__MAIN_TEXT__
feature-image

Page 1

FRAIKIN / Noleggio alla base del dinamismo della orobica Tiryan Trasporti PALLETWAYS / “Fare rete” il focus del progetto di capillarità del network Vega Editrice - Monza, Italy - Anno XXXI - N. 301 - Luglio/agosto 2021 - Euro 5,00

IDLE I M ONDO T R A S P O RT I Mensile di Politica, Economia, Cultura e Tecnica del Trasporto - FONDATO

E DIRETTO DA

PAOLO ALTIERI

I NUOVI ORIZZONTI DI GIACOMO MAURELLI

La sfida della Repsol con il partner Maurelli LEADER NEL SETTORE DEL RICAMBIO TRUCK & TRAILER, L’AZIENDA FONDATA DAL NONNO E TRAMANDATA DAL PADRE DELL’ATTUALE NUMERO UNO METTE A SEGNO UNA NUOVA PIETRA MILIARE NELLA SUA STORIA EVOLUTIVA, DIVENTANDO DISTRIBUTORE ESCLUSIVO DI UNO DEI PIÙ AFFERMATI BRAND NEL SETTORE DEI LUBRIFICANTI. DALLA CONSEGNA DEL PRODOTTO ALL’ASSISTENZA TECNICA, CON I SUOI OLTRE 35 PUNTI VENDITA IN ITALIA, IL GRUPPO MAURELLI SI OCCUPERÀ DELL’INTERA FILIERA DISTRIBUTIVA. “L’OBIETTIVO È IL MANTENIMENTO DELLO STATO DI SALUTE DEI VEICOLI DEI CLIENTI”, AFFERMA L’AD. Massimiliano Campanella da pagina 40

Poste Italiane Spa -Spedizione in Abbonamento Postale - D.L. 353/2003 (conv. in L. 27/02/2004 N. 46) Art.1, comma 1, DCB Milano

ROSSI VEICOLI

Con Trans Lilli F-Max in Umbria Basilico a pagina 8

GRUPPO CARRARO

La brillante Stella degli eccezionali Altieri da pagina 18

MAN ESPOSITO / Unico brand nella flotta di Alfieri Group

AUTOVEICOLI ERZELLI / Due veicoli per Vigotransport

S

C

Motore elettrico CON SCANIA FIORISCE IL GREEN LO SCACCO MATTO DI IVECO parte da Monaco eminare efficienza e raccogliere co presente all’interno della nostra on gli Alfieri, c’è chi come la tante indotto. Esposito è il riferimenSinari a pagina 16

RENAULT TRUCKS

Acciaio e Losanga binomio di Transar Basilico a pagina 20

TMT INTERNATIONAL

qualità è il claim della “scanista” Vigotransport di Albenga, in provincia di Savona, che inserisce nel parco due nuovi Serie S forniti dalla Concessionaria Autoveicoli Erzelli di Genova, che collabora con Vigotransport dal 1999. “Abbiamo instaurato un rapporto di fiducia professionale e umano. Grazie alla valida consulenza dello staff della concessionaria abbiamo consolidato la nostra preferenza per il prodotto Scania, oggi l’uni-

RIGOMMA

Svolta ecosostenibile Le due vite di Cusinato

Servizio a pagina 36

Sinari a pagina 38

flotta: siamo molto soddisfatti del prodotto, perfettamente indicato per la nostra strategia di crescita improntata sulla qualità”, afferma Paolo Vigo. Fondata nel 1996, l’azienda ligure, specializzata nella distribuzione di fiori e piante in vaso, ha a cuore la sua immagine perché vuole comunicare in modo chiaro e diretto la qualità dei suoi servizi.

Basilico a pagina 12

Concessionaria Iveco Esposito gioca a scacchi. Facile gioco di parole per l’azienda di Nola capitanata dai fratelli Alfieri. Da tre lustri Enzo Comoletti, venditore di esperienza e grande dinamismo del dealer partenopeo, segue con costanza e attenzione l’evoluzione di Alfieri Group che, nata come azienda individuale per volontà di Carmine Alfieri, oggi conta un parco di 150 mezzi e dà lavoro a 95 persone oltre a un impor-

to per i trattori stradali: tra 2020 e 2021 sono arrivati una decina di SWay, tre dei quali a LNG, confermando Iveco praticamente unico brand della flotta. “Ci siamo dati una struttura manageriale, ma resta sempre valido il principio per cui la stretta di mano e la parola mantengono il loro valore irrinunciabile”, afferma Pietro Alfieri.

KÖGEL TRAILER

ZARA LINE

OFFICINA VARESE

Il portale di D’Agaro

Un cavallo in rosa

Alltrucks dopo il rogo

Servizio a pagina 34

Campanella a pagina 47

Servizio a pagina 42

Campanella da pagina 10

Allegato inserto sul mondo dei veicoli commerciali


Tutto ciò che desideri, Actros Edition 2. Actros Edition 2. Scopri una nuova dimensione di comfort, sicurezza e design con un numero limitato di esemplari. Ulteriori informazioni sono disponibili al sito www.mercedes-benz-trucks.com

Rossi S.r.l. Concessionaria Ufficiale di Vendita e Assistenza Veicoli Industriali Mercedes - Benz CORCIANO (PG) - Via G. Leopardi, 9/A NARNI SCALO (TR) - Via Tuderte, 480 Tel. +39 0744 7568238, e-mail: relazioniclienti@rossispa.it

www.rossispa.it


IL MONDO DEI TRASPORTI

N° 301 / Luglio-Agosto 2021

Pagina 3

ANFIA / IL MANAGER LUCA SRA È DELEGATO PER IL TRASPORTO MERCI

“Sostegno alle aziende del settore” CHIEF OPERATING OFFICER TRUCK BUSINESS UNIT DI IVECO, DOVE HA PERCORSO LA SUA CARRIERA, OLTRE AD AVER RICOPERTO IL RUOLO DI VICE PRESIDENT SALES & AFTER SALES TRUCK & TRAILER EMEA IN THERMO KING, LUCA SRA È CHIAMATO A COORDINARE IL GRUPPO DI LAVORO DEDICATO AI TEMI DELL’AUTOTRASPORTO E DELLA LOGISTICA, FACENDOSI PORTAVOCE VERSO GLI STAKEHOLDER DEI MESSAGGI E DELLE ISTANZE DELLA FILIERA INDUSTRIALE ITALIANA DEI VEICOLI PER IL TRASPORTO MERCI, ASSE PORTANTE DEL SISTEMA PAESE PER IL SUO RUOLO DI ASSOLUTO PROTAGONISTA ECONOMICO.

A

MAX CAMPANELLA

holder dei messaggi e delle istanze della filiera industriale italiana dei veicoli per il trasporto merci. “Sono lieto di ricevere questo incarico – commenta Luca Sra – in un momento in cui tutto il settore dell’autotrasporto e della logistica del nostro Paese sta affrontando sfide e cambiamenti importanti, a partire da quelli della transizione green e digitale, in buona parte dettata dall’agenda normativa europea in materia di decarbonizzazione della mobilità e nuovi requisiti di sicurezza dei veicoli. Stiamo parlando di un comparto che, in occasione della pandemia, che ha messo alla prova tutta la filiera dei veicoli industriali e trainati, ha mostrato ancora una volta la sua forza, assicu-

TORINO

seguito della recente costituzione di un nuovo gruppo di lavoro interno ad ANFIA (Associazione Nazionale Filiera Industria Automobilistica), dedicato ai temi dell’autotrasporto e della logistica, è stato assegnato a Luca Sra, Chief Operating Officer Truck Business Unit di Iveco, il ruolo di delegato ANFIA per il trasporto merci. Il gruppo di lavoro, nato per mettere a sistema e dare voce alle attività inerenti il mondo del trasporto merci, già svolte nei diversi gruppi merceologici di ANFIA, vedrà Sra come coordinatore e portavoce verso gli stake-

rando le dinamiche distributive, e che, in Italia, dal punto di vista industriale, vanta importanti eccellenze produttive e specializzazioni: aziende che investono in ricerca e innovazione e sono, quindi, capaci di fornire tecnologie di ultima generazione e di svilupparne di nuove per il futuro, a patto di essere sostenute nei loro sforzi di investimento e di poter operare in un contesto favorevole. Penso sia molto positivo decidere di lavorare insieme su tutti i temi al centro del dibattito in questa fase e sono onorato di rappresentare le istanze dell’intera filiera nel dialogo con istituzioni e stakeholder”. Dopo la laurea in Economia e Commercio, conseguita all’Università di Torino,

Luca Sra inizia la sua carriera in Iveco nel 1999 occupandosi di veicoli commerciali leggeri. Da quel momento cresce sul piano professionale rivestendo diversi incarichi, con esperienze che lo portano anche all’estero, ad esempio nel ruolo di CEO Astra per Africa & Middle East. Dal 2016 al 2019 vive tre anni in Thermo King, produttore leader europeo di gruppi frigoriferi, occupando infine la posizione di Vice President Sales & After Sales Truck & Trailer EMEA, per poi tornare nel gruppo CNH Industrial, prima come Vice President After Market Solutions Iveco e, da novembre 2020, Chief Operating Officer Truck Business Unit sempre in Iveco.

HAM ITALIA / Prima infrastruttura di Bio Metano Liquido riservata a Gruber Logistics

È il Brennero il primo corridoio a emissioni zero d’Europa Q uando sarà possibile avere sulle nostre strade mezzi pesanti per il trasporto merci a emissioni zero? La risposta è oggi per HAM Italia, filiale italiana dell’azienda spagnola di costruzione impianti, trasporto e vendita di GNL (Gas Naturale Liquido). Grazie alla collaborazione con Gruber Logistics e APS Fuel, HAM ha avviato - con un nuovo impianto presso l’Autoparco Sadobre - il primo corridoio verde a emissioni zero d’Europa, progetto che ha alla sua base l’utilizzo di biomasse avanzate per la produzione di carburante e la completa certificazione della filiera dalla produzione all’utilizzo. Il metano liquido è oggi una realtà consolidata nel panorama dei carburanti alternativi al diesel. Il

grande vantaggio del metano è di annullare le polveri sottili e avere un decremento di emissioni considerevole rispetto al diesel. Oggi è però anche possibile ottenere biometano liquido da biomasse, annullando completamente le emissioni di CO2 nell’atmosfera. Il nuovo carburante, il cosiddetto Bio Metano Liquido, sta pian piano prendendo piede in Europa ma non esistono ancora soluzioni che possano garantire completamente la tracciabilità della molecola Bio. Gli impianti a livello infrastrutturale non sono infatti attrezzati con impianti appositi e pertanto mescolano metano di origine fossile con metano Bio. La società APS Fuel (Autoporto Sadobre) si è dotata di un’infrastruttura apposita per la distribuzione

del Bio carburante, che mantiene separato quello di origine fossile dal carburante di origine Bio. “Oggi spiega Roberto Padovani, proprietario della stazione di rifornimento - il biogas viene inserito in rete con metano normale, poi liquefatto oppure portato in stazioni di rifornimento e mescolato con carburante fossile. Avendo un serbatoio di stoccaggio ad hoc, siamo l’unica stazione in Europa che può preservare la purezza del Bio carburante: entro fine 2021, potenzieremo ulteriormente l’impianto con un erogatore d’idrogeno”. HAM è impegnata nel progetto mettendo a disposizione il BML (Bio Metano Liquido). “Non solo - precisa Riccardo Piccolo, LNG Sales Manager Italy & Swiss HAM Italia - si tratta di un carburante in

IDEE IN MOVIMENTO

I

Uscire dall’emergenza si può e si deve

l Piano Nazionale di Ripresa e Resilienza (PNRR), correttamente presentato dal Presidente Draghi come parte essenziale di una strategia più ampia e ambiziosa per l’ammodernamento del Paese, impone alcune riflessioni su un aspetto essenziale per l’Italia di domani: la responsabilità di spesa, la cui mancanza minaccia di compromettere seriamente il benessere delle prossime generazioni, alle quali non verrà data una seconda opportunità. Non dobbiamo dimenticare che quelli previsti dal PNRR sono fondi per due terzi a prestito e, per questo motivo, non vanno vanificati con interventi a pioggia di natura assistenzialista. Abbiamo bisogno di una visione seria e unitaria del Paese: il Recovery Fund da solo non basta, servono riforme immediate, che consentano di attrarre in Italia gli investimenti dei privati, sulla falsariga del sistema di riforme già avviato in altre nazioni. Alle riforme deve essere affiancato, con identico carattere di urgenza, l’ammodernamento delle infrastrutture. Approvo pienamente la decisione di destinare 630 milioni di euro previsti dal PNRR agli investimenti infrastrutturali per collegare le aree ZES (Zone Economiche Speciali) con la rete nazionale dei

di DOMENICO DE ROSA CEO del Gruppo SMET

trasporti e in particolare con le reti Trans Europee: le ZES sono una grande opportunità di sviluppo economico per interi distretti logistici e industriali e un impulso concreto per il trasporto intermodale. L’Italia è purtroppo la nazione europea che è stata colpita, per prima e più duramente, dall’emergenza Covid-19 e che ha un triste doppio primato, sia in termini di decessi che in termini di riduzione di prodotto interno lordo. La crisi sanitaria

si è abbattuta con violenza su un Paese particolarmente fragile e vulnerabile da un punto di vista economico, sociale e ambientale, con un andamento della produttività deludente, una profonda incapacità nel cogliere le opportunità legate alla rivoluzione digitale e una conseguente difficoltà nello stare al passo con le nazioni europee più avanzate. Ma nel secondo dopoguerra abbiamo già dimostrato di saper cogliere le opportunità che la storia ci concede. Lo abbiamo fatto tra il 1958 e il 1963, gli anni del Miracolo Economico, quando l’Italia è uscita definitivamente da una condizione cronica di sottosviluppo, recuperando il gap con gli altri Paesi europei. Sono certo che lo faremo di nuovo, se riusciremo a ritrovare lo spirito di coesione che ha caratterizzato quegli anni e che, oggi, ci consentirà di uscire definitivamente da questa tragedia pandemica e di consegnare alle prossime generazioni un Paese moderno, che ha finalmente trovato il posto che gli spetta nel consesso europeo. E soprattutto se sapremo costruire un futuro migliore, anteponendo ai diritti, troppo spesso evocati e pretesi, i doveri a cui ognuno di noi è chiamato, in funzione del suo ruolo nella società.

grado di abbassare le emissioni del 95 per cento rispetto al diesel, ma previene le emissioni di CO2 che deriverebbero dagli scarti delle produzioni agricole, facendone per l’appunto un carburante a zero emissioni”. Il progetto è appoggiato da Martin Gruber, CEO della società di logistica e trasporti altoatesina, che ha ottenuto l’utilizzo del carburante in via esclusiva. “Molti si chiedono quando si potrà parlare di trasporto a emissioni zero. La nostra risposta è oggi. Il futuro che immaginiamo - afferma Gruber - è fatto di un utilizzo di più carburanti a basse emissioni, da utilizzarsi anche in presenza di trasporto combinatointermodale. Oggi tracciamo un nuovo punto d’inizio per tutto il settore dei trasporti in Europa”.

IL MONDO DEI TRASPORTI

Mensile di Politica, Economia, Cultura e Tecnica del Trasporto Direttore responsabile Paolo Altieri - paolo.altieri@vegaeditrice.it

Comitato di Redazione Fabio Basilico - f.basilico@vegaeditrice.it Max Campanella - m.campanella@ vegaeditrice.it Direzione, redazione e amministrazione Via Ramazzotti 20 - 20900 Monza Tel. +39 039 493101 - info@vegaeditrice.it www.ilmondodeitrasporti.com Sede Legale Via Stresa 15 - 20125 Milano Editore Vega Editrice Presidente Luisella Crobu Vice Presidente Michele Stefano Altieri Direttore editoriale Cristina Altieri cristina.altieri@vegaeditrice.it Condirettore editoriale Vincenzo Lasalvia Pubblicità Vega Editrice srl: Via Ramazzotti 20 - 20900 Monza Tel. +39 039 493101 Promozione Piero Ferrari Impaginazione e Fotocomposizione Varano, Busto Garolfo (Milano) Stampa Reggiani Print srl, Brezzo di Bedero (VA) Il Mondo dei Trasporti è registrato presso il Tribunale di Milano numero 327 del 4/5/1991 - Iscrizione al ROC: N. 35164 Abbonamento annuo: Italia Euro 50,00, estero: Euro 150,00 Banca d’appoggio: UniCredit Banca - Agenzia Muggiò; Codice IBAN: IT 21 V 02008 33430 000041141143 - Monte dei Paschi di Siena - Agenzia 5 Milano; Codice IBAN: IT 51 K 01030 01605 000000212676 - Poste Italiane Spa - Sped. in Abbonamento Postale - D.L. 353/2003 (conv. in L. 27/02/2004 N. 46) Art.1, comma 1, DCB Milano - Distribuzione GE.MA Srl: Burago di Molgora (MB).


IL MONDO DEI TRASPORTI

Pagina 4

N° 301 / Luglio-Agosto 2021

VAROM / IN QUATTRO ANNI SOLO SCANIA NEL PARCO DELL’AZIENDA DI TRASPORTI PAVESE

Alla corte di Re Sergio

N

MAX CAMPANELLA CODEVILLA

on c’è ostacolo per il V8, il più potente dei motori sul mercato, simbolo della potenza messa in campo da Scania nello sviluppo dei propulsori. Ed era proprio il principe dei motori per veicoli industriali quello a cui mirava Re Sergio Autotrasporti, azienda cresciuta negli anni grazie alla passione e alla tenacia della famiglia Re e alla “grande famiglia” dei 90 dipendenti. L’intuizione di una partnership che, nata solo quattro anni fa, ha portato a un parco di 50 trattori stradali interamente a marchio del Grifone, è di Antonio Arrigoni, dinamico manager della Concessionaria Varom di Lodi, che ha incrociato l’entusiasmo del fondatore Sergio e della “grande famiglia” Re: “Per la sua azienda - afferma Arrigoni - ha sempre voluto il meglio: c’è stata la possibilità di un viaggio in Svezia, a Södertälje, per scoprire il sito pro duttivo e per provare il V8”. Da quel momento l’incanto è rimasto intatto. Anzi, è cresciuto negli anni. Classe 1949, Sergio Re è tuttora al timone dell’azienda che ha fondato, giovanissimo, per il commercio di frutta. Originario di Brallo di Pregola, a una manciata di chilometri dall’attuale sede di Codevilla (in un’area di 10mila mq in provincia di Pavia), con il suo autocarro OM rosso - che vediamo tuttora esposto tra vetture d’epoca, altra grande passione dei Re - commerciava in prodotti agricoli, che iniziò a trasportare con una piccola flotta di autotreni. La svolta con l’arrivo della seconda generazione, nelle persone dei figli Loretta e Costantino e del genero Marco Sala, la prima pilastro della struttura amministrativa, i secondi autentici eredi della passione per i camion. Sono gli anni del boom delle fornaci, che per il loro lavoro richiedono terra da lavorare: Sergio Re investe su cinque trattori che trainano vasche ribaltabili per il trasporto terra, e che rappresentano l’inizio del la nuova avventura imprenditoriale di Re Sergio Autotrasporti. Poi, con la forza derivante dalle nuove energie, si apre al segmento del trasporto rifiuti. “Di anno in anno - ricorda Marco Sala - si acquistavano due, tre o quattro camion, fino ad arrivare alle attuali dimensioni”. Re Sergio conta 50 trattori e un’ottantina di semirimorchi (tra vasche e piani mobili dei brand Stas e Knapen) ed effettua trasporto rifiuti nazionale e internazionale, oltre alla proprietà di due cave per l’estrazione e la commercializzazione del materiale inerte. “Il 80 per cento del business - spiega Sala - è costituito dal settore dell’ecologia, che comprende non solo i trasporti rifiuti ma anche un impianto di recupero di rifiuti ligneocellulosici”. Sull’onda lunga ecologica si colloca l’azienda agricola Della Giovanna Severina, coniuge di Sergio Re, con circa 400 ettari coltivati a mais e cereali, che da dieci anni produce energia

CON L’ARRIVO, ENTRO FINE ANNO, DI SEI UNITÀ CHE VANNO A SOSTITUIRE VEICOLI DEL 2018, LA FLOTTA DI TRATTORI STRADALI DELL’AZIENDA DELL’OLTREPÒ PAVESE È INTERAMENTE DEL MARCHIO DI SÖDERTÄLJE. UNA PARTNERSHIP NATA QUATTRO ANNI FA CON UN VIAGGIO IN SVEZIA ALLA SCOPERTA DELLA CASA SVEDESE E, IN PARTICOLARE, PER LA PROVA DEL POTENTE V8. “L’AZIENDA HA SEMPRE VOLUTO IL MEGLIO, NOI GLIEL’ABBIAMO DATO”, AFFERMA ANTONIO ARRIGONI DI VAROM.

tramite un impianto biogas da un megawatt. Oggi i trattori sono tutti a marchio Scania, considerando le ultime sei unità in arrivo entro fine anno per sostituire altrettanti veicoli del 2018. Una partnership che nasce

con un viaggio in Svezia insieme ad Antonio Arrigoni, manager della Concessionaria Varom di Lodi. “Re Sergio spiega Arrigoni - è un’azienda che ha sempre voluto il meglio: erano intenzionati a provare il top di gamma e,

quando vi è stata l’opportunità, li abbiamo accompagnati alla scoperta del mondo Scania. A Södertälje hanno avuto l’opportunità anche di provarlo su strada: dopo qualche mese hanno acquistato i primi due veicoli e, dopo un seme-

stre, ben 25 unità. Da quel momento la collaborazione si è andata rafforzando anno dopo anno”. La scelta del V8 prosegue tuttora, e non é solo questione di passione per la massima potenza. “I nostri veicoli - illustra Sala - affrontano spesso percorsi gravosi e, soprattutto, viaggiano con la portata massima. In queste condizioni di carico e tipologia di percorso, una potenza importante aiuta a consumare di meno: più bassi giri motore, soprattutto in salita, contengono i consumi e ottimizzano i tempi di viaggio. Scegliere il massimo come lo Scania V8 significa per noi avere strumenti di lavoro di cui ci si può fidare: sopporta ogni stress, dura di più e (poiché anche l’occhio vuole la sua parte) il camion è decisamente bello”. Sperimentazione che Marco Sala ha provato in prima persona. “La necessità di occuparmi di questioni gestionali - prosegue il manager di Re Sergio - oggi mi tiene lontano dal volante, ma le assicuro che, all’occorrenza, non esiterei a occuparmi di un viaggio”. Grazie al tandem con

Varom, gli Scania di Re Sergio con semirimorchi al seguito soddisfano ogni necessità di trasporto dei big dell’ecologia, perlopiù le municipalizzate del settore, oltre al trasporto di inerti. Committenza di prestigio che richiede un valore aggiunto anche nella gestione della flotta. “Re Sergio - precisa Arrigoni - è una delle aziende italiane per le quali Scania ha avviato il progetto Fleet Care: un fleet manager nella sede di Trento è in costante contatto con l’ufficio traffico dell’azienda e concorda ogni step della manutenzione dei veicoli, calendarizzando la presenza in officina di ogni mezzo e occupandosi, all’occorrenza, della gestione diretta di eventuali fermi macchina, oltre a monitorare le performance della flotta, che consentono il controllo degli stili di guida degli autisti. Re Sergio, riconosciuta leader nel suo settore, intende confermarsi azienda preparata e all’avanguardia; comunicarci le performance degli autisti consente di migliorarle, affiancando al prodotto di qualità Scania un servizio del medesimo livello di qualità”.

Re SeRgio AutotRASpoRti

Lo Scania V8 della flotta Re Sergio. In alto, da sinistra: Marco Sala, Responsabile Parco mezzi di Re Sergio con Antonio e Matteo Arrigoni della Concessionaria Scania Varom.

Sede operativa principale: Codevilla (PV) Amministratore Unico: Sergio Re Merce trasportata: Rifiuti Flotta: 50 trattori + 80 semirimorchi Dipendenti: 90 Fatturato di gruppo 2020 (euro): 20 milioni Sito internet: resergio.it


IL TUO PA ARTNER NELLA LOGISTICA, NE EI TRASPORTI T E NEI SERVIZI. V


IL MONDO DEI TRASPORTI

Pagina 6

N° 301 / Luglio-Agosto 2021

FRAIKIN / CONSEGNATI TRE TRATTORI MAN TGX E UN SEMIRIMORCHIO LAMBERET SR2

Il noleggio e i progetti di Tiryan Trasporti GIOVANE AUTISTA DI UNA MOTRICE SUL FINIRE DEGLI ANNI NOVANTA, NEL 2006 DAVIDE CESTARI ACCETTA LA SFIDA DI APRIRE LA SUA IMPRESA OGGI, AFFIANCATO DALLA MOGLIE ELENA PEDERSOLI, DÀ LAVORO A 18 DIPENDENTI E OPERA PER UNA COMMITTENZA CHE PRESTA MASSIMA ATTENZIONE AL SERVIZIO, TRASPORTANDO CARNE E ORTOFRUTTA IN OGNI PERIODO DELL’ANNO. LA PARTNERSHIP CON IL NOLEGGIATORE FRANCESE CONSENTE ALL’AZIENDA DI INVESTIRE SULLA FLOTTA CON PRUDENZA E DI AVVIARE PROGETTI COME IL CAMION A LNG.

CON UNA LINEA ESPRESSO.

I

MAX CAMPANELLA

ALBANO S. ALESSANDRO

l dinamismo non manca in casa Tiryan Trasporti, a zienda bergamasca con uffici a Albano Sant’Alessandro che, puntando da sempre sul servizio di qualità e supportata dalla passione per il trasporto del suo fondatore Davide Cestari, 55 anni, sta conoscendo una fase di graduale e importante sviluppo, affrontando anche momenti difficili, come il periodo pandemico, confortata dalla presenza dei dipendenti che non hanno mai smesso di essere partecipi dell’attività dell’azienda. Affiancata da Fraikin Italia, Tiryan Trasporti per la flotta di trattori e semirimorchi sceglie il noleggio, come formula da affiancare ai veicoli di proprietà: un giusto equilibrio che consente a Cestari e al suo team di accogliere la sfida di nuove committenze senza l’assillo d’immediati investimenti sul parco veicolare. L’azienda nasce nel 2006 quando l’imprenditore, nato e cresciuto a Milano, decide di mettere a frutto l’esperienza fino a quel momento maturata. Al volante di una motrice per conto di un’azienda che operava per il corriere espresso Bartolini, già sul finire degli Anni Novanta Cestari manifesta interesse e passione per l’attività. “Se si trattava di fare qualche viaggio in più racconta - non mi sottraevo, an zi: creavo più linee per sod disfare le richieste del cliente, mi appassionava poter accontentare le sue necessità”. Quell’attenzione ai progetti futuri è nel dna: dopo un’esperienza in Francia, nel 2006 torna in Italia e accetta la sfida di Bartolini. “Mi proposero - prosegue Cestari - di

occuparmi di una linea con autotreno scarrabile: a quel punto ho aperto l’azienda con un solo veicolo”. Tiryan nome che unisce il termine Tir le iniziali dei primi due figli Yanis, 23 anni, e Anna, 16, (la terza Sara, di 7 anni, ancora non c’era) - cresce aprendosi a nuovi clienti e nuovi segmenti di mercato: la linea espresso con Bartolini resta, ma la chiave di volta è rappresentata dalla GDO, in particolare dalla partnership con la genovese Sogegross. “La crescita dell’azienda precisa Davide Cestari - si è accompagnata con committenti che credono nella qualità del servizio: Tiryan non si sottrae dal fare sforzi importanti nel tenere aggiornata la flotta e fidelizzati gli autisti, puntando a progetti importan-

ti come l’ottenimento della certificazione Iso 9000 e l’apertura a nuovi segmenti in fase di sviluppo, come la logistica dei freschi nel trasporto aereo. Abbiamo dalla nostra parte storia, competenza e volontà d’investire, approccio che possiamo condividere con clienti che cercano un servizio di qualità”. Di ritorno dalla linea espresso i camion Tiryan trasportano bancali o cassette per ortofrutta di Polymer Logistics. Ma il core business è oggi concentrato presso il grande magazzino logistico Italtrans, a Calcio, in provincia di Bergamo, da dove tre bilici con sponda e muletto elettrico - in grado di trasportare bancali fino a 11 q, ad esempio per carichi di acqua minerale - partono per il na-

vettaggio verso i siti di Serravalle Scrivia, Tortona e Genova Bolzaneto e presso tutti i punti vendita Sogegross e del l’altro brand del gruppo GrosMarket. Ogni mattina i veicoli vengono posizionati in ribalta nella sede Italtrans e effettuano due viaggi al giorno. Da tre anni Cestari ha smesso si mettersi al volante per occuparsi - affiancato dalla moglie Elena Pedersoli del rapporto con i clienti e fornitori, ma in ogni ramo di attività dimostra la competenza maturata sul campo. Come nel caso della scelta della flotta. “Il noleggio - afferma l’imprenditore - è la formula giusta, che va bilanciata con veicoli di proprietà. Nel nostro caso intendiamo mantenere una quota di noleggio

Da sinistra: Davide Cestari e la moglie Elena Pedersoli, timonieri della bergamasca Tiryan Trasporti, e Diego Pellicioli, Sales Director Fraikin Italia.

tiRyAn tRASpoRti

Sede operativa principale: Albano Sant’Alessandro (BG) Presidente: Davide Cestari Merce trasportata: Alimentare secco e frutta Flotta: 10 trattori + 11 semirimorchi Dipendenti: 18 Fatturato 2020 (euro): 2 milioni Sito internet: tiryantrasporti.com

del 50-60 per cento del parco”. Su strada Tiryan porta 10 trattori e 11 semirimorchi coibentati, pronti a trasportare all’occorrenza a temperatura controllata - carne e ortofrutta in sicurezza in ogni periodo dell’anno. Quale partner per il noleggio, Fraikin Italia ha consegnato all’azienda bergamasca tre trattori MAN TGX e un semirimorchio Lamberet SR2. “Il vantaggio di Fraikin - afferma Cestari - è che ci consente di inserire nel parco sempre veicoli nuovi. Quest’anno, confidando nel buon esito di trattative in corso, pen siamo di aggiungere almeno un altro bilico e punteremo sul noleggio: Fraikin ci consente di accettare nuovi servizi senza dovere, nell’immediato, investire nell’acquisto di veicoli. L’investimento d’acquisto viene effettuato quando, nel corso degli anni, si consolida la partnership con il cliente”. I trattori sono tutti Euro VI e guidati da autisti che vengono costantemente seguiti nella formazione, e non solo. “Sono tutte persone di grande disponibilità tant’è vero - afferma Pedersoli - che durante la pandemia erano gli stessi nostri clienti a dare loro un sup porto, ad esempio con buoni spesa: mai si è espressa in tutta la sua pienezza la catena di solidarietà”. Geolocalizzazione, scarico da remoto dei tachigrafi, ser-

vizio di rimorchio h 24 in caso di guasto: in Tiryan l’organizzazione è presa sul serio in ogni aspetto. “Fraikin - aggiunge Cestari - garantisce la sostituzione del mezzo in caso di necessità e, soprattutto, tempi brevi e risposta immediata alle richieste: abbiamo riscontrato un livello di qualità e dinamismo che si sposa bene con il nostro approccio al mercato”. Una visione comune che trova d’accordo Diego Pellicioli, Sales Director Fraikin Italia. “Il noleggio - afferma il manager Fraikin - deve essere veloce in ogni dinamica: la committenza chiede a Tiryan di essere flessibile? La stessa Tiryan ha bisogno di flessibilità. Si tratta di un’azienda che ha molto diversificato il suo business: Fraikin, unico noleggiatore presente in ogni segmento di mercato, ha il panel giusto per soddisfarne le necessità. Non da ultimo, un’azienda di medie dimensioni come quella di Davide e Elena Cestari può sfruttare il potere d’acquisto di Fraikin per crescere e sviluppare il suo business”. Opportunità che Tiryan Trasporti intende cogliere anche per aprirsi al nuovo mondo dell’LNG: “Con Fraikin costituiamo un team di lavoro che sta valutando l’utilizzo di un camion a gas, senza esporre l’azienda sul piano finanziario”, confermano i Cestari.


TRATTALO MALE.

SOVRACCARICALO. 3XzWUDVSRUWDUH¼QRDWRQQHOODWHFRPHVHQLHQWHIRVVH MALTRATTALO. &RVuUHVLVWHQWHFKHQHVVXQDPLVVLRQHRIIURDGqWURSSRGXUD STRESSALO. 3UHVWD]LRQLHDI¼GDELOLWjDOWRSVRQRODQRUPD

NIENTE PUÒ PIÙ FERMARTI ADESSO. LA GAMMA COMPLETA OFF-ROAD È A TUA DISPOSIZIONE.


IL MONDO DEI TRASPORTI

Pagina 8

N° 301 / Luglio-Agosto 2021

ROSSI VEICOLI / FORD TRUCKS ENTRA NELLA FLOTTA TRANS LILLI DI PERUGIA

L’Umbria apre le porte a F-Max

C

FABIO BASILICO PERUGIA

ontinua la marcia trionfale di F-Max alla conquista del mercato italiano. Dopo aver reso conto del primo trattore Ford Trucks consegnato nelle Marche, tocca ora all’Umbria accogliere l’ammiraglia dell’Ovale Blu. La consegna del primo esemplare dell’ammiraglia Ford Trucks è stata effettuata anche in questo caso da Rossi Veicoli, Concessionaria con headquarter a Corciano, alle porte di Perugia, alla quale F-Trucks Italia ha assegnato il mandato Ford Trucks non solo per l’Umbria ma anche per Marche, Abruzzo e Romagna (Forlì, Cesena e Rimini). Il nuovo F-Max con livrea nera entra nella flotta di un’azienda perugina dalla solida competenza e organizzazione: Trans Lilli, fondata negli anni Settanta da Federico Lilli e og gi capitanata dal figlio Walter che per un certo periodo ha condiviso la direzione con il fratello Amilcare. “La nostra famiglia opera nel settore del trasporto da cinquant’anni - dice Walter Lilli - Trans Lilli è la prima società nata per volere di mio padre Federico agli inizi del 1970. Successivamente, al raggiungimento della maggior età, siamo entrati in azienda io e mio fratello Amilcare. Allora il servizio principale era prevalentemente legato alle attività di trasporto, scarico e montaggio di mobilio. In seguito, con l’acquisto di nuovi mezzi e attrezzature la nostra offerta si è ampliata sia in termini di merci trasportate sia in chilometri percorsi. Siamo così arrivati a operare in terri-

L’AMMIRAGLIA DELL’OVALE BLU SBARCA ANCHE IN

UMBRIA. LA CONSEGNA DEL PRIMO TRATTORE F-MAX DA

500 CV È STATA EFFETTUATA ANCHE IN QUESTO CASO DALLA

CONCESSIONARIA CON HEADQUARTER A

CORCIANO. PROTAGONISTA UN’AZIENDA PERUGINA DALLA SOLIDA COMPETENZA E ORGANIZZAZIONE: TRANS LILLI, FONDATA NEGLI ANNI SETTANTA DA FEDERICO LILLI E OGGI CAPITANATA DAL FIGLIO WALTER, RESPONSABILE ANCHE DELLA COLLEGATA

S.T.P. (SOCIETÀ TRASPORTI PERUGIA). torio europeo ed extraeuropeo, arrivando fino in Kazakistan. Oggi ci occupiamo prevalentemente di trasporti sull’intero territorio italiano”. Nel 2004 viene costituita la seconda azienda che fa capo alla famiglia Lilli e denominata S.T.P., Società Trasporti Perugia. “Attualmente continua Walter Lilli - entrambe le società lavorano in

perfetta sintonia e sinergia, condividendo mezzi e risorse umane, arrivando a essere attive nel trasporto di diverse tipologie di merci, con una particolare specializzazione nel trasporto, scarico e montaggio di manufatti in cemento, come ad esempio le barriere New Jersey”. “La scelta di inserire l’FMax nella flotta - spiega Wal-

ter Lilli - è motivata non solo dalle qualità complessive del veicolo ma anche dal rapporto di conoscenza e fiducia instaurato con Rossi Veicoli e in particolare con Andrea Reali, Responsabile vendite veicoli commerciali e industriali di Rossi Veicoli. È stato lui a propormi l’F-Max e a illustrarmi nel dettaglio le caratteristiche vincenti del trat-

tore”. L’incontro con Reali è l’autentica “chiave di volta” alla base della collaborazione con Rossi Veicoli. “Ero solo un ragazzo - ricorda il manager della Concessionaria quando a diciott’anni conoscevo Walter che mi raccontava dei trasporti nel Kazakistan: condividevamo la grande passione per i camion”. La motorizzazione alto di gamma da 500 cavalli del prestazionale propulsore Ecotorq Euro 6d da 12.740 cc, che equipaggia l’ammiraglia Ford, il punto di forza sottolineato da Lilli nella scelta dell’F-Max. “È la qualità complessiva, abbinata a un prezzo corretto, ciò che mi ha convinto ad adottare il trattore FMax per svolgere le mie attività di trasporto su tutto il territorio nazionale”, precisa l’imprenditore umbro. Del resto Walter Lilli se ne intende di prestazioni e performance su strada: da anni affianca alla sua attività professionale di trasportatore la passione per lo sport automobilistico: pilota provetto, Lilli si è classificato primo nel 2020 nel combattuto Trofeo Super Cup con protagonista Renault Clio. Con l’ingresso di F-Max nella flotta di Trans Lilli e S.T.P. anche in Umbria i truck Ford fanno sentire la loro presenza e si preparano a colle-

zionare nuove e significative affermazioni. “Trans Lilli afferma Andrea Reali - è un cliente di riferimento in Umbria: azienda consolidata, con una lunga tradizione storica, caratterizzata dalla presenza di Walter sempre sul campo, che conosce il lavoro perché se ne occupa personalmente e direttamente. Per noi è uno straordinario biglietto da visita: negli autotrasportatori il passaparola è un valore di assoluta importanza, il pensiero di chi, come Lilli, ha dalla sua competenza e passione vale ancora di più. L’auspicio è che la consegna a Trans Lilli rappresenti una vera rampa di lancio per un incremento futuro delle vendite del l’FMax anche in Umbria”. Il successo del brand Ford parte dalla tenacia e dall’impegno dello staff Rossi Veicoli, realtà consolidata che non cessa di svilupparsi, soprattutto per quanto riguarda la gamma di servizi offerti a una clientela sempre molto esigente. “Oltre che nella vendita, una caratteristica basilare dell’identità di Rossi Veicoli è il business del post-vendita per far sì che il cliente si senta il più possibile tranquillo nell’utilizzo del veicolo aggiunge Reali - A distanza di quasi mezzo secolo dall’avvio delle attività della Concessionaria, posso sicuramente affermare che è stata la scelta vincente che, ancora oggi, con i naturali cambiamenti e le crescite, sia aziendale che del mercato, ci possono far affermare di avere un servizio altamente qualitativo e competitivo, in un settore dove ogni fermo macchina pesa in maniera determinante sul bilancio dell’utilizzatore. A ulteriore approfondimento, sui nostri servizi - aggiunge il Responsabile vendite veicoli commerciali e industriali di Rossi Veicoli - faccio presente che forniamo Service 24h con veicoli e personale dedicato, recupero stradale con mezzi propri e garanzia di mobilità per la clientela con veicoli sostitutivi. Il truck di cortesia viene concesso grazie alla possibilità che abbiamo avuto dopo l’acquisizione della licenza di trasporto conto terzi che ci permette di noleggiare i veicoli stessi”. La clientela della zona di competenza di Rossi è composta in prevalenza da aziende medio-piccole, vale a dire da padroncini monoveicolari e flotte di massimo 80 veicoli, a eccezione di un gruppo di imprese che arriva fino a 300 veicoli e che coprono sia rotte nazionali che internazionali. “Abbiamo anche una numerosa clientela composta da aziende in conto proprio”, conclude Reali.

tRAnS LiLLi

Da sinistra: Carlotta Caponi, segretaria FAI Umbria, Walter Lilli e Andrea Reali, Sales Manager Vans & Trucks Rossi Veicoli.

Sede: Strada Eugubina 333, Piccione (PG) Sede S.T.P.: Via dell’Ala 10/C, Ponte Felcino (PG) Fondazione: 1970, Federico Lilli Titolare: Walter Lilli Flotta: 20 trattori e gamma semirimorchi Dipendenti: 24 Autisti: 20 Fatturato: circa 5 milioni di euro Internet: lilliautotrasporti.it


Charged & Ready. Il nuovo eActros.


IL MONDO DEI TRASPORTI

Pagina 10

N° 301 / Luglio-Agosto 2021

ESPOSITO / IVECO È ASSOLUTO PRIMO BRAND DELLA FLOTTA CAMPANA

Gli Alfieri del servizio al cliente

DA TRE LUSTRI ENZO COMOLETTI, VENDITORE DI ESPERIENZA E GRANDE DINAMISMO, SEGUE CON COSTANZA E ATTENZIONE L’EVOLUZIONE DI ALFIERI GROUP CHE, NATA COME AZIENDA INDIVIDUALE PER VOLONTÀ DI CARMINE ALFIERI, OGGI CONTA UN PARCO DI 150 MEZZI E DÀ LAVORO A 95 PERSONE OLTRE A UN IMPORTANTE INDOTTO. IL DEALER NAPOLETANO È RIFERIMENTO PER I TRATTORI: TRA 2020 E 2021 SONO ARRIVATI UNA DECINA DI S-WAY, TRE A LNG.

E

MAX CAMPANELLA NOLA

ntrando nella sede di Nola di Alfieri Group ci si sente a casa. L’atmosfera con cui i fratelli Alfieri ci accolgono è proprio quella familiare: l’immancabile caffè napoletano, il desiderio di raccontarci ogni step dell’evoluzione dell’azienda,

di mostrarci l’intensità con cui si lavora lì, nell’headquarter, e nella rete di servizi di trasporto che contraddistingue il player campano. L’elemento di familiarità è rimasto quello delle origini, quello con il quale Carmine Alfieri iniziava a trasportare quan d’an cora si usavano i carri con animali da traino. A fare tesoro di quelle origini è la

gloriosa SNC che tuttora fa parte del gruppo aziendale, an che oggi che la holding della famiglia Alfieri dà lavoro a 95 persone in modo diretto, oltre a un importante indotto, e ha chiuso il 2020 con un fatturato di 12 milioni di euro. In tutto il suo percorso di crescita, tra i punti fermi di Alfieri Group la Concessio-

naria Esposito è il riferimento per i pesanti, sulla base di una partnership che di fatto consente a Iveco di essere il principale brand della flotta di trattori stradali. Di quest’anno l’acquisizione di cinque unità S-Way, cui se ne aggiungono altrettante nel 2020. Le origini di quella che oggi è un’azienda presente sull’intero territorio nazionale,

con mezzi a carico completo e parziale, risale alla distribuzione di vino a dorso di cavalli. La prima figura che rappresenta l’inizio dell’impresa è Carmine Alfieri, accanto al quale crescono i figli: Aniel-

lo, Pietro, Michele e Tommaso. “Un po’ tutti noi - ricorda Pietro, 60 anni - siamo cresciuti accanto a lui che guidava il camion: io stesso ricordo di essermi messo al volante veramente da piccolo e lo ac-

ALfieRi gRoup

Da sinistra: i due cugini Carmine Alfieri; i fratelli Pietro, Aniello e Michele Alfieri; Enzo Comoletti, Venditore di Zona della Concessionaria Esposito; e Tommaso Alfieri, rappresentante della seconda generazione al timone dell’azienda campana.

