è tenuto a Verona, il focus era tutto sulle relazioni tra UE e Comunità Economica Eurasiatica. In questa sede, UTLC ERA, joint venture del le Ferrovie Russe, delle Fer rovie Bielorusse e delle Ferrovie del Kazakistan, specializzata nel trasporto di container merci su rotaia tra Europa e Cina e tra Sud-Est asiatico e Europa, ha incontrato potenziali partner e clienti italiani. Qual è la strategia di sbarco sul mercato italiano? “UTLC ERA - spiega il CEO Alexey Grom - segue una strategia che può essere applicata a qualsiasi operatore cargo attivo nel commercio eurasiatico che intenda cogliere i vantaggi competitivi offerti dal trasporto merci su rotaia, senza concentrarci in particolare sugli spedizionieri italiani, né su quelli francesi, svizzeri o tedeschi. Quando approdiamo in determinati Paesi, adattiamo il nostro modello di business e la tecnologia al contesto locale. Prestiamo maggiore attenzione alle zone strategiche e ai settori industriali che hanno maggiori probabilità di entrare in relazioni commerciali con la Cina. Nel caso dell’Italia, si tratta dell’industria alimentare, automotive e tessile. Non

ALEXEY GROM CHIEF EXECUTIVE OFFICER UTLC ERA

in Italia? “Il nostro target principale - risponde Grom comprende aziende che operano nei settori delle attrezzature industriali, componenti per automobili e macchinari. Al momento, trasportiamo soprattutto merci meno costose come tessile, carta e cellulosa e prodotti dell’industria chimica. Nostro compito è prestare particolare attenzione ai clienti che ci affidano treni interi per il trasporto o potenzialmente aggiungono più con tainer. Quest’approccio definisce il valore del prodotto e permette l’implementazione del nostro piano strategico che mira ad aumentare il volume di trasporto fino a un milione di TEU. Che si tratti dell’industria alimentare, tessile, chimica, automobilistica, dell’industria pesante o leggera: le nostre porte sono aperte a tutti i settori e clienti in Italia e in Europa”. Sono previste nuove partnership con i fornitori italiani? “Per quanto riguarda la possibilità di stipulare contratti - precisa il Ceo di UTLC ERA - siamo sempre alla ricerca di nuovi partner italiani e clienti provenienti da settori diversi. I nostri principali partner sono sia le aziende di trasporto sia i proprietari di carichi diretti. Siamo pronti a costruire relazioni aperte e trasparenti e ac-

Cina enorme potenziale di crescita A MARGINE DEL FORUM ECONOMICO EURASIATICO DI VERONA, IL NUMERO UNO DELLA JOINT VENTURE DELLE FERROVIE RUSSE, DELLE FERROVIE BIELORUSSE E DELLE FERROVIE DEL KAZAKISTAN, SPECIALIZZATA NEL TRASPORTO DI CONTAINER MERCI SU ROTAIA TRA EUROPA E CINA E TRA SUD-EST ASIATICO E EUROPA, ILLUSTRA LA STRATEGIA DI AFFERMAZIONE SUL MERCATO ITALIANO. “ABBIAMO GETTATO LE BASI PER MEMORANDUM CHE PORTERANNO A NUOVI VOLUMI DI TRAFFICO”, AFFERMA ALEXEY GROM, NUMERO UNO DELLA JOINT VENTURE. escludo la possibilità che possano emergere altre opportunità di cui, al momento, non conosciamo il potenziale. In tal caso saremmo disposti a sviluppare una strategia specifica per l’Italia nel suo complesso e per i singoli trasportatori italiani”. Qual è la sua analisi del trasporto merci italiano? “Il potenziale del mercato italiano - afferma Grom - è enorme. Non posso immaginare il mondo di oggi senza i prodotti italiani che vanno dall’alimentare al tessile alle automobili. Anche le più grandi firme della moda sono direttamente connesse all’Italia. Dal momento che la Cina è entrata nel segmento di mercato mondiale del lusso e ha iniziato a comprare sempre più prodotti di alta qualità, il potenziale di crescita dell’industria italiana dei trasporti è enorme. Sia le aziende di autotrasporti italiane sia i produttori hanno iniziato a prestare maggiore attenzione ai servizi di logistica, che includono la massimizzazione della velocità di consegna, il miglioramento della sicurezza delle spedizioni e la digitalizzazione del processo di trasporto su gomma. Dal canto

nostro, siamo pronti a collaborare con i nostri partner italiani per raggiungere i più alti standard di qualità. Per incrementare il volume di merci trasportate, è importante considerare il potenziale del collegamento merci italiano dall’Italia alla Cina e viceversa. Sono certo che il margine di crescita di questo settore è enorme e che sia le società di logistica sia i proprietari delle merci ne trarrebbero beneficio”.

di MICHELE S. ALTIERI VERONA

Quali saranno i Paesi strategici sui quali punterà UTLC nel collegamento con l’Italia? “La nostra società - prosegue il CEO - ha buone relazioni con l’Europa nel suo complesso. Per definire le relazioni con i Paesi europei piuttosto che utilizzare il termine “speciale”, preferirei definirle rapporti “aperti” basati su un accordo di collaborazione e vol ti a conseguire vantaggi reciproci. La nostra rotta prevede in primis l’attraversa-

mento di Polonia e Germania per entrare in Europa. UTLC ERA ha instaurato buoni contatti con Polonia e Germania, ma anche con tutti gli altri Paesi della rotta europea, senza privilegiarne uno in particolare. Nostro obiettivo è lavorare tutti insieme per fornire un servizio in grado di evitare qualsiasi rallentamento della velocità di trasporto o di compromettere la qualità del servizio. Le relazioni dovrebbero essere “aperte”, fondate

su collaborazione e fiducia reciproca. In fin dei conti, dovremmo tutti credere di avere tutte le carte in regola per raggiungere un elevato livello di sviluppo sostenibile. Ogni volta che ci incontriamo, dobbiamo avvicinarci, imparare sempre più l’uno dall’ altro, individuare i vantaggi tangibili, le sfide da superare e programmare il futuro”. Quali sono le tipologie di clientela cui in particolare UTLC si rivolge nello sbarco

quisire nuovi clienti. Lavoriamo per migliorare costantemente i nostri servizi e mi riferisco in particolare all’aumento della velocità e, al tempo stesso, alla riduzione dei costi di consegna delle merci e ciò si può riscontrare facilmente dai volumi che siamo riusciti a raggiungere nel 2019. A Verona alla fine di ottobre abbiamo gettato le basi per alcuni memorandum che porteranno a contratti effettivi e a nuovi volumi di traffico. La nostra attenzione è rivolta ai nostri clienti e alla conclusione di accordi con loro nel più breve tempo possibile”. UTLC ERA gestisce il secondo più grande parco di raccordo ferroviario (fitting platform) di binari a scartamento largo 1.520 mm. “Attualmente - afferma in conclusione Alexey Grom - il parco ferroviario è costituito da più di 4mila vagoni ed è gestito tramite affitto e leasing finanziario. Non escludo che, se la situazione cambierà, inizieremo a costituire il nostro parco ferroviario. Ciò avverrà se tale scelta si rivelerà profittevole o se saremo in grado di ridurre i costi per i nostri clienti”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 57

DKV / OFFENSIVA IN TUTTA EUROPA CON IL POST-PAY

DAL 1° OTTOBRE DKV EURO SERVICE

Nuovo pedaggio anche in Serbia

A

VALENTINA MASSA

FATTURARE IL PEDAGGIO ANCHE IN

SERBIA IN MODO

MILANO

partire dal 1° ottobre DKV Euro Service è la prima società di carte carburante e servizi per l’autotrasporto in grado di fatturare il pedaggio dei camion che transitano in Serbia con la modalità post-pay. Gli autisti possono così utilizzare le corsie veloci dedicate, senza dover rallentare il proprio viaggio a causa di code e traffico ai caselli. La fatturazione sarà digitale e successiva al passaggio del casello, mentre fino ad ora gli autisti dovevano pagare il pedaggio prima di intraprendere il viaggio. Sarà possibile ritirare il box pedaggio post-pay al confine per entrare in Serbia: i clienti DKV non dovranno far altro che esibire la propria DKV Card e la carta di circolazione, dopodiché riceveranno l’OBU, che verrà configurata sul posto, in modo personalizzato. Da subito tutte le transazioni di pedaggio in Ser bia verranno rilevate da que sto nuovo dispositivo e fatturate all’azienda una volta al mese tramite la fattura DKV. La Serbia rappresenta un importante paese di transito per gli spedizionieri internazionali che attraversano questo stato della penisola balcanica quando, ad esempio, da Turchia, Grecia, Bul-

PERMETTE DI PAGARE E

POSTICIPATO CON LA PROCEDURA POST-PAY.

LA NOTIZIA SEGUE DI POCO L’AVVIO DELLE REGISTRAZIONI ON LINE

REPUBBLICA CECA E L’ACQUISIZIONE DEL 25 IN

PER CENTO DELLA SPAGNOLA VAT

SERVICES DA PARTE DI DKV MOBILITY SERVICES GROUP.

garia, Romania o Ungheria si recano in Europa centrale e settentrionale oppure quando dalla Russia vanno in Europa meridionale. Lo scorso settembre si è reso disponibile il servizio online di DKV per registrarsi al nuovo sistema di pagamento pedaggio in Repubblica Ceca, che sarà operativo dal

1° dicembre. Entro quella data è necessario registrarsi al nuovo sistema di pedaggio poiché tutti i dispositivi compatibili con l’attuale tecnologia non saranno più validi e dovranno essere sostituiti dalle nuove OBU satellitari del consorzio CzechToll e SkyToll. Inoltre, dal 2020, è previsto un aumento delle tratte

stradali ceche soggette a pedaggio. La notizia dell’investimento di DKV nell’est Europa e nel sud est della Penisola balcanica giunge quasi in concomitanza con la notizia dell’acquisizione del 25 per cento della spagnola VAT Services da parte di DKV Mobility Services Group. VAT Servi-

ces, azienda leader in Spagna per la fatturazione internazionale e pagamento dei pedaggi, rimborsi fiscali e carburante, ha raggiunto nel 2018 un fatturato di oltre 200 milioni con oltre 1.500 clienti at tivi e 36mila OBU (On Board Unit, dispositivo installato sul veicolo per calcolare i chilometri percorsi) in

tutto il mondo. Il contratto firmato a Madrid prevede che la famiglia Alfaro rimanga l’azionista di maggioranza dell’azienda, con il 57 per cento delle quote. “Siamo lieti - afferma Marco van Kalleveen, CEO di DKV - di finalizzare questo investimento strategico con VAT Services che, siamo sicuri, ci permetterà di crescere ulteriormente, insieme”. “La partecipazione di DKV in VAT Services - aggiunge Carlos Alfaro, Direttore Generale VAT Services darà un impulso fondamentale alla commercializzazione delle nostre soluzioni e sarà decisiva per consolidarci ulteriormente nella penisola iberica”.

La so oluzione più ù veloce per il trasp porto del tuo t busine ess. Palletway ys: trasportia amo i tuoi pallet anche in Eur uropa. Palletways è il Network twork di trasporto espr spresso di LL Communication

merce pallettizzata a che grazie alla sua capillarità sul territorio con una copertura in 20 0 Nazioni e l’utilizzo delle più iù moderne tecnologie, gie, offre la giusta soluzione e per ogni tipo di esigenza, assicurandoti un servizio di consegna rapido, sicuro ed affidabile, e favor orendo lo sviluppo commer mmerciale del tuo business in tutta Italia ed Europaa.

Trova il tuo Concessionario di zona su

www.palletways.com © Pallet ways Europe GmbH

Il Network espresso per merce pallettizzata

Palletways Plus

portal.palletways.com


MOBILITÀ

IL MONDO DEI TRASPORTI

Pagina 58

L

N° 284 / Novembre 2019

INTERVISTA

MICHELE MALDINI DIRETTORE SETTORE LINEA DI EVOBUS ITALIA

’arrivo in Italia del MercedesBenz Citaro elettrico è stato programmato in maniera speciale da EvoBus Italia: dieci clienti stanno testando l’urbano full electric per le strade italiane. Tutte le varianti del Citaro elettrico si basano sul best-seller mondiale Citaro, che nel 2012 è stato il primo autobus urbano al mondo a rispettare la classe di emissioni Euro VI, quella attualmente più severa. Senza dimenticare che è completamente non inquinante la variante Citaro hybrid, con un consumo di carburante ulteriormente ridotto. Se il Citaro NGT a metano con il biogas arriva quasi a un bilancio neutrale di CO2, il Citaro a trazione completamente elettrica compie ora il passo successivo, dalle basse emissioni alle emissioni zero locali. L’eCitaro rappresenta dunque una valida opportunità per le aziende italiane del TPL, un settore in continua evoluzione e costantemente impegnato ad affrontare sfide e problematiche. Ne abbiamo parlato con Michele Maldini, 47 anni, bolognese, da vent’anni in EvoBus Italia e dal 2014 Direttore settore linea di EvoBus Italia per i marchi Mercedes-Benz e Setra. “I problemi che devono affrontare le aziende di trasporto pubblico locale sono estremamente seri - esordisce il manager - In questo settore

e Setra ci sono diverse cose in cantiere. “Due cose importanti avverranno nel 2020 - continua Maldini La prima è l’estensione dell’offerta sul prodotto elettrico sia per il 18 metri che per le macchine più corte. La seconda novità è che presenteremo la nuova piattaforma interurbana che per noi rappresenta uno step di importanza storica”. Nel frattempo, eCitaro percorre le strade e le vie delle città italiane mostrando, alla prova dei fatti, tutte le sue qualità. “Il Citaro elettrico ha compiuto negli anni un progresso continuo è oggi disponiamo di un veicolo più evoluto rispetto a quello presentato qualche anno fa con la prima serie tecnologica di batterie -commenta Michele Maldini - L’anno prossimo avremo tutte le lunghezze disponibili. Attualmente stanno testando in Europa circa 300 unità di eCitaro e in Italia abbiamo coinvolto dieci clienti. L’utilizzo pratico del mezzo durerà fino alla metà del 2020”. “A livello europeo - dice ancora Maldini da questo prodotto ci aspettiamo la possibilità concreta di creare una nuova aspettativa La stessa cosa vale per l’Italia, anche se noi non siamo ancora pronti per l’elettrico. Prima dobbiamo far tornare l’età media dei veicoli a un livello decente, iniziando a tirare via dalla strada mezzi Euro 1 ed Euro 2 ancora circolanti.

Più trasparenza ed efficienza nel TPL IN OCCASIONE DEL LANCIO SUL MERCATO ITALIANO DELL’AVVENIRISTICO ECITARO, PROTAGONISTA DI UN VASTO PROGRAMMA DI TEST CON DIECI SELEZIONATI CLIENTI, MICHELE MALDINI CI ILLUSTRA LE SFIDE E LE PIÙ URGENTI PROBLEMATICHE CHE INTERESSANO IL COMPARTO DEL TRASPORTO PUBBLICO LOCALE, ASSE PORTANTE DELLA MOBILITÀ DEL SISTEMA PAESE. non c’è spazio per la psicologia spicciola dal momento che si devono gestire problemi concreti. Innanzitutto abbiamo tanta necessità di controllo sulla gestione dei finanziamenti. Oggi si parla di un’ulteriore revisione del codice degli appalti, ma le semplificazioni in un ambito delicato come il controllo anticorruzione non vanno mai bene. Inoltre, c’è il problema della diversificazione delle necessità delle aziende. In Francia per esempio esistono enti che fanno grandi gare, stilano un listino dei concorrenti dopo di ché l’azienda del TPL guarda il listino e si sceglie quello che vuole. Il contributo pubblico è finalizzato al prodotto che costa meno e se l’azienda ha qualche esigenza in più, i soldi ce li mette lei. In Italia vige l’obbligo di servirsi di Consip, cioè della centrale acquisti della pubblica amministrazione, per gli acquisti di bus e per l’utilizzo del contributo pubblico anche nel caso in cui ci siano prezzi inferiori a quelli fissati da Consip. Non viene quindi lasciata libertà alle aziende che ne hanno diritto di accedere ai contributi di cofinanziamento pubblico con procedure contrattuali proprie al fine di massimizzare l’uso dei già scarsi finanziamenti”. Come si è evoluta negli ultimi dieci anni la professionalità dei dirigenti delle aziende TPL? “Nel ricambio generazione dei dirigenti c’è oggi la tendenza a scegliere persone con spirito imprenditoriale - afferma

Maldini - Una cosa che prima non succedeva. I nuovi dirigenti sono per la maggior parte delle volte esperti di finanza o TPL. Il Politecnico di Milano ha anche programmato un corso di laurea specialistico in trasporto pubblico. Ciò rappresenta un forte segnale nella direzione delle competenze specifiche anche dal punto di vista della carriera universitaria e della formazione. Come costruttori, ai dirigenti chiediamo innanzitutto programmazione e standardizzazione della richiesta. In secondo luogo la trasparenza. E chiediamo un dialogo serio sulla contribuzione pubblica perché c’è necessità di allineare e semplificare. Lo Stato oggi assegna fondi alle Regioni e ciascuna Regione si inventa i modi per elargire fondi alle aziende TPL: questo crea problemi a noi perché ogni Regione mette dei requisiti minimi per la finanziabilità del veicolo e non elargisce soldi all’azienda fin-

di PAOLO ALTIERI

SORBARA DI BOMPORTO

ché questa non ha acquistato il prodotto. Ma se il mio contributo serve per sviluppare il parco veicoli lo do all’azienda prima che questa acquisti il veicolo, non certo dopo. La serietà che chiediamo alla pubblica amministrazione, la chiediamo ovviamente anche alle aziende clienti. Occorre anche regolare la frequenza, la cadenza e il rispetto della legge che de finisce i pagamenti nel settore pubblico: non è possibile che un’azienda di trasporti paghi a 30 o 60 giorni mentre la quota regionale non si sa quando arriverà perché c’è già un arretrato di diversi anni. Così io faccio pagare un mezzo in modo diverso a un’azienda di trasporto di Roma rispetto a una di Milano. Ed è assurdo”. Questione rilevante rimane l’età media assai elevata del parco circolante italiano. “Una realtà che le aziende del TPL non sopportano più spiega Maldini - Un parco circolante

Il Mercedes-Benz eCitaro in prova nelle mani dei clienti anche in Italia.