Sede operativa principale: Nola Presidente: F.lli Alfieri Merce trasportata: Automotive, food & beverage, industriale Flotta: 53 trattori + 75 semirimorchi Dipendenti: 95 Fatturato 2020 (euro): 12 milioni Sito internet: alfierigroup.it


N° 301 / Luglio-Agosto 2021

compagnavo nei viaggi per con to di Fiat”. Quell’esperienza è stata vissuta dagli Alfieri in modo del tutto naturale, come se il camion sia parte del loro dna. Lo stesso che è inscritto nella quarta

ge nerazione, nelle persone dei due cugini di 33 e 19 anni che, uno figlio di Pietro l’altro di Michele, portano orgogliosamente il nome del nonno. “Step by step” quell’impresa, nata come individuale,

IL MONDO DEI TRASPORTI

cresce. “Non abbiamo mai fatto azzardi - precisa Pietro e forse non cogliendo determinate opportunità, ma il nostro obiettivo era ed è svilupparsi un po’ alla volta, tenendo salda la colonna portante

La flotta della campana Alfieri Group è costituita da trattori in massima parte a marchio Iveco.

costituita dalla SNC, cui si è aggiunta l’SRL per dare vita all’attuale configurazione aziendale”. Lo stesso Pietro è decisamente un imprenditore d’altri tempi: ci presentiamo a lui sul piazzale, mentre è intento a aiutare con l’utilizzo di un muletto. “È il mio lavoro - spiega - e lo faccio volentieri: nessuno di noi si sente un coordinatore; siamo tutti operativi, sempre in campo. Tut ti noi fratelli abbiamo sempre lavorato e continuiamo a farlo”. Quattro anni fa la decisione di trasferirsi dalla sede storica di Piazzolla a quella attuale, nella zona industriale di Nola, che si sviluppa su 25mila mq di area totale, di cui seimila di capannoni coperti, ed è localizzata in posizione strategica per favorire il flusso logistico delle merci destinate agli stabilimenti del Gruppo FCA-Stellantis di Termoli, Cassino, Pomigliano d’Arco, Pratola Serra e Melfi. Alfieri Group dispone inoltre di piazzali e magazzini per una copertura capillare. Oltre a Nola: a San Nicola di Melfi, in provincia di Potenza (15mila mq coperti, 28mila di piazzale); a Parma (15mila coperti e 30mila di piazzale); a Nichelino, in provincia di Torino (10mila coperti e 20mila di piazzale). A breve

Pagina 11

sarà operativo a Nola un altro edificio con piazzale per rafforzare il business della logistica. Negli anni Alfieri Group ha diversificato il business: se l’automotive resta il settore principale, che rappresenta il 30 per cento dell’attività, l’azienda opera nel food & beverage, per clienti come Ferrarelle, nell’industriale, nel farmaceutico, nell’aerospace e nella catena del freddo. Il parco mezzi è costituito da 150 veicoli: 53 trattori stradali e 75 semirimorchi. Il legame con il costruttore italiano di autovetture ha certamente favorito la presenza di mezzi Iveco, brand per il quale la Concessionaria di riferimento è il dealer Esposito. “Iveco - precisa Gerardo Nardozza, dal 2020 Business Development & Operations Manager Alfieri Group - rappresenta l’80 per cento della nostra flotta di trattori. Tra l’anno scorso e quest’anno sono arrivate una decina di nuove unità S-Way, delle quali tre Natural Power, ovvero alimentate a LNG”. Tutti trattori che effettuano rotte nazionali, da Nord a Sud, con un particolare focus su Lombardia, Piemonte e Centro-Sud. “Sul lungo raggio - afferma Nardozza - utilizziamo esclusivamente vei-

coli di proprietà, nel perimetro Campania-BasilicataLazio abbiamo partner che effettuano percorsi brevi, che nel complesso rappresentano il 5 per cento del traffico. Disporre di una flotta propria consente la tracciabilità delle merci e, su richiesta del cliente, siamo in grado di effettuare procedure di re-imballaggio, nel rispetto dei pro tocolli previsti, e di etichettatura con barcode. Inoltre, nell’ottica di servire il cliente a 360 gradi, è operativo un deposito doganale: sempre più aziende importano merce dall’estero; il deposito doganale consente la gestione di merce extraeuropea e il differimento del pagamento delle imposte”. La Concessionaria guidata da Domenico Esposito è riferimento per i trattori e per l’assistenza. “Pur avendo nel passato - aggiunge Carmine Alfieri, cugino maggiore sperimentato altri brand, Iveco per noi resta una sicurezza. A maggior ragione oggi che l’ammiraglia ha un suo stile caratteristico che si fa notare”. Il padre Pietro ne sottolinea la praticità di utilizzo: “In termini di manutenzione - afferma - il pesante Iveco è sicuro e funzionale, inoltre presenta punti di appoggio installati in modo da facilitare le nostre operazioni. Del resto, siamo orgogliosamente italiani, non possiamo che scegliere Iveco”. Da 15 anni il dealer Esposito per Alfieri Group ha il volto di Enzo Comoletti, venditore caratterizzato da esperienza e dinamismo. “Più che seguire il cliente - afferma Co moletti - posso dire che siamo cresciuti insieme: i fratelli Alfieri sono persone di valore, quando prendono un impegno lo mantengono. Giustamente richiedono al fornitore un servizio adeguato, ma allo stesso tempo comprendono le nostre esigenze: con loro non ci sono motivi di scontro, ma semmai di confronto”. E proprio sulla base del confronto nasce il “progetto LNG”. “Alfieri Group - dichiara Nardozza ha avviato percorsi di certificazione ad ampio raggio in tema di sostenibilità e ambiente, puntando a ridurre le emissioni nel lungo e nel breve raggio. L’u tilizzo di veicoli a gas rientra in questi percorsi, unitamente a corsi di guida responsabile e rispettosa, che se gue precise regole”. Anche nel 2020, anno della pandemia, l’azienda campana ha continuano il suo sviluppo, pur dovendo affrontare il difficile periodo dei lockdown. Cosa resta in Alfieri Group delle origini? Di quel Carmine che oltre sette decenni fa iniziava l’avventura imprenditoriale? “Per noi - conclude Pietro - è sempre stato fondamentale il rispetto per gli altri: ci siamo strutturati, abbiamo una struttura manageriale, ma resta valido il principio per cui la stretta di mano e la parola mantengono il loro valore irrinunciabile”.


IL MONDO DEI TRASPORTI

Pagina 12

N° 301 / Luglio-Agosto 2021

AUTOVEICOLI ERZELLI / DUE NUOVI SERIE S NELLA FLOTTA DI VIGOTRANSPORT

Semi di efficienza, raccolto di qualità

Q

FABIO BASILICO ALBENGA

uando si vedono passare, gli articolati Scania di Vigotransport non passano inosservati. La livrea dei camion è infatti accuratamente studiata e riproduce i colori di piante e fiori, ovvero il settore che ha dato origine all’azienda di Albenga, nata per trasportare i prodotti botanici dell’azienda agricola della famiglia Vigo e negli anni cresciuta anche grazie alla movimentazione di numerose altre tipologie merceologiche, alimentari compresi. Vigotransport, fondata nel 1996 da Gerolamo Vigo e oggi gestita dai figli Paolo e Franca, ha a cuore la sua immagine perché vuole comunicare in modo chiaro e diretto la qualità dei suoi servizi. Il brand Scania ben si adatta a questa strategia e i camion del Grifone firmati Vigotransport sono ormai un tutt’uno immediatamente riconoscibile sulle strade italiane ed europee. Di recente, la ditta ligure, che ha una flotta interamente targata Scania, ha introdotto nel parco mezzi due nuovi Serie S 660 cv, un trattore e una motrice, consegnati da Autoveicoli Erzelli, storica concessionaria Scania di Genova che collabora con Vigotransport fin dal 1999. “Vigotransport è un’azienda di trasporti con un importante parco mezzi attrezzato e specializzato per trasporti nazionali e internazionali – ci racconta Paolo Vigo – Fondata nel 1996, ha raccolto l’eredità delle attività che mio padre Gerolamo svolgeva nell’azienda agricola di fami-

FONDATA NEL 1996, L’AZIENDA DI ALBENGA SPECIALIZZATA NELLA DISTRIBUZIONE DI FIORI E PIANTE IN VASO, HA A CUORE LA SUA IMMAGINE PERCHÉ VUOLE COMUNICARE IN MODO CHIARO E DIRETTO LA QUALITÀ DEI SUOI SERVIZI. DI RECENTE, LA DITTA LIGURE, CHE HA UNA FLOTTA INTERAMENTE TARGATA SCANIA, HA INTRODOTTO NEL PARCO MEZZI DUE NUOVI SERIE S 660 CV, UN TRATTORE E UNA MOTRICE, CONSEGNATI DA AUTOVEICOLI ERZELLI, STORICA CONCESSIONARIA SCANIA DI GENOVA CHE COLLABORA CON VIGOTRANSPORT.

glia, specializzata nella commercializzazione di piante in vaso. La necessità di traspor-

tare i prodotti aziendali ha spinto mio padre ad acquistare il primo camion Scania ar-

rivato ad Albenga. Era il 1985. Da allora di camion ne sono stati acquistati altri fino

ad arrivare al 1996 quando mio padre ha costituito la Vigotransport allargandone il raggio d’azione. Pur rimanendo specializzati nella distribuzione di fiori e piante ci siamo allargati a coprire anche molte altre tipologie merceologiche, in particolare gli alimentari”. Alla ventina di trattori si aggiungono i 30 semirimorchi di vario tipo, dalle cisterne ai centinati fino ai veicoli per trasporto a temperatura controllata. “Il servizio e l’efficienza sono il nostro punto di forza e le caratteristiche che da sempre ci distinguono sulle rotte nazionali ed europee – precisa Paolo Vigo L’attenzione particolare alla qualità e all’efficienza delle operazioni quotidiane si avvale tra l’altro di una sede ampia e attrezzata, dotata di parcheggio, area esterna per carico e scarico, area interna, uffici e officina. I nostri servizi logistici ci consentono di ottimizzare la movimentazione e la distribuzione delle merci con lo scopo di agevolare i clienti e offrirgli un li-

vello di servizio adattato alle loro specifiche esigenze”. “Con Autoveicoli Erzelli abbiamo instaurato un rapporto di fiducia professionale e umano che risale ormai a più di venti anni fa – continua Paolo Vigo – Grazie alla valida consulenza dello staff della concessionaria genovese abbiamo consolidato la nostra preferenza per il prodotto Scania che oggi è l’unico presente all’interno della nostra flotta. Siamo estremamente soddisfatti del prodotto che è perfettamente indicato per la nostra strategia di crescita improntata sulla qualità. I due nuovi Serie S che entrano in flotta rappresentano lo stato dell’arte del costruttore svedese. Con la loro originale livrea, che come nostra tradizione è ideata per noi da un architetto in concorso con le strategie di marketing, ci aiuteranno a veicolare un’immagine aziendale di altissimo livello. Entro fine anno pensiamo di sostituire altri due veicoli, confermando i punti di riferimento della scelta: Scania e Autoveicoli Erzelli”.

VigotRAnSpoRt

La ligure Vigotransport per la sua flotta sceglie Scania S in partnership con la concessionaria Autoveicoli Erzelli.

Sede: Regione Camporette, 9 - Albenga (SV) Fondazione: 1996, Gerolamo Vigo Amministratori: Franca e Paolo Vigo Attività: trasporti nazionali e internazionali di merce varia, fiori e piante in vaso, alimentari Flotta: 20 trattori, 1 motrice, 30 semirimorchi (cisterne, centinati e frigoriferi) Dipendenti: 22 autisti + 2 impiegati Fatturato 2020: 3,3 milioni di euro Internet: vigogerolamosrl.it


TAKE CHARGE in carica per un trasporto a prova di futuro

Scopri la nuova gamma Scania di veicoli ibridi ed elettrici. Visita il sito: www.scania.it


IL MONDO DEI TRASPORTI

Pagina 14

N° 301 / Luglio-Agosto 2021

GB TRUCKS / PARTNERSHIP DALLE SOLIDE FONDAMENTA CON LA LAZIALE ECOCITY

I rifiuti viaggiano in prima classe

P

CRISTINA ALTIERI CISTERNA DI LATINA

uò capitare che un acquirente utilizzi toni tiepidi per raccontare la sua esperienza con il fornitore. Anche quando è stata positiva, magari per non dare troppa corda che possa servire a impacchettare un prezzo più alto la volta successiva. Niente di più lontano dall’entusiasmo di Vincenzo Tuccillo che, per commentare la sua soddisfazione nei confronti del prodotto DAF e di come gli è stato consegnato, non usa mezzi termini. “Gianluca Bondatti l’ho conosciuto tre anni fa - ci racconta Vincenzo - e da lui ho acquistato ben sei camion in questi pochi mesi: cinque DAF e un Isuzu. Ci troviamo benissimo, la Concessionaria GB Trucks ha un programma di assistenza completo, la disponibilità nel post vendita è a 360 gradi e questo, per un’azienda come la nostra, è un aspetto fondamentale. Gianluca è una grandissima persona, al di là della validità del prodotto”. Ecocity Srl è un’azienda di medie dimensioni e in forte crescita. È specializzata nel recupero, stoccaggio e trasporto dei rifiuti civili e industriali, nonché nel commercio, trasporto, stoccaggio e vendita di cascami e sottoprodotti metallici. Le sue origini risalgono agli Anni Settanta, al 1972 precisamente, quando Gennaro Tuccillo costituisce, a Cisterna di Latina, una ditta individuale che si occupa di raccolta rottami. Nel 2008 il capostipite va in pensione e, nel 2009, i figli Vincenzo, classe 1979, e Carmela, classe 1971, fondano Ecocity SRL. “Abbiamo espanso il business, dai rottami - afferma l’imprenditore laziale oggi ci occupiamo di tutte le tipologie di rifiuti. I nostri dipendenti sono arrivati a 15, di cui 10 autisti. Io sono il primo a lavorare sui camion, men tre Carmela dirige dall’ufficio. La doppia anima è necessaria. I mezzi sono 12: sette autocarri, due trattori e tre semirimorchi. Il nostro

ALLA SCOPERTA DELL’AZIENDA CON HEADQUARTER A CISTERNA DI LATINA, SPECIALIZZATA IN RECUPERO, STOCCAGGIO E TRASPORTO DI RIFIUTI CIVILI E INDUSTRIALI E GESTITA DAI FRATELLI CARMELA E VINCENZO

TUCCILLO. SUI MEZZI NESSUN DUBBIO: IL RIFERIMENTO È DAF E L’ASSISTENZA IMPECCABILE QUELLA DI GIANLUCA BONDATTI E DELLA SUA CONCESSIONARIA GB TRUCKS, CHE IN POCHI MESI HA CONSEGNATO A ECOCITY SEI VEICOLI, IN RAPPRESENTANZA DI TUTTA LA GAMMA DEL COSTRUTTORE OLANDESE. cliente principale, per il quale operiamo su tutto il territorio nazionale, è Ferrovie dello Stato, oltre naturalmente al portafoglio di clienti locali”. Ecocity S.r.l. è in grado di garantire il corretto espletamento di tutti gli obblighi derivanti dalle normative vigenti in materia di trattamento e trasporto rifiuti. Al centro del l’azione dell’azienda di Cisterna di Latina l’ambiente e l’innovazione tecnologica. “Per questo motivo - precisa

Vincenzo Tuccillo - ci impegniamo per il continuo rinnovo del parco, e oggi disponiamo di autocarri di ultima generazione a basso impatto ambientale, dotati d’impianti scarrabili necessari per lo svolgimento dell’attività. Possiamo usufruire di escavatori di nuova generazione; per eseguire lavori di pulizia capannoni, cantieri e opere di bonifica disponiamo di cento cassoni scarrabili”. Ecocity dispone inoltre di un magaz-

La latinense Ecocity per la sua flotta sceglie la gamma DAF in partnership con GB Trucks.

eCoCity

Sede operativa principale: Cisterna di Latina Amministratori: Carmela e Vincenzo Tuccillo Merce trasportata: Rifiuti Flotta: 7 autocarri + due trattori + tre semirimorchi Dipendenti: 15 Fatturato 2020 (euro): 2 milioni Sito internet: ecocitysrl.com

zino di circa 5mila mq per il ricovero dei mezzi e ubicazione uffici. E il futuro pare proprio in espansione: Ferrovie dello Stato ha rinnovato il contratto per i prossimi 7-8 anni. “Inseriremo nuovi veicoli in flotta e tra qualche anno avremo il cento per cento dei camion a marchio DAF. Sono veicoli silenziosi, affidabili, da quando li abbiamo provati non vogliamo più cambiare. Sono stato costretto di recente scherza Vincenzo - ad avvicinarmi a un altro brand perché Gianluca mi faceva aspettare troppo, ma d’ora in poi cambierò i mezzi solo quando Bondatti ne avrà la disponibilità”. Una crescita ben supportata, dunque, che ha attraversato indenne anche il brutto periodo di pandemia che come tutti ci auguriamo - ci stiamo lasciando alle spalle. “Abbiamo avuto tanta paura quando è stato decretato il primo lockdown ma - conclude Tuccillo - abbiamo continuato a lavorare, sempre di più. Solo per fare due numeri: siamo partiti nel 2009 con un fatturato di 400mila euro e abbiamo chiuso il 2020 con due milioni”. Vincenzo sorride e pensa alla sua flotta, e a quando, prestissimo, la tingerà di un solo colore affiancandosi a GB Trucks. “Con i fratelli Tuccillo - spiega Gianluca Bondatti, timoniere del dealer laziale - il confronto è stato su base quotidiana: abbiamo individuato insieme le loro necessità e trovato nella famiglia DAF i veicoli adatti a ciascuna mission. Oggi la loro azienda possiede l’intera gamma: l’ammiraglia XF, il medio LF e il cittadino CF, tutti equipaggiati con gancio per i cassoni scarrabili. Ci sentiamo spesso e valutiamo i futuri aggiornamenti del parco indirizzati ai trend e alle richieste della loro clientela, in modo da sostenere il business di un’azienda che fa del dinamismo e dell’innovazione il suo punto di forza”.


100% MADE IN ITA ALY

Ci siamo o. La nu uo ov va sede lombarda della IF FAC è ora una realtà. Ad un ann no dall’apertura della nuova sede di Trezz zo sull’Adda, il calore, la a professionalità e la cura del cliente, da sempre empre segni distintivi di d IFAC, sono ora una realtà in Lombardia.

Headquarter | Acquaviva delle Fonti (BA) - Italy Sede di Milano | Trezzo su ull’Adda (MI) - Italy inffo@iffacspa.com | iffacspa.c acspa.c pa.com


IL MONDO DEI TRASPORTI

Pagina 16

N° 301 / Luglio-Agosto 2021

MAN TRUCK & BUS / AL VIA IL PRIMO E-MOBILITY CENTER NELLA CAPITALE BAVARESE

È elettrico il sito di Monaco

Q

LINO SINARI

MONACO DI BAVIERA

uando Andreas Tostmann, Ceo di MAN, ha aperto per la prima volta le porte del MAN eMobility Center alla presenza di Hubert Aiwanger, ministro dell’Economia bavarese, di Saki Stimoniaris, Chairman MAN Group Works Council, e di un piccolo gruppo di ospiti ufficiali, è stato subito chiaro che MAN ha ufficialmente aperto le porte alla tecnologia del futuro. “L’elettromobilità - ha affermato Tostmann - è la tecnologia chiave per il trasporto del futuro. MAN sta gestendo questo progetto di sviluppo delle nuove tecnologie insieme ai clienti. Con l’apertura del MAN eMobility Center di Monaco, diamo inizio al processo di produzione in serie del camion del futuro”. Il passaggio dal motore a combustione a motori alternativi è una parte importante del costante rinnovamento dell’azienda, come ha sottolineato Tostmann: “L’Unione Europea richiede una riduzione di CO2 del 30 per cento per i veicoli industriali oltre le 16 tonnellate entro il 2030 rispetto ai livelli attuali. Abbiamo deciso non solo di lavorare per raggiungere questo significativo obiettivo, ma di cogliere quest’opportunità per assumerci una responsabilità sociale e predisporre un’attività sostenibile a lungo termine. Con l’eMobility Center, MAN compie un altro grande passo sia verso il lavoro del futuro sia verso una mobilità priva di emissioni di CO2”. NUOVA STRUTTURA NUOVI PROCESSI

L’autobus urbano Lion’s City E, alimentato a batteria, e il furgone eTGE, anch’esso completamente elettrico, vengono già utilizzati sul mercato come veicoli di serie; il pri mo camion elettrico, eTGM, è stato consegnato a clienti in tutta Europa in piccole unità. Una tendenza destinata a cambiare nel prossimo futuro. “L’elettromobilità - ha sottolineato il ministro

LA CASA DEL LEONE COMPIE IL PRIMO PASSO VERSO LA PRODUZIONE IN SERIE DI CAMION ELETTRICI. IN UN’AREA DI CIRCA 4MILA MQ, I DIPENDENTI STANNO OPERANDO IN CONDIZIONI REALI E RICEVENDO UNA FORMAZIONE SPECIFICA SULLE TECNOLOGIE DI PROSSIMA GENERAZIONE. IN PREVISIONE DI UN AUMENTO DELLA DOMANDA DI E-TRUCK, IL FOCUS È SULLA FORMAZIONE E PROFESSIONALIZZAZIONE PER LA SICURA GESTIONE E MANUTENZIONE DELLE TECNOLOGIE AD ALTA TENSIONE.

dell’economia bavarese Hubert Aiwanger - è un mercato in forte crescita e, se gestito correttamente, può portare grandi benefici sia al mondo del lavoro sia all’ambiente. Investimenti come quelli realizzati da MAN sono un esempio di come l’attrattiva del la Baviera, come area com merciale, possa essere rafforzata a lungo termine. Qui la tutela del clima e l’eco nomia si rafforzano a vicenda”. Presso l’eMobility Center, il costruttore di Monaco sta ponendo le basi per la produzione di e-truck su larga scala

industriale. “Questo - ha aggiunto Tostmann - ci consentirà di soddisfare la domanda di veicoli a emissioni zero per tutte le applicazioni del settore del trasporto (camion, autobus e furgoni), in modo da raggiungere gli obiettivi climatici. In questo modo, MAN continuerà a proporsi come fornitore di soluzioni di trasporto sostenibili e rispettose dell’ambiente”. SEGNI DISTINTIVI

Nuove parti come le batterie e il motore e nuovi com-

ponenti ad alta tensione distinguono l’e-truck dalla sua controparte alimentata in modo convenzionale. Di conseguenza, sono necessarie una nuova struttura del veicolo e fasi di produzione differenti. L’intero ciclo produttivo, compreso il processo di avviamento del veicolo, viene gestito nell’eMobility Center di Monaco, dove sono state previste anche apposite aule tecniche per la formazione del personale: sia durante l’attività produttiva sia in aula, i dipendenti apprendono le fasi del processo e le competenze per assemblare i prodot-

Le nuove tecnologie sono alla base dei processi produttivi nel primo e-Mobility Center del costruttore tedesco MAN.

ti elettrici in serie sulla linea di produzione. “Presso l’e Mobility Center - ha affermato Michael Kobriger, Executive Board Member for Production & Logistics MAN Truck & Bus - stiamo sviluppando le competenze che ci consentiranno di passare alla produzione in serie di veicoli elettrici. Qui, i dipendenti dello stabilimento di Monaco ricevono una formazione sulle tecnologie di prossima generazione direttamente sulle linee di produzione. Il programma di formazione è strutturato per spiegare sia i processi di produzione dei camion elettrici sia come gestire in totale sicurezza le tecnologie ad alta tensione di questi nuovi veicoli. L’esperienza acquisita durante i test viene ora impiegata per l’effettiva produzione dei veicoli elettrici sulla catena di montaggio”. L’obiettivo è produrre, nella fabbrica di Monaco, camion in serie sia a motore endotermico sia elettrico sulla stessa linea di produzione. La mobilità elettrica sta diventando sempre più popolare nel settore dei trasporti sia merci sia passeggeri. Mentre le aziende di trasporto pubblico, in particolare, stanno già elettrizzando le loro flotte di autobus su larga scala, i camion a batteria per la gestione dell’attività di distribuzione e il trasporto a lungo raggio non sono ancora così richiesti sul mercato, il che è in parte dovuto alla mancanza d’iniziative di finanziamento e incentivi commerciali. Tuttavia, MAN prevede che la domanda di veicoli elettrici a

zero emissioni, da parte delle società di trasporto locali, aumenterà nel prossimo futuro, anche per rispondere alle norme di riduzione delle emissioni di CO2. Testando la pro duzione in serie dell’etruck presso l’eMobility Center, il costruttore di Monaco si prepara a gestire l’aumento della domanda di soluzioni di trasporto a impatto climatico zero. Il piano è avere tutti i lavoratori nel reparto di produzione di camion a Monaco di Baviera, formati e qualificati, per la produzione in serie di camion elettrici, entro fine 2023. COMPETENZE SUL FUTURO

Saki Stimoniaris considera il programma di formazione all’eMobility Center un passo importante per garantire la futura redditività dell’azienda. “Vogliamo - ha dichiarato il manager di punta del Gruppo Traton - che il traffico dei veicoli industriali del futuro sia costituito da veicoli climaticamente neutri. Per questo l’apertura dell’eMobility Center è un passo strategicamente importante per il futuro della nostra azienda e per la salvaguardia dei posti di lavoro. Anche con l’arrivo di nuove tecnologie, i dipendenti sono la più grande risorsa di MAN, motivo per cui la formazione professionale e lo sviluppo professionale continuo sono le chiavi del successo. Con le competenze dei dipendenti, sarà possibile produrre con successo que ste tecnologie negli anni a venire”.


IL MONDO DEI TRASPORTI

N° 301 / Luglio-Agosto 2021

Pagina 17

FLOTTE / QUELLA DELLA FAMIGLIA FERRETTI È LA PRIMA AZIENDA CON RATING ESG

Fertrans, la sostenibilità è certificata SI È CONCLUSO CON ESITO POSITIVO L’ITER DI VALUTAZIONE DELLA PIATTAFORMA INTERNAZIONALE ESG PORTAL, CHE HA ASSEGNATO ALL’AZIENDA 72 PER CENTO, SULLA BASE DI UN PUNTEGGIO CALCOLATO SU TUTTI GLI ASPETTI DELLE TRE MACROAREE: ENVIRONMENT, SOCIAL E GOVERNANCE. “OGNI GIORNO PORTIAMO A TERMINE SERVIZI TRANSFRONTALIERI DI RIFIUTI CON MEZZI DI PROPRIETÀ GUIDATI DA PERSONALE SPECIALIZZATO, PER GARANTIRE, OLTRE AL TRASPORTO, IL CORRETTO SMALTIMENTO O RICICLO”, AFFERMA L’AD EMANUELE FERRETTI.

PIACENTINA UNO SCORE DEL

F

MAX CAMPANELLA ALSENO

ertrans è la prima azienda di trasporto italiana a ottenere il Rating ESG, giudizio di sostenibilità certificato dalla piattaforma internazionale ESG Portal, che assegna all’azienda con headquarter a Alseno, in provincia di Piacenza, uno score del 72 per cento. La validazione dell’ente, che esprime un rating misurando la conformità delle imprese ai principi di ESG, sanciti dagli accordi ONU di Parigi 2015 per evitare pericolosi cambiamenti climatici, è stata resa nota come esito di un preciso processo di valutazione. L’iter è iniziato l’11 marzo scorso con la trasmissione, da parte di Fertrans, della documentazione attestante le performance nelle tre macro aree individuate: Environment, Social, Governance; il 1° aprile si è conclusa con esito positivo la “due diligence” e Fertrans è risultata idonea a procedere alla fase di emissione del rating. Già in possesso delle certi-

L’Ad Emanuele Ferretti

ficazioni internazionali Iso 9001 sulla chiarezza dei processi aziendali, Iso 14001 sulla conoscenza del proprio impatto ambientale e Iso 45001 sulla sicurezza dei luoghi di lavoro, Fertrans primo player italiano nel trasporto internazionale di rifiuti - dà lavoro a 577 dipendenti, porta su strada 1.124 veicoli e realizza un fatturato di 45,6 milioni di euro (esercizio 2019). La flotta è costituita unicamente da veicoli Euro V e Euro VI, con un’età media inferiore ai cinque anni. Il rating di ESG Portal rappresenta il risultato di un pun-

teggio calcolato su tutti gli aspetti delle tre macroaree. Per l’impatto ambientale, considerando tutte le attività dirette di Fertrans (il 91 per cento delle attività complessive), il 48 per cento dell’ener-

gia consumata deriva da fonti rinnovabili. Ma l’impegno ecosostenibile dell’azienda è relativo al suo stesso core business. “La domanda di produzione mondiale di rifiuti spiega Emanuele Ferretti,

Amministratore delegato e timoniere dell’azienda con il padre Gianfranco e il fratello Eugenio - è in costante crescita: Fertrans ogni giorno porta a termine servizi transfrontalieri di rifiuti con mezzi di

proprietà guidati da personale specializzato, per garantire, oltre al trasporto, il corretto smaltimento o riciclo”. Quanto alle tematiche sociali, la famiglia Ferretti si è sempre contraddistinta per la massima attenzione alla formazione dei dipendenti, alla regolarità dei contributi previdenziali e assicurativi, alla presenza di figure femminili nonché alla promozione di iniziative culturali e per la crescita della persona. Un sistema di gestione è stato sviluppato ad-hoc per prevenire gli incidenti sul lavoro. Infine la Governance, ovvero la condotta etica, i valori aziendali ma anche la capacità di reagire a eventuali situazioni avverse per garantire la continuità aziendale: in quest’ambito Fertrans si è dotata di un codice etico, che delinea i principi su cui si basa la propria attività aziendale; di un Risk Assessment, con procedure per la prevenzione dei reati; e di un Whistle Blowing, la garanzia di denunciare comportamenti illeciti senza il rischio d’incorrere in ritorsioni.

KRONE COOL LINER

SCANSIONA

A D ES S O r il codice QR pipeù! saperne di

Importatore per l’ Italia: REALTRAILER SRL, Via Marocchi 2/a, 46029 SUZZARA MN, Tel. 0376/536809, info@realtrailer.it, www.realtrailer.it

13:40:32


IL MONDO DEI TRASPORTI

Pagina 18

N° 301 / Luglio-Agosto 2021

GRUPPO CARRARO / FORMAZIONE E ASSISTENZA TOP PER I TRASPORTI ECCEZIONALI

Un autista in cattedra L’HANDOVER SPECIALIST È UN RUOLO CHE NASCE IN AMBITO

MERCEDES-BENZ TRUCKS PER ACCOMPAGNARE I CLIENTI NEL PERCORSO DI SCOPERTA DEL LORO NUOVO ACQUISTO.

MA

LA CONCESSIONARIA VENETA OFFRE MOLTO DI PIÙ GRAZIE ALLA STRAORDINARIA

SERGIO SERAFIN, “DOCENTE”

INTUIZIONE DI

DOPO AVER VESTITO I PANNI DEL TRASPORTATORE PER BEN

Q

CRISTINA ALTIERI

NERVESA DELLA BATTAGLIA

uando arriva lui inizia la festa. Significa che il momento più importante e emozionante del processo di acquisto è giunto: quello della consegna. Chiudere un contratto quando l’oggetto della compravendita è un veicolo pesante comporta solitamente un iter decisionale piuttosto lungo, in considerazione della rilevanza dell’investimento e della necessità di valutare a fondo i costi di gestione. E proprio per onorare l’evento e dare al protagonista l’opportunità di viverlo al meglio MercedesBenz Trucks ha istituito la figura dell’handover specialist, il “professionista del passaggio di consegne”. Nel Gruppo Carraro il ruolo appartiene a Sergio Serafin, che visita a seconda delle necessità le sedi dell’azienda per presenziare al momento in cui l’autista entra in contatto per la prima volta con il mezzo che guiderà negli anni successivi. Con lui l’autotrasportatore effettua un vero e proprio viaggio alla

Sergio Serafin, Handover Specialist e Responsabile vendite trasporti eccezionali Gruppo Carraro.

scoperta del camion, apprendendo il giusto utilizzo degli equipaggiamenti qualunque sia il segmento di appartenenza del trasportatore, anche in quello dei carichi eccezionali, per i quali il nuovo Mercedes-Benz Actros si presta con tutte le sue potenzialità e performance. “Vado a consegnare il mezzo - ci racconta Sergio Serafin - spiego le funzioni del veicolo e poi seguo l’autista nei mesi successivi assistendolo in ogni suo dubbio o difficoltà. Dopo due o tre mesi esiste la possibilità per loro di partecipare a un vero e proprio corso di formazione. Non lo proponiamo contestualmente all’acquisto perché prima il driver deve prendere confidenza con il mezzo, e capire quali sono i punti critici che riscontra quotidianamente”. Dunque, se già MercedesBenz ha avuto un’intuizione importante nell’istituire la figura dell’handover specialist, Serafin è riuscito ad andare oltre con il pieno supporto dell’Amministratore delegato Giovanni Carraro. “Non basta spiegare il libretto delle istruzioni: guidare in modo piutto-

21 LUNGHI ANNI.

sto che in un altro - continua Serafin - conoscere a fondo tutte le funzioni di questi veicoli straordinari costituisce la differenza tra risparmiare e viaggiare sicuri e avere una macchina performante e non saperla utilizzare. Ho avuto questa idea qualche anno fa e quando ne ho parlato a Giovanni Carraro ha subito compreso l’importanza del progetto”. “Il marchio MercedesBenz - spiega Giovanni Carraro - è riconosciuto per il suo valore aggiunto in termini di novità, ma occorre accompagnare il cliente alla scoperta del giusto utilizzo di queste ultime: se ci si limita a parlare al cliente per sigle si rischia di creare confusione. Il nostro messaggio al cliente è “monta con me sul camion” per mettere alla prova insieme tutto quello che c’è”. Il Gruppo Carraro, che dà lavoro a 318 persone, di cui 170 in officina, carrozzeria, ricambi e assistenza h 24, mette a disposizione dei clienti una gamma di servizi particolarmente estesa: dalla configurazione e vendita dei truck, alla formazione degli

SPECIALIZZAZIONE LA PAROLA D’ORDINE DELLA CONCESSIONARIA MERCEDES-BENZ DEL TRIVENETO

Actros SLT, ammiraglia pensata e sviluppata per carichi eccezionali E strema specializzazione è la parola d’ordine in casa Carraro, Concessionaria che sin dalla sua fondazione - nel 1976 ad opera di Francesco Carraro - fa del servizio “cucito” su misura del cliente uno dei suoi punti di forza. Espresso anche nella nuova organizzazione manageriale, che vede la presenza di responsabili Sales in specifici rami di business: se a Matteo Polles è affidato l’incarico di occuparsi dei clienti del settore Enti pubblici e Unimog, Sergio Serafin assume la responsabilità dei Trasporti eccezionali, segmento per il quale MercedesBenz Truck propone la sua ammiraglia Actros in versione SLT, ovvero il massimo possibile. “La sua catena cinematica - spiega Serafin - arriva fino a 10 t di portata. Ma il vero asso nella manica Mercedes-Benz per questa tipologia di trasporti è l’es-

sere nato espressamente per la sua mission: non è la mera trasformazione di un veicolo, ma un mezzo pensato e sviluppato per i trasporti eccezionali”. Quali sono le caratteristiche che fanno dell’Actros SLT un veicolo dedicato a questo segmento? “Dimensioni del telaio, doppio ponte, guida semiautonoma, turbofrizione per la ripartenza, fase di spunto: la cabina - afferma Serafin - è quella dell’Actros, ma dal motore alle caratteristiche fino alle possibili configurazioni, siamo di fronte a un veicolo a sé”. Quali sono le differenze di guida rispetto a un camion tradizionale? “Chi guida un veicolo per il trasporto eccezionale dichiara Serafin - deve essere fortemente preparato e motivato: è tutt’altro che facile, occorre una preparazione specialistica.

Sul piano istituzionale, non servono altre patenti o certificazioni, ma la conoscenza delle normative e il comportamento del veicolo richiedono che chi lo guidi sia consapevole delle differenze sostanziali. Il nostro Gruppo parte da questa necessità per dare al cliente il supporto necessario nella fase di pre e post vendita”. Riferimento nel Triveneto (e non solo), Carraro sta registrando un trend positivo nel settore dei carichi eccezionali. “Nel nostro territorio - conclude Serafin - sono presenti diverse aziende, per lo più di dimensioni medio-piccole, molto specializzate, che si occupano della movimentazione di componenti di grosse dimensioni per settori quali costruzioni navali, industrie meccaniche e raffinerie”


N° 301 / Luglio-Agosto 2021

IL MONDO DEI TRASPORTI

Pagina 19

Mercedes-Benz Actros SLT è il top di gamma con cui la Concessionaria Carraro compete nei trasporti eccezionali.

autisti, all’assistenza in merito alle pratiche per i collaudi, in definitiva tutto ciò che serve a mettere in strada i mezzi. “Collaboriamo con le aziende che producono semirimorchi - aggiunge Serafin in modo da mettere a punto il bilico perfetto per il cliente in base al tipo di mission e alle

esigenze”. Quando il mandato è quello della Stella, è dato quasi per scontato: il Gruppo Carraro va oltre. “Due anni fa abbiamo dato il via - prosegue Sergio Serafin - a Eco Drive Training. Si tratta di una scuola unica in Italia in grado di offrire una serie di servizi

di formazione che permettono agli autisti di acquisire competenze in merito alla guida economica. Dovevamo partire in pompa magna nel 2020 ma purtroppo la pandemia ha rallentato l’iniziativa. Abbiamo lavorato da remoto, ma i mezzi pesanti devono essere messi in strada per venir

compresi a fondo”. I corsi sono personalizzati, a seconda del tipo di impiego. “Con i corsi di guida economica - aggiunge Serafin da vero “insegnante” - riusciamo a coinvolgere anche sei-otto persone alla volta. Si tratta di studiare e verificare tutti i sistemi che il nuovo Actros

mette in campo per aiutare chi guida ad imparare a sfruttarne al meglio le potenzialità. Il mio compito è quello di parlare con le persone, capirne le esigenze, individuare gli errori. Il corso ha una parte teorica e una pratica. Di solito dura due giorni e viene fissato nel fine settimana. Il venerdì mattina gli autisti guidano come sono abituati a fare, nel pomeriggio ci chiudiamo in aula e spiego loro come ottenere il massimo del mezzo che hanno in mano. Il sabato tornano al volante e guidano come dico io. Poi confrontiamo i risultati e lasciamo che siano i numeri a parlare”. Non è semplice convincere le aziende a fermare i loro autisti per due giorni, ma più si progredisce in ambito tecnologico più occorre essere formati. Quando poi i titolari comprendono che se l’autista migliora la guida loro risparmiano sui costi di gestione allora si convincono. Il discorso assume ancora più rilevanza quando si parla di trasporti

eccezionali, nell’ambito dei quali un comportamento di guida corretto rispetto ad un’abitudine impropria può fare davvero la differenza. “I clienti che operano nel trasporto eccezionale - precisa Serafin - si occupano d’infrastrutture, rinnovamento energetico e grandi impianti, e hanno quindi bisogno di movimentare componenti di grande peso. In questo l’Actros è un veicolo straordinario, Intanto dispone, unico nel panorama dell’offerta dei pesanti, del sistema idraulico per poter partire a pieno carico in salita. E poi la versione da 43,8 t permette di scaricare 30 t sulla ralla: sono prestazioni davvero importanti”. Come a Serafin sia venuta l’idea di proporre corsi agli autisti per gestire al meglio i mezzi che guidano ogni giorno è presto detto: egli stesso è stato al volante di un camion per 21 anni, e per questo ispira fiducia nei suoi interlocutori, che lo sentono come un loro pari.

Tutto ciò che desideri, Actros Edition 2. Actros Edition 2. Scopri una nuova dimensione di comfort, sicurezza e design con un numero limitato di esemplari. Ulteriori informazioni sono disponibili al sito www.mercedes-benz-trucks.com

Carraro S.p.A. Concessionaria di Vendita Mercedes-Benz Trucks Via Priula 107 – 31040 -Nervesa della Battaglia (TV) Via Belluno 62 – 32036 – Sedico (BL) Via Martiri della Libertà 350 – 30173 – Venezia-Mestre (VE) Via Noalese 162 – 30036 – Santa Maria di Sala (TV) Via Nazionale 53 – 33040 – Pradamano (UD) www.gruppocarraro.it


IL MONDO DEI TRASPORTI

Pagina 20

N° 301 / Luglio-Agosto 2021

RENAULT TRUCKS / TRANSAR INSERISCE IN FLOTTA SETTE T520 HIGH PERSONALIZZATI

L’acciaio che fortifica l’immagine aziendale CONSEGNATI DALLA CONCESSIONARIA

TORCHIA V.I. DI LAMEZIA TERME (CZ) VANNO AD AGGIUNGERSI AI

60

TRATTORI GIÀ PRESENTI NEL PARCO DELL’AZIENDA DI TRASPORTI LUCANA.

CON CABINA ALTA FULL OPTIONAL, I TRUCK SONO COMPLETI DEL PACCHETTO OPTIROLL CHE ASSICURA CONSUMI RIDOTTI FINO AL

5 PER CENTO DUE GLI

ANNUO.

ALLESTIMENTI CURATI

S

FABIO BASILICO SANT’ARCANGELO

ul piazzale della sede di Sant’Arcangelo (PZ) della Transar Srl sono stati accesi i riflettori sui sette Renault Trucks T520 High personalizzati con un allestimento in acciaio Acitoinox. Consegnati dalla concessionaria Torchia V.I. di Lamezia Terme (CZ) vanno ad aggiungersi ai 60 trattori già presenti nel parco dell’azienda di trasporti lucana. Con cabina alta full optional, i truck sono completi del pacchetto OptiRoll che assicura consumi ridotti fino al 5 per cento annuo. “La nostra scelta - ha dichiarato Rosaria Guarini, Amministratrice della Transar - è caduta sui trattori Renault Trucks T perché siamo convinti che siano veicoli in grado di rispettare tutti i nostri standard aziendali: la sicurezza, l’affidabilità, il comfort, i

DA ACITOINOX: LEGGERO ED EXTREME. bassi consumi e l’indiscussa qualità della Rete assistenziale, senza dimenticare l’immagine aziendale, importantissima quando, come facciamo noi, si lavora per clienti importanti e giustamente esigenti. E poiché per noi il camion non è solo business, ma soprattutto passione, comprando dei veicoli nuovi abbiamo pensato di personalizzarli con i prodotti Acitoinox, un’azienda con la quale collaboriamo da diversi anni con soddisfazione e della quale apprezziamo la professionalità e la serietà. Non si tratta di allestimenti particolarmente ricchi, ma sicuramente interessanti perché danno quel tocco di diverso e di particolare ai veicoli”. Transar è nata nel 2014 ed è cresciuta in fretta. Impegnata in trasporti nazionali e internazionali si occupa di trasporto merci, trasporti in ADR, trasporti industriali e logistica,

trasporti di rifiuti solidi e liquidi. Una gran parte del lavoro si svolge per conto di ENI, nel trasporto di reflui con cisterne; i mezzi operano, inoltre, nelle bonifiche dei terreni e, in generale, in molti settori dell’ecologia. L’azienda, che oggi dà lavoro a una sessantina di persone tra personale viaggiante e amministrativo, dispone di un parco di 60 trattori stradali e 80 tra rimorchi e semirimorchi tra i quali cisterne, piani mobili e centinati. Giorgio Orsenigo, Direttore Commerciale di Renault Trucks Italia, presente alla consegna dei mezzi, ha affermato: “Sono molto fiero della collaborazione nata con Transar. La Gamma T di Renault Trucks si distingue per l’alta affidabilità, le ottime prestazioni e i bassi consumi di carburante. Per Renault Trucks è molto importante la vicinanza al cliente: garantire un servizio di assistenza di alta quali-

tà, disponibile 24 ore su ore, 7 giorni su 7, grazie alla nostra Rete capillare presente su tutto il territorio italiano, è fondamentale.” “Come Concessionaria - ha detto Luigi Torchia, titolare della Torchia V.I. oltre alla vendita mettiamo a disposizione dei clienti tutto il ‘mondo Renault Trucks’, che

va dall’officina ai ricambi, dai corsi per la guida economica a tutti i servizi previsti nell’offerta alla clientela. Per un’azienda di trasporti è fondamentale avere un rapporto stretto con la concessionaria di riferimento, con la sua officina e, in generale, con la Rete. Oggi, quando un’azienda sce-

tRAnSAR

Sede legale: Corso XX Settembre, 69 - Sant’Arcangelo (PZ) Sedi operative: Zona Industriale C. Acquara, Viggiano (PZ) - Zona Artigianale Giardini Calderaro, Sant’Arcangelo (PZ) Fondazione: 2014 Amministratore: Rosaria Guarini Attività: trasporti nazionali e internazionali; trasporti in ADR, trasporti industriali e logistica; trasporti di rifiuti solidi e liquidi Dipendenti: una sessantina tra personale viaggiante e amministrativo Flotta: 60 trattori stradali e 80 tra rimorchi e semirimorchi tra cui cisterne, piani mobili e centinati Internet: transarsrl.com

glie un veicolo è importantissimo poter offrire un’assistenza e, soprattutto, una Rete assistenziale, perché spesso è proprio la Rete che convince a effettuare l’acquisto di un veicolo. Quando esiste una Rete efficiente come quella di Renault Trucks possiamo dire che le vendite arrivano da sole”. La concessionaria Torchia V.I. ha il mandato Renault Trucks per la Calabria dal 1996. In totale, tra officina, forza vendita e amministrazione lavorano una ventina di persone, compresi il titolare Luigi Torchia e la sorella Teresa. Gli accessori montati sui trattori della Transar sono già presenti nel catalogo di Renault Trucks; tutta la Rete ha quindi la possibilità di offrire i prodotti Acitoinox ai propri clienti. I veicoli Renault Trucks T520 acquistati da Transar vantano due tipi di allestimenti, Leggero ed Extreme.

RENAULT TRUCKS ITALIA E GORENT SI ACCORDANO PER LA FORNITURA DEL PRIMO TRUCK ELETTRICO IN ITALIA

R

D Wide Zero Emissions e il ciclo virtuoso dell’igiene urbana enault Trucks Italia e la fiorentina Gorent Spa, azienda leader nel noleggio di veicoli per servizi di igiene urbana, hanno siglato un accordo per l’acquisto del primo veicolo industriale elettrico in Italia: si tratta di un Renault Trucks D Wide Z.E. dotato di compattatore per la raccolta dei rifiuti. Questa collaborazione segna l’inizio di una “rivoluzione green” del Paese verso la mobilità elettrica pesante, per ridurre le emissioni inquinanti e migliorare la qualità dell’ambiente nelle città italiane. Gorent è pronta per intervenire nell’ambito del trasporto rifiuti con una flotta elettrica che impatta sul territorio in modo sostenibile. Il compattatore di rifiuti elettrico lavora anche nelle parti più sensibili della città, andando a eliminare la problematica delle emissioni. L’azienda ha un modello di business che si basa sull’economia circolare e sul rendere concreto il valore del rispetto per l’ambiente attraverso scelte pragmatiche. Gorent combatte le polveri sottili e le emissioni di CO2 non solo introducendo i camion pesanti elettrici, che restano la punta di diamante del suo business model, ma anche attraverso l’investimento progressivo in veicoli alimentati con carburanti eco-sostenibili. Da anni, il Gruppo Gorent esercita un ruolo strategico nella transizione energetica, studiando possibili fonti di energia alter-

native. Una progettualità che sfocia nel cosiddetto “Villaggio della Sostenibilità”, ovvero un centro per lo sviluppo dell’economia circolare che avrà un’area di 25mila metri quadrati a Firenze Sud (nel comune di Bagno a Ripoli), dotato anche di una stazione di ricarica elettrica e dove si produrrà energia da fotovoltaico, da biometano e dal riciclaggio delle plastiche residue, a impatto zero. “A livello europeo - ha ricordato Pierre Sirolli, Ad di Renault Trucks Italia (a sinistra nella foto iniseme a Furio Fabbri, Presidente e Amministratore delegato di Gorent Spa) - molti clienti hanno già scelto Renault Trucks come partner per la rivoluzione green. Ora il primo veicolo industriale elettrico arriva in Italia”. Inoltre, Gorent è promotrice dell’iniziativa “Puliamo la tua piazza”, il roadshow firmato Go Green (brand ombrello che firma tutte le iniziative concrete a favore della sostenibilità condotte dal Gruppo Gorent) che porta in tutta Italia e presenta ai cittadini gli innovativi mezzi elettrici Renault Trucks per l’igiene urbana. Il tour in 100 piazze della Penisola è partito a fine maggio da Firenze (in concomitanza con la consegna del primo D Wide Z.E. a Gorent), continuerà da settembre dopo lo stop di agosto per poi proseguire nel 2022.


ALLESTIMENTO ALLE ESTIMENTO VEICOLI INDU INDUSTRIALI STRIALI E COMM COMMERCIALI MERCIALI

IL FUTURO F UTURO È VERSO ll’ECONOM l’ECONOMIA ’ECONOM ECONOMMIA CIRCO CIRCOLARE OLARE

PA R T N E R

NO RD-EST

Via Vicenz Vicenza, za, 136 - 36034 S. Tomio T di MMalo alo (Vice (Vicenza) (Vicen nza) - Tel. +39 0445 04445 588110 - Fax +399 0445 588027

www.golo.it www w.golo.it


IL MONDO DEI TRASPORTI

Pagina 22

N° 301 / Luglio-Agosto 2021

RENAULT TRUCKS / LE STRATEGIE VERSO IL LANCIO DELLA GAMMA TCK EVOLUTION

Immersione totale nella mobilità elettrica R

PIERRE SIROLLI, AMMINISTRATORE DELEGATO DI RENAULT TRUCKS ITALIA, ILLUSTRA NEI DETTAGLI L’IMPEGNO DEL COSTRUTTORE FRANCESE PER ACCELERARE LO SVILUPPO DEL TRASPORTO A ZERO EMISSIONI E FACILITARE LA TRANSIZIONE ENERGETICA DEGLI AUTOTRASPORTATORI. LA LOSANGA È ORA AL FIANCO DEI CLIENTI CON LA GAMMA DI VEICOLI Z.E., CON PTT DA 3,1 A 26 T (MASTER, D E D WIDE) MA IN PROGRAMMA C’È ANCHE IL LANCIO, IL PROSSIMO AUTUNNO, DELLA GAMMA PESANTE TCK EVOLUTION PARTICOLARMENTE ATTESA DAL MERCATO.

FABIO BASILICO ZINGONIA

enault Trucks accelera sulla mobilità elettrica. Nel corso di una conferenza stampa online, Pierre Sirolli, Amministratore delegato di Renault Trucks Italia, ha illustrato nei dettagli l’impegno del costruttore francese per accelerare lo sviluppo del trasporto a zero emission e facilitare la transizione energetica degli autotrasportatori. La Losanga è ora al fianco dei clienti con la gamma di veicoli Z.E., con PTT da 3,1 a 26 t (Master, D e D Wide) ma in programma c’è il lancio il prossimo autunno della gamma pesante TCK Evolution. I veicoli elettrici sono dunque al centro della strategia di Renault Trucks, che ha la chiara ambizione di diventare leader in questo settore. Da sempre pioniera, nel 2008 la Casa costruttrice francese ha messo a punto il primo camion elettrico e nel 2010 diede il via alla prima vendita. Nella sua strategia, la Losanga punta a una penetrazione di vendita dei veicoli elettrici a un livello del 10 per cento dei volumi totali nel 2025, del 35 per cento nel 2030, con l’ambizione complessiva di essere al 100 per cento senza combustibili fossili a livello di flotta in esercizio nel 2050. Si tratta di un obiettivo obbligatorio per raggiungere l’accordo di Parigi per il quale Renault Trucks si è impegnata. La gamma attuale Z.E. comprende Master Z.E., veicolo commerciale versatile e ideale per operare nelle zone a traffico limitato con un massimo di 120 km di autonomia, D Z.E., la soluzione elettrica per la distribuzione urbana, con un’autonomia fino a 400 km, D Wide Z.E., la soluzione ideale per la raccolta dei rifiuti urbani con un massimo di 11 tonnellate di carico utile e autonomia fino a 180 km con furgonatura e 100 km con allestimento per rifiuti. I veicoli elettrici Renault Trucks sono fabbricati in Francia, a Blainville-sur-Orne e a Batilly, in stabilimenti certificati ISO 14001. Master Z.E. è proposto in 6 versioni (3 lunghezze e 2 altezze) con PTT di 3,1 e 3,5 t, tre modelli (furgone, pianale cabinato e telaio cabinato), batterie agli ioni di litio da 33 kWh e motore elettrico con potenza massima di 57 kW e coppia massima di 225 Nm. Il volume disponibile arriva a un massimo di 22 mc e il carico utile fino a 1,7 tonnellate. D Z.E. da 16 t è proposto con due passi di 4.400 e 5.300 mm, batterie agli ioni di litio da 200 kWh a 400 kWh, motore elettrico con

potenza massima di 185 kW, potenza continua di 130 kW e coppia massima di 425 Nm. D Wide Z.E. da 26 t è dotato di due motori elettrici con potenza massima di 370 KW, potenza continua di 260 kW e coppia massima di 850 Nm, batterie agli ioni di litio da 200 a 265 kWh. La base delle ruote misura 3.900 mm e altre sono disponibili su richiesta. “Perché abbiamo bisogno di un trasporto sostenibile?”: è questa la domanda d’esordio dell’intervento di Sirolli. La risposta, secondo l’Ad di Renault Trucks Italia, va ricercata nell’analisi delle tendenze globali in atto e delle conseguenti problematiche:

decarbonizzazione e qualità dell’aria, rapida urbanizzazione, crescente popolazione glo bale, nuove tecnologie, crescente commercio elettronico, nuove richieste della società. “La strategia di Renault Trucks per la mobilità elettrica - ha dichiarato Sirolli identifica il brand come produttore responsabile nei confronti del clima, delle risorse e delle persone. Ad esempio, nei progetti rientra il portare al 65 per cento l’utilizzo di energie rinnovabili nelle nostre attività entro il 2025, l’alimentazione completa con energie rinnovabili dei nostri siti, lo sviluppo dell’economia circolare aumentando la

riciclabilità dei veicoli nella nostra fabbrica di camion usati e riciclando parti e componenti usati in collaborazione con Indra, la riduzione del nostro tasso di infortuni sul lavoro di almeno il 50 per cen to entro il 2030 e l’aumento della quota di donne leader ad almeno il 35 per ceno entro il 2030”. Il grande passaggio all’elettrificazione si traduce per Renault Trucks anche in fruttuose partnership: quella di Volvo Energy, nuova divisione del Gruppo Volvo, a cui appartiene anche la Losanga, che lavora sul ciclo di vita delle batterie, sull’infrastruttura di ricarica e su tutti i

campi di interesse che ruotano intorno alla soluzione elettrica; la partnership con la tedesca Daimler riguarda le celle a combustibile e l’alternativa rappresentata dall’idrogeno; nell’elenco figurano anche collaborazione con Samsung per le batterie e con Isuzu e Renault per la mobilità urbana. “Sono già numerosi i clienti italiani che si fidano di noi e delle nostre proposte innovative - ha aggiunto Pierre Sirolli - Con Gorent, azienda leader specializzata nel noleggio di veicoli dedicati ai servizi di igiene urbano, abbiamo siglato un importante accordo per l’acquisto del primo veicolo industriale

La filiale italiana di Renault Trucks, nella persona dell’Amministratore delegato Pierre Sirolli, è pronta alla rivoluzione elettrica.

elettrico in Italia, un D Wide Z.E. dotato di compattatore per la raccolta dei rifiuti. Inoltre, con DHL Express Italy, azienda leader di mercato nel settore del trasporto espresso internazionale, stiamo costruendo il futuro del trasporto merci dell’ultimo miglio nelle zone urbane grazie a una partnership che prevede il test del nuovo Master Z.E. in tre città italiane”. L’offerta elettrica di Renault Trucks è completa e tiene in considerazione veicolo (tra l’altro con l’offerta di camion usati), riparazione e manutenzione (presso la rete con contratti di servizio e up-time), soluzioni per le batterie (ottimizzazione delle applicazioni per gamma, durata e peso), finanziamento e assicurazione (acquisto, noleggio, finanziamento del veicolo e delle infrastrutture). Renault Trucks ha anche calcolato, sulla base dei dati dell’Agenzia internazionale dell’energia, le emissioni di CO2 dalla sorgente alla ruota nelle applicazioni distribuzione e raccolta dei rifiuti, mettendo a confronto diesel, metano compresso e propulsione elettrica Z.E.. Nell’ambito della distribuzione, con un profilo urbano di 150 km, ai 123 kg di CO2 emessi da un veicolo a gasolio su una missione e ai 111 kg del veicolo a CNG si contrappongono i 45,3 kg del veicolo Z.E.. I valori corrispondenti per l’applicazione raccolta dei rifiuti, in un profilo urbano di 73 km, calcolati per una missione sono 159, 143 e 36,9 kg di CO2. “Nel 2023 inizieremo a produrre a Bourg-en-Bresse i camion elettrici pesanti della gamma TCK Evolution - ha concluso Pierre Sirolli - Arriveranno un trattore 4x2 per distribuzione regionale e un veicolo per costruzioni urbane”.


N° 301 / Luglio-Agosto 2021

IL MONDO DEI TRASPORTI

Pagina 23

IVECO / CINQUE S-WAY E UN EUROCARGO ALLA DUE ESSE DISTRIBUZIONI

L’autentica forza dell’import-export FAST, RAMO OPERATIVO NEI TRASPORTI DELL’AZIENDA CON HEADQUARTER A MARTINA FRANCA, INSERISCE NEL PARCO DUE TRATTORI S-WAY, TRE CABINATI S-WAY E UN EUROCARGO, TUTTI OPERATIVI NEL CENTRO-SUD ITALIA PER L’IMPORT-EXPORT DI ARTICOLI ARREDO PER LA CASA, FERRAMENTA E ACCESSORI MARE. LA FORNITURA È STATA SEGUITA DALLA CONCESSIONARIA SAICAR INDUSTRIALI, CHE SI OCCUPERÀ ANCHE DEL SERVIZIO DI ASSISTENZA.

S

LINO SINARI MASSAFRA

ono sei i veicoli Iveco due trattori S-Way, tre cabinati S-Way e un Eurocargo - che Fast, azienda che si occupa del ramo trasporti per il gruppo Due Esse Distribuzioni, inserisce nel parco mezzi. Alla consegna ufficiale, che si è tenuta a Massafra, in provincia di Taranto, hanno partecipato Michele e Stefano Scatigna, titolari del gruppo Due Esse Distribuzioni, Gianpiero Vitale, Iveco Italy Market district manager per l’area di riferimento, Giulio Musca e Gianni Longo, rispettivamente titolare e venditore gamma Medium-Heavy della Concessionaria Saicar Industriali. I due trattori, modello AS440S51T/FP, e i tre cabinati S-Way, modello AS260S51Y/FS, sono equipaggiati con cambio automatizzato 12 marce, intarder, climatizzatore automatico e clima da fermo, ADR, riscaldatore e luci full led. Inoltre, i veicoli sono dotati di Connectivity Box, che rende i mezzi costantemente connes-

Da sinistra: Gianpiero Vitale, Iveco Italy Market District Manager; Michele Scatigna, titolare Due Esse Distribuzioni; Giulio Musca e Giovanni Longo, rispettivamente titolare e venditore Heavy & Medium della Concessionaria Iveco Saicar Industriali.

si. L’Eurocargo, modello ML120E25/FP, è dotato di Pack top comfort, che aumenta la vivibilità a bordo del mezzo, e ADR. I veicoli verranno impiegati nel Centro-Sud Italia per l’importexport di articoli arredo per la casa, ferramenta e accessori mare. L’Eurocargo è stato allestito con furgone

isolato e sponda caricatrice per svolgere attività di consegna e distribuzione presso i propri punti vendita. I tre cabinati sono allestiti con furgone isolato e sponda caricatrice in ADR per incentivare l’attività d’import-export, unitamente ai due trattori, completi di semirimorchio. Con l’Eurocargo, il truck

medio efficiente, maneggevole e versatile, e l’S-Way, ammiraglia di casa Iveco che punta su efficienza dei consumi, tecnologie all’avanguardia e sistemi avanzati per la connettività, Fast si assicura le massime prestazioni. “Abbiamo scelto Iveco – afferma Michele Scatigna – per la qualità dei suoi prodotti e, in particolare, per la gamma S-Way. Inoltre, il servizio di assistenza garantito dalla concessionaria Saicar soddisfa pienamente le esigenze della nostra azienda”. Con headquarter a Martina Franca, il gruppo Due Esse Distribuzioni, di cui fa parte Fast per il ramo trasporti, è stato fondato da Stefano Scatigna una quarantina di anni fa e conta circa 150 dipendenti. Negli ultimi anni, il fondatore è coadiuvato nelle attività dal figlio Michele. La fornitura è stata seguita da Saicar Industriali, concessionaria Iveco di riferimento per il territorio dal 1978. L’azienda si occupa della vendita di veicoli Iveco, ricambi originali, assistenza per manutenzione e riparazione di veicoli commerciali e industriali.


IL MONDO DEI TRASPORTI

Pagina 24

N° 301 / Luglio-Agosto 2021

VOLVO TRUCKS / UN ALLARME ACUSTICO CON SUONI UNICI AVVERTE GLI UTENTI DELLA STRADA

Le note piacevoli dell’elettrico

IL SISTEMA DI ALLARME ACUSTICO CON SUONI UNICI AVVERTE PEDONI, CICLISTI E ALTRI UTENTI DELLA STRADA DELL’ARRIVO DEL MEZZO ELETTRICO, ALTRIMENTI QUASI DEL TUTTO SILENZIOSO E QUINDI POCO PERCEPIBILE. ALLO STESSO TEMPO, I SUONI SONO CONCEPITI PER ESSERE PIACEVOLI E DISCRETI, SIA PER IL CONDUCENTE CHE PER LE ALTRE PERSONE NELLE VICINANZE. CON IL RECENTE AVVIO DELLA VENDITA DI TRE NUOVI MODELLI DI CAMION ELETTRICI PESANTI - FH, FM E FMX - VOLVO TRUCKS VANTA ADESSO UN’IMPORTANTE GAMMA DI SEI CAMION ELETTRICI PER CARICHI DI MEDIA ENTITÀ E PESANTI.

A

FABIO BASILICO GÖTEBORG

bituata per natura a misurarsi con le innovazioni per la sicurezza, Volvo Trucks ha messo a punto una nuova utilissima so luzione che migliora la fruibilità dei camion elettrici. Si tratta di un sistema di allarme acustico con suoni unici che avverte pedoni, ciclisti e altri utenti della strada dell’arrivo del mezzo, altrimenti quasi del tutto silenzioso e quindi poco percepibile. Allo stesso tempo, i suoni sono concepiti per essere piacevoli e discreti, sia per il conducente che per le altre persone nelle vicinanze. A livello normativo, da luglio tutti i nuovi veicoli elettrici dell’Unione Europea devono emettere un certo livello sonoro quando viaggiano a velocità inferiori a 20 km/h. Il livello sonoro richiesto dipende dalla velocità e aumenta in proporzione con quest’ultima. Alla velocità massima di 20 km/h dovrebbe essere di almeno 56 decibel. Gli Stati Uniti hanno una legislazione simile per i veicoli che viaggiano a 30 km/h o più lentamente. Se il veicolo è troppo silenzioso, è necessario aggiungere un sistema di allarme acustico del veicolo (AVAS) esterno. Quindi, per soddisfare i nuovi requisiti e allo stesso tempo mantenere i vantaggi dei livelli di rumorosità inferiori offerti dai veicoli elettrici, Volvo Trucks ha sviluppato un insieme unico di suoni di livello elevato per i suoi modelli di camion elettrici. “Accogliamo con favore questa nuova legislazione - spiega Anna Wrige Berling, Traffic and Product Safety Director presso Volvo Trucks - Sin dall’infanzia, abbiamo imparato a fare affidamento non solo su ciò che vediamo, ma anche su ciò che sentiamo quando ci troviamo nel traffico, a tal punto che talvolta

non guardiamo nemmeno prima di attraversare la strada! Con il nostro nuovo sistema di allarme, vogliamo contribuire a garantire che pedoni e ciclisti si accorgano quando sono vicini ai nostri camion elettrici”. La gamma di suoni è il risultato di approfonditi test e ricerche da parte degli esperti di acustica del Gruppo Volvo. “Siamo particolarmente orgogliosi di aver sviluppato suoni di alta qualità che sono abbastanza percettibili da avvertire le persone vicine al camion e al tempo stesso piacevoli per il conducente e gli altri utenti della strada - aggiunge Anna Wrige Berling - È importante notare che i veicoli saranno molto più silenziosi dei camion tradizionali. I suoni sono progettati per non penetrare attraverso le pareti. I nostri camion elettrici consentiranno comunque consegne notturne silenziose e miglioreranno le condizioni di lavoro dei conducenti oltre a favorire un ambiente più silenzioso e pulito”. Il sistema di allarme acu-

stico sviluppato da Volvo per i veicoli elettrici in realtà non è costituito da un solo suono ma da quattro suoni diversi, che informano le persone vicine di ciò che sta facendo il camion: marcia avanti, minimo, retromarcia, ecc.. I suoni varieranno di intensità, in base alla velocità del camion, e cambieranno di frequenza durante l’accelerazione e la decelerazione. Con il recente avvio della vendita di tre nuovi modelli di camion elettrici pesanti - FH, FM e FMX Vol vo Trucks vanta adesso un’importante gamma di sei camion elettrici per carichi di media entità e pesanti. Attualmente è la gamma di camion elettrici commerciali più com pleta del settore. “I camion elettrici saranno sempre più comuni nelle strade e, aggiungendo il sistema di allarme acustico ai nostri veicoli elettrici, siamo fieri di procedere sul doppio binario delle emissioni zero e dell’eliminazione degli incidenti stradali, come del resto auspichiamo da molto tempo”, dice ancora Anna Wrige Berling.

Con l’inizio delle vendite dei tre nuovi modelli completamente elettrici per impieghi gravosi, Volvo Trucks ritiene che sia il momento giusto per una rapida ripresa dell’elettrificazione del trasporto pesante su strada. Questa prospettiva positiva si basa sulla capacità dei veicoli elettrici di Volvo di soddisfare un’ampia varietà di esigenze di trasporto. Secondo il costruttore, nell’UE quasi la metà di tutti i trasporti su camion potrebbe essere elettrificata nel prossimo futuro. I grandi acquirenti di trasporti nazionali e internazionali mostrano un forte interesse per i veicoli elettrici. Un interesse trainato dai loro ambiziosi obiettivi climatici, oltre che dalle richieste di decarbonizzazione e trasporti più puliti da parte dei consumatori. “Sempre più aziende di trasporto si stanno rendendo conto di dover iniziare il loro percorso di elettrificazione subito, sia nel rispetto dell’ambiente che per motivi di concorrenza, per soddisfare le esigenze dei clienti che chiedono spedi-

Silenzio fa rima con sicurezza per la famiglia di pesanti stradali del costruttore svedese Volvo.

zioni sostenibili. Con l’offerta ampia e diversificata di Volvo Trucks, è assolutamente possibile per molte più aziende di trasporto passare all’elettrico”, afferma Roger Alm, Presidente di Volvo Trucks. Con l’inizio delle vendite di Volvo FH e Volvo FM, il trasporto elettrificato è ora possibile non solo nelle aree urbane, ma anche per il traffico regionale interurbano. Inoltre, il nuovo modello elettrico FMX sta realizzando nuovi modi per rendere le operazioni di trasporto più silenziose e pulite nel settore della cantieristica. La produzione dei nuovi modelli elettrici per l’Europa inizierà nella seconda metà del 2022. E andranno ad aggiungersi a Volvo FL Electric e Volvo FE Electric per la distribuzione urbana e la raccolta rifiuti, che vengono prodotti in serie dal 2019 per lo stesso mercato. In Nord America, le vendite di VNR Electric sono invece iniziate nel dicembre 2020. Con l’inizio delle vendite dei nuovi modelli di veicoli, Volvo Trucks dispone attualmente di una gamma di sei veicoli elettrici per carichi medi e pesanti, che diventa così la gamma di veicoli elettrici commerciali più completa del settore. Con l’aggiunta dei nuovi prodotti con capacità di carico più elevate, catene cinematiche più potenti e un’autonomia fino a 300 km, la gamma elettrica di Volvo Trucks potrebbe coprire circa il 45 per cento di tutte le merci trasportate oggi in Europa, secondo gli studi statistici Eurostat. Può così offrire un contributo importante per ridurre l’impatto climatico delle merci su strada, che secondo le statistiche ufficiali sono responsabili di circa il 6 per cento delle emissioni totali di CO2 nell’Unione Europea. “Vi è un enorme potenziale di elettrificazione dei trasporti

su camion in Europa e in altre parti del mondo, in un futuro molto prossimo - dice ancora Roger Alm - Per dimostrarlo, ci siamo posti l’ambizioso obiettivo di far sì che i veicoli elettrici rappresentino la metà delle nostre vendite entro il 2030. E i tre nuovi veicoli pesanti che stiamo lanciando segnano un enorme passo avanti verso il raggiungimento di questo obiettivo”. Oltre ai veicoli elettrici, il programma di elettrificazione di Volvo Trucks include un ecosistema completo, con numerose soluzioni di assistenza, manutenzione e finanziamento e di altro tipo che possono favorire una transizione più rapida e semplice al trasporto elettrificato. Un approccio olistico aiuterà i clienti a rimanere produttivi e ad avere il pieno controllo della loro nuova flotta di trasporto elettrico. E, sempre secondo Volvo Trucks, in un futuro non immediato anche i trasporti pesanti a lungo raggio potranno essere effettuati con veicoli elettrici. Per rispondere a queste richieste complesse sia di capacità di carico elevata che di un notevole incremento dell’autonomia, la Casa svedese prevede di utilizzare celle a combustibile a idrogeno per generare l’elettricità necessaria. L’obiettivo è iniziare a commercializzare veicoli elettrici a celle a combustibile nella seconda metà di questo decennio. Volvo FH, FM e FMX Electric garantiscono un’autonomia fino a 300 km, una potenza continua di 490 kW e coppia massima di 2.400 Nm. Per FE Electric l’autonomia arriva fino a 200 km con potenza continua di 330 kW e coppia massima fino a 850 Nm. Infine, per Volvo FL Electric l’autonomia è fino a 300 km, la potenza continua è pari a 165 kW e la coppia mas sima arriva fino a 425 Nm.


IL MONDO DEI TRASPORTI

N° 301 / Luglio-Agosto 2021

Pagina 25

THERMO KING / OCADO RETAIL SCEGLIE LE UNITÀ ADVANCER

Tutto il meglio per la home delivery

T

LINO SINARI BRUXELLES

hermo King, azienda leader nelle soluzioni di controllo della temperatura per il trasporto e marchio di Trane Technologies, dopo essere rimasta favorevolmente colpita dalla funzionalità e dal flusso d’aria del sistema di refrigerazione Advancer, Ocado, la più grande piattaforma di vendita al dettaglio online e a domicilio di prodotti alimentari del Regno Unito, ha ordinato 27 nuove unità Advancer A-400 a Marshall Fleet Solutions, Concessionaria ufficiale Thermo King nel Regno

d’aria, così come il significativo risparmio di carburante, determinano un costo di proprietà decisamente più ridotto per i semirimorchi dotati di unità Advancer. Di conseguenza, quest’anno abbiamo deciso di aumentare il numero di unità Advancer nel nostro parco veicoli a due piani, per un totale di 27 nuovi semirimorchi equipaggiati con Advancer che entreranno in servizio nei prossimi mesi”. “Introducendo Advancer ha dichiarato David O’Gorman, Direttore vendite regionale di Thermo King - abbiamo voluto re-immaginare l’unità di refrigerazione per

FAVOREVOLMENTE COLPITA DALLE PRESTAZIONI TECNOLOGICHE DELLE NUOVE UNITÀ PER SEMIRIMORCHI DEL PRODUTTORE EUROPEO DI GRUPPI FRIGORIFERI, MARCHIO DI TRANE TECHNOLOGIES, PER AGGIORNARE IL PARCO VEICOLI LA PIATTAFORMA DI VENDITA AL DETTAGLIO ONLINE DI PRODOTTI ALIMENTARI DEL

REGNO UNITO NE HA ORDINATE 27.

semirimorchi e ridefinire le possibilità della logistica della catena del freddo. Siamo orgogliosi di ricevere feedback positivi da Ocado e da altri clienti in tutta Europa che hanno la possibilità di sperimentare in prima persona le prestazioni ineguagliabili offerte dalla Serie A. Siamo felici di sapere che l’innovativo sistema di controllo della temperatura Advancer, con i massimi livelli di protezione del carico e risparmio di carburante, stiano facendo la differenza nelle loro operazioni quotidiane”. Le unità Advancer di Thermo King saranno montate sui semirimorchi monotemperatu-

ra a due piani di Paneltex, che percorreranno oltre 135mila km l’anno per i servizi di trasporto di Ocado, sette giorni su sette. Questi semirimorchi rientrano in un aggiornamento generale del parco veicoli di Ocado, insieme a 46 semirimorchi completamente refrigerati di Thermo King che saranno aggiunti nel corso del 2021. I nuovi mezzi sono dotati dei sistemi di refrigerazione Advancer o SLXi Spectrum di Thermo King, forniti, installati e sottoposti a manutenzione da Marshall Fleet Solutions, concessionario ufficiale di Thermo King per il Regno Unito. “Fin dai primi giorni, le unità Advancer hanno di-

mostrato di essere la svolta per noi”. Abbiamo lavorato a stretto contatto sia con Marshall Fleet Solutions che con Paneltex per incorporare il maggior numero possibile di unità Advancer nei nostri veicoli a due piani il più rapidamente possibile”, ha dichiarato Graham. “Negli ultimi 12 mesi, durante la pandemia, la domanda nel nostro settore è stata insaziabile e non ci sono segni di calo, dal momento che lo shopping online a domicilio è diventato la nuova normalità. Ognuno di questi semirimorchi dotati di unità Advancer può contenere l’equivalente di 12 furgoni di prodotti alimentari, pertanto

stanno giocando un ruolo vitale nel soddisfare le nostre esigenze aziendali e operative”. Le unità Advancer Serie A presentano caratteristiche esclusive che consentono di affrontare con successo un’ampia gamma di sfide operative e finanziarie, tra cui: abbassamento della temperatura fino al 40 per cento più rapido e consumi di carburante fino al 30 per cento più bassi rispetto ai valori medi del mercato; flusso d’aria totalmente variabile che può essere regolato per singolo viaggio e carico ed è indipendente dalla velocità motore dell’unità; livelli ineguagliati di efficienza elettrica e risparmio di

www.aceservices.it

Unito. Ocado raggiunge oltre il 74 per cento delle famiglie britanniche, con più di 330mila ordini a settimana. Il nuovo parco veicoli sarà usato per il trasferimento dai quattro principali CFC (Centri di approvvigionamento clienti) di Ocado ai siti regionali. “Da quando abbiamo acquistato la prima unità Thermo King Advancer all’inizio di quest’anno - ha dichiarato Graham Thomas, Responsabile del parco veicoli di Ocado Group - tutto sembra funzionare al meglio. Queste unità si adattano perfettamente alle nostre operazioni di trasporto. I miglioramenti in termini di funzionalità dell’unità e del flusso

carburante che contribuiscono a ridurre l’impronta di CO2 e motori caratterizzati dal 50 per cento di emissioni in meno rispetto al massimo consentito dalle più recenti norme NRMM Fase V; controllo elettronico della velocità motore sulle unità A-400 e A500, le prime sul mercato a garantire una totale trasparenza su livelli e consumi di carburante. I dati sui consumi del carburante saranno registrati, visualizzati e resi disponibili da remoto tramite sistemi telematici; manutenzione facilitata e dai costi inferiori rispetto ai modelli precedenti grazie a sensori che forniscono maggiori informazioni su motore, carburante, batteria e prestazioni di altri componenti chiave; sistemi intelligenti di serie per la gestione del parco veicoli, essendo l’unità Advancer la prima a offrire nel prezzo di acquisto due anni di connettività completa tramite sistemi telematici.

IL TUO CARICO IN MANI SICURE 100% ITALIANA TESTATA, SICURA E AFFIDABILE COMPONENTI DI ALTA QUALITÀ

PER IL TUO CARICO SCEGLI ANTEO, SPONDE CARICATRICI DAL 1969

www.anteo.com /AnteoTailLifts

RICAMBI ORIGINALI ENTRO 24H IN TUTTO IL MONDO • OLTRE 130 MODELLI, ANCHE PERSONALIZZABILI • CENTRI DI ASSISTENZA IN EUROPA E NEL MONDO

/ANTEOSALES


IL MONDO DEI TRASPORTI

Pagina 26

N° 301 / Luglio-Agosto 2021

IVECO / A DUE ANNI DAL LANCIO SI RINNOVA L’AMMIRAGLIA DEL COSTRUTTORE

Trionfa l’approccio smart: ora

S

FABIO BASILICO TORINO

ono bastati solo due anni per fare dell’Iveco SWay un punto di riferimento del mercato in grado di fare innovazione e apportare cambiamenti di valore epocale. Dal lancio avvenuto nel 2019, l’ammiraglia del costruttore italiano è ora pronta a fare un altro grande balzo in avanti, proponendosi sul mercato in configurazione rinnovata e con contenuti assolutamente all’avanguardia. Oggi S-Way rappresenta un punto di svolta nel settore perché cambia il modo in cui i conducenti interagiscono con il veicolo, grazie all’esclusivo compagno di viaggio digitale Iveco Driver Pal con i comandi vocali di Amazon Alexa. L’APPROCCIO È SMART

Il nuovo S-Way è stato presentato insieme all’ultima generazione del Daily (di cui riferiamo nelle pagine dedicate all’interno dell’inserto LCV) in occasione di un innovativo evento digitale, trasmesso in streaming sulla piattaforma Iveco Live Channel, la nuova piattaforma di trasmissione dedicata al mondo dei trasporti. In 60 minuti di evento, con set cinematografico appositamente progettato e costruito, la Casa torinese ha invitato gli ospiti ad “adottare un approccio smart” con i nuovi veicoli, che portano innovazione, connettività, TCO e sostenibilità al livello successivo. Thomas Hilse, Iveco Brand President, ha dichiarato: “Abbiamo fortemente voluto che l’evento di lancio comunicasse in modo chiaro e coinvolgente gli esclusivi vantaggi del nuovo Daily e di S-Way. Fin dall’apertura dell’evento, abbiamo dimostrato come stiamo rivoluzionando il modo in cui i nostri clienti comunicano con i nostri veicoli. Abbiamo dato prova di metterli al centro dello sviluppo dei nostri prodotti e servizi, con una sola linea guida: rendere la loro vita e il loro lavoro più in telligenti, facili, gradevoli e produttivi. Per questo li invitiamo a passare al livello successivo insieme a noi, adottando un approccio smart!”. Se la recente presentazione del T-Way per le applicazioni

pesanti off-road ha dimostrato tutta la capacità innovativa che Iveco ha racchiuso nella famiglia Way, ora al completo, tocca all’S-Way dimostrare la validità del processo in corso nelle applicazioni a cui è destinato, quelle pesanti onroad. La nuova gamma, che nasce nello stabilimento Iveco di Madrid, è stata progettata per offrire un sostanziale valore aggiunto e produttività ai gestori di flotte, aumentando ancora l’efficienza nei consumi (già tra le migliori) con nuove motorizzazioni e un assale posteriore di nuova generazione, tecnologie all’avanguardia e servizi innovativi sviluppati su misura per le esigenze del cliente. Non a caso, la nuova gamma porta la connettività e la centralità del driver al massimo livello grazie allo straordinario sistema Iveco Driver Pal con i comandi vocali di Amazon Alexa, alle nuove funzionalità a vanzate e ai servizi connessi. “Il nuovo S-Way è un veicolo davvero all’avanguardia - ha detto ancora

Thomas Hilse - È sostenibile ed efficiente, ed è stato progettato con profondo spirito imprenditoriale. Mette il cliente al centro di tutto, rivoluzionando il modo di comunicare con il veicolo. Il mondo si muove in fretta, e il settore dei trasporti non solo deve tenere il passo, ma cercare di anticipare e guidare il cambiamento. Ed è proprio ciò che Iveco sta facendo”. AL LIVELLO SUCCESSIVO

Giuliano Giovannini, Head of Medium & Heavy Line Product Management, ha poi affermato: “È insolito che un costruttore proponga un importante aggiornamento di gamma a soli due anni dal lancio di un modello totalmente nuovo. Iveco lo fa con il nuovo S-Way, migliorando un veicolo che figurava già tra i migliori della sua categoria. Oggi, con il nuovo S-Way, passiamo al livello successivo, con un grado di innovazione senza pari sul mercato.

Offriamo ai nostri clienti un veicolo che anticipa i loro bisogni e supera le loro aspettative”. Il nuovo modello si basa sul successo che questa gamma ha raggiunto fin dal lancio nel 2019. Oggi la quota Iveco nel segmento è pari al 7,5 per cento, il 30 per cento in più rispetto a due anni fa. L’obiettivo sul mercato complessivo fissato dal costruttore per i prossimi anni è del 10 per cento. In generale, Iveco prevede di arrivare a consuntivare vendite europee per oltre 25.400 unità nel 2021, ben al di sopra delle poco più di 21mila preventivate nel 2019. L’attuale positiva tendenza del costruttore italiano è testimoniata dal buon andamento dei truck rigidi, grazie anche al completamento della gamma Way con l’arrivo del muscoloso T-Way per cava-cantiere che si affianca al nuovo S-Way. L’ammiraglia Iveco è diventata molto popolare tra i driver per i suoi livelli di comfort e i clienti hanno dimostrato di apprezzare il mi-

glioramento sia delle prestazioni sia del costo totale di esercizio (TCO), ottenuti grazie alla connettività e ai servizi avanzati. “Questo ha fatto sì che circa 4 clienti su 5 abbiano scelto di sottoscrivere tutti i servizi telematici, e il tasso è in costante crescita ha spiegato Giovannini - Nel complesso, le vendite hanno superato tutte le aspettative, portando Iveco a un significativo incremento nelle quote di mercato. Inoltre, i modelli SWay alimentati a gas naturale sono leader assoluti in Europa, e rappresentano più di un quarto delle unità totali vendute. Anche i proprietari sono orgogliosi del loro S-Way e lo dimostrano personalizzandolo e condividendo le sue im magini sui social media”. Quello delle personalizzazioni è un tema particolarmente caro a Iveco, che le promuove anche attraverso la disponibilità di versioni personalizzate in fabbrica, quindi con la qualità stabilimento unita alla configurazione super-accessoriata. Un esempio è il dina-

mico e super-prestazionale Iveco S-Way Magirus. TUTTE LE VERSIONI

La riduzione dei consumi, dovuta a una serie di ottimizzazioni e nuove funzioni, arriva fino al 3 per cento. La nuova gamma motori è conforme alla normativa Euro VI-E sulle emissioni ed è omologata al 100 per cento per i biodiesel di seconda generazione come l’HVO. La gamma Cursor 13 è stata ampliata con l’introduzione di due nuovi livelli di potenza: 490 e 530 cv. L’efficienza dei propulsori Cursor 11 e Cursor 13 è stata ottimizzata grazie a rapporti di compressione più alti e a una nuova strategia di gestione della combustione. La gamma C9 propone versioni da 340, 360 e 400 cv e versioni CNG/LNG da 270, 340 e 400 cv. La famiglia C11 comprende le versioni da 420, 460 e 480 cv mentre le proposte C13 sono: 410, 450, 490, 510, 530 e 570 cv con la

Gli interni del nuovo Iveco S-Way offrono un ambiente moderno ed efficiente, a misura del driver.


N° 301 / Luglio-Agosto 2021

IL MONDO DEI TRASPORTI

Pagina 27

ITALIANO CHE CAMBIA L’INTERAZIONE TRA CONDUCENTE E VEICOLO

S-Way parla al conducente struttore sta lanciando un nuovo e rivoluzionario servizio che assicura la massima tranquillità al conducente e al proprietario della flotta in caso di incidente o altri problemi al mezzo. Il driver può attivare Iveco Top Care attraverso Iveco Driver Pal e ciò consentirà di allertare l’officina Iveco più vicina, con una corsia preferenziale per l’assistenza. Nel caso in cui non fosse possibile ripristinare l’operatività del veicolo entro sei ore, il servizio offre anche un innovativo pacchetto di hospitality per il driver, che comprende trasferimento, spese di alloggio e (se necessario) assistenza medica a titolo gratuito. FOCUS SUL METANO

LA NUOVA GAMMA È STATA PROGETTATA PER OFFRIRE UN SOSTANZIALE VALORE AGGIUNTO E PRODUTTIVITÀ AI GESTORI DI FLOTTE, AUMENTANDO ANCORA L’EFFICIENZA NEI CONSUMI CON NUOVE MOTORIZZAZIONI E UN ASSALE POSTERIORE DI NUOVA GENERAZIONE, TECNOLOGIE ALL’AVANGUARDIA E SERVIZI INNOVATIVI SVILUPPATI SU MISURA PER LE ESIGENZE DEL CLIENTE. IL RINNOVATO S-WAY RAPPRESENTA UN PUNTO DI SVOLTA NEL SETTORE PERCHÉ CAMBIA IL MODO IN CUI I CONDUCENTI INTERAGISCONO CON IL CAMION, GRAZIE ALL’ESCLUSIVO COMPAGNO DI VIAGGIO DIGITALE IVECO DRIVER PAL.

versione CNG/LNG che eroga 460 cv. I motori da 13 litri sono stati abbinati a nuovi ponti posteriori a riduzione singola ad alta efficienza (disponibili con pneumatici a profilo standard), con rapporti al ponte che arrivano fino a 2,31:1. Questo consente un significativo down-speeding, e di conseguenza maggiore efficienza nei percorsi a lungo raggio a velocità costante, caratteristiche che rendono il nuovo modello Cursor 13 da

490 cv e 2.400 Nm un vero campione di TCO per costo totale di esercizio sui lunghi tragitti. Su una percorrenza annua media di 120mila km, questo propulsore consente un risparmio di 3.600 euro a veicolo in tre anni. Anche altre dotazioni contribuiscono all’efficienza dell’S-Way. Tra queste, la nuova funzione Eco Mode per il condizionatore automatico, che elimina l’assorbimento di energia non necessario, e le nuove appendici

aerodinamiche del montante A, che migliorano ulteriormente il flusso d’aria intorno alla cabina. Punto essenziale della nuova proposta S-Way è la trasformazione del modo in cui i driver interagiscono con il veicolo. L’ammiraglia Iveco inaugura la nuova era del supporto proattivo e predittivo. Il sistema Iveco Driver Pal è il compagno di viaggio digitale del conducente: consente al driver di interagire

con il veicolo, i sistemi di controllo, la Control Room di Iveco e tutte le funzioni di gestione della flotta utilizzando comandi vocali attraverso un dispositivo Amazon Alexa completamente integrato. Inoltre, con l’esclusiva skill MYIveco, i driver non solo pos sono attivare i comandi interni alla cabina e utilizzare i sistemi di infotainment, ma anche impiegare il sistema di navigazione per pianificare il percorso, controllare lo stato

del veicolo e consultare il punteggio della Driving Style Evaluation. Iveco Driver Pal li mette anche in contatto con la loro community attraverso la skill MYCommunity, che permette di condividere messaggi con altri driver che stanno percorrendo lo stesso tragitto o che si trovano nei pressi della loro destinazione. In questo modo, possono scambiarsi utili informazioni di viaggio e aiutarsi a vicenda. Non è tutto perché il co-

Ultimo ma non ultimo: SWay è campione di sostenibilità. Le versioni a gas naturale compresso (CNG) e a gas naturale liquefatto (LNG) includono ora nuovi sistemi ausiliari intelligenti, come il compressore della frizione e la pompa sterzo a portata variabile, che aumentano ulteriormente l’efficienza dei consumi. Le ottimizzazioni del motore e le nuove dotazioni che i modelli a gas naturale condividono con le versioni diesel, insieme ai nuovi sistemi ausiliari intelligenti, assicurano un’ulteriore riduzione delle emissioni di CO2. Tutto questo rende S-Way a metano un autentico punto di riferimento assoluto nel trasporto a lungo raggio. Iveco è leader in Europa per i modelli a metano: entro la fine del 2021 la previsione è di arrivare a 6.500 unità vendute, con una quota di mercato che supera il 55 per cento. In pratica, un veicolo Iveco venduto su quattro è alimentato a gas naturale.

IVECO DRIVER PAL È IL COMPAGNO DI VIAGGIO DIGITALE REALIZZATO CON AMAZON WEB SERVICES E FUNZIONALITÀ ALEXA

L’intelligenza artificiale monta in cabina U n nome, una garanzia per il futuro. Iveco Driver Pal è al centro della nuova proposta S-Way. L’innovativo compagno di viaggio digitale per la nuova ammiraglia torinese è stato realizzato con il contributo di AWS Professional Services ed è supportato da AWS Machine Learning, voce, sicurezza, tecnologie serverless, incluso Amazon Comprehend, Amazon DynamoDB, AWS Lambda, Amazon Translate, e utilizza il servizio vocale basato su cloud Amazon Alexa per ottimizzare l’esperienza di guida. La soluzione fornisce al driver un’esperienza di Intelligenza Artificiale vocale on the road, consentendo al conducente di portare a bordo la propria vita digitale e di interagire con il veicolo tramite comandi vocali. Iveco Driver Pal è studiato per aiutare il conducente a ottimizzare l’itinerario e le soste, tenendo conto di quanto accade lungo il percorso. Per farlo, il sistema fa affidamento sulle informazioni in tempo reale provenienti dalla community di driver, dai servizi di assistenza Iveco e, più in generale, dal web. In questo modo, il driver può svolgere tutti i compiti secondari senza distrarsi dalla guida, tenendo le mani sul volante e concentrandosi sulla sua mission. “Siamo davvero entusiasti del lancio di Iveco Driver Pal, che definisce un nuovo standard di riferimento nell’industria automobilistica - ha dichiarato Fabrizio Conicella, Global Head of Digital & Adv Technology Commercial & Specialty Vehicles di Iveco - Sfruttando l’ampiezza del portfolio di AWS e l’Amazon Working Backwards Innovation methodology durante la nostra collaborazione, Iveco è stata in grado di innovare e fornire in tempi record un nuovo servizio che modifica radicalmente il modo in cui i conducenti interagiscono con i veicoli e con il resto della community. Il nuovo sistema Iveco Driver Pal consolida la strategia digitale adottata dall’azienda, con l’obiettivo di offrire ai driver la possibilità di svolgere le proprie mansioni e di interagire con il veicolo in maniera del tutto nuova, aumentando al contempo il livello di sicurezza e il

comfort”. Attraverso i comandi vocali, i driver possono, in tutta sicurezza, gestire il calendario, riprodurre musica o i propri podcast preferiti, chiamare altri dispositivi compatibili con Amazon Alexa, controllare le notizie, il meteo e le informazioni sul traffico, e persino accedere ai propri dispositivi di domotica. Iveco Driver Pal compie un ulteriore passo in avanti introducendo come novità assolute nel settore due skill esclusive sviluppate insieme ad AWS Professional Services: MYIveco e MYCommunity. La skill MYIveco consente al conducente di interagire con il veicolo in modo innovativo. Chi siede al volante può utilizzare i comandi vocali per gestire il viaggio e pianificare il percorso: impostare la destinazione, trovare parcheggio o stazioni di servizio lungo l’itinerario con il sistema di navigazione, cambiare tragitto per evitare il traffico e cercare ristoranti e hotel. Può inoltre controllare il punteggio Driving Style Evaluation e chiedere consigli per guidare in modo più sicuro ed efficiente. Per i tragitti più lunghi, Iveco Driver Pal suggerisce ai conducenti quando fermarsi per le pause obbligatorie in base alle informazioni del tachigrafo. Grazie alla skill MYIveco, i conducenti possono effettuare una checklist del veicolo prima del viaggio e ricevere informazioni sulla manutenzione e sullo stato dei componenti principali del truck, quali pneumatici, batterie, filtri, frizione e pastiglie freno. Possono poi accedere alle informazioni sull’efficienza del veicolo, leggere consigli su come migliorarla e prenotare un appuntamento per l’assistenza presso un concessionario di fiducia. In caso di problemi tecnici, i conducenti possono chiedere aiuto alla Control Room di Iveco e, se necessario, attivare il servizio Assistance Non-Stop e accedere al servizio Remote Assistance Service e agli aggiornamenti Over-The-Air. I driver possono utilizzare la skill MYIveco anche per attivare diverse funzioni interne alla cabina, come impostare il climatizzatore e l’impianto di riscaldamento, accendere o spegnere le luci, attivare i supporti multimediali e molto altro ancora. Chi è alla guida ri-

mane così concentrato sulla strada, incrementando la sicurezza nel traffico. La seconda skill esclusiva, MYCommunity, funge da radio CB digitale e consente agli utenti di far parte di una community di driver. Ad esempio, questi ultimi possono scambiarsi messaggi vocali con i colleghi lungo il percorso o nell’area nei pressi della destinazione. Possono poi condividere e ascoltare informazioni sulle condizioni del traffico e sulle code alle frontiere, evitando così ritardi imprevisti, oppure ricevere consigli sui parcheggi o sui ristoranti migliori e altro ancora. La lingua non rappresenta un ostacolo, in quanto MYCommunity al momento traduce da e verso inglese, tedesco, francese, italiano e spagnolo e, a breve, saranno disponibili altre lingue. La skill MYCommunity sarà disponibile non solo per coloro che guidano un veicolo Iveco, ma per tutti i driver, in modo tale da creare una comunità ancora più grande dove scambiarsi consigli e suggerimenti e tenersi in contatto con altri driver lungo la strada.