così vecchio non incentiva in alcun modo l’utilizzo del mezzo pubblico che viene ancora ghettizzato. Chi infatti vorrebbe utilizzare mezzi datati, malconci, che vibrano durante la mar cia e per giunta inquinano di più? L’immagine che ne ricava il trasporto pubblico non è certo positiva. Ma è altresì vero che le aziende di trasporto che non hanno la possibilità di usufruire di contratti di servizio a lungo termine non possono pianificare investimenti in modo credibile. Si sta anche verificando la possibilità del noleggio come valida alternativa perché il noleggio si basa sul periodo di utilizzo del mezzo. Ma anche in questo senso c’è molto da fare per agevolare l’implementazione del sistema. La legge è già stata fatta, tecnicamente è già possibile noleggiare. Eppure, in questo momento, il Ministero non ha ancora provveduto ad adeguare il software della motorizzazione per le relative immatricolazioni di un veicolo destinato al TPL. Forse la situazione si sbloccherà l’anno prossimo”. Il mondo ideale per un costruttore di autobus per il servizio di linea? A questa domanda, Michele Maldini risponde con enfasi: “Il mondo ideale è quando esiste qualcuno che ti dice: tu venderai, ad esempio, 300 autobus all’anno, tutti uguali, che prima o poi io ti acquisto. La realtà è però ben diversa”. Intanto, EvoBus non sta con le mani in mano e per Mercedes-Benz

Non siamo pronti anche perché abbiamo un numero di stazioni appaltanti troppo elevato. In Francia sono meno di un decimo delle nostre. Questo provoca una frammentazione delle conoscenze tecniche che vanifica l’approccio corretto a una tecnologia sofisticata e sconosciuta come la trazione elettrica. Senza contare che non esiste una linea guida italiana su come affrontare la problematica dell’elettrificazione delle linee. Infine, non siamo pronti perché i fondi di investimento non possono essere dati a pioggia: non può essere finanziato al cento per cento un veicolo elettrico quando questo ha costi di gestione attualmente ancora superiori al veicolo diesel”. Per Michele Maldini, “la soluzione che pare tecnicamente più logica dal punto di vista ambientale è produrre energia elettrica più vicino possibile a dove qull’energia la si utilizza. La dispersione derivante dal trasporto dell’energia dovrebbe quindi essere azzerata. Un veicolo elettrico a celle combustibile è per me la soluzione ottimale. Se per far funzionare un veicolo elettrico devo riempirlo di batterie e fargli arrivare corrente perfino alle fermate, creo dispersione elettrica; se invece il veicolo si ricarica di notte e di giorno viaggia autoricaricandosi con celle combustibile a idrogeno, arrivo a risparmiare più del 50 per cento delle emissioni che avrei con le soluzione precedente”.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 59

MAN BUS / PRIMO VIAGGIO A BORDO DEL LION’S CITY HYBRID

Passi rapidi verso l’elettrico IN UN CONVEGNO AL MUSEO NICOLIS ILLUSTRATA LA STRATEGIA DELLA CASA DI MONACO. LANCIATA L’ANNO SCORSO ALL’IAA, LA NUOVA FAMIGLIA DEL GUERRIERO DEL LEONE NEL TRASPORTO URBANO CONTINUA A CRESCERE: ACCANTO AL DIESEL EURO VI E AL METANO OGGI LA SOLUZIONE IBRIDA È DISPONIBILE CON

L

LINO SINARI VILLAFRANCA

anciata l’anno scorso all’IAA, prosegue il suo sviluppo la gamma MAN Lion’s City, con la qua le il costruttore di Monaco punta a ricoprire un ruolo da leader nel segmento del trasporto urbano. Equipaggiato con il motore diesel MAN Euro VI da 9 litri, il guerriero della Casa del Leone nel segmento

ENTRAMBE LE MOTORIZZAZIONI. dei trasporti urbani è sbarcato sulle strade con la trazione a metano, nella quale MAN mette in campo un’expertise da oltre 8mila autobus prodotti, 750 dei quali tuttora circolanti. Nel suo viaggio verso l’elettrificazione, con progetti in corso grazie alla squa dra di esperti MAN Transport Solutions, oggi Lion’s City è pronto in versione ibrida diesel-elettrica e metano-elettrica. Il nostro primo viaggio a bordo di

un Lion’s City Hybrid lo facciamo a Villafranca, alle porte di Verona, partendo dal Museo Nicolis, regno di autentici cimeli dell’automotive e non solo, nel quale ha avuto luogo un convegno di presentazione delle soluzioni e-Mobility di MAN, alla presenza di rappresentanti di oltre settanta manager di aziende di TPL di tutta Italia. Tema dell’evento le “Transport Solutions” di MAN, non solo come ente preposto ad affianca-

I manager MAN Truck & Bus presenti al convegno di Villafranca. Da sinistra: Tiziano Gavardini, Responsabile Vendite Bus pubblico; Florian Rott, Lauch management nuovi prodotti; Michael Voll, Direttore Network Analysis MAN Transport Solutions; Giovanni Tosi, Product Marketing Bus; David Siviero, Direttore Vendite e Prodotto Bus.

re le aziende nel passaggio verso la trazione e let trica, ma anche come impegno della Casa di Monaco sul fronte dell’efficienza e nergetica e ambientale applicata al trasporto pubblico di persone. Il Museo Nicolis, con auto storiche e altri oggetti di automobilia vintage, è stato scelto per sottolineare il passaggio tra una tradizione eccezionale, ma ormai superata, e il nuovo che avanza. A dare il benvenuto David Siviero e Tiziano Gavardini, rispettivamente Direttore Vendite e Prodotto Bus e Responsabile Vendite Bus pubblico di MAN Truck & Bus Italia. Michael Voll, Direttore Network Analysis MAN Transport Solutions, ha ribadito come il passaggio alla trazione elettrica ponga nuove sfide alle flotte TPL in termini di autonomia del veicolo, infrastrutture di ricarica, durata e peso delle batterie. “I vantaggi della mobilità elettrica - ha ricordato Voll - sono noti, con emissioni locali e rumore azzerati. MAN sta svi luppando questa tecnologia su tutta la gamma di prodotti dal bus al truck al van”. L’intervento si è focalizzato sull’analisi della rete, con l’or ganizzazione delle linee in base alle esigenze di portata e autonomia dei nuovi veicoli, ma anche alla topografia e alle condizioni climatiche. “Una ri-pianificazione sistemica del servizio - ha dichiarato Voll - consente un passaggio sicuro dalla trazione diesel a quella elettrica e, grazie all’utilizzo di eventuali pause per la ricarica in deposito, si incrementa l’autonomia per coprire il servizio”. Sul fronte dell’infrastruttura di ricarica le variabili coinvolgono l’ottimizzazione dei carichi di consumo, e quindi dei punti di ricarica, con la riduzione dei picchi attraverso una programmazione delle ricariche stesse, privilegiando le ore notturne, quando l’energia elettrica costa meno. L’at-

UN

ALTERNATORE ELETTRICO GENERA ENERGIA CHE ALIMENTA LA RETE DI BORDO E, NELLA RIPARTENZA, DÀ UN BOOST AL PROPULSORE TERMICO.

tenzione si è poi spostata sulle batterie di trazione che Voll ha indicato come “uno dei componenti chiave dell’elettromobilità”. Nello specifico, MAN Transport Solutions è attenta alle nuove tecnologie e consiglia come utilizzare le batterie in modo sostenibile e corretto per assicurarne funzionalità ottimale e durata. Giovanni Tosi, Product Marketing Bus MAN Italia, ha illustrato la nuova generazione MAN Lion’s City con un focus particolare sul sistema Efficient Hybrid che equipaggia il nuovo veicolo urbano della Casa di Monaco. Disponibile da 12, 18 (come quello sul quale abbiamo viaggiato) e 18,75 metri, il prossimo anno nella famiglia entrerà anche la versione da 14 metri e non si esclude l’ipotesi di un veicolo di accesso alla gamma da 10,5 metri. “Tra cambio e motore termico - spiega Tosi - è collocato un motore-generatore che funziona da alternatore: in marcia o in frenata accumula energia elettrica che rende disponibile in base all’esigenza di viaggio del veicolo”. Primo e prioritario step, l’energia elettrica viene utilizzata per alimentare la rete di bordo; a seguire, il motore elettrico entra in funzione nella ripartenza per sgravare il motore termico, che può essere diesel o a metano. Considerando gli start & stop, in media si calcola un risparmio nei consumi fino al 15 per cento”.

PROGETTO CON SCELTE PRECISE: IL PROSSIMO ANNO HA INIZIO LA PRODUZIONE IN SERIE

COME TI ELETTRIFICO LA FLOTTA: IL CASO DI AUTOSERVIZI SAF DI UDINE A l convegno di Villafranca l’intervento di Michael Voll si è concentrato sulla presentazione di un caso specifico: lo studio di fattibilità per l’azienda Autoservizi SAF di Udine per l’elettrificazione tramite veicoli MAN Lion’s City E della linea 1 della città friulana. La linea può essere elettrificata con poche variazioni all’attuale esercizio tramite l’utilizzo di nove unità di eBus per i quali è sufficiente una ricarica notturna e, solo per uno di essi, anche una parziale ricarica diurna, in orario non di massima tariffazione energetica. Per svolgere tale servizio sono necessari quattro caricabatterie da 150 kW (quattro gruppi e nove prese di ricarica) con un picco massimo di energia di circa 667 kW in deposito in condizioni operative

normali. Il risparmio è dell’ordine di quasi il 50 per cento l’anno al netto del costo di acquisto dei veicoli. MAN Lion’s City E è stato presentato all’IAA 2018 destando grande clamore. A fare il punto sugli sviluppi intercorsi dalla prima apparizione ad oggi ci ha pensato Florian Rott, Lauch management nuovi prodotti di MAN, che volutamente ha parlato di scenari futuri molto “elettrizzanti”. Partendo dalle esigenze del cliente dell’eMobility (flessibilità, affidabilità, compatibilità e consulenza sull’esempio dei servizi di Transport Solutions), Rott ha confermato che dal 2020 MAN Lion’s City E di 12 metri, con una capacità fino a 88 passeggeri, sarà prodotto in serie e gli farà seguito, l’anno seguente, il

modello da 18 metri per il trasporto fino a 120 passeggeri. Alla base del progetto del MAN Lion’s City E ci sono scelte precise: ricarica in deposito tramite presa, motore centrale per la massima integrazione con i modelli attuali e maggiore facilità di manutenzione. Le batterie sono agli ioni di litio, tecnologia al momento più affidabile e duratura nel tempo, con sei moduli da 480 kWh per il 12 metri e otto moduli di 640 kWh per gli articolati. Fino a 270 km l’autonomia in condizioni favorevoli, 200 km in tutte le stagioni e per tutta la vita delle batterie, al massimo tre ore per il 100 per cento di ricarica con prese standardizzate, posizionate nella parte anteriore del veicolo; in alternativa altre due prese sono disponibili sui lati.


IL MONDO DEI TRASPORTI

Pagina 60

N° 284 / Novembre 2019

IVECO BUS / IMPORTANTI ORDINI DI URBANWAY E CROSSWAY DA FRANCIA E NORVEGIA

I principi della linea IL PRIMO ORDINE È QUELLO DI ILE-DE-

FRANCE MOBILITÉS E RIGUARDA 409 URBANWAY NATURAL POWER 12 M. I VEICOLI ALIMENTATI A BIOGAS VERRANNO CONSEGNATI TRA IL

2020 E IL 2021 E OPERERANNO NEI SOBBORGHI INTERNI ED ESTERNI DELL’AREA METROPOLITANA DI

PARIGI. LA PIÙ GRANDE CONSEGNA DI SEMPRE IN NORVEGIA COMPRENDE

217

AUTOBUS URBANI E INTERURBANI

E

FABIO BASILICO TORINO

uropa chiama, Iveco Bus risponde. Sempre più apprezzata dagli operatori del trasporto passeggeri, la gamma del costruttore conquista importanti fette di mercato in diversi Paesi del vecchio continente. Due nuovi importanti ordini vengono da Francia e Norvegia. Il primo è quello che fa capo a Ilede-France Mobilités e riguarda 409 Urbanway Natural Power. Durante l’inaugurazione dell’esposizione nazionale dedicata al trasporto pubblico che si è svolta a Nantes agli ini zi di ottobre, Iveco Bus, CATP (Centrale d’achat du transport public) e Ile-deFrance Mobilités hanno ufficialmente confermato l’ordine per gli Urbanway Natural Power. I veicoli alimentati a biogas verranno consegnati tra il 2020 e il 2021 e opereranno nei sobborghi interni ed esterni dell’area metropolitana di Parigi. È la prima volta che un ordine simile viene effettuato tramite un ufficio centrale per gli acquisti, senza passare per

CROSSWAY IN TRE DIVERSE VERSIONI. un operatore di trasporto. Si tratta di una nuova procedura mirata a standardizzare i veicoli impiegati nella regione dell’Ile-deFrance, al fine di garantire che i passeggeri possano usufruire di autobus di qualità equivalente. Gli Urbanway Natural Power da 12 metri presenteranno il nuovo design degli interni di Ile-deFrance Mobilités, che ridefinisce gli standard in termini di comfort e sicurezza. Più silenziosi che mai, grazie al-

l’impiego di gas naturale, questi nuovi autobus saranno dotati di aria condizionata, CCTV, porte USB e illuminazione a Led per un comfort di viaggio di alto livello. Alimentati a biogas, andranno ad aggiungersi agli autobus eco-compatibili già attivi nella regione e rivestiranno un ruolo attivo nel piano di rinnovo delle flotte di autobus diesel. Il carburante, derivato da rifiuti organici riciclati, offre enormi vantaggi

ambientali in termini di emissioni inquinanti e rumorosità. Il livello di particelle fini rasenta lo zero e le emissioni di NOx vengono ridotte di oltre un terzo. Il livello di rumore risulta dimezzato, offrendo un funzionamento quasi completamente silenzioso a beneficio di autisti, passeggeri e residenti. L’impiego di questa tecnologia risponde, già da oggi, alle sfide della mobilità di domani: qualità dell’aria, tutela del clima e funziona-

mento silenzioso sono soltanto alcuni dei vantaggi aggiunti ottenuti senza compromettere le prestazioni. Inoltre, grazie all’autonomia estesa di 400 chilometri, gli Urbanway NP sono ideali per il trasporto pubblico nell’area della Grande Parigi. Leader europeo da quasi 25 anni, il brand Iveco riconferma ancora una volta la pro pria predominanza nel campo dei sistemi di propulsione alternativi e mette a disposizione una soluzione matura, virtuosa e sostenibile dal pozzo alla ruota. Con soluzioni adatte a tutti i tipi di trasporto e un ottimo ritorno sull’investimento, le competenze di Iveco Bus nel campo delle tecnologie Natural Power trasformano la mobilità sostenibile in realtà. “Siamo estremamente orgogliosi del fatto che Ile-deFrance Mobilités abbia scelto proprio noi per piazzare questo ordine, che conferma l’impegno dell’azienda nei confronti della tran sizione energetica - ha commentato Stéphane Espinasse, Direttore di Iveco Bus - Questo rappresenta l’ennesimo riconosci-

mento delle com petenze di Iveco Bus nel campo dei veicoli alimentati a energia alternativa”. Il costruttore ha inoltre completato la più grande consegna di sempre in Norvegia. La controparte è la Vy Buss AS, precedentemente nota come Nettbuss AS. L’accordo pre vede la consegna di 217 autobus urbani e interurbani Crossway in tre diverse versioni. I primi autobus sono in funzione già dall’inizio dell’estate. I veicolo opereranno sia a Øvre che a Nedre Romerike. L’appalto durerà 8 anni, con possibilità di estensione. La maggior parte degli autobus coinvolti nella consegna (110) appartiene alla versione Crossway LE Line da 14,5 m a tre assali. Questi autobus, alimentati da un motore Cursor 9 da 360 cv, dispongono di 57 posti a sedere e spazio per 52 passeggeri in piedi. Ci sono poi 67 Crossway LE Line da 12,1 m a due assali, con motore Tector 7 da 320 cv, 45 posti a sedere e spazio per 39 passeggeri in piedi. Su questi due modelli il pianale ribassato semplifica notevolmente la salita e la discesa dei passeggeri. I restanti 40 mezzi sono Crossway in versione Line da 13 metri e con un’altezza dal suolo standard. Alimentati da un motore Tector 7 da 320 cv, dispongono di 49 posti a sedere, con la possibilità di accogliere 29 passeggeri in piedi. Entrambe le versioni dei motori che alimentano gli autobus consegnati a Vy Buss sono completamente compatibili con HVO (olio vegetale idrogenato). Adatti a soddisfare tutte le esigenze, questi veicoli sono equipaggiati con spargisabbia, molto utili d’inverno quando le strade norvegesi sono ghiacciate. Tutti gli autobus sono dotati inoltre di un sistema di ticketing migliorato e di schermi TFT con informazioni aggiornate per i passeggeri, mentre per la ricarica dei dispositivi mobili dei passeggeri sono disponibili prese USB. Ci si è presi cura anche del comfort dell’autista, dotando il posto di guida di un sedile moderno e ben protetto. Una caratteristica speciale dei Crossway per la Norvegia è la nuova barra luminosa sul tetto, che aumenta la potenza degli abbaglianti, integrandosi perfettamente con i due fari tondi ausiliari montati sul tetto. Molti di questi autobus saranno operativi in aree con scarsa illuminazione dove la maggiore potenza degli abbaglianti contribuirà ad aumentare la sicurezza stradale.

Lo stabilimento Iveco di Sete Lagoas ottiene un importante riconoscimento dal programma WCM

Medaglia d’argento per l’impianto brasiliano

L

o stabilimento di produzione Iveco di Sete Lagoas, in Brasile, ha ottenuto il livello Argento nel programma World Class Manufacturing (WCM). Si tratta di un riconoscimento significativo per il costruttore membro di CNH Industrial e un’ulteriore testimonianza del successo dell’ampio programma aziendale volto a raggiungere l’eccellenza dei processi di produzione attraverso gli sforzi combinati della sua complessa forza lavoro. Lo stabilimento di Sete Lagoas è stato inaugurato nel 1997 nello

stato di Minas Gerais e oggi produce i modelli di furgoni e autocarri Daily, Tector, HiRoad e Hi-Way per il marchio Iveco, nonché i telai degli autobus e il Daily Minibus per Iveco Bus. Lo stabilimento ospita anche un centro di Ricerca e Sviluppo all’avanguardia, il primo inaugurato dal marchio al di fuori del continente europeo. Con una superficie di circa 2,3 milioni di metri quadrati, il complesso industriale conta circa 1.500 dipendenti e dispone di un centro di collaudo, il primo della sua categoria a

essere costruito in Sud America, con una struttura completa per testare l’intera gamma di veicoli commerciali e per la difesa. Il World Class Manufacturing è uno dei più prestigiosi standard del settore manifatturiero globale per la gestione integrata degli stabilimenti e dei processi di produzione. Consiste in un sistema strutturato in pilastri, basato sul miglioramento continuo e progettato per eliminare sprechi e perdite dal processo produttivo attraverso l’identificazione di obiettivi quali

zero infortuni, zero difetti, zero rotture e zero sprechi. Per certificare i miglioramenti ottenuti, il sistema prevede una serie di audit periodici indipendenti su tutti i pilastri del WCM. L’esito dei controlli determina l’assegnazione di un punteggio e tre livelli di certificazione: Bronzo, Argento e Oro. Lo stabilimento di Sete Lagoas ha apportato miglioramenti significativi nelle aree della “Manutenzione professionale” e della “Motivazione degli operatori” ottenendo così il livello Argento.