IL MONDO DEI TRASPORTI

Pagina 28

N° 301 / Luglio-Agosto 2021

SU STRADA / A BORDO DEL MODERNO E CONFORTEVOLE SCANIA R 410 A4X2NA,

Toglietemi tutto, ma

FABIO BASILICO ASSAGO

The Sound of Silence” cantava il duo Simon & Garfunkel. E il suono del silenzio, o per meglio dire l’assenza di rumori fastidiosi, è ciò che immediatamente si percepisce a bordo dello Scania Serie R 410 che abbiamo testato lungo un tragitto esclusivamente autostradale di circa 250 chilometri che ha attraversato le province di Milano, Alessandria e Varese. La Serie R è un vanto della nuova generazione dei truck del Grifone, che propone un’ammiraglia confortevole, efficiente e nel contempo prestazionale. La cabina Highline CR20H che all’esterno spicca per la solare colorazione Passion Green ci accoglie a bordo offrendoci uno spazio più che adeguato determinato da una lunghezza totale di 5.960 mm, una larghezza di 2.600 mm e un’altezza di 3.697 mm (senza considerare i deflettori al tetto). La cabina, equipaggiata con un letto e con la possibilità di adottarne un secondo, trasmette la sensazione pratica del giusto equilibrio tra esigenze operative e comfort di driver e passeggero. Il trattore agganciato a un semirimorchio Schmitz (44 tonnellate la combinazione) monta un brillante propulsore della famiglia dei 13 litri Scania a disposizione della Serie R. Nel dettaglio, il 6 cilindri in linea eroga una potenza massima di 302 kW/410 cv a 1.800 giri/min e una coppia massima di 2.150 Nm a 900-1.300 giri/min. Tutte le zone della cabina della Serie R sono state studiate, ritoccate e affinate per agevolare il flusso dell’aria e ridurne il più possibile la resistenza aerodinamica. Tutti gli spazi vuoti e gli angoli sono

stati ridotti e ottimizzati per rendere più efficiente il flusso dell’aria e migliorare il dinamismo delle linee. Sul tetto, i deflettori vengono alzati e abbassati con un pratico comando posizionato sul cruscotto, a sinistra del volante. I vani portaoggetti sono diversi e di ampia capacità e non manca lo spazio frigo contenuto in un vano estraibile da sotto il letto. Sul cruscotto trova spazio un display più grande, accompagnato da una grafica migliorata e controlli intuitivi a portata di mano che consentono al driver di concentrarsi unicamente sulla strada. Progettato per il massimo comfort, il sedile del conducente può essere ampiamente regolato per garantire la posizione di guida ideale. I passeggeri viaggiano con lo stesso comfort e il loro sedile è girevole e reclinabile. Scania offre 5 livelli di potenza del 13 litri 6 cilindri in linea: 370, 410, 450, 500 e 540 cv. Ciò che accomuna tutte le unità della gamma sono le prestazioni in termini

di consumo di carburante e l’utilizzo della tecnologia pura SCR per il trattamento delle emissioni. L’innata solidità, unitamente alla manutenzione Scania con piano flessibile portano a risultati ottimali sia in termini di costi che di uptime, garantendo una proficua economia operativa totale. Caratteristica vincente del 13 litri è il sistema di iniezione del carburante ad altissima pressione Scania XPI. Si tratta di un sistema di iniezione common rail, ideato dal costruttore svedese, che esegue regolazioni continue e precise per garantire un’erogazione ottimale del carburante. È inoltre in grado di variare il volume e i tempi dell’iniezione, riducendo così al minimo i consumi e le emissioni, senza porre limiti di coppia. Grazie a Scania XPI, la pressione può essere gestita in modo indipendente dalla velocità del motore e con estrema precisione. Su strada emerge la funzionalità di Scania Opticruise, sistema di cambio automatizza-

LA CARtA d’identità

Nome: R 410 Cognome: Scania Configurazione: trattore 4x2 con semirimorchio. Cabina: CR20H; lunghezza 5.960 mm, larghezza 2.600 mm, altezza 3.697 mm (senza deflettori al tetto); colore: Passion Green. Motore: Scania DC13, 13 litri 6 cilindri in linea, Euro 6; riduzione catalitica selettiva SCR con AdBlue; sistema di iniezione del carburante ad altissima pressione Scania XPI; potenza max: 302 kW/410 cv a 1.800 giri/min; coppia max: 2.150 Nm a 900-1.300 giri/min. Cambio: Scania GRS895R, Scania Opticruise. Performance modes: Economy, Standard, Power. Livello rumore: 80 dBA Retarder: Scania R4100D, 4.100 Nm, 500 kW. Pneumatici: 385/55 R22.5 (anteriori); 315/70 R22.5 (posteriori) . Serbatoi: gasolio 400 litri; AdBlue: 47 litri.

È su strada che Scania R 410 dimostra tutta la sua efficienza in performance e silenziosità.


N° 301 / Luglio-Agosto 2021

IL MONDO DEI TRASPORTI

Pagina 29

PORTABANDIERA DELLA NUOVA GENERAZIONE TRUCK DEL GRIFONE

non il mio silenzio L’ASSENZA DI RUMORI FASTIDIOSI È CIÒ CHE IMMEDIATAMENTE SI PERCEPISCE A BORDO DELLO SCANIA SERIE R

410 CHE ABBIAMO TESTATO LUNGO UN TRAGITTO ESCLUSIVAMENTE AUTOSTRADALE DI CIRCA

250 CHILOMETRI

CHE HA ATTRAVERSATO LE PROVINCE DI

MILANO, ALESSANDRIA E VARESE. LA SERIE R È UN VANTO DELLA NUOVA GENERAZIONE DEI TRUCK DEL

GRIFONE, CHE PROPONE UN’AMMIRAGLIA CONFORTEVOLE, EFFICIENTE E NEL CONTEMPO PRESTAZIONALE.

to che offre diversi vantaggi a conducenti e operatori. Oltre a migliorare il comfort ed eliminare la necessità di monitorare il regime e cambiare marcia, consente al driver di prestare maggiore attenzione alla gestione del veicolo e al traffico. La strategia di cambio è progettata in modo da adattarsi continuamente al contesto,

sulla base di fattori quali pendenza della strada, peso del rimorchio e caratteristiche del motore. La combinazione di Scania Opticruise e Scania Active Prediction aumenta ulteriormente il risparmio di carburante, poiché il sistema utilizza il GPS per prevedere la topografia della strada ancora da percorrere e regola la

velocità sulla base della pendenza. Nell’elenco delle dotazioni di rilievo dello Scania R 410 cv va incluso naturalmente anche lo Scania Retarder: la possibilità di apprezzare l’effetto potente e uniforme del rallentatore idraulico è un’ulteriore prova della qualità complessiva del progetto Serie R.

Eni station Assago (MI) - Alessandria (Tang. Ovest MI - A7 - A21)

Km 82,15

Litri 21,54

Economy (l/100 km): 26,23

Media km/l 3,813

Km 92,73

Litri 28,53

Economy (l/100 km): 30,77

Media km/l 3,250

Km 67,49

Litri 13,17

Economy (l/100 km): 19,51

Media km/l 5,124

Km 242,37

Litri 63,25

Economy (l/100 km): 26,09

Media km/l 3,831

Arquata - Raccordo A26/A8 (A26)

Raccordo A26/A8 - Eni station Assago (MI) (A26/A8 - A8 - Tang. Ovest MI)

Pratico e agevole, la salita in cabina dello Scania R 410 avviene nella massima sicurezza. Sopra, i deflettori sul tetto possono essere alzati e abbassati con un comando sul cruscotto.

Risultato finale


IL MONDO DEI TRASPORTI

Pagina 30

N° 301 / Luglio-Agosto 2021

DAF / INIZIA A OTTOBRE LA PRODUZIONE DELLA NUOVA GENERAZIONE XF, XG E XG+,

Ecco le ammiraglie

I MODELLI XF, XG E XG+ SONO ANNUNCIATI COME NUOVO PUNTO DI RIFERIMENTO IN TERMINI DI EFFICIENZA, SICUREZZA E COMFORT PER IL CONDUCENTE. L’XF È BEN CONOSCIUTO COME ATTUALE AMMIRAGLIA DELLA CASA OLANDESE. DIVERSO IL CASO DELLE DUE NOVITÀ ASSOLUTE DELLA PROPOSTA ORANGE: I MODELLI XG E XG+ SONO DICHIARATAMENTE CHIAMATI A RIVOLUZIONARE IL MERCATO IN NOME DI UNA NUOVA CLASSE SUPERIORE. TUTTI E TRE I PROTAGONISTI DELLA NUOVA OFFENSIVA DI EINDHOVEN OFFRONO QUALITÀ, EFFICIENZA DEL CONSUMO CARBURANTE MIGLIORATA DEL 10 PER CENTO, UNA VASTA GAMMA DI FUNZIONI PER LA SICUREZZA ATTIVA E PASSIVA E UN LIVELLO SUPERIORE IN TERMINI DI LUSSO NEL DESIGN.

L

FABIO BASILICO EINDHOVEN

a nuova generazione DAF per la lunga distanza arriva con un carico di motivate ambizioni. Con le versioni trattore e cabinato 4x2 e 6x2 dal prossimo ottobre inizia la produzione dei modelli XF, XG e XG+, annunciati come nuovo punto di riferimento in termini di efficienza, sicurezza e comfort per il conducente. L’XF è ben conosciuto come attuale ammiraglia della Casa olandese. Diverso il caso delle due novità assolute della proposta orange: i modelli XG e XG+ sono dichiaratamente chiamati a rivoluzionare il mercato in nome di una nuova classe superiore. Tutti e tre i protagonisti della nuova offensiva di Eindhoven offrono qualità, efficienza del consumo carburante migliorata del 10 per cento, una vasta gamma di funzioni per la sicurezza attiva e passiva e un livello superiore in termini di lusso nel design. Niente nasce per caso. Non solo perché i tre veicoli della nuova generazione DAF sono stati sottoposti a oltre 20 milioni di chilometri di test funzionali, di durata, affidabilità e prove su strada con clienti. Tenendo conto che la Commissione europea ha introdotto un nuovo regolamento su masse e dimensioni con l’obiettivo di migliorare i termini di riduzione delle emissioni inquinanti (CO2), sicurezza stradale e comfort di

guida, DAF è il primo produttore di veicoli industriali in Europa a presentare una nuova generazione di veicoli dotati di un design molto aerodinamico e accattivante e che sfruttano al massimo le nuove possibilità offerte dal regolamento. Dalla presentazione della prima generazione nel 1997, il numero di XF venduti in oltre 50 Paesi ammonta a oltre 650mila unità. La nuova generazione presenta una cabina interamente ridisegnata, con un allungamento di 160 mm nella parte anteriore che permette di raggiungere un livello di aerodinamica da leader del settore, oltre alla mas-

sima efficienza energetica e alle minori emissioni di CO2 in assoluto. Rispetto al predecessore, il modello XF di nuova generazione ha il sedile di guida posizionato più in basso di 75 mm rispetto alle tanto apprezzate e ancora disponibili XF Super Space Cab and Space Cab. Questa caratteristica, unita all’ampio parabrezza e alla linea inferiore dei finestrini laterali abbassata, consente una ottimale visione generale diretta, contribuendo a garantire una sicurezza da leader del settore, soprattutto nei confronti degli utenti della strada solitamente meno visibili (pedoni, ciclisti, ecc.). Il nuovo XF

è inoltre dotato di un’ottimale altezza interna, che si colloca tra 1.900 e 2.075 mm a seconda della posizione all’interno della cabina. I neofiti XG e XG+ sfruttano al massimo il nuovo regolamento europeo masse e dimensioni. Oltre ai 160 mm aggiuntivi nella parte anteriore, i due modelli di punta sfoggiano ben 330 mm aggiuntivi nella parte posteriore della cabina, che assicurano la massima comodità in termini di spazio per lavorare, vivere e dormire. Il pavimento della cabina XG e XG+ è più alto di 125 mm rispetto al modello XF di nuova generazione. Il pianale semipiatto

garantisce una combinazione ottimale di facilità d’accesso, con tre soli gradini, e una posizione di seduta ideale per la visione diretta. Inoltre, l’abitacolo della cabina XG offre un’altezza interna compresa tra 1.980 e 2.105 mm e, grazie alla lunghezza aggiuntiva della parte posteriore, un’abbondanza di spazio interno. Non è da meno il DAF XG+. L’altezza del tetto è persino maggiore, assicurando un’altezza interna massima di ben 2.200 mm. Vero e proprio modello di punta della proposta DAF, XG+ offre un elevato livello di comfort e abitabilità. Con un volume di 12,5 mc, XG+ ottiene il 14 per

La nuova generazione XF presenta una cabina interamente ridisegnata, con un allungamento di 160 mm nella parte anteriore.

cento di volume in più rispetto all’attuale XF Super Space Cab, già punto di riferimento in tema di spazio in cabina per il settore. Il design è un punto qualificante delle nuove ammiraglie DAF. Un esempio per tutti: la barra del logo con rivestimento lucido nella parte superiore sottolinea la classe e caratterizza i veicoli. Elemento cardine sono i fari a Led, sormontati dalle caratteristiche luci diurne e dalle luci di svolta integrate, che contribuiscono a creare uno stile aggressivo e assicurano una visione notturna ottimale. Lo stile è ulteriormente arricchito dagli skylight Led, di serie su XG e XG+, dotati di un design specifico per ogni modello. Per la struttura della cabina è stato utilizzato acciaio leggero ad alta resistenza, mentre per gli interni vengono utilizzati materiali e pelle di alta qualità soft touch. DAF non ha risparmiato sforzi per ottenere l’aerodinamica migliore possibile, creando un design esterno accattivante con raggi e rastremazioni ottimali che consentono un flusso d’aria adeguato. Il parabrezza curvo con i montanti laterali più stretti, i deflettori laterali angolari di forma ellittica, il convogliatore inferiore fronte cabina e i deflettori inferiori fronte pneumatici contribuiscono all’aerodinamicità totale del veicolo, come anche le telecamere opzionali in sostituzione degli specchi retrovisori (Sistema di visione digitale


N° 301 / Luglio-Agosto 2021

IL MONDO DEI TRASPORTI

Pagina 31

PUNTO DI RIFERIMENTO PER EFFICIENZA, SICUREZZA E COMFORT PER IL CONDUCENTE

dell’offerta olandese

DAF). Non meno importanti sono le tante misure adottate per ottimizzare i flussi d’aria del vano motore e sotto la cabina. Il risultato è un’aerodinamica migliore di almeno il 19 per cento che contribuisce per più della metà al miglioramento complessivo del 10 per cento in termini di efficienza nei consumi di carburante. XF, XG e XG+ sono dotati di nuove motorizzazioni, con nuove tecnologie di motore e trasmissione e assali posteriori innovativi. La combustione dei propulsori Paccar MX-11 da 10.8 litri e MX-13 da 12.9 litri è stata ottimizzata con l’uso di nuovi iniettori, di una nuova testata e un nuovo monoblocco, consentendo maggiori pressioni del cilindro, e con pistoni e canne ridisegnate. La gestione dell’aria è stata ottimizzata con l’uso di nuovi turbocompressori efficienti, mentre nuovi compressori pneumatici, nuove

pompe dell’olio e nuovi alternatori riducono al minimo le perdite parassite. L’impianto di post-trattamento dei gas di scarico è stato ridisegnato per minimizzare la distanza tra lo scarico del turbocompressore e l’ingresso nell’unità EAS, riducendo al minimo la perdita di temperatura dello scarico e massimizzando così l’efficienza. Il risultato è un motore estremamente efficiente con prestazioni di livello sia guidando che frenando, minori emissioni di CO2, un intervallo di assistenza annuale e un peso inferiore di 10-15 kg che contribuiscono ad aumentare la produttività del veicolo. I modelli sono dotati di cambio automatizzato TraXon di serie, con nuove tecnologie come la selezione automatica della marcia di partenza, funzionalità predittive migliorate e (come optional) funzione urge-to-move. Inoltre, sono presenti assali poste-

riori con bassi livelli dell’olio e nuovi cuscinetti del pignone. Le pinze del freno di nuova generazione garantiscono minori perdite per attrito e minore peso. Vanno anche considerati il peso del veicolo ridotto (il peso in ordine di marcia dell’XF in versione trattore 4x2 e con le specifiche più comuni ammonta ad appena 6.912 kg) e i sistemi di ausilio alla guida migliorati (Predictive Cruise Control con funzionalità EcoRoll estese e Preview Downhill Speed Control) che contribuiscono al già citato 10 per cento di miglioramento dell’efficienza nei consumi di carburante. Le unità MX-11 e MX-13 garantiscono notevoli prestazioni grazie a un aumento della coppia tra i 50 e i 100 Nm nelle marce alte e con il cambio in presa diretta. La versione di punta da 390 kW/530 cv offre 2.550 Nm in ciascuna delle marce basse e

Il nuovo XG+ e, in alto, il fratello XG. A destra, i moderni interni della nuova gamma DAF.

2.700 Nm in quelle alte. Il turbocompressore HE400 di nuova generazione migliora la gestione dell’aria, rafforzando ulteriormente le notevoli prestazioni in termini di riduzione del numero di giri, con la coppia massima disponibile che si assesta a 900 giri, anche per l’MX-13 da 390 kW/530 cv. Inoltre, il freno motore già leader del mercato assicura fino al 20 per cento in più di coppia massima a basso regime, fissando un nuovo standard nel settore. Gli intervalli di assistenza fino a 200mila km contribuiscono a una disponibilità senza pari. E per le lunghe percorrenze è disponibile un’opzione a lungo intervallo di assistenza. Oltre al sistema brevettato ProCaDis (Programmed Cab Displacement System) per lo spostamento di 400 mm della cabina sul telaio che permette di assorbire l’energia ed evita il distacco della cabina stessa

preservandone la struttura e massimizzando le possibilità di sopravvivenza delle persone presenti nel veicolo, XF, XG e XG+ offrono una gamma completa di dispositivi di sicurezza, come Brake Assist, Lane Departure Warning System (Sistema di avvertimento abbandono corsia) e luci di arresto di emergenza. L’ultima versione di Advanced Emergency Braking System (Impianto frenante d’emergenza avanzato) è in grado di eseguire una frenata di emergenza completamente autonoma per evitare le collisioni con veicoli fermi e in movimento, a una velocità massima di 80 km/h. Il sistema City turn assist rileva la presenza di altri utenti della strada o di oggetti dal lato del secondo conducente. Le ampie opzioni di regolazione di sedili e piantone dello sterzo consentono a qualunque conducente di trovare la propria posizione di

guida ideale, consentendo persino posture più vicine a quelle di un’autovettura. Su XG e XG+ sono disponibili in via opzionale i sedili girevoli per conducente e secondo conducente, che possono essere utilizzati per rilassarsi dopo una lunga giornata al volante. La seduta ripiegabile del secondo conducente è di serie. Il poggiatesta può essere piegato (opzione) per creare un pratico tavolino accanto alla cuccetta. La lunghezza delle cuccette per tutte le versioni è pari a 2.220 mm, con un’ampiezza che nei modelli XG e XG+ raggiunge gli 800 mm. Il letto DAF Relax Bed, regolabile meccanicamente o elettricamente, è disponibile come opzione e assicura un supporto ottimale a testa, schiena e gambe. Il cruscotto è dotato di un accattivante display centrale da 12” per consultare le informazioni relative al veicolo, e di un touch screen opzionale da 10” per il sistema di navigazione e il DAF Infotainment System. Sul display centrale, il conducente può scegliere tra due layout diversi e tra quattro livelli di informazione. Le impostazioni del display possono anche essere personalizzate. Senza dimenticare che all’interno dell’abitacolo le luci sono interamente a Led. XF, XG e XG+ sono anche dotati di un sistema di regolazione automatica della temperatura di serie o di un comando climatizzazione interamente automatizzato in via opzionale. La novità è l’integrazione di Park Airco, disponibile come opzione su XG+, per riscaldare o raffreddare automaticamente l’abitacolo durante la guida o da fermo. Infine, XF, XG e XG+ rappresentano una piattaforma di veicoli completamente nuova ed estremamente efficiente in termini di consumo energetico, preparata ad accogliere fonti di energia future come batterie e idrogeno e motorizzazioni future come motori elettrici, ibridi plug-in, celle a combustibile e motori a idrogeno. Gli avanzati motori diesel sono pronti per i biocarburanti di ultima generazione, come GTL (Gas-to-Liquid) e HVO (Hydro-treated Vegetable Oil), con l’obiettivo di portare avanti la decarbonizzazione del trasporto stradale.


IL MONDO DEI TRASPORTI

Pagina 32

N° 301 / Luglio-Agosto 2021

CARRIER TRANSICOLD / MILANO POINT NUOVO RIFERIMENTO PER IL SERVICE

Freddo al sicuro in Lombardia DALL’UNIONE DI DAVIDE DIECI, FONDATORE E TIMONIERE DI

COLDPOINT - SALES POINT CARRIER TRANSICOLD CON SEDE A PARMA - E ANDREA CUGNATA, FRIGORISTA CON VENT’ANNI DI ESPERIENZA, NASCE L’OFFICINA DI SETTIMO MILANESE, A UNA MANCIATA DI CHILOMETRI DAL CAPOLUOGO.

“DISPONIBILITÀ E REPERIBILITÀ H 24 I NOSTRI PUNTI DI FORZA”, AFFERMA

CUGNATA. “RAFFORZIAMO IN LOMBARDIA LA RETE DI ASSISTENZA DEDICATA

I

MAX CAMPANELLA SETTIMO MILANESE

n Lombardia, area industriale per eccellenza del territorio italiano, autentico crocevia di professionisti e trasportatori della catena del freddo, Carrier Transicold – produttore leader europeo di gruppi frigoriferi – avvertiva l’esigenza di un riferimento per l’assistenza post vendita, per garantire al cliente finale la massima sicurezza in caso di emergenza: il trasporto a temperatura controllata richiede interventi rapidi, tempestivi per garantire la corretta conservazione della merce (alimentari o farmaci). Dall’unione di due imprenditori, entrambi con esperienza nel settore, lo scorso aprile è nata Milano Point, officina con sede a Settimo Milanese, a una manciata di chilometri da Milano e a ridosso delle principali arterie autostradali. L’avvio di una nuova società è l’autentica sfida che lanciano Davide Dieci, Amministratore Delegato di Coldpoint Sales Point di Carrier con headquarter a Parma - e Andrea Cugnata, dinamico “frigorista”, come ama definirsi, che assume l’incarico di Amministratore Delegato di Milano Point: 43 anni, nel settore della temperatura controllata quando di anni ne aveva 19, Cugnata unisce all’entusiasmo e a una grande passione per il mestiere la disponibilità che richiede l’assistenza dei gruppi frigo: “Milano Point – afferma – consente di ripristinare in Lombardia il servizio h 24, con reperibilità notturna e nei weekend, elemento che ci rende oggi unico Carrier Service del territorio milanese. Metto a disposizione dei clienti oltre vent’anni di esperienza in

ALLA FILIERA DEL FREDDO”, AGGIUNGE

un’officina autorizzata Carrier”. Perché nasce Milano Point? Quali sono le premesse e gli obiettivi? “L’assistenza ai gruppi frigo – illustra Cugnata – dev’essere effettuata in esclusiva, occorre dedicare ai clienti tempo e competenze. Con Davide abbiamo condiviso questi valori, ci siamo subito trovati d’accordo: quando arriva un veicolo carico di merce che richiede la temperatura controllata, occorre procedere con la riparazione nel minor tempo possibile”. Perché a Milano? “Perché in quest’area – prosegue l’Amministratore Delegato – mancava un Centro di riferimento esclusivo per i gruppi frigoriferi, con un piazzale adeguato per la manovrabilità dei veicoli industriali, semirimorchi compresi. Milano Point ha sede presso un capannone in precedenza a uso di un’azienda di trasporti,

quindi assolutamente adatto per la movimentazione di bilici e autotreni, sia all’interno (in un’officina di 600 mq) sia soprattutto all’esterno, dove si svolgerà gran parte della attività, d’estate e d’inverno”. Dimostrando eccellente perspicacia e una visione futura, Andrea Cugnata nel service è affiancato da un giovane, al quale intende trasferire la competenza maturata sul campo. “Vogliamo crescere – prosegue – non solo nel business ma anche nella forza lavoro, arrivando presto a un team in grado di soddisfare le esigenze della zona”. Core business di Milano Point è la manutenzione in garanzia e in contratto dei gruppi Carrier, nonché il montaggio di nuovi impianti. Considerata l’ubicazione, quale tipologia di cliente sarà maggioritaria in Milano Point? “Non ci poniamo limiti: serviamo – aggiunge Cugnata – ogni professionista

DIECI.

In manutenzione presso la sede di Milano Point, una motrice Mercedes-Benz Actros con gruppo frigorifero Carrier Supra 1.250 Silent e cassa frigorifera IFAC.

I due imprenditori che hanno fondato Milano Point: Andrea Cugnata (a sinistra) e Davide Dieci.

del trasporto con stesse passione e disponibilità, qualunque sia la dimensione dell’azienda: se un autista si trova in panne, il nostro impegno è affrontare la situazione con professionalità, lavorando con precisione. Spesso accade che un intervento modifichi l’impianto frigorifero, che invece deve mantenere intatta la sua semplicità. La nostra “chiave di differenza” è questa: lavorare bene e dare il massimo, consapevoli dei sacrifici che questo richiede”. Da Parma a Milano, Davide Dieci, con Coldpoint figura di riferimento in Lombardia, Emilia, Toscana e Sardegna per la vendita e assistenza Carrier, scende in campo nel capoluogo meneghino. “Si tratta – spiega l’imprenditore parmense – di un pro-

getto che coltivavo da tempo. L’occasione è arrivata dall’incontro con Andrea, che ha una grande passione e si dedica al lavoro con estrema dedizione. La sua disponibilità ha rappresentato la chiave di volta per affermare un riferimento Carrier in Lombardia”. Un’estensione della rete di assistenza che consente, al produttore europeo di gruppi frigoriferi, maggiore vicinanza al cliente finale. “In un territorio importante qual è quello lombardo – prosegue Dieci – occorreva rafforzare la rete di assistenza Carrier: con Milano Point lo facciamo mettendo in campo forze giovani e determinate”. Aperta dalle 8 alle 18, Milano Point sta operando al servizio di aziende di trasporto alimentare e pharma.


SER VICEE PROFESSION AL E RIVE N DITO OR E GRUPPI FRIGO CARRIE R TRAN SICOLD

CE NTRO AUTORIZZ ATO CER TICOLD

www.coldpoint.it


IL MONDO DEI TRASPORTI

Pagina 34

N° 301 / Luglio-Agosto 2021

KÖGEL / IN TRE ANNI IL BRAND TEDESCO È DIVENTATO LEADER NELLA FLOTTA FRIULANA

D’Agaro portale per l’Europa A UNA MANCIATA DI CHILOMETRI DAL CONFINE CON AUSTRIA E SLOVENIA, L’AZIENDA NASCE COME PADRONCINO PER SVILUPPARSI ALLE ATTUALI DIMENSIONI DI

45 TRATTORI E 80 SEMIRIMORCHI,

MANTENENDO INTATTA LA CARATTERISTICA D’IMPRESA GUIDATA DA UNA TIPICA FAMIGLIA FRIULANA, DI POCHE PAROLE E TANTI FATTI.

NEL 2018 L’INCONTRO CON IL MARCHIO DI

BURTENBACH, SCELTO PER IL SUO PUNTO DI FORZA: TELAIO RESISTENTE E DUREVOLE.

P

MAX CAMPANELLA UDINE

oche parole, tanti fatti. È un autentico stile di vita per il popolo friulano. Di esempi nella storia se ne possono fare molti: come non ricordare Enzo Bearzot? O, per restare in tema calcistico, Dino Zoff? Due friulani che d’interviste e apparizioni televisive ne hanno fatte poche, ma i cui risultati sono sui libri di storia. Ed è con que sto spirito che veniamo accolti in Autotrasporti D’Agaro, azienda collocata nel fazzoletto di terra che, in provincia di Udine, guarda verso Slovenia e Austria, da cui di sta 45 km. In fase di completamento dei nuovi uffici e in attesa di un importante ampliamento, con l’acquisizione di altri due piazzali di 4mila mq l’uno e l’operatività di una pensilina coperta di 700 mq per aprire un Centro revisioni, D’Agaro tre anni fa ha stretto una collaborazione con Kögel, puntando sulla robustezza e solidità del telaio dei semirimorchi, arrivando gradualmente a portare la flotta del trainato a maggioranza del marchio di Burtenbach. Autentico crocevia per l’Europa, la tratta di Tarvisio rappresenta di fatto l’alternativa al Passo del Brennero per i trasporti verso Germania e Est Europa, in particolare Polonia, Cechia e Lituania. Vantaggi logistici che hanno assegnato al territorio una forte vocazione imprenditoriale, con l’affermazione di aziende e la costituzione di Poli industriali, dall’automotive alle cartiere, dagli scambiatori di calore a realtà di minori dimensioni che contribuiscono a rendere estremamente varia la tipologia merceologica. Alla quinta gene-

razione della famiglia D’Agaro, l’azienda si propone come player di riferimento per il trasporto per ogni tipo di necessità del territorio, puntando da sempre sulla qualità del servizio. Le matrici storiche le ritroviamo all’ingresso dell’headquarter di Amaro, dove sei anni fa è stato celebrato il novantesimo anniversario di fondazione: custodito in una teca, uno dei due carri che, trainati da cavalli, quasi cent’anni fa Umberto D’Agaro ereditava dal padre Giacinto. È il 1925, siamo a Rigolato, a una trentina di chilometri da Amaro, da dove Umberto partiva per le consegne di generi alimentari nei paesi limitrofi. Nel 1935 si passa ai camion, attività mantenuta con i cavalli durante la Seconda Guerra, per ricominciare negli Anni Quaranta con il Lancia 3Ro - del quale viene tuttora conservata la portiera che trasportava legname per la friulana Candido e marmo

per la vicentina Margraf. Con quest’ultima il legame è tuttora molto stretto, tant’è che nella sede rinnovata di Amaro - su 8mila mq di superficie, 400 dei quali adibiti a uffici i marmi carnici forniti da Margraf, sono autentici protagonisti. Negli Anni Sessanta è la terza generazione, nella persona di Mario D’Agaro, poi affiancato dalla moglie Maria Grazia, a far evolvere l’azienda in flotta strutturata, ampliando il suo raggio d’azione, superando i confini austriaci e aprendosi a nuovi settori merceologici, come il trasporto per Goccia di Carnia, acque simbolo del territorio. È la chiave di volta: l’impresa passa da due a 10 poi 15 poi 20 camion. Negli Anni Ottanta entra in azienda Angelo, oggi 53enne, con il quale l’azienda si apre alle cartiere, rafforza le rotte nazionali e internazionali, raggiungendo Francia e Germania, e stabilisce la sede a

Amaro, presso un capannone subito all’uscita dell’autostrada. Conseguita la laurea in Ingegneria gestionale, ad assegnare il futuro all’azienda sono oggi i suoi due figli Stefano, 30 anni, e Angela, 25. La crescita è stata graduale ma costante, anno dopo anno. Oggi Autotrasporti D’Agaro dà lavoro a 48 persone, con un fatturato che dal 2019 si attesta sui 5,5 milioni di euro e una flotta di 45 trattori, con età media inferiore ai quattro anni, e 80 semirimorchi, in massima parte centinati, oltre a quattro cassonati e due vasche per il trasporto di blocchi di marmo e sassi. Massima è l’attenzione pre stata al parco mezzi. “L’intera attività di trasporto spiega Angelo D’Agaro - viene effettuata unicamente con nostri veicoli, scelta che viene apprezzata dalla clientela e che ci consente il monitoraggio costante, sia dei veicoli in circolazione sia del loro stato di efficienza”. È

Da sinistra: i giovani ingegneri Angela e Stefano D’Agaro e il padre Angelo in una stretta di mano con Mauro Denti, Area Manager Kögel Trailer Italia.

AutotRASpoRti d’AgARo Sede operativa principale: Amaro (UD) Presidente: Angelo D’Agaro Merce trasportata: Automotive, acque, industriale Flotta: 45 trattori + 80 semirimorchi Dipendenti: 48 Fatturato 2020 (euro): 5,5 milioni Sito internet: dagarotrasporti.it

questo il motivo per cui, nel 2018, i D’Agaro hanno puntato su Kögel, incrociando Mauro Denti, Area Manager del produttore di Burtenbach. “In questi anni - prosegue D’Agaro - è in forte aumento il traffico estero verso la Germania, con viaggi per Berlino e Brema da dove trasportiamo in Italia rifiuti speciali, come bottiglie di plastica, per risalire con cartone o nylon estensibile, anche questo segmento in forte sviluppo. Raggiungiamo la bassa e alta Francia e in Italia fino in Campania con cartone e legname. Sono tutte committenze che richiedono un servizio senza problemi, che hanno la consapevolezza di rivolgersi a un partner che lavora bene e con serietà”. Un approccio al quale D’Agaro risponde scegliendo fornitori con i quali consolida partnership di lungo termine. È il caso di Kögel, incontrato inizialmente per risolvere un problema contingente. “Il telaio dei semirimorchi - afferma D’Agaro - deve essere durevole e resistente alla ruggine. Avendo avuto dei problemi in precedenza, abbiamo chiesto precise garanzie: non ci interessa ingaggiare trattative sul prezzo, vogliamo la sicurezza che, in qualsiasi tratta viaggino, i semirimorchi mantengano negli anni le loro caratteristiche di funzionalità e integrità”. Su queste basi l’azienda

friulana nel 2018 ha inserito nel parco i primi venti semirimorchi di Burtenbach, cui ne sono seguiti dieci nel 2020 e altri venti quest’anno, portando il marchio Kögel a essere brand maggioritario. “È il procedimento di nanoceramica - illustra Denti - a rendere il telaio Kögel resistente alla ruggine, rendendo più robusta la superficie e proteggendo la vernice da urti e acidi: il processo di produzione nel sito di Burtenbach prevede una tempistica determinata per cataforesi e nanoceramica e la presenza d’ingegneri chimici che sovrintendono l’intero processo, verificando che in ogni vasca sia presente la giusta dose di additivi. Il telaio carrellabile e dalla tara leggera rappresenta il nostro punto di forza. La soddisfazione di collaborare con D’Agaro, in questi tre anni nei quali ha risolto i problemi, è tale che oggi abbiamo stretto un rapporto di amicizia, ci confrontiamo di frequente sulle tematiche del settore”. I centinati Kögel, alcuni dei quali ribassati, scendono su strada per ogni tipo di com mittenza dei D’Agaro, per viaggi nazionali e internazionali. “Siamo soddisfatti conclude Angelo - anche perché stiamo inserendo nella flotta semirimorchi moderni, con un marchio capace di aggiornarsi nel tempo in termini di allestimento”.


IL MONDO DEI TRASPORTI

Pagina 36

N° 301 / Luglio-Agosto 2021

INTERVISTA

L

BERARDO DI GIUSEPPE DIRETTORE GENERALE DI TMT INTERNATIONAL

’urgenza delle problematiche ambientali è ormai indiscutibile. Per disinnescare il processo deleterio che il nostro Pianeta vive, risulta necessario l’impegno di tutti, privati e aziende. Queste ultime sono causa di gran parte dell’inquinamento, immettendo nel terreno, nell’acqua e nell’aria sostanze dannose per l’uomo e l’ecosistema. Raggiunta la consapevolezza del loro ruo lo, molte aziende hanno deciso di abbracciare un nuovo approccio basato sulla sostenibilità, modificando le lavorazioni dei prodotti. Implementare un processo produttivo di tipo ecofriendly significa ridurre al minimo l’impatto ambientale, usando materiali riciclabili e/o biodegradabili e fonti di energia rinnovabile. Su questa scia si colloca la mission di TMT International, azienda di San Benedetto del Tronto, in provincia di Ascoli Piceno, da anni impegnata nella realizzazione di semirimorchi, autobotti, container, impianti di misurazione e pompaggio petrolifero, impianti di trasferimento rifiuti. “La nostra vision - spiega Berardo Di Giuseppe, Direttore Generale TMT International - fa perno su valori importanti:

da”. L’evoluzione green di TMT International si riflette anche nello sviluppo del settore intermodale. Molti semirimorchi viaggeranno sui tre ni: in questo modo, si andrà a ridurre il consumo di CO2 prodotta dai motori termici. L’impatto ambientale, dunque, è notevolmente limitato. Con il fondamentale supporto degli amministratori Alfredo e Gianluca Spinozzi, l’azienda sta registrando un importante sviluppo nei Paesi europei ed extraeuropei, distinguendosi per affidabilità, qualità e assistenza. “La vocazione green - prosegue Di Giuseppe - ha aiutato a incrementare l’interesse del mercato, sollecitando la curiosità di tanti nuovi clienti. TMT International è una delle prime aziende del suo settore in Europa a proporre un progetto di trasformazione dei processi produttivi in un’ottica ecosostenibile”. Le industrie metalmeccaniche sono conosciute per essere altamente inquinanti, consumatrici di energie tradizionali e poco attente alle tematiche ambientali. “I prossimi anni per la nostra azienda -continua il Direttore - saranno fondamentali e, sfruttando nuove infrastrut-

Svolta green responsabile IL PRODUTTORE ITALIANO DI SEMIRIMORCHI A PIANO MOBILE ESEMPIO CONCRETO DI NUOVE APPLICAZIONI NEL SETTORE DEI TRASPORTI 5MILA METRI COPERTI, COME PRIMA FASE DI UN PROGETTO CHE S’INSERISCE IN UN CONTESTO INDUSTRIA 4.0, CON MACCHINARI CONNESSI TRA LORO, CON TECNOLOGIA INVERTER, CHE UTILIZZERANNO ENERGIA DA PANNELLI FOTOVOLTAICI E TERMICI. “OGGI ESSERE UN’AZIENDA GREEN SIGNIFICA SOPRATTUTTO ADOTTARE UN MODELLO DI SVILUPPO

IN UN’OTTICA ECOSOSTENIBILE. IL SITO DI SAN BENEDETTO DEL TRONTO CRESCERÀ DI OLTRE

IN GRADO DI ASSICURARE IL SODDISFACIMENTO DEI BISOGNI DELLA GENERAZIONE PRESENTE SENZA COMPROMETTERE LA POSSIBILITÀ DELLE GENERAZIONI FUTURE DI REALIZZARE I PROPRI”, AFFERMA

lo sviluppo e la crescita dell’azienda vanno di pari passo con il rispetto per l’ambiente. Innovare oggi significa avere un occhio di riguardo per il futuro che lasceremo alle altre generazioni. Le nostre scelte non sono focalizzate solo sui problemi a breve termine, ma anche su quelli a lungo termine. Per questo motivo, proponiamo soluzioni innovative responsabili, in grado, cioè, di soddisfare i più elevati standard di sostenibilità”. In particolare, TMT International ha in mente un progetto ambizioso di ampliamento della produzione con impianti green. “La messa in discussione - afferma il Direttore Generale - è per noi fondamentale e costante: stiamo pianificando di aggiungere oltre 5mila metri coperti, come prima fase di un progetto che ne prevede molti di più. Per un’azienda metalmeccanica è un grande e simbolico passo di sostenibilità. Saranno inserite aree verdi all’esterno e all’interno dei nuovi capannoni.

Tutto il progetto s’inserisce in un contesto Industria 4.0, dove tutti i macchinari sono connessi tra loro. I macchi-

di LINO SINARI

S. BENEDETTO DEL TRONTO

nari stessi avranno tecnologia inverter e utilizzeranno energia proveniente da pannelli fotovoltaici di ultima

generazione. Non solo: stiamo pensando d’installare una centrale termica, alimentata con biomasse. Que-

DI GIUSEPPE.

sta tecnologia permetterà di non consumare gas e produrre acqua calda, sanitaria e non, per gli usi dell’azien-

Il container intermodale è una delle proposte di TMT International per un trasporto orientato alla sostenibilità ambientale.

ture e tecnologie, contiamo di diventare leader del mercato. Innovazione ma anche risorse umane: ogni processo è affidato a tecnici specializzati, che lo monitorano costantemente. L’azienda confida nella professionalità dei dipendenti, dando massimo supporto affinché stiano a loro agio nel lavoro quotidiano. Abbiamo, inoltre, rafforzato molto l’area qualità, ambiente e sicurezza, inserendo personale esperto. Il lavoro di squadra e l’alta motivazione, che ci con traddistinguono, permettono di raggiungere gli obiettivi pianificati e superare le aspettative del cliente, garantendo un prodotto nei tempi e nella qualità desiderati”. L’azienda è sempre pronta a nuove sfide: dopo aver ottenuto il rinnovo della certificazione ISO 9001/2015, punta all’acquisizione della certificazione ambientale ISO 14001. “È questo un obiettivo decisivo, che suggella l’impegno profuso per la trasformazione green”, conclude Di Giuseppe.


MA ST

PE ER LA TU C I F CC

ER

SE A LE

MASTER START

Leasing esclusivo per diluire nel tempo il costo dei pneumatici e dei servizzi.

MASTER CARE

FLOTT TA O IN 4!

Prodotti e servizi su misura per rispondere ai bisogni della tua flotta.

Il sistema di gestione ne programmata dei pneumatici della flotta.

ER

ET E FL

Canone all inclusive per una manutenzione senza pensie eri.

MA S T L’’offer ta 4 MA STER offre 4 soluzioni esclusive di assistenza e manutenzione pneumatici cr eate su misu r a p e r og ni e sig e nz a d ella vo s t r a f lot t a au to c a r r o o t r asp o r to leg g e r o. + Tarif fe uniche e trasparenti su tut to il territorio nazionale + Fat turazione centralizzata + Omogeneità degli stand dard operativi + Suppor to costante del Customer Care Euromaster + Soccorso stradale 24h e 7gg su 7 Per saperne di più chiamaci 02 00664521 o scrivi a gestione.flot te@euromaster.com EUROMA STER , il par tner della tua mobilità

IN BU UONE MANI eurom master-pneumaticci.it


IL MONDO DEI TRASPORTI

Pagina 38

N° 301 / Luglio-Agosto 2021

PNEUMATICI / CUSINATO RENATO SCEGLIE IL “SISTEMA RIGOMMA”

Due vite sono meglio di una

S

LINO SINARI

SAN PIETRO IN GU

ull’onda di un mercato altalenante, il segmento dei pneumatici ricostruiti è tra quelli che più hanno registrato un forte sviluppo in termini d’investimenti in qualità. Dall’originaria idea che la seconda vita di uno pneumatico non potesse presentare identiche qualità di resa, si è passati negli anni a una valutazione della seconda (e persino terza) vita di uno pneumatico non solo come possibile continuità in termini di performance: utilizzare uno pneumatico ricostruito vuol dire schiacciare l’occhio all’ambiente. Ben lo sanno in casa Rigomma, azienda che ha fatto del ricostruito (presente già nel nome) la sua ragion d’essere. Con forti investimenti in Ricerca&Sviluppo, Rigomma ha perfezionato una linea brandizzata di pneumatici ricostruiti che nascono nel sito di Marghera, alle porte di Venezia. Prodotto sinonimo di qualità che viene sempre più apprezzato da moderne aziende di trasporto, che ricercano nel ricostruito non già un risparmio sul costo iniziale, ben sì una partnership di lungo termine con il produttore, che mira a rispettare gli standard prestazionali sui vei-

ACQUISTARE PNEUMATICI NUOVI DI QUALITÀ E POI RICOSTRUIRLI È IL MODELLO VINCENTE ADOTTATO DALL’AZIENDA PADOVANA, CHE TROVA NEL PRODUTTORE DI MARGHERA IL PARTNER GIUSTO PER L’EQUIPAGGIAMENTO DEI CIRCA 80 TRATTORI SCANIA E 120 SEMIRIMORCHI, IN GRAN PARTE A TEMPERATURA CONTROLLATA. BILICI CHE PERCORRONO UNA MEDIA CIASCUNO DI 120MILA KM L’ANNO, COPRENDO NORD E CENTRO ITALIA, AL SERVIZIO DI AZIENDE DEL SETTORE ALIMENTARE. coli e a garantire la massima durabilità delle gomme, con il fine di impattare il meno possibile sull’ecosistema. Tra gli esempi di chi sceglie con consapevolezza l’utilizzo del ricostruito Ri-

gomma, un posto di rilievo occupa Autotrasporti Cusinato Renato, azienda con headquarter a San Pietro in Gu, in provincia di Padova, caratterizzata dal dinamismo che il fondatore trasmette all’intera

organizzazione. La flotta mezzi è costituita da circa 80 trattori stradali (a marchio Scania) e 120 semirimorchi. L’età media dei mezzi è di sei anni, e si tratta in massima parte di mezzi frigoriferi a

doppia temperatura e centinati. Le rotte coprono Nord e Centro Italia e i veicoli percorrono una media ciascuno di 120mila km l’anno. “Ci rivolgiamo - spiega Gianni

AutotRASpoRti CuSinAto RenAto

I veicoli della padovana Cusinato Renato sono tutti equipaggiati con ricostruiti Rigomma.

Sede operativa principale: San Pietro in Gu (PD) Presidente: Renato Cusinato Merce trasportata: Alimentari a temperatura controllata Flotta: 80 trattori + 120 semirimorchi Dipendenti: 180 Sito internet: cusinatotrasporti.it

Bartolomei, responsabile del parco mezzi - principalmente ad aziende del settore alimentare per il trasporto di beni destinati all’industria, l’approvvigionamento di materia prima e la distribuzione per conto della Grande Distribuzione Organizzata”. Quanto è importante la scelta del giusto pneumatico, oggi, per una moderna azienda di trasporto come Cusinato Renato? “Il giusto pneumatico - afferma Bartolomei - è importantissimo per garantire zero fermi macchina, puntualità nelle consegne e un servizio all’altezza delle aspettative dei committenti. Anche la manutenzione dei pneumatici è un aspetto fondamentale e con Rigomma è completamente programmata. Il rapporto di collaborazione con Rigomma è cominciato grazie alle ottime referenze che avevo ricevuto, e si è consolidato negli anni con il rapporto di fiducia che si è creato con Simone Masiero, consulente che ci segue”. Quali erano le aspettative dall’utilizzo degli pneumatici ricostruiti Rigomma? “Le principali aspettative - risponde il gestore del parco erano due: l’affidabilità e la riduzione dei costi; obiettivi entrambi raggiunti. Tutti i nostri veicoli, trattori e semirimorchi, sono equipaggiati con pneumatici ricostruiti Rigomma. Questa è la scelta che garantisce il costo chilometrico più conveniente: il modello di acquistare pneumatici nuovi di qualità e poi di ricostruirli batte senza dubbio il modello di acquistare solo pneumatici nuovi, di qualità o primo prezzo. Senza dimenticare che il PFU (pneumatici fuori uso, ndr) non si paga sui pneumatici ricostruiti”. Qual è la “chiave di differenza” che deve avere uno pneumatico ricostruito per essere scelto da una flotta come Cusinato Renato? “Le chiavi di differenza - afferma Bartolomei - sono innanzitutto la sicurezza e l’affidabilità, ma anche la resa chilometrica, con conseguente abbassamento del costo chilometrico. Ultimo, ma non meno importante, il tema dell’ecologia: per ogni pneumatico ricostruito che decidiamo di montare, evitiamo l’immissione di 60 kg di CO2 nell’ambiente”.

SIMONE MASIERO, CONSULENTE SETTORE INDUSTRIALE, ILLUSTRA I VANTAGGI DEL “MODELLO RIGOMMA”

“Il nostro valore aggiunto? Pensiamo solo agli autotrasportatori” P rodurre solo per i trasportatori è il principale valore aggiunto della ricostruzione Rigomma, che impone al produttore veneziano un’asticella elevatissima nel momento dell’accettazione, e poi nell’ispezione, dei pneumatici. La scelta di produrre a “freddo”, inoltre, riduce lo stress per la carcassa, aspetto che in un Paese come l’Italia è vincente. “Il nostro fornitore di riferimento per la ricostruzione - spiega Simone Masiero, consulente settore Industriale Rigomma - è Michelin. Poter comprare le medesime mescole e disegni del prodotto nuovo, progettati con la nota qualità che il marchio francese si è guadagnato nell’autocarro, garantisce a clienti come Cusinato continuità di qualità e prestazioni tra nuovo e ricostruito. Abbiamo poi una storica collaborazione con Kraiburg, marchio austriaco indipendente; da poco abbiamo infine iniziato a utilizzare con soddisfazione mescole e disegni Continental”. Quali vantaggi derivano dall’utilizzo di pneumatici ricostruiti per un’azienda come Cusinato Renato? “Parlando di

rese chilometriche e riferendoci al traino - dichiara Masiero registriamo percorrenze nell’ordine di circa 240mila km per quanto riguarda il nuovo, e di 220mila per il ricostruito. Stiamo inoltre testando un nuovo disegno ricostruito, il Multi D HD, che promette di eguagliare il chilometraggio del nuovo: vedremo quali risultati ci porterà”. Quali sono le garanzie che, in termini di percorrenza chilometrica e assistenza, il network Rigomma offre alle aziende di trasporto italiane? “Rigomma - afferma in conclusione Masiero - si propone come partner strategico della aziende di trasporto. I negozi, la ricostruzione, la manutenzione a domicilio, il servizio Rigomma Assistance e la manutenzione predittiva con la divisione Alta Sartoria hanno lo scopo di perseguire due obiettivi: abbattere il costo chilometrico ed essere a fianco del trasportatore, sempre. In questo modo, come Renato Cusinato ci riconosce, diveniamo partner dell’azienda di trasporto, e non semplicemente un fornitore”.


N° 301 / Luglio-Agosto 2021

IL MONDO DEI TRASPORTI

Pagina 39

SCANIA / È LA QUINTA VOLTA CONSECUTIVA CHE IL GRIFONE VINCE IL “GREEN TRUCK AWARD”

Il lungo raggio verde del truck svedese

I

FABIO BASILICO TRENTO

l “Green Truck Award” è diventato negli anni un punto di riferimento per la valorizzazione della sostenibilità nei trasporti a lungo raggio. Lo sa bene Scania che per il quinto anno consecutivo ha vinto l’ambito premio tedesco, un vero e proprio campionato mondiale di efficienza. “Le parole che mi vengono in mente sono: successo totale e valore per il cliente - ha evidenziato Stefan Dorski, Senior Vice President e Head of Scania Trucks, in risposta alla notizia dell’ultimo trionfo di Scania nel “Green Truck - Vincere questo test per cinque anni di fila è un’impresa impossibile, eppure ce l’abbiamo fatta. A mio avviso questa è un’ulteriore testimonianza di come gli innovativi sistemi di propulsione Scania rappresentino un elemento fondamentale che consente ai nostri clienti di raggiungere la migliore economia operativa totale”. Il “Green Truck” è organizzato dalle riviste tedesche di settore “Trucker” e “Verkehrs Rundschau”. Il test del 2021 non è stato meno impegnativo di quelli effettuati negli anni precedenti. Gli organizzatori

LO SCANIA R 410 È RIUSCITO A OTTENERE UN RISULTATO INCREDIBILE, SBARAGLIANDO LA CONCORRENZA: IL CONSUMO MEDIO DEL MEZZO È STATO

23,53 100 KM

MISURATO IN LITRI PER

(4,25 KM/L); INOLTRE IL TRATTORE SCANIA HA RAGGIUNTO LA VELOCITÀ MEDIA PIÙ ALTA, RAGGIUNGENDO

hanno stabilito un peso complessivo di 32 tonnellate e una potenza massima di 430 cv per i mezzi in gara, che hanno percorso il tragitto-prova di 360 km a nord di Monaco. Quest’anno Scania ha partecipato con un veicolo R 410 che è riuscito a ottenere un risultato incredibile, sbaragliando la concorrenza: il consumo medio del mezzo è stato misurato in 23,53 litri per 100 km (4,25 km/l); inoltre il trattore Scania ha raggiunto la velocità media più alta,

raggiungendo 80,60 km/h. Non è un’impresa da poco in quanto alcuni tratti del circuito di prova sono piuttosto impegnativi. Il test è monitorato rigorosamente e si svolge su strade pubbliche con un mix tra autostrade e strade secondarie. Le condizioni che possono influenzare i risultati, come il traffico e le condizioni meteorologiche, vengono compensate dall’utilizzo di un altro mezzo di riferimento. Tutti i veicoli hanno la stessa marca di

pneumatici, con la stessa usura e pressione. “Essere in grado di offrire i mezzi più efficienti non è solo parte del DNA Scania ma qualcosa in più, che richiede un impegno costante da parte nostra – ha evidenziato Dorski - È qualcosa di estremamente importante che ci consente di contribuire alla lotta ai cambiamenti climatici e, al tempo stesso, di raggiungere i Science Based Target fissati. Anche se l’elettrificazione è in arrivo, abbiamo la necessità di

KRONE / SEMIRIMORCHI CON ELEVATI STANDARD DI SICUREZZA

avere a disposizione motori a combustione interna maggiormente efficienti, così da poter raggiungere gli obiettivi dell’Accordo di Parigi, ai quali Scania ha aderito”. Il costruttore svedese considera i test un fattore altamente importante nel suo processo di sviluppo. I test della stampa e le valutazioni dei giornalisti indipendenti sono sicuramente le informazioni che i potenziali acquirenti di veicoli industriali tengono maggiormente in considerazione.

80,60 KM/H. NON È UN’IMPRESA DA POCO IN QUANTO ALCUNI TRATTI DEL CIRCUITO DI PROVA DI COMPLESSIVI 360 KM SONO PIUTTOSTO IMPEGNATIVI.

SCANIA / CABINE SERIE R E S

In primis vedere ed essere visti Più profonde e confortevoli LUCI DI STOP SULLA PARTE SUPERIORE DEL TELAIO E LUCI DEI FRENI DI CONTORNO ASSICURANO COOL LINER. DA QUEST’ANNO IL PRODUTTORE TEDESCO STA EQUIPAGGIANDO I VEICOLI CON UN POSTERIORE ANTINCASTRO DI NUOVA CONCEZIONE.

MASSIMA VISIBILITÀ AL NUOVO FRIGORIFERO

A

LINO SINARI WERLTE

spetto essenziale per un alto livello di sicurezza nel traffico stradale è vedere e essere visti: una buona visibilità è enormemente importante per le combinazioni di bilici e autocarri con rimorchi. Ciclisti e pedoni in particolare possono ritrovarsi nell’angolo cieco, dal punto di vista del camionista, in diverse situazioni di traffico. Ciò è particolarmente vero quando il mezzo pesante affronta una curva e ciclisti o pedoni ad una certa angolazione nello specchietto del camion non si vedono più. Per rendere consapevoli le potenziali vittime di incidenti di questo pericolo, e in definitiva per proteggerli, Krone equipaggia i rimorchi e semirimorchi con adesivi di avvertimento ben visibili nei punti nevralgici, mentre le luci di posizione laterali lampeggianti offrono ancora più sicurezza. Il segnale lampeggiante in curva ha lo scopo di avvertire i ciclisti della svolta del camion, in modo che si avvicinino con lungimiranza alla situazione potenzialmente pericolosa. Fonti di pericolo per gli altri utenti della strada possono essere anche autoarticolati parcheggiati in una zona buia o in una strada laterale. In questo caso si rivelano utili le indicazioni di contorno riflettenti sui semirimorchi Krone, che si accendono non ap-

pena illuminati dalle luci di una vettura o bicicletta. Una migliore visibilità delle situazioni di guida aiuta anche a disinnescare i pericoli prevedendo in anticipo situazioni nel traffico in movimento. Ad esempio, il nuovo semirimorchio frigorifero Krone Cool Liner è dotato di serie di luci di stop sulla parte superiore del telaio, per evitare tamponamenti dei veicoli che seguono. Inoltre, sono disponibili come optional anche le luci dei

freni di contorno. Al fine di aumentare ulteriormente la sicurezza passiva, a partire dallo scorso marzo Krone sta equipaggiando i veicoli di un posteriore antincastro di nuova concezione, che presenta il doppio della forza di assorbimento, per garantire in maniera più efficace che, a seguito di un tamponamento, auto e moto non finiscano per incastrarsi sotto il rimorchio o semirimorchio. Anche i sistemi elettronici aiu-

tano a prevenire situazioni di traffico pericolose, evitandone innanzitutto il verificarsi. Ad esempio, ogni pneumatico montato sui veicoli Krone presenta il sistema di monitoraggio della pressione, che misura e controlla costantemente la pressione in tutti e sei i pneumatici del semirimorchio: se la pressione scende pericolosamente il sistema avverte il conducente, che può intervenire prima che la situazione di pericolo si aggravi.

Le luci di posizione laterali lampeggianti sul semirimorchio Krone assicurano maggiore sicurezza. In curva il segnale lampeggiante avverte il ciclista che il camion sta effettuando una svolta.

C

omfort di guida eccezionale per missioni lunga distanza è il focus con cui Scania introduce le cabine CR23 e CS23, caratterizzate da profondità maggiorata di 27 cm, ideali anche per applicazioni particolari come veicoli per autoscuole, mezzi di recupero o con un equipaggio. Prodotte in esclusiva da Laxå Special Vehicles, consociata Scania, innalzano l'asticella dei veicoli premium del costruttore di Södertälje. “Uniremo - spiega Stefan Dorski, Senior Vice President, Head Scania Trucks - alcune caratteristiche della CrewCab alle cabine premium delle serie R e S, in questo modo aggiungendo uno spazio generoso che innalza il livello di comfort, aprendo la strada a una moltitudine di soluzioni creative”. La decisione di Scania di offrire cabine più spaziose costruite in piccole serie si basa su una richiesta proveniente da diversi mercati in cui viene richiesto uno spazio longitudinale maggiore. “La prestigiosa serie S - precisa Dorski sfoggia un pavimento piatto ed è già elogiata per la sua spaziosità. Con lo spazio aggiuntivo la nuova cabina diventerà il sogno per tutti quei conducenti di veicoli industriali che percorrono lunghe distanze e che trascorrono molte notti lontano da casa”. Queste cabine possono essere equipaggiate ad esempio con il letto estendibile da 100 cm, senza la necessità di doverlo ripiegare. L’aggiunta di 27 cm alla lunghezza iniziale di 200 cm (che si misura dai pedali alla parete posteriore) rappresenta un aumento di oltre il 13 per cento, qualcosa che sicuramente fa la differenza e apre la strada a soluzioni interessanti. “Il vantaggio più evidente - afferma Dorski - è ovviamente per autisti di veicoli a lungo raggio, che sono sempre alla ricerca di soluzioni premium più confortevoli: avranno la possibilità di utilizzare lo spazio ulteriore per avere un’abitabilità maggiore o per alloggiare un letto più ampio, oppure entrambe le opzioni. Queste cabine possono essere impiegate per altri utilizzi, ad esempio per i veicoli delle autoscuole, per i mezzi per la difesa e quelli per il soccorso, che avranno la possibilità di trasportare passeggeri che hanno ricevuto assistenza”. Lo spazio extra viene recuperato utilizzando i componenti presenti nel rinomato sistema modulare Scania, che intende certificare le cabine con l’omologazione europea.


Pagina 40

IL MONDO DEI TRASPORTI

N° 301 / Luglio-Agosto 2021

INTERVISTA

GIACOMO MAURELLI AMMINISTRATORE DELEGATO MAURELLI GROUP

Passa da Maurelli l’offensiva della spagnola Repsol T

LEADER NEL SETTORE DEL RICAMBIO TRUCK & TRAILER, L’AZIENDA FONDATA DAL NONNO E TRAMANDATA DAL PADRE DELL’ATTUALE NUMERO UNO METTE A SEGNO UNA NUOVA PIETRA MILIARE NELLA SUA STORIA EVOLUTIVA, DIVENTANDO DISTRIBUTORE ESCLUSIVO DI UNO DEI PIÙ AFFERMATI BRAND NEL SETTORE DEI LUBRIFICANTI. DALLA CONSEGNA DEL PRODOTTO ALL’ASSISTENZA TECNICA, CON I SUOI OLTRE 35 PUNTI VENDITA IN ITALIA, IL GRUPPO MAURELLI SI OCCUPERÀ DELL’INTERA FILIERA DISTRIBUTIVA. “L’OBIETTIVO È IL MANTENIMENTO DELLO STATO DI SALUTE DEI VEICOLI DEI CLIENTI NEI SETTORI TRUCK, INDUSTRIAL, AUTO E MOTO”, AFFERMA L’AD.

raghettare l’azienda ere ditata dal nonno, di cui porta il nome, e dal padre Eduardo verso nuove, avvincenti sfide. È l’obiettivo che si è posto il dottor Giacomo Maurelli quando, conseguita la laurea in Economia, si è ritrovato, in modi e tempi assolutamente imprevisti, al timone del Gruppo Maurelli. Negli anni, dimostrando sul campo non comuni doti intuitive e la capacità di saper guardare oltre l’orizzonte del mercato, ha saputo non solo ben radicare l’azienda, che oggi conta oltre 35 punti vendita, collocati sull’intero territorio italiano, e dà lavoro, tramite l’intero Gruppo, a oltre 500 risorse (numero in costante crescita). Nel diversificare le attività aziendali, l’Amministratore delegato ha investito in nuovi rami di business, dal Centro di Ricerca&Sviluppo sugli oli motore di Napoli alla sede distaccata

di MASSIMILIANO CAMPANELLA CASORIA

La sede di Capua del Gruppo Maurelli che continua il suo sviluppo aprendosi al settore dei lubrificanti in partnership con Repsol.

di Trento, al servizio degli autotrasportatori che viaggiano oltreconfine; dalla partecipazione attiva nella compagine sociale di F-Trucks Italia, importatore esclusivo in Italia del marchio di pesanti Ford, del cui sviluppo rete si occupa il figlio Eduardo, alla scelta di essere tra i protagonisti della costituzione di VEM, importatore di cargo scooter elettrici a marchio RAP. Sull’onda lunga di un crescente sviluppo, per nulla rallentato dalla pandemia, il Gruppo Maurelli mette a segno una nuova “pietra miliare” della sua storia, con la distribuzione esclusiva, sull’intero territorio italiano, del brand di lubrificanti Repsol, società spagnola nata alla fine degli Anni Ottanta, con sede centrale nella capitale Madrid, attiva nei settori del petrolio e del gas naturale, con interessi in 29 paesi, un fatturato di oltre 50 miliardi euro e


N° 301 / Luglio-Agosto 2021

una forza lavoro di oltre 25mila dipendenti.

Mdt - Come nasce il “progetto Repsol”? Quali sono le premesse e gli obiettivi di sviluppo? Maurelli - Il gruppo Maurelli, leader nel settore del ricambio truck & trailer, ha deciso di effettuare ingenti investimenti in nuovi ma adiacenti settori alle proprie attività come l’oleodinamica, il bus, l’auto e il fleet management. Da anni importante e affezionato cliente dei prodotti Repsol, grazie agli ottimi rapporti con la direzione italiana abbiamo avuto l’opportunità di poter presentare un nostro progetto di gestione e sviluppo del prodotto in Italia direttamente alla sede spagnola: da questo parte la nuova avventura con uno dei marchi mondiali più importanti come Repsol.

Mdt - Qual è stato l’iter del progetto e quali manager sono stati coinvolti nella sottoscrizione della partnership? Maurelli - Il board da me guidato ha da subito compreso la potenzialità di questo pro getto, forte della conoscenza approfondita del territorio, e ha dato mandato al proprio management di sviluppare un piano di lavoro. La proposta è stata accolta con entusiasmo dal Direttore Divisione Lubrificanti Rlesa Clara Velasco. Grazie a un’attiva e proficua collaborazione, i due team di lavoro hanno bruciato tutti i tempi per permetterci, oggi, di essere già attivi e efficienti sulla distribuzione, consegna del prodotto e assistenza tecnica.

Mdt - A quale tipologia di cliente professionale si rivolge in particolare il prodotto Repsol? Maurelli - L’inserimento nell’offerta Maurelli dell’intera gamma di lubrificanti, liquidi permanenti e liquidi freni a marchio Repsol genera numerosi benefici che pervadono l’intero gruppo, in tutte le sue divisioni dedite alla cura dei mezzi pesanti, per i quali abbiamo strutturato quel ventaglio di soluzioni e proposte ormai noto. Le peculiarità della gamma di prodotti Repsol, però, non si esauriscono in questo settore, anzi: la selezione del lubrificante di qualità è di vitale importanza

anche per i veicoli commerciali leggeri, le autovetture e le moto, coinvolgendo una clientela potenzialmente infinita. La tecnologia e la qualità dell’offerta di lubrificanti Repsol sono garanzia di performance ottimali in termini di efficacia e durata per tutti i veicoli, da due ruote a salire. Attraversando l’intera filiera distributiva, con la nostra offerta vogliamo raggiungere tutti gli appassionati dei motori, per contribuire al mantenimento dello stato di salute

IL MONDO DEI TRASPORTI

potenziale energetico del Pianeta e disponiamo di uno dei sistemi di raffinazione tra i più efficienti di Europa. I lubrificanti vengono prodotti nell’impianto sito all’interno della raffineria di Puertollano, nel cuore della Spagna. Le attività di Ricerca&Sviluppo e di espansione della gamma di prodotto avvengono all’interno del Repsol Tec Lab, situato a Mostoles, nei pressi di Madrid, il più grande centro di ricerca e sviluppo per prodotti petroliferi in Europa.

fonte di orgoglio e energia, che desideriamo condividere con tutti i nostri interlocutori, sia storici sia nuovi.

Mdt - In base alla sua esperienza, quanto è importante equipaggiare un veicolo industriale con un lubrificante di qualità? Maurelli - È fondamentale: le nuove tecnologie applicate ai motori, ma soprattutto dei sistemi di scarico, impongono l’utilizzo di prodotti di massima qualità e soprattutto che

Pagina 41

striali.

Mdt - Oggi quali sono i grandi brand con i quali il Gruppo Maurelli, nei suoi vari segmenti di business, ha stretto una partnership? Maurelli - Maurelli Group ha scelto di schierarsi in prima linea per la salvaguardia dell’ambiente e ha deciso di diventare distributore di veicoli elettrici a tre ruote utilizzati nella micro-logistica per le con segne last-mile, proponendo e offrendo soluzioni

La fornitura di ricambi è uno dei business di Maurelli Group, leader nella distribuzione componenti per veicoli industriali.

dei loro veicoli. In particolare, i segmenti dei lubrificanti coperti da Repsol e distribuiti da noi in esclusiva sul territorio italiano sono: Truck, Industrial, Auto, Moto.

Mdt - Com’è costituita la famiglia di lubrificanti Repsol per il trasporto professionale? Maurelli - La gamma di prodotti Repsol copre tutte le esigenze di questo canale professionale: lubrificanti per i motori, anche di ultimissima generazione, per cambi e trasmissioni, movimenti idraulici, liquidi permanenti e liquidi freni. L’offerta Repsol prevede una vasta gamma di oli per il settore automotive e per l’industria, che si adattano alle necessità del cliente e sono omologati dalle principali case moto e automobilistiche.

Mdt - Dove vengono sviluppati e prodotti i lubrificanti Repsol? Maurelli - Sviluppiamo attività nelle zone con maggiore

Mdt - Nel proporre alla clientela la nuova offerta di lubrificanti, il Gruppo Maurelli sta studiando apposite campagne di marketing? Maurelli - Il nostro Team Marketing da sempre si contraddistingue per l’originalità delle sue iniziative, volte ad accompagnare ciascun acquisto dei clienti, per ringraziarli della scelta e della fiducia di cui siamo onorati. Sappiamo bene che il processo di acquisto non si esaurisce con la con segna del prodotto e/o l’erogazione del servizio e pianifichiamo ogni attività promozionale per lasciare un segno nel cuore della clientela. Tale spirito di sicuro pervaderà anche l’offerta di lubrificanti a marchio Repsol ma con una maggiore enfasi: ci stiamo approcciando a un mercato e a un’utenza differenti dalle consuete e vogliamo trasmettere solo sensazioni positive. L’ampliamento della nostra offerta e del mercato di riferimento è per noi

siano omologati dalla Case costruttrici. È fondamentale richiedere al proprio fornitore le schede di omologazione: sul mercato esistono lubrificanti sulle cui etichette sono indicati livelli di specifica ma, non essendo omologati, in caso di problemi al mezzo il costruttore non risponderà dei danni occorsi a causa di un lubrificante non idoneo.

Mdt - Da questo punto di vista qual è la “chiave di differenza” del prodotto Repsol? Maurelli - La qualità del prodotto è sicuramente il primo fattore, a seguire omologazioni dei costruttori su tutti i prodotti, personale qualificato e formato, disponibilità costante di tutta la gamma con il preciso scopo di assicurare il miglior servizio ai clienti. I prodotti e le materie prime Repsol sono usati anche nel quotidiano e migliorano la qualità del lavoro dei clienti, il loro benessere e la loro sicurezza, e riguardano la quasi totalità dei segmenti indu-

green e di mobilità tramite la società di nuova costituzione VEM, azienda che nasce dalla decennale esperienza dei suoi soci nel settore dell’automotive, divenuta dealer esclusivo per l’Italia dei cargo scoo ter elettrici a marchio RAP, già largamente impiegati in servizi post-vendita e micro-logistica. Il Gruppo Maurelli inoltre ha dato vita, nel 2019, insieme ad altri tre soci, a F-Trucks Italia, che sta portando sul mercato italiano gli inconfondibili camion contrassegnati dall’ovale blu: i truck a marchio Ford Trucks. I grandi obiettivi del Gruppo riguardano anche GT Parts che, nata come punto vendita di ricambi, è evoluta in un progetto più ambizioso: un’officina unica nel suo genere in Sud Italia. GT Parts è officina autorizzata Mercedes, Ford Trucks, DAF, Schmitz nella zona industriale di Pastorano, ma non solo. Mira oggi a essere un nuovo punto di riferimento per i clienti per la meccanica, la

diagnostica, la vendita di ricambi e tutte le altre tipologie di riparazioni meccaniche per i veicoli. Formau, società del Gruppo dedita all’assistenza tecnica e alla formazione, sta portando avanti, in collaborazione con il partner Texa, il programma didattico Texaedu, strutturato in moduli che consentono a ogni officina di seguire il corso specifico più adatto alle proprie esigenze. L’obiettivo è quello che da sempre contraddistingue l’operato Formau: rendere sempre più professionale e competente il lavoro svolto in officina. Sono tante le partnership portate avanti dal Gruppo Maurelli tramite le sue diverse società. Questo è fondamentale in un mondo e in un settore sempre più tecnologico e connesso.

Mdt - Oggi nel suo complesso com’è costituita la “grande famiglia” Maurelli? Quali sono le società, le dimensioni, caratteristiche e prospettive di sviluppo? Maurelli - A oggi il Gruppo Maurelli si sostanzia come leader internazionale nel settore truck & trailer grazie alle competenze nel proprio core business che le singole società del gruppo hanno saputo sviluppare nel tempo. I servizi offerti spaziano dalla vendita di ricambi originali e aftermarket, che rappresenta il core business ed è realizzata attraverso gli oltre 35 punti vendita collocati su tutto il territorio italiano, per continuare con la manutenzione, l’assistenza post-vendita e la formazione professionale, tutte affidate ai migliori e sperti e professionisti, costantemente aggiornati sulle evoluzioni dei sistemi elettronici e di diagnosi. Nel 2020, la strategia di diversificazione attuata dal Gruppo, ispirata alla volontà di garantire un miglioramento dei servizi offerti, ha portato al lancio sul mercato del nuovo brand Motyx, progetto nato dopo un’importante attività di Ricerca&Sviluppo e che si va ad affiancare allo storico brand del Gruppo Maurelli: GAM Technic. Motyx si presenta al mondo con una gamma completa di accessori, prodotti di fissaggio, utensili e dispositivi di protezione individuale al servizio di tutti i professionisti del settore automotive e non solo.


IL MONDO DEI TRASPORTI

Pagina 42

N° 301 / Luglio-Agosto 2021

ALLTRUCKS / LA STORIA DI CORAGGIO DEL TEAM DI OFFICINA VARESE

L’orgoglio di risorgere dalle fiamme UNO SPAVENTOSO INCENDIO NEL 2018 L’AVEVA COMPLETAMENTE RASA AL SUOLO.

NELLO

STESSO PERIODO DECIDEVA DI ENTRARE NEL NETWORK DI ASSISTENZA TEDESCO, IN ITALIA GUIDATO DA

GIANLUCA ANNUNZIATA CHE AFFERMA: “L’INSEGNAMENTO DI CLAUDIO MARCONI È PREZIOSO: ANCHE LE PIÙ DURE DIFFICOLTÀ SI SUPERANO QUANDO NON SI È SOLI”.

R

MAX CAMPANELLA VANZAGHELLO

imboccarsi le maniche con la consapevolezza che, anche nei momenti più difficili, non si è mai da soli. È il messaggio che proviene dalla storia di Officina Varese, entrata a far parte del network Alltrucks Trucks & Trailers nell’estate 2019, a una manciata di mesi da un vero e proprio spartiacque nella vita dell’azienda, del suo fondatore Claudio Marconi e del team di sette dipendenti: nella notte di quel terribile 13 novembre un rogo spaventoso, sprigionato da un camion in riparazione all’interno del capannone, devastava completamente l’edificio. Attonito, Marconi raggiungeva la sede osservando i vigili del fuoco impegnati a proprio rischio nel difendere quanto possibile dal logorio delle fiamme: “Guardavo quei pompieri e mi dicevo: stanno

facendo di tutto, rischiano la vita e neanche mi conoscono”. All’alba al suo fianco i sette dipendenti: sette famiglie a un passo dal baratro. Il loro titolare si ritrova a incoraggiarli, e a chiedere sostegno: “Se mi aiutate tutti, ricominciamo daccapo”. Nel giro di un anno e mezzo Officina Varese risplende a nuo vo, sotto le insegne Alltrucks in co-branding con Total Lubrificanti, con la quale Alltrucks collabora a livello internazionale. Gianluca Annunziata, Italy Market Manager Alltrucks, è al suo fianco sin dall’inizio: “Al di là dell’amicizia, che posso definire storica, Claudio trasmette a tutti un prezioso insegnamento: anche le difficoltà più dure si superano se non si è da soli”. Oggi 57enne, Marconi è un tipico esempio di imprenditoria lombarda: originario di Busto Arsizio, nel fazzoletto di terra che, in provincia di Varese, ruota attorno all’aero-

porto di Milano Malpensa, è solo un ragazzino quando dimostra di conoscere in dettaglio il motore delle vetture di quei tempi. Figlio di un autista dedito ai trasporti locali, in braccio al padre impara a mettere le mani sul volante del camion, a 13 anni si diverte a montare e smontare i propulsori. È il connubio vincente passione per i camionsensibilità per l’assistenza. È il 1984. A 19 anni, Marconi è dipendente della storica Officina Varese, così chiamata per la sua prima localizzazione lungo via Varese, principale direttrice di Busto, per poi trasferirsi, nel 1973, nella vicina Codevilla, al confine con Vanzaghello. “L’officina - spiega l’imprenditore sin dal primo dopoguerra si è sempre tramandata da titolare a dipendenti”. Marconi ne diventa proprietario nel 1995 e, due anni dopo, Officina Varese è ufficialmente parte della rete di assistenza Volvo

Da sinistra: Gianluca Annunziata, Italy Market Manager Alltrucks Trucks & Trailers; Renato Basso, Lubricants Truck & Bus Total Italia; Claudio Marconi, titolare di Officina Varese.

Trucks. Sono gli anni dello sbarco dell’FH, ammiraglia svedese che si faceva notare per tutta una serie di innovazioni tutte da conoscere per il mercato italiano, dal motore alla cabina. “È stato - prosegue Marconi - un importante cambiamento: tutti partivamo alla pari ed eravamo chiamati a imparare sul campo”. Marconi dimostra le sue capacità,

strando quelle che sono le priorità per il suo veicolo; se segue i miei consigli sa che non avrà problemi con il mezzo”. Ogni veicolo industriale trattore, autocarro e semirimorchio, ma anche furgoni e vetture - qualunque sia il marchio, in Officina Varese trova una vera filiera d’assistenza, seguendo un iter lungo il

sbaragliando i competitor nelle diverse competizioni organizzate dal costruttore svedese, dall’assistenza ai ricambi. Nel 2005 la scelta di restare indipendente si sposa con la domanda di una clientela sempre più multibrand. “Ho sempre preferito - aggiunge Marconi - lavorare per aziende medio-piccole, che rappresentano la parte rilevante del bacino di nostra competenza: la clientela arriva anche da Ber gamo e Milano. La più grande soddisfazione? Sapere che dopo essere passato da qui il cliente torna sempre, per ché attribuisce valore al servizio. Pur non esercitando ufficialmente assistenza h 24, ogni cliente sa che in caso di necessità noi ci siamo sempre. Il mio segreto? Mi sento un “sarto” della riparazione: al cliente do dei consigli, illu-

quale una persona competente lo segue, fino al ritorno al cliente. Un’attenzione meticolosa, rafforzata dalla mai sopita voglia di conoscere, sapere, imparare (l’ufficio di Marconi è una vera biblioteca dei motori per camion), che rappresentava per Annunziata quanto di meglio per il network Alltrucks Italia. “Conoscevo Claudio - spiega il manager della Rete tedesca - da diversi anni e l’idea di chiedergli di percorrere un tratto di strada insieme l’ho avuta sin dall’inizio del mio incarico in Alltrucks. Il confronto è iniziato nel periodo in cui è avvenuto l’incendio: quando ho rivisto la sede nuova, il pensiero che di lì a poco ci sarebbero state le insegne Alltrucks è stato per me motivo di orgoglio. Oltre al servizio ai trasportatori, che fa parte

della mission comune con Claudio, si lanciava un segnale di speranza, di ottimismo sul futuro: se si è uniti con il team, ogni ostacolo si abbatte, ogni risultato si può raggiungere”. Oggi Officina Varese è un gioiello tutto nuovo: 3.850 mq di spazio, 700 mq di officina, che diventano mille con il soppalco. Il 2018 annus horribilis? Macché: “Quell’anno avevamo lavorato talmente tanto - afferma Marconi - che la pausa forzata per l’incendio non ha influito sul risultato finale”. Anche in termini di business, che per Officina Varese vuol dire attestarsi sui 5 milioni di euro di fatturato, costante negli ultimi anni. L’anno dopo, nel 2019, Marconi e i suoi si rimboccano le maniche: mentre veniva rifatto il tetto si occupavano degli sgomberi e della tinteggiatura. I clienti? Tutti dalla loro parte: “Comprendendo le difficoltà, attendevano pazienti il tempo necessario per ogni intervento”, ricorda l’imprenditore. I lavori proseguono nel 2020, sfruttando i due mesi della pandemia, quando l’attività di officina registra un lieve calo, per poi riprendersi del tutto nel corso dell’anno e per l’intero 2021. Ben collocata sul territorio, a due passi dall’autostrada Milano-Torino, Officina Varese è diventata anche Total Rubia Truck Center, specializzandosi ulteriormente nei lubrificanti. “La solidità di Officina Varese - afferma in conclusione Annunziata - e la versatilità di Claudio e del suo team rappresentano il vero valore aggiunto non solo per Alltrucks, ma soprattutto per i suoi clienti, che possono contare sulla disponibilità, la tenacia e la grande passione per le questioni tecniche che caratterizza questi ragazzi”.


jli^inni j_lmih_ j[mmcih_ ,1)2#707,17(51$7,21$/,7  :::707,17(51$7,21$/,7


IL MONDO DEI TRASPORTI

Pagina 44

N° 301 / Luglio-Agosto 2021

HYDRONAT / ALL’AVANGUARDIA NEL SERVICE PER SPONDE IDRAULICHE

Spondisti per vocazione L’AZIENDA CON SEDE E OFFICINA A PADERNO DUGNANO (MI), NATA DALL’ESPERIENZA PROFESSIONALE DI DOMENICO NATALE, CHE OGGI LA GESTISCE INSIEME AI FIGLI MIRKO E ANDREA, È UN PUNTO DI RIFERIMENTO NELL’INSTALLAZIONE, MANUTENZIONE E RIPARAZIONE DELLE SPONDE CARICATRICI DEI PRINCIPALI BRAND OPERANTI SUL MERCATO.

PUNTO QUALIFICANTE DELL’OPERATO HYDRONAT È IL SERVICE: PROFESSIONALITÀ E SERIETÀ CARATTERIZZANO OGNI SINGOLO INTERVENTO DEL PERSONALE, SIA IN SEDE SIA SU STRADA.

I

FABIO BASILICO

PADERNO DUGNANO

l mestiere di spondista, cioè di addetto alla manutenzione e al montaggio delle sponde idrauliche, non si improvvisa. Oggi che il mercato delle sponde ha assunto una rilevanza centrale nell’organizzazione del sistema trasporti la figura dello spondista si distingue per specializzazione e specifiche competenze, da confondere con quelle di un classico meccanico. Siamo andati a conoscere da vicino un’azienda di spondisti di provata esperienza: la HydroNat, con sede e officina a Paderno Dugnano (MI), nata dall’esperienza professionale di Domenico Natale, che oggi la gestisce insieme ai figli Mirko e Andrea. “HydroNat si fonda sull’esperienza ultratrentennale di mio padre Domenico nell’installazione, manutenzione e riparazione delle sponde caricatrici - ci racconta Mirko Natale, che nell’azienda si occupa di amministrazione, mentre il fratello Andrea e il validissimo collega peruviano Saul Gamboa Chacon affiancano il padre in officina e negli interventi assistenziali in esterna - All’inizio degli anni Duemila, mio padre ha deciso di mettersi

in proprio e qualche anno dopo è stato affiancato da Andrea. Io sono entrato in aziende nel 2016, pochi mesi dopo l’inaugurazione dell’attuale sede di Paderno Dugnano”. HydroNat è costantemente cresciuta negli anni riuscendo a conquistarsi la fiducia di numerosi clienti e aziende di ogni settore e dimensioni, dal singolo padroncino alle grandi flotte. Punto qualificante dell’operato HydroNat è proprio il service: professionalità e serietà caratterizzano ogni singolo intervento del personale, sia nell’officina di Paderno Dugnano sia nell’attività di assistenza su strada, attiva 24 ore su 24, 7 giorni su 7, grazie alla disponibilità di due furgoni allestiti come officina mobile. “Siamo in grado di intervenire su tutti i mezzi anche in movimento garantendo un servizio completo a tutti i nostri clienti, il tutto grazie alla nostra officina mobile attrezzata con tutti i componenti e ricambi necessari a eseguire un intervento mirato – precisa Mirko Natale – Inoltre, è nostra consuetudine assicurare la piena operatività assistenziale delle flotte presso la sede delle aziende clienti”. Non solo, perché a Paderno Dugnano sono molto

esperti anche per quanto riguarda l’installazione completa delle sponde. “Per i montaggi completi delle sponde collaboriamo con Antonio D’Ambra e la sua azienda Hydromontaggi continua Mirko Natale - I nostri montaggi sono curati in tutte le fasi in ogni dettaglio, garantiti da personale qualificato, con esperienza pluriennale sul campo”. Oggi HydroNat è in grado di seguire i principali brand di riferimento del set-

tore, da Anteo ad Altimani Lift, da Elefantcar a Dautel, da HydroSystem a Palfinger, da MBB a Bär e Sorensen. “Siamo quindi in grado di intervenire su tutti i modelli di sponde di questi brand e naturalmente di montarli in base alle esigenze di ogni singolo cliente”, specifica Mirko Natale. Il raggio d’azione di HydroNat è l’intera Lombardia e il Piemonte orientale. “Ci occupiamo di ogni tipologia di veicolo, dal furgone al

truck - aggiunge Natale - e interveniamo su sponde utilizzate per il trasporto di svariate merci in tutti gli ambiti di impiego, compresi i mercati ortofrutticoli. Da gennaio ad aprile 2021 abbiamo effettuato circa 400 interventi in officina, una media di 100 al mese. Gli interventi in esterna sono almeno una cinquantina al mese mentre di montaggi completi di sponde ne effettuiamo una trentina all’anno”. Se il service è il cuore

pulsante di HydroNat nella sede di Paderno Dugnano non poteva mancare un attrezzato magazzino ricambi multimarca in grado di accontentare anche il mercato dell’usato. HydroNat soddisfa anche la richiesta esterna di ricambi tramite il servizio di spedizione in tutta Italia. “Il cliente oggi chiede innanzitutto la massima velocità di esecuzione degli interventi, sia in officina che in esterna - continua Mirko Natale - Il fermo macchina va ridotto al massimo e noi cerchiamo di fare il possibile intervenendo in modo efficace e organizzato. Lo stesso vale per i montaggi completi della sponda. Il veicolo deve essere in grado di lavorare nel più breve tempo possibile. Ci siamo anche attivati in accordo con i nostri fornitori per garantire delle offerte di sponde nuove (non trattiamo l’usato) particolarmente vantaggiose per un’ampia fascia di clientela, dal padroncino alla flotta”. Mirko Natale ha un so gno nel cassetto: aprire uno show room a fianco dell’officina. “Voglio dare a ogni cliente la possibilità di vedere e toccare le diverse tipologie di sponde disponibili sul mercato, di metterci mano e comprenderne caratteristiche e funzionamento conclude - È importante che il cliente si approcci in modo diretto alla sponda, un accessorio meccanico che de ve essere innanzitutto semplice da usare e molto pratico”.

HydRonAt

Sede: Via Giancarlo Puecher, 18 - Paderno Dugnano (MI) Fondazione: inizio anni Duemila, Domenico Natale Titolari: Domenico, Mirko e Andrea Natale Attività: installazione, manutenzione e riparazione sponde caricatrici Personale: 4 Fatturato: 495mila euro Internet: hydronat.it

Da sinistra: Mirko, Andrea e Domenico Natale con il collega di officina, il peruviano Saul Gamboa Chacon.


LOGISTICA

Pagina 46

IL MONDO DEI TRASPORTI

N° 300 / Giugno 2021

CECCARELLI GROUP / PARTNERSHIP CON IL MOVIMENTO TURISMO DEL VINO FVG

Enoturismo che passione

F

LINO SINARI UDINE

L’AZIENDA FRIULANA LEADER NEL SETTORE DELLA LOGISTICA DIVENTA TRASPORTATORE DI RIFERIMENTO DELL’ASSOCIAZIONE GUIDATA DA ELDA FELLUGA: “L’OBIETTIVO È OFFRIRE AGLI ASSOCIATI LA POSSIBILITÀ DI UN SERVIZIO SARTORIALE: CRESCE SEMPRE DI PIÙ IL DESIDERIO DA PARTE DEI TURISTI DI FARE ACQUISTI IN CANTINA E RICEVERE IL VINO A CASA”. CECCARELLI GROUP METTE IN CAMPO UNA FLOTTA DI VEICOLI COIBENTATI E UN DEPOSITO A TEMPERATURA CONTROLLATA A UDINE PER GARANTIRE UNA FILIERA ASSOLUTAMENTE CONTROLLATA.

riuli patria del vino e del buon bere. Lo sa bene l’associazione regionale “Movimento Turismo del Vino Fvg (Friuli-Venezia Giulia)”, guidata da Elda Felluga, dal 1993 portabandiera di uno stile di vita improntato alla scoperta del territorio e, in particolare, delle più belle zone votate alla viticoltura. Ne è altrettanto convinta Ceccarelli Group, azienda friulana leader nel settore della logistica e dei trasporti con sedi a Udine, Trieste, Padova, Milano e Prato che, con il Movimento Turismo del Vino Fvg, ha sottoscritto un accordo per diventare trasportatore ufficiale dell’associazione. Non poteva essere altrimenti per due realtà entrambe ancorate al territorio e a tutto quello che lo rappresenta. “Vivere ogni giorno a stretto contatto con l’eccellenza del settore vitivinicolo - spiega Luca Ceccarelli, Presidente di Ceccarelli Group ci fa fatto comprendere l’alto valore del prodotto e le aspettative dei clienti. Il fatto di aver stretto una collaborazione con un’associazione prestigiosa come il Movimento Turismo del Vino Fvg ci riempie d’orgoglio: siamo pronti a mettere a disposizione le nostre competenze per valorizzare insieme il territorio e le straordinarie eccellenze che lo caratterizzano”. Consapevolezza che, mai come in questo periodo, si sposa con il desiderio di Ceccarelli Group e Movimento Turismo del Vino Fvg di mettersi al servizio dell’intera filiera, per supportare i produttori verso la ripartenza. L’associazione, con sede a Udine, conta circa 60 cantine vitivinicole associate, che credono fermamente nell’enoturismo e fanno dell’accoglienza uno dei principali obiettivi;

potranno servirsi d’ora in poi dei servizi offerti dal gruppo che ha il suo cuore pulsante nel capoluogo friulano. “Siamo molto soddisfatti sottolinea Elda Felluga - di questa collaborazione, voluta non solo per la comunione d’intenti che caratterizza le due realtà, ma anche per offrire agli associati un partner altamente professionale, in grado di fornire un supporto logistico integrato e la possibilità di un servizio sartoriale agli enoturisti. Cresce sempre di più il desiderio dei turisti di fare acquisti in cantina e ricevere il vino

a casa: un piacevole ricordo della vacanza trascorsa nella nostra bella e variegata regione”. Non un semplice trasporto, quello di vini e distillati. Oltre a offrire mezzi adatti per le preziose merci, Ceccarelli Group fornirà anche un servizio di logistica integrata che prevede la possibilità di stoccare le merci in magazzini a temperatura controllata, di gestire in tempo reale i flussi in entrata e uscita, così come la verifica delle giacenze nelle cantine e il ripristino delle scorte necessarie.