BTS

VERSAT TILE PER NAT TURA. REDDITIZIO PER SCELT TA A.

VERSAT TILITÀ STRAORDINARIA Nuova architettura polivalente su misura sura :S SPYQI&EKEKPMIVE½RSEQ3: ideale per il trasporto su percorsi regionali e nazionali, i transfer aeroportuali, le escursioni e i tour organizzati

AFFID DA ABILITÀ COLLAUDAT TA A Solidee tradizioni e lunga esperienza Teestato in condizioni sstradali e climatiche estreme: da -30°C a +50°C Esclusiva tecnologia cnologia HI-SCR senza rigenerazione

REDDITIVITÀ À OTTIMIZZAT TA T A Miglior TCO della categoria Basso consumo di carburante e ridotta frequenzaa di manutenzione Eccellente valutazione dell’usato Polivalenza ottimizzata per il servizio sia ferialle che festivo

MASSIMO COMFOR O T E MASSIMA SICUREZZA Comfort di bordo ai vertici della categoria Sistemi avanzati v di sicurezza attiva e passiva Rum morosità e vibrazioni ridotte


IL MONDO DEI TRASPORTI

Pagina 62

N° 284 / Novembre 2019

INTERVISTA

È

THOMAS SAUTTER

CHIEF MAKETING OFFICER E SENIOR VICE PRESIDENT EMEA DIVISION MOBILITY VOITH TURBO

menta Sautter - Si va verso la mobilità elettrica passando anche attraverso soluzioni intermedie. In Austria è attiva un’azienda di Voith Turbo che si occupa proprio di sviluppare inverter di potenza e sistemi elettrici per il mondo ferroviario. Un altro ambito di sviluppo Voith è il sistema ibrido green basato su motore diesel di sviluppo Voith abbinato a un generatore elettrico. Una soluzione che viene incontro ai clienti che vogliono essere green senza l’onere di investire nell’elettrificazione di tutte le linee che non sono ancora elettrificate. Risparmiano così sui costi di investimento della catenaria oppure fanno il ponte verso l’elettrificazione”. A fronte di un’offerta così ampia e specifica, c’è da chiedersi cosa mai possano volere ancora i clienti da Voith. “Voith è azienda molto tecnologica che offre soluzioni solo quando sono effettivamente comprovate - dice Thomas Sautter - Voith è anche una realtà in continuo sviluppo, che cerca di venire incontro e se possibile anticipare la domanda dei clienti. Il nostro obiettivo è da re al cliente un servizio e una consulenza a tutto tondo sulla driveline del treno”. In conclusione, Thomas Sautter esprime un’inevitabile valutazione sul futuro del settore rail: “La tendenza in atto a

Expo Ferroviaria, il Salone milanese dedicato alle ultime novità tecnologiche dell’industria ferroviaria, il palcoscenico ideale per fare il punto sulle iniziative di un operatore fortemente innovativo come Voith Turbo, che ha nella divisione Rail uno dei suoi decisivi assi strategici. “La Divisione Rail è parte integrante della più vasta divisione Mobility di Voith Turbo - ci dice Thomas Sautter, Chief Marketing Officer e Senior Vice President EMEA della Mobility Division di Voith Turbo, presente in Fiera Milano per accompagnare la presentazione sullo stand delle importanti novità Voith per il settore ferroviario - E senza dubbio quella Rail è la parte più grande dell’articolato business Mobility, con un valore di circa 500 milioni di euro. Ogni anno Voith investe il 5 per cento di questo fatturato in Ricerca & Sviluppo. Il risultato è che i nostri clienti ricevono dal lavoro di Voith diverse linee di prodotto: dalle linee di trasmissione per il treno, agli accoppiatori e ad altri prodotti ancora come i cinematismi di azionamento del muso del treno. Un altro pilastro molto importante è il Service. Oltre alla Germania, siamo presenti con il Service in ben 42 Paesi e ciò vuol dire che siamo molto vicini al cliente finale”.

Divisione Rail, locomotiva tecnologica “LA DIVISIONE RAIL È PARTE INTEGRANTE DELLA PIÙ VASTA DIVISIONE MOBILITY DI VOITH TURBO - CI DICE THOMAS SAUTTER, CHIEF MARKETING OFFICER E SENIOR VICE PRESIDENT EMEA DELLA MOBILITY DIVISION DI VOITH TURBO, PRESENTE IN FIERA MILANO A EXPO FERROVIARIA 2019 PER ACCOMPAGNARE LA PRESENTAZIONE DI DUE IMPORTANTI NOVITÀ - E SENZA DUBBIO QUELLA RAIL È LA PARTE PIÙ GRANDE DEL COMPLESSO BUSINESS MOBILITY, CON UN VALORE DI CIRCA 500 MILIONI DI EURO”. In un settore altamente specializzato come quello ferroviario, quali sono le richieste del cliente? “Partendo dai clienti e dalla loro tipologia - risponde Thomas Sautter - ci sono aziende diversissime, da quelle altamente complesse come Trenitalia o Deutsche Bahn in Germania agli operatori locali; ognuno ha esigenze differenti e quello che fa Voith è andare incontro a ogni cliente con soluzioni personalizzate. Sia mo in grado, con il nostro know-how, di offrire soluzioni tailor made affinché il veicolo su rotaie sia sempre disponibile per il servizio. Operiamo con il criterio della “customer tailored solu-

tion”, la soluzione personalizzata e su misura che beneficia di tutta la competenza dell’organizzazione Voith”. Molteplici la carte vincenti che caratterizzano il produttore tedesco anche nel settore ferroviario. “Le differenze tra Voith e i principali competitor risiedono nelle innovazioni - spiega Sautter - Come il CargoFlex, l’accoppiatore automatico per vagoni cargo che introduce condizioni di sicurezza al top per tutti gli operatori ferroviari che nei sistemi attuali devono andare da un vagone all’altro per poter eseguire l’aggancio manualmente. Con CargoFlex ovviamo all’intervento umano e

di FABIO BASILICO MILANO

garantiamo sicurezza anche prevenendo il deragliamento, dal momento che il sistema ha un movimento di adattamento laterale che consente di mantenere sempre il veicolo sui binari. Inoltre, questa soluzione rappresenta un’ ulteriore ottimizzazione dei costi di manutenzione per l’operatore. CargoFlex viene applicato in testa e in coda a ciascun vagone”. “Il sistema presentato a Expo Ferroviaria 2019 è una novità per il settore del trasporto merci - aggiunge Sautter - Voith detta già da tempo lo standard del mercato per quanto riguarda gli accoppiatori per i veicoli dedicati al trasporto passeggeri; ora of-

friamo anche il primo accoppiatore specifico per i treni cargo. CargoFlex è un prodotto che è già realtà, dal momento che ce ne sono già più di 200 esemplari in servizio. Nella visione di Voith, crediamo che CargoFlex sarà il nuovo standard per il comparto cargo merci”. Altra première è rappresentata dal primo motore Stage V per applicazioni ibride dieselelettriche. “Siamo molto orgogliosi - dice ancora Thomas Sautter - Siamo i primi al mondo ad avere un prodotto simile. I vantaggi assicurati sono molteplici, a cominciare dalla riduzione del consumo di carburante e da un livello di emissioni in

linea con le richieste molto stringenti dello Stage V. Il motore diesel sviluppato da Voith ha un’applicabilità molto ampia e si adatta perfettamente alle esigenze degli operatori. È molto interessante questo aspetto perché il motore è stato sviluppato in modo da essere utilizzabile facilmente anche nei casi di modernizzazione della linea cinematica di vecchie locomotive che possono così essere facilmente adeguate agli standard normativi vigenti in tema di emissioni inquinanti”. Voith sta investendo molto an che in mobilità elettrica. “Questo è un trend sempre più rilevante nel mondo rail - com-

rendere i veicoli ferroviari più green è tale per cui ci saranno in futuro sempre più linee elettrificate. L’altro trend sono le gui de automatiche dei treni merci che potrebbero avere diversi sviluppi fino ad arrivare alla guida autonoma senza conducente. Un ruolo importante lo avranno la digitalizzazione e la telematica. Per Voith è importante continuare a lavorare su tre fondamentali direttrici per il settore ferroviario: affidabilità, sicurezza e puntualità. Voith si preoccupa di sviluppare soluzioni per gli operatori, cioè per le persone che lavorano nell’industria ferroviaria, per rendergli la vita e il lavoro più sicuri”.

L’accoppiatore automatico Voith CargoFlex e, a sinistra, il nuovo motore diesel Stage V.


IL MONDO DEI TRASPORTI

N° 284 / Novembre 2019

Pagina 63

LAZZERINI / CONCLUSA L’OPERAZIONE CON B4 INVESTIMENTI SGR

Via alla crescita internazionale IL FONDO EUVECA, DOPO UN ANNO DI LAVORO PREPARATORIO, ACQUISISCE COSÌ, ATTRAVERSO UN’OPERAZIONE DI BUY-OUT IN PARTNERSHIP CON I TOP MANAGER DELLA SOCIETÀ ITALIANA IL CONTROLLO DEL GRUPPO LAZZERINI, STORICA AZIENDA ATTIVA SU SCALA GLOBALE NELLA PROGETTAZIONE, PRODUZIONE E COMMERCIALIZZAZIONE DI SEDILI PASSEGGERI (E RELATIVI COMPONENTI) PER MEZZI DI TRASPORTO, PRINCIPALMENTE AUTOBUS.

F

LINO SINARI TORINO

irmato l’accordo, da parte del nuovo fondo di B4 Investimenti SGR, per il primo investimento nel Gruppo Lazzerini, la società marchigiana che o pera nel settore dei sedili per mezzi di trasporto. La partnership tra B4 Investimenti SGR e il management team del Gruppo Lazzerini ha l’obiettivo di consolidare la leadership globale nella nicchia di riferimento di una storica realtà italiana che già oggi realizza oltre 3/4 del proprio fatturato all’estero. La conclusione dell’operazione è avvenuta il 30 settembre 2019 preso lo studio di Gianni Origoni Grippo Capelli & Partners. BPER e Intesa San Paolo hanno supportato il finanziamento e la realizzazione dell’operazione. Il Fondo EuVECA, dopo un anno di lavoro preparatorio, acquisisce così, attraverso un’operazione di buy-out in partnership con i top manager della società italiana (Innocenzo Salvatore Carbone, Alessandro Cirioni e Vincenzo Lasalvia) il controllo del Gruppo Lazzerini, storica azienda attiva su scala globale nella progettazione, produzione e commercializzazione di se dili passeggeri (e relativi componenti) per mezzi di trasporto, principalmente autobus. Lazzerini S.r.l., fondata nel 1967, con sede operativa a Monsano (AN), opera in un settore che su scala globale ha un giro d’affari di oltre 2,5 miliardi di euro, con significativi tassi di crescita storici ed attesi (nell’ordine del 10 per cento annui), grazie ai trend connessi con la sharing economy, ai refitting del “parco mezzi” derivanti dalla ricerca e sviluppo (in relazione sia agli aspetti legati alle crescenti esigenze degli standard di sicurezza, nonché all’infotainment),come anche alla domanda importante dei

mercati del Far East. Nel 1996 Lazzerini è acquisita ed incorporata da Grammer AG, gruppo tedesco quotato presso la borsa di Francoforte, attivo nella produzione di interior component (sedili autista, scocche strumentazione, consolle di comando dei veicoli, bocchette AC) per il settore automotive ed agricultural. Nell’ambito di una riorganizzazione di Grammer AG, nel 2007 la società è oggetto di un’operazione di management buy-out da parte degli attuali top manager, con l’obiettivo di sviluppare lo storico marchio Lazzerini. Nel 2014 la società, al fine di sviluppare il mercato nordamericano e incrementare il proprio footprint internazionale, ha costituito Lazzerini Corporation, società basata negli Stati Uniti (a Elkhart, Indiana). Nel marzo di quest’anno, al fine di aumentare la penetrazione in Oceania e nel sud est asiatico, la società ha acquisito l’azienda australiana Styleride Pty Ltd, leader nel proprio mercato

domestico. Il Gruppo Lazzerini è cresciuto nel corso degli ultimi dieci anni con un tasso medio prossimo al 10 per cento. Nel 2018 il Gruppo ha generato un fatturato consolidato (proforma, includendo il business australiano) di oltre 27 milioni di euro (di cui circa il 75 per cento all’estero dove i principali mercati sono UK, Australia, Italia, Hong Kong e Nuova Zelanda) e una marginalità (in termini di EBITDA) superiore al 10 per cento. Il progetto di partnership tra il top management di Lazzerini e B4 mira a consentire al Gruppo italiano di effettuare un ulteriore ‘step up’ nel percorso di crescita e sviluppo, con l’obiettivo di incrementare la propria presenza all’estero, principalmente tramite lo sviluppo delle partecipate negli Stati Uniti e in Australia e consolidare quindi il posizionamento di Lazzerini come player globale di successo nel mercato dei sedili passeggeri per mezzi di trasporto (autobus, ma anche

sempre più treni, navi e mezzi speciali). Il Piano Industriale condiviso e alla base del progetto prevede un significativo ulteriore rafforzamento del team manageriale, soprattutto in ottica di sviluppo internazionale, importanti investimenti produttivi, in ricerca e sviluppo e attività commerciali (in particolare, in USA e in Australia), funzionali, sostanzialmente, a raddoppiare il giro d’affari nel corso dei prossimi 3-5 anni. Il progetto non esclude altresì di valutare, laddove se ne presentasse l’opportunità, eventuali opzioni M&A di crescita internazionale anche per linee esterne. “Una multinazionale tascabile che pensa in grande e vuole conquistare i mercati globali, ecco che cosa abbiamo visto in Lazzerini, una delle tante eccellenze talvolta nascoste del tessuto imprenditoriale italiano - afferma Fabrizio Baroni, Founding & Managing Partner di B4 Investimenti SGR - L’elevata componente taylor-made, l’al-

ta qualità garantita, un team straordinario di manager/imprenditori e la capacità di innovazione tipici del “made in Italy”, fanno sì che Lazzerini sia identificata, in Italia e specialmente all’estero, come un punto di riferimento nel mercato dei sedili passeggero per mezzi di trasporto. Una delle principali sfide di questo progetto riguarderà proprio il consolidamento della presenza del Gruppo Lazzerini all’estero, attraverso lo sviluppo delle partecipate negli Stati Uniti e in Australia e la penetrazione di nuovi mercati geografici.” Innocenzo Carbone, Amministratore delegato e azionista di Lazzerini, sottolinea dal suo canto: “Siamo entusiasti di continuare il nostro percorso in Lazzerini insieme a B4, che siamo sicuri rappresenterà un compagno di viaggio fondamentale per proseguire il percorso di crescita della Società e del Gruppo oltre a una ulteriore (stimolante) sfida per il management team dopo l’esperienza con

Grammer e il periodo di gestione successivo al management buy-out. La chiave della nostra futura crescita in Italia e, soprattutto, all’estero sarà quella di continuare a creare soluzioni innovative e garantire ai nostri clienti la massima qualità dei materiali e delle finiture e un servizio pre e post vendita che deve continuare a rappresentare un elemento di distinzione e di successo per il nostro Gruppo.” Per B4 Investimenti SGR l’operazione è stata condotta da Fabrizio Baroni (Managing Partner), Beniamino Viscogliosi (Principal), Luca Amedeo Masobello (Investment Manager) e Adalberto Di Clemente (Associate). Su gli aspetti legali B4 Investimenti SGR è stata supportata dagli avvocati Andrea Mazziotti di Celso, Ruggero Gambarota e Antonella Barbato di Gianni Origoni Grippo Cappelli & Partners, mentre le diligence sono state condotte con l’assistenza, rispettivamente, del team financial due diligence di PwC (Federico Mussi Partner, Bianca Varcasia, Director e Luca Petroni, Manager) per gli aspetti contabili e finanziari, del team tax di PwC (Nicola Broggi,Partner, Flavia Barone, Director, Fabrizio Tenuta, Senior Manager), per gli aspetti fiscali e giuslavoristici e dagli studi esteri Valla & Partners e Thomson Geer, per gli aspetti legali, rispettivamente negli Stati Uniti ed in Australia. Lo Studio Gusmitta ha assistito la strutturazione fiscale e societaria dell’operazione. Lazzerini e i suoi azionisti sono stati assistiti da K Finance (Antonio Scarabosio, Partner, Massimo Banfi, Director e Andrea Mon talboddi, Analyst) in qualità advisor finanziario, dagli avvocati Alessandro Marena, Andrea Faoro e A li ce Fazzioli di Pedersoli Studio Legale per i temi legali e da Guido Cesarini di Sistema per gli aspetti contabili e fiscali.

FNM-STADLER / A Expo Ferroviaria presentato il Mock-up Flirt diesel-elettrico

Il nuovo treno sarà in servizio in Lombardia

Ecologici, tecnologici e sostenibili”. Anche i treni stanno vivendo il loro periodo di grande evoluzione e trasformazione. L’edizione 2019 di Expo Ferroviaria ce lo testimonia. FNM e Stadler hanno presentato Mock-up Flirt, un nuovo treno a trazione dieselelettrico. Modello che è destinato alle tratte ferroviarie locali della Lombardia. Il progetto è andato in porto al termine di una lunga trattativa conclusasi con la sottoscrizione e firma di un accordo quadro che ha sancito la fornitura di una cinquantina di treni. In parallelo, è stato siglato un altro tipo di accordo in base al quale Stadler fornirà a Ferrovienord, società controllata al 100 per cento da FNM, una trentina di

convogli dello stesso modello. Il Mock-up Flirt Diesel-elettrico è a tre carrozze, lungo 66,8 metri. Al suo interno dispone di 168 posti a sedere: calcolando anche i posti in piedi, in totale sono 328 circa. L’illuminazione è a Led, disponibili il wi-fi, un sistema digitale che trasmette informazioni sul viaggio e la tratta che si sta percorrendo, le prese da 220 volt, le porte USB dotate di un sistema di spie luminose, in accensione tutte le volte che si aprono e chiudono. I portatori di handicap o con capacità motorie molto limitate godono di un’accessibilità più a portata di mano grazie ai gradini scorrevoli che collegano facilmente le porte di ingresso con la piattaforma.