È pari a circa il 15 per cento del fatturato il business che in Ceccarelli Group deriva dal trasporto del vino e distillati, effettuato in groupage e collettame. Per il lungo raggio l’azienda udinese mette a disposizione motrici da 9,60 metri a quattro assi, oltre a autotreni e semirimorchi; la distribuzione nell’ultimo miglio avviene con furgoni e motrici per i centri storici mezzi a metano. “Nei periodi estivi - precisa il Presidente Ceccarelli - prediligiamo l’utilizzo di casse coibentate, sia in trazione sia in distribuzione con fur-

Il giovane manager Luca Ceccarelli, Ad dell’azienda friulana in continuità con l’opera avviata dal padre Bernardino.

goni coibentati, in modo da mantenere il giusto range di temperatura: in questo modo, anche in caso di caldo eccessivo, il vino non soffre al sole”. Nella flotta Ceccarelli Group sono presenti due semirimorchi refrigerati per utilizzo in carichi completi e 60 casse mobili coibentate per le trazioni. Il vino viene ritirato direttamente dalle cantine dei vignaioli, o reti d’imprese del Friuli, e trasportato nel magazzino di Udine, presso un deposito interrato di 1.500 mq a temperatura controllata, in modo da conservarsi protetto anche per soste prolungate. Lì viene ispezionato, si procede con la bollettazione e infine con il carico su trazioni in notturna. “Le nostre destinazioni - precisa Luca Ceccarelli - sono Trieste, Padova, Bologna, Milano e Prato, dove il vino raggiunge i Centri di smistamento delle nostre filiali o viaggia attraverso i network ai quali appartiene la nostra azienda: CDS, Pallex e Astre Plus”. Ultima meta i supermercati della GDO, dove il vino viene trasportato con veicoli industriali frigoriferi, e ristoranti, hotel, bar, enoteche e trattorie dell’HoReCa. E se la promozione e la diffusione della conoscenza della cultura del vino in Friuli Venezia Giulia si realizza grazie a numerosi eventi, Ceccarelli ha dimostrato di voler fare la sua parte, presenziando in occasione dell’appuntamento Cantine Aperte, organizzato come sempre dal Movimento Turismo del Vino. La partnership con la primaria associazione friulana si colloca in un periodo di grande dinamismo per Ceccarelli Group, che ha chiuso il 2020 con un fatturato di circa 36 milioni di euro e dà lavoro a 180 dipendenti, otto dei quali assunti quest’anno.


IL MONDO DEI TRASPORTI

N° 300 / Giugno 2021

Pagina 47

ZARA LINE / LA PRESENZA FEMMINILE È UN VALORE NELL’AZIENDA REGGIANA

La corsa rosa del cavallo arabo C

SONO DIECI LE DONNE CHE IN QUESTO MOMENTO RICOPRONO UN RUOLO FONDAMENTALE ALL’INTERNO DELL’AZIENDA DI TRASPORTO UN GRUPPO COESO E DETERMINATO CHE, DAL 2007 A OGGI, È CRESCIUTO SUL PIANO PERSONALE E PROFESSIONALE IN PARALLELO CON LO SVILUPPO DELL’IMPRESA. “IN ALTRI PAESI EUROPEI I RUOLI OPERATIVI PER LE DONNE SONO LA NORMALITÀ: OCCORRE FARE UN SALTO IN QUESTA DIREZIONE ANCHE IN ITALIA. ZARA È UN PASSO AVANTI”, AFFERMA IL TEAM.

CON HEADQUARTER A SAN POLO D’ENZA.

MAX CAMPANELLA SAN POLO D’ENZA

he il mondo del trasporto sia prettamente maschile è oggi un’espressione fuorviante. In una fase di importante cambiamento di valori nelle aziende, a ogni livello si moltiplica la presenza femminile, sempre più ritenuta strategica per lo sviluppo e la crescita del business. Trend che parte dalla Germania, dove l’illustre Cancelliera Angela Merkel ha saputo dimostrare, in 16 anni di governo del Paese, che quando si tratta di prendere decisioni importanti contano i fatti. Così sembrano pensarla le tante donne impegnate nel settore del trasporto. E non già solamente in ruoli amministrativi e gestionali, ma sempre più in posizioni operative, oltre che di vertice. Un esempio arriva da Zara Line, azienda di trasporto con headquarter a San Polo d’Enza, in provincia di Reggio Emilia, concessionaria del network Pallex, che fa della presenza femminile uno dei punti di forza: dal 2007 a oggi Zara Line ha puntato sul valore aggiunto della presenza delle donne all’interno di un’azienda. Oggi Zara è composta da un team femminile giovane e altamente qualificato. “Sono dieci - spiegano in Zara - le donne che in questo momento ricoprono un ruolo fondamentale all’interno dell’azienda. Per

R

Foto di gruppo per le dieci donne che ricoprono un ruolo fondamentale all’interno dell’azienda reggiana Zara Line.

un’impresa come Zara è un valore di grande importanza. In questi anni l’azienda è cresciuta e, con lei, sono cresciute le risorse umane: dal 2007 Zara ha permesso un’importante crescita professionale, assegnando a tutte loro un valore aggiunto all’interno dell’organizzazione aziendale”.

Il team è costituito da donne che occupano posizioni diverse: in un mondo ancora molto maschile qual è quello dei trasporti, ritenete di aver dovuto, o di dover tuttora affrontare maggiori difficoltà? “No, in Zara affermano determinate - non ci sono mai state difficoltà da questo punto

di vista. In qualsiasi settore dell’azienda, essere donna non ha portato difficoltà, anzi: è sempre stato considerato un fatto positivo”. Qual è a vostro giudizio il valore aggiunto di una maggiore presenza femminile in azienda? “Una maggiore presenza femminile - risponde

il gruppo - è da considerare come valore aggiunto per qualsiasi realtà aziendale. Professionalità, organizzazione, precisione, lungimiranza e sinergia sono gli ideali in cui crediamo e le fondamenta della nostra azienda. In più, la proverbiale forza delle donne fa la differenza, come viene rappresentato anche dal nostro marchio con un fantastico cavallo arabo in corsa”. Qual è la parte più affascinante del vostro lavoro? “In Zara - aggiungono - ogni presenza femminile, grazie alla collaborazione e condivisione, è riuscita a raggiungere gli obiettivi prefissati, seppur lavorando in settori e ambiti differenti. Sono stati raggiunti determinati livelli di crescita e ciò ha permesso a tutte noi di arricchire il proprio bagaglio professionale e personale”. Quale potrebbe essere un modo per consentire al mondo dei trasporti di risultare più attraente per le donne? “Quel lo dei trasporti - dichiarano le dieci donne di Zara - è un settore come tutti gli altri: in altri Paesi la presenza femminile, anche in ambito di personale viaggiante, è una normalità. Anche in Italia deve iniziare a passare questo messaggio. I nostri uffici amministrativo e operativo sono prevalentemente al femminile, per questo motivo noi crediamo che in Zara il “modo” sia stato già trovato”.

CON IL SERVIZIO NON STOP CONSEGNE IN GIORNATA IN GRAN PARTE DEL NORD ITALIA

MASSIMA ATTENZIONE AI TEMPI DI CONSEGNA DALL’HEADQUARTER DI REGGIO EMILIA

eggio Emilia è un punto di snodo sempre più decisivo per il trasporto merci, in particolare per il rispetto dei tempi di consegna. Ne è convinta Zara Line che grazie al network Pallex,

per i tempi di consegna in Italia, ha lanciato il servizio Non Stop: consegna in 24h in tantissime zone della Penisola (gran parte del Centro-Nord Italia) e max h 72 per le zone disagiate. Soprattutto, cosa as-

solutamente importante, la certezza dei tempi di consegna. “Come tutti sanno spiega Alessandro Mele, Direttore Generale Zara Line - l’Italia è un Paese meraviglioso, ma è anche

Alessandro Mele, da un anno Direttore Generale di Zara Line, guidata dai cugini Ferrari.

vero che, dal punto di vista morfologico, presenta zone difficili da raggiungere. È giusto che si conoscano le tempistiche corrette necessarie per spedire i prodotti e aumentare la trasparenza nei confronti dei clienti”. Le tempistiche indicate da Zara Line sono frutto di un lavoro di squadra. “Un team qualificato - prosegue Mele - opera con intensità e costanza, impegnandosi a soddisfare le esigenze del cliente curando ogni minimo dettaglio con efficienza, professionalità e rapidità. Proprio per organizzare al meglio l’attività di trasporto, il servizio Zara è pensato su misura per la clientela: l’esigenza del cliente rappresenta anche la nostra esigenza”. Il team di Zara è chiamato a valutare i diversi fattori che influenzano i tempi di consegna: tempistiche di guida, orari, navette notturne, viabilità ecc. “Qualunque sia la strada da percorrere Zara Line intende rappresentare un aiuto, un punto di riferimento per ogni esigenza di trasporto. Sicurezza, operatività e velocità sono i nostri principali punti di forza”.


IL MONDO DEI TRASPORTI

Pagina 48

N° 301 / Luglio-Agosto 2021

PALLETWAYS / CONTINUA LO SVILUPPO CAPILLARE

L’importanza di fare rete

I

MAX CAMPANELLA CALDERARA DI RENO

n poco più di due anni, con l’arrivo al timone del CEO Massimiliano Peres, il network di Palletways Italia è passato da 108 a 132 Concessionari, che saliranno a 150 da qui al 2022. Un processo di graduale evoluzione e trasformazione del Network, con l’obiettivo di raggiungere la massima capillarità del servizio di trasporto espresso su pallet per garantire ai Clienti finali standard qualitativi sempre più elevati e favorire l’acquisizione di nuovi business da parte dei Concessionari. Un percorso lungo il quale Peres, timoniere dell’azienda da gennaio 2019, a settembre dello stesso anno ha voluto coinvolgere Bruno Oliana, Direttore Network con un’importante esperienza sviluppa-

ta nella logistica su pallet. Classe 1962, cresciuto in una famiglia di Vittorio Veneto, Oliana entra giovanissimo nel mondo dei trasporti: subito dopo le scuole superiori, inizia dalla gavetta presso la storica F.lli Piccin autotrasporti, azienda guidata dai cugini che tutto avrebbero voluto fuorché quel giovane si dedicasse ai trasporti. Quando la passione è nel dna, difficile da fermare, a maggior ragione in uno come Oliana che fa del dinamismo la sua ragion d’essere: dal facchinaggio alla bollettazione, dopo cinque anni dimostra sul campo il suo potenziale e diventa capo filiale. Nel 2000 viene contattato da un famoso Corriere Nazionale e Internazionale leader nei Trasporti Spedizione Merce e Groupage in Italia dove resta per 10 anni. A quel punto Oliana ha maturato una profonda conoscenza

delle aziende di trasporto italiane, che mette a disposizione dei primi network che vanno costituendosi nel nostro Paese, assumendo il ruolo di Direttore Generale. CONSEGNE VELOCI

Quando nel 2019 Peres assume la guida di Palletways Italia, individua in Oliana il manager adatto a condividere e perseguire la strategia di riorganizzazione e sviluppo capillare del Network in Italia. “Ci siamo incontrati in estate - afferma il Direttore Rete - e abbiamo trovato immediatamente una sintonia di valori e di vision: abbiamo predisposto un percorso di sviluppo del network con l’obiettivo di garantire al mercato la consegna delle merci su tutto il territorio nazionale in 24/48 ore con un

elevato standard qualitativo. Abbiamo così definito i criteri con cui realizzare il piano strategico, dapprima attraverso l’analisi dei KPI operativi e della copertura delle aree geografiche per individuare quelle zone dove i Concessionari avevano un territorio troppo ampio da coprire o volumi troppo elevati da distribuire. Ci siamo quindi dati l’obiettivo di aumentare la redditività per i Concessionari, soprattutto in un mercato in forte trasformazione dopo la pandemia Covid-19: l’aumento del numero di Concessionari comporta per gli stessi un’opportunità di contenimento dei costi di distribuzione e di miglioramento delle performance a fronte di una riduzione dell’area di competenza”. Il tandem Peres-Oliana ha portato, nel solo 2020, all’ingresso di 21 nuove Conces-

A Calderara di Reno (BO) è localizzato l’unico hub centrale di Palletways Italia, che garantisce consegne in 24/48 ore.

sionarie. “È del tutto naturale - prosegue Oliana - che si registrino ingressi e uscite di Concessionari dal Network, in funzione della condivisione o meno del progetto, di mutate esigenze o di situazioni di difficolta aziendali. Il network Palletways propone ai Clienti la stessa tipologia di servizi e gli stessi standard qualitativi in tutti i 24 Paesi in cui è presente. Per questo è fondamentale puntare su Aziende altamente qualificate! I criteri con cui scegliamo le Aziende da inserire nel ns Network sono la solidità sul piano finanziario, il radicamento nel territorio e la capacità di garantire sempre un eccellente servizio di distribuzione, anche per un solo bancale”. Com’è l’attuale “stato dell’arte” del network Palletways Italia? “La presenza nel Centro-Sud - afferma il ma-

nager veneto - assicura performance che ci posizionano come leader di mercato. Stiamo rafforzando la capillarità nel Centro-Nord, che negli ultimi anni è stata l’area che più di tutte ha sofferto la crisi e le difficoltà del settore del trasporto, e quest’anno contiamo di inserire almeno altre cinque nuove realtà”. L’INGRESSO NEL MONDO

Qual è il vantaggio dell’adesione a Palletways per aziende di trasporto meno dimensionate? “Entrare a far parte del network Palletways - aggiunge Oliana - vuol dire poter offrire ai clienti una gamma di servizi di trasporto che da soli farebbero fatica a proporre e gestire: attraverso Palletways, le aziende entrano a far parte di un mondo formato da oltre 450 Conces-


N° 301 / Luglio-Agosto 2021

IL MONDO DEI TRASPORTI

Pagina 49

DEL NETWORK SULL’INTERO TERRITORIO NAZIONALE

per crescere insieme

IN POCO PIÙ DI DUE ANNI GIUNGE A UN PRIMO TRAGUARDO IL PROGETTO DI CAPILLARITÀ AVVIATO DAL CEO MASSIMILIANO PERES, AFFIANCATO DA UN MANAGER DI COMPROVATA ESPERIENZA QUAL È BRUNO OLIANA, DIRETTORE NETWORK: L’OBIETTIVO È ARRIVARE A 150 CONCESSIONARI ENTRO IL 2022. “FAR PARTE DI PALLETWAYS VUOL DIRE GARANTIRE ELEVATI STANDARD QUALITATIVI, AUMENTARE IL PORTAFOGLIO DEI SERVIZI DA OFFRIRE AI CLIENTI E BENEFICIARE DEL SUPPORTO DEL MANAGEMENT DI UN’AZIENDA MULTINAZIONALE”, AFFERMA L’AMMINISTRATORE DELEGATO.

sionari, in grado di garantire il servizio di consegna e di ritiro in tutta Europa, con una facilità e semplicità di gestione grazie all’utilizzo dello stesso sistema di gestione: non esiste alcuna differenza tra la gestione di un servizio nazionale ed un servizio internazionale. Ecco quindi che i Concessionari sono così in grado di focalizzarsi sullo sviluppo commerciale del loro business e sulla gestione delle consegne nella propria zona di distribuzione. Tutto l’aspetto gestionale ed amministrativo è semplificato dall’avere un unico interlocutore: Palletways”. ESPERTI AL SERVIZIO

Inoltre, dallo scorso anno, è possibile offrire anche il servizio P2C (Pallet to Consumer), cioè quelle consegne dell’ultimo miglio richieste dai consumatori che ordinano merce pesante o voluminosa e che, per questo, non possono essere consegnate dai corrieri tradizionali. “Ai Concessionari - sottolinea Massimiliano Peres - proponiamo un legame stretto: entrare nel network Palletways vuol dire far parte di una multinazionale con logiche di gestione che favoriscono l’intero Network: ovunque in Europa il modello è lo stesso, dalla programmazione alla tracciabilità. I Concessionari possono beneficiare del supporto di un team di manager di assoluto valore in grado di affiancare il Concessionario a 360°, dagli aspetti gestionali a quelli operativi, da quelli amministrativi e finanziari a quelli commerciali: un team di esperti al servizio dei Concessionari! Palletways prevede per tutte le aziende del Network, senza distinzione, pari equità di diritti e as-

Massimiliano Peres (a sinistra), da gennaio 2019 Ad di Palletways Italia, e Bruno Oliana, Direttore Rete da settembre 2019.

soluta imparzialità: un Concessionario non può essere allontanato se non per motivazioni gravi, precise e dimostrate. Non da ultimo, nel Network non è prevista l’esclusività commerciale territoriale, ma solo l’esclusiva distributiva: questo vuol dire che le aziende maggiormente strutturate hanno la possibilità di crescere svolgendo attività commerciali anche al di fuori della loro zona di competenza, fatto salvo il rispetto della regola della non concorrenza: un Concessionario non può proporsi a un cliente di un altro Concessionario. Su questo punto siamo molto ri-

gidi: il mancato rispetto di tale regola può comportare l’esclusione dal Network”. Appartenere a Palletways vuol dire affrontare le situazioni potendo contare su un solido supporto. “Così è stato per la Brexit che - aggiunge Peres - nei primi mesi dell’anno ha messo in crisi le spedizioni da e verso il Regno Unito, perché la merce non veniva sdoganata. Palletways fin dallo scorso anno ha iniziato ad adeguare il Portal alle nuove procedure introdotte dalla Brexit, ha individuato individuando un broker per ciascun Paese ed ha assicurato ai Concessionari la

giusta formazione, con sessioni in gruppi, webinar, studiate per illustrare le regole e imparare a gestire le operazioni verso il Regno Unito. Oggi ciascun Concessionario organizza in totale autonomia le spedizioni attraverso il nostro Portal”. MODELLO PER LE URGENZE

Com’è costituito il modello distributivo che assegna a Palletways la sua specificità? “La nostra scelta – dichiara Peres – è quella di mantenere un unico hub centrale, che garantisce sul territorio le con-

segne in 24-48 ore. Accanto a questo, ubicato a Bologna con i suoi 10mila pallet movimentati ogni notte, abbiamo attualmente due hub regionali, a Milano e Avellino, per evitare inutili passaggi su Bologna per l’interscambio della merci al Nord ed al Sud Italia. Un modello certamente più oneroso, sul piano economico, ma che garantisce il servizio h 24 per consegne urgenti in tutta Italia. Nei prossimi mesi ci saranno interessanti novità che ci permetteranno di offrire al mercato ed ai nostri Concessionari un numero sempre maggiore di servizi e di soluzioni per il tra-

sporto delle merci”. Subito dopo il primo lockdown Palletways ha lanciato specifiche campagne commerciali a supporto dei Concessionari: qual è il bilancio di queste iniziative? “Il successo - afferma Peres - è nei numeri: dopo il primo lockdown siamo ritornati rapidamente ai volumi ante-pandemia. Purtroppo lo scorso Ottobre siamo ripiombati nell’incubo della pandemia e del lockdown che soltanto dal mese di maggio ha visto una graduale ripresa. Abbiamo voluto contribuire alla ripartenza, offrendo degli incentivi commerciali per i Concessionari da poter offrire ai loro clienti, consolidati e nuovi, dapprima con la campagna #RicominciAMOinsieme da giugno a dicembre dello scorso anno, poi con la nuova campagna #Pallet4You lanciata a maggio, con nuovi incentivi commerciali per i Concessionari, differenziati per Regione, che arrivano fino al 15 per cento del costo totale. Con queste iniziative e con la focalizzazione al servizio, sono certo che raggiungeremo i nostri obiettivi di crescita”. Come sta cambiando il mondo delle spedizioni con l’avvento della pandemia? “È sotto gli occhi di tutti - afferma il CEO - il trend di forte riduzione delle partite medie: i completisti ricevono sempre più richieste di carichi parziali e meno di carichi completi, i corrieri sono sommersi di spedizioni per consegne di acquisti e-commerce. In questo contesto Palletways si propone come player in grado di soddisfare le nuove esigenze: il nostro dna è proprio la capacità di occuparci delle piccole spedizioni, composte anche solo da un singolo bancale”.


MOBILITÀ

Pagina 50

A

IL MONDO DEI TRASPORTI

N° 300 / Giugno 2021

SPECIALE / TUTTI I MODELLI E LE SOLUZIONI

Bus elettrico, il futuro A CURA DI FABIO BASILICO

nche il settore autobus è in forte tensione per far fronte alle sfide alla mobilità del futuro, in particolare di quella di ambito urbano e interurbano, sempre più concentrata sulla sostenibilità e l’efficienza di un sistema trasporto passeggeri progressivamente più integrato. Non solo veicoli, dunque, ma anche servizi e avanzate strategie di implementazione dell’offerta di trasporto. Costruttori e operatori si stanno muovendo su più fronti per venire incontro alle esigenze del pubblico e soddisfarne le richieste di mobilità nel modo più flessibile, economico ed ecologico possibile. In questo servizio passiamo in rassegna i modelli a propulsione alternativa elettrica e ibrida attualmente proposti sul mercato. È questa tipologia di mezzi che, nello specifico settore di impiego del trasporto urbano, sta manifestando le più innovative potenzialità tecnologiche.

I

VECO BUS propone diverse soluzioni a trazione alternativa, a cominciare dal poliedrico Crealis, evoluzione dell’Urbanway che trova impiego nel BRT (Bus Rapid Transit), ovvero le linee autobus dedicate a scorrimento veloce, ma anche come filobus electric a zero emissioni. La gamma Crealis è disponibile con lunghezze da 12 fino a 18 metri e quattro motorizzazioni, di cui una full hybrid. Iveco Bus propone anche Crealis In-Motion-Charging, un filobus con batterie di trazione che si ricaricano mediante le linee elettriche aeree. Il motore termico è stato eliminato dando origine a un veicolo a zero emissioni che può circolare ovunque in città, anche nelle zone sprovviste di linee aeree. Crealis è un autobus urbano dalla linea estetica originale e moderna. L’area passeggeri si caratterizza per una luminosità elevata, rafforzata ancor più dall’inserimento delle vetrature in parte bassa mentre l’illuminazione interna a LED crea un’atmosfera rilassante e contribuisce al risparmio energetico, grazie alla sua durata di vita estesa e al basso consumo. Altro punto di forza del costruttore è l’EWay, vero e proprio alfiere dell’elettromobilità. Iveco Bus, tramite il suo brand Heuliez, propone un autobus elettrico progettato per adeguarsi a ogni esigenza. E-Way di Heuliez è disponibile in 3 diverse lunghezze (9,5 m, 12 m e 18 m) e con varie soluzioni di ricarica, dalla carica notturna lenta a quella rapida con pantografo. La flessibilità raggiunge i massimi livelli con la selezione del numero di batterie, che si traduce nella possibilità di adattare il veicolo esattamente ai requisiti di autonomia del cliente, senza dover trasportare del peso extra e quindi compromettere la capacità di trasporto passeggeri. Disponibile nelle versioni standard e articolata, E-Way presenta caratteristiche costruttive uniche che lo collocano ai vertici della categoria in termini di qualità e affidabilità. La struttura del veicolo è in acciaio inox mentre la trazione è affidata a un motore elettrico posizionato centralmente e collegato direttamente al ponte posteriore. L’architettura di EWay offre indubbi vantaggi tecnologici per un veicolo urbano a batterie: essa risulta la soluzione più affidabile ed economica per il cliente e per i passeggeri poiché evita i problemi derivanti da una maggiore sollecita-

zione ed esposizione agli urti che si possono avere con altre soluzioni tecniche come ad esempio quella che prevede motori elettrici installati sulle ruote e allo stesso tempo è garanzia di maggiore comfort interno in quanto produce un livello di vibrazioni inferiore. Con E-Way la sicurezza è di serie grazie a EBS con ABS e ASR, i sistemi elettronici che assicurano la stabilità del veicolo in qualsiasi condizione, anche nelle situazioni di guida più critiche. Per l’illuminazione anteriore si può optare per i proiettori Full LED per una visibilità a tutto campo dell’autista. E sempre in tema di ibridi, Iveco Bus ne propone due modelli da 12 e 18 metri anche all’interno della famiglia Urbanway. Il modello da 12 m è equipaggiato con supercapacito-

ri mentre quello da 18 m può essere dotato sia di supercapacitori sia di batterie. L’ibrido seriale Urbanway garantisce un’accelerazione progressiva e confortevole. In prossimità delle fermate con velocità inferiore ai 20 km/h il motore diesel si spegne automaticamente passando in modalità Full Electric (modalità Arrive & Go).

MERCEDES-BENZ ha nel Cita-

ro elettrico un affermato testimonial dell’impegno costante che il costruttore tedesco riserva alla mobilità alternativa. Tutte le varianti del Citaro elettrico si basano sul best-seller mondiale Citaro, che nel 2012 è stato il primo autobus urbano al mondo a rispettare la classe di emissioni Euro VI, quella attualmente

più severa. Senza dimenticare che è completamente non inquinante la variante Citaro hybrid, con un consumo di carburante ulteriormente ridotto. Se il Citaro NGT a metano con il biogas arriva quasi a un bilancio neutrale di CO2, il Citaro a trazione completamente elettrica compie il passo successivo, dalle basse emissioni alle emissioni zero locali. L’eCitaro rappresenta dunque una valida opportunità per le aziende italiane del TPL. Il sistema di trazione full electric si basa su un asse a portale elettrico con motori elettrici sui mozzi ruota. La potenza di picco dei motori si attesta su 2 x 125 kW, la coppia equivale a 2 x 485 Nm ed è pienamente disponibile fin dalla partenza, com’è insito nel sistema, assicurando così una dinamica di marcia

adeguata anche con l’autobus pieno di passeggeri. L’alimentazione di tensione è affidata alle batterie agli ioni di litio con una capacità complessiva massima di circa 243 kWh, suddivise in un massimo di dieci moduli da 25 kWh ciascuno. A tutto ciò si possono aggiungere, su richiesta del cliente, altri due o quattro moduli di batterie da collocare sul tetto. Anche la tecnica di ricarica è flessibile e prevede anche l’utilizzo alternativo del pantografo. Con dotazione completa di batterie Citaro elettrico raggiunge un’autonomia di circa 150 chilometri in estate. In questo modo si possono servire reti parziali con il carico di lavoro giornaliero di un autobus urbano senza necessità di ricariche intermedie. Per EvoBus elettromobilità significa ri-

Il Citaro elettrico testimonia il massiccio impegno Mercedes-Benz nella mobilità alternativa. In alto, il poliedrico filobus elettrico della gamma Iveco Crealis.


IL MONDO DEI TRASPORTI

N° 300 / Giugno 2021

Pagina 51

MESSI IN CAMPO DAI COSTRUTTORI

IL TRASPORTO PASSEGGERI STA CAMBIANDO E LE CITTÀ SONO IL LUOGO

è già presente

PRIVILEGIATO PER CONCRETIZZARE NUOVE SOLUZIONI DI MOBILITÀ CHE SIANO SOSTENIBILI DAL PUNTO DI VISTA ECOLOGICO ED ECONOMICO. COSTRUTTORI E OPERATORI SI STANNO MUOVENDO SU PIÙ FRONTI PER VENIRE INCONTRO ALLE ESIGENZE DEL PUBBLICO E SODDISFARNE LE MOLTEPLICI RICHIESTE.

I MODELLI A

PROPULSIONE ALTERNATIVA ELETTRICA E IBRIDA SONO I MEZZI CHE, NELLO SPECIFICO SETTORE DI IMPIEGO DEL TRASPORTO URBANO, STANNO MANIFESTANDO LE PIÙ INNOVATIVE POTENZIALITÀ TECNOLOGICHE.

pensare la mobilità urbana con gli autobus. Il Citaro a trazione completamente elettrica fa parte del sistema complessivo eMobility predisposto da Daimler Buses: in pratica, prima della fase di acquisto è previsto il competente servizio di consulenza eMobility Consulting, con gli esperti che analizzano ogni linea, valutano i settori di impiego e li collegano tra loro. Un programma di simulazione calcola quindi il fabbisogno energetico. Come risultato vengono forniti consigli e calcoli precisi sia in merito alle infrastrutture di ricarica che al consumo energetico, alla potenza di allaccio dell’alimentazione elettrica del deposito e alla gestione delle ricariche. Con l’elettromobilità cambiano anche i servizi di assistenza, manutenzione e riparazione. Per

questo l’eMobility Service del marchio di servizi OMNIplus offre concept di assistenza su misura: si parte dalla classica assistenza presso l’officina del cliente, proseguendo per i servizi di officina forniti in abbinamento ai contratti di assistenza in centri di competenza della fabbrica, per poi arrivare al BusDepot Management; in quest’ultimo caso, i collaboratori di OMNIplus si occupano di eseguire determinati interventi, fino all’assistenza completa dei veicoli direttamente presso l’officina del cliente. Il 2020 ha visto l’estensione dell’offerta sul prodotto elettrico Citaro sia per il 18 metri che per le macchine più corte.

M AN ha di recente ampliato la gamma Lion’s City E con la versio-

ne articolato da 18 metri del suo urbano elettrico. Grazie a una notevole autonomia e a una considerevole capacità passeggeri, il Lion’s City 18 E è il candidato perfetto per coprire le linee urbane con molti passeggeri. In aprile è ufficialmente iniziata la produzione in serie del Lion’s City 18 E nello stabilimento MAN di Starachowice, in Polonia, mentre la produzione in serie del fratello Lion’s City 12 E è iniziata lo scorso ottobre. Sull’autobus elettrico, circa il 30-40 per cento della scocca è diverso da quello della sua versione convenzionale. Poi c’è la trasmissione elettrica, le batterie e altri componenti ad alta tensione. Nell’ambito del processo di preparazione della produzione a Starachowice, è stato necessario acquistare nuovi sistemi

o aggiornare quelli esistenti, riprogettare i processi e programmare per circa 3.500 dipendenti una formazione approfondita e specifica. Con una lunghezza di 18 metri, l’autobus urbano articolato elettrico può ospitare a bordo fino a 120 passeggeri. Il design ottimizzato dell’autotelaio dell’elettrico garantisce inoltre una dinamica di marcia ottimale per viaggiare in modo piacevole e tranquillo, potendo contare su una autonomia di 200 km che può arrivare fino a 270 km in condizione favorevole d’utilizzo. Due motori elettrici centrali sul secondo e terzo asse conferiscono all’autobus la potenza necessaria per muoversi nel traffico cittadino. A differenza dei motori elettrici posizionati nei mozzi delle ruote, i modelli MAN si caratteriz-

Il Citywide LF BEV 4x2 è l’avanzata proposta Scania con motore elettrico di 300 kW. In alto, il Lion’s City 18 E che completa la gamma dell’urbano MAN.

zano per una maggiore accessibilità ai propulsori, rendendo le manutenzioni molto più agevoli e veloci. I due assi motore sono sincronizzati elettronicamente e contribuiscono anche a migliorare la maneggevolezza del bus articolato poiché aumentano la stabilità di guida e anche il livello di sicurezza. Inoltre, il bus articolato viene fornito con un sistema di controllo anti-jackknifing e un sistema di controllo dell’angolo di curvatura, che ne migliorano ulteriormente la stabilità e la sicurezza di guida. In questo modo è possibile prevenire in anticipo situazioni critiche in quanto la coppia motrice può essere distribuita selettivamente sui due assi motore in linea con la situazione specifica della strada. Inoltre, i due assi motore aumentano l’energia massima recuperata in frenata. La trasmissione completamente elettrica ha una potenza da 320 kW a un massimo di 480 kW. L’energia proviene dalle batterie modulari con 640 kWh di capacità. Le batterie hanno un sistema di gestione della temperatura intelligente. Questo sistema garantisce che siano sempre efficienti, indipendentemente delle temperature. Il veicolo è equipaggiato con otto pacchi batteria, tutti i componenti ad alto voltaggio sono posizionati sul tetto in un’area che risulta sicura in caso di collisione e di facile accesso in caso di manutenzione. Questa soluzione, e l’assenza di tunnel motore, garantiscono maggior spazio interno, che è stato utilizzato per aggiungere quattro ulteriori sedili. Con una potenza di carica media di 100 kW e una potenza massima di 150 kW, il bus articolato può essere ricaricato completamente in meno di quattro ore. Il compito di fare da apripista alla strategia MAN di elettrificazione del trasporto passeggeri europeo è stato assunto dal Lion’s City E che giorno dopo giorno mostra di cosa è capace e attira l’attenzione di un numero crescente di operatori del trasporto pubblico, conducenti ed esperti del settore. Senza contare la disponibilità nella segue


IL MONDO DEI TRASPORTI

Pagina 52

N° 301 / Luglio-Agosto 2021

seguito

Bus elettrico, il futuro è già presente

gamma del Leone del Lion’s City 12C EfficientHybrid, urbani di 12 metri con due doppie porte, motore MAN D1556 da 9 litri per 330 cv di potenza e cambio automatico ZF Ecolife 2 a sei rapporti. Il modulo MAN EfficientHybrid è costituito da un motore elettrico posizionato tra motore diesel e cambio. Il motore elettrico è in pratica un generatore di avvio dell’albero motore che, con il condensatore UltraCap posizionato sul tetto e il sistema di gestione intelligente dell’energia, garantisce un sostanziale incremento dell’efficienza energetica del veicolo, con una riduzione del consumo di carburante, delle emissioni nocive e del rumore. A ogni frenata, il generatore di avvio dell’albero motore trasforma immediatamente in energia elettrica l’energia di recupero ottenuta, mentre la funzione start&stop spegne automaticamente il motore diesel alle fermate e ai semafori consentendo così anche ai passeggeri di apprezzare la tecnologia ibrida.

S

CANIA punta a essere tra i leader nella mobilità sostenibile. E lo fa ponendo molta attenzione ai dettagli al fine di sviluppare gli autobus, i pullman e i servizi necessari per rendere la mobilità sostenibile una realtà, in ogni parte del mondo. I tecnici Grifone riflettono sul fatto che l’urbanizzazione porta con sé un aumento delle esigenze di trasporto che interessa le aree metropolitane. Questa situazione pone molte sfide in termini di congestione del traffico, ma anche di emissioni e di inquinamento, che incidono sia sulle persone sia sull’ambiente. Privilegiare i viaggi collettivi per ridurre il numero di veicoli può essere di grande aiuto, ma questo richiede un sistema di trasporti pubblici che inviti all’utilizzo. Secondo Scania, “per ridurre ulteriormente le emissioni, tale sistema deve essere composto da veicoli che siano efficienti dal punto energetico ed elettrici o a carburanti rinnovabili, a seconda dell’attività che svolgono e delle condizioni del luogo. Scania offre autobus e servizi in cui la sostenibilità va di pari passo con l’economia operativa: questo è un requisito essenziale per la diffusione su larga scala dei trasporti sostenibili”. Il costruttore svedese offre una gamma ricca per il trasporto urbano, con molteplici opzioni per personalizzare le configurazioni. Ugualmente importante l’ampia proposta di servizi. Questa flessibilità consente a Scania di garantire la soluzioni su misura per le sfide e le esigenze di

Irizar propone un’offerta articolata di modelli ibridi ed elettrici. Qui sopra l’ie bus elettrico. Sotto, l’Urbino elettrico del costruttore polacco Solaris.

ogni singolo operatore. Il Citywide LF con pianale ribassato è dotato di un motore elettrico di 300 kW massimo con coppia di 2.100 Nm. La capacità della batteria ad alta tensione è pari a 254 kW o 330 kW, rispettivamente con 8 o 10 gruppi batteria. Dotato di un cambio a 2 velocità, l’urbano svedese prevede tra le opzioni di ricarica anche l’utilizzo di pantografo invertito fino a 300 kW. Citywide LE con accesso ribassato è un ibrido elettrico equipaggiato con motore termico da 9 litri che eroga una potenza massima di 235 kW/320 cv e una coppia di 1.600 Nm e motore elettrico da 130 kW e 1.030 Nm. Il cambio è a 12 velocità con Scania Opticruise. Stessa configurazione per la versione ibrida elettrica di Interlink che prevede un cambio a 12 velocità con macchina elettrica integrata.

I

RIZAR è caratterizzata da una proposta articolata in modelli ibridi (i4 e i3) e modelli elettrici (ie bus, ie bus 18 metri e ie tram). Irizar i4 ibrido, disponibile nelle versioni da 10,7 m fino a 13m a 2 assi e 15 m a 3 assi, è un pullman per aree periferiche e suburbane a breve percorren-

za e per il trasporto scolastico. La tecnologia ibrida creata da Irizar è la tecnologia ibrida parallela. Combina un motore a propulsione diesel o biodiesel di ultima generazione (HVO) con un motore elettrico che agisce da propulsore o generatore di elettricità e che, in funzione, può agire singolarmente o congiuntamente, ottenendo così ottimi livelli di resa ed efficienza. Nella versione a due assi fino a 13 metri, il motore è un Cummins da 6.7 litri da 300 cv di potenza e coppia da 1.200 Nm, che rispetta la normativa Euro 6 Step D. La versione ibrida è il modello Eaton, composto da una scatola del cambio robotizzata a 6 velocità Eaton-Fuller e da un inverter e motore elettrico Edrive (44/65KW) refrigerati ad acqua e batterie agli ioni di litio. Nella versione a 3 assi e 15 m di lunghezza, il motore è un Cummins da 8,9 litri con potenza di 370 cv e coppia di 1.600 Nm. Irizar i4 ibrido classe II per linee a corta e media percorrenza è proposto nelle versioni H, M e L e pavimento alto con bagagliaio. Irizar i3 ibrido è un suburbano low entry destinato alle brevi distanze e in grado di offrire una modularità che consente di rego-

lare la capacità dei passeggeri alle necessità del cliente. E’ disponibile nelle versioni da 10,7, 12,2 o 12,75 a 2 assi e 15 metri a 3 assi. Anche in questo caso, la tecnologia ibrida creata da Irizar è la tecnologia ibrida parallela. Nella versione a due assi fino a 13 metri, il motore è sempre un Cummins da 6.7 litri da 300 cv di potenza e coppia di 1.200 Nm. La versione ibrida è il modello Eaton, composto da una scatola del cambio robotizzata a 6 velocità Eaton-Fuller e da un inverter e motore elettrico Edrive (44/65KW) refrigerati ad acqua e batterie agli ioni di litio. Nella versione a 3 assi e 15 m di lunghezza il motore è ancora Cummins da 8,9 litri con potenza di 370 cv e coppia di 1.600 Nm. Creato e prodotto con tecnologia propria del marchio spagnolo, con un’attenzione particolare al ciclo di durata del mezzo, Irizar ie bus è frutto della scommessa strategica del Gruppo sull’innovazione. Il veicolo, di 12 metri, 100 per cento elettrico, è progettato per offrire i maggiori livelli possibili di efficienza energetica, minor consumo e autonomia del veicolo, oltre a un’ottima gestione del fine vita dello stesso. Salendo di li-

vello, l’articolato ie bus 18 metri rappresenta una nuova soluzione di mobilità urbana per il transito di un maggior numero di persone. E’ un veicolo che integra i principali componenti e sistemi con tecnologia del Gruppo Irizar nonché i sistemi di sicurezza attiva più avanzati sul mercato. Rappresenta una valida alternativa al tram per quanto riguarda flessibilità, capacità operativa e costi. L’ie tram è un autobus articolato da 18 metri con caratteristiche estetiche tipiche del tram. La combinazione della notevole capacità, la facilità d’accesso e la circolazione interna tipiche di un tram e la flessibilità di un autobus urbano, insieme alla condizione di emissioni zero, definiscono il Dna di questo veicolo. Il design ha origine da un linguaggio estetico minimalista, privo di fronzoli e in cui tutte le caratteristiche rispondono ad aspetti funzionali concreti che consentono di creare un’identità e un’immagine facilmente riconoscibile dagli utenti. Una delle caratteristiche più rilevanti del design dell’ie tram è l’arco perimetrale cromato che circonda il veicolo e che inquadra la grande superficie vetrata laterale che diventa una tela in grado di riflettere l’ambiente in cui circola il veicolo. Con configurazione da 3 a 5 porte, ie tram è in grado di trasportare fino a 140 passeggeri.

S

OLARIS è un solido punto di riferimento europeo per l’elettromobilità. Il costruttore polacco propone una gamma articolata di modelli in grado di soddisfare tutte le esigenze del moderno trasporto passeggeri urbano. Novità del 2020 nel portafoglio di soluzioni del costruttore polacco, Urbino 15 LE electric viene realizzato negli stabilimenti di Solaris Bus & Coach S.A in Polonia e commercializzato in Italia con l’apporto della filiale italiana con headquarter a Roma. L’introduzione sul mercato del nuovo Urbino 15 LE electric implementa la gamma degli autobus Solaris con propulsione elettrica. Difatti, l’offerta “elettrica” ??di Solaris, che prima comprendeva solo autobus urbani di classe I, soddisfa con la presentazione della nuova versione, con lunghezza di 15 metri, anche le esigenze del trasporto interurbano. Questo nuovo autobus è quindi offerto con le caratteristiche specifiche di classe I o classe II, a seconda della tipologia di servizio, urbano o interurbano, al quale dovrà essere destinato dall’utilizzasegue


AV VERE TUTTO SI PUÒ.

btsadv.com

SICUREZZA. EFFICIENZA. VERSAT TILITÀ À.

TASSO LEASING 2,5% 5% E V VAL ALORE DI RISCA AT TTO GARANTITO * GIÀ DA AL 3° ANNO A

VERSAT V TILITÀ STRAOR RDINARIA Architettura modulare personalizzabile per il servizio navvetta, feriale, festivo e sostitu utivo.

CAPA ACITÀ SUPERIORE ORE 3 Fino a 12 m di capacità bagagli, cappelliere incluse, I½RSETEWWIKKIVMGSQSHMIWMGYVM

AFFIDABILITÀ COLLAUDAT TA A Esclusiva tecnolo ogia Euro 6 HI-SCR senza biso ogno di rigenerazione attiva.

REDDITIVITÀ GARANTIT NTITA A Miglior TCO della d categoria, bassi consumi,, manutenzione ridotta.

Off ffer er ta valida fino al 30/11/2021 sulla gamma Evadys Classe III su nuovi ordini e modelli a stock salvo esaurimento scor te, su valori di fornitura fino a 230.000€ e sog getta a condizioni. Esempio di fornitura 230.000€ e leasing a 36 mesi: anticipo 10%, valore finale di riscatto 45%, 36 canoni mensili a 3.432,54€ comprensivi polizza Incendio e Fur to, T Taasso Leasing 2,50%. Spese pratica, IV VA A , traspor to e messa su strada escluse. Salvo approvazione IVECO CAPIT TAL (CNH Industrial Capital Europe S. A .S.). Polizza Fur to e Incendio obbligatoria ed è inclusa in canone. Prima di aderire al finanziamento è necessario prendere visione delle Condizioni Contrattuali e dei Fogli infformativi ormativi disponibili presso le concessionarie aderenti. Possibilità di personalizzare l’off ffer er ta con altri impor ti direttamente in concessionaria. Immagine a puro scopo illustrativo. Messaggio pubblicitario con finalità promozionale. *


IL MONDO DEI TRASPORTI

Pagina 54

N° 301 / Luglio-Agosto 2021

seguito

Bus elettrico, il futuro è già presente

tore finale. Lo stoccaggio di energia elettrica negli autobus Urbino 15 LE electric è ottenuto con l’utilizzo di batterie Solaris High Energy + di ultima generazione. Le prime unità costruite sono dotate di sei pacchi batteria, aventi una potenza totale di oltre 470 kWh. Due pacchi batteria sono installati sul tetto, i restanti quattro sono posizionati nella parte posteriore del bus. Le batterie possono essere ricaricate tramite plug-in oppure, dotazione opzionale, utilizzando un pantografo che, in base alla richiesta, può essere del tipo montato sull’autobus o invertito; il tutto in piena compatibilità con l’infrastruttura di ricarica esistente o pianificata. L’unità motrice del tre assi è il motore elettrico centrale CeTrax da 300 kW raffreddato a liquido. Urbino 15 LE electric va a completare, ponendosi come moderna alternativa ai già commercializzati autobus a metano, l’offerta di Solaris di veicoli a impatto ambientale zero, che possano garantire, sia in ambito di classe I che classe II, l’effettuazione di linee ad alta frequentazione e capacità. La filiale italiana di Solaris Bus & Coach SA, nel corso del 2020, perseverando in una strategia commerciale ad hoc mirata, soprattutto, all’incremento della quota di mercato degli autobus con propulsione alternativa, ha consolidato la propria presenza nell’ambito di tali prodotti: nello specifico bus urbani full electric, idrogeno e filobus.

carica basati sui nuovi standard europei. La ricarica può avere luogo a una capacità compresa fra 30 e 450 kW, con una differenza fra la ricarica lenta e rapida. Tutti gli autobus sono dotati di spina di ricarica Combo2 per una potenza di ricarica pari a 50 kW. Per una maggiore capacità, sono disponibili su richiesta pantografi montati sul tetto e sull’infrastruttura. Con un pantografo è possibile generare fino a 450 kW di capacità. Il pantografo montato sul tetto e sull’infrastruttura può essere utilizzato anche per la ricarica in deposito. La famiglia Citea Electric comprende i modelli SLF/SLFA, SLE e LLE. Grazie al pavimento totalmente piano, all’elevato grado di modularità, alle dimensioni compatte e all’ottima manovrabilità, il Citea Low Floor Electric è adatto ai trasporti pubblici urbani e ai flussi intensi di passeggeri con frequenza elevata. La gamma SLF/SLFA è composta dal due assi SLF 12 m e dagli articolati SLFA-181, 180 e 187. Il modello SLE è proposto in configurazione 12 e 12,9 metri mentre la famiglia LLE include le configurazioni 99 e 115. Il Citea Light Low Entry Electric è un innovativo concetto di autobus con peso ridotto e accesso ribassato, progettato appo-

sitamente per le condizioni complesse dei trasporti urbani e regionali. Grazie al metodo costruttivo accuratamente studiato, il peso ridotto si accompagna a importanti vantaggi, come il basso consumo energetico e i costi di manutenzione contenuti. Il Citea LLE Electric è dotato di un pacco batterie che consente l’operatività in un ampio raggio. Il pantografo opzionale permette una ricarica più rapida, aumentando ulteriormente il suo raggio di azione. Lo scorso febbraio, VDL ha celebrato il raggiungimento dei 100 milioni di chilometri percorsi dagli oltre 800 bus elettrici Citea in esercizio in ben 55 città europee.

V

OLVO propone diverse soluzioni di mobilità alternativa. Molte città limitano l’accesso alle zone centrali e si moltiplicano le aree in cui sono imposti limiti di emissioni, rumorosità e velocità. Il Volvo 7900 Electric è in grado di soddisfare questi limiti di emissioni e rumorosità e, con l’ausilio del sistema Zone Management di Volvo, può anche gestire i li-

B

YD, colosso cinese dell’autobus elettrico, ha da tempo iniziato a farsi notare in Europa e nel resto del mondo, mettendo a segno ordini di una certa consistenza in diversi Paesi (Italia compresa). Da segnalare l’accordo firmato con l’operatore del trasporto pubblico di Bogotà (Colombia) che ha ordinato oltre 1.000 bus elettrici con logo BYD, la cui consegna è prevista nel 2021 e nel 2022. BYD propone bus elettrici con lunghezze di 8,7 – 12 e 18 metri, a cui si aggiunge un coach da 12,9 metri.

V

DL è un partner all’avanguardia nella transizione energetica di operatori ed enti statali in tutta Europa, sia per quanto riguarda la transizione completa dai motori diesel a quelli elettrici, sia per l’introduzione graduale di miglioramenti mirati a rinnovare la flotta con un certo numero di autobus elettrici. Per raggiungere l’obiettivo di zero emissioni, VDL Bus & Coach ha sviluppato uno speciale processo di transizione a supporto dei clienti. Dall’analisi alla definizione del progetto, ai calcoli, all’esecuzione, alle prove e alle operazioni quotidiane, l’azienda supporta i clienti in tutti i modi e lungo l’intero percorso. Oltre a essere un fornitore di autobus, VDL è fornitore di sistemi completi: infrastruttura di ricarica e gestione completa del progetto anche dal punto di vista della formazione e della consulenza. La gamma VDL Citea Electric è basata su un concetto modulare: il sistema permette a ogni operatore di configurare la propria flotta a zero emissioni. I modelli della gamma Citea Electric possono essere ricaricati utilizzando diversi sistemi di ri-

miti di velocità. Tutti gli autobus Volvo per uso urbano possono essere equipaggiati con il nuovo Pedestrian and Cyclist Detection System, un sistema che avvisa il conducente e gli utenti della strada più vulnerabili in caso di rischio di collisione. Inoltre, con la soluzione di carica flessibile studiata da Volvo è possibile utilizzare sia il sistema a pantografo che a cavo. La carica può avvenire nei momenti più comodi in funzione della pianificazione: nelle pause, nei momenti più calmi o di notte, in ogni combinazione. Volvo 7900 Electric Hybrid consente un livello di servizio più elevato abbinato a una riduzione media del consumo di carburante del 75 per cento. Il resto della potenza necessaria viene generata dal recupero energetico e dalla ricarica eseguita al capolinea. Il risparmio energetico totale è del 60 per cento. La catena cinematica dei veicoli Volvo Electric Hybrid è un’estensione di quella, collaudatissima, impiegata nel Volvo 7900 Hybrid. La differenza consiste in una maggiore potenza del motore elettrico, in una capacità superiore di accumulo di energia e nel sistema di ricarica Volvo Opportunity Charging System. In definitiva, Volvo 7900 Electric Hybrid offre una grande flessibilità. Grazie alla ricarica rapida al capolinea, la produttività è sempre elevata e la tabella di marcia viene rispettata. Inoltre, può funzionare in modalità elettrica in aree specifiche ed essere utilizzato come ibrido su qualsiasi percorso. L’offerta Volvo Buses comprende anche il Volvo 7900 S-Charge, che, grazie al servizio connesso Zone Management, è in grado di operare in solo

Il bokbussen Volvo 7900 elettrico. In centro, gli elettrici della cinese Byd e, in alto, la gamma Citea di VDL.

elettrico alle fermate, nei depositi e in zone specifiche a zero emissioni, il tutto senza necessità di infrastrutture di ricarica. Il modello 7900 SCharge è un veicolo elettrico ibrido (HEV, Hybrid Electric Vehicle). In pratica, è un bus a ricarica autonoma e, contrariamente ai cosiddetti “ibridi leggeri”, è in grado di operare in modalità solo elettrica: infatti, può arrivare alla fermata, sostare e ripartire in totale silenzio e senza emissioni. Inoltre, in zone specifiche può percorrere fino a un chilometro in solo elettrico raggiungendo una velocità massima di 50 km/h, sempre in funzione delle condizioni locali. Consumi ed emissioni di CO2 vengono ridotti fino al 39 per cento e, includendo NOx e particolati, l’abbattimento delle emissioni tocca quasi il 50 per cento. Inoltre, Volvo 7900 S-Charge è certificato per funzionare con percentuali di biocarburante fino al 100 per cento, il che riduce ulteriormente il suo impatto ambientale. Nel Volvo 7900 S-Charge articolato la capacità aumenta a 154 passeggeri, 4 in più rispetto al precedente modello diesel articolato. La catena cinematica Volvo I-Sam comprende un motore elettrico da 110 kW, un motore Euro 6 da 5 litri correttamente dimensionato e un cambio Volvo I-Shift.


o n a i l a t i o d i u # io g

UNA BELLA STORIA IT TALIANA ALIANA DAL 1919

industriaitalianaautobus.com


Promozione speciale su Ricambi e Fluidi Originali 2 anni di garanzia sulll’intervento Condizioni vantaggio ose sulla manodopera 3HUVRQDOHWHFQLFRDOWDPHQWHTXDOLÀFDWR Attrezzature e tecnolo ogie d’avanguardia ... e ulteriori vantaggi


IDLE I M ONDO T R A S P O RT I Mensile di Politica, Economia, Cultura e Tecnica del Trasporto FONDATO E DIRETTO DA PAOLO ALTIERI

VEICOLI COMMERCIALI

INTERVISTA / GABRIELE TRIMIGLIOZZI, CEO YYM STORE

Pronti con la Casa della Mobilità

I

MAX CAMPANELLA ANAGNI

n un’epoca di profonda e voluzione dei meccanismi che sottostanno alla mobilità, di merci e persone, aziende e professionisti che si dedicano al trasporto necessitano sempre più di riferimenti competenti, aggiornati, in linea con le moderne e rinnovate esigenze. Per rispondere a questa esigenza, ad Anagni, in piena valle Latina, nella provincia di Frosinone a una manciata di chilometri da Roma, ha aperto le porte il primo YYM (You, Your, Mobility) Store, che ha l’obiettivo - espresso chiaramente dalle imprese che ne sono promotrici, YouVan e YouMove - di proporsi come player a tut to tondo per il mondo della mobilità. In particolare per il noleggio, considerando che il claim scelto è “Ready to Rent!”, pronti per il noleggio. Alla guida della società YYM troviamo un volto noto nel settore, per l’esperienza maturata sul campo e per il dinamismo che l’ha sempre contraddistinto. Classe 1974, Gabriele Trimigliozzi, Amministratore di YYM, nel 1995 è venditore in Romana Diesel, Concessionaria Iveco con headquarter nella Capitale, per poi passare nel 1998 nella Nuova ABC, Concessionaria MercedesBenz. Nel 2003 assume l’incarico di Responsabile della filiale di Latina della Stella e, nel 2007, rientra nella sede di Roma come Responsabile Commerciale della divisione Trucks di tutte le se di Mercedes-Benz Roma. Nel 2010 decide di intraprendere l’attività imprenditoriale orientandosi verso il settore del Noleggio a Lungo Termine e dei servizi complementari del settore Veicoli Commerciali, rappresentando i principali player dell’automotive. In Mercedes-Benz Roma nasce l’amicizia tra Marco Cicini e Gabriele Trimigliozzi, consolidata negli anni e caratterizzata dalla medesima determinazione e vision. I due manager si uniscono con l’obiettivo di far evolvere un nuovo concept di mobilità, dedicato ai professionisti e alle flotte Van, proponendo un canale distributivo differente: un dealer di noleggio e servizi customizzati che scende in campo per le esigenze di aziende e professionisti che utilizzano i veicoli commerciali come fonti di ricavo per la propria attività.

Mdt - Chi sono i protagonisti della nascita del primo YYM Store e quali ne sono gli obiettivi a medio e lungo termine? Trimigliozzi - YYM Store nasce per volontà di YouVan e YouMove. Gli operatori del servizio courier, della distribuzione, dell’ultimo miglio, food e pharma, hanno la necessità di professionisti, di un brand e di dealer che li orientino verso la perfetta correlazione tra il prodotto e il servizio più consono alle loro esigenze: noleggio a medio, a lungo termine, veicoli nuovi o usati, con allestimenti personalizzati o standard, elettrici, sharing, servizi di stop&go e quickly. Tutto questo, con uno spiccato orientamento verso l’evoluzione e l’innovazione, saranno i protagonisti

N° 301 / Luglio-Agosto 2021

YOUVAN E YOUMOVE, BRAND INNOVATIVI, INAUGURANO AD ANAGNI IL PRIMO YYM (YOU, YOUR, MOBILITY ) LA PRIMA “CASA DI MOBILITÀ”, DOVE SI TROVERÀ TUTTO CIÒ CHE È UTILE PER IL TRASPORTO DEL FUTURO.

ALLA GUIDA DELLA

NEONATA AZIENDA UN MANAGER CON UN’IMPORTANTE ESPERIENZA NELLE CONCESSIONARIE DI VEICOLI PROFESSIONALI.

“READY TO RENT È IL NOSTRO CLAIM”, AFFERMA GABRIELE TRIMIGLIOZZI. di una mobilità istantanea. YYM Store ha nel nome la sua mission: vuole essere la Vostra Location, il Vostro Dealer, La Vostra Casa di tutto ciò che è utile alla Vostra Mobilità: You, Your, Mobility.

Mdt - In quali segmenti di mercato andrà a operare il nuovo player? Trimigliozzi - Scooter, auto, veicoli commerciali di ogni genere, anche Green e tutto ciò che sarà utile e indispensabile per la mobilità sarà pre-

sente nello Store per essere Ready to Rent!

Mdt - Quale valore aggiunto viene apportato dai fondatori? Trimigliozzi - Ogni segmento di mercato ha bisogno della propria professionalità e competenza. YouMove offrirà servizi per il settore auto e microcar e tutto ciò che è mobilità per la persona; YouVan porterà il suo know-how in microvan, scooter e veicoli commerciali quale risposta per il trasporto della merce. Mdt - Quali sono le dimensioni dello store di Anagni? Quante le persone che vi opereranno? Trimigliozzi - Lo store ha 400 mq tra uffici e showroom, il piazzale è di 1.500 mq, che si arricchisce di un’ulteriore area di 5.000 mq quale punto logistico per gestire i picchi di rientro prodotto. Il team è composto da nove figure tra diretti e indiretti, ma è prossimo alla crescita con l’inserimento di altre due risorse commerciali.

Mdt - Lo store di Anagni na sce sulla base di un approccio decisamente innovativo: qual è la “chiave di differenza” con cui si propone ai professionisti del trasporto? Trimigliozzi - Consulenza, innovazione, formazione e aggregazione leale di relazioni sono certamente le

Gabriele Trimigliozzi e due scorci dello YYM Center di Anagni.

marce in più che permettono l’orientamento verso una proposizione eccellente.

Mdt - Quali saranno i prossimi step dello sviluppo di YYM? Trimigliozzi - YYM Store vuole essere “La Casa” anche della mobilità innovativa e istantanea, con l’ambizione di coprire maggiormente il territorio regionale; stiamo già analizzando le prossime aperture.

Mdt - Sulla base della sua esperienza, come sta evolvendo e come evolverà nei prossimi anni il settore dei veicoli commerciali? Trimigliozzi - La pandemia ha letteralmente certificato a tutti quanto il settore dei veicoli commerciali e quello dei trasporti, logistica e delivery siano essenziali e necessari nella vita quotidiana e per la sopravvivenza: il settore si evolverà, miscelandosi con una mobilità innovativa e attraverso i Big Data, al fine di posizionarsi quale protagonista indiscusso.

Mdt - In che modo YYM punta a rappresentare un partner che accompagnerà tale evoluzione? Trimigliozzi - YYM vuole essere il “decoder” che supporterà gli operatori del settore e il mercato in questa importante e vitale fase di transizione, che sancirà il mutamento epocale del prossimo decennio.

Pagina I


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

SIFÀ / IL DIRETTORE GENERALE PAOLO CUOGHI ILLUSTRA LE STRATEGIE AZIENDALI

Più forti nelle sfide del mercato

O

FABIO BASILICO REGGIO EMILIA

ra che si profila un qua dro più ottimistico sulla ripresa del Sistema Paese dopo le difficoltà del lungo periodo dell’emergenza pandemica, è tempo di bilanci e di previsioni. Il Direttore Generale di SIFÀ, Paolo Cuoghi, illustra le strategie aziendali di Società Italiana Flotte Aziendali alla luce della situazione attuale del mercato automotive nell’attuale fase di riapertura. Cuoghi affronta diverse tematiche che interessano da vicino l’azienda di cui è Direttore Generale, come le difficoltà affrontate durante il periodo di crisi, i piani strategici messi in atto da SIFÀ e le più recenti problematiche del settore legate alla produzione dei veicoli nuovi, la partnership con Fondazione Umberto Veronesi, in ottica di Responsabilità Sociale d’Impresa, e i progetti promossi dall’azienda nell’anno della pandemia. “Nonostante le difficoltà del mercato durante l’anno della pandemia, nel 2020 l’impegno del team di SIFÀ ha permesso di chiudere l’esercizio con un fatturato di circa 165 milioni di euro e una flotta gestita di 24mila unità, a cui va a sommarsi l’importante traguardo di 9.500 nuovi ordini - esordisce Paolo Cuoghi - Numeri straordinari che hanno posto stabilmente l’azienda nella top ten dei player del Noleggio a Lungo Termine in Italia. È stato possibile raggiungere questi risultati straordinari solo grazie al grande impegno e alla proattività di tutti i collaboratori di SIFÀ, i quali si sono messi in gioco con continuità e dedizione per intercettare e reagire prontamente alle nuove sfide del mercato trasformandole in opportunità. L’azienda ha saputo affrontare i momenti critici limitando al massimo l’impatto su dipendenti, collaboratori, clienti e stakeholder, mantenendo relazioni aperte a 360 gradi, garantendo puntualità nei pagamenti ai fornitori e restando attivi e focalizzati sugli obiettivi. Il tutto garantendo, sempre, la piena sicurezza. Inol-

N° 301 / Luglio-Agosto 2021

PAOLO CUOGHI AFFRONTA DIVERSE TEMATICHE CHE INTERESSANO DA VICINO L’AZIENDA DI CUI È

DIRETTORE GENERALE, COME LE DIFFICOLTÀ DEL PERIODO DI CRISI, I PIANI STRATEGICI MESSI IN ATTO DA SIFÀ, LE PIÙ RECENTI PROBLEMATICHE DEL SETTORE LEGATE ALLA PRODUZIONE DEI VEICOLI NUOVI, LA PARTNERSHIP CON

FONDAZIONE UMBERTO VERONESI, IN OTTICA DI RESPONSABILITÀ SOCIALE D’IMPRESA, E I PROGETTI PROMOSSI DALL’AZIENDA NELL’ANNO DELLA PANDEMIA.

tre, in questo momento particolarmente delicato, SIFA’ continua ad affrontare le sfide che il mercato propone con proattività, cura e resilienza: è a partire dal 2020 infatti che SIFÀ ha deciso di pubblicare il suo primo Bilancio di Sostenibilità. Una scelta coraggiosa che rappresenta il primo vero step verso una crescente trasparenza e un allineamento sempre maggiore degli interessi tra i vari stakeholder, ovvero i driver per una crescita di valore sostenibile nel lungo periodo. Inoltre, con il Bilancio, si crea anche l’occasione di tracciare una panoramica di tutte le iniziative di sostenibilità realizzate nel triennio 2018-2019-2020, evidenziando come la Responsabilità Sociale d’Impresa debba essere una strada percorribile anche in contesti economici sfavorevoli, rappre-

sentando un vantaggio competitivo, oltre che uno strumento di dialogo con clienti, fornitori, collaboratori e comunità locali”. Il 2020 si è dimostrato un anno straordinario per SIFÀ anche per quanto concerne la crescita del personale: l’Azienda ha assunto oltre 25 nuove persone. Nei primi mesi del 2021, il trend di assunzioni è continuato superando ampiamente l’organico di 100 persone come dipendenti diretti, a cui si aggiungono i collaboratori che operano a tempo pieno per conto di SIFÀ nella gestione delle attività operative e dei sistemi informatici, nelle attività di customer service e nella logistica. “Questi numeri - spiega Cuoghi che continueranno a crescere di qui a fine anno, oltre a testimoniare l’ottimo stato di salute della società rap-

presentano anche il significativo contributo di SIFÀ allo sviluppo dei territori in cui è presente, in primis a Reggio Emilia dove ha sede la Direzione generale e quartier generale dell’azienda”. È anche importante sottolineare come la società, in un contesto di mercato in sofferenza causato dall’emergenza sanitaria, non abbia mai fatto ricorso alla cassa integrazione. “A ciò si aggiungono anche i progetti a valore aggiunto che hanno coinvolto sempre di più e a diverso titolo tutti i collaboratori - dice ancora il Direttore Generale - In particolare, il progetto ‘Circular Mobility’ con la pianificazione di diverse giornate di formazione insieme a docenti universitari a cui è seguito il contest interno ‘Circular Mobility Challenge’. L’obiettivo è quello di rispondere alle esigenze dei clienti con

In alto, Paolo Cuoghi, Direttore Generale SIFÀ. La società di BPER Banca è attiva su più fronti nell’offrire ai professionisti le necessarie soluzioni di mobilità.

l’offerta e l’implementazione di soluzioni di mobilità innovative e personalizzate, a ridotto impatto ambientale. L’iniziativa ha trovato convinto consenso e supporto da parte di Case costruttrici, aziende di primario livello ed enti pubblici. Un altro importante progetto è il ‘Roadshow della Salute per SIFA’’, in collaborazione con Fondazione Umberto Veronesi, basato su quattro incontri dedicati ai temi della salute e della prevenzione in ottica di Responsabilità Sociale d’Impresa”. Inoltre, abbiamo presentato l’Agenda della Salute per SIFÀ: un documento ‘storico’ di Fondazione Veronesi che è stato rieditato e ampliato nei contenuti grazie al contributo dell’azienda e distribuito a tutti i collaboratori. In forza del grande successo ottenuto, il Roadshow della Salute nel 2021 è stato esteso anche a clienti e partner di SIFÀ, a riprova del nostro impegno nell’investire sul benessere e sulla salute delle persone e dell’intera comunità”. Paolo Cuoghi parla anche delle problematiche emerse a causa delle restrizioni adottate per fronteggiare la prima emergenza epidemiologica da COVID-19, che hanno comportato una prolungata chiusura nel 2020 (oltre tre mesi) delle fabbriche delle Case automobilistiche, con il blocco della produzione dei veicoli nuovi. “Ad aggravare la situazione - continua il manager - c’è poi da considerare che tutti gli ordini pervenuti dopo la fine del primo lockdown hanno avuto una programmazione della produzione successiva al recupero della produttività persa nei mesi precedenti, con analoghi ritardi. Una situazione, questa, che ha impattato su tutta la filiera dell’auto in Europa, protraendo i propri effetti anche nel 2021, anche a causa del nuovo lockdown, che pure è stato meno ‘invasivo’ del primo. A queste criticità, nei primi mesi di quest’anno si è sommata anche una crescente difficoltà dei costruttori ad approvvigionarsi di semiconduttori e microchip (in gran parte dirottati verso l’elettronica di consumo e la produzione di strumenti per lo smart working, pc portatili e tablet in primis), oggi alla base dei sistemi di qualsiasi tipologia di veicolo. Questa criticità ha ulteriormente contribuito a rallentare i processi produttivi e di consegna dei veicoli stessi. È una difficoltà oggettiva che condiziona inevitabilmente tutto il mondo dell’automotive e anche l’attività degli operatori del Noleggio a Lungo Termine. È ben chiaro che l’emergenza epidemiologica da COVID-19 comporterà rilevanti ripercussioni nel medio e lungo periodo sul settore automotive in quanto il mondo della distribuzione dei veicoli nuovi dovrà fronteggiare questa difficile situazione ancora per diverso tempo”. SIFÀ si è quindi subito attivata per supportare i clienti e offrire loro adeguate soluzioni di mobilità, soprattutto con il nuovo servizio di Noleggio a Lungo Termine di Veicoli usati. Conclude Paolo Cuoghi: “Per le aziende clienti che necessitano di potenziare, in tempi rapidi, la propria flotta con mezzi subito disponibili per diversi settori - come il food, il pharma e la logistica dell’ultimo miglio - SIFÀ ha implementato la propria offerta con il rinoleggio del proprio usato in pronta consegna che, già nel corso del 2020, si è dimostrato essere un sostegno concreto per gestire improvvisi picchi di lavoro delle aziende. A questo servizio si è affiancata la vendita dei veicoli usati”.

Pagina III


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

TRUCK ITALIA / REPARTO VAN A GONFIE VELE GRAZIE A UN TEAM PREPARATO E MOTIVATO

Un commercialista con la passione dei corrieri IL GRUPPO TRUCK ITALIA HA CONOSCIUTO NEGLI ULTIMI ANNI UN’ESPANSIONE STRAORDINARIA, E SE I NUMERI SONO POSITIVI E LA RISPOSTA DEI CLIENTI ENTUSIASTA IL MERITO È ANCHE DELLE PERSONE CHE LA PROPRIETÀ HA SAPUTO POSIZIONARE NEI RUOLI STRATEGICI. TRA QUESTE SICURAMENTE ROSARIO

SANTORO, RESPONSABILE VENDITE DEI VEICOLI COMMERCIALI.

Q

CRISTINA ALTIERI

MONTELUPO FIORENTINO

uale lavoro volesse intraprendere nel momento in cui veniva proclamato dottore in Economia Aziendale nell’aula magna dell’Università di Catania non lo sapeva ancora. Certamente chiara era l’idea di non voler trascorrere la vita professionale dietro ad uno sportello o nello studio di un commercialista, fosse anche il suo. La passione per i motori, quella c’era, e arrivava dalla frequentazione fin dal ragazzo dell’officina dello zio, ma ancora mancava la consapevolezza di volerne fare un mestiere. Quando però arriva la chiamata da Montelupo Fiorentino, Rosario Santoro capisce subito che deve rispondere “presente”. A distanza di tredici anni lui e la sua squadra vendono 1200 van all’anno e la motivazione per fare sempre meglio non ha abbandonato il ragazzo siciliano che in Toscana ha trovato una terra accogliente e nei Taverni il sostegno di una seconda famiglia. “Non avrei mai lasciato la Sicilia - inizia a raccontarci Rosario Santoro - se non per la Toscana. Ho conosciuto la famiglia Taverni nel 2008, avevo 26 anni e cercavo un impiego sfidante, che mi desse ogni giorno la possibilità di misurare il mio valore. Non era certo il momento giusto per entrare nell’automotive, stiamo parlando degli anni della crisi del settore, però avercela fatta in quel momento è stata un’ottima scuola per le esperienze successive”. Nel 2012 Truck Italia entra a Bologna e Rosario accetta di assumere il ruolo di responsabile di filiale. Si trasferisce nel capoluogo emiliano dove vivrà per un anno e mezzo - e si rimbocca le maniche fino alle spalle. “I predecessori avevano fatto tanti danni su quella piazza, eravamo il terzo dealer di nomina in 14 mesi”. Rosario però, a cui piace lavorare per obiettivi, completa con successo la fase di start-up della concessionaria e quando torna in sede viene no-

Pagina IV

minato responsabile commerciale van dell’intero Gruppo Truck Italia. Le vendite oggi coprono il 74 per cento del fatturato, e di questa parte il 57 per cento è riferito ai leggeri. “La scelta della proprietà - corretta, precisa Santoro - è stata di separare i pesanti dai commerciali: le esigenze sono diverse, i numeri e i servizi pure, solo il fatturato si equivale, più o meno, solo che loro vendono circa 350 veicoli all’anno, e noi 1200”. Truck Italia consegna van a chiunque abbia una partita iva; operando in tutta la regione Toscana e in tutta l’Emilia la destinazione finale della fornitura dipende molto dalla zona, si va dagli artigiani, agli imprenditori edili, agli scuolabus, al trasporto disabili. “Stiamo lavorando anche con i corrieri, quella è stata una mia idea, e qualche venditore avventuroso mi ha seguito: è un terreno difficile, i margini sono bassi, ma da quando abbiamo il prodotto stiamo cominciando a raggiungere qualche risultato importante. Quale prodotto? Lo Sprinter a trazione anteriore, fenomenale, certo, costa un po’ di più, ma quando poi si va a tirare la riga il conto è sempre a favore di chi lo utilizza: minori costi di manutenzione, meno fermi, maggior valore residuo. Teniamo conto del fatto che poi la formula di possesso

per i van è quella del noleggio a lungo termine, e quindi l’azione di persuasione deve indirizzarsi in una duplice direzione: da una parte verso le società di noleggio e poi nei confronti del cliente utilizzatore. Per fortuna abbiamo i numeri che parlano al nostro posto”. L’asso nella manica di Rosario è dunque il Mercedes-Benz Sprinter: da solo totalizza il 60 per cento delle vendite, è conosciutissimo, affidabile e versatile, potendo essere configurato secondo le esigenze più varie. “Gli altri modelli stanno soffrendo

Rosario Santoro (in alto) è il manager al quale la famiglia Taverni ha affidato lo sviluppo del business Mercedes-Benz Vans all’interno di Truck Italia.

l’azzeramento del settore turistico precisa Rosario parlando di Vito e Classe V. “Molti clienti sono passati da un fatturato del 100 per cento al 10. Le grandi aziende si stanno ridimensionando, mentre dei monoveicolari qualcuno ha addirittura cambiato lavoro. Noi facciamo il tifo per loro, era una nicchia importante per noi, ora è assente da un anno e mezzo”. E l’elettrico? “L’elettrico sta arrivando e noi concessionari lo accogliamo con cautela. Mercedes ha fatto una scelta importante sui van, quella di non passare dall’ibrido ma di proporre direttamente la versione a sola batteria. Il cliente normal business è tiepido, poi dipende da dove è dislocata l’attività, un conto al Nord dove le possibilità di ricarica sono maggiori, diverso al Sud dove se non esistono stazioni di rifornimento come si può anche solo mettere l’argomento sul tavolo? Noi ci troviamo a metà strada in tutti i sensi, nelle regioni in cui operiamo non è facilissimo trovare una ricarica pubblica ma neanche difficile. In ogni caso il fatto di non avere il paracadute dell’endotermico frena la richiesta. Il discorso non vale per i corrieri, in questo settore c’è la gara a chi ha l’immagine più green. Senza contare che nel delivery l’elettrico

ha più senso, queste aziende sono attrezzate con hub in centro città dotati di wall box e colonnine private: le consegne dell’ultimo miglio così sono fattibilissime. E i costi di ingresso alle ZTL si azzerano. Lo scorso anno abbiamo consegnato 6 Sprinter elettrici a DHL, quest’anno 20 a GLS, 8 a DHL e 3 a Bartolini. Tra l’altro una grandissima mano è stata data negli ultimi tempi dagli ecoincentivi: permettono alle società dei noleggio di formulare una rata molto competitiva. Il mondo dei corrieri è sfidante, in tutti i sensi, per questo mi appassiona. Quando devi consegnare 90 veicoli a settimana serve impegno extra ed esperienza, e l’incasso è sempre posticipato rispetto all’anticipo di liquidità”. Rosario Santoro guarda davanti a sé e sorride. Sembra soddisfatto di quanto è stato fatto e motivato per quanto ancora ci sarà da fare in futuro. “Oggi abbiamo otto sedi e quasi 150 dipendenti, ma non ci stiamo certo fermando qui. Arrivano nuovi mandati, e stiamo inserendo in gamma van anche Piaggio: sarà un lavoro impegnativo, perché gestiremo questo ampliamento dell’offerta con le risorse che abbiamo. Ma se l’azienda chiama, io mi metto a disposizione: l’ho già detto che amo le sfide?”

N° 301 / Luglio-Agosto 2021


FRED DDO INTEG GRAT GRA TO O EAS SYFIT IL RISVEGLIO O DELLA FFORZA

Isolamento inttegrato Easyfit su Mercedes Sprinter S furgone e Mercedes-Benz ha molta olta classe con l’ultimo nato degli Sprinter coibentati. ntati. Il suo isolamento integrato si avvale vale della nuova tecnologia gia Easyfit per soddisfare le norme AT ATP in freddo negativo, classe se C, e in freddo positivo, classe A. Questi kit di nuova uova generazione offrono prestazioni so orprendenti, i massimi van ntaggi nell’uso e una sicurezza urezza senza pari per la catena del freddo. ddo. Assicurano un coefficiente ficiente di isolamento perrfettamente controllato e soddisfano i più elevati requisiti internazionali. ernazionali. L’’isolamento integrato Easyfit ottimizza il volume inte erno che resta pallettizzabile abile ed è compatibile con la por ta laterale originale che consente e il carico diretto di pallet da 1200 mm, una caratteristica tteristica completamente nuova!

info@lamberet.it - www.la amberet.it


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

IVECO / UN PIENO DI TECNOLOGIE PER LA NUOVA FAMIGLIA DEL PRINCIPE DEI

Daily accompagna il cliente

È

FABIO BASILICO TORINO

dal 1978 che Iveco Daily continua imperterrito a tracciare le linee guida del settore veicoli commerciali, in Italia e nel resto d’Europa. E a distanza di oltre quarant’anni rilancia alla grande, come è nel suo stile, proponendosi in una nuova generazione rigorosamente al passo con i tempi. Presentata in pompa magna in un evento digitale sul canale Iveco Live Channel insieme alla rinnovata gamma dell’ammiraglia Iveco S-Way, l’ultima evoluzione della famiglia di commerciali leggeri apre nuove frontiere, introducendo innovative soluzioni adattive e intelligenti che portano l’interazione con il driver e il proprietario del veicolo a un nuovo livello. “Con il nuovo Daily - ha dichiarato Thomas Hilse, Iveco Brand President - passiamo al livello successivo e diventiamo sempre più smart, offrendo un’innovazione senza equivalenti sul

Cambiano le abitudini di acquisto e Iveco Daily evolve per rispondere alle nuove necessità del mercato.

mercato. Con il nuovo Daily portiamo a bordo comfort e sicurezza ai vertici della categoria, straordinaria flessibilità e focus sulla mission, il tutto associato a una sostanziale riduzione del costo totale d’esercizio (TCO) e a un portfolio in costante espansione dei servizi Iveco On. In Iveco non ci fermiamo mai: raggiunto un traguardo, iniziamo a lavorare per il successivo”. Davide Diana, Iveco Light Business Line Director, ha poi aggiunto: “Ogni generazione di Daily ha fissato nuovi standard di riferimento, e questo ha reso il Daily ‘un brand all’interno del brand Iveco’ che continua ad avere grande successo. Oggi il Daily è primo in Europa nel settore degli chassis cab con una quota mercato di oltre il 22 per cento, ma non solo. Daily detiene una quota del 37 per cento nel comparto veicoli con trasmissioni automatiche e con la versione 7 tonnellate, nel segmento di massima portata utile fra i leggeri, è leader con oltre il 54 per cento delle vendite. Fedele alla sua vocazione sostenibile, Daily è anche punto di riferimento tra i veicoli commerciali a trazione alternativa: nel settore dei veicoli alimentati a gas naturale compresso la sua quota supera il 56 per cento. Nuovo Daily entra nel mercato dei veicoli commerciali leggeri in un anno in cui è previsto il massimo storico di vendite, 760mila unità contro le 613mila del 2020 e le 664mila del 2019. Le immatricolazioni di veicoli commerciali sono aumentate costantemente negli ultimi tre trimestri e Iveco ha registrato lo stesso andamento: nei primi quattro mesi del 2021 Daily ha aumentato le vendite del 42 per cento rispetto allo stesso periodo del 2019”. I trend chiave dell’industria dei veicoli commerciali hanno guidato la recente evoluzione del principe dei leggeri Iveco. “Le consegne dell’ultimo miglio - ha detto ancora Diana hanno vissuto un periodo di ‘boom’, perché i consumatori hanno aumentato considerevolmente il ricorso all’e-commerce e ai servizi di consegna durante i lockdown dell’emergenza Covid-19. La previsione è che questo cambiamento delle abitudini di acquisto si mantenga anche con l’allentamento delle restrizioni, generando una crescita della domanda di veicoli commerciali leggeri adibiti alla distribuzione urbana delle merci. In secondo luogo, la connettività è diventata una necessità in ogni ambito della vita quotidiana - personale e professionale - e perciò un requisito che anche i veicoli devono soddisfa-

DAILY MINIBUS EVOLVE PER SODDISFARE LE NUOVE ESIGENZE DEL TRASPORTO PASSEGGERI

Si rinnova il versatile compatto della gamma Iveco Bus L a più recente evoluzione della famiglia di minibus Iveco Daily apre nuove frontiere, introducendo innovative soluzioni adattative e intelligenti che portano l'interazione con autisti e operatori a un nuovo livello. Le rivoluzionarie sospensioni pneumatiche Air-Pro si adattano continuamente alle condizioni di utilizzo per offrire una guida straordinariamente fluida e sicura per l’autista e i passeggeri. L'esclusivo sistema di controllo costante dell'ammortizzazione (CDC) delle sospensioni reagisce quasi istantaneamente alle asperità della strada, calcolando ogni 10 millisecondi la pressione ideale da esercitare su ciascun ammortizzatore per garantire la migliore reazione dinamica. Daily Minibus è disponibile in due versioni diesel (180 e 210 cv) e una versione a gas naturale (136 cv) e fornisce una risposta adeguata a tutte le esigenze del trasporto passeggeri: navetta per i viaggi brevi (Start), minibus interurbano con la più ampia capacità di trasporto passeggeri della categoria (Line), minibus turistico per viaggiare all'insegna di gradevolezza e comodità

Pagina VI

(Tourys), scuolabus (Pop) e, in arrivo prossimamente, minibus urbano (Access). Il nuovo cambio manuale a 6 marce offre un’esperienza di guida ottimale ed esclude la necessità di cambiare l’olio, in quanto l’intervallo è stato esteso a 350mila km, contribuendo a un’ulteriore riduzione dei costi di manutenzione e riparazione fino al 4 per cento. L’esclusiva trasmissione HiMatic a 8 rapporti rimane disponibile di serie. La sua combinazione con il motore CNG rende il Daily Minibus Hi-Matic a CNG il migliore della categoria in termini di prestazioni e sostenibilità. A ciò si aggiunge un retarder Telma per migliorare ulteriormente il comfort di guida e la sicurezza dei passeggeri. Nuovo Daily Minibus è anche dotato di sedile di guida riprogettato con cuscino centrale, schienale e poggiatesta in memory foam, una novità assoluta nel settore dei minibus. La schiuma si adatta al corpo, distribuendo il peso in modo uniforme e riducendo i picchi di pressione fino al 30 per cento. Infine, con le soluzioni Iveco On vengono fornite un'intera serie di servizi su misura per i veicoli e le missioni dei clienti.

N° 301 / Luglio-Agosto 2021


LEGGERI CHE SEGNA L’ENNESIMO STEP INNOVATIVO NEL SEGMENTO DEI COMMERCIALI

nel business del futuro

“CON IL NUOVO DAILY - HA DICHIARATO THOMAS HILSE, IVECO BRAND PRESIDENT PORTIAMO A BORDO COMFORT E SICUREZZA AI VERTICI DELLA CATEGORIA, STRAORDINARIA FLESSIBILITÀ E FOCUS SULLA MISSION, IL TUTTO ASSOCIATO A UNA SOSTANZIALE RIDUZIONE DEL COSTO TOTALE DI ESERCIZIO (TCO) E A UN PORTFOLIO IN COSTANTE ESPANSIONE DEI SERVIZI

IVECO ON”. I PUNTI QUALIFICANTI DELLA NUOVA PROPOSTA SONO: LE RIVOLUZIONARIE SOSPENSIONI PNEUMATICHE

AIR-PRO, IL COMPAGNO DI VIAGGIO DIGITALE IVECO DRIVER PAL CON AMAZON ALEXA, IL NUOVO CAMBIO MANUALE A SEI MARCE E I SEDILI COMPLETAMENTE RIPROGETTATI CON MEMORY FOAM.

re. Terzo aspetto da tenere in considerazione: sostenibilità e aria pulita sono questioni sempre più urgenti, che danno origine a normative sempre più sfidanti sulle emissioni dei veicoli. E da ultimo, gli incentivi pubblici stanno favorendo lo sviluppo di nuove infrastrutture, con conseguente ripresa del settore edile, a tutto vantaggio del Daily in versione chassis cab”. Oltre che riconfermare i valori fondamentali di versatilità, robustezza, durevolezza e prestazioni, che lo rendono uno dei preferiti del segmento da oltre 40 anni, nuovo Daily presenta soluzioni innovative e orientate al cliente che lo rendono straordinariamente adattivo, interattivo, collaborativo e connesso. La rinnovata famiglia Daily propone le rivoluzionarie sospensioni pneumatiche Air-Pro che si adattano continuamente alle condizioni di utilizzo per offrire una guida straordinariamente fluida e sicura per il conducente e il carico. Con l’esclusivo Air-Pro Continuous Damping Control (CDC) il veicolo reagisce quasi istantaneamente alle vibrazioni della strada, calcolando ogni 10 millisecondi la pressione ideale di ogni ammortizzatore per garantire la migliore reazione dinamica. “Le minori vibrazioni, ridotte del 25 per cento, contribuiscono ulteriormente a un’esperienza di guida straordinariamente confortevole - ha spiegato Davide Diana - Il sistema intelligente Air-Pro si adatta anche alle esigenze dei driver, permettendo il controllo del comportamento delle sospensioni. Il conducente può scegliere di dare priorità al comfort con l’impostazione Soft, selezionare Load per ottimizzare la maneggevolezza e il controllo del rollìo e del beccheggio in condizioni di pieno carico, oppure lasciar scegliere al sistema in base ai suoi parametri di auto-adattamento con l’impostazione Auto. Le sospensioni AirPro si adattano al carico del veicolo, riducendo l’angolo di rollìo del 30 per cento in curva, con conseguente miglioramento della sicurezza del

N° 301 / Luglio-Agosto 2021

guidatore e protezione del carico. Senza contare che rendono le operazioni di carico e scarico semplici ed efficienti regolando l’altezza dello chassis in meno di 10 secondi. Inoltre, una funzione memory permette al driver di memorizzare l’allineamento con le piattaforme di carico abituali, rendendo l’operazione ancora più rapida. Il sistema intelligente Air-Pro è facile da gestire, grazie a un comando dedicato sul cruscotto e alla nuova e intuitiva grafica TFT”. Al pari del fratello maggiore SWay anche Daily adotta l’Iveco Driver Pal con Amazon Alexa, il compagno di viaggio digitale del conducente che gli consente di portare a bordo la propria vita digitale, di interagire con il proprio veicolo e la community di driver e di accedere ai servizi connessi di Iveco. “Iveco Driver Pal - ha continuato Diana - offre due skill esclusive sviluppate con Amazon Web Services e il team di Alexa Auto. La prima, MYIveco, consente al conducente di controllare lo stato del veicolo, impostare e gestire il sistema di navigazione, richiedere as-

sistenza quando necessario e chiedere suggerimenti per uno stile di guida volto a risparmiare carburante e guidare in sicurezza. Iveco Driver Pal porta la connettività del Daily a un livello superiore permettendo facile accesso ai servizi connessi Iveco On, ideati per supportare in modo proattivo ed efficace il business dei clienti. La seconda skill esclusiva, MYCommunity, mette in contatto il conducente con la comunità degli autisti. I driver possono scambiarsi consigli e chiedere aiuto per evitare fermate impreviste e ritardi grazie a informazioni sul traffico e altri inconvenienti stradali. Inoltre, la traduzione automatica permette di superare le barriere linguistiche”. Non è tutto. Sul nuovo Daily c’è anche un nuovo cambio manuale a sei marce che offre un’esperienza di guida ottimale con innesti e precisione ai vertici della categoria. Questa caratteristica lo rende il preferito dei driver per le missioni urbane, grazie alla possibilità di beneficiare di un maggiore comfort nelle lunghe giornate al volante. “Il nuovo cambio -

ha commentato l’Iveco Light Business Line Director - contribuirà anche a ridurre il costo totale di esercizio (TCO). È stato possibile abbinare il motore da 2.3 litri alla stessa frizione del motore da 3 litri, migliorando la solidità nelle missioni più impegnative e incrementando la durata del componente fino al 18 per cento. Con il nuovo cambio non sarà necessario cambiare l’olio, in quanto l’intervallo è stato esteso a 350mila km, contribuendo a un’ulteriore riduzione dei costi di manutenzione e riparazione che arriva fino al 4 per cento”. A bordo, i sedili sono stati completamente riprogettati con cuscini, schienali e poggiatesta in memory foam, una novità assoluta nel settore dei veicoli commerciali leggeri. La schiuma si adatta al corpo, distribuendo il peso in modo uniforme e riducendo i picchi di pressione fino al 30 per cento. Questo consente un elevato comfort e previene il mal di schiena. Le sezioni laterali sono state ispessite con 15 mm di schiuma ad alta densità per migliorare il conteni-

A bordo, i sedili sono stati completamente riprogettati con cuscini, schienali e poggiatesta in memory foam.

mento laterale, ottimizzando la sicurezza e l’esperienza di guida. Le persone più alte staranno più comode grazie al cuscino più lungo di 20 mm e più spesso di 15 mm, che offre un migliore supporto per le gambe lunghe. Le scocche laterali e le leve del sedile sono state riprogettate per facilitare l’accesso e l’uscita dal veicolo, una soluzione ideale per le missioni porta a porta e di consegna pacchi, che richiedono di scendere frequentemente dal veicolo. Nuovo Daily rimane fedele alla sua reputazione di veicolo estremamente versatile, grazie alla sua ampia line-up di motori: F1A da 2.3 litri con potenza di 116, 136 e 156 cv (disponibile nell’omologazione lightduty e heavy-duty) e F1C da 3 litri con potenza di 160, 176 e 207 cv. L’unità F1A da 2.3 litri va apprezzata per i consumi ridotti, con un risparmio di carburante fino al 6 per cento rispetto al modello precedente. Il nuovo cambio manuale ha permesso un aumento della coppia fino al 15 per cento, migliorando le prestazioni del Daily nelle applicazioni gravose e ottimizzando la sua versatilità per gli allestimenti con presa di forza. Non mancano le alternative a gas naturale compresso: l’unità CNG da 3 litri eroga 136 cv e 350 Nm di coppia. Il veicolo è conforme alle norme Euro 6-D Final ed Euro VI-E, raggiungendo il Fattore di conformità 1 (CF=1) in anticipo rispetto alle normative. Ciò significa che Daily rispetta i limiti di emissione in condizioni reali per tutta la sua vita. Utilizza un doppio sistema di post-trattamento SCR, completamente riprogettato per occupare lo stesso spazio dei modelli precedenti, in modo da non avere alcun impatto sulle operazioni di allestimento e preservare la leggendaria versatilità del campione dei leggeri. Prodotto nello stabilimento di Suzzara (MN), la nuova generazione Iveco Daily avvierà le ordinazioni il prossimo ottobre. In gamma figura anche la versione minibus, con motori da 180 e 207 cv, a cui si aggiunge l’unità CNG da 136 cv.

Pagina VII


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI SU STRADA / PIAGGIO PORTER NP6 1.5 BENZINA/GPL PIANALE FISSO

Praticità senza confini

PORTER NP6 È A TUTTI GLI EFFETTI UN “CAMION DI CITTÀ”, RIUSCENDO A UNIRE IN UNA MIRABILE FUSIONE INGEGNERISTICA E COSTRUTTIVA LE DIMENSIONI COMPATTE DI TRADIZIONE PIAGGIO CON LA PORTATA STRAORDINARIA. IL TUTTO INCORNICIATO IN UN DESIGN MODERNO E ACCATTIVANTE, INTERNI CONFORTEVOLI ED ERGONOMICI E MOTORIZZAZIONI ESCLUSIVAMENTE ECO-FRIENDLY. ABBIAMO TESTATO SU PERCORSI URBANI E INTERURBANI LA VERSIONE CON PIANALE FISSO EQUIPAGGIATO CON UNA DELLE DUE VERSIONI COMBIFUEL IN CUI È DISPONIBILE IL PRESTAZIONALE ED EFFICIENTE QUATTRO CILINDRI DI 1.498 CC, QUELLA CON ALIMENTAZIONE COMBINATA BENZINA/GPL (L’ALTRA PROPONE IL CONNUBIO BENZINA-METANO).

P

FABIO BASILICO

78 kW (+30 per cento) a 6.000 giri/min, mentre la coppia massima è di 136 Nm a 4.500 giri/min (+27 per cento rispetto alla precedente unità MultiTech).