Mock-up Flirt viaggia grazie a un PowerPack dove sono posizionati due motori diesel di ultima gamma ossia livello V con catalizzatore SCR. Accanto al motore sono installate quattro batterie. L’intera motorizzazione si trova al centro del convoglio, in un punto tale che i passeggeri non sentono alcun tipo di rumore, potendo così viaggiare all’insegna della tranquillità e del massimo comfort. Durante il tragitto, le emissioni di CO2 sono notevolmente ridotte: si calcola una riduzione, in un an no, attorno alle 12.400 tonnellate. Anche il consumo di carburante è molto contenuto e, rispetto ai vecchi modelli, la riduzione dei consumi è stimata attorno al 30 per cento.

Il “debutto sulle scene” del Mock-up Flirt rinnova molto, soprattutto sotto l’aspetto del design, la flotta dei treni locali chiamati, ogni giorno, a trasportare lungo tutta la Lombardia centinaia di migliaia di persone, tra residenti e pendolari. Il Presidente di FNM, Andrea Gibelli, in occasione della presentazione del convoglio a Expo Ferroviaria, ha detto: “Proseguiamo nell’azione di rinnovamento della flotta dei treni, possibile grazie ai finanziamenti e alle indicazioni della Regione Lombardia. L’obiettivo resta sempre quello di garantire un servizio migliore alle oltre 800mila persone che, quotidianamente, utilizzano il servizio ferroviario regionale”.

Maurizio Oberti, Direttore Sales e Marketing Italia presso Stadler, ha aggiunto: “Siamo orgogliosi di poter supportare FNM nel continuo sviluppo e ammodernamento della flotta con veicoli innovativi. La presentazione

del Mock-up sottolinea la proficua e piacevole collaborazione con FNM. Siamo lieti che i futuri passeggeri abbiano l’opportunità di scoprire il treno per la prima volta sotto forma di modello dimostrativo”.


mr senior evolution:

Per i tuoi veicoli sca ania c con più di 5 anni: assistenza a costi t fissi, pa acchetti componibili, va vanta aggi crescenti.

“DICONO O CHE IL TEMP PO DIA IL GIUSTO VA ALORE ALL LE COSE. GR RA AZIE A SCA AN NIA LO DICO ANCH’ ANCH’IO A ’IO” mr senior, il servizio di manutenzione e riparazione riserv vato ai veicoli con più di 5 anni, oggi diventa evolution con l’ag ggiunta di cinque nuovi pacchetti riparazione a cos sti fissi, diversamente combinabili. o Per preservare l’efficienza e il vallore dei tuoi veicoli nel tempo e .

SCANIA. PER L’UNICA A IMPRESA CHE C CONTA A. LA TUA.

www.sca ania.it


IDLE I M ONDO T R A S P O RT I Mensile di Politica, Economia, Cultura e Tecnica del Trasporto FONDATO E DIRETTO DA PAOLO ALTIERI

VEICOLI COMMERCIALI

Collaborazione di successo per un parco veicoli sempre moderni

SIFÀ PARTNER D’ECCEZIONE DI FIORENTINI IL PLAYER GLOBALE NEL SETTORE DEL GAS NATURALE SI AFFIDA ALLA SOCIETÀ DI NOLEGGIO DI BPER BANCA E METTE SU STRADA FURGONI DI DIVERSE DIMENSIONI ALLESTITI SU MISURA DALLA CONCESSIONARIA MILANESE MOCAUTO PER LE ESIGENZE DELLA PIETRO FIORENTINI E PER RISPONDERE ALLE SEVERE NORMATIVE SULLA SICUREZZA CHE REGOLANO L'ATTIVITÀ DELLA MULTINAZIONALE LEADER NELLA FILIERA DELLA DISTRIBUZIONE DEL GAS. Massimiliano Campanella da pagina XVIII

GEMA / A fianco degli esperti di Rentokil Initial

GRUPPO CARRARO / Intervista al Responsabile Mercedes-Benz Vans Diego Ragogna

C

I

SCELTA VINCENTE PER GLI ALLESTIMENTI INTERNI PARTE DA TREVISO L’AVANZATA DELLA STELLA he si tratti di occuparsi d’igiene personale e ambientale o di risolvere, prevenire e controllare i problemi d’infestazione, Rentokil Initial - a seguito dell’acquisizione di CWS-boco Italia leader di mercato - ha bisogno di una flotta di veicoli professionali pronti a soddisfare un carico che si differenzia di volta in volta. Nell’ottica della massima modularità ed efficienza del parco, sceglie il noleggio piuttosto che la proprietà; e quando si tratta di allestire i veicoli, richiede partner come la fiorentina GEMA che sappiano disegnarli sulla base delle sue esigenze.

numeri parlano chiaro. A Treviso MercedesBenz Vans ha chiuso il 2018 con una quota di mercato del 9,4 per cento; in media, nell’area di competenza del Gruppo Carraro, il marchio dei van con la Stella supera l’8 per cento di market share, rispetto alla media del 5,5. Timoniere dell’offensiva nel segmento dei veicoli commerciali della Concessionaria trevigiana è Diego Ragogna, che si racconta in un’intervista esclusiva. Sua anche l’intuizione di distribuire in Italia il prodotto CMS Auto.

Servizio a pagina XXII

Servizio a pagina X

Renault / Su strada con Trafic e Master

FIAT PROFESSIONAL / Le novità MY2020

FORD / L'ennesima sfida del Transit

PSA / Proposte per il turismo en plein air

Quarta generazione promossa a pieni voti

Più efficienza e funzionalità nell’evoluzione del Talento

Innovazione e tecnologia per il van dei record

Peugeot e Citroën seducono gli amanti del campering

N° 284 Novembre 2019

Basilico da pagina II

Servizio a pagina IV

Cristina Altieri a pagina VI

Servizio da pagina XIV

MERCEDES-BENZ / Sempre più allestimenti

Lo Sprinter dei professionisti richiede pronte soluzioni

Pagina I

Galimberti a pagina VIII


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

RENAULT / TEST DRIVE SULLE ROTTE BRIANZOLE

È il momento dei furgoni TRAFIC E MASTER ARRIVANO ALLA QUARTA GENERAZIONE DOPO AVER VENDUTO OLTRE

4,4 MILIONI DI VEICOLI NEL MONDO, DI CUI 2,4 MILIONI DI UNITÀ MASTER E 2 MILIONI DI TRAFIC. IMPORTANTI LE INNOVAZIONI PROPOSTE NEL DESIGN, NELLE MOTORIZZAZIONI, PIÙ POTENTI DI SEMPRE, NELLA DOTAZIONE DI BORDO. IN

ITALIA, IL PRODUTTORE FRANCESE È IL SECONDO IMPORTATORE E IL GRUPPO

RENAULT (RENAULT E DACIA) ALLA FINE DI AGOSTO HA REGISTRATO LA QUOTA DI MERCATO PIÙ ALTA DI SEMPRE, 12,2 PER CENTO.

D

FABIO BASILICO

ANZANO DEL PARCO

al 1980 a oggi di progressi ne hanno fatti tanti. La quarta generazione dei Renault Trafic e Master raccoglie un’importante eredità e nel contempo segna un decisivo spunto evolutivo nella storia del medio e dell’ammiraglia van della Losanga. Siamo andati a conoscere da vicino i nuovi Trafic e Master approfittando di un interessante test drive per le strade brianzole che da Milano ci ha portato fino ad Anzano del Parco, in provincia di Como, nel quartier generale di Living Divani, eccellenza brianzola del design e dell’arredo conosciuta e

Pagina II

apprezzata in tutto il mondo. La scelta di questa speciale location è presto spiegata: innovazione e tailor-made, caratteri tipici della piccola e media impresa italiana che ne hanno decretato il successo nel mondo, si ritrovano su Trafic e Master, top seller a vocazione mondiale nel campo dei veicoli commerciali. Trafic e Master arrivano alla quarta generazione dopo aver venduto oltre 4,4 milioni di veicoli nel mondo, di cui 2,4 milioni di unità di Master e 2 milioni di Trafic. Risultati rilevanti che testimoniano la consolidata esperienza della Losanga nel settore e ne qualificano il ruolo di leader europeo dei van leggeri che ricopre da 20 anni e che oggi si

avvale anche del primato nel particolare settore dei van elettrici. In Italia, il produttore francese è il secondo importatore e il Gruppo Renault (Renault e Dacia) alla fine di agosto ha registrato la quota di mercato più alta di sempre, 12,2 per cento. EVOLUTI ANCHE NEL DESIGN

Nuovo Trafic e nuovo Master presentano importanti innovazioni nel design, nelle motorizzazioni, più potenti di sempre, nella dotazione di bordo. La prima tratta ci vede al volante di un Master furgone. Dal punto di vista del design il large van

Foto di gruppo della nuova gamma Renault Trafic, proposto anche nell’elegante versione SpaceClass particolarmente adatta al trasporto passeggeri.

francese, e con lui il fratellino medio Trafic, si avvicina ancora di più al concetto di stile automobilistico. Ridisegnato com pletamente il look esterno con la firma luminosa C-Shape, la nuova calandra e il frontale, Master è bello da vedere e da ammirare. Anche all’interno l’abitacolo si presenta completamente rinnovato e con una definita impronta vettura. La nuova plancia più automobilistica e pratica (con nuovo ripiano Easy Life e nuova strumentazione) ingloba il sistema di navigazione integrato Media Nav, compatibile con Android Auto e Apple Car Play. È disponibile anche il sistema R-Link. Ancora più ottimizzata la zona di carico, con nuova illuminazione interna a Led e soglia di carico rivisitata, per facilitare le operazioni di carico e scarico. Su strada, Master è generoso in manovrabilità e dinamismo. Merito del motore 2.3 dCi che ora diventa al 100 per cento Twin Turbo, con potenze che vanno da 130 a 180 cv (la più potente di sempre) e coppia fino a 400 Nm. L’innovazione tecnologica offre numerosi sistemi avanzati di assistenza alla guida (ADAS): troviamo il Rear View Assist per la visione posteriore dal veicolo anche in marcia - unico sul segmento - e il Side Wind Assist per il

N° 284 Novembre 2019


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI A BORDO DEI NUOVI TRAFIC E MASTER

dall’anima automobilistica La gamma comprende il motore 1.6 dCi 95 con trasmissione manuale a 6 marce e le unità 2 litri dCi da 145 e 170 cv, entrambe con la possibilità di abbinamento al cambio manuale o all’EDC6. Anche il nuovo Trafic risponde in pieno al concetto di veicolo su misura per il cliente, proponendo 2 lunghezze (4.999 e 5.399 mm), 2 altezze e oltre 100 versioni disponibili nella gamma Italia. Il listino parte da 24.330 euro (Iva esclusa) nella versione 1.6 ICE dCi 95 S&S. Alla versione ICE, già completa alla base con il climatizzatore manuale, la radio, il cruise control e il computer di bordo, si affianca la versione ICE Plus, che presenta i fari fendinebbia, il Media Nav, la parking camera con i sensori di parcheggio e il Wide View Mirror per una visione completa dell’angolo morto a destra del conducente). La gamma ICE Plus permette quindi di offrire ai clienti più esigenti un veicolo completo e funzionale, mantenendo invariata la possibilità di personalizzazione in base alle proprie esigenze. PRO+ AL SERVIZIO DEI PROFESSIONISTI

e si rivolge in particolare ai clienti professionali che necessitano di uno shuttle Vip, di un veicolo per i trasferimenti alberghieri dei clienti o di un autentico ufficio mobile. MOLTEPLICI CONFIGURAZIONI

controllo del mezzo in caso di vento laterale, i sensori di parcheggio anteriori e posteriori, l’Active Emergency Bra king System e il Blind Spot Warning. Disponibile con la trazione anteriore e posteriore, 4 lunghezze (5.075, 5.575, 6.225 e 6.875 mm) e 3 altezze, Master può essere non solo furgone ma anche pianale o telaio cabinato, allestibile e personalizzabile in base alle esigenze del cliente. Non è un caso che con oltre 400 versioni disponibili a listino per la gamma Italia, Master è un vero furgone “su misura”. Ed è proposto anche nella versione 100 per cento elettrica che va a completare la gamma dei veicoli elettrici più ricca del mercato comprendente al momento Zoe Van, Kangoo ZE e Twizy Cargo. Le motorizzazioni 2.3 dCi sono proposte in abbinamento con il cambio manuale a 6 rapporti nelle configurazioni 130, 135, 145, 150, 165 e 180 cv. Nuovo Master è proposto a partire da 25.900 euro (Iva esclusa) nella versione 2.3 ICE dCi 135 S&S. La versione ICE Plus costa 1.500 euro in più. Al ritorno montiamo sul Trafic SpaceClass, elegante versione per il trasporto persone, in configurazione 8 spaziosi e comodi sedili in pelle. Trafic SpaceClass ritorna in gamma

N° 284 Novembre 2019

Trafic SpaceClass offre la possibilità di oltre 50 configurazioni interne dei posti, che da 2 possono arrivare fino a 9. Il veicolo esclusivo è proposto a partire da 42.000 euro (Iva compresa) nella versione 2.0 dCi 145 cv. In generale, nuovo Trafic presenta un rinnovato design esterno e nuovi motori 2.0. Nuova è la griglia e la calandra tra i fari, che

presentano la caratteristica firma luminosa C-Shape. L’interno è spazioso, confortevole e funzionale, anche grazie al sistema di navigazione Media Nav. Anche in questo caso, Renault mette a disposizione degli utenti l’avanzato sistema R-Link. I nuovi motori 2.0 sono i più potenti di sempre, arrivando fino a 170 cv di potenza e con una coppia dal valore massima di 380 Nm. Un’importante novità è rappresentata dal cambio automatico a 6 marce EDC, ottimale nell’uso cittadino ed extraurbano. Fluido e reattivo, l’EDC mette a frutto la tecnologia della doppia frizione regalando un’andatura altamente confortevole e prestazioni all’altezza delle richieste.

Naturalmente, i nuovi Trafic e Master sono al centro dell’attenzione del network Renault Pro+, il marchio specialista degli operatori professionali che si occupano della vendita e assistenza dei van all’interno della rete Renault. Si tratta di una rete di 661 centri in 39 paesi (che rappresentano circa il 25 per cento dei punti di vendita generali Renault) e che nella sola Italia arrivano attualmente a quota 37 su un totale di 85 dealer della Losanga. Va poi considerata la rete di quasi 400 allestitori autorizzati, in 30 paesi (ce ne sono 24 in Italia), che si occupano di allestire i veicoli in funzione delle esigenze specifiche degli operatori professionali, un centro di ingegneria, dedicato ai veicoli commerciali, con sede a Villiers-Saint-Frédéric, in Francia e siti di produzione van in tre continenti: Europa (3 in Francia), America Latina (Argentina e Brasile) e Africa (Marocco).

Il Renault Master rinnovato con una più forte personalità e per soddisfare ancora meglio quanti lo utilizzano per motivi di lavoro.

Pagina III


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

FIAT PROFESSIONAL / TALENTO MY 2020 RINNOVA MOTORI, INTERNI E CONNETTIVITÀ

Le novità di un veicolo eclettico IL MODEL YEAR 2020 DEL VAN FIAT PROFESSIONAL SI PRESENTA SUL MERCATO CON UNA SERIE DI NOVITÀ CHE NE AUMENTANO LE DOTI IN TERMINI DI CAPACITÀ DI CARICO, COMPATTEZZA E AGILITÀ.

NEL DETTAGLIO,

VENGONO RINNOVATI MOTORI, INTERNI E CONNETTIVITÀ.

I NUOVI 2 LITRI, OMOLOGATI EURO6D-TEMP, MOTORI DA

AFFIANCANO LE NOVITÀ ALL’INTERNO DELL’ABITACOLO, TRA CUI IL SISTEMA DI INFOTAINMENT

TOUCH-RADIO NAV DA 7” CHE INCLUDE L’INTEGRAZIONE DI APPLE

CARPLAY E LA COMPATIBILITÀ CON

ANDROID AUTO TRAMITE APP DEDICATA.

T

FABIO BASILICO TORINO

alento di nome e di fat to. Il Model Year 2020 del van Fiat Professional si presenta sul mercato con una serie di novità che ne aumentano le doti in termini di capacità di carico, compattezza e agilità. Nel dettaglio, vengono rinnovati motori, interni e connettività. I nuovi motori da 2 litri, omologati Euro6d-Temp, affiancano le novità all’interno dell’abitacolo, tra cui il sistema di infotainment TouchRadio Nav da 7” che include l’integrazione di Apple CarPlay e la compatibilità con Android Auto tramite app dedicata. Vengono confermate ovviamente le qualità del modello che ne fanno il compagno ideale dei professionisti nei loro percorsi urbani ed extraurbani, quali le generose capacità di carico, la grande versatilità e l’abilità di adattarsi alle diverse esigenze dei clienti. Di certo le novità del MY 2020 contribuiranno a rafforzare il successo del Talento che nei primi sei mesi dell’anno ha segnato una crescita dei volumi di vendita del 13 per cento rispetto allo stesso periodo del 2018.

Pagina IV

Grande novità è il debutto del nuovo motore EcoJet da 2 litri che rispetta la normativa Euro6d-Temp e si caratterizza per una riduzione dei consumi fino all’11 per cento, pur offrendo potenza e coppia migliorate rispetto al 1.6 precedente. Disponi-

Pratico e funzionale, il Talento MY2020 si presenta con numerose innovazioni.

bile in tre diverse potenze (120 cv e 320 Nm di coppia massima, 145 cv e 350 Nm e 170 cv e 380 Nm) con coppia massima già disponibile a 1.500 giri, il propulsore è dotato di turbocompressore a geometria variabile che garantisce una guida più fluida e un propulsore più elastico fin dalle basse velocità, con conseguente riduzione dei consumi nel reale ciclo di utilizzo. Infatti, grazie al controllo elettronico, il nuovo turbocompressore è in grado di adattare la sua fluidodinamica alla velocità del motore e allo stile di guida, per garantire in ogni momento la giusta sovralimentazione. Inoltre, il propulsore adotta la tecnologia SCR (Selective Catalytic Reduction), il sistema che abbatte le emissioni di ossidi di azoto, iniettando una soluzione di AdBlue nei gas di scarico. Infine, completa la gamma di mo torizzazioni del Talento MY 2020 il compatto 1.6 EcoJet Turbo da 95 cv con S&S e 260 Nm di coppia massima, anch’esso con turbo a geometria variabile e tecnologia SCR. All’interno, Talento MY 2020 garantisce il massimo comfort e un’ot-

tima ergonomia, grazie a tessuti robusti e sedili ben profilati, che assicurano una seduta confortevole a tutti i passeggeri, e la posizione ottimale del volante e dei comandi che rendono più rilassante e sicura la guida di tutti i giorni. In particolare, i nuovi interni Black sono stati rinnovati per creare un ambiente elegante e funzionale che bene si sposa con i numerosi vani portaoggetti presenti - la capienza totale dei vani è di 90 litri - e il pratico e intelligente “Ufficio Mobile”. Quest’ultimo include un innovativo sedile centrale reclinabile, dotato di tavolino a scomparsa, schienale apribile con vano portaoggetti e tablette porta documenti. Disponibile in tutti i tipi di carrozzeria - furgone a tetto basso e alto, trasporto persone, doppia cabina e pianalato - Talento MY 2020 offre 2 lunghezze, 2 altezze e 2 diversi passi. Combinando questi elementi, il rinnovato modello di Fiat Professional soddisfa tutte le esigenze per il trasporto leggero, da 5,2 a 8,6 metri cubi, peso lordo del veicolo compreso tra 2,80 e 3,05 tonnella-

te e carico utile che può raggiungere i 1.266 chilogrammi. In dettaglio, l’apertura della paratia “CargoPlus”, posta sotto i sedili passeggeri, permette ai professionisti di trasportare oggetti lunghi fino a 3,75 metri (4,15 m per l’allestimento a passo lungo). La straordinaria accessibilità è garantita anche dalla soglia di soli 552 mm e dalla larghezza della porta scorrevole di 1.030 mm (a 100 mm dal pavimento). Il volume di carico è pari a 5,2 mc nell’allestimento a passo corto, a 6 mc in quello a passo lungo e addirittura a 8,6 mc nell’allestimento a passo lungo e tetto alto; ciò significa che il Talento MY 2020, anche nell’allestimento a passo corto, è in grado di trasportare 3 Euro pallet. Con il nuovo Talento MY2020 è ora disponibile il nuovo dispositivo di infotainment Touch-Radio Nav da 7” che include l’integrazione di Apple CarPlay e la compatibilità con Android Auto. Dotato di ingresso USB e sintonizzatore Radio DAB, il sistema offre anche funzione di navigazione e tecnologia Bluetooth per uso del telefono in vivavoce. Inoltre, Apple CarPlay fornisce indicazioni stradali ottimizzate a seconda delle condizioni del traffico e può essere usato per eseguire e ricevere chiamate, inviare e ricevere messaggi e ascoltare Apple Music, audiolibri e podcast restando sempre concentrati sulla strada. CarPlay è anche dotato di controllo vocale Siri ed è progettato appositamente per l’utilizzo alla guida. Il sistema è compatibile inoltre con Android Auto, che consente di non uscire dall’ecosistema Android nemmeno mentre si è al volante, “proiettando” applicazioni e servizi sul display centrale, ed è progettato per rendere il recupero di informazioni alla guida un esercizio facile e sicuro. Il conducente può utilizzare Google Maps o Waze per ottenere indicazioni stradali e inoltre accedere con facilità a musica, contenuti multimediali e alle principali app di messaggistica.

N° 284 Novembre 2019


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI FORD TRANSIT / TANTE LE NOVITÀ CHE DEBUTTANO NEL NUOVO ANNO

Ennesima sfida per restare campione TECNICI E PROGETTISTI HANNO LAVORATO TANTO SUL DESIGN E SUL CORREDO TECNOLOGICO, QUANTO SULL’EFFICIENZA, CON L’INTRODUZIONE DI PROPULSORI DIESEL OTTIMIZZATI E SOPRATTUTTO DI UNA VARIANTE

MILD

HYBRID. È DUNQUE LA GAMMA MOTORI LA PROTAGONISTA ASSOLUTA DI QUESTA NUOVA EDIZIONE DEL COMMERCIALE AMERICANO, LEADER DI VENDITE IN

U

CRISTINA ALTIERI STOCCOLMA

na ventata di novità investe il Transit da due tonnellate che si prepara all’appuntamento con le sfide del nuovo anno intervenendo tanto sul design e sul corredo tecnologico, quanto sull’efficienza, con l’introduzione di propulsori diesel ottimizzati e soprattutto di una variante Mild Hybrid. È dunque la gamma motori la protagonista assoluta di questa nuova edizione del commerciale americano, leader di vendite in Europa e negli Stati Uniti. Innanzitutto il nuovo 2.0 EcoBlue a gasolio, che migliora del 7 per cento l’efficienza grazie a un sistema d’iniezione potenziato e ad altri accorgimenti utili a realizzare il massimo risparmio: dal servosterzo elettrico alla riduzione della tara, dall’uso di pneumatici a bassa resistenza al rotolamento ad altre migliorie aerodinamiche. Tut to lavora per

comprimere all’osso i consumi e ridurre i costi di gestione di chi con un Transit ci lavora. Lo Start&Stop è standard su tutta la gamma, mentre la tecnologia EcoGuide suggerisce quando rallentare o cambiare marcia in base al traffico. La scelta è tra quattro livelli di potenza: 105, 130, 170 e 185 CV. Il cambio rimane per il momento l’automatico a sei marce, ma dalla prossima primavera sui modelli a trazione posteriore debutterà il 10 rapporti con Adaptive Shift Scheduling, il sistema che valuta lo stile di guida per ottimizzare i tempi di cambiata. Diesel migliorati dunque, ma la novità assoluta parla di elettrificazione. Come annunciato a inizio anno ogni nuovo veicolo Ford d’ora in avanti avrà una versione a batterie. Dalla Fiesta al Transit, tutti i modelli della gamma offriranno una soluzione tra Mild Hybrid, Hybrid, Plug-In Hybrid o Electric. E così se il Transit da una tonnellata accoglie una va-

riante Plug-In Hybrid, il due tonnellate per il momento si propone anche in declinazione Mild Hybrid. In attesa del Full Electric che debutterà nel 2021. Disponibile tanto per i modelli a trazione anteriore quanto per quelli a trazione posteriore, il Mild Hybrid assicura un migliora-

mento dei consumi di circa il 3 per cento rispetto al diesel, che arriva fino all’8 per cento nelle percorrenze urbane. Come funziona: uno starter/generator sostituisce l’alternatore standard, consentendo il recupero e lo stoccaggio di energia durante le decelerazioni, e la ricarica di un

EUROPA E NEGLI STATI UNITI.

pacco batteria agli ioni-litio da 48 volt. L’energia viene poi riutilizzata per fornire assistenza al motore, oltre che per far funzionare gli accessori elettrici del veicolo. Interventi importanti dunque sul fronte delle propulsioni che non esauriscono però le novità di questo Transit. A parte un leggero ritocco estetico, anche le altre modifiche sono di sostanza. È stata aumentata la portata utile, grazie a un attento programma di riduzione del peso, e sono ora disponibili il modem integrato FordPass Connect e la nuova app FordPass Proserve, che facilitano il lavoro del singolo e soprattutto la gestione di una flotta. E non manca un innesto corposo sul fronte dei dispositivi di assistenza alla guida e degli equipaggiamenti votati a rendere le manovre meno stressanti. Il listino del nuovo Ford Transit parte de 28.000 euro, con il primo ibrido proposto a 3.000 euro in più.

Transit e Tourneo Custom Plug-In Hybrid

UN ALTRO PRIMATO FORD CON I VEICOLI DA LAVORO F ord è il primo brand a fornire la tecnologia ibrida Plug-In nel segmento dei commerciali da 1 tonnellata, e lo fa introducendo il Transit Custom Plug-In Hybrid, in ar-

Pagina VI

rivo verso la fine dell’anno. Il furgone ha un’autonomia in elettrico di 56 km, quelli che si immaginano ottimali per l’impiego cittadino. Ma nessuna paura di rimanere a sec-

co. Se è l’elettrico da 92.9 kW a muovere sempre l’asse anteriore, finché il pacco batterie agli ioni di litio da 13.6 kWh è carico sarà possibile procedere a zero emissioni perché quest’ultimo fornirà energia all’unità propulsiva. Ma nel momento in cui la carica dovesse esaurirsi allora entra in gioco il benzina 1.0 EcoBoost che, fungendo da range extender, aumenta l’autonomia totale fino a 500 chilometri. Tutto questo senza che vengano compromesse le caratteristiche di carico del veicolo: grazie al posizionamento delle batterie sotto al pianale, la portata utile netta resta di 1.130 kg, mentre il volume di carico rimane di 6 mc.

L’alternanza tra i due motori è gestita dal conducente che ha la possibilità di scegliere tra quattro modalità di guida. In EV Auto è il sistema a decidere quale propulsione utilizzare. EV Now dà priorità all’uso dell’energia immagazzinata nelle batterie, disattivando il termico. EV Later antepone il funzionamento dell’EcoBoost e utilizza al massimo l’energia rigenerativa proveniente dalle frenate per mantenere il livello di carica esistente delle batterie. EV Charge utilizza l’EcoBoost per riportare al massimo la carica delle batterie per quando sarà richiesto un successivo utilizzo in modalità zero emissioni. Anche

il grado della ricarica rigenerativa può essere modificato dal conducente tramite le modalità Drive o Low sulla trasmissione. Completano il quadro di un veicolo molto completo il modulo Geofencing che abilita in automatico l’alimentazione completamente elettrica quando si ac-

cede a zone a emissioni zero o a traffico limitato e l’Epower Pack che permette di collegare apparecchi ad alta potenza alla batteria del veicolo. Il sistema Plug-In Hybrid, oltre che sul Transit, sarà disponibile anche sul people mover a otto posti, il Tourneo Custom.

N° 284 Novembre 2019


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

MERCEDES-BENZ VANS / NUOVO MODELLO DI PARTNERSHIP CON GLI ALLESTITORI

Quando il bodybuilder è di casa A LUDWIGSFELDE, NELLO STABILIMENTO CHE DAL

2006 DÀ VITA A MERCEDESBENZ SPRINTER, LA STELLA ILLUSTRA LA NUOVA STRATEGIA FINALIZZATA A SVILUPPARE, SIN DAL TELAIO, IL VEICOLO SCELTO DAL CLIENTE FINALE.

SONO

CIRCA 300 LE AZIENDE EUROPEE (UNA DECINA QUELLE ITALIANE) CERTIFICATE VAN

PARTNER.

IN ALTERNATIVA A DISPOSIZIONE DEL PROFESSIONISTA UN VENTAGLIO DI VAN

S

MATTEO GALIMBERTI LUDWIGSFELDE

SOLUTIONS GARANTITE E REALIZZATE IN FABBRICA.

ul piazzale esterno, il sito produttivo di Lud wigs felde, a pochi chilometri dall’aeroporto di Berlino Schönefeld, è circondato da nuovissimi Mercedes-Benz Sprinter allestiti in diverse tipologie: c’è il furgone trasformato in street food che propone frullati di frutta, c’è il cassone con la gru, ci sono due differenti varianti di camper van e almeno tre unità a trazione integrale che dimostrano l’estrema versatilità del leggero della Stella, pronto com’è a salire e scendere senza problemi dalle bisarche così come a fungere da base per un carrello elevatore per missioni che sfiorano il cielo. È la cornice con cui Mercedes-Benz Vans dà il via a Clever Bodybuilder Solutions 2019, manifestazione con cui la Casa di Stoccarda illustra la nuova strategia finalizzata a dare al professionista il veicolo che questi desidera per svolgere la sua attività. Del resto, con le sue infinite varianti disponibili - tra colore, carrozzeria, lunghezza/altezza e trazioni - la generazione Sprinter lanciata nel marzo 2018 tra le mission ha quella, strategica, di proporsi come veicolo

che “calza” perfettamente sulle esigenze del cliente finale. Una grossa mano verso quest’obiettivo arriva dalla fabbrica di Ludwigsfelde, nel Brandeburgo, sulle cui linee il furgone grande della Stella nasce sin dal 2006, sulla base di un’expertise dello stabilimento tedesco che si è cimentato

anche nella produzione di camion e autobus. “Ogni giorno - afferma Sebastian Streuff, Head of MercedesBenz Ludwigsfelde - entrano in questo sito oltre cento camion di oltre 750 fornitori, per produrre ogni giorno circa 200 unità di Mercedes Sprinter, con 54 varianti di design e praticamente ogni tipo di colore esi-

Sprinter sempre più proiettato a soddisfare le esigenze dei clienti.

stente: alla fine del processo, non esisterà mai uno Sprinter uguale all’altro”. Ludwigsfelde dà lavoro a circa duemila dipendenti. Un tour della fabbrica consente di assistere alla nascita di uno Sprinter telaio base praticamente dalle primissime componenti. È su queste piattaforme di veicolo che nascerà il compagno di viaggio del professionista finale. Perché è su di esso che sarà realizzato l’allestimento richiesto per la sua attività. La novità del 2019 è nell’adozione di un nuovo modello organizzativo, che consentirà al cliente finale di decidere come “costruirsi” il veicolo su misura. “Il mercato delle consegne di generi alimentari freschi ad esempio - spiega Peter Strobach, Bodybuilder Solutions - offre grandi potenziali di redditività a livello internazionale. Il trasporto delle merci sensibili alle temperature, tuttavia, esige un utilizzo e un raffreddamento ottimali del vano di carico, perché tali prodotti richiedono, ad esempio, differenti temperature di conservazione. Il veicolo, inoltre, deve poter essere integrato nella catena logistica nel modo più efficiente possibile”. Lo stesso accade anche in altri settori. “In virtù del rapido incremento delle vendite on-line - prose-

gue Strobach - servizi quali la consegna pacchetti mediante corriere espresso registrano crescite esponenziali degli ordini, a fronte di una contemporanea riduzione dei ricavi medi per singola consegna. Nuovi concept di mobilità e la crescente pressione dei costi stanno cambiando il trasporto passeggeri. Con l’esigenza di una maggiore sostenibilità e flessibilità cresce di pari passo anche l’importanza delle soluzioni di connettività. I clienti del settore edile, al contrario, hanno bisogno, oggi come in passato, delle qualità tipiche del trasporto: affidabilità, robustezza, sicurezza”. Per rispondere a tutte queste differenti esigenze e richieste, Mercedes-Benz Vans si affida a una stretta collaborazione con i maggiori e più affermati allestitori: circa 300 Van Partner europei, certificati Mercedes-Benz, che realizzano il veicolo adatto alle specifiche esigenze. Tra questi le italiane Scattolini (fornitore in primo equipaggiamento), Cold Car, Elevox, Focaccia Group, Car Fibreglass, Sperotto e Novaplast. In alternativa, nelle Concessionarie Mercedes-Benz Vans il professionista troverà un’offerta di Van Solutions, garantite e realizzate in fabbrica, fornite a listino.

Nove differenti settori tra i quali quello strategico del trasporto refrigerato

VEICOLI FRIGO COMPLETAMENTE ELETTRICI PER LA CONSEGNA DI ALIMENTARI A Ludwigsfelde MercedesBenz Vans, insieme ad alcuni allestitori partner, ha presentato allestimenti speciali per i veicoli commerciali con la Stella. La gamma spazia dal veicolo con cassone ribaltabile in alluminio fino al minibus per ospiti di una cerimonia nuziale e abbraccia nove differenti settori: Commercio ed eGrocery, Assistenza e prestazioni di servizi, Trasporto passeggeri, Mobilità limitata, Autocaravan, Corriere espresso, consegna pacchetti e logistica, Edilizia, Veicoli operativi e per servizi comunali e Altri settori. Sullo sfondo delle attuali

Pagina VIII

sfide che i diversi settori devono affrontare, si affermano come temi determinanti digitalizzazione, elettrificazione e sostenibilità. Un esempio in tal senso è il veicolo destinato al settore eGrocery: ricorrendo a un approccio customer-co-creation, MercedesBenz Vans ha sviluppato, insieme all’allestitore Kerstner, l’Arctic Fox, veicolo eGrocery per l’ambiente urbano basato su Vito elettrico. Disponendo di un sistema di propulsione e di un impianto di raffreddamento completamente elettrici, questo veicolo consente di effettuare le consegne di generi alimentari a zero emissioni locali. Una

novità è rappresentata dall’integrazione dell’impianto di raffreddamento nella rete di bordo del veicolo e ciò ha consentito di ridurre al minimo l’esigenza di batterie supplementari. Arctic Fox ha già dimostrato la sua adattabilità all’impiego quotidiano nell’ambito di un progetto pilota con la società di servizi eGrocery belga HelloFresh. Altro esempio il veicolo, su base Sprinter, pronto a operare per Carlsen Baltic nel trasporto alimentare a temperatura controllata: equipaggiato con gruppo frigo Carrier Pulsor, prevede anch’esso la refrigerazione al cento per cento elettrica.

N° 284 Novembre 2019


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

GRUPPO CARRARO / INTERVISTA A DIEGO RAGOGNA, RESPONSABILE MERCEDES-BENZ VANS

L’escalation dei van tuttofare DALLE DOLOMITI ALL’ADRIATICO FINO AL CONFINE SLOVENO, LA STELLA NELL’AREA DEL GRUPPO CARRARO HA UNA QUOTA DI MERCATO CHE SUPERA L’8 PER CENTO, ARRIVA AL 9 A TREVISO ED È DESTINATA QUEST’ANNO A RAFFORZARSI.

DAL 2017 LA

STRATEGIA NEI VEICOLI COMMERCIALI È AFFIDATA A

DIEGO RAGOGNA, MANAGER ESPERTO E CON UNA GRANDE PASSIONE PER I VEICOLI DA LAVORO, CHE HA LANCIATO UN’OFFENSIVA AD AMPIO RAGGIO DAL SETTORE DEL

D

MAX CAMPANELLA

NERVESA DELLA BATTAGLIA

CAFFÈ AI VINI AL TRASPORTO PERSONE.

al settore del caffè, con la candidatura dell’espresso italiano a patrimonio Unesco, ai minibus di linea, dallo scuolabus al mondo del turismo (complice la venticinquesima edizione dei Giochi olimpici invernali a Cortina d’Ampezzo), l’offensiva del Gruppo Carraro nel settore dei veicoli commerciali leggeri è sempre più protesa ad affermare il marchio della Stella con le sue caratteristiche di versatilità, in grado di soddisfare le più disparate esigenze professionali tenendo sempre il focus sugli aspetti di alta tecnologia, massima qualità di prodotto e servizio e livello eccellente che contraddistinguono Mercedes-Benz Vans. Il manager che dal 2017 si occupa, all’interno del Gruppo Carraro, della divisione Vans della Casa di Stoccarda è Diego Ragogna, classe 1963, friulano, entrato nel 2015 nella Concessionaria con headquarter a Nervesa della Battaglia, a nord di Treviso, fondata da Francesco Carraro e oggi guidata dai figli Giovanni e Ruggero. La carriera di Ragogna nell’automotive inizia da giovane ventunenne: dopo la Ragioneria incrocia Vol-

kswagen che sta selezionando venditori e lui, appassionato di turismo e delle lingue, sostiene il colloquio in inglese, elemento che gli fa aggiudicare l’incarico. A 24 anni entra in Germacar, dealer Mercedes del Friuli, ed è l’inizio di una passione per la Casa di Stoccarda che gli resterà sempre, anche quando incrocia l’americana R.L. Polk, per cui effettua la prima esperienza europea da consulente, tra Gran Bretagna e Olanda, o quando decide di costituire un’a-

Diego Ragogna di Gruppo Carraro.

genzia che organizza viaggi d’avventura nel Nord Africa, viaggi che, naturalmente, avevano tra i protagonisti Unimog, veicolo in grado di sostenere le traversate di Libia e Tunisia. Nel 2007 Ragogna torna in Germacar, stavolta per occuparsi di veicoli professionali, truck e van usati, vivendo la prima esperienza di web marketing. A quel punto il manager ha una conoscenza profonda del mondo del dealer, già conosce i fratelli Carraro e, a seguito della riorganizzazione post Germacar, accetta la nuova sfida presso la Concessionaria trevigiana. Sfida che non parte per caso, ma poggia su una piattaforma comune con i Carraro. “A fine 2013 - ricorda Diego Ragogna - sono andato alla scoperta di potenziali allestitori europei con i quali potesse svilupparsi una partnership nei minibus. Credevo nell’opportunità che, su base Sprinter, potesse nascere un nuovo brand di minibus ad ampia capacità di posti a sedere, per soddisfare l’esigenza del mercato di veicoli robusti, di qualità, sviluppati sulla base di precise richieste dell’operatore: per le sue caratteristiche territoriali il nostro Paese non può basarsi sugli standard”. Quell’intuizione di Ragogna viene sposata pienamente dai Carraro,

la cui azienda ha storicamente un forte focus sui veicoli professionali. Nel 2015, al suo arrivo a Treviso, Ragogna porta avanti il suo progetto, occupandosi anche di marketing per l’intero settore dei veicoli commerciali e industriali. Nel 2017 il management del Gruppo Carraro gli assegna l’incarico di seguire completamente la linea di business dei Van e oggi Diego Ragogna guida un team di sette venditori che si dedicano esclusivamente ai veicoli commerciali. “Nella sede di Nervesa e nelle filiali di Treviso, Belluno, Mestre, Castelfranco Veneto e Santa Maria di Sala - illustra il Responsabile Mercedes-Benz Vans del Gruppo Carraro - abbiamo un nostro venditore dedicato e officine specializzate per il mondo del veicolo commerciale. Un’organizzazione che nel 2017 è stata premiata da MercedesBenz con la certificazione Van Pro, che ha validato i nostri processi di vendita e assistenza, dall’esposizione dei veicoli alla preparazione dei venditori al servizio di reception. Non da ultimo, a Mestre siamo la prima Concessionaria in Italia a utilizzare il layout MAR2020, che dal prossimo anno sarà standard globale”. Decisamente eterogenea la clientela Van di Mercedes nell’area di

competenza di Carraro, che va dalle Dolomiti all’Adriatico fino al confine sloveno: varietà molto legata alle diverse vocazioni territoriali. “A nord di Treviso - spiega Ragogna c’è una forte presenza di aziende legate al vino, a ovest prevale l’edilizia, a Venezia naturalmente il turismo con un’importante domanda di veicoli per NCC. L’ammiraglia in assoluto resta Sprinter, in tutte le diverse articolazioni, versioni e allestimenti, ma ha successo un po’ tutta la gamma, dal Citan al Vito, dalla Classe V e anche Classe X che si sta ritagliando una sua nicchia. Diamo a tutti i clienti la possibilità di effettuare test drive, li seguiamo nel post vendita e a richiesta è possibile anche il noleggio a breve termine con Carraro Rent”. La “strategia-Ragogna” nei Van funziona: la Stella nell’area del dealer ha chiuso il 2018 con una quota di mercato dell’8,2 per cento rispetto alla media nazionale che si attesta sul 5,5, con un picco a Treviso, città che assegna a Mercedes-Benz Vans uno share del 9,4 per cento. “L’obiettivo - afferma Ragogna - è consolidare e migliorare questi dati: l’anno scorso abbiamo sottoscritto 480 contratti rispetto ai 387 dell’anno prima, quest’anno supereremo quota 500 contratti”.

Tra le unicità del dealer trevigiano l’offerta di veicoli allestiti su base Mercedes-Benz Sprinter

DISTRIBUTORE DI CMS AUTO, PROPONE MINIBUS PERSONALIZZATI N ell’ambito della strategia di affermazione del Grup po Carraro nei veicoli commerciali leggeri, cenno a par te merita la partnership con CMS Auto, produttore di allestimenti con sede nei pressi di Varsavia, dove sono pre senti sito produttivo e Centro Ricerca & Sviluppo. Allestitore certificato Mercedes-Benz con una capacità pro duttiva di 400 unità an nue, CMS Auto viene distribuito in Italia con la Concessionaria Carraro, che da questa collaborazione fa nascere minibus turistici e scuolabus su base Sprinter. “La nostra proposta di veicoli - spiega Diego Ragogna - arriva fino

Pagina X

a 22 posti più accompagnatore e autista. Si parte dal furgone allungato di 7,3 metri e 50 q a pieno carico per arrivare al minibus. Siamo distributori di CMS da due anni e abbiamo consegnato finora oltre 40 unità, tutte diverse l’una dall’altra, fatta eccezione per la gara di TPL di Busitalia che ci siamo aggiudicati e prevede la consegna di 90 veicoli in tre anni”. La “chiave di differenza” del minibus CMS Auto sta nella personalizzazione e nel vantaggio, per l’operatore, di avere un unico interlocutore: Carraro. “Il cliente - spiega Ragogna - non è costretto ad acquistare il mezzo e poi re-

carsi dall’allestitore: dalla scelta del tipo di veicolo all’allestimento ai ricambi, Carraro rappresenta il suo unico riferimento, nella vendita e nel post vendita”. Due i veicoli esposti sul piaz zale di Nervesa della Bat taglia: una delle unità TPL in consegna a Busitalia, da 19 posti più autista e due carrozzelle, e il primo scuolabus ordinato da Carraro per la pronta consegna. “In questo caso - precisa Ragogna si arriva fino a 32 posti, per soddisfare le esigenze di materne, elementari e medie. Nel ventaglio di prodotti abbiamo poi i turistici per il lungo raggio fino a 19 posti”.

N° 284 Novembre 2019


FIAT FULLBACK

*1XPHURVRJJHWWRDWDULIID]LRQHVSHFL¿FD

,OSLFNXSGHOODÃ&#x20AC;RWWD$PLFR%OX

AmicoBluGLYHUVL¿FDHGDPSOLDXOWHULRUPHQWHODÃ&#x20AC;RWWDGHLYHLFROLFRPPHUFLDOLFRQ)LDW)XOOEDFN LOSLFNXSGHOODGLYLVLRQH3URIHVVLRQDOGHOPDUFKLRLWDOLDQR0DVVLPDIXQ]LRQDOLWjFKHVLXQLVFHDG XQDOLQHDVSRUWLYDSHUODYHUVLRQHFDELQDGRSSLDDWUD]LRQHLQWHJUDOHSHUWUDVSRUWLDQFKHVXIXRUL VWUDGDLPSHJQDWLYL 1ROHJJLDLOQXRYRSLFNXS3HUprivati liberi professionisti ed aziende

amicoblu.it - 199 151 198*


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI MERCEDES-BENS VANS / IN PRIMO PIANO LE NOVITA DELLA GAMMA MARCO POLO

Viaggiatore per vocazione TANTE LE NOVITÀ PRESENTI NELL’AREA ESPOSITIVA DELLA CASA DI STOCCARDA, A COMINCIARE DAL CAMPER COMPATTO MARCO POLO CHE CONSENTE DI VIAGGIARE NEL TIPICO COMFORT DI UNA BERLINA MERCEDES, AL VOLANTE DI UNA CASA SU QUATTRO RUOTE. TRA I PROTAGONISTI DEL SALONE PARMENSE ANCHE LO SPRINTER CHE CON SUA LA VERSIONE TRACTOR HEAD VA INCONTRO A OGNI ESIGENZA DEGLI ALLESTITORI.

A

FABIO BASILICO PARMA

llo stand Mercedes-Benz Vans allestito al la Fiera di Parma in occasione dell’annuale edizione del popolarissimo Salone del Camper si respirava aria di vacanze e di trasmetteva autentica voglia di avventura. Protagonista d’eccezione dell’esposizione della Stella a uno dei principali appuntamenti internazionali del turismo en plein air il Marco Polo, camper compatto della Stella, proposto in anteprima anche in versione Horizon, che apre nuovi orizzonti nel segmento dei veicoli per il tempo libero e consente di viaggiare nel tipico comfort di una berlina Mercedes, al volante di una casa su quattro ruote. Tra i protagonisti del Salone anche lo Sprinter che con sua la versione Tractor Head va incontro a ogni esigenza degli allestitori. La famiglia Marco Polo, basata sulla Mercedes-Benz Classe V, beneficia appieno di tutte le novità relative al primo restyling realizzato per la monovolume di Stoccarda. Gli autocaravan e i veicoli per il tempo libero di dimensioni compatte Marco Polo e Marco Polo Horizon si presentano infatti con un frontale ridisegnato, una nuova gamma di ver-

nici e cerchi in lega leggera, nuove bocchette d’aerazione e nuovi rivestimenti degli interni. A questi si aggiungono il nuovo motore diesel OM 654 con nuova potenza massima di 176 kW/239 cv e coppia massima di 500 Nm con 30 Nm aggiuntivi di overtorque, il Brake Assist attivo, il sistema di assistenza abbaglianti Plus e il cambio automatico 9G-Tronic. L’offerta Marco Polo è declinata in tre: Marco Polo, Marco Polo Horizon e Marco Polo Activity. Funzionalità e stile sono le carte vincenti del Marco Polo, veicolo polifunzionale i dea le per gli amanti delle vacanze all’aria aperta ma adattissimo anche a un normale utilizzo quotidiano in città come elegante automobile multispazio. Una caratteristica, quest’ultima, che lo distingue chiaramente dai classici camper. Il compatto camper della Stella offre un blocco cucina con due fuochi, lavello, box frigorifero e tre cassetti, scomparti e armadi, un guardaroba, un divano-letto nel vano posteriore, sedili anteriori girevoli, un tavolino ribaltabile e scorrevole e un letto sollevabile alloggiato sotto il tetto per un totale di quattro posti letto. Il design degli interni, caratterizzato da un elegante contrasto di zone chiare e scure, il rivestimento del pianale di serie in look “yacht

deck” e una suggestiva illuminazione a Led dell’abitacolo, con luci soffuse interne “ambient” a richiesta, creano un ambiente esclusivo, facendo dell’abitacolo e del posto di guida un’unità armonica. Per stare comodamente all’aria aperta, Marco Polo è dotato a richiesta anche di sedie da campeggio e tavolino, riposti in una pratica borsa nel vano bagagli e di un tendalino parasole amovibile posto sopra la porta scorrevole che assicura sufficiente ombra durante le piacevoli soste in mezzo alla natura. Nomen omen, si chiama Horizon l’ultimo membro della famiglia. Questa versione è la

scelta ideale di chi cerca un mezzo adatto per il contesto urbano, dove si muove con agilità ed elegante grazie alle dimensioni compatte e al look ricercato, ma che sappia anche essere versatile per i weekend all’insegna del relax o dell’avventura. Dalla versione cinque posti a sedere, passando per la versione con quattro sedili singoli Comfort nel vano posteriore, alla versione a sette posti con una panca a tre posti trasformabile in letto nella seconda fila e due sedili singoli supplementari nella prima fila del vano posteriore, Marco Polo Horizon può essere adattato a seconda delle esigenze, facendosi apprez-

All’interno del Marco Polo tante soluzioni per il miglior comfort.

zare per la cura dei dettagli e i materiali pregiati. Al Salone del Camper, i vertici di Mercedes-Benz Vans Italia hanno messo in risalto il network in crescita delle concessionarie oggi a quota 12 - che fanno parte del cosiddetto Marco Polo Expert Program, una rete di esperti sul mondo del camper compatto della Stella. Spazio anche all’ammiraglia di Casa Mercedes-Benz Vans, il nuovo Sprinter, che già conosciamo per la sua estrema versatilità, in primis grazie alla possibilità di avere tutti i tipi di trazione, anteriore, posteriore o integrale. Il risultato è che si adatta alla perfezione alle singole esigenze di trasporto e alle tipologie d’impiego. La trazione anteriore di nuovo sviluppo viene combinata a scelta con il cambio manuale a 6 marce, anch’esso di nuova concezione, o con il nuovo cambio automatico a 9 rapporti con convertitore di coppia. Con la trazione posteriore, i vantaggi classici dati dalla separazione di trazione e sterzo si traducono in un comfort di marcia ottimale, un diametro di volta inferiore e un comportamento su strada più agile. La trazione posteriore regala maggiore controllo anche nei viaggi con rimorchio e con peso totale massimo ammesso al limite. La trazione integrale inseribile migliora la trazione in particolare in caso di condizioni atmosferiche o stradali difficili, aumentando così la sicurezza e la dinamica di marcia. Si può scegliere anche la demoltiplicazione in caso di utilizzo in contesti impegnativi. Anche per lo Sprinter a trazione integrale è per la prima volta disponibile a richiesta il cambio automatico 7G-Tronic Plus, che regala un maggiore comfort di innesto e riduce i consumi. E proprio come risposta alla maggiore richiesta di veicoli idonei ai viaggi privati, Mercedes-Benz Vans propone anche la variante Testata motrice, riservata esclusivamente agli allestitori. Anche questa versione, in combinazione con la trazione anteriore, offre una grande liberà di configurazione nell’ideazione e nell’utilizzo degli allestimenti. La variante della testa del trattore è pronta per la guida: il gruppo propulsore, il serbatoio e tutti gli altri componenti principali si trovano di fronte al cosiddetto montante B, cioè nell’area della cabina anteriore. In questo modo Mercedes-Benz Vans offre agli allestitori nel settore dei camper ancora più spazio per progettare la zona giorno.

Andrea Verdolotti, Responsabile Marketing di Mercedes-Benz Vans Italia

A

“MARCO POLO È IL VEICOLO RICREZIONALE PER ECCELLENZA”

d Andrea Verdolotti, Responsabile Marketing di Mercedes-Benz Vans Italia, abbiamo chiesto di tracciare un quadro della strategia della Stella nel competitivo settore dei camper. “Marco Polo è senza dubbio il nostro veicolo ricreazionale per eccellenza, con una proposta veramente completa - ha esordito Verdolotti - Si va dalla versione con blocco cucina, frigorifero, divano-letto e quant’altro alla Horizon con presenza di letto ma senza la cucina e alla versione

Pagina XII

Activity che rappresenta l’entry level dell’intera gamma”. “Al Salone del Camper - ha detto ancora Andrea Verdolotti - abbiamo presentato due novità di rilievo come il restyling interno ed esterno dello stesso Marco Polo e il nuovo motore OM 654 da 239 cv disponibile sia in abbinamento alla trazione anteriore che a quella posteriore. La trazione anteriore su Activity parte da 102 cv e arriva fino a 136 cv, a questo punto entra in gioco il nuovo OM 654 con potenze che vanno da

163 a 239 cv, il tutto passando per la configurazione 190 cv. Sulla trazione posteriore si aggiunge la possibilità di avere la trazione integrale 4Matic che è disponibile pure su Activity che in più offre anche la trazione anteriore. In sintesi: Activity rappresenta il massimo della versatilità in modalità più spartana, il Marco Polo e Marco Polo Horizon maggior lusso e versatilità grazie alle trazioni posteriore e integrale. Quello che proponiamo è un veicolo per utilizzo camper

che non è un camper in senso tradizionale ma che offre tutta la versatilità che occorre per muoversi liberamente anche in città come a bordo di un auto. In fiera abbiamo constatato come sia sempre più forte la richiesta di un veicolo doppio uso. L’allestitore di riferimento di Marco Polo è Westfalia, con cui collaboriamo da anni”. Anche Sprinter ha forti potenzialità da esprimere: “la configurazione Tractor Head è specifica per gli allestitori del settore camper - ha commentato

Verdolotti - Lo dimostra l’accordo che è stato avviato lo scorso con il produttore Hymer”. Nel mercato italiano dei camper, Mercedes-Benz vuole tornare a essere protagonista. “Eravamo molto presenti con lo Sprinter non della precedente generazione ma di quella ancora prima - ha spiegato Verdolotti - Vogliamo rientrare e diventare ancora protagonisti in un mercato di riferimento, soprattutto per quanto riguarda la produzione, in tutta Europa. Un mercato nel quale ve-

diamo si sta sviluppando il settore dei furgonati che vengono allestiti e personalizzati diventando dei camper in grado di soddisfare molteplici esigenze. Quello dei van per il settore camper rappresenta oggi il 15-20 per cento del mercato totale e il dato è crescita”.

N° 284 Novembre 2019


16:30


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

PEUGEOT / TRE IDEE VINCENTI PER GLI AMANTI DEL TURISMO EN PLEIN AIR

Divertirsi con l’outdoor G

RINNOVANDO LA SUA ATTENZIONE AL MONDO DEL CAMPER E DEL TEMPO LIBERO, IL LEONE HA PRESENTATO A PARMA 3 INTERESSANTI SOLUZIONI VOTATE AL TEMPO LIBERO: IL BRAVIA SWAN 599 TREND REALIZZATO PARTENDO DA UN BOXER BLUEHDI 165 S&S, L’EXPERT KLUBBER BLUEHDI 180 S&S EAT8 E IL CONCEPT RIFTER 4X4 BY DANGEL DOTATO DI TENDA OVERLAND E MOUNTAIN-BIKE ELETTRICA PEUGEOT EM02 FS POWERTUBE.

FABIO BASILICO PARMA

ruppo numero uno in Europa nei veicoli com merciali, secondo in Italia con una quota di mercato del 19,6 per cento e il +10,3 per cento di volumi da gennaio ad agosto in confronto con lo stesso periodo del 2018, Groupe PSA è un leader che ha molto da dire anche nello specifico settore dei camper, dove si qualifica come secondo costruttore in Europa con 14.800 veicoli venduti e una quota salita dal 14,1 per cento del 2018 all’attuale 16,5 per cento. Al Salone del Camper Peugeot e Citroën hanno presentato una serie di novità in grado di definire ancora più compiutamente il ruolo dei francesi nel mondo del turismo en plein air. Nello specifico, Peugeot era presente con 3 diverse soluzioni per il tempo libero: il Bravia Swan 599 Trend realizzato partendo da un Boxer BlueHDi 165 S&S, l’Expert Klubber BlueHDi 180 S&S EAT8 e il concept Rifter 4x4 by Dangel dotato di tenda Overland e mountain-bike elettrica Peugeot eM02 FS Powertube. Il veicolo più grande dello stand del Leone era il Bravia Swan 599 Trend realizzato in col-

Pagina XIV

laborazione con Bravia Mobil partendo da un Boxer L3H2 con la nuova motorizzazione BlueHDi 165 S&S. Si tratta di un mezzo pensato per esaltare lo spirito outdoor garantendo però un elevato livello di comfort all’interno e una elevata versatilità dell’abitacolo. Lungo poco meno di 6 metri, è disponibile anche nella versione Swan 636, lunga 36,5 cm in più e basato sulla versione L4H2 di Boxer. Alto 2 metri e 59 e in grado di garantire un’altezza interna di 1 metro e 89, il Bravia 599 può accogliere comodamente al suo interno quattro persone. Al suo interno trova posto una cucina con soggiorno, la zona letto, la doccia con servizi igienici e spazio adeguato per equipaggiamento sportivo e attrezzature da campeggio. Bravia 599 annovera la presenza di serie di Cruise Control, Intelligent Traction Control, fari fendinebbia e fari diurni a Led nonché volante rivestito in pelle. Il prezzo al pubblico parte da 47.500 euro. Expert allestito da Klubber è un veicolo molto interessante che ha come base di partenza il commerciale Peugeot di maggior successo nella configurazione di lunghezza intermedia, vale a dire quella da 4,96 metri. Dotato di tenda a soffietto sulla parte supe-

riore rappresenta la soluzione ideale per chi vuole utilizzare un veicolo dalle dimensioni contenute ma beneficiando di una elevata versatilità interna. Nell’abitacolo trova posto un frigorifero da 39 litri, un serbatoio per l’acqua bianca da 45 litri e da 25 litri per le acque nere e un sistema di riscaldamento (opzionale) da 2.000 W. Tre le configurazioni dell’abitacolo: Road, in grado di ospitare fino a sette passeggeri; Camping, dove gli occupanti possono essere cinque; Night per quattro persone.

Il prezzo al pubblico parte da 49.033 euro. Rifter 4x4 Concept by Dangel è il prototipo svelato qualche mese fa e realizzato in collaborazione con lo storico partner del Leone che ha realizzato il sistema di trazione integrale. La versione di serie sarà sul mercato nei prossimi mesi. Dotato della motorizzazione diesel BlueHDi 130 S&S del Rifter di serie, il concept è dotato di una tenda Overland installata sul tetto - messa a punto insieme all’esperto Autohome - ed è

pensato per l’avventura su tutti i tipi di percorsi: oltre alla trazione integrale, adotta pneumatici specifici e altezza dal suolo opportunamente rialzata di ben 80 millimetri. In definitiva, le proposte della Casa francese rispondono a tutte le ultime tendenze del mondo campering, venendo incontro anche alle richieste più specifiche di coloro che amano avventurarsi in luoghi ameni e trascorrere il loro tempo libero in compagnia della loro voglia di avventura.

Joel Gorin, Responsabile Business

“Italia strategica nei piani

A

testimoniare l’importanza del Salone del Camper di Parma da Parigi è arrivato allo stand allestito da PSA Italia Joel Gorin, Responsabile Business Unit Camper di Groupe PSA. “L’evoluzione del mercato è più che positiva per Groupe PSA - ha esordito Gorin - Con i prodotti all’avanguardia offerti dai marchi Peugeot e Citroën siamo in grado di soddisfare tutte le esigenze dei clien-

ti del settore camper. In futuro ovviamente ci sarà spazio anche per lo sviluppo nel settore del brand Opel; ci sono ottime prospettive di integrazione nella gamma proposta da PSA, in particolare per quanto riguarda il Movano. Il tutto in linea con i buoni risultati che stanno ottenendo i van del marchio”. Il mercato camping car è in crescita in tutto il continente (+4 per cento nel primo semestre 2019 ri-

spetto al 2018) e da parte del pubblico vi è una sempre maggiore attenzione per il rispetto dell’ambiente e la versatilità dei prodotti allo scopo di aver maggiore libertà di movimento. Il Salone del Camper di Parma si inserisce quindi in un momento di mercato favorevole anche nel nostro Paese. “L’Italia ha un ruolo strategico all’interno dei piani di crescita di Groupe PSA - ha aggiunto Joel

N° 284 Novembre 2019


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

CITROËN / CREATIVITÀ E COMFORT NELLE PROPOSTE DEL DOUBLE CHEVRON

Libertà è movimento N

IL DOUBLE CHEVRON HA PRESENTATO TRE SOLUZIONI PER VIVERE L’OUTDOOR IN MANIERA ORIGINALE E CONFORTEVOLE: SPACETOURER THE CITROËNIST CONCEPT, CHE RAPPRESENTA IL DINAMISMO DEL BRAND, ESTESO ANCHE NEL SEGMENTO DEI CAMPING CAR, E I CAMPER ADRIA MATRIX AXESS 670 SC E P.L.A. SIENA 397, ENTRAMBI REALIZZATI SULLA COLLAUDATA BASE DI CITROËN JUMPER.

FABIO BASILICO PARMA

otoriamente caratterizzata da un forte spirito creativo, Citroën non ha mancato di sottolineare i suoi valori di riferimento anche al Salone del Camper 2019. Il Double Chevron ha presentato tre soluzioni per vivere l’outdoor in maniera originale e confortevole: SpaceTourer The Citroënist Concept, Adria Matrix Axess 670 SC e P.L.A. Siena 397, entrambi su base Citroën Jumper. SpaceTourer

The Citroënist Concept è fedele a 100 anni di storia di una Marca popolare, che da sempre si pone l’obiettivo di rendere accessibile a tutti la mobilità e l’evasione. Rappresenta il dinamismo Citroën, esteso anche nel segmento dei camping car. Il nome è un omaggio ai fan della marca francese, dalla quale eredita tutto il DNA: una silhouette grafica e di carattere, una promessa di mobilità nel totale comfort. Su base SpaceTourer, questo concept di camping car inedito propone un allestimento interno

specifico sviluppato con Pössl, primo costruttore europeo di furgoni allestiti come camping car. Permette a due persone di dormire a bordo, di caricare due bici e dispone di mobile ad uso ufficio, connesso. Compatto all’esterno (lunghezza di 4,95 m, larghezza di 1,92 m e altezza di 1,99 m), SpaceTourer The Citroënist Concept è molto maneggevole ed è il mezzo ideale nella vita di tutti i giorni e nel tempo libero. Robusto e pratico, SpaceTourer The Citroënist Concept può contare

Unit Camper Groupe PSA

di crescita di Groupe PSA” Gorin - L’Italia è il terzo Paese per numero di vendite nel settore camper, dopo Germania e Gran Bretagna. In un mercato nazionale che ha segnato un calo del 2 per cento, PSA è stabile nell’andamento 2019”. Joel Gorin ha anche rimarcato il fatto che il lavoro di PSA nel campo delle soluzioni ibride ed elettriche interessa anche lo sviluppo della gamma dei veicoli commerciali e dei camper a loro collegati.

N° 284 Novembre 2019

sull’altezza dal suolo rialzata e sulla trasmissione integrale, disinseribile, realizzata dal partner Automobiles Dangel. La motorizzazione BlueHDi 150 S&S offre potenza e versatilità. La trasformazione Campster by Pössl, con tetto rialzabile, integra una grande zanzariera in tela traforata e contiene al suo interno una zona per dormire. In configurazione “notte”, in questa zona specifica posta sopra all’abitacolo, possono dormire due persone. Di giorno invece, per ottenere maggiore comodità, il tetto libera spazio in altezza e permette di stare in piedi. Adria Matrix Axess 670 SC è realizzato in collaborazione con AdriaMobil su base Jumper Furgone 36.5 L3 con motore BlueHDi 140 S&S. In aggiunta è disponibile anche il nuovo 2.2 BlueHDi 165 S&S Euro 6.2D-ISC. Omologato per cinque persone, offre 5 posti letto e misura 7,503 metri di lunghezza, 2,299 metri di larghezza e 2,810 metri di altezza esterna. L’allestimento interno offre un ambiente confortevole e spazioso, caratterizzato da sedili guida “captain chair” girevoli completamente e integrati nella dinette, un’ampia zona letto in posizione posteriore e una confortevole zona living arredata con legno di alta qualità e dotata di numerose soluzioni salvaspazio. Il prezzo al pubblico del camper Adria parte da

53.500 euro. Il Salone parmense ha rappresentato anche l’occasione per la presentazione della realizzazione di P.L.A. Camper, che vanta una lunga collaborazione con Citroën e che da quest’anno commercializza i veicoli sul mercato italiano solo con il brand Giottiline. Si tratta del Giottiline Siena 397 sviluppato su base Jumper Autotelaio 35 L3 con motore BlueHDi 140 S&S: si caratterizza per lo sfruttamento ottimale dello spazio abitativo interno, con la zona giorno ben separata dalla zona notte, dinette face to face, letto centrale con bagno e doccia separati. Omologato per quattro persone, offre 5 posti a tavola nella comoda dinette face to face e 4 posti letto. Il prezzo al pubblico parte da 47.800 euro. Citroën ha contribuito fortemente alla crescita del mercato dei camping car registrando nel 2018 un incremento del 71 per cento delle immatricolazioni di quei veicoli della sua gamma ideali per diverse trasformazioni per il tempo libero. In particolare, SpaceTourer e Jumper sono i principali artefici di questa crescita. In Italia, nel mercato dei camping car che ha registrato una leggera flessione nei primi sei mesi del 2019 (-2 per cento rispetto allo stesso semestre 2018) Citroën consolida la terza posizione.

Pagina XV


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

FORD / BASATO SUL TRANSIT CUSTOM È IDEALE PER IL TRASPORTO E IL TEMPO LIBERO

Nugget, camper multifunzionale TRANSIT CUSTOM NUGGET POSSIEDE LA VERSATILITÀ, L’AFFIDABILITÀ E LE TECNOLOGIE INNOVATIVE DEL TRANSIT CUSTOM, VEICOLO DAL CONSOLIDATO SUCCESSO, REINTERPRETATE IN OTTICA CAMPER. IL RISULTATO È UNA SOLUZIONE IDEALE CHI VUOLE VIVERE ESPERIENZE OUTDOOR SENZA RINUNCIARE A COMFORT E SICUREZZA IN PERFETTO STILE AUTOMOBILISTICO. È OFFERTO CON L’EFFICIENTE MOTORIZZAZIONE 2.0 DIESEL ECOBLUE IN DUE DIVERSI LIVELLI DI POTENZA, 130 E 185 CAVALLI, QUEST’ULTIMA ANCHE ABBINATA AL CAMBIO AUTOMATICO.

P

GUIDO PRINA ROMA

rotagonista dell’avanzata dei van trasformati che diventano veicoli multifunzionali in grado di soddisfare molteplici esigenze di mobilità e trasporto, dalla normalità quotidiana al tempo libero, Transit Custom Nugget è il camper che Ford ha realizzato in collaborazione con Westfalia, azienda specializzata per il mondo caravanning. Presentato in anteprima italiana all’ultima edizione del Salone del Camper di Parma, Transit Custom Nugget possiede la versatilità, l’affidabilità e le tecnologie innovative del Transit Custom, veicolo dal consolidato successo, reinterpretate in ottica camper. Il risultato è una soluzione ideale chi vuole vivere espe-

rienze outdoor senza rinunciare a comfort e sicurezza in perfetto stile automobilistico. Il design intelligente degli interni ha permesso di modellare e gestire tutti gli spazi con l’obiettivo di incontrare e soddisfare ogni esigenza di praticità. I sedili anteriori ruotanti e il tavolo a scomparsa creano una piacevole zona giorno per vivere il viaggio con famiglia o amici, mentre la cucina, completamente attrezzata, offre tutto il necessario per dilettarsi ai fornelli anche in movimento. L’area dedicata include un piano cottura a gas a due fuochi, lavello, frigo e tutto lo spazio per la dispensa. L’estrema versatilità del nuovo Transit Custom Nugget permette di cambiare facilmente la configurazione dell’interno per la notte, per ospitare 4 adulti in due comodi letti, uno

matrimoniale ripiegabile nello spazio del tetto e il secondo nella zona giorno. Sul fronte tecnologie, Transit Custom Nugget dispone di una serie di sistemi di assistenza alla guida, per rendere i viaggi più semplici e piacevoli. Tra questi figurano il sistema di monitoraggio dell’angolo cieco, il limitatore di velocità intelligente, che consente di rimanere entro i limiti di velocità, e il sistema di mantenimento della corsia di marcia, che rileva eventuali scostamenti involontari. Disponibile con una motorizzazione 2.0 diesel EcoBlue in due diversi livelli di potenza, 130 e 185 cv, quest’ultima anche abbinata al cambio automatico. Per coloro che desiderano godere di ulteriore spazio, è disponibile la versione Nugget Plus, più lunga di 36,7 centimetri rispetto

a quella standard. Lo spazio extra viene utilizzato per fornire una toilette integrata con WC elettrico, dotato di un pannello a scomparsa per garantire la privacy, un frigorifero da 40 litri di capienza e un armadio più grande. Più in linea con gli standard classici del veicolo camper, Ford ha di recente svelato il prototipo di una versione più grande del Nugget. Si tratta del versatile, spazioso e pratico concept Big Nugget. Realizzato in collaborazione con Westfalia, il concept Big Nugget ha una lunghezza di 6 metri ed è basato sul Ford Transit a passo lungo e tetto alto; offre 13 metri cubi di spazio con oltre 2 metri di altezza all’interno. Big Nugget sfrutta al meglio lo spazio extra, creando quattro aree funzionali ben definite. Nella parte an-

teriore, i sedili del conducente e del passeggero possono essere ruotati per offrire maggiore spazio abitativo e un’ampia e confortevole zona pranzo. Al centro del veicolo si trova un’area bagno separata, con servizi igienici, lavabo e doccia completamente integrati, oltre a un pratico angolo cottura con fornello a gas a due fuochi e un frigorifero da 70 litri. Nel la parte posteriore, la zona notte presenta un letto lungo 2 metri disposto sul veicolo in modo da poter ospitare comodamente due adulti. Lo spazio abitativo può anche essere riconfigurato per ospitare altri due occupanti. L’Ovale Blu sta studiando la prossima introduzione del concept Big Nugget nei mercati europei, da offrire insieme al Transit Custom Nugget già in commercio.

L’interno del Ford Nugget e, a sinistra, il concept Big Nugget.

Marco Buraglio, Direttore Veicoli Commerciali di Ford Italia

“TRANSIT CUSTOM NUGGET SODDISFA ANCHE I PALATI PIÙ ESIGENTI” A bbiamo chiesto a Marco Buraglio, Direttore Veicoli Commerciali di Ford Italia, di illustrarci le caratteristiche vincenti del progetto Transit Custom Nugget. “Al Salone del Camper di Parma abbiamo presentato in anteprima per l’Italia un veicolo che è basato sul Transit Custom e che si differenzia dal prototipo Big Nugget che è invece su base Transit e non è an cora commercializzato esordisce Buraglio - Transit Custom Nugget è disponibile sul mercato in due versioni, il

Pagina XVI

passo corto con tetto a soffietto e il passo lungo con tetto rigido fisso. Il prezzo di base risponde alla consolidata strategia di Ford che cerca di proporre alla clientela un rapporto qualità-prezzo tangibile: promuoveremo il veicolo con un listino veramente interessante, che al lancio promozione fino a fine 2019 prevede prezzi a partire da poco più di 45mila euro”. Molto e stesa la politica di personalizzazione: “Il cliente - conferma Marco Buraglio potrà dotare il veicolo come

vuole. L’allestimento camper è curato dall’azienda specializzata del settotre Westfalia, nostro partner da tempo. L’acquisto e l’assistenza sono gestiti dalla rete Ford anche per ciò che riguarda gli allestimenti personalizzati. Abbiamo previsto corsi di formazione presso Westfalia per i nostri tecnici affinché acquisiscano tutte le conoscenze necessarie per operare in ambito assistenziale nella maggior parte delle operazioni mentre per le operazioni più complesse Westfalia è

eventualmente in grado di far uscire i suoi tecnici”. Mentre Nugget appartiene al segmento dei van trasfor-

mati in camper, con Big Nugget Ford si avvicina più esplicitamente al discorso camper: “non si tratterà però di un telaio specifico per camper ma di una Transit con allestimento camper”, spiega Buraglio. Che aggiunge: “Come Ford Italia contiamo molto su Nugget che ci permette di entrare da protagonisti in un segmento che prevediamo in crescita nei prossimi anni. Stiamo infatti assistendo a un profondo cambiamento nel modo di utilizzo da parte dei clienti, che oggi sempre più

richiedono un veicolo multifunzionale che sia adatto sia al trasporto normale quotidiano che all’impiego nel weekend. È un concetto nuovo rispetto al passato. Le grosse monovolume stanno uscendo di scena lasciando spazio ai veicoli che nascono come commerciali e poi vengono trasformati aprendo nuove opportunità di utilizzo per il medesimo mezzo. Si tratta di van con livelli di comfort, sicurezza e design perfettamente allineati agli standard automobilistici”.

N° 284 Novembre 2019


FRED DDO INTEG GRAT GRA TO O EAS SYFIT IL RISVEGLIO O DELLA FFORZA

Isolamento inttegrato Easyfit su Mercedes Sprinter S furgone e Mercedes-Benz ha molta olta classe con l’ultimo nato degli Sprinter coibentati. ntati. Il suo isolamento integrato si avvale vale della nuova tecnologia gia Easyfit per soddisfare le norme AT ATP in freddo negativo, classe se C, e in freddo positivo, classe A. Questi kit di nuova uova generazione offrono prestazioni so orprendenti, i massimi van ntaggi nell’uso e una sicurezza urezza senza pari per la catena del freddo. ddo. Assicurano un coefficiente ficiente di isolamento perrfettamente controllato e soddisfano i più elevati requisiti internazionali. ernazionali. L’’isolamento integrato Easyfit ottimizza il volume inte erno che resta pallettizzabile abile ed è compatibile con la por ta laterale originale che consente e il carico diretto di pallet da 1200 mm, una caratteristica tteristica completamente nuova!

info@lamberet.it - www.la amberet.it


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI SIFÀ E PIETRO FIORENTINI: UNA COLLABORAZIONE DI SUCCESSO

Valicando le frontiere del gas naturale NEL 2016, IL COLOSSO GLOBALE DEL SETTORE OIL & GAS HA INCROCIATO LA SOCIETÀ DI NOLEGGIO DI

BPER BANCA. UNA PARTNERSHIP OGGI CONSOLIDATA, CHE PORTA SULLE STRADE DIVERSI MEZZI ALLESTITI SU MISURA

PIETRO FIORENTINI E PER

PER LE ESIGENZE DI

RISPONDERE ALLE SEVERE NORMATIVE SULLA SICUREZZA CHE REGOLANO LA SUA ATTIVITÀ.

D

stiti da Mocauto, storica concessionaria di Milano, e tutti noleggiati da SIFÀ (Società Italiana Flotte Aziendali), società di proprietà di BPER Banca.

MAX CAMPANELLA ARCUGNANO

all’estrazione all’utilizzo finale, Pietro Fiorentini è un’azienda leader nel settore Oil & Gas, con una presenza globale tra uffici e siti produttivi. Dalle stazioni per la riduzione della pressione e la misura del gas alla realizzazione di prodotti e servizi tecnologicamente avanzati per la distribuzione e l’utilizzo del gas naturale, l’azienda - con headquarter ad Arcugnano, alle porte di Vicenza - per la sua attività dispone di una flotta di veicoli strutturata, configurata, Paese per Paese, sulla base delle specifiche esigenze e caratteristiche del territorio. In Italia per la componente Service (assistenza, interventi e installazione di contatori) utilizza veicoli commerciali leggeri alle-

DAL BREVETTO DEL FONDATORE

Pietro Fiorentini nasce nel 1938 da un brevetto del suo fondatore, da cui prende il nome, relativo a una valvola di regolazione per l’alimentazione a GPL delle vetture. In oltre ottant’anni di storia ha sviluppato la sua offerta di business lungo tutta la filiera del gas naturale. Dopo aver attraversato un percorso fatto di profondi rinnovamenti ed espansione continua, Pietro Fiorentini è oggi un gruppo internazionale attivo su un ampio ventaglio di prodotti, sistemi e servizi dedicati al settore Oil

Stretta di mano tra Lorenzo Groppo ed Elena Scolari.

& Gas. “Siamo il partner ideale spiega Lorenzo Groppo, TLC & Fleet Manager - per chi opera nel settore del gas naturale, per tutta la filiera di trasporto, distribuzione e utilizzo del gas. La nostra azienda progetta, realizza e commercializza componenti, sistemi e servizi per la regolazione, la misura e il trattamento del gas naturale, per consentirne e incrementarne un utilizzo sicuro da parte di produttori, distributori e utenti in un’ottica di continua evoluzione: dai misuratori di portata multi fase ai regolatori di pres sione, dalle stazioni di riduzione agli impianti di trattamento e odorizzazione, dai servizi di gestione remota degli impianti a un’offerta completa di contatori industriali, residenziali e domestici”. Pietro Fiorentini vanta undici segue

Non ha dubbi Lorenzo Groppo, TLC & Fleet Manager di Pietro Fiorentini

“AFFIDABILITÀ E RAPPORTO PERSONALE I VALORI CHE CI CONVINCONO NELLA SCELTA” G uida appropriata, per sicurezza e consumi, è quanto Pietro Fiorentini chiede ai tecnici, dipendenti e esterni, che tutti i giorni operano in Italia per occuparsi del Service. A loro disposizione l’azienda mette un parco veicoli studiati appositamente per lo svolgimento della loro attività. “La scelta di utilizzare il noleggio con SIFÀ - spiega Lorenzo Groppo - è nata, in principal modo, per avere una società di servizi dinamica e tempestiva nel rispondere alle svariate esigenze in termini di necessità aziendali. Con loro non abbiamo mai avuto problemi per avere l’assenso ad allestire i veicoli in modo specifico e a studiare pro-

Pagina XVIII

getti per migliorare e calibrare meglio le durate e le percorrenze chilometriche da considerare nei contratti di locazione a lungo termine”. Quali sono gli elementi essenziali che un’azienda come Pietro Fiorentini richiede oggi a un operatore di noleggio come SIFÀ? “La loro chiave di differenza - risponde il manager sta innanzitutto nel contatto personale: non c’è un numero verde da chiamare all’occorrenza, tantomeno dobbiamo essere noi a contattare un’officina per manutenzione o diagnostica. Sappiamo che possiamo contare in ogni momento su di loro: sul piano dei servizi siamo a un livello eccellente. Sicu-

ramente oggi si richiede trasparenza, fiducia e puntualità nelle consegne, considerando che la clientela a sua volta è esigente e si aspetta giustamente un servizio premium. Non da ultimo, e questo rappresenta un vantaggio strategico, SIFÀ utilizza la rete ufficiale dei costruttori con pezzi di ricambio originali, a tutto vantaggio della serenità di chi lavora e guida tutti i giorni”. Grazie a questa collaborazione Pietro Fiorentini ha anche potuto sviluppare progetti innovativi atti a migliorare, durante l’utilizzo dei veicoli, la sicurezza attiva. I mezzi sono dotati di uno dei principali dispositivi ADAS disponibili sul mercato, fondamentale nella

prevenzione di sinistri e per educare i vari driver ad avere comportamenti più adeguati quando sono alla guida: SIFÀ non ha avuto alcun problema a dare la sua liberatoria per l’installazione del sistema. I nostri veicoli sono inoltre equipaggiati con un sistema, sviluppato dalla software house Arcoda, che monitora tutta una serie di dati, dalla velocità media ai fermi alla tipologia di servizio che il mezzo sta effettuando: anche in questo caso con il benestare di SIFÀ che, non da ultimo, considerando la nostra attività, permette che i veicoli percorrano strade non geolocalizzate, obbligatorie in molti casi per i nostri tecnici”.

N° 284 Novembre 2019


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI seguito

Valicando le frontiere del gas naturale

stabilimenti di produzione e 26 tra filiali e società controllate, attraverso cui copre oltre cento Paesi, generando all’estero oltre il 70 per cento dei ricavi. L’azienda continua a mantenere il suo cuore in Italia: tra le sedi di Arcugnano, Milano, Napoli, Desenzano, Rosate e Pordenone, del gruppo fanno parte circa 1.400 dipendenti, che salgono a oltre 1.800 a livello mondiale. Nel 2018 il giro d’affari consolidato si è chiuso oltre i 280 milioni di euro (erano 260 milioni nel 2017). DIETRO LE QUINTE

Quella di Pietro Fiorentini è un’attività quasi “dietro le quinte”: se arriva il gas nelle case lo si deve ai suoi operatori, per quanto il tutto avvenga senza che il cittadino comune se ne accorga. In altri casi l’attività è più che evidente; è il caso ad esempio degli odorizzanti, sostanze che - prodotte nello stabilimento di Pordenone - vengono immesse nei gasdotti per la sicurezza del consumatore finale. “Il gas - spiega Groppo - è inodore, non se ne avvertirebbe la presenza: basta una “spruzzata” di odorizzante per sentirlo a distanza di chilometri”. Quanto decisivo sia il sistema di trasporto è facilmente intuibile: gli impianti dell’azienda sono ubicati lontano dai centri abitati, spesso raggiungibili solo attraverso sterrati o strade non geolocalizzate. Per il trasporto servono autocarri in ADR, per l’assistenza furgoni allestiti ad hoc, che rispondano a una severa normativa. “Il settore - aggiunge Lorenzo Groppo è particolarmente normato, con richieste di certificazioni per l’intera filiera, in cui il trasporto è una voce fondamentale: dai cablaggi ai sistemi di ancoraggio all’isolamento delle cabine tutto deve rispondere a precisi criteri di sicurezza, livello che dopo alcuni episodi saliti alla ribalta della crona-

Pagina XX

ca si è ulteriormente innalzato. Da questo punto di vista i nostri veicoli viaggiano assolutamente in rispondenza con le normative, con un’attenzione particolare riservata alla tranquillità del personale”. Nel caso degli autocarri la flotta è costituita da diverse unità che viaggiano in regime di ADR, con il loro carico di bombole; la componente Service si avvale di veicoli commerciali. Pietro Fiorentini ha una consolidata collaborazione con la Concessionaria milanese Mocauto, che a disposizione del

cliente mette tutto il know-how del suo reparto dedicato agli allestimenti. Con Mocauto, l’azienda ha sviluppato tutta una serie di accorgimenti per rendere sicuri i mezzi utilizzati per il trasporto di merci di pericolose e di quelli adibiti al servizio di assistenza e installazione. Per questi ultimi, dopo un’analisi del mercato Lorenzo Groppo alla proprietà ha preferito il noleggio e, nel 2016, ha inizio la partnership con SIFÀ. “L’obiettivo - spiega Groppo - era noleggiare il veicolo allestito sulla

base delle nostre personalizzazioni ed esigenze in termini di certificazioni: un allestimento su misura, deciso nel confronto con i nostri tecnici, con spazi determinati per la garanzia di avere le certificazioni necessarie. Non da ultimo, l’obiettivo era strutturare un parco di veicoli sempre moderni: oggi l’età media è di 36 mesi e non si va oltre i 48, e assicurare la gestione e l’assistenza dei mezzi sulla base delle nostre particolarità di business. Abbiamo a tutti gli effetti sposato il principio della

prevenzione”. Tutte esigenze che la multinazionale ha rivolto a SIFÀ. “Quando l’azienda ci è stata presentata da Mocauto - spiega Elena Scolari, Responsabile Direzione Territoriale Nord Italia di SIFÀ - il primo step è stato analizzare il parco e avviare un confronto con il loro ufficio Service per trovare la giusta soluzione. La chiave di volta è stata il rapporto di trasparenza che si è creato, all’insegna della correttezza da ambo le parti: sappiamo che i veicoli vengono ben gestiti, alla luce dell’accurato controllo da parte dell’azienda sul loro utilizzo; da parte nostra siamo venuti incontro alle loro esigenze puntando a massimizzare l’efficienza del lavoro dei loro tecnici”. OFFICINE SU STRADA

A sinistra Sergio Berardinelli, responsabile Fleet e B2B del Gruppo Mocauto, e Angelo Mazzeo, Coordinatore della filiale di Milano di SIFÀ. A destra Elena Scolari, Responsabile Direzione Territoriale Nord Italia SIFÀ, e Lorenzo Groppo, TLC & Fleet Manager Pietro Fiorentini.

A distanza di due anni la partnership è oggi consolidata. Pietro Fiorentini si avvale della collaborazione di SIFÀ e Mocauto in generale per tutti i tipi di veicoli che vengono utilizzati in ambito a ziendale. “Da parte di SIFÀ - afferma Groppo - c’è una specifica attenzione nella gestione dei veicoli che sono utilizzati nell’ambito dei servizi manutentivi e per quelli che trasportano merci pericolose. Per i veicoli destinati ai servizi manutentivi vengono forniti allestimenti che consentono ai driver di avere la possibilità di utilizzare vere e proprie officine mobili. Per i veicoli destinati al trasporto di merci pericolose e infiammabili, che devono osservare e rispettare le norme ADR, oltre a dotare i veicoli di specifici sistemi sono stati sviluppati tutta una serie di accorgimenti atti a prevenire incidenti di vario genere: sono stati realizzati impianti elettrici, ove previsti, utilizzando cavi e materiali ad altissima sicurezza, completi di tutte le certificazioni richieste per legge e non”.

N° 284 Novembre 2019


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI GEMA / ALLESTIMENTI IN LEGA DI ALLUMINIO PER RENTOKIL INITIAL

Per gli esperti dell’igiene DAI DISPENSER E CONSUMABILI PER L’IGIENE E LA PURIFICAZIONE DELL’ARIA, ALLA DERATTIZZAZIONE E MONITORAGGIO DELLE DISINFESTAZIONI, QUASI

300

TECNICI DI SERVIZIO OPERANO IN TUTTA ITALIA TRASPORTANDO DISPOSITIVI E MATERIALI DI DIVERSE TIPOLOGIE.

AL SERVIZIO

DELLA FILIALE ITALIANA DEL LEADER DI MERCATO IN QUESTI SETTORI, L’AZIENDA TOSCANA METTE IL SUO KNOW-HOW PER LO SVILUPPO E LA RICERCA DI SOLUZIONI ADEGUATE AD UN CLIENTE FINALE DALLE

C

MAX CAMPANELLA

CERNUSCO SUL NAVIGLIO

he si tratti di occuparsi d’igiene personale e ambientale o di risolvere, prevenire e controllare i problemi d’infestazione, Rentokil Initial - a seguito dell’acquisizione di CWS-boco Italia leader di mercato - ha bisogno di una flotta di veicoli professionali pronti a soddisfare un carico che si differenzia di volta in volta. Nell’ottica della massima modularità ed efficienza del parco, sceglie il noleggio piuttosto che la proprietà; e quando si tratta di allestire i veicoli, richiede partner che sappiano disegnarli sulla base delle sue esigenze. La filiale italiana, con headquarter a Cernusco sul Naviglio, alle porte di Milano, sulla sua strada ha incrociato da circa sette anni GEMA, leader negli allestimenti in lega leggera di alluminio, con il quale ha stretto una partnership di lunga durata, che proseguirà nel 2020 quando, seguendo i piani di e spansione del business, Rentokil Initial anche in Italia continuerà a investire sulla flotta e sul personale, per far crescere di pari passo la struttura organizzativa. Con un fatturato globale di 1,7 miliardi di euro, 28mila dipendenti in 68 Paesi e oltre mille filiali, Rentokil Initial ha sede centrale nel Regno Unito. In Italia opera con due divisioni di business: Initial per l’igiene ambientale e personale (installazione, controllo e manutenzione di dispenser, saponi liquidi, salviette, igienizzanti wc, contenitori ecc.); Rentokil per il “pest control”, ovvero derattizzazioni, disinfestazioni da insetti, volatili, protezione derrate alimentari ecc. Nel nostro Paese operano 700 dipendenti, dei quali circa 300 tecnici di servizio per oltre 30mila clienti attraverso agenzie distribuite in modo capillare sul territorio. Una squadra di dieci biologi assiste tecnici e clienti in caso di necessità e su progetti specifici. “Grazie alla tecnologia - spiega Mario Francesco Colombo, da dieci anni Fleet Manager con un importante bagaglio di esperienza da Responsabile Acquisti Indiretti & Facility - il monitoraggio avviene da remoto,

Pagina XXII

ESIGENZE COMPLESSE.

con alert che trasmettono tutto quanto accade ad esempio in relazione a trappole per topi. Un’evoluzione che adotteremo anche per i dispositivi igienici”. A disposizione dei tecnici Rentokil Initial Italia un parco di 350 veicoli commerciali, quasi interamente a marchio Fiat Professional: per il business Initial, Doblò e Ducato con portate fino a 3,5 t; per Rentokil operano esclusivamente Fiat Doblò. In campo anche una flotta di pickup: 35 Mitsubishi L200. “Non solo ogni business ma ogni tipologia di servizio al cliente - precisa Colombo -necessita di un allestimento altret-

tanto specifico: un veicolo può servire per il trasporto di rotoli di carta, di ceste di grosse dimensioni per il cotone, piuttosto che di flaconi, saponi e dispenser o tappeti antipolvere e antiscivolo. La flotta di veicoli a noleggio è completata, in termini di servizio al cliente, da terzisti per la sola consegna del materiale occorrente ai tecnici”. Altrettanto diversificata la clientela, dal supermercato all’aeroporto alle officine e a tutte le aziende che, anche per rispettare normative e protocolli richiesti in ambito d’igiene ambientale, si affidano a un’azienda che garantisce un’esperienza di oltre cent’anni di

presenza sul mercato. Nella scelta del veicolo la mission è dunque trovare il tipo di furgone più appropriato. Per gli allestimenti interni la scelta si è indirizzata sulla toscana GEMA, che fornisce progetto, sviluppo e realizzazione in lega leggera di alluminio estruso. “Sull’intera flotta e per ogni tipologia di veicolo - prosegue il Fleet Manager - l’obiettivo è avere un allestimento che consenta il massimo del trasporto in termini di capacità. L’utilizzo della lega di alluminio mantiene la solidità ma, essendo un materiale più leggero rispetto all’acciaio, ne aumenta la portata. Altro elemento

Da sinistra: Elena Ossanna, Amministratore delegato Rentokil Initial Italia; Alessandro Lulli e Piero Tribolini, rispettivamente Amministratore delegato e Area Manager GEMA; Mario Colombo, Luca Peretti e Marco Zappulli, rispettivamente Fleet Manager, QSHE Manager e General Manager Hygiene Division Rentokil Initial Italia.

indispensabile è la modularità: la scaffalatura GEMA si può modificare facilmente in base alle necessità del momento. Ad esempio per alcuni dei nostri clienti abbiamo necessità di trasportare grandi quantitativi di rotoli in cotone. Grazie a specifici cestoni metallici con ruote possiamo gestire il carico in modo igienico e sicuro”. Altro elemento di differenza è l’aspetto consulenziale. “Con GEMA - aggiunge Colombo - è aperto un confronto per lo studio degli allestimenti ogni volta che abbiamo l’esigenza di gestire una nuova tipologia di servizio e consegna ai nostri clienti per soddisfare le specifiche necessità: vengono realizzati prototipi, il furgone allestito lo vediamo insieme per verificarne la funzionalità e la sicurezza. Non da ultimo, nelle sedi GEMA, compresa quella di Firenze Campi Bisenzio, sono concentrati i lotti dei nostri furgoni ogni volta che è giunto il momento del rinnovo”. La partnership è iniziata nel 2012 e si è consolidata negli anni. “Abbiamo iniziato - precisa Colombo quando si è resa evidente la necessità di allestimenti più leggeri. Nel 2020 abbiamo in programma una forte espansione del business, per possibili acquisizioni, per l’avvio di nuove linee per la cura del verde e per il marketing olfattivo nonché per il trend positivo che registrano entrambe le divisioni. Certamente avremo bisogno di implementare la flotta e di curare il comfort alla guida dei nostri mezzi”. Non da ultimo, Rentokil Initial è un’azienda che opera nel settore ambientale e vuole essere in primo piano sul fronte dell’eco compatibilità. “Oltre a introdurre processi e metodologie, come i propri uffici plastic free, abbiamo in corso lo sviluppo - conclude Mario Colombo di importanti progetti di sperimentazione di veicoli elettrici, che ci consentiranno di svolgere i nostri servizi anche nelle aree a traffico limitato ed abbattere la CO2”. Tema che sta a cuore anche a GEMA, che sta sviluppando allestimenti ad hoc per veicoli commerciali a trazioni alternative, elettrico compreso.

N° 284 Novembre 2019


Profile for Vega Editrice

Il Mondo dei Trasporti - Novembre 2019  

Il Mondo dei Trasporti - Novembre 2019