MONZA

resentato ufficialmente come il primo city truck del mercato dei veicoli commerciali, il nuovo Piaggio Porter NP6 conferma su strada quanto affermato, dimostrandosi un veicolo adatto al traffico cittadino per manovrabilità e versatilità, le doti richieste a un city truck che si rispetti. Successore dello storico Porter presentato per la prima volta nel 1992, Porter NP6 è a tutti gli effetti un “camion di città”, riuscendo a unire in una mirabile fusione ingegneristica e costruttiva le dimensioni compatte di tradizione Piaggio con la portata straordinaria. Il tutto incorniciato in un design moderno e accattivante, interni confortevoli ed ergonomici e motorizzazioni esclusivamente eco-friendly.

PORTATA SUPERIORE

NOTEVOLI PERFORMANCE

Abbiamo testato la versione con pianale fisso equipaggiato con una delle due versioni CombiFuel in cui è disponibile il prestazionale quattro cilindri di 1.498 cc, quella con alimentazione combinata benzina/Gpl (l’altra propone il connubio benzinametano). Il propulsore ha basamento e testata in lega di alluminio ed è conforme agli standard Euro 6D Final. La distribuzione è a 16 valvole con doppio albero a camme in testa comandato da catena e doppio variatore di fase su aspirazione e scarico. Un motore di cilindrata contenuta con costi d’esercizio ridotti, ma capace di notevoli prestazioni sia in accelerazione che ad andatura costante: la potenza massima è pari a

Pagina VIII

Stile moderno e linee dinamiche caratterizzano il Porter NP6, nuova proposta firmata Piaggio Commercial.

L’impianto di alimentazione adotta bombole ad alta pressione collocate al di sotto del piano di carico, che non vanno perciò a intaccare le capacità di trasporto di Porter NP6. Le bombole sono saldamente fissate al telaio e realizzate in acciaio ad alta resistenza e trattato termicamente. Il veicolo è progettato per il funzionamento di default in modalità gas, salvo la fase di accensione a benzina con seguente switch automatico al raggiungimento della temperatura di esercizio, ma è comunque presente un interruttore alla sinistra del volante per commutare manualmente la modalità. Il pulsante è inoltre dotato di quattro Led che indicano il livello di gas nel serbatoio e di una spia verde che si illumina quando si circola a gas. Le unità CombiFuel sono disponibili in due differenti versioni, a seconda dell’autonomia garantita dall’impianto a Gpl o a metano: per il nostro test drive la versione Short Range è indicata per un uso prevalentemente urbano, mentre la Long Range garantisce una maggiore autonomia e anche una portata superiore. Caratterizzato da uno stile moderno e da linee dinamiche e ben armonizzate, Porter NP6 è dichiaratamente votato all’ambiente urbano, dove trova posto con estrema facilità potendo contare una pratica e agevole movimentazione delle merci anche

N° 301 / Luglio-Agosto 2021


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

Carta d’identità

Nome: Porter NP6 Cognome: Piaggio Commercial Configurazione: pianale fisso, passo corto L1, ponte posteriore a ruote singole. Colore cabina: Plaster White Passo: 2.650 mm. Dimensioni cassone: lunghezza 2.200 mm, larghezza 1.680 mm. Motore: quattro cilindri di 1.498 cc, alimentazione benzina/Gpl; basamento e testata in lega di alluminio; Euro 6D Final; distribuzione è a 16 valvole con doppio albero a camme in testa comandato da catena e doppio variatore di fase su aspirazione e scarico; potenza massima di 78 kW a 6.000 giri/min; coppia massima di 136 Nm a 4.500 giri/min. Trazione: posteriore. Cambio: manuale, monodisco a secco, 5 marce + R. Portata: 930 kg. Mtt: 2.120 kg. Altezza piano di carico: 800 mm. Sponde: lega di alluminio, apribili su tre lati; altezza: 400 mm; spessore: 25 mm. Sospensioni: anteriore MacPherson, posteriore ad assale rigido con balestre paraboliche bi-lama. Serbatoi: benzina 45 litri, Gpl 15 litri. Equipaggiamento: Start. Dotazioni: kit portascale, tappeto moquette, kit pedana ingresso cabina, kit gradino pianale, borsa stivaggio, kit coprisedili HD, kit bauletto. Prezzo: 17.250 euro (franco concessionario, IPT e IVA escluse).

bloccaggio) e EBD (ripartitore elettronico di frenata), che coadiuvano il conducente durante le manovre e ottimizzano le performance del veicolo aumentando la sicurezza attiva. SPAZIO A VOLONTÀ

nelle strade più strette e trafficate, senza tuttavia alcuna penalizzazione in termini di dinamica di guida ed efficienza sui tragitti a più veloce percorrenza. Porter, “il grande lavoratore di piccola taglia” si è rinnovato completamente. Porter NP6 identifica così una generazione di nuovi veicoli pensati e progettati per esaltare ulteriormente i valori tipici di Porter, capace di unire dimensioni compatte e portata straordinaria. La denominazione “City Truck” qualifica un veicolo commerciale compatto, leggero, performante, versatile, confortevole, conveniente e sostenibile. Qualità che consentono all’ultimo nato di Casa Piaggio Commercia di sfidare da protagonista il mercato del trasporto merci a corto e medio raggio come compagno ideale per le più svariate esigenze professionali nei contesti urbani ex extraurbani, sempre più congestionati e regolati da severe restrizioni anti-emissioni.

vata robustezza e peso contenuto. La sospensione anteriore MacPherson e posteriore ad assale rigido con balestre paraboliche bi-lama, permettono una capacità di carico di 1.000 kg sull’asse anteriore e fino a 2.020 kg sull’asse posteriore. In più, grazie alla trazione posteriore, il carico

produce aderenza sulle ruote motrici assicurando un’ottimale tenuta di strada in ogni condizione di fondo stradale. A ciò contribuiscono anche le moderne funzioni di assistenza alla guida, tra cui ESC (controllo elettronico della stabilità), ASR (controllo della trazione), ABS (anti-

La cabina di Porter NP6 rappresenta un ambiente di lavoro sicuro e confortevole, con una postazione di guida ergonomica studiata per ottenere un’ampia e immediata visibilità, facilitando così la guida e le manovre di parcheggio, grazie ai sedili posti a una corretta altezza e al volante compatto. Il quadro strumenti è intuitivo e di rapida lettura, e il gruppo dei comandi è raggiungibile agevolmente alla sinistra del volante. Al centro della plancia campeggia la nuova console centrale, che accoglie i comandi dell’impianto di climatizzazione. Sul lato passeggero è presente un capiente vano portaoggetti. Tra gli equipaggiamenti di serie sono inclusi l’airbag guidatore,

TUTTO È INTEGRATO

Porter NP6 è progettato per massimizzare la capacità di carico senza rinunciare alla compattezza e all’agilità, doti sempre più richieste in contesti urbani congestionati, aumentando nel contempo la sicurezza e il comfort a bordo. Rispetto alla precedente generazione Porter, la larghezza della cabina cresce di soli 245 mm, attestandosi a 1.640 mm: un dato che si mantiene inferiore di 500 mm rispetto alla media dei veicoli commerciali leggeri. L’adozione di una cabina semi-avanzata compatta ha inoltre consentito di ottimizzare gli spazi a vantaggio della massimizzazione del carico. Le performance elevate in termini di portata utile, che si attestano ai vertici della categoria, sono possibili grazie a una configurazione da autentico truck: il telaio a longheroni in acciaio altoresistenziale a sezione scatolare, saldato e integrato alla struttura della cabina, garantisce ele-

N° 301 / Luglio-Agosto 2021

Accedere in cabina è agevole e sicuro: tutto è pensato per facilitare la vita e il lavoro dell’utilizzatore del Porter.

l’airbag passeggero, i fari fendinebbia e gli specchi retrovisori esterni ripiegabili. La possibilità di combinare versioni a passo corto (L1), come nel nostro caso, o a passo lungo (L2), con ponte posteriore a ruote singole (SW) o a ruote gemellate (TW), e la disponibilità di due versioni pronte all’uso, con pianale fisso o pianale ribaltabile, rende la gamma Porter NP6 estremamente completa. In più, i due differenti rapporti al ponte standard e ridotto - ottimizzano i consumi nelle varie tipologie di utilizzo e agevolano il lavoro con carichi gravosi in condizioni di elevata pendenza, aumentando la capacità di spunto in salita da fermo. Combinando tra loro le varie versioni a disposizione, Porter NP6 offre fino a 1.400 diverse possibilità di scelta, potendo essere di fatto configurato su misura per qualsiasi tipo di esigenza professionale e di preferenza dell’utilizzatore finale. Il Pianale Fisso della nostro test drive è la versione ideale per chi necessita di un vano di carico piatto e regolare, completamente sfruttabile e facilmente accessibile. L’altezza del piano di carico è infatti pari a 800 mm e le sponde in lega di alluminio sono apribili su tre lati. Il cassone è disponibile in due differenti lunghezze, standard o extra, e in ogni caso arriva a uno spazio utile in grado di ospitare 4 europallet. Porter NP6 Pianale Ribaltabile combina i vantaggi derivanti dalla struttura del pianale con la praticità del sistema di ribaltamento elettroidraulico, con angolo massimo di 45°. Ideale per il trasporto e lo scarico di merci sfuse e materiali pesanti è perciò il veicolo che meglio soddisfa le esigenze delle piccole e medie imprese impegnate, ad esempio, nel campo dell’edilizia. Il cassone è dotato di serie di paracabina e di sponde in lega di alluminio apribili su tre lati. Le prestazioni, la dotazione tecnica, la robustezza e la versatilità del telaio garantiscono la funzionalità della versione Chassis, base di partenza per trasformazioni dalle performance straordinarie: Porter NP6 nasce per adattarsi con facilità a un ventaglio ampissimo di allestimenti e di conseguenza di mission specifiche, tra cui logistica urbana, food delivery, cura delle aree verdi, manutenzione, officine mobili, edilizia, vele pubblicitarie, pubblica utilità, manutenzione. Sempre nell’ottica di facilitare anche gli allestimenti destinati ai compiti più gravosi, su Porter NP6 sono state sviluppate predisposizioni per prese di forza, da cui prelevare sino a 16 kW di potenza: oltre che sul motore, la presa è installabile anche sul cambio, dove è demoltiplicata e più facilmente raggiungibile per attrezzature poste dietro la cabina.

Pagina IX


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI OPEL / MOVANO E MOVANO-E AL VERTICE DEL SEGMENTO LARGE VAN

Il blitz attento all’ambiente

O

FABIO BASILICO

LA NUOVA GENERAZIONE DI OPEL MOVANO CON MOTORI DIESEL E TRAZIONE ELETTRICA COSTITUISCE L’OFFERTA PIÙ COMPETITIVA MAI PRESENTATA DALLA CASA DI RÜSSELSHEIM IN QUESTA CATEGORIA DI VEICOLI COMMERCIALI LEGGERI. CARATTERIZZATA DA PRESTAZIONI AL VERTICE DEL SEGMENTO PER PORTATA, VOLUME DI CARICO E MASSA COMPLESSIVA, E OFFERTA IN UN’AMPIA GAMMA DI VERSIONI, LUNGHEZZE E ALTEZZE, LA NUOVA GENERAZIONE DI MOVANO SARÀ DISPONIBILE PRESSO LE CONCESSIONARIE OPEL NEL CORSO DELL’ANNO.

MILANO

pel lancia la sfida al seg mento dei van di grandi dimensioni e lo fa giustamente in grande, proponendo sul mercato i nuovi Movano e Movano-e, la versione elettrica che mantiene intatte fruibilità e versatilità del larga van tedesco. La nuova generazione di Opel Movano con motori diesel e trazione elettrica costituisce l’offerta più competitiva mai presentata dalla Casa di Rüsselsheim in questa categoria di veicoli commerciali leggeri. Caratterizzata da prestazioni al vertice del segmento per portata, volume di carico e massa complessiva, e offerta in un’ampia gamma di versioni, lunghezze e altezze, la nuova generazione di Opel Movano

sarà disponibile presso le concessionarie Opel nel corso dell’anno. In pratica, c’è un nuovo Movano per qualsiasi necessità di trasporto, da quello di persone alle consegne urbane, dalla temperatura controllata ai camper. Il sistema di propulsione elettrica del nuovo van elettrico Opel genera 90 kW (122 cv) e 260 Nm di coppia, con la velocità massima bloccata elettronicamente a 120 km/h. In base alla versione, i clienti possono scegliere tra batterie agli ioni di litio da 37 a 70 kWh per autonomie (in base al profilo di guida e alle condizioni ambientali) che possono arrivare rispettivamente fino a 117 o 224  chilometri nel ciclo misto. Le batterie sono posizionate sotto il vano di carico, in modo da non compromettere l’uso del veicolo e incrementare la stabilità in curva e

in caso di vento, anche a pieno carico. Un raffinato sistema di frenata rigenerativa che recupera l’energia prodotta nelle fasi di frenata o decelerazione aumenta ulteriormente l’efficienza. In aggiunta alla motorizzazione elettrica, i propulsori diesel del nuovo sono in linea con quanto c’è di meglio sul mercato per l’elevata efficienza in termini di consumi e le basse emissioni di CO2. La potenza dei motori diesel 2.2 litri - tutti rispettosi delle rigide norme sulle emissioni Euro 6d - va da 88 kW (120 cv) a 121 kW (165 cv). L’elevata coppia ai bassi regimi va da 300 Nm a 1.500 giri a 370 Nm a 1.750 giri. I motori azionano le ruote anteriori e sono abbinati a cambi manuali a sei rapporti. Movano versione furgone è disponibile in quattro lunghezze

(L1-4) e tre altezze (H1-3), con una capacità di carico massima che va da 8 a 17 metri cubi. Le porte della versione H3 hanno un’altezza di 2,03 metri, la migliore del la categoria. Insieme alle porte posteriori apribili a 180 gradi (opzionale l’apertura a 270 gradi) rendono il carico di Movano particolarmente facile. La gamma delle masse complessive è tra le più ampie di questa categoria, e va da 2,8 a 4,0 tonnellate, mentre le portate raggiungono un massimo di 2,1 tonnellate. Grazie a una soglia di carico di soli 494 millimetri, una larghezza di 1.422  mm tra i passaruota e di 1.870 mm tra le pareti, il vano di carico del nuovo grande van Opel rappresenta il nuovo punto di riferimento per i concorrenti. La cabina è dotata come stan-

dard di una fila di tre sedili, mentre la seconda fila della versione cabinata in opzione consente di trasportare altri quattro passeggeri. Per soddisfare ogni tipo di esigenza, Opel Movano è disponibile anche in versione telaio cabina singola e doppia e pianale con una fila di tre sedili. Il nuovo van Opel è la base ideale anche per un’ampia gamma di allestimenti, come i cassoni ribaltabili, i cassoni fissi e i camper. Il nuovo Movano si affianca a Combo e Vivaro ed è il membro più giovane della famiglia dei veicoli commerciali leggeri Opel. Entro la fine dell’anno ciascun modello della gamma LCV del marchio disporrà di una versione elettrica a batteria. Inoltre, Opel offrirà una versione elettrica di ogni modello della propria gamma entro il 2024.

Combo-e Life è offerto in versione cinque posti o in una configurazione navetta a sette posti

FLESSIBILITÀ, FUNZIONALITÀ E VERSATILITÀ IN FORMATO ELETTRICO O pel Combo-e Life si presenta sul mercato come nuovo veicolo elettrico a batteria per il tempo libero (LAV). In Italia è in vendita al prezzo d’ingresso di 37.005 euro. Estremamente versatile e pratico, Combo-e Life viene offerto con una o due porte laterali scorrevoli ed è disponibile in versione standard, lunga 4,4 metri, o in versione XL, da 4,75 m, entrambe con 5 o 7 posti. In base al profilo di guida e alle condizioni prevalenti, il nuovo veicolo Opel può percorrere fino a 280 chilometri con una carica della

Pagina X

batteria agli ioni di litio da 50 kWh. La ricarica all’80 per cento richiede circa 30 minuti presso le stazioni pubbliche in modalità CC. ?Naturalmente, il veicolo è adatto a numerose infrastrutture energetiche e opzioni di ricarica, dalla Wall box alla ricarica rapida o anche al cavo di ricarica con presa domestica, se necessario. Grazie a una potenza di 100 kW (136 cv) e a una coppia di 260 Nm generate dal sistema di propulsione elettrico, Combo-e Life si dimostra all’altezza delle aspettative della moderna mobilità green.

Il commerciale per uso passeggeri del costruttore tedesco accelera da 0 a 100 km/h in soli 11,2 secondi, mentre la velocità massima di 130 km/h (limitata elettronicamente) lo rende “a prova di autostrada”. Il raffinato sistema di frenata rigenerativa con due impostazioni a scelta dell’utente aumenta ulteriormente l’efficienza. La batteria con 216 celle e 18 moduli è posizionata sotto il pianale tra asse anteriore e posteriore e quindi non limita in alcun modo la funzionalità dell’abitacolo. A seconda del mercato e dell’in-

frastruttura esistente, Opel Combo-e Life monta un potente caricatore di bordo trifase da 11 kW o il caricatore di bordo monofase da 7,4 kW di serie. La versione 5 posti, più corta, offre un vano bagagli da 597 litri (850 litri nella versione più lunga). Abbattendo i sedili posteriori, il volume di carico della versione a passo corto triplica e raggiunge i 2.126 litri, mentre il modello più lungo può trasportare fino a 2.693 litri. Il nuovo Opel Combo-e Life giungerà nelle concessionarie questo autunno.

N° 301 / Luglio-Agosto 2021


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

STELLANTIS / IL GRUPPO CALA IL SUO TRIS DI VEICOLI COMMERCIALI

C’è il motore a idrogeno nel

I

IL FATTORE H DELLA MOBILITÀ ENTRA NEL VIVO. I FURGONI DEI TRE MARCHI EX PSA SARANNO PRESTO IN VENDITA IN VERSIONE AD IDROGENO E POTRANNO CONTARE SU DUE FONTI DI ENERGIA: UNA PILA A COMBUSTIBILE DA 45 KW CHE PRODUCE ELETTRICITÀ CONSUMANDO L’IDROGENO IMMAGAZZINATO IN TRE SERBATOI DA 700 BAR E UNA BATTERIA DA 10,5 KWH CHE FUNGE DA RISERVA PER 50 CHILOMETRI E SUBENTRA AUTOMATICAMENTE QUANDO IL SERBATOIO DI IDROGENO È VUOTO. LA PILA A IDROGENO ASSICURA L’AUTONOMIA DEL VEICOLO E IL RIFORNIMENTO RAPIDO, MENTRE LA BATTERIA È NECESSARIA DURANTE LE FASI TRANSITORIE, COME LE FORTI ACCELERAZIONI E LE PENDENZE LUNGO IL PERCORSO CHE RICHIEDONO MAGGIORE POTENZA.

CRISTINA ALTIERI MILANO

l mercato del segmento dei furgoni compatti rappresenta più di 750.000 veicoli all’anno in Europa e l’8 per cento delle aziende ha bisogno di percorrere

Pagina XII

tragitti superiori a 300 km, o comunque non ha il tempo per ricaricare la batteria dei loro veicoli durante il giorno. Partendo da queste considerazioni Peugeot, Citroën e Opel ampliano ulteriormente la loro gamma a disposizione dei professionisti e diventa-

no tra i primissimi marchi a proporre, di serie a partire dal 2021, una versione elettrica alimentata da una pila a combustibile a idrogeno nel segmento dei furgoni compatti. Offerti in aggiunta ai modelli termici e 100% elettrici, i nuovi e-Expert, ë-Jumpy, e Viva-

ro-e, tutti con la sigla Hydrogen a completarne la denominazione completano dunque una gamma dedicata ai professionisti che vogliano ridurre i costi, non avere limiti di accesso alle zone centrali delle città ed essere sostenibili nel loro lavoro. Tutto questo senza

dover fare troppo i conti con i tempi di carica e l’autonomia che, in caso dei furgoni ad idrogeno, è ancora più estesa di quella delle corrispondenti versioni a sola batteria. L’innovazione passa attraverso un sistema mid-power plug-in hy-

N° 301 / Luglio-Agosto 2021

Opel Vivaro-e è il veicolo a idrogeno con il marchio del Blitz appartenente al Gruppo Stellantis. In alto, Peugeot e-Expert, avanguardia tecnologica firmata dalla Casa del Leone.


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI A IDROGENO: CITROËN E-JUMPY, PEUGEOT E-EXPERT E OPEL VIVARO-E

futuro dei professionisti

drogen fuel cell electric specifico per il gruppo Stellantis e composto da: una pila a combustibile che produce l’elettricità necessaria alla propulsione del veicolo grazie all’idrogeno a bordo dei tre serbatoi; una batteria agli ioni di litio ad alta tensione con una capacità di 10,5 kWh che può essere ricaricata dalla rete elettrica e che alimenta anche il motore elettrico in alcune fasi della guida. Questo comporta la capacità di questi van di coprire tutti i percorsi senza emissioni di CO2 durante la guida, la possibilità di fare il pieno di idrogeno in 3 minuti e

Frank Jordan, Research & Innovation Director Germany Stellantis.

un’autonomia di oltre 400 km. Oltre alla piena conservazione di una delle funzioni essenziali dei veicoli commerciali leggeri: il trasporto di oggetti voluminosi e pesanti: offerti in due lunghezze, i van infatti associano dimensioni esterne compatte a capacità di carico massime, La collocazione dei serbatoi di idrogeno sotto il pavimento permette di mantenere intatto il volume di carico, identico in tutto e per tutto a quello delle versioni Diesel e 100% elettriche. e-Expert e ë-Jumpy Hydrogen saranno prodotti in Francia, a Valenciennes, e poi trasformato nel

centro specializzato Stellantis a Rüsselsheim, dove verrà invece completamente sviluppato il modello Opel. L’idrogeno sta diventando un pilastro importante della transizione energetica, con l’annuncio di numerosi progetti internazionali. In Europa in particolare, assistiamo allo sviluppo delll’ecosistema e gli investimenti della European Clean Hydrogen Alliance per promuovere questa soluzione sono stimati in circa 60 miliardi di euro. Grazie a questi piani governativi, il numero di stazioni di idrogeno in Europa è in costante aumento.

L’innovazione a portata di mano per tutti gli utilizzatori: ecco come funziona la tecnologia a idrogeno

I

DALLA PILA A COMBUSTIBILE AL VAPORE ACQUEO, IL PROCESSO VIRTUOSO

componenti di questa tecnologia sono i seguenti. Una pila a combustibile a idrogeno situata nel vano motore nella parte anteriore del veicolo, che fornisce elettricità al motore elettrico, ricombinando l’idrogeno contenuto nel serbatoio e l’ossigeno dell’aria, e che emette solo vapore acqueo attraverso il tubo di scarico. Un motore elettrico a magneti permanenti, con una potenza massima di 136 cv e una coppia massima di 260 Nm. Una batteria agli ioni di litio ad alta tensione; è situata sotto i sedili della cabina e ha una capacità di 10,5 kWh ed una potenza di 90 kW. Un caricabatterie di bordo trifase da 11 kW, situato nel vano motore. Un sistema di serbatoi composto da tre bombole per lo stoccaggio dell’idrogeno situate sotto il pianale, con una capacità totale di 4,4 kg a una pressione di 700 Bar. La batteria ad alta tensione (10,5 kWh) viene ricaricata tramite la presa di ricarica sul parafango anteriore sinistro. Il caricatore trifase da 11 kW a bordo

consente i seguenti tempi di ricarica: da una Wall Box da 11 kW (32A): ricarica completa in meno di un’ora, da una presa potenziata (16A): ricarica completa in 3h, da una presa domestica classica (8A): ricarica ricarica completa in 6h.

N° 301 / Luglio-Agosto 2021

Esistono diverse fasi di funzionamento del sistema «midpower plug-in hydrogen fuel cell electric. In partenza e a bassa velocità la sola batteria ad alta tensione fornisce al motore elettrico la potenza necessaria alla trazione. A velocità stabilizzata la pila

a combustibile fornisce l’energia direttamente al motore elettrico. Nelle fasi di accelerazione, sorpasso o in salita la pila a combustibile e la batteria ad alta tensione lavorano in sinergia per fornire energia al motore elettrico. Nelle fasi di frenata e di decele-

razione, il motore elettrico ricarica la batteria ad alta tensione. La potenza è disponibile sin dall’avviamento del veicolo per una reattività immediata, senza vibrazioni, senza rumore, senza cambi di marcia, senza odore e, naturalmente, senza emissioni di CO2. L’unica emissione del sistema è il vapore acqueo scaricato attraverso il tubo di scarico. In città, fino a 30 km/h, per garantire la sicurezza dei pedoni, un segnale acustico segnala la presenza del veicolo sia a marcia avanti che in retromarcia. Affinché gli utenti possano godersi il loro veicolo in tutta tranquillità, la batteria ad alta tensione è garantita per 8 anni o 160.000 km per almeno il 70 per cento della sua efficienza. Tre le modalità di guida selezionabiii: Eco (60 kW/82 cv, 190 Nm erogati dal motore): favorisce l’autonomia, Normal (80 kW / 109 cv, 210 Nm), ottimale per l’uso quotidiano e infine Power (100 kW/136 cv, 260 Nm): ottimizza le prestazioni in caso di trasporto di carichi elevati. Sono

anche disponibili due modalità di freno motore, con logiche specifiche di rigenerazione della batteria: moderata, per sensazioni simili a quelle di un veicolo termico, aumentata (selezionando la posizione “B” (Brake) sul comando del cambio), per avere una decelerazione maggiore (e quindi anche un recupero maggiore dell’energia) in fase di rilascio dell’acceleratore. Il quadro strumenti presenta un’evoluzione rispetto alle versioni precedenti per condividere le informazioni necessarie alla gestione del veicolo elettrico con pila a combustibile: un power meter (o potenziometro) per visualizzare il livello di consumo energetico in funzione delle prestazioni richieste al veicolo (Eco, ottimizzazione dell’energia o Power, potenza massima) o di recupero dell’energia (Charge), un indicatore del livello di carica dell’idrogeno un indicatore del livello di carica della batteria una matrice a colori che permette di visualizzare le informazioni del computer di bordo e l’autonomia.

Pagina XIII


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI

VOLKSWAGEN VEICOLI COMMERCIALI / PRIMO BULLI CON PROPULSIONE

Multivan firma il lifestyle I PUNTI DI FORZA DEL RINNOVATO MODELLO TEDESCO SONO PARECCHI: DESIGN CHE SI RIFÀ AL DNA DEI LEGGENDARI PREDECESSORI; DEBUTTO COME PRIMO BULLI CON PROPULSIONE IBRIDA PLUGIN; CAMBIO AUTOMATICO A DOPPIA FRIZIONE

DSG DI

SERIE PER TUTTE LE VERSIONI; DEBUTTO DELLA MODALITÀ PARZIALMENTE AUTOMATIZZATA MEDIANTE

IQ.DRIVE TRAVEL ASSIST. L’ARRIVO DELLA SETTIMA GENERAZIONE MULTIVAN SUI MERCATI NELLA SECONDA METÀ DELL’ANNO SI PREANNUNCIA CARICA DI ASPETTATIVE.

È

FABIO BASILICO

vamente elettrici: ID.BUZZ, il van all’insegna del lifestyle, e ID.BUZZ Cargo, il furgone pensato a misura per la dimensione urbana. Nel frattempo, il nuovo Multivan s’incarica di svolgere i compiti di talentuoso veicolo multiuso, anche grazie a una capacità di carico che può raggiungere i 4.053 litri e a un peso rimorchiabile massimo di 2.000 kg. Con il van fino a sette posti e disponibile nei tre allestimenti Multivan, Life e Style, Volkswagen VC trasferisce uno speciale lifestyle au-

Pagina XIV

Comfort di bordo in primo piano nella progettazione dell’esclusivo Volkswagen Bulli.

VERONA

un concentrato di innovazione che fa tesoro di una storia prestigiosa il nuovo Volkswagen Multivan. I punti di forza del rinnovato modello tedesco sono parecchi: design che si rifà al Dna dei leggendari predecessori; debutto come primo Bulli con propulsione ibrida plug-in; cambio automatico a doppia frizione DSG di serie per tutte le versioni; debutto della modalità parzialmente automatizzata mediante IQ.DRIVE Travel Assist. Non c’è che dire: l’arrivo del nuovo Multivan sui mercati nella seconda metà dell’anno si preannuncia carica di aspettative. La nuova generazione del best-seller di Volkswagen VC è stata concepita completamente ex novo e per la prima volta il nuovo Bulli si basa su pianale modulare trasversale (MQB) che ha permesso di includere nella gamma motorizzazione un avanzato sistema ibrido plug-in (versione eHybrid) che consente al Multivan di diventare per determinati periodi uno Zero Emission Vehicle particolarmente indicato per le aree urbane ma non solo, visto che la sua autonomia gli consente di proporsi anche come van per i lunghi viaggi. Con l’anteprima mondiale della settima generazione del Bulli, Volkswagen Veicoli Commerciali si proietta in una nuova era. Inizia un decennio che sarà segnato da molteplici forme di elettrificazione dei sistemi di propulsione e dall’avvento della guida automatizzata. In questo contesto, l’offerta del Bulli sarà suddivisa in futuro in tre colonne portanti: la gamma Multivan, il Transporter 6.1 e, a partire dal 2022, la versione di serie dell’ID.BUZZ. Ciascuno di questi pilastri è di fondamentale importanza: il T6.1 si conferma lo specialista dell’impiego commerciale come Transporter e Caravelle, mentre come California rimarrà un’icona tra i camper. Due i modelli esclusi-

tomobilistico in un presente e in un futuro caratterizzati dalla digitalizzazione e dall’interconnessione in rete. Concepito principalmente per la famiglia e per gli appassionati sportivi, Multivan si adatta a innumerevoli scenari di mobilità grazie al suo sistema di sedili e al vano di carico completamente nuovo. Inoltre, secondo le previsioni, il nuovo Bulli espanderà le sue quote di mercato anche come business-van ed esclusivo shuttle, in virtù della sua versatilità e dei pregiati interni in

stile lounge. Dal punto di vista del design esterno, il costruttore tedesco ha ulteriormente sviluppato il carattere inconfondibile di Multivan facendogli compiere un grande passo in avanti, pur rimanendo fedele alle linee tipiche del Bulli. Un esempio è dato dalla linea orizzontale del T3 (terza generazione Bulli e prima generazione Multivan) che abbraccia l’intera carrozzeria: sul nuovo Multivan, questa linea caratteristica è arricchita da un inserto cromato a

partire dall’allestimento Style. Se poi il nuovo Multivan viene ordinato in una verniciatura bicolore, la linea caratteristica separa anche le due zone cromatiche l’una dall’altra. Rispetto al modello precedente, la versione base è diventata più lunga e più larga. Allo stesso tempo, Volkswagen Veicoli Commerciali ha ridotto leggermente l’altezza – ciò tuttavia a fronte di un’altezza massima interna pressoché identica o perfino migliorata se il veicolo è dotato del nuovo tetto panoramico in vetro. In dettaglio, senza gli specchietti retrovisori esterni ripiegabili elettricamente, dotazione a richiesta, il nuovo Multivan è largo 1.941 mm (+37 mm rispetto al Multivan 6.1), lungo 4.973 mm (+69 mm) e alto fino a 1.903 mm (-47 mm). Il passo misura 3.124 mm (+124 mm). Un’importante novità per Multivan sono i fari a Led Matrix IQ.LIGHT interattivi, offerti a richiesta come alternativa ai fari Led di serie. La gamma delle funzioni dei fari a Led Matrix IQ.LIGHT comprende il Dynamic Light Assist (sistema di abbaglianti permanenti che non causano l’abbagliamento dei veicoli provenienti in senso contrario) e le luci di svolta dinamiche (per un’illuminazione precisa dell’andamento della curva). Nel caso dei fari a Led Matrix IQ.LIGHT, figura nel layout esterno un listello trasversale luminoso a Led nella calandra, che funge come ulteriore elemento delle luci diurne. La versione di allestimento Style è sempre dotata di listello trasversale illuminato nella calandra. Tutti i nuovi Multivan dispongono inoltre di gruppi ottici posteriori a Led di serie. Come gli esterni, gli interni nel loro complesso sono nuovi. La plancia si presenta come un ambiente di visualizzazioni ergonomico e collegato in rete. Di serie è dotata di Digital Cockpit e del sistema di infotainment Ready 2 Discover. Sempre integrati sono i servizi onli-

N° 301 / Luglio-Agosto 2021


VEICOLI COMMERCIALI

IDLE I M ONDO TRASPORTI IBRIDA PLUG-IN E CAMBIO A DOPPIA FRIZIONE DSG DI SERIE

nella moderna mobilità

ne We Connect e We Connect Plus (quest’ultimo per una durata limitata, prorogabile in seguito a pagamento). La maggior parte degli elementi di comando sono stati concepiti come superfici touch e pulsanti a controllo digitale. Per la prima volta è presente un comando del cambio shift-by-wire digitale, quindi non ingombrante, che consente di azionare il cambio a doppia frizione di serie. Viene azionato a comando elettrico anche il freno di stazionamento. Entrambe le soluzioni creano ancora più spazio per passare dal sedile del conducente al sedile del passeggero anteriore o viceversa. Un tavolino multifunzione è integrato nel sistema di guide dei sedili. Grazie all’innovativa tecno-

logia di bloccaggio, questa dotazione multifunzionale può essere utilizzata come consolle centrale tra i sedili del conducente e del passeggero anteriore oppure come tavolino ribaltabile completo di portabevande e vani portaoggetti nella seconda e terza fila di sedili. Nella versione base, Multivan offre una capacità di carico di 469 litri dietro la terza fila di sedili, con carico sistemato fino al tetto; caricato fin dietro la seconda fila di sedili, il volume aumenta a 1.844 litri (1.850 litri con tetto panoramico in vetro). Sfruttando tutta la capacità di carico fin dietro la prima fila di sedili e in alto fino al tetto, si ottengono 3.672 litri. Per la variante di carrozzeria lunga le medesime mi-

sure sono rispettivamente 763, 2.171 e 4.005 litri (4.053 litri con tetto panoramico in vetro). Il tetto panoramico in vetro è suddiviso in due parti. Il Multivan con trazione ibrida plug-in si fregia della denominazione aggiuntiva eHybrid. La potenza di sistema dei motori elettrici più motore turbo benzina (TSI) è di 160 kW/218 cv. Grazie alla batteria agli ioni di litio con contenuto energetico pari a 13 kWh, Multivan eHybrid può coprire le tipiche distanze quotidiane in modalità esclusivamente elettrica. La propulsione ibrida plug-in è stata progettata in modo tale che il veicolo si avvii di norma in modo esclusivamente elettrico e quindi copra automatica-

mente a zero emissioni locali soprattutto le brevi percorrenze. Solo a velocità superiori ai 130 km/h entra in funzione anche il TSI. Parallelamente alla propulsione ibrida plug-in, Multivan a trazione anteriore sarà offerto con due motori turbo benzina a quattro cilindri che sviluppano 100 kW/136 cv e 150 kW/204 cv. Il prossimo anno, la gamma sarà completata da un quattro cilindri Turbodiesel (TDI) con potenza di 110 kW/150 cv. La versione di accesso è rappresentata dal modernissimo motore turbo benzina 4 cilindri a iniezione diretta da 136 cv e con cilindrata di 1.498 cc. La coppia massima tocca i 220 Nm. Analogamente a tutti i propulsori del Multivan, anche que-

sta unità benzina rispetta la norma sui gas di scarico EU6 AP. Il TSI più potente presenta una cilindrata di 1.984 cc. Il quattro cilindri con 204 cv di potenza massima appartiene alla serie di motori EA888, tra i quattro cilindri più potenti dell’intero Gruppo Volkswagen, tra l’altro adottati anche su alcuni modelli di vetture, come Golf GTI, Golf R o Tiguan R e Arteon R. Sul Multivan, questo efficiente propulsore sviluppa una coppia massima pari a 320 Nm. Il motore elettrico di Multivan eHybrid eroga una potenza di 85 kW/116 cv, mentre il quattro cilindri turbo benzina, con cilindrata di 1.395 cc, sviluppa 110 kW/150 cv. La potenza di sistema, che deriva dalla combinazione dei due propulsori, è come detto pari a 160 kW/218 cv, con relativa coppia massima che si attesta su 350 Nm. Il DSG a 6 rapporti della versione eHybrid è un cambio appositamente sviluppato per la propulsione ibrida plug-in e forma un’unità di sistema con il motore elettrico. Per le versioni TSI e il successivo TDI verrà impiegato un cambio DSG a 7 rapporti. La gamma dei sistemi di assistenza è stata notevolmente ampliata. A seconda dell’equipaggiamento, sono disponibili fino a 20 sistemi. Sempre a bordo, già nella dotazione di serie, sono inclusi, tra gli altri, Car2X (sistema di avvertimento locale di serie), il sistema di controllo perimetrale Front Assist con funzione di frenata di emergenza City, il sistema d’assistenza alle manovre di scarto con nuovo assistente alle svolte, il riconoscimento della segnaletica stradale, l’assistenza per il mantenimento della corsia Lane Assist e il cruise control. Tra gli innovativi nuovi sistemi figura l’IQ.DRIVE Travel Assist, che consente una guida semi-automatizzata da 0 a 210 km/h. Con l’IQ.DRIVE Travel Assist, la nuova regolazione automatica predittiva della distanza ACC (guida longitudinale) e il Lane Assist (guida trasversale) si fondono fino a formare un nuovo sistema che perfeziona notevolmente il comfort e la sicurezza sulle medie e lunghe percorrenze.

Volkswagen VC e Argo AI avviano una serie di test per la guida autonoma a livello internazionale

LA TEDESCA MOIA È LA PRIMA UTILIZZATRICE DI ID.BUZZ L o sviluppo è già iniziato e quest’estate i primi prototipi a guida autonoma basati sulla futura ID. BUZZ sono testati sul campo in un’area nei pressi di Monaco di Baviera. Si tratta di una pietra miliare della collaborazione internazionale all’interno del Gruppo Volkswagen, nell’ambito della quale Volkswagen Veicoli Commerciali sviluppa tecnologie per la guida autonoma di livello 4 per navette e van a guida autonoma. I veicoli commerciali leggeri sono i primi mezzi dove è logico impiegare tecnologie per il trasporto autonomo di persone e merci. “Con la versione a guida autonoma di ID. BUZZ, il nostro scopo è quello di applicare le nuove tecnologie per usi commerciali, nei servizi di trasporto e consegne, a partire dal 2025”, ha dichiarato Christian Senger, Responsabile Guida Autono-

ma in Volkswagen Veicoli Commerciali - In città selezionate, i clienti potranno ricorrere a veicoli a guida autonoma per arrivare a destinazione. Anche la consegna di merci e pacchetti sarà molto più semplice grazie a questa tecnologia”.Sono stati quindi sviluppati progetti concreti per l’utilizzo della futura tecnologia anche per scopi commerciali, nei servizi di trasporto. Nel 2025, appunto, MOIA, affiliata del Gruppo Volkswagen e fondata nel 2016, sarà la prima utilizzatrice di ID. BUZZ AD a guida autonoma. “MOIA vanta una grande esperienza nel campo dei servizi di mobilità e di ge-

N° 301 / Luglio-Agosto 2021

stione delle flotte – ha sottolineato il COO Robert Henrich - In pochissimo tempo siamo riusciti a creare il servizio di ride pooling completamente elettrico più grande d’Europa, assicurando la mobilità di milioni di passeggeri. Questa competenza è il nostro contributo alla collaborazione con Volkswagen Veicoli Commerciali e Argo AI. Amburgo sarà la prima città a offrire un ser-

vizio di ride pooling a guida autonoma con ID. BUZZ”. MOIA è l’azienda fornitrice di servizi di sharing più importante di Amburgo e attualmente conta 1.200 dipendenti. Per la società, la guida autonoma è un passo fondamentale sulla strada verso il successo. Per lo sviluppo di ID. BUZZ AD a guida autonoma, Volkswagen Veicoli Commer-

ciali punta sulla tecnologia LiDAR di Argo AI, in grado di riconoscere oggetti posti fino a 400 metri di distanza. Per implementare la guida autonoma, Volkswagen Veicoli Commerciali ha fondato una divisione commerciale dedicata e ha annunciato la partecipazione in Argo AI, azienda statunitense che si occupa del cosiddetto Self Driving System (SDS), per integrare la tecnologia nel modello ID. BUZZ AD completamente elettrico. In primavera, Argo ha già installato il sistema su un primo prototipo, testandolo per la prima volta anche in Germania. Bryan Salesky, CEO di Argo, ha commentato: “Stiamo creando un sito di prova nel nostro centro di Monaco di Baviera, nelle immediate vicinanze dell’aeroporto, applicando l’esperienza accumulata da Argo AI nel corso degli anni con i test

negli Stati Uniti alle condizioni di trasporto europee”. Dal punto di vista sia di Volkswagen Veicoli Commerciali sia di Argo AI, la combinazione di sensori e telecamere è irrinunciabile in questo contesto. Di recente, Argo AI ha presentato uno scanner LiDAR (Light detection and ranging) che, a differenza del sistema radar, sfrutta le onde luminose e riesce a individuare oggetti posti fino a 400 metri di distanza. La sua modalità Geiger brevettata è in grado di rilevare anche la più piccola particella di luce. In questo modo può “vedere” anche oggetti che riflettono poco, fornendo rappresentazioni estremamente precise dell’ambiente circostante. “Abbiamo installato questa tecnologia anche sui prototipi di Volkswagen Veicoli Commerciali”, ha detto ancora Salesky.

Pagina XV


DOPPIO ZE Z RO O ANTICIPO ZERO + TA ASSO ZERO

3 ANNI

IN PIÙ DI MANUTENZIO ONE ORDINARIA

&

3° ANN NO

DI GARANZIA A ESTESA SULLA CAT TENA CINEMAT T TICA

I NCL USI NEL PREZ ZZO! ZO! -P (EMP] YR´IZSPY^MSRI GLI cambierà la prospettiva al tuo o business 9RE RYSZE KEQQE HM QSXSVM TIV KIWXMVI PE XYE EXXMZMXk MR QSHS sostenibile s e SUR¼FXR 9R ambiente di lavoro TVSHYXXMZS I YRE WIVMI HM sistemi s di guida assistitaa TIV YR´IWTIVMIR^E GSQTPIXEQIRXIRYSZE9RRYSZSPMZIPPSHMconnettivitàGLIXMETVIYRQSRHSHMservizii personalizzati -P(EMP]rHEZZIVSPEWSPY^MSRIHMXVEWTSV XSTM€GSQTPIXEIWYQMWYVETIVMPXYSFYWMRIWW

CORRI IN CONC CESSIONARIA O CHIAMA SUB BITO IL NUMERO VERDE ! lun-ven 8-20 / sabato 8-12

IVECO. L’ IT TALIA CHE VINCE. 3JJIV XE ZEPMHE ½RS EP  WY XYXXE PE KEQQE (EMP] 1= *YVKKSRM I 'EFMREXM VYSXE WMRKSPE WY ZEPSVM HM JSVRMXYVE ½RS E º I WSKKIXXE E GSRHM^MSRM )WIQTMS HM JSVRMXYVE º PIEWMRK E  QIWM ERXMGMTS ^IVS ZEPSVI ½REPI HM VMWGEXXS   GERSRMQIRWMPMHEºGSQTVIRWMZMHM4SPM^^E*YV XSI-RGIRHMS8EWWS0IEWMRK 7TIWITVEXMGE-:%XVEWTSV XSIQIWWEWYWXVEHEIWGPYWI7EPZSETTVSZE^MSRI-:)'3'%4-8%0 '2,-RHYWXVMEP'ETMXEP)YVSTI7%7 4VMQEHMEHIVMVIIEP½RER^MEQIRXSrRIGIWWEVMS TVIIRHIVIZMWMSRIHIPPI'SRHM^MSRM'SRXVEXXYEPMIHIM*SKPMMRJSVQEXMZMHMWTSRMFMPMTVIIWWSPIGSRGIWWMSREVMIEHIVIRXM4SWWMFMPMXkHMTIVWSREPM^^EVIIP´SJJIV XEGSREPXVMMQTSV XMIHYVEXIHMVIIXXEQIRXIMRGSRGIWWMSREVME0´SJJIV XEGSQTVIRHIMPTEGGLIXXS00MJIHYVEXEQIWM TIVZIMGSPMGSRTIVGSVVIR^EERRYEQEWWMQEHMOQ STTYVIGSRQEWWMQSOQXSXEPM -PTEGGLIXXS0PMJIGSQTVIIRHIP´IWXIRWMSRIHMKEVER^MEEQIWMWYPPEGEXIREGMRIQEXMGEIQIWMHMQERYXIR^MSRIGSQITVIZMWXSHETMERSQERYXIRXMZS4IVMHIXXEKPM WYMGSRXIRYXMIWYPPIGSRHM^MSRMJEVIVMJIVMQIRXSEPGSRXVEXXSHMQERYXIR^MSRIIVMTEVE^MSRIVIITIVMFMPITVIWWSXYXXIPIGSRGIWWMSREVMIEHIVIIRXM-QQEKMRIETYVS SWGSTSMPPYWXVEXMZS1IWWEKKMSTYFFPMGMXEVMSGSR½REPMXkTVS SQS^MSREPM

Profile for Vega Editrice

Il Mondo dei Trasporti - Luglio Agosto 2021  

Il Mondo dei Trasporti - Luglio Agosto 2021  

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded