Page 1

DOMINGO MACEIร“ - ALAGOAS 6 DE JANEIRO DE 2013 Nยบ. 1.637 R$

3,00

SANDRO LIMA

TRIBUNA

INDEPENDENTE

EXEMPLAR DO ASSINANTE

tribunahoje.com

Vem aรญ a Lei Seca para medicamentos A nova Lei Seca nรฃo se destina a punir apenas motoristas alcoolizados. No texto sancionado pela presidenta Dilma estรฃo incluรญdas drogas lรญcitas e ilรญcitas que provocam sonolรชncia e comprometem a coordenaรงรฃo motora. 0DVUHVWDDLQGDHVSHFLร€FiODV(VVD LQFXPErQFLDVHUiGR&RQWUDQTXH SUHSDUDDUHJXODPHQWDomRSDUDYLJR UDUHPIHYHUHLUR9iULRVPHGLFDPHQ WRVGHWDUMDSUHWDDOpPGHPDFRQKD HFRFDtQDGHYHUmRFRQVWDUGDOLVWD

EMPREGO EM 2013

Secretรกrio TXHUTXDOLยฟFDU alagoanos Para o secretรกrio de Estado do Trabalho e Renda, Alberto Sextafeira, 2013 serรก o ano GDTXDOLยฟFDomRHRSRUWXQLGDGHVGHHPSUHJRSDUDRV DODJRDQRV3DUDLVVRHOH TXHUDPSOLDURQ~PHURGH DJrQFLDVGR6LQHHH[SDQGLU VXDVDWULEXLo}HVFRPRHPLWLU carteira de trabalho.

PรGINA 13 ADAILSON CALHEIROS

PรGINA 2 DESGASTE E DESCRร‰DITO

VEREADORES PROMETEM ESFORร‡O PARA MUDAR IMAGEM DA Cร‚MARA PรGINA 4

21 MOTORISTAS PEGOS PELA PRF VรƒO PAGAR MULTA DE R$ 1.915,40 'HVGHRGLDGHGH]HPEURTXDQGRHQWURXHPYLJRUDQRYD/HL6HFDPDLVUtJLGDHFRPPDLV DOWHUQDWLYDVGHSURYDVFRQWUDPRWRULVWDVDOFRROL]DGRVD3ROtFLD5RGRYLiULD)HGHUDODXWXRX FRQGXWRUHVHSUHQGHXHP$ODJRDV7RGRVYmRSDJDUPXOWDGH53DUDHYLWDU DDXWXDomRPXLWDJHQWHDJRUDYDLDRVEDUHVGHWi[LDSpRXHOHJHRยณPRWRULVWDGDYH]ยด

PรGINA 9

ASSASSINATO DE TORTURADOR LEVA A COMร‰RCIO ILEGAL DE ARMAS

TV & MULHER

JOANA PRADO: โ€˜Sร“ SE FOSSE MUITO BURRA PARA NรƒO POSAR PARA A PLAYBOYโ€™

$SULVmRGHGRLVVROGDGRVGD %ULJDGD0LOLWDUDFXVDGRVGH PDWDURFRURQHODSRVHQWDGR GR([pUFLWR-XOLR0LJXHO0Rlina Dias - reconhecido como torturador do DOI-Codi duUDQWHDGLWDGXUDPLOLWDUSDUD URXEDUDFROHomRGHDUPDV dele, revela a face obscura de ยณKRPHQVGDOHLยดTXHPHUJXOKD UDPQRVXEPXQGRGRWUiยฟFR de armas. O assassinato de 0ROLQDWDPEpPUHYHORXGRFXPHQWRVVREUHRGHVDSDUHFLmento de Rubens Paiva e o atentado do Rio-Centro.

SUPLEMENTO

COMEร‡ANDO BEM

PREFEITO COMEMORA A VINDA DE MAIS DE 250 MIL TURISTAS NA TEMPORADA SUPLEMENTO TEMPO Bom a parcialmente nublado com possiblidades de chuvas em รกreas isoladas

Mรญnima

20ยบ

Mรกxima

30ยบ

Marรฉs

04:23 10:34 16:53 23:15

0.6 1.7 0.6 1.7

FINANร‡AS Dร“LAR COMERCIAL R$ 2,03 R$ 2,03 DOLAR PARALELO R$ 2,06 R$ 2,20 OURO: R$ 109,00 POUPANร‡A: 0,4134%

PรGINA 7

ESQUISTOSSOMOSE

ACORDO ORTOGRรFICO

5LFDHPODJRDVHULRVSRUpP SREUHHPVDQHDPHQWREiVLFR $ODJRDVWHPHPVHXWHUULWyULR GRVPXQLFtSLRVFRPHQGHPLD SDUDDHVTXLVWRVVRPRVHPDQV{QLFD(QWUHDSRSXODomRDODJRDQD FRUUHPULVFRGHLQIHFomR SHODGRHQoDTXHVHHVSDOKD SDUDDOpPGD=RQDGD0DWDMi DWLQJLQGRERDSDUWHGROLWRUDO

2QRYRDFRUGRRUWRJUiยฟFRTXH MiIRLDGRWDGRSHORVEUDVLOHLURV WHYHVXDYLJrQFLDRยฟFLDODGLDGD SDUDRTXHGHVDJUDGRX SURIHVVRUHVHHVWXGDQWHVDODJRDnos. Com a medida, editais de concursos e vestibulares continuDUmRDFREUDUDVUHJUDVDQWLJDV 3DUDHVSHFLDOLVWDVRDGLDPHQWR pXPJUDQGHUHWURFHVVR

PรGINA 10

PรGINA 11

80% correm risco da doenรงa em Alagoas

Adiamento รฉ criticado por professores


TRIBUNAINDEPENDENTE

2 POLÍTICA MACEIÓ - DOMINGO, 6 DE JANEIRO DE 2013

Política

2PHUFDGRUHTXHUKRMHTXHYRFrVDLDSDUD ID]HUDOJRTXHVHMDXPSURÀVVLRQDOTXDOLÀFDGRSDUDDPLVVmRTXHHOHH[LJHµ ALBERTO SEXTAFEIRA 6(&5(7È5,2'275$%$/+2(035(*2 5(1'$(48$/,),&$d­2

SDUD6H[WDRDQRGDTXDOLÀFDomR

6HFUHWiULRGR7UDEDOKRH4XDOL¿FDomR$OEHUWR6H[WDIHLUDOXWDSHODDPSOLDomRGRV6LQHVSDUDTXDOL¿FDUDODJRDQR

ESPLANADA LEANDRO MAZZINI - FRQWDWR#FROXQDHVSODQDGDFRPEU

0(&FHUFDGHSXWDGRV¶HGXFDGRUHV·

A

SURSRVWDGHFULDomRGR,QVDHV ,QVWLWXWR1DFLRQDOGH6XSHUYLVmRH $YDOLDomRGD(GXFDomR6XSHULRU YLVDHPHVSHFLDOIHFKDURFHUFR DLQVWLWXLo}HVGHHQVLQRVXSHULRUSDUWLFXODUHVQDVTXDLV HVWXGDPDOXQRV&XULRVDPHQWHPXLWDVGHODVVmRGHSURSULHGDGHVGHGHSXWDGRVIHGHUDLVHHVWDGXDLVFRPDXWRUL]DomRGRSUySULR 0(&QRV~OWLPRVGH]DQRV2FRQWLQJHQWHGHDOXQRVpTXDWURYH]HV PDLRUGRTXHRGHPDWULFXODGRVQDVIHGHUDLV  

Reação 3UHRFXSDGRFRPDTXDOLGDGHR0(&HQYLRXSURMHWRSDUDGHEDWHQD &kPDUDHQmRYDLUHFXDU$DVVRFLDomRGDVIDFXOGDGHVSURPHWHUHDJLU PrVTXHYHP

Há vagas &RPRGLYXOJDGRSHODFROXQDR,QVDHVSURS}HDFULDomRGHPDLVGH FDUJRVSDUDTXHIXQFLRQH$FRUULGDMipJUDQGHHQWUHIXQFLRQiULRVGH PLQLVWpULRV

Raios x 'DGRVGR0(&RSDtVWHPLQVWLWXLo}HVGHHQVLQRVXSHULRU6mR S~EOLFDVXQLYHUVLGDGHVFHQWURVXQLYHUVLWiULRVIDFXOGDGHVH&HIHWV

Freio diplomático $RFRQWUiULRGRH[SUHVLGHQWH/XODTXHGLVWULEXLXGHVGHQRYDV HPEDL[DGDVSRUSDtVHVGDÈIULFDHÈVLDDSUHVLGHQWH'LOPDIUHRXR JDVWRLQWHUQDFLRQDOSUHRFXSDGDFRPR2UoDPHQWR$DVVHVVRULDGR0LQLVWpULRGDV5HODo}HV([WHULRUHVJDUDQWHTXHQmRKiSUHYLVmRGHQRYDV XQLGDGHVQRH[WHULRUDWp¿PGH

Tatto no prato 2H[GHSXWDGR-LOPDU7DWWRVHFUHWiULRGH7UDQVSRUWHVGH+DGGDGLQYROXQWDULDPHQWHSRGHGHL[DURSUHIHLWRHPVLWXDomRGHOLFDGDQR2UoDPHQWR GD(GXFDomR(OHDSUHVHQWRXHP%UDVtOLDSURMHWRTXHJDUDQWHPHUHQGD DRVSURIHVVRUHVGDUHGHPXQLFLSDOSHORSDtV

Parlamento verde 2VHWRUSURGXWLYRUXUDOHVWiIXULRVR5HFODPDTXHVyWHPGXDVFDGHLUDV HKiDPELHQWDOLVWDVGHVREUDQDVRXWUDVYDJDVGR&RQVHOKR1DFLRQDO GR0HLR$PELHQWH &RQDPD TXHHOHJHGLDPHPEURVSDUDRELrQLR 

Ponto C 2&RQDPDpGRVPDLVLPSRUWDQWHVQRJRYHUQReSRUHOHTXHSDVVDP OLFHQoDVSDUDPXLWDVPHJDREUDVGR3$&(jVYH]HVHOHWUDYDSDUD YDOHU

Concorrido 9HMDRSUHVWtJLRGR&RQVHOKR1DFLRQDOGH-XVWLoD7HUPLQRXQDVH[WDD LQVFULomRFRPUHJLVWURUHFRUGHSDUDFRQFXUVRFRPSUHHQFKLPHQWRGH YDJDV

Altos Poderes 2PLQLVWUR&DUORV$OEHUWR5HLVGH3DXODGR7ULEXQDO6XSHULRUGR 7UDEDOKRHLQWHJUDQWHGR&1-GHL[DRFDUJRGHFRQVHOKHLURHPPDUoR TXDQGRDVVXPLUiDSUHVLGrQFLDGR767³2&1-YHLRSDUDPXGDUD -XVWLoD´D¿UPD

Dobrada petista 20LQLVWpULRGD6D~GHGH$OH[DQGUH3DGLOKDLQYHVWLXQRV~OWLPRVWUrV DQRV5ELOKmRQR3URJUDPD1DFLRQDOGH5HHVWUXWXUDomRGRV +RVSLWDLV8QLYHUVLWiULRVGHVHQYROYLGRHPSDUFHULDFRPR0(&RXWUD SDVWDGR37

Batalha pantaneira $&RPLVVmRGD$PD]{QLDGD&kPDUDDSURYRXSURMHWRTXHHOHYDR3DQWDQDOjFRQGLomRGHSDWULP{QLRQDFLRQDO3DUD0DWR*URVVRR3DQWDQDO GHOipPDLVEHOR0DVRVVXOPDWRJURVVHQVHVGL]HPTXHVHX(VWDGR WHPDPDLRUiUHDGRELRPD

Dinheiro no bolso 2EUDVLOHLURWHPDSRVWDGRPDLVQDORWHULD/HYDQWDPHQWRGD&DL[D PRVWUDTXHVyFRPDV0HJDGD9LUDGDREDQFmRDUUHFDGRX5 PLOK}HVHP5PLOK}HVHPH5PLOK}HVQRDQR SDVVDGR

Ponto Final 'LSORPDXQLYHUVLWiULRYLURXXPJUDQGHQHJyFLR Com Marcos Seabra e Vinicius Tavares ZZZFROXQDHVSODQDGDFRPEU FRQWDWR#FROXQDHVSODQDGDFRPEU Twitter @leandromazzini

SANDRO LIMA

CADU EPIFÂNIO EDITOR DE POLÍTICA

E

m um mercado tão disputado como se apresenta, hoje é inconcebível buscar emprego sem WHUTXDOLÀFDomR(R secretário do Trabalho, Emprego, Renda e QuaOLÀFDomR$OEHUWR6H[tafeira, vê 2013 como RDQRGDTXDOLÀFDomR e claro, por tabela, das oportunidades de emSUHJRSDUDRDODJRDQR Veja como conseguir essa oportunidade tão desejada, seja autônoPRRXSURÀVVLRQDOIRUPDOL]DGR3DUD6H[WDIHLUD´FRPSUHSDUDomR RHPSUHJRYHPµ Tribuna Independente – O alagoano pode esperar mais emprego este ano que HVWiFRPHoDQGR" Alberto Sextafeira – É impossível termos emprego e UHQGDVHPTXDOLÀFDomRSURÀVVLRQDO 2 PHUFDGR UHTXHU KRMHTXHYRFrVDLDSDUDID]HU DOJR TXH VHMD XP SURÀVVLRQDOTXDOLÀFDGRSDUDDPLVVmR TXHHOHH[LJH3RUHVVHYLpVp que estamos enxergando o trabalho, por meio da quaOLÀFDomR SURÀVVLRQDO 1HVVH FDPLQKR HQWmR DPSOLDPRV D RIHUWD GH TXDOLÀFDomR 2 4XDOLÀFD$ODJRDVpXPSURJUDPDTXHIRFDQLVVRDFDGD DQRYLVDDDPSOLDomRGHVXDV vagas para aumentar a quaOLÀFDomRGRDODJRDQRGHXP PRGRJHUDO(PIRUDP PLO YDJDV GLVSRQLELOL]DGDV SDUD TXDOLÀFDomR HP  PLOTXDOLÀFDGRVHP queremos ir para 4 mil quaOLÀFDGRV(VVDpQRVVDPHWD &RQWDPRV FRP RV UHFXUVRV GR (VWDGR H FRP FRQYrQLRV TXHHVWDPRVFHOHEUDQGRFRP RJRYHUQRIHGHUDO T.I. – &RPR R 6LQH SRGH DEUDoDURDODJRDQRHDVVHJXrar que ele tenha mais oporWXQLGDGHGHHPSUHJR" Alberto Sextafeira ² 2 WUDEDOKDGRU H D VRFLHGDGH tem de entender que o Sine pRSRUWRVHJXURGHOH26LQH pXPGHQRVVRVUDGDUHVSHOD EXVFDGDTXDOLÀFDomR4XDQdo o trabalhador ver o Sine H TXLVHU WHU XPD TXDOLÀFDomR H SRU WDEHOD FRQVHJXLU um emprego, ele pode entrar porque lá vai se sentir em FDVD (OH IDUi XP FDGDVWUR H SRU PHLR GHVVH FDGDVWUR YHUHPRV VH R FLGDGmR SUHFLVDGHXPDTXDOLÀFDomRRXMi GLUHWDPHQWHXPHPSUHJR2 6LQHpREUDoRGR0LQLVWpULR GR 7UDEDOKR H GD VHFUHWDULD estadual no interior, por isso SUHFLVDPRV DPSOLDU ( HP  DPSOLDPRV 0DUHFKDO 'HRGRUR 0DUDJRJL &RUXULSH KRMH GLVS}HP GH 6LQH já estamos pleiteando para TXH QHVWH DQR GH  SRVsamos ter mais Sine no inteULRUFRPRQRVPXQLFtSLRVGH Teotônio Vilela, Rio Largo H RXWUR QR /LWRUDO 1RUWH VH SRVVtYHOHP0DWUL]GH&DPDUDJLEHRX3RUWR&DOYRVHQGR LQVWDODGRLQFOXVLYHjVPDUJHQVGD$/1RUWHSDUD IDFLOLWDU R DFHVVR 3HQVDPRV HP FUHVFHU HP WUrV RX TXDWUR DJrQFLDV SHOR LQWHULRU Como o Sine Centro, que IXQFLRQD QR DQWLJR (GLItFLR GR3UREXEDQ$OLQD5XDGR

Secretário Alberto SextafeiraFRORFRXFRPRPHWDSDUDHVWHDQRDTXDOL¿FDomRGHPLOSUR¿VVLRQDLV

(PIRUDPPLOYDJDVGLVSRQLELOL]DGDVSDUD TXDOLÀFDomRHP PLOTXDOLÀFDGRVHP queremos ir para 4 mil TXDOLÀFDGRVµ

3UHWHQGHPRVTXHWRGRV os Sines possam emitir FDUWHLUDGHWUDEDOKRSDUD TXHRFLGDGmRGRLQWHULRU QmRSUHFLVHVHGHVORFDUj 0DFHLySDUDREWrOD(P 0DUDJRJL$UDSLUDFDH &RUXULSHVHWLUDµ

(VWDPRVSOHLWHDQGRSDUD TXHQHVWHDQRGH possamos ter mais Sine no LQWHULRUFRPRQRVPXQLFtpios de Teotônio Vilela, Rio Largo, e outro no Litoral 1RUWHµ

&RPpUFLRRQGHRDFHVVRpIDFLOLWDGR'HOiYDPRVSDUDR (GLItFLR/REmR%DUUHWRQXP DQGDU LQWHLUR FRP PDLV HVSDoR SDUD PHOKRU VHUYLU R FLGDGmR2VUHFXUVRVMiHVWmR DORFDGRV (QWHQGHPRV TXH antes do Dia do Trabalhador >žGHPDLR@YDPRVHQWUHJDU HVVD DJrQFLD PRGHOR DR WUDEDOKDGRU T.I. – 26LQHSRGHDJUHJDU RXWURVVHUYLoRV" Alberto Sextafeira – 7HPRV SRXFDV DJrQFLDV GR 6LQH TXH HPLWHP D FDUWHLUD GH WUDEDOKR 3UHWHQGHPRV que todos os Sines possam HPLWLU R GRFXPHQWR H DVVLP SHUPLWLUTXHRFLGDGmRGRLQWHULRUQmRSUHFLVHVHGHVORFDU D 0DFHLy SDUD REWHU D FDUWHLUD (P 0DUDJRJL Mi WLUD $UDSLUDFDWDPEpP&RUXULSH WLUD7DPEpPRDWHQGLPHQWR do seguro desemprego está VHQGRRIHUWDGR4XHUHPRVID]HUGR6LQHHVVDSRUWDDPLJD RQGHHOHYDLHQFRQWUDUTXDOLÀFDomR HPLVVmR GD FDUWHLUD do trabalho, ela passa a disFXWLU R VHJXUR GHVHPSUHJR RULHQWDomR SURÀVVLRQDO SDUD VDEHUFRPRHVWiVHXFRPSRUWDPHQWR 6mR HVVHV RV DYDQoRV TXH SUHWHQGHPRV DOFDQoDUDWpRÀQDOGH T.I. – Como isso pode DFRQWHFHU" Alberto Sextafeira ² 2 0LQLVWpULR GR 7UDEDOKR HQtendeu a proposta do goverQRGR(VWDGRGHPHOKRUDURV 6LQHV FRPR PXLWR EHQpÀFD ( VHQGR DVVLP QyV DPSOLDPRV R FRQYrQLR FRP R 0L-

QLVWpULR SDUD 5  PLOKmR H DVVLP PHOKRUDU RV 6LQHV +iXPDVHJXUDQoDGHÀQDQFLDPHQWR SDUD TXH SRVVDmos aumentar o número de DJrQFLDV 3DUDOHOR D LVVR R &HQWUR GR 7UDEDOKDGRU $XW{QRPR >&7$@ ORFDOL]DGR QR EDLUUR GR -DUDJXi WDPEpP YDL SDVVDU SRU XPD UHIRUPD agora para melhor atender o segmento, para ele ter melhor ganho, para que ele WHQKDPDLVIDFLOLGDGHDRFUpGLWR 2 6LQH H R &7$ HVWmR sendo ampliados para meOKRU VHUYLU 9DPRV DPSOLDU o número de autônomos, por H[HPSOR HP LQFOXVmR GLJLWDOTXHUHPRVFKHJDUDPDLV GHDXW{QRPRVVHUi um ano muito positivo para DTXDOLÀFDomR T.I. – Com a demanda de novos empreendimentos cheJDQGR HP $ODJRDV R SHUÀO do trabalhador alagoano já PXGRX" Alberto Sextafeira – 1yV SUHFLVDPRV PHOKRUDU PXLWRLVVR(VWiQRÀQDQFLDPHQWR GR %DQFR 0XQGLDO D UHVSRVWDSDUDVXDSHUJXQWD &RP D FULDomR GR 2EVHUYDWyULR GR 7UDEDOKR XP FRQYrQLR GR JRYHUQR GR (VWDGR FRPD8QLYHUVLGDGH)HGHUDO GH$ODJRDVHOiSRUPHLRGR &XUVR GH (FRQRPLD YDPRV HQWHQGHUDSXOVDomRGRPHUFDGR22EVHUYDWyULRYDLSHUPLWLU LVVR FRP DQWHFLSDomR YDPRV FRQKHFHU D GHPDQGD GH WUDEDOKR R TXH R PHUFDdo vai exigir, em virtude da FKHJDGDGHHPSUHHQGLPHQWR

¶[·RX¶\·RXGDVSRWHQFLDOLGDGHVGHWDOUHJLmR4XDOTXDOLÀFDomR VHUi QHFHVViULD SDUD DTXHOH PRPHQWR HVSHFtÀFR 3RUpP HVWDPRV FRUUHQGR DWUiV SDUD LQVWDODU R 2EVHUYDWyULR FRP HVVH ÀQDQFLDPHQWR SUHFLVDPRV FRPHoDU Mi $ )XQGDomR GH $PSDUR j 3HVTXLVD GH $ODJRDV )DSHDO  Mi HVWi FRP EROVDV GH HVWXGRSDUDFRQWUDWDURVHFRQRPLVWDV TXH LQLFLHP HVVHV WUDEDOKRV (VSHUDPRV TXH HPIHYHUHLURR2EVHUYDWyULR MiHVWHMDIXQFLRQDQGR T.I. – Como o Observatório pode atuar de modo práWLFR" Alberto Sexta-feira – -XQWR DRV QLFKRV HPSUHVDULDLV4XDQGRR&RQVHOKRGH 'HVHQYROYLPHQWR(FRQ{PLFR HVWLYHUGLVFXWLQGRLQFHQWLYRV HFRQ{PLFRVSDUDTXHHPSUHVDV YHQKDP SDUD R (VWDGR QHVVH SURFHVVR RV GDGRV GR 2EVHUYDWyULR SRGHP ID]HU D GLIHUHQoD (P RXWUD YHUWHQWH QHVVHV QLFKRV HPSUHVDULDLV ORFDLV WDPEpP VmR EHQHÀFLDGRV FRP GHPDQGDV HVSHFtÀFDVHPTXHRTXDOLÀFDGRWHUPLQDQGRRFXUVRMi VH HPSUHJD 5DPR GH yWLFD PDUFHQDULD PyYHLV ODQWHUnagem automotiva, pintura DXWRPRWLYD HVWmR SUHFLVDQGRXUJHQWHPHQWHGHSHVVRDO (VWDPRV WUDEDOKDQGR MXQWR D )HGHUDomR GR &RPpUFLR SDUD TXH VHMD EHP GLUHFLRQDGR HVVHV FXUVRV e PXLWR HVSHFtÀFR 1HVVD YHUWHQWH R 2EVHUYDWyULR VHUi PDLV SXOVDQWH


TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013 ANDREZZA TAVARES

POLĂ?TICA

3

Governo Rui: expectativa da população ĂŠ boa Povo nas ruas acredita nas propostas do novo prefeito de MaceiĂł DIVULGAĂ‡ĂƒO

ANDREZZA TAVARES REPĂ“RTER

D

Professora Maria BernadeteQmRDSRVWDQRVXFHVVRGDJHVWmR5XL

EM BAIXA

Professora nĂŁo acredita em bom governo do PSDB Apesar da “moralâ€? do novo prefeito de MaceiĂł estar em alta, algumas pessoas estĂŁo com o ‘pÊ’ atrĂĄs com ele por causa do partido o TXDO5XL3DOPHLUDpĂ€OLDGR o PSDB (Partido da Social Democracia Brasileira). Embora queira que o novo prefeito faça um bom trabalho Ă frente da prefeitura, a professora Maria Bernadete Lima da Silva, que hĂĄ 26 anos integra o funcionalismo pĂşblico estadual, nĂŁo acredita que Rui Palmeira seja um bom gestor pĂşblico, principalmente para os servidores. “O partido dele nĂŁo valoriza o funcionalismo e independente da ĂĄrea, eu acredito que ele nĂŁo farĂĄ um bom governoâ€?, declarou a professora. “Acho que as pessoas nĂŁo devem esperar muito com a uniĂŁo dos governos municipal e estadualâ€?, enfatizou a professora. Maria Bernadete disse ainda que Rui pode atĂŠ fazer algumas obras, mas se seguir o padrĂŁo do partido, “pode ser que a situação permaneça como estĂĄ ou atĂŠ

pioreâ€?, reforçou. A professora revelou que nĂŁo votou no candidato tucano para prefeito e que nĂŁo se arrependeu de sua decisĂŁo. Ela votou em Jurandir BĂłia (PDT), substituto de Ronaldo Lesa (PDT) na disputa pela Prefeitura de MaceiĂł. “JĂĄ conheço o trabalho do Lessa e as circunstâncias vivenciadas durante as gestĂľes do PSDB nĂŁo me fazem acreditar em Ruiâ€?, explicou. Maria Bernadete diz que quer melhorias, mas nĂŁo aposta muito. “Pode ser que daqui hĂĄ um ou dois anos eu mude de opiniĂŁo, mas por enquanto, nĂŁo estou conĂ€DQWHQRJRYHUQRGR36'%Âľ pontuou. RELAĂ‡ĂƒO Pode ser que Rui Palmeira esteja pagando pela mĂĄgoa que os servidores S~EOLFRV HVWDGXDLV WrP GR governado Teotonio Vilela Filho (PSDB). Para vĂĄrios servidores pĂşblicos do Estado, Vilela nĂŁo ĂŠ um bom governador. “Ele ĂŠ pĂŠssimo! E olhe que eu idolatrava o TĂŠoâ€?, exclamou a servidora Ivonete Paulino. (A.T.)

a mesma forma que os bĂşzios disseram na edição do Ăşltimo domingo dia 30, da Tribuna: 2013 serĂĄ o ano da mudança! E com a chegada do ano-novo, a população de MaceiĂł renovou as esperanças em relação a administração da cidade, com a posse do prefeito Rui Palmeira (PSDB). A Tribuna Independente foi Ă s ruas da capital para saber qual a expectativa da população em relação ao novo prefeito. A maioria dos entrevistados acredita que Rui farĂĄ um bom governo. “Devemos dar XP FUpGLWR GH FRQĂ€DQoD DR novo prefeito, pois eu acredito em seu governoâ€?, enfatizou o funcionĂĄrio pĂşblico Altamir Bernardes Rosa, lembrando que Rui ĂŠ um homem jovem e disposto. Outra servidora pĂşblica que acredita no governo tucano de Rui ĂŠ Ivonete Paulino GH 2OLYHLUD ´(VWRX FRQĂ€DQWH nele, acho que ele vai cumprir as promessas de campanhaâ€?, declarou Ivonete, que foi umas das eleitoras do prefeito. “Meu coração estĂĄ me dizendo que ele vai fazer um bom governo, TĂ´ colocando fĂŠ neleâ€?, reforçou. A expectativa do guarda

População ouvida SHODUHSRUWDJHPHVWiFRQ¿DQWHQDJHVWmRGH5XL3DOPHLUDHP0DFHLy

municipal Josias Oliveira, em relação a administração que se inicia tambĂŠm ĂŠ boa. Ele espera que Rui continue pagando o funcionalismo em dia e realizando obras que a comunidade precisa. “Ele [Rui Palmeira] tambĂŠm precisa priorizar a SaĂşde e a

Passagem pelo Legislativo dĂĄ credibilidade O povo aguarda uma gesWmR EHQpĂ€FD GH XP PRGR geral, da gestĂŁo tucana na capital alagoana. Na opiniĂŁo da psicĂłloga Ana Paula da Silva Vieira o histĂłrico do novo prefeito contribui. Para a psicĂłloga, a trajetĂłria de Rui Plameira no Legislativo ĂŠ positiva e o fato de ser a primeira vez dele no ([HFXWLYR WUD] FRQĂ€DQoD D ela pela promessa de renovação. “Espero realmente que ele faça isso, porque acreditamos nas palavras dele.

AtĂŠ agora, no Legislativo, Rui Palmeira tem cumprido. Vamos aguardar como serĂĄ no Executivo Municipalâ€?, pontuou Ana Paula. “Ele fez um bom trabalho na Assembleia Legislativa, tanto ĂŠ que passou para a Câmara Federalâ€?, lembrou. Sua visĂŁo polĂ­tica em relação ao exercĂ­cio do mandato do novo prefeito ĂŠ boa, em relação a pessoa do Rui, e nĂŁo ao partido ao qual ele p Ă€OLDGR ´0LQKD H[SHFWDWLva ĂŠ que ele atue principalmente no social, que ĂŠ tĂŁo

1° DIA DE TRABALHO

Ao contrĂĄrio do que pensa a professora Maria Bernadete Lima da Silva, a servidora pĂşblica acredita que o novo prefeito de MaceiĂł realizarĂĄ um bom governo, mas o partido de Rui Palmeira (PSDB) ĂŠ uma barreira. “Eu votei QHOH>5XL3DOPHLUD@HFRQĂ€R na pessoa dele, porĂŠm acho que seu partido vai decepcionar todo mundoâ€?, opinou a administradora LĂşcia de FĂĄtima Freire TenĂłrio Lima. A administradora, que tambĂŠm ĂŠ funcionĂĄria pĂşblica, ressaltou que Ă s vezes o gestor quer fazer alguma coisa pela população, mas o partido interfere nas decisĂľes e em sua administração. Mas LĂşcia de FĂĄtima acredita que Rui Palmeira vai lutar para cumprir as promessas de campanha. “Como deputado federal ele lutou e conseguiu muita coisa, foi atĂŠ eleito um dos melhores do paĂ­sâ€?, lembrou. “Acho que ele precisa priorizar a SaĂşde e a Educaçãoâ€?, completou. Para ela, o fato de o prefeito ser jovem e ter boas ideias dĂĄ a credibilidade que ele merece, e com isso, so-

Durante sua campanha para a prefeitura, Rui Palmeira prometeu, alÊm de outras coisas, dar uma atenção maior à Saúde e a Educação da capital. Construir o Hospital de Maceió, no bairro do Tabuleiro do Martins, e fazer novos postos de saúde, alÊm de recuperar e equipar os antigos foram praticamente o carro-chefe da campanha do atual prefeito. Em seu primeiro dia de trabalho, após a posse, ele fez uma visita ao PAM SalJDGLQKR SDUD YHULÀFDU DV instalaçþes do local. Acompanhado dos secretårios da Saúde, João Marcelo Lyra; da Infraestrutura, Roberto Fernandes; e da Comunicação, Clayton Santos, o novo prefeito constatou vårias GHÀFLrQFLDV QR DWHQGLPHQWR do posto mÊdico, como problemas no fornecimento de luz elÊtrica, e equipamentos GDQLÀFDGRVSHODVFRQVWDQWHV quedas de energia. Ao constatar in loco, os problemas do Posto de Atendimento MÊdico (PAM) Salgadinho, o prefeito anunciou que uma equipe de especialistas da Secretaria de Infraestrutura farå um estudo para tentar solucionar os problemas e realizar

bressair o problema que ĂŠ o PSDB - para ela. A administradora revelou que votou no tucano porque apostou na mudança, mesmo nĂŁo acreditando muito nas gestĂľes do partido. “Votei no Rui mesmo sabendo que o partido dele ĂŠ o mesmo do TĂŠo, um pĂŠssimo governador que deixa muito a desejarâ€?, criticou. PESQUISA Em recente entrevista Ă Tribuna Independente, o vice-governador JosĂŠ TomĂĄz NonĂ´ (Democratas), contou que segundo pesquisa da Vox Poppolli, Alagoas tem o pior Ă­ndice do mundo, em relação a votos partidĂĄrios. “Apenas 2% dos eleitores votam no partidoâ€?, informou. DESABAFO “NĂŁo acredito em prefeito nenhum, sĂŁo todos farinha do mesmo sacoâ€?, desabafou a ambulante Maria JosĂŠ do Nascimento, totalmente desacreditada na gestĂŁo do novo prefeito. “SĂł espero disso a piorâ€?, enfatizou. $ FDPHO{ DĂ€UPRX TXH votou em Rui sĂł por votar. “Ele estĂĄ bom de melhorar a SaĂşde que estĂĄ pĂŠssimaâ€?, disparou Maria JosĂŠ. (A.T.)

que a maioria tem formação superior. O novo gestor assumiu a prefeitura hĂĄ apenas cinco dias, por isso algumas pessoas nĂŁo quiseram expor suas opiniĂľes e disseram que preferiam aguardar. “Ainda ĂŠ cedoâ€?, concluĂ­ram.

HISTĂ“RICO

EXPECTATIVA

Partido tem pesado no conceito popular do prefeito

Educação. Josias sai em defesa de sua categoria. “O prefeito poderia fazer uma academia na orla lagunar para treinar o pessoalâ€?, enfatizou o servidor municipal, informando que os guardas municipais deveriam ser melhor aproveitados, jĂĄ

importanmte e foi esquecido pelo CĂ­cero Almeida [PSD]â€?, GHFODURXDSVLFyORJDMXVWLĂ€cando que cada prefeito tem seu foco. “A visĂŁo polĂ­tica do Rui ĂŠ positiva, ele ĂŠ ĂŠtico e correto em suas açþes. Eu estou FRQĂ€DQWH HP VHX JRYHUQRÂľ reforçou a psicĂłloga. Para Ana Paula, ninguĂŠm consegue fazer um planejamento e cumprir 100%, mas se tiver boa vontade polĂ­tica e apoio do Legislativo, realizarĂĄ a maioria das promessas de campanha, den-

tre outas açþes em prol da população. â€œĂ€s vezes a gente nĂŁo cumpre todo o planejado para o dia que ĂŠ tĂŁo mais fĂĄcil e sĂł depende da gente, imagine fazer 100%, quando se depende dos outrosâ€?, jusWLĂ€FRX Assim, como a maioria dos entrevistados pela reportagem, Ana Paula da Silva Vieira tambĂŠm votou no prefeito. Rui Palmeira, no comando da capital hĂĄ cinco dias, terĂĄ que trabalhar muito para atender as expectativas. (A.T.)

Prefeito reforça compromisso com a saúde YVETE MOURA/SECOM-MACEIÓ

Visita ao PAM Salgadinho,QRSULPHLURGLDGHVHUYLoRMiGHXRUHFDGRGHFRPRVHUiDDGPLQLVWUDomR

os reparos necessĂĄrios, sem com isso, prejudicar o atendimento Ă população. “A gestĂŁo voltada para saĂşde ĂŠ um dos nossos comSURPLVVRVĂ€UPDGRV23$0 pXPDUHIHUrQFLDHWHPXPD Ăłtima estrutura, mas pre-

cisa de mais investimentos para que no futuro possamos atĂŠ desafogar o atendimento do Hospital Geral do Estado [HGE]â€?, declarou Rui Palmeira. EDUCAĂ‡ĂƒO Escola em tempo integral

e professores valorizados tambĂŠm foram um compromisso de campanha de Rui, DOpPGHĂ€VFDOL]DUDPHUHQGD dos alunos. “Eu quero ver ele aqui cozinhando com a genteâ€?, exclamou a merendeira SĂ´nia Maria da Silva. (A.T.)


4

TRIBUNAINDEPENDENTE

POLĂ?TICA MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013

BARTOLOMEU DRESCH bartolomeu_dresch@hotmail.com.br

O impasse do FPE

O

Supremo Tribunal Federal (STF) decidiu pela extinção do Fundo de Participação dos Estados (FPE) com o atual modelo. Mas o governo vai manter a atual distribuição de verbas aos 27 estados, mesmo contrariando a decisão da Justiça. São quase R$ 50 bilhþes que serão destinados aos estados em 2013. Em fevereiro de 2010, o Supremo Tribunal Federal declarou que o atual modelo de repasse do FPE era inconstitucional e deu o prazo para que o Congresso criasse um novo formato atÊ o dia 31 de dezembro de 2012. Caso contrårio o Fundo seria extinto. O Supremo entendeu, naquela oportunidade, que os critÊrios de repasse não haviam sido regulamentados desde a aprovação do Fundo em 1989 (mesmo tendo sido criado em 1966), e determinou que o modelo fosse refeito. O governo, que acompanha o impasse, garante que não pode deixar os estados, principalmente os mais dependentes, sem o repasse do FPE e por isso manterå RDQWLJRFULWpULR2PLQLVWUR0DUFR$XUpOLR0HORGR6XSUHPRD¿UPRX que, diante do fato consumado, a saída mais razoåvel para o impasse em torno do FPE, Ê que o rateio dos recursos seja feito pelo critÊrio antigo, atÊ que uma nova lei seja criada pelo Congresso Nacional. Uma das ideias sugeridas para o estabelecimento de novos critÊrios era que o FPE, formado por recursos vindos do Imposto de Renda e pelo IPI, deveria ser de 85% para os estados das regiþes Centro-Oeste, Norte H1RUGHVWH¿FDQGRR6XOHR6XGHVWHFRP(VWHVLPPRWLYRPDLV TXHVX¿FLHQWHSDUDRLPSDVVH

Alcoolismo russo O presidente russo, Vladimir Putin, de uma só canetada restringiu a venda de cerveja na Rússia, aumentou o preço mínimo da vodca (bebida mais consumida do país) e baniu a publicidade das bebidas alcoólicas, inclusive na internet. O alcoolismo Ê considerado um dos problemas mais sÊrios do país, que tem uma das mais altas taxas de consumo de ålcool do planeta. As novas leis que começaram a vigorar na terça feira (1º) tambÊm restringem a quantidade de cerveja que pode ser vendida por lojas e restaurantes e proíbe seu comÊrcio entre as 23h e as 8h. A cerveja tambÊm não poderå ser mais comercializada nos quiosques, que são locais populares de vendas de bebidas em Moscou.

Mais irrigação A Agricultura familiar irrigada de Alagoas vai ganhar R$ 135 milhþes do Programa Mais Irrigação, do governo federal. Os recursos serão investidos em empregos, desenvolvimento e produção de alimentos nos 11,6 mil hectares atendidos pela Codevasf no Estado, em Delmiro Gouveia, Pariconha, Inhapi e nos projetos de Boacica e Itiúba na região sul do Estado. Em uma årea de 3,1 mil hectares ao longo do Canal do Sertão, serão implantados dois projetos de irrigação para agricultura familiar, que estão em fase de licitação e receberão R$ 89 milhþes. Jå os projetos de Boacica, em Igreja Nova e Itiúba em Porto Real do ColÊgio receberão R$ 49 milhþes.

Abate de animais Acredite se quiser. O abate de elefantes e rinocerontes bateu o recorde HPGHDFRUGRFRPOHYDQWDPHQWRGRJUXSRGHFRQVHUYDomR7UDIÂżF que monitora o comĂŠrcio mundial de animais e plantas. O abate ĂŠ GHFRUUHQWHGRFUHVFLPHQWRGRFRPpUFLRGHFKLIUHHPDUÂżPQRVSDtVHV asiĂĄticos. Somente na Ă frica do Sul, que abriga o maior nĂşmero de rinocerontes da Ă frica, foram mortos atĂŠ o inĂ­cio de dezembro 633 animais, FRQWUDHP-iRFRPpUFLRLOHJDOGHPDUÂżPMiKDYLDFKHJDGR a 28 toneladas em 2012, mas os nĂşmeros ainda sĂŁo incompletos. Isso VLJQLÂżFDPLOKDUHVGHHOHIDQWHVDVVDVVLQDGRV

Abate de animais 2 $GHPDQGDSRUPDUÂżPFRPRLWHPRUQDPHQWDOHVWiFUHVFHQGRQDĂˆVLD assim como a procura pelo chifre de rinoceronte, usado hĂĄ sĂŠculos pela medicina chinesa, onde ĂŠ moĂ­do em pĂł para tratar uma sĂŠrie de doenças como reumatismo, gota e atĂŠ possessĂŁo por demĂ´nios. Em DOJXQVSDtVHVDIULFDQRVRVWUDÂżFDQWHVDWXDPHPFRQMXQWRFRPRFULPH organizado e com grupos guerrilheiros como ĂŠ o caso do ExĂŠrcito de ResistĂŞncia do Senhor (LRA) em Uganda, que ĂŠ liderado por Joseph Kony, conhecido como “Senhor da Guerraâ€? e que ĂŠ caçado por uma força militar especial pela UniĂŁo Africana e pelos Estados Unidos.

Venda de veículos A indústria automotiva brasileira bateu novo recorde na venda de veículos em 2012. Foram emplacados 3.802 milhþes de veículos no ano passado, que representou um aumento de 4,7% em relação a 2011 (quando foram emplacados 3.633 milhþes de unidades), de acordo com a Federação Nacional da Distribuição de Veículos Automotores, a Fenabrave. Se desta conta forem excluídos ônibus e caminhþes, as vendas de automóveis e comerciais leves as vendas alcançam 3.634 milhþes de unidades, com um aumento de 6,1%. O setor atribui a excelência das vendas à redução do Imposto sobre Produtos Industrializados (IPI), que agora começa a ser cobrado novamente de forma escalonada.

Hospital da Mulher O prefeito de Recife, Geraldo JĂşlio, jĂĄ anunciou a construção, em parceria com o Governo do Estado, do Hospital da Mulher em Recife. A unidade serĂĄ construĂ­da em um terreno de 30 mil m2, no bairro de JiquiĂĄ em frente Ă Ceasa, e terĂĄ 13 mil m2 de ĂĄrea construĂ­da. O Hospital da Mulher serĂĄ equipado com 110 leitos, Unidade de Terapia Intensiva, cenWURFLU~UJLFRPDPRJUDÂżDEDQFRGHOHLWHVHWRUGHGLDJQyVWLFRVHRXWURV exames. O terreno pertence Ă  UniĂŁo, mas estĂĄ cedido ao Departamento Nacional de Infraestrutura de Transportes (Dnit), que agora vai ceder o imĂłvel para a Prefeitura do Recife. ‡$&DL[D(FRQ{PLFD)HGHUDOGHÂżQLXVHXRUoDPHQWRSDUDR)XQGRGH *DUDQWLDSRU7HPSRGH6HUYLoR )*76 SDUDÂż[DGRHP5 bilhĂľes. Em 2012 o orçamento do Fundo foi de R$ 47,6 bilhĂľes. ‡'HVWHPRQWDQWH5ELOK}HVVHUmRGHVWLQDGRVjFRQFHVVmRGH ÂżQDQFLDPHQWRVDSHVVRDVItVLFDVRXMXUtGLFDVEHQHÂżFLDQGRIDPtOLDVFRP UHQGDGHDWp5QRkPELWRGR3URJUDPD1DFLRQDOGH+DELWDomR 8UEDQD 31+8 GHQWURGRÂł0LQKD&DVD0LQKD9LGD´ ‡2XWURV5ELOK}HVGHYHUmRVHUDSOLFDGRVQDSURGXomRRXDTXLVLomR de imĂłveis novos, tambĂŠm enquadrados no mesmo programa, alĂŠm de 5PLOK}HVSDUDÂżQDQFLDPHQWRVGHLPyYHLVHPiUHDVUXUDLVGHQWUR do Programa Nacional de Habitação Rural (PNHR). ‡$LQGDGHDFRUGRFRPRRUoDPHQWRGD&()5ELOKmRVHUiDSOLFDGR HPÂżQDQFLDPHQWRVTXHQmRVHHQTXDGUHPQRVSURJUDPDVHVSHFLÂżFDGRV2XWURV5ELOK}HVVHGHVWLQDUmRDRSHUDo}HVGHFUpGLWRYLQFXODGDVDiUHDGHLQIUDHVWUXWXUDXUEDQDGLUHWDPHQWHDVVRFLDGRVDR3$& ‡3DUDH[HFXomRGHDo}HVQmRLQVHULGDVQRSURJUDPDGH$FHOHUDomRGR Crescimento 2, os recursos somam atĂŠ R$ 1 bilhĂŁo, alocados em nĂ­vel nacional.

Vereadores com vontade de mudança em 2013 ZÊ Mårcio, Heloísa Helena e Wilson Júnior com a missão de dinamizar a Câmara CORTESIAS

EDITORIA DE POLĂ?TICA COM ASSESORIA

A

pĂłs um processo eleitoral onde atĂŠ o dia da diplomação dos vencedores na urnas deste ano, ainda era decidido quantos vereadores iriam ocupar a Câmara Municipal de MaceiĂł, a sensação que se sentia durante a posse dos novos parlamentares da capital era uma sĂł: responsabilidade e mudança. O desgaste e o descrĂŠdito social, com um possĂ­vel aumento forçoso de vagas, a nova composição da Casa de MĂĄrio GuimarĂŁes ganhou uma nova atribuição. $OpPGHOHJLVODUHĂ€VFDOL]DU essa nova legislatura tem que limpar a imagem do Legislativo local. Pelo menos, eles anunciaram que estĂŁo dispostos a isso. Considerada por muitos como uma Câmara pluralista, a Casa de MĂĄrio ZĂŠ MĂĄrcio, Wilson JĂşnior e HeloĂ­sa HelenaFODPDPSRUPXGDQoDVQR/HJLVODWLYRGDFDSLWDO GuimarĂŁes receberĂĄ tanto vereadores reeleitos, como ZĂŠ Marcio (PSD) e HeloĂ­sa Helena (PSOL), como tambĂŠm novatos a exemplo de CONTRIBUIÇÕES Wilson JĂşnior (PDT), que vem reforçar a ideia da vonWDGH SRSXODU GH GLYHUVLĂ€FDU os membros que formam o corpo legislativo. Segundo ZĂŠ MĂĄrcio, a maneira de pensar de cada novo membro amplia a viO Complexo Regulador intervir diretamente nos re- quistar, ele conquistou ainda AssistĂŞncia de MaceiĂł sultados das açþes pĂşblicas da quando era apresentador sĂŁo de como ajudar MaceiĂł D FUHVFHU ´7HPRV SURĂ€VVLR(Cora), tambĂŠm foi lembra- que serĂŁo implementadas de TV. “NĂŁo vi no mandato um futuro para mim, pois eu nais de vĂĄrias ĂĄreas que irĂŁo do pelo vereador ZĂŠ MĂĄrcio. nos prĂłximos anos. atuar em prol da população Implementado em março de “Existem programas fe- jĂĄ estou satisfeito com a vida 2012 para organizar a mar- derais que podem ser apli- que tenho, eu vi a oportuni- PDFHLRHQVH Ă€VFDOL]DQGR H cobrando açþes por parte cação de consultas, exames e cados em MaceiĂł, mas para GDGH GH FREUDU H Ă€VFDOL]DU procedimentos cirĂşrgicos na o seu bom funcionamento o melhorias para MaceiĂł, aju- dos ĂłrgĂŁos pĂşblicosâ€?, disse o vereador. capital, atualmente ele fun- servidor precisa ser valori- dando assim, os menos favo“Temos muito que muzado, estar satisfeito com recidosâ€?, explicou ele. ciona de maneira precĂĄria. Segundo Wilson, a expe- dar nos prĂłximos anos e nĂŁo “Esse sistema facilita a seus direitos e ter seus beresta dĂşvida que a uniĂŁo do vida do usuĂĄrio e serve para nefĂ­cios garantidosâ€?, opinou. riĂŞncia como apresentador o grupo farĂĄ a diferença que -i:LOVRQ-XQLRUQHyĂ€WR ajudou a tomar vĂĄrias decicoletar dados de pesquisa serĂĄ vista com os resultapara o governo federalâ€?, con- na polĂ­tica e eleito vereador sĂľes, inclusive a de nĂŁo dedos positivos que eu acredito tou. para esta nova legislatura, sistir do pleito, mesmo com que começarĂŁo a surgir ainAinda de acordo com ZĂŠ explicou que nĂŁo tinha pai- tantos problemas no decorda em 2013â€?, acrescentou ZĂŠ Marcio, a valorização do xĂŁo por polĂ­tica e que tudo rer das eleiçþes. MĂĄrcio. funcionĂĄrio pĂşblico pode que sempre sonhou em conAo ser questionado sobre o ponto de partida para iniciar os trabalhos, o vereador do PSD logo comentou soCOMPROMISSO bre as condiçþes dos postos de saĂşde, especialmente os localizados nos bairros do Ouro Preto, Prado e Vergel do Lago. “Algo precisa ser feito com urgĂŞncia nestes locais, pois nĂŁo hĂĄ condiçþes de Sempre presente na ro- certamente nĂŁo terĂ­amos medidas para punir aqueles tina da Casa de MĂĄrio Gui- problemas dessa ordemâ€?, de- que nĂŁo estavam cumprindo cuidar de quem chega pedindo ajudaâ€?, disse ZĂŠ MĂĄrcio, marĂŁes, a vereadora mais clarou HeloĂ­sa. “Precisamos com suas obrigaçþes. dando eco as recorrentes rePROMESSA votada nas Ăşltimas eleiçþes, de companheiros de plenĂĄclamaçþes sociais a respeito Para tranquilizar a vereHeloĂ­sa Helena, comentou rio comprometidos com a da condição que se encontra que, infelizmente, a ausĂŞn- população mais humilde, adora psolista HeloĂ­sa Helea SaĂşde PĂşblica em MaceiĂł. cia da maioria dos vereado- nĂŁo adianta termos muitos na, o novato Wilson JĂşnior Pelo visto nĂŁo ĂŠ sĂł o preres, que cumpriram manda- vereadores se nenhum deles jĂĄ avisa que nĂŁo quer ser feito Rui Palmeira (PSDB) WRDWpRĂ€PGHLPSHGLX pensa em ajudarâ€?, argumen- como os outros. que estĂĄ inbuĂ­do em mudar “NĂŁo sei como serĂĄ essa a situação na capital. a Casa de apreciar matĂŠrias tou. O atĂŠ entĂŁo presiden- experiĂŞncia, mas estou certo importantes, incluindo vetos “Salas sem o mĂ­nimo de do Executivo Ă Lei de Dire- te da Câmara Municipal de uma coisa: nĂŁo quero ser ventilação, falta de meditrizes OrçamentĂĄrias (LDO) de MaceiĂł, Galba Novaes igual aos outros vereadores camentos na farmĂĄcia, sere a Lei OrçamentĂĄria Anual (PRB), cobrou a presença que nĂŁo pensavam na im- vidores desmotivados, tudo dos vereadores faltosos du- portância de seu cargo, eu isso prejudica o atendimento (LOA), ambas de 2013. “Se todos os 21 vereado- rante o Ăşltimo dia de sessĂŁo quero e vou fazer diferenteâ€?, da população mais carenteâ€?, res cumprissem com o horĂĄ- em nota enviada Ă  impren- prometeu Wilson JĂşnior. explicou o experiente vereario e estivessem presentes, sa, dizendo que estudaria (EP) dor.

ZĂŠ MĂĄrcio fala em valorizar servidor; Wilson fala de experiĂŞncia

Precisamos de vereadores comprometidos com a população

NOVOS DIAS

ABOMINA

O vereador ZĂŠ MĂĄrcio anunciou que vai focar seu mandato nĂŁo apenas na ĂĄrea da SaĂşde, mas tambĂŠm vai olhar outras vertentes. “NĂŁo sĂł na ĂĄrea da saĂşde, mas focarei tambĂŠm na questĂŁo da evasĂŁo escolar, dos salĂĄrios dos professores e tudo que estĂĄ ligado diretamente Ă educação municipalâ€?, concluiu ZĂŠ MĂĄrcio. Quem compartilha desse pensamento plural ĂŠ o novo presidente da Casa, Chico Holanda Filho (PMDB), que jĂĄ prometeu fazer uma gestĂŁo transparente e de diĂĄlogo.

Wilson JĂşnior, como um dos novos vereadores de MaceiĂł, ainda estĂĄ se adaptando Ă realidade polĂ­tica encontrada em Alagoas. Ele jĂĄ falou que sua experiĂŞncia na comunicação vai ajudar e muito em sua passagem pela Casa de MĂĄrio GuimarĂŁes, porĂŠm, os hĂĄbitos de outros polĂ­ticos o perseguem. “As pessoas me perguntavam as coisas mais absurdas, como, por exemplo, quanto eu tinha para gastar com a compra de votos, o que eu abominoâ€?, declarou Wilson.

Chico Holanda Filho vai pregar diĂĄlogo

HĂĄbitos de outros perseguem novato


TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013 POLĂ?TICA

5

Novos deputados constrangem Casa Presidente da Câmara dos Deputados, Marco Maia falou que posse de Genoíno incomodou parlamento federal

Cotidiano

DIVULGAĂ‡ĂƒO

EDITORIA COM AGĂŠNCIAS

A

LININHO NOVAIS - contato@lininho.com

Tem dono, sim!

S

er a capital brasileira dos rĂŠveillons, fez de MaceiĂł destaque nacional nos Ăşltimos meses. “Longe da onda de violĂŞnciaâ€?. Entretanto o que acontece em nossa orla marĂ­tima ĂŠ algo vergonhoso, quando empresĂĄrios que tĂŞm seus empreendimentos comerciais privatizam todo o espaço, cobrando valores exorbitantes, e causando transtorno a quem gostaria de curtir o dia de sol. O poder pĂşblico silencia e deixa claro que o mais importante ĂŠ gerar emprego, renda e oportunidades. Se jĂĄ nĂŁo bastasse a privatização da areia da praia, os mesmos empresĂĄrios – abençoados – ainda invadem a avenida causando um verdadeiro caos no trânsito com eventos e exposiçþes. PorĂŠm se o mais importante ĂŠ ver MaceiĂł se destacando, entĂŁo que a população local tenha paciĂŞncia atĂŠ o verĂŁo acabar. “Quem nĂŁo tem colĂ­rio usa Ăłculos escuroâ€?, jĂĄ dizia Raul Seixas.

Perguntar não ofende Serå que o prefeito Rui Palmeira vai cumprir a lei que proíbe o trafego GHFDPLQK}HVSHOD$YHQLGD)HUQDQGHV/LPD"6HDVVLPR¿]HULUi¹ quem sabe – diminuir um pouco a situação infernal que vive o cidadão que precisa trafegar pela avenida, principalmente nos horårios de pico.

Mesmo lugar Na solenidade de posse do desembargador Malta Marques para a presidĂŞncia do TJ/AL, estavam presentes ao evento, o desembargador aposentado Orlando Manso, e o ex-comandante da PolĂ­cia Militar de Alagoas, Luciano Silva. Manso jĂĄ proferiu diversas crĂ­ticas a Luciano Ă ĂŠpoca em que mandou prendĂŞ-lo.

Comedido O governador Teotonio Vilela Filho (PSDB) aguardava ser chamado para compor a lista dos convidados para sentar no pleno do Tribunal de Justiça de Alagoas, na posse de Malta Marques. Quando foi anunciado, passou pelo senador Renan Calheiros (PMDB), o cumprimentou e foi para seu lugar. Renan e Vilela dizem reconhecer a importância um do outro para Alagoas.

Trabalho O secretariado do prefeito Rui Palmeira (PSDB) deve ter muito trabalho. Após a posse, todos estão se debruçando em conseguir informaçþes que não foram repassadas pela equipe de transição do ex-prefeito da capital Cícero Almeida (PSD).

Uma dĂŠcada O prĂŠdio da SĂŠtima Coordenadoria de Ensino em UniĂŁo dos Palmares necessita passar por uma reforma, que jĂĄ foi prometida hĂĄ mais de dez anos.

Abdicou? O novo secretårio de Educação de São JosÊ da Laje, professor Ricardo Jorge, abdicou de seu gordo salårio no sistema federal de ensino para receber apenas três mil reais, porÊm o novo cargo chancelarå seu currículo.

Na frente O advogado HorĂĄcio Aguiar estava reunido com outros companheiros e os convenceu de que o nome que melhor representarĂĄ a classe no 7ULEXQDO5HJLRQDOGR7UDEDOKRpRGH0DUFHOR9LHLUD(MXVWLÂżFRXWRGDD experiĂŞncia e humildade de quem um dia jĂĄ fez parte do TRT.

Festividade 2DGYRJDGR7KLDJR%RP¿PHVWDUiDPDQKm  WRPDQGRSRVVHFRPR QRYRSUHVLGHQWHGD2$%6HUiDSDUWHIHVWLYDSRLV%RP¿PMiUHFHEHX as chaves da instituição no dia 1º. O evento acontecerá no Centro de Convenções de Maceió.

Em mãos 2SUySULR7KLDJR%RP¿PHVWiID]HQGRTXHVWmRGHHQWUHJDUSHVVRDOmente alguns convites para a festa. E onde chega tem recebido elogios e fortes abraços com desejos de boa sorte.

Emocionante Quem esteve presente na posse do desembargador JosĂŠ Carlos Malta, como presidente do Tribunal de Justiça do Estado de Alagoas, viveu momentos de pura emoção. A entrada de Malta no plenĂĄrio foi conduzida ao som da mĂşsica ‘Santana de meus amores’, entoada pelo coral de Santana do Ipanema.

Independente Do ex-procurador-geral de Justiça, Eduardo Tavares, no seu discurso de despedida do comendo do MP: “O MinistĂŠrio PĂşblico precisa fazer cumprir sempre o papel em defesa da sociedade, e nĂŁo advogar em defesa GDSDUWHLQWHUHVVDGD´8PDDOÂżQHWDGDVREUHRSURFHVVRGDPiÂżDGROL[R o qual denunciou o ex-prefeito Cicero Almeida.

CONDENADOS

Partido nĂŁo vai H[SXOVDUĂ€OLDGRV

A chegada de JosÊ Genoino à Câmara Federal, de fato, causou muita polêmica. Entretanto, mesmo com a condenação do agora deputado federal no Supremo Tribunal Federal, o Partido dos Trabalhadores nega que irå expulsar os seus ¿OLDGRVeSUHFLVRVHJXQGRR 37HVSHUDUR¿PGRSURFHVVR do STF atÊ seu trânsito em julgado, aquele momento em que não cabem mais recursos. AlÊm disso, depois desse prazo, a Câmara determina ainda um processo interno sobre o caso.

Chico TenĂłrio estĂĄ na lista dos parlamentares com processos

renúncia dos parlamentares que se elegeram prefeitos, em 2012, traz de volta à Câmara Federal, em Brasília-DF, pelo menos cinco políticos que estiveram envolvidos em denúncias recentemente. AlÊm de JosÊ Genoino (PTSP), condenado no processo do mensalão pelos ministros do Supremo Tribunal Federal (STF), outros quatro personagens retornam à Casa, pela qual jå passaram como titulares ou suplentes, respondendo a acusaçþes. Um deles Ê acusado de dois homicídios e de participar de um esquema que desviou mais de R$ 300 milhþes dos cofres públicos em Alagoas - a conhecida operação Taturana, de 2007; dois são acusados de explorar trabalho escravo. Outro teve seu nome envolvido em denúncias que derrubaram o então ministro do Trabalho, Carlos Lupi (PDT), em dezembro de 2011. O delegado Francisco Tenório (PMN-AL) chegou a tomar posse em 2012 como delegado-adjunto da Delegacia de Acidentes de Trân-

sito de Maceió utilizando uma tornozeleira eletrônica. O uso do apetrecho foi exigido pela Justiça após Tenório ser rÊu em dois processos nos quais Ê acusado de homicídio. O aparelho foi retirado oito meses depois. Jå os novos deputados Camilo Cola (PMDB-ES) e Urzeni Rocha (PSDB-RR) respondem pela pråtica de trabalho anålogo ao escravo. Na lista divulgada na semana passada pelo MTE (MinistÊrio do Trabalho e Emprego) consta o complexo Agroindustrial Pindobas, de propriedade do peemedebista. Weverton Rocha (PDT-MA) assume o mandato na Câmara cerca de um ano após ser suspeito de integrar um esquema de cobrança de propina de ONGs no MTE. Rocha tambÊm Ê acusado pelo MinistÊrio Público do Maranhão de irregularidades na execução do programa ProJovem Urbano, projeto do governo federal que promove a reinserção de jovens na escola e no mercado. Rocha não foi encontrado. O presidente da Câmara, Marco Maia (PT-RJ) reconheceu esta semana que a posse de Genoíno, por exemplo, incomoda o parlamento.

NEM AĂ?

Partido nega constrangimento O novo lĂ­der do PT na Câmara, deputado JosĂŠ GuimarĂŁes (PT-CE), negou que a posse de JosĂŠ Genoino (PT-SP) como deputado federal cause constrangimentos Ă bancada. GuimarĂŁes ĂŠ irmĂŁo de Genoino, que foi condenado pelo Supremo Tribunal Federal (STF) no processo de mensalĂŁo por formação de quadrilha e corrupção ativa. “NĂŁo tem nada de constrangedor ou de constrangimento na bancada. A ban-

cada vive o auge do Estado Democråtico de Direito. Vamos aguardar o trânsito em julgado. Não vivemos em estado de exceção, vivemos em estado de direito�, disse Guimarães à imprensa no momento em que Genoino assumia o cargo. O líder petista se referiu à necessidade de que se esgotem todas as possibilidades de recursos antes que a Ação Penal 470 seja concluída e que ocorra o trânsito em julgado. O trâmite pode

levar tanto tempo que Ê possível que Genoino exerça seu mandato como suplente DWpRÀPHP SIMILAR Em caso semelhante, o deputado Natan Donadon (PMDB-RO) foi condenado pelo Supremo a 13 anos de prisão por peculato e formação de quadrilha. A condenação ocorreu em outubro de 2010, mas os recursos atrasaram tanto o trânsito em julgado que o deputado, mesmo condenado, atua atÊ

hoje na Câmara e ainda não teve o mandato cassado. DIVERGÊNCIA AlÊm disso, a divergência entre o Legislativo e o Judiciårio pode provocar demora na cassação do mandato de Genoino e de mais três deputados condenados no mensalão – Valdemar Costa Neto (PR-SP), Pedro Henry (PP-MT) e João Paulo Cunha (PT-SP). O presidente da Câmara Maia (PT-RS), diz que cassar os mandatos Ê prerrogativa da Casa.


6

OPINIAO

TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013

OpiniĂŁo

SUS e seus usuĂĄrios

E

m um ano, o MinistÊrio da Saúde jå enviou 10,1 milhþes de cartas para que os usuårios do Sistema Único de Saúde possam avaliar o atendimento e os serviços prestados nos hospitais da rede pública e nas unidades conveniadas. Nela, os usuårios podem fazer críticas, elogios e sugestþes de melhorias. A ideia Ê aprimorar os mecanismos de comunicação direta com o cidadão para melhorar o atendimento e ampliar a transparência do SUS, servindo de controle contra o desperdício de recursos. O montante de correspondências enviadas, apenas no último trimestre de 2012, equivale a quase o dobro do entregue durante os nove primeiros meses, quando foram distribuídas 5,7 milhþes. A Carta Ê distribuída mensalmente pelos Correios, com porte pago, e traz dados do cidadão, a data de entrada na unidade de saúde, o dia da alta mÊdica, o motivo da inter-

nação e o valor pago pelo SUS pelo tratamento. O usuårio, o familiar ou uma pessoa próxima pode conferir se essas LQIRUPDo}HVHVWmRFRUUHWDVHYHULÀFDUVH correspondem ao serviço prestado de fato e ao custo total do atendimento. Em caso de possíveis irregularidades, são desencadeados processos de auditoria para averiguar se houve desvio de recursos ou må aplicação de verba pública. Todas as manifestaçþes registradas são categorizadas e encaminhadas para instâncias governamentais, nas três esferas de governo. TambÊm se faz necessårio recoPHQGDUDRVXVXiULRVTXHVHMDXPÀVcalizador deste sistema que Ê o maior VLVWHPDGHGHVYLRVGHUHFXUVRVÀQDQceiros de toda a esfera do governo federal, principalmente em estados de pequeno porte.

JOĂƒO LYRA Deputado federal pelo PSD de Alagoas

FĂĄbrica de medos e pessimismo Entre 2008 e 2012, o Brasil elevou expressivamente os padrĂľes de vida e bem-estar de sua população, graças, sobretudo, a mudanças radicais empreendidas na distribuição da renda nacional. Isso ĂŠ o que registra estudo da consultoria internacional Boston Consulting Group, utilizando dados de 150 paĂ­ses, coletados de fontes como o Banco Mundial, Fundo MonetĂĄrio Internacional (FMI) e Organização das Naçþes Unidas (ONU). É impossĂ­vel deixar-se de reconhecer a magnitude daquele estudo, mas, por mesquinhez e falta de patriotismo, alguns grupos polĂ­ticos tentam “esconderâ€? a relevância de tĂŁo importante conquista do povo brasileiro. Tais grupos comandam, desde 2003, uma orquestrada crĂ­tica Ă polĂ­tica econĂ´mica, mas seus ĂŞxitos tĂŞm sido restritos, contabilizando derrotas eleitorais que os deixaram tontos e perdidos. A oposição ĂŠ um dos fundamentos da liberdade democrĂĄtica, todavia a praticada no Brasil tem corrido contra os interesses maiores do paĂ­s. Seria bom que seguisse o recente exemplo do Congresso Nacional dos Estados Unidos quando os republicanos se uniram aos democratas e evitaram

R FKDPDGR ´DELVPR ÀVFDO¾ que levaria o país a uma nova e profunda recessão. Vejamos as principais críticas que embalam a oposição, segundo Ernesto Lozardo, em o Valor Econômico, de 28 de dezembro passado. A primeira delas trata dos critÊrios dos investimentos do programa de infraestrutura, jå em plena execução pelo governo. A iniciativa abarca projetos de concessþes públicas para a construção de ferrovias (10 mil km) e rodovias (7,5 mil km), interligando todas as regiþes aos 12 principais portos da costa brasileira, com desembolsos da ordem de R$ 133 bilhþes. Ademais, a abertura dos aeroportos ao capital privado somarå nada menos do que R$ 54,0 bilhþes. Dessa forma, as expectativas Ê que, atÊ 2017, os investimentos estarão acima de 25% do PIB, transformando o Brasil em um gigantesco canteiro de obras e de criação de empregos. Por que fazer de conta que programas como esses não existem? É um suicídio essa atitude e, com isso, perdem o País e a própria oposição. A segunda crítica reitera sonolentamente que o governo optou por estimular o consumo em vez dos investimentos. Não quere entender

que o objetivo buscado foi o de evitar o desemprego e a perda maior da dinâmica industrial. Sem mais comentĂĄrios, portanto. Finalmente, a terceira crĂ­tica ĂŠ a de que o Banco Central teria abandonado seu triplo mandato (câmbio Ă H[tYHO PHWD LQĂ DFLRQiULD e superĂĄvit primĂĄrio), substituĂ­do por um novo tripĂŠ FkPELRĂ€[RPHWDVGHMXURV e de crescimento). A “acusaçãoâ€? ĂŠ um tremendo fora, porque o PaĂ­s, mesmo com a crise, continua crescendo, o que acontecerĂĄ mais intensamente em 2013. A fĂĄbrica de medos e de pessimismos ĂŠ um desserviço ao Brasil e ao seu povo. O discurso negativo nĂŁo tem lugar na atual fase de nossa histĂłria, porque o povo sabe que a presidenta Dilma Rousseff prioriza uma polĂ­tica econĂ´mica responsĂĄvel, voltada para a redução das desigualdades sociais e contĂ­nuo aumento da prosperidade nacional. E essa tendĂŞncia estĂĄ conĂ€UPDGD SHODV SHVTXLVDV GH RSLQLmR S~EOLFD É” PDLV GH 80% dos brasileiros apoiam o governo e a Presidenta que, voluntariosa e decidida, lembra a frase lapidar do astro jamaicano Bob Marley: “O otimismo ĂŠ a fĂŠ em açãoâ€?.

OLĂ?VIA DE CĂ SSIA CORREIA DE CERQUEIRA INOCĂŠNCIO NĂ“BREGA

Jornalista-blog http://oliviadecassia.blogspot.com.br/

Jornalista inocnf@gmail.com

Bem-vindo, janeiro!

J. & Jornalistas Hå bom tempo me persegue a ideia de dedicar meu primeiro artigo do mês a jornais e jornalistas, de preferência obedecendo o calendårio mensal. Claro, que meus arquivos estarão sempre carentes de informaçþes, mas tenho certeza de que se enriquecerão à medida em que o douto leitor as for me enviando, pelo correio eletrônico, ou sob outra forma. Os periódicos brasileiros, ou atÊ internacionais, não precisam, apenas, serem lidos, mas tambÊm conhecidos na sua história e na sua atividade perante a sociedade. É um trabalho de pesquisa, numa homenagem à imprensa escrita do período, normalmente apresentado em duas partes: a inicial, obedecendo-se o calendårio mensal: a segunda, uma retrospectiva, embora sucinta, sobre um deles, ou personalidade ligada à arte do jornalismo ou à empresa do ramo. Serão relatos dentro de espaços que os acomode, numa esWUXWXUDJUiÀFDFRHUHQWHDRVDQWHULRUHV 9HMDPRV FRPR ÀFDUmR

nesta edição inaugural: Dia 1Âş SĂŁo lançados o “Jornal do Recifeâ€?; “Blumenau Zeitungâ€? (1856), Blumenau, SC: 02 “DiĂĄrio do Governoâ€?, (1823), Rio de Janeiro; 03 “Gazeta ExtraordinĂĄria Pernambucanaâ€? (1823), Recife: 04 “A ProvĂ­ncia de SĂŁo Pauloâ€?, (1875), SĂŁo Paulo; 07 “O Povoâ€? (1928), Fortaleza, CE; 12 “Abelha de Itacolomiâ€?, (1824), Ouro Preto, MG: 13 “Jornal da Semanaâ€? (1979), FlorianĂłpolis, SC; 18 “O Artista Brasileiroâ€? (1891): 21 “The North Parahyba Heraldâ€? (1891), JoĂŁo Pessoa, PB 31 “DiĂĄrio do Estadoâ€? (1916), CearĂĄ. Nessa data, jĂĄ andava circulando seu nÂş 348. 9R] Ă€UPH H HPSROJDQWH quando falava da tribuna, seja em comĂ­cio ou na Câmara dos Deputados, assim o jornalista DemĂłcrito Rocha, criador de “O Povoâ€?. Poeta, aprofundado nos conhecimentos de Ăłpera e teatro FOiVVLFR Ă€ODWHOLVWD DWUDYpV

TRIBUNA

INDEPENDENTE

Rua da Praia, 134 - sala 303 - centro - Maceió Alagoas Endereço Comercial: Av. Menino Marcelo - 10.440 - Serraria Maceió - Alagoas - CEP: 57.083.410 CNPJ: 08.951.056/0001 - 33

delas se comunicando com o mundo, em vĂĄrios idiomas. De Caravelas, cidade baiana e sua terra natal, fazendo escalas em Salvador e Sergipe, cidades por onde residiu por algum tempo, atĂŠ chegar a Fortaleza, a 10 de setembro de 1912, por força de FRQFXUVR GH WHOHJUDĂ€VWD D TXH submetera na capital sergipana. 2 &HDUi DĂ LWR HP UD]mR GR cangaço e do mĂ­stico padre CĂ­cero, no governo do Comendador Pinto Acioly. O Morse e d. Creusa do Carmo Rocha, sua esposa, eram as paixĂľes do momento. Foi no seu consultĂłrio odontolĂłgico da rua Major Facundo, Fortaleza, que foi convidado a participar, com Julio Matos Ibiapina, da fundação de “O CearĂĄâ€?. Nesse ato redescrobria-se o jornalista combativo, que com o beneplĂĄcido do presidente JosĂŠ Moreira da Rocha funda “O 3RYRÂľ1DVFLGRDĂ€lho de JoĂŁo Rodrigues da Rocha e Maria da GlĂłria Rocha, nosso homenageado falece em 1943, vĂ­tima de pertinaz enfermidade. FILIADO AO

Jorgraf UM PRODUTO:

Cooperativa dos Jornalistas H*UiÂżFRVGRHVWDGRGHDODJRDV

Chegou janeiro, o primeiro mês do ano, meu mês de nascimento. Todo ano nessa Êpoca as esperanças se renovam em busca de dias melhores. Sinto que surge dentro de mim um novo caminhar que jå venho percorrendo hå algum tempo. A passagem de ano ocorreu GHIRUPDWUDQTXLODHSDFtÀFD na rua onde moro, sem grandes holofotes e apenas uma pequena reunião entre amigos e familiares, comemorando o aniversårio da sobrinha; depois o sono bateu e fui dormir o sono dos justos. Sinto-me melhor, com mais disposição de luta, com mais vontade de fazer e dar o meOKRUGHPLPQDPLQKDSURÀVsão e no campo pessoal. Tenho vontade de viver cada dia mais, muito e intensamente, apesar da saúde frågil. A partir deste janeiro começa um novo ciclo em nossas vidas, seremos mais fortes e mais atuantes. Um PRESIDENTE Antonio Pereira Filho DIRETOR ADMINISTRATIVO FINANCEIRO: JosÊ Paulo Gabriel dos Santos Editor geral: Ricardo Castro

WHPSR GH UHĂ HWLU GH WRPDU novas atitudes, fazer novas amizades, conservar os bons amigos que se tem e viver a vida de forma que ela possa ser encarada com suavidade. Existem mil possibilidades nos esperando nesse ano que chegou. Quero absorver todo o conhecimento que a vida me proporciona. A vida ĂŠ um aprendizado. Quero viver um mundo de paz, de consciĂŞncia ĂŠtica e humildade e nunca esquecer os bons ensinamentos que me foram passados pelos meus pais. Esse ĂŠ um tempo de um novo caminhar para todos nĂłs, de boas perspectivas, de se fazer uma limpeza na alma e em nossas gavetas e nos despojarmos de tudo aquilo que nĂŁo tem utilidade. A gente se renova quando faz isso. Durante a nossa vida vamos acumulando excessos: de peso, de coisas inĂşteis, na vida prĂĄtica e espiritual e ĂŠ

preciso que a gente faça uma UHĂ H[mR VREUH WXGR LVVR (X nunca quis acumular muita riqueza, mas sempre gostei de conforto, apesar de tudo. NĂŁo vale a pena essa acumulação, essa densidade que sĂł nos torna mais doentes da alma. A escritora Lya Luft disse em uma de suas crĂ´nicas que para reinventar-se ĂŠ preciso a gente pensar. Segundo a cronista, precisamos “apalpar, no nevoeiro de quem somos algo que pareça uma essĂŞnciaâ€?. Existem muitas inquietaçþes dentro de mim, mas sĂŁo inquietaçþes que me levam Ă construção de coisas boas, mas a gente tem que ter discernimento e clareza, tambĂŠm, de que nem tudo funciona como a gente quer, mas que podemos buscar o melhor para si e para os outros, que fatalmente a verdade e o bom senso prevalecerĂŁo. Bem-vindo, janeiro, bem-vindo 2013!

Nosso noticiĂĄrio nacional ĂŠ fornecido pelas agĂŞncias: AgĂŞncia Folha e AGĂŞncia Nordeste PABX: 82.3311.1338 COMERCIAL: 82.3311.1330 - 3311. 1331 REDAĂ‡ĂƒO: 82.3311.1328 - 3311.1329 CENTRAL DE ASSINANTE: 82.3311.1308 - 3311.1309 comercial.tribunaindependente@gmail.com redação.tribunaindependente@gmail.com

ricardocastro@tribuna-al.com.br

DIRETORA COMERCIAL: Marilene Canuto

OS ARTIGOS ASSINADOS SĂƒO DE RESPONSABILIDADE DOS SEUS AUTORES. NĂƒO REPRESENTANDO, NECESSARIAMENTE, A OPĂ?NIĂƒO DESTE JORNAL.


TRIBUNAINDEPENDENTE

0$&(,Ă?'20,1*2'(-$1(,52'( POLĂ?TICA 7

Desvio de cargas de revĂłlver Taurus ocorreu por intermĂŠdio dos Correios

Coronel do ExÊrcito morto tem relação com o sumiço de Rubens Paiva

$PDLVVXUSUHHQGHQWHYHUWHQWHGRFRPpUFLRLOHJDOGHDUPDVQR5LR*UDQGHGR 6XOHQYROYHRGHVYLRGHFDUJDVUHPHWLGDVSHOD)RUMDV7DXUXVGH3RUWR$OHJUH SDUDFOLHQWHVQR%UDVLOYLD&RUUHLRV5HYyOYHUHVHSLVWRODVYrPVHQGRVXUUXSLDGRV GXUDQWHRWUDMHWRHQWUHDIiEULFDHRVGHVWLQDWiULRV6HULDPSHORPHQRVFDVRVH VHJXQGRD3ROtFLD)HGHUDORGHUUDPHQRPHUFDGRFODQGHVWLQRFKHJDULDDFHQWH QDVGHDUPDVGHVGH2FDVRVHJXHFRPRPLVWpULRVHPSLVWDVVREUHDXWRUHV GRFULPH$7DXUXVWHPDXWRUL]DomROHJDOSDUDDVUHPHVVDVSRUFRUUHVSRQGrQFLD $VFDL[DVVmRODFUDGDVVHPLGHQWLÂżFDomRGRSURGXWRQHPGRIDEULFDQWH

'RFXPHQWRVR¿FLDLVVREUHRGHVDSDUHFLPHQWRGRH[GHSXWDGR5XEHQV3DLYD VHTXHVWUDGRHPRUWRHPSRULQWHJUDQWHVGDUHSUHVVmRSROtWLFDQRSDtV FRPSURYDPDPRELOL]DomRGDGLWDGXUDSDUDWHQWDUPRQWDUXPDKLVWyULDTXH DOLYUDVVHGDDFXVDomRGHUHVSRQVDELOLGDGHQRFDVR2VGRFXPHQWRVIRUDP HQFRQWUDGRVQDFDVDGRFRURQHOUHIRUPDGRGR([pUFLWRJúlio Miguel Molinas Dias,DQRVDVVDVVLQDGRQRGLD¾GHQRYHPEURTXDQGRFKHJDYDHPFDVD HP3RUWR$OHJUH2VSDSpLVJXDUGDGRVKiTXDVHTXDWURGpFDGDVLQGLFDPD SDUWLFLSDomRGRFRURQHOWDPEpPQRFDVRGDERPEDGR5LR&HQWUR

0HUFDGRGHDUPDVYLUDWUiÀFRQR56 Assassinato de coronel da ditadura reforça informação sobre aluguel de armas por autoridades gaúchas

A

prisão de dois soldados da Brigada Militar hå duas semanas, suspeitos de matar o coronel aposentado do ExÊrcito Julio Miguel Molinas Dias para roubar a coleção de 23 armas dele, revela a face obscura de homens da lei que mergulharam no subPXQGR GR WUiÀFR GH DUPDV Assim como outros PMs, policiais civis e bandidos que se passam por colecionadores, a dupla de soldados trocou de lado, tentando se estabelecer no mais rentåvel negócio do momento entre os criminosos da região metropolitana de Porto Alegre: a venda e o aluguel de armas HPXQLo}HV — A repercussão do caso trouxe à tona um dos grandes problemas que temos hoje: a valorização do preço das armas no mercado ilegal — diz o delegado Alexandre Vieira, da 9ª Delegacia da 3ROtFLD&LYLO Os soldados se juntaram a contrabandistas, atraídos por um mercado cada vez PDLV LQà DFLRQDGR SRU FDXsa das restriçþes às vendas RÀFLDLV SHOD FDPSDQKD GR desarmamento e pelo cresFLPHQWR GD FULPLQDOLGDGH

CRIME

2ÀFLDLVGULEODP segurança de presídio

No começo do ano, um sargento da força-tarefa da BM que atua em cadeias foi preso por colegas, apĂłs apreensĂŁo de cinco armas em uma galeria da facção “Os 0DQRVQR3UHVtGLR&HQWUDOÂľ Ele seria o fornecedor de celulares, pistolas e revĂłlveres SDUD DSHQDGRV $ FDSWXUD do sargento explicaria como cerca de 50 armas de fogo driblaram os mecanismos de segurança e detectores de metais e foram parar nas mĂŁos de detentos do Central QRV~OWLPRVGRLVDQRV Em Canoas, uma ex-estagiĂĄria da Delegacia de PolĂ­cia de Pronto Atendimento responde a processo criminal por desvios de dinheiro, drogas e armas da repartição, ocorridos em 2009

ESCOLA CARIOCA

Valorização de armas tem o Rio como base Estudos dão conta da valorização das armas no merFDGRLOHJDOQD~OWLPDGpFDGD Por exemplo: pistolas calibre  H  PP PXLWR XVDGDV por ladrþes de carro, custavam R$ 3 mil, e agora pulaUDP SDUD 5  PLO +RXYH tambÊm uma mudança na maneira de operar o mercaGR LOHJDO GH DUPDV 2V WUDÀcantes gaúchos copiaram o modelo das favelas cariocas: aluguel de armas para assalWDQWHV $GTXLULGDV HP JUDQdes quantidades por criminosos para manter as bocas de fumo, as armas acabaram se tornando um lucrativo negócio de aluguel, observou Luiz Carlos Silveira, da Viva Rio, uma ONG que virou um ícone no país na luta contra a YLROrQFLD

PREÇO

Aluguel de um

fuzil custa R$ 2 mil por 24 h No Rio Grande do Sul, a locação de armamento para assaltantes jĂĄ foi detectada em escutas telefĂ´nicas, DĂ€UPD R SURPRWRU 0DXUR 5RFKHPEDFN $V DUPDV VmR alugadas por “lançadaâ€?, gĂ­ria usada pelos bandidos para denominar um assalWR3RUH[HPSORDGLiULDGH um revĂłlver custa R$ 400 e GHXPIX]LO5PLO$JDrantia do retorno da arma jV PmRV GR WUDĂ€FDQWH WHP um grande estĂ­mulo: a pena GHPRUWH'DtR]HORGRVEDQdidos pelas armas locadas, como mostram escutas teleI{QLFDV*HUDOPHQWHDDUPD ĂŠ devolvida 24 horas depois GHWHUVLGRXVDGD

Diagnóstico sobre como se procede a venda e aluguel de armas e muniçþes no Rio Grande do Sul

O Rio Grande do Sul, em proporção à população, Ê o recordista em recolhimento de armas no país — jå foram WLUDGDVGHFLUFXODomR XQLGDGHV GHVGH  $Wp outubro, os homicídios cresFHUDPHVWHDQRHRURXERGHYHtFXORVVXELX O comÊrcio clandestino se fortalece graças à falta de segurança e ao descontrole em organismos sob a tutela do Estado, quartÊis, delegacias, fóruns e atÊ em acervos GHFROHFLRQDGRUHV São as principais fontes ³ DVVLP FRPR R WUiÀFR SHlas fronteiras e o desvio de cargas — de abastecimento do mercado clandestino de revólveres, pistolas, espingardas, submetralhadoras, fuzis e muniçþes no Rio *UDQGHGR6XO Antes de serem presos, os dois PMs suspeitos da morte de Molinas jå eram investigados pela Corregedoria da BM por causa de furtos de armas no quartel onde trabalhavam, Rž%DWDOKmRGH3ROtFLD0LOLWDUQD]RQDQRUWHGD&DSLWDO ³6HÀFDUHPSURYDGRVHVses indícios, as sançþes serão VHYHUDV ³ DÀUPD R FRURQHO João Gilberto Fritz, corregeGRUJHUDOGD%0


8

PUBLICIDADE MACEIÓ - DOMINGO, 6 DE JANEIRO DE 2013

TRIBUNAINDEPENDENTE


TRIBUNAINDEPENDENTE

MACEIÓ - DOMINGO, 6 DE JANEIRO DE 2013

Cidades

CIDADES

9

Prisões em todo o Brasil tiveram aumento de 125% nas rodovias federais O número de prisões por embriaguez nas rodovias federais de todo o Brasil, entre o dia 21 de dezembro e 2 de janeiro cresceu 125% na comparação com o mesmo período do ano anterior, de acordo com dados divulgados na semana passada pela Polícia Rodoviária Federal. Do dia 21 até o dia 2, segundo a polícia, 723 pessoas foram presas por embriaguez. No mesmo período do ano anterior, foram 322 prisões. Ainda de acordo com a PRF, no feriado de Réveillon foram aplicados 70.855 testes de embriaguez por meio do bafômetro, aumento de 181% em relação ao ano anterior.

Onze são presos após a nova Lei Seca Rigor maior desde o dia 21 de dezembro tem aumentado o número de abordagens e de autuações de condutores ANA PAULA OMENA REPÓRTER

O

medo das punições por conta do rigor da Lei Seca aliado ao aumento das operações policiais parece ter surtido efeito no Estado de Alagoas. É que desde o dia 21 de dezembro de 2012, além do bafômetro, são admitidos vídeos e outras provas como o depoimento do policial, testes clínicos, vídeos e outros testemunhos, para provar a embriaguez do motorista. De acordo com o levantamento divulgado pela Polícia Rodoviária Federal (PRF), nas rodovias que cor-

tam Alagoas, 916 testes de bafômetro foram realizados desde que a nova Lei Seca entrou em vigor, com 21 autuações e 11 prisões. Em 2011, no mesmo período, foUDPDSHQDVQRWLÀFDo}HV Para o inspetor da PRF Carlos Ramos, da Seção de Policiamento e Fiscalização, as pessoas que bebiam e dirigiam estão evitando repetir a ‘dose’, além de estarem temerosas em beber e se recusar a fazer o teste, já que a atitude pode resultar em prisão. Roberto Elias da Silva, comerciante, foi parado numa blitz do Batalhão Rodoviário Estadual (BPRV) e

SANDRO LIMA

realizou o teste do bafômetro a pedido da reportagem: o resultado deu negativo, ao contrário da atitude positiva do condutor. “Acho importante ações como esta, porque evitam mortes de inocentes por motoristas imprudentes que ingerem em excesso bebida alcoólica”, opinou. De 0,28 até 0,32 miligramas de álcool no sangue, o motorista sofre infração, tendo a carteira de habilitação recolhida, sendo também multado em R$ 1.915. Acima de 0,33 miligramas, além da infração, o motorista é preso, conforme explicou o subtenente Edvaldo Silva, do BPRV.

VÃO DE TÁXI

Turistas optam por não alugar veículo Os turistas Fabiano Jorge Bitipal e Suzana Bitipal, de Ribeirão Preto, que estão em Maceió curtindo as férias, concordam com a nova Lei Seca em todos os sentidos. A empresária OHPEURX R FDVR GR ÀOKR GH uma amiga que durante o carnaval saiu embriagado com o carro da mãe, morreu e matou mais um casal que vinha em outro veículo. “É lamentável, mas infelizmente as pessoas insistem em beber e dirigir”, frisou Suzana. Fabiano ressaltou que em vez de alugar um veículo em Maceió, eles preferiram ir aos destinos mais visitados da capital de táxi, porque diante do calor e das férias seria inevitável que ele e sua esposa não bebessem. “Nós dois dirigimos e optamos pelo motorista da vez. Às vezes é ela e outra sou eu, é mais seguro e evita multas”, contou. O engenheiro Luiz Leopoldo estava na Praia de Pajuçara quando conversou com a reportagem. Ele cobra mais rigor da polícia, no sentido de mais operações

SANDRO LIMA

Motorista que fez o teste do bafômetro riu ao ver o resultado negativo e aprovou a lei com mais rigor

MEDO

Lei Seca reduz movimento em bares, mas dá lucro aos taxistas Motoristas começam agora a ir aos bares a pé ou em táxi

Turistas dizem que ambos bebem, por isso vão passear de táxi

na orla marítima de Maceió. Segundo ele, o número de jovens que saem alcoolizados das boates localizadas na região é grande. “Tanto os rapazes quanto as moças saem embriagados podendo acabar com a vida deles e a dos outros”, observou. O dentista Mário Augusto Pinheiro acredita que

a nova Lei Seca deve pegar mesmo e a única opção será ir de táxi. “Tanto eu, quanto minha esposa bebemos e quando queremos sair de casa a gente se combina em um beber e o outro não. Quando não tem acordo, o negócio é irmos de táxi, sai bem mais em conta do que uma multa”, ressaltou. (A.P.O.)

O rigor da Lei Seca também tem deixado os comerciantes da capital alagoana no prejuízo. Segundo o proprietário de um bar localizado numa avenida movimentada no bairro do Farol, Geovane Lopes, as vendas no seu estabelecimento reduziram 40% se comparado a dezembro de 2011. “Sempre faço montagens de vídeos orientando o pessoal a não dirigir e beber, beber não é proibido, crime é beber e dirigir. Infelizmente o pessoal que mora nas proximidades tem o vício de tudo o que faz ser de carro, mas ultimamente já

percebo o pessoal deixando os carros e aparecendo a pé”, mencionou. A nova Lei Seca entrou em vigor com mais rigor e sem vetos no dia 21 de dezembro passado, sancionada pela presidente Dilma Rousseff. A proposta que altera a Lei Seca endurece a ÀVFDOL]DomR GD HPEULDJXH] ao volante. As alterações passaram a valer imediatamente. O taxista Natalício de Oliveira comemora o lucro após a nova Lei, que segundo ele tem colocado medo nos motoristas que estão cada vez mais optando por

beber sem dirigir. “Quando mexe com o bolso, o pessoDO ÀFD PDLV YLJLODQWH 1mR é qualquer um que vai preferir pagar R$ 1.915,40 de multa a R$ 17 ou R$ 90 por uma corrida dependendo do percurso”, observou. Para o taxista André Cavalcante, as pessoas estão tendo mais consciência, com medo da multa e da falta de grana no bolso. “Acredito TXH D OHL YHLR SDUD EHQHÀciar os que bebem e os que não bebem. Está havendo muitas mortes no trânsito por ingestão de bebida alcoólica, quando não mata deixa sequelas”, disse. (A.P.O.)


10

CIDADES

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013

TRIBUNAINDEPENDENTE

Esquistossomose ameaça 80% da população alagoana Quase 70% dos municípios do Estado são åreas endêmicas para a doença

C

omo o próprio nome sugere, o Estado de Alagoas Ê reconhecido pela presença marcante dos rios e das lagoas na vida de seus habitantes. No território alagoano, as åguas são fonte de lazer e de geração de renda. No entanto, tambÊm Ê em meio aquåtico que cresce o número de pessoas infectadas pelo parasito Schistosoma mansoni, que causa a doença Esquistossomose mansônica. Sob a coordenação da mÊdica e professora Janira Lúcia Couto, uma pesquisa desenvolvida no Instituto

de CiĂŞncias BiolĂłgicas e da SaĂşde (ICBs) da Universidade Federal de Alagoas revela a existĂŞncia de zonas hiperendĂŞmicas na regiĂŁo. As ĂĄreas sĂŁo assoladas pelo elevado Ă­ndice de indivĂ­duos com esquistossomose, doença conhecida popularmente como “barriga d’åguaâ€?. De acordo com dados divulgados pela Secretaria de Estado da SaĂşde de Alagoas, 69% dos municĂ­pios alagoanos representam ĂĄreas endĂŞmicas de esquistossomose, com manifestaçþes graves da doença e UFAL

mortalidade atribuída à infecção. Em Alagoas, mais de 2,5 milhþes de pessoas vivem sob o risco de contaminação. No Laboratório de Esquistossomose e Malacologia (LEM), setor de Parasitologia e Patologia da Ufal, os resultados da anålise de exames realizados em crianças e jovens de dois a 15 anos de idade preocupam pesquisadores da årea da saúde. Segundo Janira Couto, RV tQGLFHV YHULÀFDGRV QRV municípios alagoanos superam os parâmetros da Organização Mundial da

SaĂşde (OMS). “Em Santana do MundaĂş, desenvolvemos pesquisas com cerca de 690 indivĂ­duos. Durante dois anos de atividades, constatamos que a carga parasitĂĄria na regiĂŁo era muito alta, com uma mĂŠdia de 187,9 ovos de Schistosoma mansoni por grama de fezes. A OMS considera que a taxa de infecção de 5% jĂĄ ĂŠ elevada e no municĂ­pio ela chega a 27,72%â€?, revelou. Esses dados foram publicados na Revista da Sociedade Brasileira de Medicina Tropical, em 2010, e permanecem semelhantes em diferentes cidades de Alagoas.

TRANSMISSORES

Capela, Rio Largo, MaceiĂł e Marechal tĂŞm altos Ă­ndices

População que vive próximo a rios e lagoas são mais infectadas

Nos estudos mais recentes realizados pela Ufal, as situaçþes de Capela, Rio Largo, Marechal Deodoro e MaceiĂł com relação a Esquistossomose sĂŁo consideradas preocupantes. De acordo com a pesquisadora Janira Couto, os riscos sĂŁo ainda maiores com o acĂşmulo de ĂĄgua parada. “Na periferia da capital do Estado jĂĄ encontramos muitos caramujos transmissores da doença infectados pelo parasito Schistosoma mansoni. O caramujo transmissor do parasito vive nas ĂĄguas paradas e poluĂ­das de canais e de valas com esgotos. Esses caramujos sĂŁo encontrados na Zona da Mata de Alagoas, mas agora tambĂŠm sĂŁo observados no litoral. Ressaltamos que hĂĄ prevalĂŞncia desses transmissores HPFULDGRXURVDUWLĂ€FLDLVFULDdos pelo homem, como poços, valas de irrigação e açudesâ€?, alertou. Atualmente, a atenção dos pesquisadores estĂĄ voltada para a cidade de Marechal Deodoro. O grupo desenvolve

trabalhos educativos em Vila Altina e em TaperaguĂĄ – povoados com elevado nĂşmero de infectados –, realiza exames em jovens e em crianças da regiĂŁo e, em parceria com a Secretaria Municipal de Endemias, disponibiliza medicação aos indivĂ­duos com diagnĂłsticos positivos para a presença de ovos do Schistosoma mansoni nas amostras de fezes. “NĂłs utilizamos os mĂŠtodos de Lutz, uma anĂĄlise qualitativa e de rotina, e o Kato Katz, que ĂŠ quantitativo, para a contabilização do nĂşmero de ovos no indivĂ­duo. Com esses mĂŠtodos, sabemos a carga parasitĂĄria aproximada na população analisada no estudo. Na regiĂŁo de Vila Altina, nĂłs realizamos exames em 300 pessoas, das quais 105 estĂŁo infectadas. Esse resultado indica que 35% dos investigados possuem ovos do parasito distribuĂ­dos pelo organismo. Como mĂŠdica, posso prescrever o receituĂĄrio para as pessoas com os exames positivosâ€?, explicou. SANDRO LIMA

ALARMANTE

Garoto de 12 anos teve 22 ovos detectados em pesquisa Durante a elaboração desta matÊria, o grupo de pesquisadores da Ufal detectou a presença de 22 ovos do Schistosoma mansoni no exame de Lutz de um garoto de 12 anos. Em pesquisa anterior, realizada em 2011, os números foram ainda mais alarmantes. Na ocasião, 91% das 200 amostras de fezes coletadas em Vila Altina, em Marechal Deodoro, apresentaram infecção parasitåria. Esses dados indicam que 182 pessoas avaliadas possuíam algum tipo de parasita intestinal. AlÊm do responsåvel pela esquistossomose, outros vermes são detectados com frequência nos exames,

como Ascaris lumbricoides, Enterobius vermicularis, Hymenolepis nana, Entamoeba histolytica e Ancilostomídeos. Segundo a bolsista do projeto e aluna de Licenciatura em Biologia, Janaína Melo da Silva, as atividades vão alÊm da intervenção nos municípios. A estudante revela que o trabalho de conscientização tambÊm Ê importante para D HÀFiFLD GR SURMHWR ´$OpP dos exames que realizamos, nós vamos às escolas uma vez por semana e disponibilizamos jogos educativos, desenvolvemos dinâmicas e apresentamos vídeos sobre o assunto�, reforçou.

Caramujos são os transmissores das doença, comuns no litoral

SE NĂƒO TRATADA

Doença pode causar atÊ paralisia O parasito Schistosoma mansoni apresenta dois hospedeiros, o caramujo Biomphalaria glabrata, intermediårio, e o homem, que p GHÀQLWLYR 2 FLFOR YLWDO GR verme consiste em duas etapas. Na primeira, larvas do parasito penetram nos caramujos que habitam åguas doces, se desenvolvem neles e se transformam em outras larvas, as cercårias. No segundo momento, as cercårias abandonam o hospedeiro intermediårio e penetram na pele do

homem. A contaminação pode acontecer por meio do contato humano com rios, lagos e córregos. Segundo a professora Janira Lúcia Couto, quando os ovos não são eliminados nas fezes, eles são distribuídos pelo organismo por meio do sangue. O parasito vive nos ramos da veia porta do fígado e nas veias mesentÊricas do intestino. Nas åreas onde os RYRVÀFDPLQVWDODGRVVXUJHP LQà DPDo}HV TXH DJUDYDP R estado de saúde dos indivídu-

RV´&RPRWHPSRDLQĂ DPDomRVHWUDQVIRUPDHPĂ€EURVH [tecido endurecido], considerado o grande problema da doença, pois ĂŠ a principal lesĂŁo. O granuloma, que ĂŠ o ovo PDLV D LQĂ DPDomR DWLQJH principalmente o fĂ­gado, os pulmĂľes e o intestino. HĂĄ casos em que a medula espinhal tambĂŠm ĂŠ atingida, o que provoca paralisiasâ€?, explicou. No caso mais avançado da doença, hĂĄ o surgimento de ascite – a famosa “barriga d’åguaâ€? –, provocada pelo ex-

travasamento de plasma no abdĂ´men. Com a medicação adequada, o verme pode ser eliminado, mas as lesĂľes nĂŁo sĂŁo reparadas. Para a professora, as diĂ€FXOGDGHV HP FRPEDWHU D doença estĂŁo na falta de prĂĄticas educativas e de saneamento bĂĄsico. “No interior, a maior parte das casas jĂĄ ĂŠ construĂ­da com tijolos e alvenaria. Muitas casas tĂŞm ĂĄgua canalizada. O lixo sempre ĂŠ coletado. Mas tudo isso ĂŠ realizado precariamenteâ€?.


TRIBUNAINDEPENDENTE

MACEIÓ - DOMINGO, 6 DE JANEIRO DE 2013

CIDADES

11

$GLDPHQWRGDQRYDRUWRJUDÀDpFULWLFDGR Prorrogação do prazo para 2016 deixa estudantes e professores confusos; eles já trabalham com as novas regras ALANA BERTO REPÓRTER

A

obrigatoriedade do novo acordo ortográÀFR IRL SURUURJDGD SRUPDLVWUrVDQRVSRUPHLR GR'HFUHWRQžGD3UHVLGrQFLD GD 5HS~EOLFD SXEOLFDGRGLDGHGH]HPEURGH 2SUD]RTXHVHULDDWpR GLDGHGH]HPEURGH IRLDGLDGRSDUDGHGH]HPEURGH(QTXDQWRLVVR D SRSXODomR EUDVLOHLUD ÀFD FRQIXVDQDKRUDGHHVFUHYHU 3DUDDSURIHVVRUDGH3RUWXJXrV 'HLVH )UDQFR QmR KDYLD QHFHVVLGDGH GH SRVWHUJDUHVVHDFRUGR´1yVQRV DGDSWDPRV EHP jV PXGDQoDV 2V OLYURV Mi VH DGDSWDUDP 2 ~QLFR SUREOHPD QD YLGD GRV EUDVLOHLURV p R KtIHQµDOHJRX (ODFRQWDTXHSDUDDGLDU

DREULJDWRULHGDGHGRDFRUGR XP GHSXWDGR H XP VHQDGRU DOHJDUDP TXH p SUHFLVR TXH DV PXGDQoDV VHMDP PDLV WUDEDOKDGDV $ SURIHVVRUD DFUHVFHQWRX TXH XP DOXQR VHX HVFUHYHX S{UGRVRO VHP KtIHQ HP XPD SURYD GH FRQFXUVR FRQIRUPHRDFRUGRRUWRJUiÀFR  H SUHFLVRX HQWUDU FRP UHFXUVR SDUD WHU D SRQWXDomR´,VVRpXPSUHMXt]RSDUD TXHP DGTXLUH XP OLYUR (X QmR VHL DYDOLDU R PHUFDGR HGLWRULDO PDV DFUHGLWR TXH Mi WHQKD OLYURV HQFDOKDGRV SRU FRQWD GLVWR 2 TXH YDL DFRQWHFHUpTXHGDTXLDWUrV DQRVYDLKDYHUPXGDQoDVGH QRYRHQmRYDLSDUDUDtµGLVVHDSURIHVVRUD 'HLVH)UDQFRFRORFRXTXH GD &RPXQLGDGH GRV 3DtVHV GH /tQJXD 3RUWXJXHVD &3/7  3RUWXJDO VHUi R

~OWLPR D DSURYDU R DFRUGR ´4XDQGR WRGRV RV SDtVHV DSURYDUHP p TXH 3RUWXJDO YDLFRORFDUHPYLJRUµIULVRX $ GRFHQWH UHVVDOWRX TXH QRHGLWDOGR([DPH1DFLRQDO GR(QVLQR0pGLR (QHP IRL HVWDEHOHFLGD D RUWRJUDÀD DQWLJD (OD DLQGD DÀUPRX TXH FRQVLGHUD R DGLDPHQWR XP SUHMXt]R SDUD RV DOXQRV SULQFLSDOPHQWH SDUD RV GR (QVLQR 0pGLR TXH HVWmR HQIUHQWDQGR FRQFXUVR ´$GLDU R QRYR DFRUGR p XP GHVUHVSHLWR j SRSXODomR p XPWUDQVWRUQReSUHFLVROHYDU DV FRLVDV PDLV D VpULRµ RSLQRX VELHAS REGRAS $ LPSODQWDomR GR DFRUGR FRPHoRX HP  FRP R LQWXLWRGHXQLÀFDURVSDtVHV HP TXH D OtQJXD RÀFLDO p R SRUWXJXrV 1R HQWDQWR 3RUWXJDOVyFRPHoRXDLQVHULUR

QRYRDFRUGRHP (P HQWUHYLVWD SDUD R MRUQDO 2 *ORER R JUDPiWLFR (YDQLOGR %HFKDUD TXH p PHPEURGD$FDGHPLD%UDVLOHLUDGH/HWUDVDÀUPRXTXH pSUHFLVRTXHKDMDXPDXQLIRUPL]DomR GR 3RUWXJXrV (OH DLQGD FRPHQWRX TXH R DGLDPHQWR p XP DWR VHP VHQWLGRXP´DWHVWDGRGHLJQRUkQFLDµ SDUD SURIHVVRUHV HDOXQRVTXHMiGRPLQDPDV QRYDVUHJUDV $ GHFLVmR GH DGLDU R DFRUGR IRL XP SHGLGR GH VHQDGRUHV TXH DWHVWDP TXH R SUD]R SDUD DGDSWDomR GDV QRYDV UHJUDV RUWRJUiÀFDV VHULDLQVXÀFLHQWH$VSULQFLSDLV PXGDQoDV WUD]LGDV QR QRYR DFRUGR RUWRJUiÀFR VmR UHODWLYDVDRXVRGRKtIHQRV GLWRQJRVFUHVFHQWHVTXHQmR VHUmR PDLV DFHQWXDGRV H R ÀPGRWUHPD

COM OU SEM TREMA?

(VWXGDQWHVWrPTXHVDEHUGXDVUHJUDV (GLWDLVGHFRQFXUVRVHYHVWLEXODUHVDLQGDFRVWXPDPFREUDURUWRJUD¿DDQWLJD 3DUD D DGPLQLVWUDGRUD 0D\UD /LPD TXH HVWi HVWXGDQGR SDUD ID]HU FRQFXUVRV FRP R QRYR DFRUGR D SUHRFXSDomR DXPHQWRX ´(VWDPRV DFRVWXPDGRV D XPD UHJUD H DJRUD WHPRV TXH DVVLPLODU GXDVµ $ HVWXGDQWH DFUHGLWD TXH PXLWD JHQWH SRGH WHU VLGR SUHMXGLFDGD SRU QmR VDEHU VH XVDULD D QRYD UHJUD RX D DQWLJD HP FRQFXUVRV ´1HP WRGD IXQGDomR HVWDYD DGRWDQGR R DFRUGRµ 0D\UD GLVVH TXH DOJXQV HGLWDLV SHGHP

GHWHUPLQDGRV DVVXQWRV PDV QmR GL]HP VH RV DOXQRV GHYHUmR XVDU R QRYR DFRUGR ´4XDQGRLVVRDFRQWHFHWHPRV TXHSHVTXLVDUVHD)XQGDomR TXH SUHSDUD R H[DPH FRVWXPDXWLOL]DURQRYRDFRUGRRX QmRµDÀUPRX $OLQH *yHV TXH p SUHVLGHQWH GD &RPLVVmR 3HUPDQHQWHGH9HVWLEXODU &RSHYH  FRQWRXTXHFDGDHGLWDOpXPD VLWXDomR ´$JLPRV GH DFRUGR FRP D OHJLVODomR YLJHQWHµ GLVVH HOD $OLQH DÀUPRX TXH QDVSURYDVGHUHGDomRDVUH-

FRPHQGDo}HVVmRGHQmRWLUDU QHQKXPD SRQWXDomR GR FDQGLGDWR SRU HOH WHU HVFULWR QD IRUPDDQWLJDQHPQDQRYD 2SURIHVVRUGH3RUWXJXrV 1HOVRQ%LWWHQFRXUWGLVVHTXH GRSRQWRGHYLVWDOLQJXtVWLFR R QRYR DFRUGR RUWRJUiÀFR p GHVQHFHVViULR ´1mR Ki QHFHVVLGDGHGHWLUDURDFHQWRGH GHWHUPLQDGDVSDODYUDVHGHL[DUHPRXWUDVµ (OH HPHQGRX TXH SDUD PXGDU RV IRWROLWRV JUiÀFRV H WRGR R DFHUYR ELEOLRWHFiULR GRSDtVRFXVWRIRLGH5

PLOK}HV ´1mR YHMR QHQKXPD HYROXomRQLVVRµUHFODPRX 2~QLFRHORJLRTXH1HOVRQ IH] j UHIRUPD RUWRJUiÀFD IRL TXH IDFLOLWRX R XVR GR KtIHQ ´2 KtIHQ p R SLRU DVVXQWR GD OtQJXD SRUWXJXHVD IDFLOLWRX XP SRXFR PDV DLQGD ÀFRX FKDWRµGLVVH 0HVPR QmR FRQFRUGDQGR FRP DV QRYDV UHJUDV SDUD R SURIHVVRU R DGLDPHQWR GR QRYRDFRUGRQmRWHPVHQWLGR ´$ GHFLVmR SUHMXGLFRX TXHP HVWDYDVHJXLQGRDVQRYDVUHJUDVµSRQWXRX $%

FOLHAONLINE

Principais mudanças do acordo são referentes a hífen e acentos


12

CIDADES

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013

TRIBUNAINDEPENDENTE

Rotina extensa gera estresse infantil O mesmo pode ocorrer com a criança que passa muitas horas parada, na frente do computador ou da televisão

V

Festa dos anos 80

E

stå tudo pronto para a 4ª edição da IHVWDGRVDQRVTXHVHUiUHDOLDGD QRSUy[LPRGLDQR&OXEHGRV fumicultores. Segundo SÊrgio LúcioUHVSRQViYHOSHOR HYHQWRDIHVWDUH~QHDPLJRVGDHSRFDGDV matinÊs do tradicional Clube dos Fumicultores. ´$UDSLUDTXHQVHVTXHUHVLGHPHPRXWURV HVWDGRVHDWpPHVPRHPRXWURVSDLVHV SDUWLFLSDPGRHYHQWRTXHDFDEDVHWRUQDQGR XPDHVSpFLHGHFRQIUDWHUQL]DomR¾REVHUYRX6pUJLR/~FLRDGLDQWDQGRDVDWUDo}HVGHVWHDQR&LUFXLWR0XVLFDOGR51KRMH-RmR]LQKRH%DQGD6HDOpPGR'- Zarão.

ida de criança nem sempre Ê fåcil. A falta de amadurecimento GLÀFXOWD R SURFHVVDPHQWR de informaçþes desconhecidas. A inexperiência pode resultar em situaçþes conà LWDQWHV TXH SRGHP FDXVDU estresse. Casos desse tipo estão se tornando mais coPXQV H DV FULDQoDV HVWmR PDLV DJLWDGDV GH DFRUGR com a coordenadora do Ambulatório Geral do Centro de Referência da Infância e da Adolescência (Cria) da Universidade Federal de 6mR 3DXOR 8QLIHVS  9HUD Blondina Zimmermann. 6HJXQGR D HVSHFLDOLVWD o estresse infantil ocorre TXDQGR Ki XP GHVHTXLOtEULR QD SVLTXH GRV SHTXHQRV3DUDHODLVVRHVWiPDLV IUHTXHQWH SRUTXH D URWLQD IDPLOLDU ÀFRX PDLV FRUULGD H DV FULDQoDV DFDEDP ÀFDQGR PDLV OLYUHV SDVVDQGR muitas horas em frente ao computador ou à televisão.

Tal situação propicia o contato com assuntos descoQKHFLGRV TXH SRGHP FDXVDU FKRTXH FRPR LPDJHQV LQVLQXDQWHV RX H[SOtFLWDV de violência ou sexo. Outro exemplo disso Ê a imposição GH XPD URWLQD LQWHQVD SRLV o excesso de compromissos SRGH VHU RSUHVVRU DOpP GH limitar os momentos de descanso e brincadeiras. $V HYLGrQFLDV GH TXH RV SHTXHQRV HVWmR HVWUHVVDGRV VmRYDULiYHLVPDVHVWmRFDOcadas em mudanças comportamentais. De acordo com a SVLFyORJD D FULDQoD FRPHoD DDJLUGHIRUPDGLIHUHQFLDGD R TXH SRGH VHU IDODU PHQRV RXPDLVGRTXHQRUPDOPHQWH ÀFDU PDLV VHQVtYHO RX DJUHVVLYRHVWDUPDLVTXLHWR ou mais agitado. AlÊm disVRVLWXDo}HVFRPRSHVDGHORV IUHTXHQWHVGLÀFXOGDGHSDUD dormir ou sonolência excesVLYD DXPHQWR RX DXVrQFLD da fome e desânimo para EULQFDUSRGHPVHULQGtFLRV

AĂ?LTON VILLANOVA ailton.villanova@gmail.com

O Salvador da “PĂĄtriaâ€?

-

“NĂłs utilizamos os mĂŠtodos de Lutz, uma anĂĄlise qualitativa e de rotina, e o Kato Katz, que ĂŠ quantitativo, para a contabilização do nĂşmero de ovos no indivĂ­duo. Com esses mĂŠtodos, sabemos a carga parasitĂĄria aproximada na população analisada no estudo. Na regiĂŁo de Vila Altina, nĂłs realizamos exames em 300 pessoas, das quais 105 estĂŁo infectadas pelo S. mansoni. Esse resultado indica que 35% dos investigados possuem ovos do parasito distribuĂ­dos pelo organismo. Como mĂŠdica, posso prescrever o receituĂĄrio para as pessoas com os exames positivosâ€?, explicou a especialista.

HVXDOGR5LEHLURH8PEHUWR*XHUUHUDLPRUWDLVGRUiGLRDODJRDQRVHPSUHVHGHUDP DVPLOPDUDYLOKDV,QLFLDUDP -HVXDOGRSULPHLUR FRPRORFXWRUHVQD5iGLR'LIXVVRUDGH$ODJRDVTXDQGRHVWDIXQFLRQDYDQDUXD3HGUR0RQWHLURFHQWURGH0DFHLy (VVHVGRLVLOXVWUHVFRPSDQKHLURVVHPSUHĂ€JXUDUDPHQWUHRVPDLRUHVFDUWD]HVGDWHUUD FKHJDQGRLQFOXVLYHDPDQGDUQDDXGLrQFLDGDHPLVVRUDSLRQHLUDGRHVWDGRGXUDQWH mais de duas dĂŠcadas. 6DQWRGLDQmRVHVDEHSRUTXHFDUJDVG¡iJXD-HVXDOGRH8PEHUWRVHGHVHQWHQGHUDP HTXDVHFKHJDUDPjVYLDVGRIDWR$WXUPDGR´GHL[DGLVVRÂľLQWHUIHULXHPWHPSR6yQmR FRQVHJXLXHYLWDUDVP~WXDVDPHDoDVYHUEDLV7HPLDPFROHJDVPDLVFKHJDGRVDRVGRLV TXHRSUy[LPREDWHERFDSRGHULDUHVXOWDUHPFRQVHTXrQFLDVGUiVWLFDV(QWmRDWXUPD Ă€FRXQDTXHODH[SHFWDWLYDSULQFLSDOPHQWHSRUVDEHUTXH-HVXDOGRQXQFDGHL[RXGH FDUUHJDUjFLQWDXP´SDXGHIRJRÂľGRFDOLEUH(WDPEpPSRUTXHR*XHUUHUDSDVVDUDD andar armado com uma faca-peixeira de oito polegadas. 6HPDQDVVHVHJXLUDPHDGXSODPDQWHQGRGLVWkQFLD0DVDYLJLOkQFLDUHGREURXHP torno deles. $tYHLRRGLDHPTXHRORFXWRU5RODQG%HQDPRUTXHID]LDSDUFHULDFRP-HVXDOGR5LEHLURQDDSUHVHQWDomRGR*UDQGH-RUQDO'LIXVRUDQDVVXDVWUrVDXGLo}HVGLiULDVHQWURX GHIpULDV*XHUUHUDHUDR~QLFRGLVSRQtYHOSDUDVXEVWLWXtOR3UREOHPmRSDUDR:DJQHU 1RYDHVTXHDFXPXODYDDVIXQo}HVGHGLUHWRUDUWtVWLFRHORFXWRUFKHIH 1mRKDYLDRXWUDVDtGDRVGRLVWLQKDPPHVPRTXHVHHQFRQWUDUODGRDODGRQR PHVPRHVW~GLR 4XDQGRDQRYDHVFDODGHORFXWRUHVIRLDĂ€[DGDQDSRUWDULDGRDQGDUWpUUHRWHYHQHJXLnho tremendo nas bases. 3URQWR9DLFRPHoDUDWHUFHLUDJXHUUDPXQGLDOH[DJHURXRFRQWtQXR(VWHOLWR&RXWLQKRDVVLPTXHGHRUGHPGD'$DFDERXGHDĂ€[DUDEHQGLWDHVFDODQRORFDOUHIHUHQFLDGR 2FDQWRU(UQDQGH6LOYDDPLJRGDGXSODIRLTXHPPDLVVHSUHRFXSRXFRPDPHGLGD Correu pro gabinete do Novaes e apelou: 0HXLUPmRSHORDPRUGH'HXVHYLWHXPDGHVJUDoDHQWUHGRLVSDLVGHIDPtOLD(VVHV homens vĂŁo se acabar lĂĄ dentro! (R:DJQHUWUDQTXLOtVVLPRFRPRVHPSUH 1mRVHSUHRFXSH(UQDQGH$QWHVGDDSUHVHQWDomRGRQRWLFLiULRFRQYHUVDUHLFRPRV dois. E cumpriu a promessa. Chamou a dupla Ă s falas e se deu por satisfeito. Os desafetos QmRHPLWLUDPXP´DLÂľVHTXHU6DtUDPGDVDODGRGLUHWRUPXGRVHFDELVEDL[RV )DOWDYDPFLQFRPLQXWRVSDUDDDEHUWXUDGDSULPHLUDDXGLomRGR*UDQGH-RUQDO 'LIXVRUDTXHLDDRDUjVKHRVRQRWpFQLFR$GHOPLU3HUHLUDTXHDSUHFLDYDHPLWLUXQV ERFHMRVDQWHVGDLUUDGLDomRGRQRWLFLRVRDTXHODVDOWXUDVHVWDYDOLJDGtVVLPR&DGDEXWXFR de olho!... (PPHLRjTXHODWHQVmRHQWUD-HVXDOGR5LEHLURQRHVW~GLRFRPR´VFULSWÂľGRMRUQDO QDPmR8PEHUWR*XHUUHUDMiVHHQFRQWUDYDOiSRUTXHDVVXPLUDRPLFURIRQHPHLDKRUD DQWHVGDGRRIDWRGHTXHHUDRDSUHVHQWDGRUGHXPSURJUDPDGHP~VLFDVQDSROLWDQDV 6HPGL]HUSDODYUDDOJXPD-HVXDOGRSX[RXDFDGHLUDTXHVHDFKDYDDRODGRGR *XHUUHUDHDFRORFRXGHIUHQWHDHOH$QWHVGHVHQWDUVHSX[RXGDFLQWXUDRUHYyOYHUH depositou em cima da mesa de locução. *XHUUHUDDJLXHPUHSUHViOLDUHSHWLQGRRPHVPRJHVWRGRFROHJDOHYDQWRXVHDUUDVWRXDIDFDGRFyVGDFDOoDHMRJRXQDPHVD 'DFKDPDGD´FDELQHGHVRPÂľORFDOL]DGDQRRXWURH[WUHPRHVHSDUDGDSHORSDOFRGR DXGLWyULRRVRQRWpFQLFR$GHOPLU3HUHLUDDSDYRURXVH'HL[RXXPORQJSOD\JLUDQGRQR SUDWRGD´FRQVROHWHÂľDEDQGRQRXDFDELQHHGLVSDURXHVFDGDDEDL[RDRVJULWRV 3HVVRDO$FXGDDTXL(OHVYmRVHPDWDU ProvidĂŞncia Divina! Nesse momento vai entrando na emissora o tambĂŠm sonotĂŠcnico 6HEDVWLmR0DFKDGRR%DVWLQKRVTXDVHGRLVPHWURVGHDOWXUDHPDLVGHTXLORVGH SHVRTXHWDPEpPHUDJXDUGDFLYLOHVWDGXDO(PXLWRYDOHQWH 4XHPpTXHYDLVHPDWDU$GHOPLU"SHUJXQWRXMiHPSXQKDQGRXPDGDVDUPDVTXH costumava transportar - um “canela secaâ€? do calibre 38. 2-HVXDOGRHR8PEHUWR2VGRLVHVWmRDUPDGRV9DLOi%DVWLQKRDSHORXR Adelmir. - Deixa eles comigo! %DVWLQKRTXHDOpPGHVRQRWpFQLFRHJXDUGDFLYLOHUDSDLGHVDQWRVDFRXPDLVXPD DUPDGRVHXYDVWRUHSHUWyULR XPDSLVWROD HHPSXQKDQGRDVUHVSHFWLYDVHQWURXQR HVW~GLRSLVDQGRĂ€UPH,PyYHLVXPHQFDUDQGRRRXWUR-HVXDOGRH8PEHUWRHVWDYDPD SRQWRGHUHSHWLUDFOiVLFDFHQDGRGXHORQRIDUZHVW%DVWLQKRHQWmRIDORXEUDER 2TXHpTXHHVWiDFRQWHFHQGRSRUDTXLUDSD]HV"7iWXGREHP"3HODFDUDGRVGRLVW{ YHQGRTXHQmRWi3RULVVRYRXGL]HUXPDFRLVDSUDYRFrVVHFRPSRUWHPDSUHVHQWHP RVHXMRUQDO]LQKREHPGLUHLWLQKRTXHHXYRXĂ€FDUDTXLREVHUYDQGR2SULPHLURTXHVH PH[HUHPGLUHomRjVDUPDVHXSDVVRIRJR9DPRVFRPHFHP 1HVVDPDQKmR*UDQGH-RUQDO'LIXVRUDVDLXQRFDSULFKR 7HPSRVGHSRLVRVGRLVYROWDUDPDVHURVERQVDPLJRVGHDQWHV

NĂşmeros alarmantes

Este sim, ĂŠ o rĂĄdio!

Durante a elaboração desta matÊria, o grupo detectou a presença de 22 ovos do Schistosoma mansoni no exame de Lutz de um garoto de 12 anos. Em pesquisa anterior, realizada em 2011, os números foram ainda mais alarmantes. Na ocasião, 91% das 200 amostras de fezes coletadas em Vila Altina apresentaram infecção parasitåria. Esses dados indicam que 182 pessoas avaliadas possuíam algum tipo de parasito intestinal. AlÊm do responsåvel pela esquistossomose, outros vermes são detectados com frequência nos exames, como Ascaris lumbricoides, Enterobius vermicularis, Hymenolepis nana, Entamoeba histolytica e Ancilostomídeos.

Seu Jovelino Fragoso (seu Jovem) era um velhote meio mouco que residia na Pitanguinha. Todo dia, bem cedo, depois que acordava, colava o ouvido no rĂĄdio devido a sua surdez para escutar o tradicionalĂ­ssimo “ManhĂŁs Brasileirasâ€?, apresentado pelo EdĂŠcio Lopes. E tinha mais: o som era topado. Altura dos seiscentos mil diabos. QuarteirĂľes inteiros escutavam o rĂĄdio do velho Jovelino. Certo dia, um ratinho catita entrou no receptor do velhusco, levou um choque violento, morreu ÂłHOHWURFXWDGR´HÂżFRXOiGHFDQHOLQKDVHVWLFDGDV'RLVGLDVGHSRLVHVWDYDIHGHQGRSUDEXUUR De repente, baixou na residĂŞncia de seu Jovem um antigo amigĂŁo dele, seu Olibaldo França. Foi aquela festa, jĂĄ que os dois nĂŁo se viam hĂĄ um bom tempo. - Quem ĂŠ vivo aparece, nĂŠ Olibaldo? - manifestou seu Jovem - Entra pra cĂĄ, amigo velho. E o visitante, na base do berro: - TĂĄ escutando uma musiquinha nĂŠ? O mouquinho respondeu: 7{HVFXWDQGRRÂżQDGR/XL]*RQ]DJDDTXLQRSURJUDPDGR(GpOVR - Programa bom tĂĄ aĂ­, nĂŠ? - Ora se ĂŠ. É bom pra mais da conta. Se achegue mais pra escutar melhor, amigo velho. O visitante aproximou-se do rĂĄdio e sentiu a catinga do rato podre. EntĂŁo, abriu a boca para reclamar: - Esse seu rĂĄdio... Seu Jovelino nem deixou o amigo terminar de falar. Entrou de sola: - O rĂĄdio ĂŠ bom. Pega tudo! - É, tĂ´ vendo! Pega atĂŠ o bafo do cantor!

O caso Ê sÊrio A informação Ê da Ascom – Ufal: Como o próprio nome sugere, o estado de Alagoas Ê reconhecido pela presença marcante dos rios e das lagoas na vida de seus habitantes. No território alagoano, as åguas são fonte de lazer e de geração de renda. No entanto, tambÊm Ê em meio aquåtico que cresce o número de pessoas infectadas pelo parasito Schistosoma mansoni, que causa a doença Esquistossomose mansônica.

DIVULGAĂ‡ĂƒO

Pesquisa Sob a coordenação da mĂŠdica e professora Janira LĂşcia Couto, uma pesquisa desenvolvida no Instituto de CiĂŞncias BiolĂłgicas e da SaĂşde (ICBs) da Universidade Federal de Alagoas revela a existĂŞncia de zonas hiperendĂŞmicas na regiĂŁo. As ĂĄreas sĂŁo assoladas pelo elevado Ă­ndice de indivĂ­duos com esquistossomose, doença conhecida popularmente como “barriga d’åguaâ€?.

Esquistossomose De acordo com dados divulgados pela Secretaria de Estado da Saúde de Alagoas, 69% dos municípios alagoanos representam åreas endêmicas de esquistossomose, com manifestaçþes graves da doença e mortalidade atribuída à infecção. Em Alagoas, mais de 2,5 milhþes de pessoas vivem sob o risco de contaminação. No Laboratório de Esquistossomose e Malacologia (LEM), setor de Parasitologia e Patologia da Ufal, os resultados da anålise de exames realizados em crianças e jovens de 2 a 15 anos de idade preocupam pesquisadores da årea da saúde.

Santana do MundaĂş 6HJXQGR-DQLUD&RXWRRVtQGLFHVYHULÂżFDGRVQRVPXQLFtSLRVDODJRDQRVVXSHUDP os parâmetros da Organização Mundial da SaĂşde (OMS). “Em Santana do MundaĂş, desenvolvemos pesquisas com cerca de 690 indivĂ­duos. Durante dois anos de atividades, constatamos que a carga parasitĂĄria na regiĂŁo era muito alta, com uma mĂŠdia de 187,9 ovos de Schistosoma mansoni por grama de fezes.â€?

Taxa elevada “A OMS considera que a taxa de infecção de 5% jĂĄ ĂŠ elevada e no municĂ­pio ela chega a 27,72%â€?, revelou Janira. Esses dados foram publicados na Revista da Sociedade Brasileira de Medicina Tropical, em 2010, e permanecem semelhantes em diferentes cidades de Alagoas. Nos estudos mais recentes, as situaçþes de Capela, Rio Largo, Marechal Deodoro e MaceiĂł sĂŁo consideradas preocupantes. De acordo com a pesquisadora, os riscos sĂŁo ainda maiores com o acĂşmulo de ĂĄgua parada. “Na periferia da capital do Estado jĂĄ encontramos muito caramujos transmissores da doença infectados pelo parasito Schistosoma mansoni.

Ă guas paradas “O caramujo transmissor do parasito vive nas ĂĄguas paradas e poluĂ­das de canais e de valas com esgotos. Esses caramujos sĂŁo encontrados na zona da mata de Alagoas, mas agora tambĂŠm sĂŁo observados no litoral. Ressaltamos que hĂĄ prevalĂŞncia desses WUDQVPLVVRUHVHPFULDGRXURVDUWLÂżFLDLVFULDGRVSHORKRPHPFRPRSRoRVYDODVGH irrigação e açudesâ€?, alertou.

Pesquisadores Atualmente, a atenção dos pesquisadores estå voltada para a cidade de Marechal Deodoro. O grupo desenvolve trabalhos educativos em Vila Altina e em Taperaguå – povoados com elevado número de infectados –, realiza exames em jovens e em crianças da região e, em parceria com a Secretaria Municipal de Endemias, disponibiliza medicação aos indivíduos com diagnósticos positivos para a presença de ovos do Schistosoma mansoni nas amostras de fezes.

Carga parasitĂĄria

... Segundo a bolsista do projeto e aluna de Licenciatura em Biologia, JanaĂ­na Melo da Silva, as atividades vĂŁo alĂŠm da intervenção nos municĂ­pios. A estudante revela que o WUDEDOKRGHFRQVFLHQWL]DomRWDPEpPpLPSRUWDQWHSDUDDHÂżFiFLDGRSURMHWR ... “AlĂŠm dos exames que realizamos, nĂłs vamos Ă s escolas uma vez por semana e disponibilizamos jogos educativos, desenvolvemos dinâmicas e apresentamos vĂ­deos sobre o assuntoâ€?, reforçou. ... Tem marinheiro de primeira viagem, ou melhor, prefeito que assumiu o primeiro mandato que estĂĄ com muita sede. É que o “caraâ€? gastou muito dinheiro na campanha e, “penduradoâ€?, estĂĄ tentando arranjar um jeito de botar a mĂŁo na grana e se dar bem. Um aviso aos navegantes: os tempos sĂŁo outros e a cadeia estĂĄ de portas abertas para receber polĂ­ticos corruptos.

Atividades devem ser colocadas na rotina da criança com moderação


TRIBUNA,1'(3(1'(17(

Economia

0$&(,Ă?'20,1*2'(-$1(,52'(

ECONOMIA

13

RemÊdios contra glicose alta, sedativos e antidepressivos alteram consciência O diretor do Centro Brasileiro de Informação sobre Medicamentos (Cebrim), 5RJpULR+RHÀHUHQWLGDGHOLJDGDDR&RQVHOKR)HGHUDOGH)DUPiFLD &)) UHODcionou entre os remÊdios que podem fazer efeito ao volante os antidepressivos H[ÀXR[HWLQDDPLWULSWLOLQD DQVLROtWLFRVHVHGDWLYRV H[GLD]HSDPORUD]HSDP  2VDQWLDOpUJLFRVDQWLKLVWDPtQLFRV H[GH[FORUIHQLUDPLQD HDQWLFRQYXOVLYDQWHV H[FDUEDPD]HSLQDIHQREDUELWDO WDPEpPSRGHPRIHUHFHUULVFRDRVXVXiULRV TXHGLULJHPHOHQFD+RHÀHU³8VXiULRVGHPHGLFDPHQWRVTXHUHGX]HPRVQtYHLV de glicose no sangue (ex.: glibenclamida, gliclazida) podem ter episódios de KLSRJOLFHPLDRTXHWDPEpPDOWHUDRQtYHOGHFRQVFLrQFLD´FRQFOXLX

Lei Seca vai abranger medicamentos *RYHUQRSUHSDUDOHJLVODomRSDUDHYLWDUTXHGURJDVWHUDSrXWLFDVVHMDPWDPEpPDPHDoDjGLUHomRVHJXUDQRWUkQVLWR

A

nova Lei Seca, que endureceu a pena e dobrou o valor da multa para os motoristas embriagados, tambĂŠm pode punir quem misturar medicamentos e direção. O MinistĂŠrio das Cidades informou – por meio do Departamento Nacional de Trânsito (Denatran) – que prepara o texto da regulamentação para orientar a Ă€VFDOL]DomR Incluir as drogas terapĂŞuticas como ameaças Ă direção segura ĂŠ uma demanda antiga da Associação Brasileira de Medicina e TrĂĄfego (Abramet). Desde  D HQWLGDGH Mi UHDOL]D campanhas para alertar que alguns remĂŠdios tĂŞm efeitos parecidos com os do ĂĄlcool na condução de veĂ­culos. A nova lei seca – sancionada pela presidente Dilma Rousseff e jĂĄ vigente no PaĂ­s – estabelece que alĂŠm da ingestĂŁo de ĂĄlcool tamEpP SRGHP VHU SHQDOL]DGRV os motoristas que provocam acidentes e sĂŁo usuĂĄrios de substâncias psicoativas que causam dependĂŞncia. Neste grupo, estĂŁo contempladas as drogas ilĂ­citas, como maconha e cocaĂ­na, e tambĂŠm os remĂŠdios, principalmente os de uso controlado, chamados de tarja preta.

',98/*$d­2

Segundo os especialistas, usuĂĄrios de remĂŠdios que provocam sonolĂŞncia e comprometem a coordenação motora – ansiolĂ­ticos, antidepressivos, medicamentos para Parkinson e diabetes, alĂŠm de anfetaminas e antialĂŠrgicos – jĂĄ devem discutir com os mĂŠdicos que os prescrevem quais sĂŁo os possĂ­veis efeitos na condução de veĂ­culos e qual ĂŠ a dosagem mĂĄxima segura antes de dirigir. FISCALIZAĂ‡ĂƒO O MinistĂŠrio das Cidades informou que para padroni]DU H GHĂ€QLU D Ă€VFDOL]DomR do uso de medicamentos que tornam a condução de veĂ­culos perigosa, o Conselho Nacional de Trânsito (Contran) prepara uma regulamentação. Um grupo formado por especialistas em trĂĄfego e tĂŠcnicos do MinistĂŠrio da SaĂşde discute se ĂŠ necessĂĄULR GHĂ€QLU GRVDJHQV TXDLV UHPpGLRV IDUmR SDUWH GD Ă€VFDOL]DomR H RV H[DPHV FOtQLFRV TXH SRGHP FRQĂ€UPDU D presença destas substâncias no organismo. Por trĂĄs das 35 mil mortes registradas todos os anos no Brasil podem estar motoristas entorpecidos por medicamentos que nem imaginavam o perigo de misturar RemĂŠdios podem causar sonolĂŞncia e colocar em risco a vida do motorista e do pedestre no trânsito direção e remĂŠdio.

NO CONGRESSO

1RUPDVĂ€FDP prontas atĂŠ fevereiro

Ainda nĂŁo hĂĄ previsĂŁo exata para que a regulamentação saia do papel, mas a assessoria de imprensa do MinistĂŠrio GDV &LGDGHV GL] TXH HVWH DVsunto jĂĄ estĂĄ na pauta do Contran e estima que atĂŠ fevereiro as normas estejam prontas. Hugo Leal, deputado do PSC e um dos autores da Lei Seca, ĂŠ um dos defensores da inclusĂŁo dos medicamentos como potencias inimigos da direção segura. Segundo a equipe de Leal, o objetivo “nĂŁo ĂŠ punir o usuĂĄrio de medicamento, que ID]LVVRSRUQHFHVVLGDGHPDV alertar que as medicaçþes tambĂŠm podem ser perigosasâ€?, informou a assessoria de imprensa do deputado. “Caso os exames clĂ­nicos (que a partir de agora servem como prova da culpa no acidente) comprovarem que o uso dessas substâncias pelo condutor afetou a capacidade de dirigir, ele ĂŠ enquadrado com o mesmo rigor aplicado a quem estĂĄ embriagadoâ€?, completou a assessoria do deputado.


14

ECONOMIA

TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 20131

Viagem dos sonho exige planejamento antecipado eIXQGDPHQWDOGH¿QLURTXDQWRYDLJDVWDUSDUDHYLWDUDIRUPDomRGHGtYLGDV Não existe nada melhor do que viajar, certo? Provavelmente, você e boa parte dos leitores concordarão que viajar Ê uma das atividades mais prazerosas da vida. No entanto, quando falta planejamento uma viagem pode se tornar um verdadeiro pesadelo. Pensando HVSHFLÀFDPHQWH QD SDUWH Ànanceira, algumas questþes precisam ser levadas muito a sÊrio para que o sonho não se transforme em dor de cabeça (e para que eventuais problemas não durem muito tempo). Independente do lugar para onde você pretende viaMDU p IXQGDPHQWDO GHÀQLU o quanto irå gastar. Depois

disso, Ê hora de olhar no orçamento e avaliar quanto tempo serå necessårio (e quanto serå poupado por mês) para acumular o montante necessårio (ou a maior parte), evitando assim que a viagem se transforme em uma dívida muito longa. EXTERIOR Se a viagem Ê para o exterior, um dos pontos mais importantes Ê saberque você SUHFLVDUi GHÀQLU D IRUPD GH pagamento que serå maisutilizada. Para isso, não faltarão opçþes: cartþes de crÊdito; cartþes de dÊbito;moeda local;cartãoprÊ-pago. Se sua opção costumeira Ê a utilização do cartão de

crĂŠdito, para compras no exterior ĂŠ bom saber que a variação cambial obedecerĂĄ ao fechamento de sua fatura e nĂŁo ao dia da compra. Outro ponto que precisa ser considerado ĂŠ a incidĂŞncia de 6% de IOF (Imposto sobre Operaçþes Financeiras). Os cartĂľes prĂŠ-pagos possuem algumas facilidades interessantes do ponto de vista de administração do dinheiro usado na viagem. VocĂŞ sabe exatamente quanto irĂĄ gastar (jĂĄ que o cartĂŁo ĂŠ prĂŠ-pago e vocĂŞ o“carregouâ€? com dinheiro antes da viagem) e a alĂ­quota de IOF ĂŠ menor:0,38% nessa modalidade. Vale ressaltar que vocĂŞ poderĂĄ, a qualquer

momento, realizar uma nova recarga, inclusive durante a viagem. Mesmo com a utilização de um dos tipos de cartão, Ê sempre prudente levar algum dinheiro em espÊcie para a viagem. A melhor opção para fugir das variaçþes abruptas Ê a compra mensal da moeda estrangeira,pouco a pouco, durante os meses que antecedem a viagem. Dessa forma, aoscilação não se torna um perigo para o bolso. É muito importante tamEpP FRQÀUPDU WRGRV RV GHtalhes referentes à viagem, FRPR R ORFDO RQGH ÀFDUi hospedado e os detalhes das passagens.

Planejamento ĂŠ fundamental na organização da viagem de fĂŠrias DIVULGAĂ‡ĂƒO

FILHOS DE COOPERADOS

Pindorama realiza colônia de fÊrias A partir desta segunda-feira (7), as crianças do povoado de Pindorama, em Coruripe, terão um espaço reservado para diversão e aprendizado durante o período das fÊrias. O Centro de Treinamento Rural de Pindorama (Cetrup) promove, atÊ o dia 31 desse mês, uma colônia de fÊrias SDUDRVÀOKRVGRVFRODERUDGRres e associados da Cooperativa Pindorama. Cerca de 40 crianças entre 8 e 12 anos, participam do projeto. Uma das atividades que compþem a programação Ê o plantio na horta orgânica do Cetrup. Os pequenos de-

vem acompanhar durante um mĂŞs, o desenvolvimento das hortaliças. 2V DGROHVFHQWHV TXH Ă€]Hram parte do projeto O AmanhĂŁ de Pindorama, programa que capacita jovens entre 14 e 21 anos na atividade agrĂ­cola (horticultura), monitorarĂŁo as crianças. “Todos os colaboradores da Cooperativa estĂŁo envolvidos nesse projeto. Vamos fazer de tudo para que as crianças sejam bem acolhiGDVÂľ DĂ€UPD D FRRUGHQDGRUD do projeto, Janieide Pereira Lima. A programação conta ainda com um passeio ecolĂłgico

nas comunidades, onde são produzidas as frutas que servem como matÊria prima para a fabricação dos produtos da Cooperativa. Na ocasião, as crianças visitarão algumas reservas ecológicas do município. TambÊm estão na programação atividades recreativas, atividades esportivas, cinema, narração de histórias, brincaGHLUDV SRSXODUHV RÀFLQDV GH desenho, produção artesanal, música e dança. BALANÇO Inovação seria a palavra certa para descrever a retrospectiva do ano de 2012 da

Cooperativa Pindorama. Por meio de uma incrível consolidação de novos produtos da PDUFD FRP XP ROKDU VLJQLÀcativo para o setor comercial, foram realizadas novas parcerias e a identidade da Cooperativa se fortaleceu ainda mais, tanto em Alagoas como em todo o país. PIMENTA O plantio da pimenta foi o alento para pequenos proGXWRUHV LQWHQVLÀFDUHP VXD renda. Cerca de 20 associados HVWmR VHQGR EHQHÀFLDGRV FRP 250 mudas de pimenta cada um, as quais são plantadas em suas respectivas lavouras. Cooperativa Pindorama promove colônia de fÊrias para crianças


TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013

ESPORTES 15

Quem serĂĄ o melhor do mundo de 2012? CerimĂ´nia que escolherĂĄ o ‘jogador bola de ouro’ acontece nesta segunda; Messi, Cristiano Ronaldo e Iniesta na disputa

O

carpete vermelho onde vĂŁo pisar as maiores estrelas do futebol mundial, nesta segundafeira, Ă s 16h (em MaceiĂł) ainda ĂŠ apenas um tablado preto com restos de madeira. 1HVWH Ă€QDO GH VHPDQD HP Zurique, na Suíça, cerca de 15 trabalhadores prepararam um luxuoso hotel para receber AndrĂŠs Iniesta, Cristiano Ronaldo, Lionel Messi, 1H\PDU H WRGDV DV Ă€JXUDV que participam da cerimĂ´nia de gala para a Bola de Ouro referente Ă  temporada 2012. Com tranquilidade e ritmo lento, os trabalhadores organizaram a infraestrutura do Kongress Haus, onde estarĂŁo nĂŁo apenas os jogadores e treinadores, mas tambĂŠm dirigentes e jornalistas de todos os continentes. O tradicional carpete vermelho que remete ao Oscar serĂĄ montado. (P VXD SiJLQD RĂ€FLDO D Fifa anuncia uma cerimĂ´nia “como nunca se viuâ€?. Pela pri-

TERRA

meira vez, o trofÊu de melhores do ano no futebol mundial terå transmissão ao vivo pela internet com entrevistas dos participantes, caso do brasileiro Neymar. O atacante do Santos concorre ao bicampeonato do Prêmio Puskas, entregue ao dono do gol mais bonito da temporada. Ele e demais jogadores têm programação controlada pela Fifa em Zurique, inclusive com entrevistas vetadas a outros veículos. Nos demais pontos principais da cidade sede da Fifa não hå mençþes à Bola de Ouro, que irå premiar as seguintes categorias: melhor jogador e melhor jogadora do ano, melhor treinador de futebol (masculino e feminino), gol mais boQLWRJHVWRPDLVVLJQLÀFDWLYRGH Fair Play e ainda a seleção de 2012. Nesta última categoria, hå cinco brasileiros entre os 55 ÀQDOLVWDV 'DQLHO $OYHV %DUcelona), Thiago Silva (PSG), 'DYLG/XL] &KHOVHD 0DUFHOR (Real) e Neymar (Santos). Lionel Messi, Cristiano Ronaldo e Andres Iniesta estão na disputa pela bola de ouro 2012 e o grande favorito segue sendo o argentino

ALAGOANA

Marta curtiu fĂŠrias em casa e estĂĄ pessimista para o prĂŞmio TERRA

Finalista pela nona vez consecutiva na disputa pela Bola de Ouro da Fifa (Federação Internacional de Futebol Associado), a meia-atacante alagoana Marta destacou que não serå fåcil conquistar o prêmio nesta temporada. 'HWHQWRUDGRWURIpXHP 2007, 2008, 2009 e 2010, a atleta teme que o desempenho coletivo do Brasil neste ano atrapalhe na disputa FRPDVRXWUDVGXDVÀQDOLVWDV as norte-americanas Abby Wambach e Alex Morgan. A Seleção Brasileira suFXPELX QDV TXDUWDV GH ÀQDO dos Jogos Olímpicos de Lon-

dres diante do JapĂŁo. JĂĄ os Estados Unidos chegou ao lugar mais alto do pĂłdio ao derrotar as atuais campeĂŁs PXQGLDLV SRU  D  QD Ă€QDO Wambach foi a vice-artilheira na competição em territĂłrio inglĂŞs, com cinco gols, atrĂĄs da canadense Christine Sinclair, com seis gols. Marta, assim como Alex Morgan, marcou trĂŞs gols ao longo do torneio. â€œĂ‰ uma grande vitĂłria estar entre as trĂŞs. É muito EDFDQD H JUDWLĂ€FDQWH LU WRdos os anos na premiação. É Ăłbvio que trabalho para ganhar. Quem nĂŁo quer re-

ceber um trofĂŠu de tamanha importância como esse? Mas ĂŠ complicado, ĂŠ um ano de Jogos OlĂ­mpicos, e conta o desempenho geral da equipeâ€?, analisou. Marta estava semana passada em Alagoas para rever a famĂ­lia no interior e aproveitar as belas praias. “Todos os anos venho a Alagoas para matar a saudade dos amigos H GD FLGDGH GH 'RLV 5LDFKRV 'HVVD YH] DSURYHLWHL SDUD trazer uns amigos para conhecer as nossas praiasâ€?. A jogadora alagoana, que atualmente joga no time sueco TyresĂś FF, falou que a

rotina de trabalho estå mais tranquila por conta de uma lesão que ela sofreu e que terminou tirando a atleta dos treinamentos. Segundo a própria jogadora, não foi nada grave, mas requer cuidados. ´0H FRQWXQGL QR ÀQDO GR ano passado, quando disputava um torneio com a Seleção. 'DTXL D XQV GH] GLDV GHYR começar a fazer uns treinamentos leves e um mês jå devo voltar a treinar normalmente. Nesta segunda-feira, ela Marta concorre novamente ao prêmio de melhor jogadora do mundo, em Zurique.

LUTAS

Jon Jones ĂŠ eleito o melhor de 2012

Alagoana Marta vai para Suíça tentar mais um título individual

Segundo o site da rede americana ESPN, o americano Jon Jones foi o melhor lutador de MMA (sigla em inglĂŞs para artes marciais mistas) de 2012. Ele ĂŠ o campeĂŁo dos meio-pesados do UFC e defendeu o cinturĂŁo duas vezes na Ăşltima temporada. O brasileiro Anderson Silva nĂŁo foi citado. A escolha foi divulgada no blog do comentarista Franklin McNeil. “Um punhado de lutadores pode argumentar

que teve uma melhor performance individual geral que Jones durante os últimos 12 meses – Benson Henderson, 'HPHWULRXV -RKQVRQ H &DLQ Velasquez vêm imediatamente à mente –, mas nenhum LQà XHQFLRXPDLVGHQWURHIRUD do octógono�, escreve ele. O texto recorda que o americano defendeu o cinturão dos meio-pesados duas vezes em 2012, superando Rashad Evans e Vitor Belfort. O brasileiro Anderson Silva, que G1

FUTEBOL DE AREIA

Jr. NegĂŁo assume Brasil com missĂŁo de ‘recuperar alegria’ Segundo maior artilheiro da histĂłria da seleção brasileira de futebol de areia, com 318 gols, JĂşnior 1HJmR DVVXPLX RĂ€FLDOPHQte o cargo de treinador da equipe. Irreverente, o ex-jogador marcou a â€œĂŠpoca de ouroâ€? da modalidade, ao lado de craques como Zico, JĂşnior, Claudio AdĂŁo, Paulo SĂŠrgio e Edinho. ApĂłs 15 anos vestindo a amarelinha dentro de quadra, ele volta com uma difĂ­cil missĂŁo: recuperar a hegemonia mundial. Nas areias do Leme, o grupo de 25 atletas convocados realizou o primeiro treino da temporada 2013. O inĂ­cio do trabalho serĂĄ voltado para os primeiros quatro torneios internacionais da equipe: Copa AmĂŠrica (18 a 20 de janeiro, em Santos), Copa

das Naçþes (25 a 27 de janeiro, tambĂŠm em Santos), 3ÂŞ Copa Ciudad de EncarnaciĂłn (2 a 4 de fevereiro, no Paraguai) e eliminatĂłrias sul-americanas (10 a 17 de fevereiro, na Argentina). O PDLRUGHVDĂ€RGRDQRYDLVHU a Copa do Mundo, de 18 a 28 de setembro, no Taiti, onde o paĂ­s irĂĄ buscar o pentacampeonato. Mesclar a juventude e a experiĂŞncia serĂĄ a receita do sucesso da nova era da seleção brasileira, aliada a uma intensa preparação. “Os mais novos precisam se juntar aos mais velhos. NinguĂŠm tem vaga garantida e eu vou dar oportunidades reais a todos os 25 jogadores. NĂŁo vai ter panela. Vamos selecionar aqueles que alcançarem o melhor desempenho nos treinosâ€?.

venceu suas duas lutas da temporada, nĂŁo foi mencionado pelo comentarista, mas ocupa a liderança do ranking da modalidade da emissora, Ă frente de Jones. O site da rede elegeu tambĂŠm o melhor nocaute de 2012, categoria vencida por um brasileiro. Trata-se de Edson Barboza, que acertou um chute rodado para cima de Terry Etim no UFC Rio 2. “Mesmo em câmera lenta, a propulsĂŁo e a compostu-

ra do chute de Barboza são notåceis. Você não vê uma execução perfeita como essa frequentemente�, avaliou o comentarista Chuck Mindenhall, citando o nocaute de Barboza. A emissora indicou tambÊm a melhor luta do ano – a que envolveu Benson Henderson e Frankie Edgar pelo título dos leves, na qual o atual campeão Henderson venceu por decisão unânime dos juízes.

CONTRATADO

SĂŁo Paulo corre para tirar zagueiro Breno da cadeia

Júnior Negão assume comando da seleção de futebol de areia

Com contrato registrado com Breno atÊ outubro de 2015, o São Paulo agora corre atrås da libertação do zagueiro, que estå preso na AlemaQKD'HDFRUGRFRPRMRUnal O Estado de S. Paulo, o presidente do clube tricolor, Juvenal Juvêncio, chegou atÊ a pedir para o ministro do Esporte, Aldo Rebelo, envolver o governo federal no caso e agilizar a soltura do jogador, que estå na cadeia desde julho do ano passado. Breno foi preso por provocar um incêndio na própria casa em setembro de 2011, quando defendia o Bayern de Munique e passava por uma sÊrie de problemas SHVVRDLVHSURÀVVLRQDLV

AlĂŠm do contato com Rebelo, Juvenal mantĂŠm conversas constantes com a embaixada brasileira na Alemanha para tentar na Justiça local a libertação do zagueiro. A intenção do dirigente ĂŠ ter Breno Ă disposição para jogar ainda no primeiro semestre, formando a defesa ao lado do experiente e recĂŠm-contratado LĂşcio. Atualmente, o contrato do atleta com o SĂŁo Paulo tem um “salĂĄrio mĂłdico, a tĂ­tulo de ajuda e reconhecimentoâ€?, nas palavras do vice-presidente administrativo Carlos Augusto de Barros e Silva, o Leco. Com a camisa tricolor, o zagueiro, hoje com 23 anos, foi campeĂŁo brasileiro em 2007.


16

ESPORTES

0$&(,Ă?'20,1*2'(-$1(,52'(

Esportes

TRIBUNA,1'(3(1'(17(

Começa mais uma edição do Projeto *RO¿QKRQD3UDLDGH3DMXoDUD Nesta segunda-feira (7), a praia de Pajuçara serå palco de uma grande colônia de fÊrias realizada entre uma parceria do Corpo de Bombeiros e a Braskem: o 3URMHWR*RO¿QKR$LQLFLDWLYDREMHWLYDSURPRYHUOD]HUHHGXFDomRSDUDDV FULDQoDVGH0DFHLyTXHIRUDPLQVFULWDVHQWUHHODVFULDQoDVFDUHQWHVGHSURMHWRV VRFLDLVFRPRR3URMHWR$FROKHUHR&HQWURGH5HIHUrQFLDGH$VVLVWrQFLD6RFLDO 6DQWRV'XPRQW&RPSDUWLFLSDQWHVHQWUHHDQRVVHUmRIHLWRVWUrVJUXSRVGLYLGLGRVSRUIDL[DHWiULDTXHDVVLVWLUmRDSDOHVWUDVVREUHYLROrQFLDEXOO\QJFXLGDGRVFRPVD~GHPHLRDPELHQWHFLYLVPRHSDWULRWLVPRDOpPGHDXODVSUiWLFDVGH QRomRGHVDOYDPHQWRDTXiWLFRFRPEDWHDLQFrQGLRHDWHQGLPHQWRSUpKRVSLWDODU

Heriberto aplica primeiro coletivo do CRB $SyVGXDVVHPDQDVGHLQWHQVRVWUDEDOKRVItVLFRVWpFQLFRUHJDWLDQRFRPHoDDSHQVDUQRGHVHQKRWiWLFRHQRVWLWXODUHV

T

udo Ê novidade no CRB. Do atual plantel, metade são reforços e a outra metade uma mescla de jogadores remanescentes da SÊrie B e garotos da base. Com esse material humano nas mãos, o tÊcnico Heriberto da Cunha faz neste domingo pela manhã o primeiro coletivo do Galo na temporada 2013. Pelo histórico recente do treinador, o esquema adotado deve ser o 3-5-2, com um meia de mais liberdade para chegar nos atacantes. Em quase todas as posiçþes, a briga deve ser grande pela titularidade. Apenas na lateral-esquerda, o novato João Victor não tem adversårio de posição. No gol, Cristiano terminou a temporada como titular mas nunca foi unanimidade na Pajuçara. Tiago chega com muita força para ser o camisa um e ainda Heriberto cogita trazer outro

-81,25'(0(/2$6&20&5%

JROHLURGHVXDFRQĂ€DQoD No setor de zaga o entrosamento de Filipe e RodrigĂŁo pode pesar na escolha. O terceiro homem pode ser Airton ou Eduardo Ferreira. Os jovens Rafael e Yuri correm por fora. Na ala direita KakĂĄ foi contratado para ser um ‘novo’ Elsinho. Mas o jovem Paulo Fernando tem JUDQGHFRQĂ€DQoDGDGLUHomR e pode surpreender. No meio-campo, sĂŁo muitos volantes e muitos meias de criação disputando trĂŞs vagas. Com caracterĂ­sticas de marcação estĂŁo Paulo VĂ­tor Paulista, Ederson, Diego AragĂŁo e Johnnatthan. Com mais habilidade Cristiano Brasilia, Pauli Victor, Jairo e Marcos Antonio. No ataque Liliu deve ser XP GRV KRPHQV GH FRQĂ€DQça do treinador. Com a saĂ­da precoce de Hugo e a contusĂŁo de Matheus, Jeorge deve herdar a outra vaga de titular nesse setor. CRB fazQHVWHGRPLQJRRSULPHLURWUDEDOKRFROHWLYRGDWHPSRUDGDHWpFQLFR+HULEHUWRGD&XQKDYDLHVFROKHURVSULPHLURVWLWXODUHV */2%2(63257(

AZULĂƒO

CSA ainda trabalha por mais reforços $WDFDQWH0HQGHVSRGHFKHJDUHP0DFHLyQHVWHGRPLQJRGLUHomRQmRFRQ¿UPD

0DWKHXV)HUQDQGHVpDSUHVHQWDGRQR&6$HHVWUDQKDRFOLPD

O atacante Mendes, de 36 anos, que disputou o último Campeonato Brasileiro da sÊrie D pelo Remo-PA, pode ser o novo reforço do CSA. Segundo informaçþes da Rådio Jornal o atleta pode desembarcar em Maceió neste domingo, para concretizar o acerto com o azulão e ser apresentado RÀFLDOPHQWH Em pouco mais de três meses defendendo o Remo-PA, Mendes marcou apenas dois gols. Saiu do

clube paraense com fama de jogador “descaradoâ€?. O salĂĄrio do atacante girava em torno de R$ 13 mil e isso pode ser um fator que distancie a contratação. A direção do CSA nĂŁo FRQĂ€UPDRDFHUWRPDVGL] que continua trabalhando por reforços. “O trabalho nĂŁo para. Vamos ter essa semana uma conversa com o Lorival [Santos, treinador] para que ele nos dĂŞ um balanço parcial do elenco e quais posiçþes

estão mais carentes de reforços�, disse o presidente Jorge VI. O último que chegou ao Mutange foi o lateral catarinense Matheus Fernandes. Ele desembarcou em Maceió e jå estranhou o clima quente da capital alagoana. Acostumado com o clima frio da região Sul, o lateral-direito se assustou um pouco com a temperatura elevada de Maceió. Mas jå adiantou que o calor não vai atra-

palhar o seu desempenho em campo. â€œĂ‰ muito quente. No meu primeiro dia aqui, assim que desci no aeroporto senti o calor. Muito diferente lĂĄ do Sul. Mas jĂĄ estou me adaptandoâ€?, disse o jogador ao G1. Esta serĂĄ a Ăşltima semana de treinamentos para o CSA. No prĂłximo sĂĄbado (12), o clube estreia no Alagoano 2013 diante do Comercial de Viçosa, no EstĂĄdio Teotonio Vilela, Ă s 15h.

',98/*$d­2

CRAQUE

TimĂŁo-AL aposta tudo em Thiago Silva

7KLDJR6LOYD H[SRWLJXDU pRQRYRUHIRUoRGR&RULQWKLDQV$ODJRDQR ',98/*$d­2

Cobiçado por muitos clubes do Nordeste, um jogador de destaque no cenårio nacional serå a aposta do Corinthians alagoano para temporada 2013. A diretoria do Timão-AL acertou com mais uma contratação de peso para o Estadual. Depois de trazer o meia Branquinho, campeão pernambucano pelo Santa Cruz no ano passado, e o experiente Ezequias que estava no Ra-

pid Bucarest da Romênia, o departamento de futebol fechou a contratação do meia Thiago Potiguar, que foi destaque do Paysandu na SÊrie C do Brasileiro. Depois da brilhante campanha pelo clube do Parå, o jogador passou a receber vårias propostas de clubes do Nordeste, como Fortaleza, Nåutico, Sport e Santa Cruz, alÊm de outros clubes como a Catanduvense-SP e o

Flamengo-RJ, mas o jogador optou em se transferir para o Corinthians de Alagoas, pelo fato de querer seguir os mesmos passos de atletas consagrados que passaram no Tricolor e hoje estĂŁo vestindo a camisa de grandes clubes da Europa e do futebol mundial. O jogador jĂĄ se apresentou e iniciou os treinamentos fĂ­sicos no CT da Via Expressa. A assessoria do clube infor-

mou que Thiago agora quer ser chamado de maneira diferente. “O Thiago ĂŠ do Corinthians. O jogador jĂĄ estĂĄ Ă disposição do treinador. O passe dele agora ĂŠ vinculado ao clube. O atleta inclusive nĂŁo serĂĄ chamado por Thiago Potiguar, mas sim, por Thiago Silvaâ€?, disse o assessor Wyderlar AraĂşjo. O Corinthians-AL estreia no Campeonato Estadual no dia 13, Ă s 16h, diante do Murici, em Murici.

COPA SĂƒO PAULO JR.

ASA estreia hoje contra Francana-SP

ASA WHUiGHMRJDUPXLWDERODSDUDYHQFHURVGHVDÂżRVQD&RSLQKD

Os meninos do ASA começam neste domingo a disputa na Copa São Paulo de Juniores. O duelo serå às 13h (em Maceió) contra o time da Francana. O ASA estå na Chave I, com sede em Franca, e pega ainda AtlÊtico-PR e Barras-PI. De acordo com o regulamento da competição, o primeiro colocado de cada chave e os sete melhores segundos colocados, inde-

pendentemente de grupos, passam de fase e iniciam a etapa de partidas eliminatórias. Na segunda fase, se houver empate no tempo QRUPDORFODVVLÀFDGRYDLVHU conhecido nos pênaltis. A delegação foi de ônibus de Arapiraca atÊ o interior paulista e, segundo informação por telefone do coordenador de base Gilvan do Carmo, a viagem, apesar de cansativa, foi tranquila.

OUTROS JOGOS SumarĂŠ x SĂŁo Raimundo CearĂĄ x Santa Cruz-PE Internacional x Paulista Penapolense x NĂĄutico Monte Azul x ABC Lemense x Guarany-SE SĂŁo Bernardo x Lideral D.Brasil x AmĂŠrica-RN Velo Clube x ItaĂşna Atibaia x Red Bull Brasil Flamengo-SP x Juventus UniĂŁo SĂŁo JoĂŁo x Americano GrĂŞmio x Aquidauanense

Figueirense x FerroviĂĄria Juventude x Portuguesa AtlĂŠtico-PR x Barras-PI VitĂłria x Mogi Mirim GoiĂĄs x Guarani Fortaleza x Caxias AvaĂ­ x AtlĂŠtico-GO Fluminense x AtlĂŠtico-AC Sport x GuaratinguetĂĄ AmĂŠrica-MG x Vila Nova ParanĂĄ x Ponte Preta Linense x Rio Preto Corinthians x XV Piracicaba AtlĂŠtico-MG x Noroeste


TRIBUNAINDEPENDENTE

0$&(,Ă?'20,1*2'(-$1(,52'( VEĂ?CULOS 17

VeĂ­culos

Abra as janelas antes de ligar o ar-condicionado do carro 9RFrUHSDURXTXHTXDQGRRFDUUR¿FDIHFKDGRDWHPSHUDWXUD VREHUDSLGDPHQWH"1DVRPEUDGXUDQWHRGLDFRPDVMDQHODV IHFKDGDVRLQWHULRUGRFDUURSRGHFRQWHUHQWUHHPJ GHEHQ]HQR1RVRODWHPSHUDWXUDDFLPDGHž&RQtYHOGH EHQ]HQRVREHSDUDDPJ2EHQ]HQROLEHUDGRGR SDLQHOHGHRXWUDVSDUWHVGHSOiVWLFRpXPDWR[LQDTXHDIHWDR ULPHRItJDGR3RULVVRDUHFRPHQGDomRpGHL[DUDVMDQHODV DEHUWDVSRUDOJXQVPLQXWRVDQWHVGHOLJDURDUFRQGLFLRQDGR 'HSRLVGRDUTXHQWHVDLUpTXHYRFrOLJDRDUHIHFKDMDQHODV

Ford Fusion Ê destaque em segurança

*UDGXDomRH[WUDQDDYDOLDomRIHLWDQRYHtFXORIRL DOFDQoDGDSHODERDSURWHomRRIHUHFLGDDRVRFXSDQWHV

MELHOR

Chevrolet Spin coleciona prĂŞmios O Chevrolet Spin fechou o ano de 2012 com mais um prĂŞmio. Desta vez foi escolhido como o “Melhor VeĂ­culo Familiarâ€?, na eleição “Os Melhores do Anoâ€?, da agĂŞncia Auto Press. Modelo jĂĄ tinha conquistado o prĂŞmio de melhor minivan pelos jornalistas da Abiauto – Associação Brasileira da Imprensa Automotiva. O Chevrolet Spin foi eleito por um jĂşri formado por editores especializados em automĂłveis de jornais e portais, que publicam o conteĂş-

do editorial automotivo da agência Auto Press. O prêmio foi entregue em dezembro, no Rio de Janeiro. Na categoria do qual participou o Spin, o modelo da Chevrolet obteve 69% dos votos dos jornalistas votantes – foi a maior votação obtida por um modelo em todas as categorias do prêmio. Segundo o diretor de Comunicação Social da General Motors do Brasil, Pedro Luiz Dias, o fato de o Chevrolet Spin ter conquistado prêmios importantes reforça

O

Ford Fusion 2013 obWHYH D FODVVLĂ€FDomR mais alta de segurança, o “Top Safety Pick+â€?, em um novo teste de colisĂŁo dianteira com sobreposição parcial realizado pelo Institute for Highway Safety o sucesso do modelo no mer- (IIHS), organização indecado brasileiro. pendente de segurança do “Estes prĂŞmios sĂŁo bas- trânsito dos Estados UniWDQWH VLJQLĂ€FDWLYRV SRLV dos. O carro jĂĄ havia recebirepresentam o reconheci- do em novembro o selo “Top mento ao nosso programa Safety Pickâ€?. de renovação do portifĂłlio Para alcançar a graduade veĂ­culos, que teve sete ção “maisâ€? do teste, os veĂ­cumodelos totalmente novos los tĂŞm de apresentar bons lançados em 2012, alĂŠm da Ă­ndices de proteção para os modernização e ampliação ocupantes em pelo menos industrial das nossas unida- quatro das cinco avaliaçþes desâ€?, destacou o executivo. do IIHS, com nota nĂŁo infePedro Luiz Dias lembra rior a razoĂĄvel. O instituto que a GM do Brasil comple- FODVVLĂ€FDRVYHtFXORVFRPDV tarĂĄ 88 anos de atividades notas bom, razoĂĄvel, fraco e no paĂ­s no prĂłximo dia 26. ruim, com base no desem-

FUSION 2013 traz sistema de segurança que inclui novas tecnologias de cintos de segurança e airbags

penho em testes de colisão dianteira moderada e pequena, com sobreposição parcial, alÊm de impacto lateral, capotagem e proteção dos bancos e apoios de cabeça contra danos ao pescoço em colisão traseira. O Fusion 2013 traz um sistema de segurança pessoal que inclui novas tecnologias de cintos de segurança e airbags dianteiros e laterais. Ele Ê formado por uma rede de componentes que atua de modo integrado para adequar o disparo dos airbags em colisþes dianteiras. Um módulo de controle de contenção processa as informaçþes coletadas pelos sensores. A partir desses dados, o módulo ativa os prÊ-tensio-

nadores dos cintos de segurança e determina a estratÊgia de acionamento dos airbags de duplo estågio. Esse disparo sob medida Ê projetado para oferecer a SURWHomR PDLV HÀFLHQWH DRV ocupantes, de acordo com seu tamanho e com a posição dos bancos. Os airbags laterais, montados nos bancos, são projetados para proteger a årea da bacia com nova tecnologia de enchimento, que muda de acordo com a altura do ocupante. $EROVDLQà iYHOGRPRWRrista conta com um sistema de amarração curvilíneo, que resulta em menor impacto sobre o peito e as costelas nos impactos frontais. O motorista tambÊm conta com airbag de joelho.


18

VEĂ?CULOS 0$&(,Ă?'20,1*2'(-$1(,52'(

TRIBUNAINDEPENDENTE

Modelo chega às concessionårias da marca para atrair os motociclistas que buscam uma motocicleta para uso misto ou para trajetos de longa distância com grande desempenho, segurança e pilotagem

VRF 1200X ĂŠ uma estradeira versĂĄtil Representante da categoria “Big On Off Touringâ€?, modelo quer atrair os que buscam uma motocicleta para uso misto

Q

uando foi apresentado como apenas um protótipo Crosstourer no Salão de Milão em 2010, o modelo jå chamou atenção do público por suas características e vocação estradeira. A primeira impressão foi tão positiva que a Honda traz agora para o mercado nacional a VFR 1200X Crosstourer, que passa a ser comercializada como modelo importado nas conces-

sionĂĄrias Honda a partir de outubro deste ano. O modelo chega ao Brasil para atrair os motociclistas que buscam uma motocicleta versĂĄtil e de pilotagem prazerosa. A VRF 1200X Crosstourer combina tecnologia e design inovador. Representante da categoria “Big On Off Touringâ€?, ĂŠ ideal para quem busca uma motocicleta para uso misto ou trajetos de longa distân-

cia com grande desempenho e segurança. Entre os seus principais atributos estå o moderno motor V4 de 1.236,7 cm3, equipando pela primeira vez uma motocicleta de vocação aventureira. Compacto e HÀFLHQWH R PRWRU DVVHJXUD excelente desempenho e potência. Outro grande diferencial Ê o sistema de transmissão eletrônica de dupla embre-

agem (DCT – Dual Clutch Transmission), oferecendo condução por controle manual ou totalmente automåtico. É equipada ainda com o inovador sistema de controle de tração que, aliado com os freios C-ABS, permitem uma pilotagem segura em qualquer terreno. Esses e outros detalhes, juntamente com o design LPSRQHQWH H VRÀVWLFDGR resultaram em uma moto-

cicleta que representa um grande avanço para o futuro do motociclismo, e supera as expectativas dos consumidores. A VFR 1200X Crosstourer entra para o line-up dos modelos de conceito Honda Dream, que abrangem motocicletas acima de 450 cc. A Honda pensou em cada detalhe ao projetar a VFR 1200X Crosstourer. Seu design foi inspirado na linha VFR e transmite um estilo

imponente e agressivo. Na parte frontal o destaque estå no conjunto para-brisa e o óptico com faróis sobrepostos, ambos com apelo mais moderno em suas linhas. Outro ponto de destaque são os piscas. Equipados com LED, geram melhor visibilidade na sinalização noturna. A Honda VFR 1200X chega ao Brasil pelo preço sugerido de R$ 79.900.

ESPECIAL

Fiat lança SÊrie Xingu em YHUV}HVLQVSLUDGDVQRÀOPH

Sucesso absoluto no Doblo Adventure, a Fiat acaba de lançar a SÊrie Especial ;LQJX LQVSLUDGD QR ÀOPH homônimo, tambÊm nos seus modelos de entrada do segmento aventureiro: Mille Way, Novo Uno Way 1.0 e Novo Uno Way 1.4. A SÊrie Especial deixa os modelos muito mais completos, jå que eles passam a contar com mais equipamentos de sÊrie, alÊm de adesivos GHLGHQWLÀFDomRQDVODWHUDLV e na tampa traseira dos carros – uma homenagem ao ÀOPH TXH FRQWD D VDJD GRV indigenistas Villas Boas e a história da criação do Parque Nacional Xingu.

As duas versþes do Novo Uno Way (1.0 e 1.4) com a sÊrie especial Xingu ganham em sua lista de conteúdos de sÊrie diversos itens. Entre eles: direção hidråulica, faróis de neblina, prÊ-disposição para rådio, ar-condicionado, para-brisas degradê, travas elÊtricas, vidros elÊtricos dianteiros com one-touch para motorista, alÊm de computador de bordo e banco do motorista com regulagem de altura. O Fiat Mille Way Xingu traz direção hidråulica, desembaçador do vidro traseiro, limpador e lavador do vidro traseiro, entre outros equipamentos.

FENABRAVE

Venda de 3,6 milhþes de carros e comerciais leves Ê recorde Os dados divulgados, seman passada, pela Fenabrave - Federação Nacional dos Distribuidores de VeíFXORV $XWRPRWRUHV ÀFDUDP aquÊm das expectativas, uma vez que não foram computados as vendas do dia 31 de dezembro. Assim, dezembro fechou com 343.770 carros e comerciais leves vendidos, crescimento de 15,7% sobre novembro e 4,4% em relação a dezembro de 2011. No acumulado do ano foram vendidos 3.634.421 uni-

dades, o que representou um crescimento de 6,11% sobre 2011. É um novo recorde histĂłrico de vendas. A Fiat pelo 11Âş. ano consecutivo ĂŠ lĂ­der com 23,06% das vendas. A VW ĂŠ segunda com 21,14% e a GM ĂŠ terceiURFRP$)RUGĂ€FRX em quarto com 8,9% e a Renault em quinto com 6,65%. Fecham lista das dez mais vendidas, Honda(3,71%),Toyota (3,13%), Hyundai (2,98%), Nissan (2,88%) e CitroĂŤn (2,05%).

MUDANÇAS

Chery Celer terå um novo visual A estreia do Celer (foto), no mercado brasileiro estava preYLVWDSDUDR¿PGHPDV D¿OLDOORFDOGD&KHU\DGLRX sua estreia por aqui. Um dos motivos pode ter sido a reestilização, que agora tem linhas mais elegantes e um novo interior. As principais mudanças visuais foram feitas na frente. Os faróis com formato mais arrojado ganharam måscara negra e os novos para-choque HJUDGHIURQWDOGHL[DUDPR&HOHUFRPDUPDLVHVSRUWLYR

SĂŠrie Especial deixa os modelos mais completos e exclusivos, jĂĄ que os veĂ­culos passam a contar com mais equipamentos e tecnologia

MUNDIAL

Marcas jå projetam crescimento e novas metas $+\XQGDLHVXDDÀOLDGD Kia, as maiores montadoras da Coreia do Sul, projetam crescimento de apenas 4% das vendas em 2013, o menor em dez anos, com as fåbricas da Hyundai no Brasil e na China liderando o desempenho. Outras montadoras como a japonesa Toyota estão traçando metas de vendas conservadoras para o ano diante das incertezas da economia mundial.

Hyundai e Kia, que juntas ocupam o quinto lugar no ranking mundial de vendas, acreditam que as vendas combinadas crescerão para 7,41 milhþes de unidades neste ano, o que em parte tambÊm se deve aos gargalos na capacidade de produção e à valorizada moeda sul-coreana. ´+\XQGDLH.LDVHEHQHÀFLDUDPGDVGLÀFXOGDGHVTXH concorrentes tiveram após a FULVH ÀQDQFHLUD JOREDO PDV

agora esse impulso de crescimento estå se enfraquecendo sem a ajuda da moeGDORFDO¾DÀUPDRJHVWRUGH fundos da LS Asset Management, Kim Sung-soo. Jå a desvalorização do iene pode equilibrar a balança em favor de concorrentes como a Honda. São os planos e projeçþes para o futuro do setor automotivo que vão depender do comportamento do mercado global.

CITROĂ‹N DS3

PROPULSOR

O descolado DS3 acaba de ganhar duas sĂŠries especiais inĂŠditas no Reino Unido. Batizadas de DS3 DStyle e Red e DS3 DSport Red (foto), elas chegam Ă s ruas nas cores preta e branca, ou seja, Polar White e Perla Nera Black. Os modelos se diferenciam pelas rodas de liga leve diferenciadas e detalhes em vermelho no teto, espelhos retrovisores e grade frontal. A cor vermelha predomina tambĂŠm no interior, decorado com apliques no painel e nas

A divisão esportiva da MercedesBenz, AMG, estå trabalhando no desenvolvimento de um novo motor V8, revelou o informativo britânico Autocar. De acordo com a informação, o novo propulsor da marca pXPTXHWUDEDOKDFRPRDX[tOLR de um turbo para gerar rendimento HQWUHFYHFDYDORVGH SRWrQFLD&RQIRUPHDLQIRUPDomR junto com o atual 5.5 V8 biturbo, o SURSXOVRU9ELWXUERDX[LOLDULDD $0*DDSRVHQWDURDWXDO9

Ediçþes especiais chegam ao Reino Unido

AMG trabalha em novo motor V8

2013

Ano novo marca retorno gradual do IPI O primeiro dia de 2013 marcou o retorno gradual do IPI (Imposto sobre Produtos Industrializados) para os automóveis de passeio. Desde segunda-feira, 1º. de janeiro, os modelos com motor 1.0, que tinham alíquota zerada, passam a recolher imposto de 2%. Entre abril e junho, o imposto subirå para 3,5%, chegando a 7% em julho, segundo previsão feita pelo governo. No caso dos veículos com motores de 1-litro a 2-litros FRP WHFQRORJLD à H[tYHO GH combustível, a alíquota subirå de 5,5% para 7% atÊ março. Um novo reajuste serå realizado em abril, subindo para 9%, podendo chegar aos 11% em julho. A retomada gradativa do IPI foi decidida pelo MinistÊrio da Fazenda como alternativa para manter as vendas da indústria automobilística em alta, o que poderia não acontecer se os impostos voltassem aos valores praticados anteriormente de forma repentina. A primeira redução do IPI foi anunciada no dia 21 de maio de 2012.


TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013 VEĂ?CULOS 19

Dodge Durango Ê um utilitårio esportivo de sete lugares SUV oferece design imponente, conforto, dirigibilidade, segurança e alta tecnologia

O

Chrysler Group do Brasil estå lançou no Salão Internacional do Automóvel de São Paulo, ano passado, o Dodge Durango, um utilitårio-esportivo full size, de sete lugares, com conforto, segurança e tecnologia comparåveis ao seu porte. Produzido na fåbrica de Jefferson North, em Detroit (EUA), o novo modelo traz em seu enorme portamalas muitos prêmios, como da Associação Automobilís-

tica Americana (AAA), alÊm de vitórias em comparativos. 9HtFXOR Mi VH HQFRQWUD QDV concessionårias da marca. Com suspensão independente nas quatro rodas, disWULEXLomR GH SHVR SUy[LPD da perfeição (50/50) e tração integral permanente, o Durango tem dirigibilidade inFRPXPSDUDXP689JUDQde de sete lugares. Nenhum outro modelo da categoria se compara ao Durango quando se analisa a combinação

do design limpo e agressivo da Dodge com tantas características funcionais, como o LQWHULRU EHP DFDEDGR à H[tYHOHHVSDoRVRFRPWUrVÀOHLras de bancos e sete lugares. 2'XUDQJRH[LEHPDLVGH SRUWDREMHWRV  FRQÀJXraçþes de bancos e årea de bagagem de atÊ 2.390 litros. e SRVVtYHO OHYDU SRU H[HPplo, um sofå de 1,80 metro com espaço para uma mesa de canto ou uma escada de 3 metros com o encosto do

passageiro dianteiro dobrado. Se a praticidade ĂŠ um dos atributos do Durango, a seJXUDQoD QmR Ă€FRX QR EDQFR de trĂĄs durante o desenvolvimento do projeto. Recentemente, o Dodge Durango foi nomeado uma “Escolha Top de Segurançaâ€? pelo Instituto das Seguradoras por Segurança nas Rodovias (IIHS), dos Estados Unidos. AlĂŠm disso, o site Edmunds.com e a revista Parenting Maga-

zine colocaram o modelo na lista de “Melhores Carros Familiares de 2012â€?. “Simplesmente nĂŁo hĂĄ contrapartidas com o Durangoâ€?, diz o presidente da Dodge, Reid Bigland. “SĂł o Durango oferece a melhor combinação de sete lugares, potĂŞncia, força de reboque e autonomia superior a 880 km, ao mesmo tempo que entrega estilo inconfundĂ­vel e comportamento dinâmico superior.â€?

MINIUTILITĂ RIOS

Towner serå produzida em Linhares (ES) A fåbrica da CN Auto terå um investimento de R$ 250 milhþes na primeira fase para a produção da nova linha de modelos Towner no município de Linhares, na região Rio Doce do Espírito Santo, onde serå instalada uma unidade da empresa. O contrato de licença e de transferência de tecnologia para a produção dos miniutilitårios foi assiQDGR QR ÀQDO GH GH]HPEUR pelo diretor-geral da empresa, Ricardo Strunz, e pelo presidente da Harbin Hafei Automobile Industry Group, Liu Zhengjun, em solenidade no Palåcio Anchieta, sede GRJRYHUQRFDSL[DEDHP9Ltória. A solenidade contou com a participação do governador Renato Casagrande e do secretårio de DesenvolvimenWR GR (VWDGR 0DUFLR )pOL[ A importadora, a partir de 2014, vai produzir cinco modelos: Pick-up Cabine Simples, Pick-up Cabine Dupla, Pick-up Cabine Estendida, Minivan Passageiros e Minivan Furgão. Com o investimento de R$ 250 milhþes, a capacidade produtiva serå de 25 mil unidades por ano e por turno, gerando 1.200 empregos diretos. O projeto ainda prevê cumprir os 12 SURFHVVRV SURGXWLYRV H[LJLdos pelo novo regime automotivo brasileiro.

RECALL

Subaru chama 634 mil carros com defeito Modelo Dodge Durango ĂŠ uma “Escolha Top de Segurançaâ€? para o reconhecido Instituto das Seguradoras por Segurança nas Rodovias (IIHS), dos Estados Unidos

HSD

Linha Fiat Adventure traz mais tecnologia Modelos oferecem mais conforto, segurança e desempenho para quem dirige O moderno câmbio Dualogic Plus acaba de chegar tambĂŠm para o Palio Adventure e o Strada Adventure Cabine Dupla na lista de opcionais dos modelos. AlĂŠm de evoluir todo o conceito de troca de marchas, este novo câmbio traz tambĂŠm duas novas funçþes, “Creepingâ€? e “Auto-Up Shift Abortâ€?, que proporcionam mais conforto, segurança e desempenho, aumentando o prazer de dirigir. Outra novidade da Fiat chega para o Novo Palio Attractive 1.0, que acaba de ganhar em sua lista de sĂŠrie o conceito HSD (High Safety Drive), composto por air bag duplo e freios ABS com EBD. Com a inclusĂŁo da versĂŁo

de entrada do Novo Palio, a partir de agora todas as versĂľes do modelo contam com HSD de sĂŠrie. “CREEPINGâ€? A função “Creepingâ€? proporciona manobras muito mais confortĂĄveis e seguras, jĂĄ que o sistema se encarrega, automaticamente, de mover lentamente o veĂ­culo, sem que o cliente aperte o acelerador, como em qualquer modelo automĂĄtico convencional. Enquanto a função “Auto-Up Shift Abortâ€?, ĂŠ FDSD] GH LGHQWLĂ€FDU R H[DWR momento de uma retomada de velocidade e abortar, se for o caso, a troca para uma marcha superior, mantendo a rotação do motor elevada para disponibilizar mais torque e potĂŞncia. Câmbio Dualogic Plus acaba de chegar para o Palio Adventure e o Strada Adventure Cabine Dupla

EUROPA

$XGLGHVLVWHGHQRYR$DĂ€UPDUHYLVWD

Quem esperava pela versão GH¿QLWLYDGR compacto A2 (foto), vai se decepcionar com esta notícia. Segundo a imprensa europeia, a Audi teria cancelado os planos de produção do modelo. Apresentado como carro-conceito em 2011, o A2 seria lançado em 2015 para combater o BMW i3. O veículo chegaria nas versþes elÊtrica e híbrida do tipo plug-in, ambas com a tecnologia de carroceria de alumínio. 6HJXQGRDUHYLVWDLQJOHVD$XWRFDUIRQWHVOLJDGDVj$XGLD¿UPDUDPTXH³DV liçþes aprendidas com o projeto do novo A2� serão aplicadas em futuros lançamentos da marca.

A Subaru convocarå quase 634 mil veículos nos EUA por conta de um defeito nas luzes de cortesia, que podem atÊ causar incêndios. Segundo informaçþes da agência de notícias Automotive News, estão envolvidos no chamado algumas unidades do Forester fabricadas entre 2009 e 2012 e do Tribeca produzidas entre 2006 e 2012, alÊm de todos os Legacy e Outback entre 2010 e 2011. No total, 633.842 veículos serão convocados. Um portaYR]GD6XEDUXDÀUPRXTXH somente 53.699 unidades apresentam o problema, mas a marca resolveu convocar uma quantidade tão grande de veículos por não saber quais unidades precisam passar pelo recall. O defeito acontece nas luzes de cortesia instaladas nas portas, que iluminam o chão quando as portas são abertas. Hå probabilidade de ocorrer curto-circuito caso VHMDP H[SRVWRV D PLVWXUDV com presença de sal, como UHVtGXRV GH iJXD GHL[DGRV nas estradas após chuvas. A marca se comprometeu D QRWLÀFDU RV SURSULHWiULRV dos veículos envolvidos no recall, que começarå a ser realizado em fevereiro.

SÉRIES ESPECIAIS

IMPORTADOS

As sÊries especiais (foto), são oferecidas ao consumidor com vantagens em relação ao preço do pacote de opcionais. Normalmente o preço Ê de fato mais vantajoso em relação ao carro de sÊrie, se todos os equipamentos forem pagos separadamente. Mas a compra só serå vantajosa se você estiver interessado em todos aqueles equipamentos. É uma camisa de força: custa mais barato, mas você tem de engolir o que a fåbrica oferece. Se no pacote tiver um equipamento que não lhe interessa, o barato sai caro. No mercado de usados as sÊries especiais são bem vistas. Esses carros têm muita procura, justamente porque são bem equipados.

O IPI aplicado para carros (foto), de empresas sem fåbrica no Brasil fez de 2012 um ano trågico para algumas marcas, que perderam participação - em alguns casos venderam metade do volume de 2011 -, fecharam pontos de venda, reduziram investimentos. Como saldo positivo, DOJXPDVLPSRUWDGRUDVLQLFLDUDPDFRQVWUXomRGHIiEULFDVEHQH¿FLDQGRVH das vantagens do programa Inovar Auto. Na verdade, as três empresas que jå iniciaram construçþes jå haviam decidido pela nacionalização antes do governo anunciar o aumento de 35% do IPI, JAC, Chery e BMW.

4XDQGRREDUDWRSRGHVDLUFDUR

9HQGDVHPTXHGDHVWLPXODIiEULFDV


20

PUBLICIDADE MACEIÓ - DOMINGO, 6 DE JANEIRO DE 2013 VEÍCULOS

TRIBUNAINDEPENDENTE


TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013 DIVERSĂƒO&ARTE

FĂŁ de “Star Trekâ€? ganha exibição H[FOXVLYDGHÂżOPHLQpGLWR

Um fĂŁ de “Star Trekâ€? em estado terminal recebeu um presente especial. Ele S{GHYHURÂżOPHÂł6WDU7UHN$OpPGD(VFXULGmR´DLQGDLQDFDEDGRDQWHVGH WRGRPXQGR2KRPHPGHDQRVLGHQWLÂżFDGRDSHQDVFRPR'DQLHOWHP câncer, e os mĂŠdicos haviam dado a ele apenas mais algumas semanas de vida. Segundo o site “The Hollywood Reporterâ€?, a histĂłria de Daniel chegou atĂŠ o diretor de “Star Trek - AlĂŠm da EscuridĂŁoâ€?, J.J. Abrams, por meio de uma postagem na internet, na pĂĄgina de mensagens Reddit. “Meu maravilhoso PDULGRFLQpÂżORGLDJQRVWLFDGRFRPOHXFHPLDDRVWHYHGHDJXHQWDUWUrVVHVsĂľes de quimioterapia antes de acharem um doador de medula compatĂ­velâ€?, escreveu a esposa de Daniel na mensagem.

1

%DQGD-RQDV%URWKHUVpSURFHVVDGD SRUImTXHWHULDVLGRHPSXUUDGDHPVKRZ Uma fĂŁ da banda norte-americana Jonas Brothers estĂĄ processando o grupo apĂłs ter sido empurrada contra a grade de segurança durante um show gratuito do trio realizado em 2010, segundo informaçþes do site “TMZâ€?. Ashleigh Johnson estava em uma apresentação da banda no The Groove, em Los Angeles, quando foi “esmagadaâ€? por um grupo de fĂŁs. A garota move um processo contra a banda e tambĂŠm contra a Caruso Management, empresa responsĂĄvel pelo local em que se realizava o show. A garota alega ter sofrido danos emocionais e fĂ­sicos.

Longa ‘Entre o amor e a paixĂŁo’ questiona os valores importantes em longos relacionamentos

POR O

MARCELO FORLANI ESPECIAL PARA D&A

QUE AMAR

DĂ“I

título nacional do novo longa de Sarah Polley, Entre o Amor e a Paixão (Take This Waltz), merece tantos elogios quanto o próprio longa, pois resume com perfeição o dilema central da trama, vivido por Margot (Michelle Williams), uma escritora que mora no subúrbio de Toronto e tem seu coração dividido entre seu marido, Lou (Seth Rogen), e um estranho que ela conhece em uma viagem a trabalho, Daniel (Luke Kirby). A conexão entre Margot e Daniel Ê imediata e as coincidências, TXHWDQWRLQFRPRGDPHPRXWURVÀOPHV aqui servem para mostrar as peças que o destino prega nas pessoas. Tudo começa em Louisbourg, na Nova Escócia, quando Margot visita a cidade para poder escrever um folheto turístico sobre o local. Em um passeio por um castelo, com direito a reencenação histórica que mostrava um adúltero sendo humilhado publicamente, com direito a açoitamento, Daniel faz graça e chama atenção da loira, que retribui de forma acanhada. No aeroporto antes de volta para Toronto, os dois acabam se reencontrando e engatam uma conversa após ele avistå-la embarcando em uma cadeira de rodas. Descobre que ela

usa deste subterfúgio por ter medo de SHUGHURYRRHÀFDUSUHVDHPXPDFRQHxão. É, como ela mesmo descreve, uma IRELDGHÀFDUHQWUHFRLVDVVLWXDo}HVe de forma sucinta e discreta, um resumo GRÀOPHWRGR O que poderia ser uma simples faísca entre duas pessoas vai pegando fogo e crescendo dia após dia, encontro após encontro. Mesmo sabendo o que deve fazer, ela vai dando corda ao relacionamento que não deve jamais acontecer. É extremamente dolorido acompanhar o que se passa na cabeça de Margot. Ela obviamente ama seu marido, com quem estå casada hå cinco anos, mas não sabe o que fazer com a paixão que sente por Daniel, que só aumenta. Este drama todo Ê repassado para o público, que pode se colocar no papel da mulher em dúvida ou apenas torcer por um ou outro. Polley, que estå apenas no VHXVHJXQGRÀOPH HVWUHRXQRHORJLDGR Longe Dela), mostra novamente ao público que amar pode ser muito dolorido. AtÊ a diversão, quando existe, vem com o gosto amargo que vai consumindo Margot atÊ que ela tem de tomar uma decisão e quando isso acontece a jovem cineasta não julga Margot nem coloca os dois homens aqui como vítima ou carrasco. A forma livre com que a atuação dos WUrVDWRUHVà XLFRPGLiORJRVUHDOLVWDV

e sem pausas dramĂĄticas, aumenta a empatia com o trio, e faz o sofrimento e a angĂşstia serem enormes. Michelle Williams, que jĂĄ nĂŁo ĂŠ mais a vizinha de Dawson hĂĄ muitos anos, demonstra aqui a maturidade que a possibilita ser 0DULO\Q0RQURHHPXPĂ€OPHHD%UXxa de Oz logo depois. Rogen se esforça para tentar fazer algo diferente, mas surpreende mesmo ĂŠ o carisma de Kirby, que poderia ser o vilĂŁo da histĂłria, mas com seu charme pode conseguir conquistar mais do que apenas Margot. As reviravoltas da vida e tambĂŠm do tĂ­tulo original, Take This Waltz (“pegue esta valsaâ€?, em tradução livre), geram rodopios tambĂŠm na tela em duas lindas e simbĂłlicas cenas. A primeira ao som de “Video Killed The Radio Starâ€? e a outra sob a mĂşsica que HPSUHVWDVHXQRPHDRĂ€OPHHQWRDGD por Leonard Cohen. O popismo escapista da primeira, que acaba como um FRLWRLQWHUURPSLGRpĂ€QDOPHQWHFRQWUHtizado na segunda, cheia da paixĂŁo que faltava na vida de Margot. Entre o Amor e a PaixĂŁo nĂŁo ĂŠ capĂ­tulo de novela. É uma histĂłria que poderia acontecer com vocĂŞ ou comigo, e ĂŠ isso que o torna tĂŁo bonito, mas tambĂŠm dolorido de se ver (mesmo podendo vivenciar tudo isso na pele de outra pessoa).


2

DIVERSÃO&ARTE

TRIBUNAINDEPENDENTE

0$&(,Ï'20,1*2'(-$1(,52'(

Festival de Cinema

O mundo de Pedro

2)HVWLYDO,QWHUQDFLRQDOGH&LQHPDGH6DQ)UDQFLVFR 6¿II TXHDFRQWHFHQDFLGDGHQRUWHDPHULFDQDGH6DQ)UDQFLVFRHQWUHRVGLDVGHDEULO HGHPDLRGHDOFDQoDHVWHDQRDVXDHGLomRUHFHEHQGRLQVFULo}HVDWpRGLDGHGH]HPEUR3RGHPSDUWLFLSDUREUDVGHWRGRVRV JrQHURVHGXUDo}HVLQFOXLQGRSURJUDPDVGH79H¿OPHVIDPLOLDUHV&DGDFDWHJRULDWHPYDORUHVHVSHFt¿FRVGHWD[DGHLQVFULomRFRPH[FHomRGD ~OWLPDJUDWXLWD&RQ¿UDRUHJXODPHQWRFRPSOHWRHFRQ¿UDRVYDORUHVGDVWD[DVQRHQGHUHoRKWWSZZZVIIVRUJ

$3LQDFRWHFDGD8IDOUHFHEHDWpRSUy[LPRGLDDH[SRVLomR&LVFRVGH3HGUR/XFHQD2VKRUiULRVGHYLVLWDomRS~EOLFDVmRGDVKjVKGH VHJXQGDDVH[WDGDVKjVKDVVHJXQGDVTXDUWDVHVH[WDVHGDVKjVKjVWHUoDVHTXLQWDV3DUDPDLVLQIRUPDo}HVRFRQWDWRGD3LQDFRWHFD 8QLYHUVLWiULDpR

Mostra Itinerante $$VVRFLDomR&RPHUFLDOGH0DFHLyUHFHEHDWpKRMH DPRVWUDLWLQHUDQWHGR3UrPLR&1,6HVL0DUFDQWRQLR 9LODoD$H[SRVLomR¿FDDEHUWDDRS~EOLFRGDVK jVK0DLVLQIRUPDo}HVVREUHDH[SRVLomRSHOR WHOHIRQH

O mundo de Pedro $3LQDFRWHFDGD8IDOUHFHEHDWpRSUy[LPRGLDD H[SRVLomR&LVFRVGH3HGUR/XFHQD2VKRUiULRVGH YLVLWDomRS~EOLFDVmRGDVKjVKGHVHJXQ GDDVH[WDGDVKjVKDVVHJXQGDVTXDUWDVH VH[WDVHGDVKjVKjVWHUoDVHTXLQWDV3DUD PDLVLQIRUPDo}HVRFRQWDWRGD3LQDFRWHFD8QLYHUVL WiULDpR

Seresteiros 2PDLVTXHULGRHHVSHUDGREDLOHGDVSUpYLDVGHFDUQDYDOGH$ODJRDVFRPHPRUDHPRVHXžDQL YHUViULR5HVSRQViYHOSRUWUD]HUGHYROWDDPDJLDHDOHJULDGRVDQWLJRVFDUQDYDLVR%DLOHGRV6HUHVWHLURV GD3LWDQJXLQKDDFRQWHFHUiQRGLDGHMDQHLURHIDUiXPDDXWRKRPHQDJHPUHOHPEUDQGRDVXDWUDMHWyULD GHIHVWDHIROLD$OpPGREDLOHSDUDDGXOWRVQRGLD GRPLQJR WHUHPRVDQRVVDWUDGLFLRQDOPDWLQrLQIDQWLO 2%DLOLQKR'HVWDYH]DOpPGRVVHUHVWHLURVTXHPDQLPDUiDIROLDGDJDURWDGDVHUiD%DQGD&D]XDGLQKD FRPDQGDGDSHODFDQWRUD5REHUWD$XUHOLDQR8PUHSHUWyULRHVSHFLDOHVWiVHQGRSUHSDUDGRSDUDDWDUGHGH FRQIHWHHVHUSHQWLQDGRVSHTXHQRV0DLVLQIRUPDo}HV  

Show completíssimo

2V5DLPXQGRVHVWmRURGDQGRR%UDVLOFRPRVKRZ &OiVVLFRVGR9LQLO³/DY{WiQRYR´1RVKRZHOHVYmR FDQWDUP~VLFDVGR8OWUDMHGDSUySULDEDQGDFRP FOiVVLFRVGR5RGD9LYD8PVKRZLPSHUGtYHO0D FHLyIDUiSDUWHGHVVDJUDQGHWXUQrGLDGHPDUoR GHQD9R[5RRP3UHoR53LVWD5 )URQWV6WDJHH5FDPDURWHRSHQEDU0DLVLQIRU PDo}HV  

Teatro para rir +iPDLVGHDQRVTXDWURLUPmVVHUHHQFRQWUDUDP QRYHOyULRGDPmHHVHWUDQVIRUPDUDPQDVSURWDJR QLVWDVGHXPGRVPDLRUHVVXFHVVRVGRWHDWUREUDVL OHLUR6REDEDWXWDGRVHXFULDGRU0LJXHO)DODEHOOD 6XVDQD9LHLUD$UOHWH6DOOHV3DWULF\D7UDYDVVRVH 7KHUH]D3LIIHUHVWmRQRYDPHQWHUHXQLGDVSDUDFHOH EUDUDPDLRULGDGHGRHVSHWiFXOR$3DUWLOKD'HVSRLV GDHVWUHLDHP6mR3DXORDFRPpGLDVHJXHWXUQr SHOR%UDVLO1RVGLDVHGHMDQHLURVHUiDYH] GRS~EOLFRGH0DFHLyVROWDUJDUJDOKDGDVDVVLVWLQGR DRHVSHWiFXORQR7HDWUR*XVWDYR/HLWH±&HQWURGH &RQYHQo}HV3RQWRVGH9HQGDHVWDQGH6XH&KD PXVFD±0DFHLy6KRSSLQJ0DLVLQIRUPDo}HV    FALE CONOSCO$$JHQGDpXPVHUYLoRJUDWXLWRGHRULHQWDomRDROHLWRU2VLQWHUHVVDGRVHPGLYXOJDUHYHQWRVVKRZVHH[SRVLo}HVSRGHPHQYLDUPDWHULDODWUDYpVGRHQGHUHoRWLDJHQGD#KRWPDLOFRP


TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013 DIVERSĂƒO&ARTE

3

0,&+(/$1*(/25(&25'

FLĂ VIO RICCOFRODERUDomR-RVp&DUDORV1HU\ZZZWZHWWHUFRPĂ€DYLRULFFR

Globo Esporte nadou de braçada na temporada 2012

C

omandado por Tiago Leifert, o “Globo Esporte – SĂŁo Pauloâ€? DSUHVHQWRXXPDGHVXDVPHOKRUHVSHUIRUPDQFHVQRDQRTXH SDVVRX8PDQRDWtSLFRLQFOXVLYHXPDYH]TXHRSULQFLSDO HYHQWRGRFDOHQGiULRHVSRUWLYRD2OLPStDGDGH/RQGUHVHVWHYH QDVPmRVGHRXWURYHtFXORD5HFRUG Ainda assim, de um total de 308 programas, o “GEâ€? perdeu DSHQDVXPDYH]²GXUDQWHDĂ€QDOHQWUH%UDVLOH0p[LFR DOJRFRQVLGHUDGRSUHYLVtYHOHHPSDWRXRXWUDTXDQGRD 5HFRUGFRPGLUHLWRDOLQNQDVSUR[LPLGDGHVGR3URMDF H[SORURXRVXSRVWRHVWXSURQR´%%%Âľ 2XVHMDIRUDPHGLo}HVHPSULPHLUROXJDU8PSDVVHLR (QWUHWDQWRFRQVWDWRXVHVLPXPDTXHGDQDPpGLDGH DXGLrQFLDGRSURJUDPDIHQ{PHQRTXHWDPEpPDWLQJLX DVFRQFRUUHQWHV5HFRUG6%7H%DQGHLUDQWHVQDPHVPD IDL[D1DYHUGDGHRQ~PHURGHOLJDGRVFDLX $FUHGLWDVHTXHHVVDDXGLrQFLDDFDERXPLJUDQGRSDUD DWHOHYLVmRSDJDTXHLQGLVFXWLYHOPHQWHSRVVXLYiULDV RSo}HVGHHQWUHWHQLPHQWRHTXHFRQWLQXDURXEDQGRLPSRUWDQWHVSRQWRVGDVHPLVVRUDVFRQYHQFLRQDLV Dentro desse novo cenĂĄrio, com o avanço dos canais por DVVLQDWXUDpHYLGHQWHTXHDVUHGHVDEHUWDVQmRLUmRPDLV atingir grandes Ă­ndices na faixa da tarde e tambĂŠm nas GHPDLV(ODVWHUmRQRHQWDQWRTXHDSUHVHQWDUPHOKRUHV alternativas ao telespectador, na tentativa de minimizar HVWUDJRVRXVHMDWUDEDOKDUPDLV1mRWHPRXWURFDPLQKR

TV TUDO Humilde 2GLUHWRU5LFDUGR0DQWRDQHOOL H[³$VWURV´DJRUDLQWHJUDGRDR GHSDUWDPHQWRGHQRYHODVGR6%7Mi HVWiDPELHQWDGRQRQRYRVHWRU (PVHXSULPHLURFRQWDWRFRPR SHVVRDOQDPDLRUKXPLOGDGH GHFODURXTXHFKHJDSDUDDSUHQGHU DQWRDQHOOLIDUiSDUWHGDHTXLSHGH ³&KLTXLWLWDV´

Troca-troca $LQGDHPIXQomRGHVVDLGDGH 0DQWRDQHOOLSDUDDWHOHGUDPDWXUJLD ÂżFRXGHFLGLGRWDPEpPTXHRVMXUDGRV $UQDOGR6DFFRPDQL&\]7KRPD] 5RWKH&DUORV0LUDQGDSDVVDUmR DWUDEDOKDUFRPXPRXWURGLUHWRU QDHPLVVRUD2HVFROKLGRp'HQLV 6DOOHV

Em cena da minissĂŠrie “JosĂŠ do Egitoâ€?, da Record, o protagonista, vivido por Ă‚ngelo Paes Leme resiste como pode aos encantos de Sati, Larissa Maciel. Ela ĂŠ conhecida como “devoradora de homensâ€?, e trai seu marido Potifar (Taumaturgo Ferreira), constantemente. Trata-se do primeiro trabalho de Larissa na emissora, apĂłs passagem pela Globo. Estreia dia 30.

Desligada $GHFLVmRGHQmRFRQWDU PDLVFRP&DUROLQD3RUWDOXSSL¿OKDGR5HQDWR*D~FKR QR³3kQLFRQD%DQG´SDUWLX GDGLUHomRGRSURJUDPD 7XGRPRWLYDGRVHJXQGR LQIRUPDo}HVGDHTXLSHSRU XPSHGLGRPXLWRDOWRGH DXPHQWRGHFDFKrSDUDTXH DMRYHPFRQWLQXDVVHDID]HU PDWpULDV 1mRKRXYHDFRUGRHQWUHDV partes.

Encontro 1RSUy[LPRGLDLQFOXVLYHGHYHUi DFRQWHFHUDSULPHLUDUHXQLmRQR 6%7FRP6DOOHVHRVMXUDGRVSDUD FRPHoDUDGLVFXWLUXPQRYRSURMHWR GHSURJUDPD$LGHLDpDSRVWDUHP XPGRVIRUPDWRVDGTXLULGRQDV IHLUDVLQWHUQDFLRQDLV'HTXDOTXHU IRUPDQmRVHGHVFDUWDDSRVVLELOLGDGHGHFRQWLQXDUFRPR³$VWURV´ PDVUHIRUPXODGR

Outro lado

Outra praia

(VVDLQIRUPDomRGR ³3kQLFR´SRUWDQWRQmREDWH FRPDYHUVmRDSUHVHQWDGD SRU&DURO3RUWDOXSSL &RPRPRWLYRSDUDVXD VDtGDHODGHFODURXTXHR SURJUDPDQmRFRPELQDFRP VXDIDVHDWXDOYROWDGDSDUD RMRUQDOLVPR 7DPEpPQXPDGHVVDV SRGHVHUDVGXDVFRLVDV 1LQJXpPFRPWRGDFHUWH]D YDLEULJDUSRUFDXVDGLVVR

$SHVDUGHWHUDSDUHFLGRXPDFRQYHUVDGH*ORER&DUORV*HUDOGRH[ GLUHWRUGD5HFRUGQR5LRGH-DQHLUR YDLPHVPRVHGHGLFDUjSROtWLFD (OHMiHVWiPRQWDQGRDVXDEDVHGH DSRLRHP3HUQDPEXFR

Reformulação $DSUHVHQWDGRUD(OLDQDUHWRPDVXD URWLQDGHJUDYDo}HVQR6%7DSDUWLU GRSUy[LPRGLD(MiFRPXPD ERDH[SHFWDWLYDHPWRUQRGRVQRYRV TXDGURVGRVHXSURJUDPD

Mistura

Dramas $GLUHWRUD3DWUtFLD)DORSSDGDiUHD GHGUDPDWXUJLDGD5HFRUG¿QDOL]RX RVWUDEDOKRVGHXPFXUWDPHWUDJHP QRV(8$LQWLWXODGR³(QFRQWURV´TXH VHUiODQoDGRQRVSUy[LPRVPHVHV 2WUDEDOKRIDODVREUHHQFRQWURV amorosos, que no momento certo SRGHPXGDURUXPRGHXPDYLGD 0DGLVRQ6TXDUH3DUNH%URDGZD\ IRUDPDOJXPDVGDVORFDo}HV1R HOHQFR'DQLHO(UWKDO1DWDOLDGH &DPSRV0RQLFD+XQNHQH(ULN 0F.D\HQWUHRXWURV

PALAVRAS CRUZADAS DIRETAS

www.coquetel.com.br Cursos fluviais navegĂĄveis Que estĂĄ sempre contido em algo

Š Revistas COQUETEL 2012

Fonte de enriquecimento de latifundiĂĄrios nordestinos RecĂ­proca; bilateral

PerĂ­odo em que Leonardo da Vinci pintou "Mona Lisa" (1503) Trevas; TelĂŞ Santana, exescuridĂŁo tĂŠcnico de futebol

Tecla que cancela açþes (Inform.) Cada divisão da luta de boxe (inglês) Ter (?) caras: ser falso (pop.) Edward Albee, dramaturgo (EUA) Autora da novela "AmÊrica" (2005)

Bater (?) mesma tecla: insistir

Certo jogo de cartas GramĂĄtica (abrev.)

AntĂ­lope endĂŞmico da Ă frica do Sul ReligiĂŁo (abrev.) Corta rente o pelo de

Mais alto cargo polĂ­tico do padre FeijĂł

AtĂŠ as (?): completamente

Eu, (?) e ele: nós (Gram.) Reduto de boêmios Filha da filha Condição dos indivíduos intitulados "sir" Vergonha; vexame

Aceita como verdadeiro Sistema de unidades de medida (FĂ­s.)

SebastiĂŁo TapajĂłs, virtuose do violĂŁo

Nome da letra que abrevia "Norte" Tecnologia da Informação (sigla)

"As Quatro (?)", obra de Vivaldi 3/cgs — gnu. 5/round — truco. 7/orelhas — regente. 8/ilustres. O Ç T

Ă• C R E

R E G E N T E

E N T E S N G R E R U C A M P E A

E S S E I S E

Z

S E C U L O D

Š’76,’12 SANRIO CO., LTD. Used Under License.

I M A N U N D T U U A S A T G R O R I A R D E T A L U S H E A S C S T A

Nas bancas e livrarias!

R I R O S D E P G L B A N I C I E

Duas novidades da pra vocĂŞ!

14

Solução F

BANCO

Ainda em relação a “Saramandaiaâ€?, o pessoal de produção, no Projac, vai receber nesta semana os primeiros capĂ­tulos da novela. Os roteiristas, liderados por Ricardo Linhares, estĂŁo bem adiantados no texto

HORĂ“SCOPO Ă RIES - D Âą6HQWLUi QHFHVVLGDGHGHDSHUIHLoRDUVHXV FRQKHFLPHQWRVSDUDJDUDQWLUDVXD SRVLomRQRPHUFDGRHPTXHDWXD +iVLQDOGHWHQVmRSRULVVRÂżTXHGH ROKRQRHVStULWRGHFRPSHWLomRTXH SRGHVHLQVWDODUQRDPELHQWHHP TXHYLYHRXWUDEDOKD 1~PHURVGD6RUWH 19, 22 TOURO – (20/4 a 20/5) – TenKDFXLGDGRFRPSUREOHPDV PDOUHVROYLGRVWXGRLQGLFDTXHHOHV SRGHPWUDQVERUGDU0DQWHURERP KXPRUVHUiIXQGDPHQWDO2DVWUDO UHYHODDXPDFHUWDLQFRQVWkQFLDQR GHFRUUHUGHVWHGLDG~YLGDVGHYHP VXUJLU 1~PHURVGD6RUWH 35, 39 GĂŠMEOS – (21/5 a 21/6) – ProblePDVIDPLOLDUHVSRGHPLQWHUIHULUQD VXDHQHUJLD7DOYH]VHMDKRUDGH URPSHUFRPPiJRDVUHVVHQWLPHQWRVRXFHUWRVODoRVTXHWHSUHQGDP DRSDVVDGR9RFrSRGHUiSDVVDU SRUXPDIDVHEDVWDQWHFUtWLFDQRTXH GL]UHVSHLWRjVUHODo}HVSHVVRDLV 1~PHURVGD6RUWH 39, 42 CĂ‚NCER Âą D Âą+iSRVVLELOLGDGHGHDOJXQVDERUUHFLPHQWRV OLJDGRVjVXDYLGDSURÂżVVLRQDO2 TXHYRFrWHPDGDUSRGHQmRVHU GHYLGDPHQWHYDORUL]DGR$OpPGLVVR WHQKDFXLGDGRFRPSHUGDGHGDGRV RXSUREOHPDVGHFRPXQLFDomR 1~PHURVGD6RUWH 27, 29 LEĂƒO Âą D ÂąeKRUDGH GLVFLSOLQDURVVHXVJDVWRVSDUDQmR ID]HUQRYDVH[WUDYDJkQFLDV7XGR LQGLFDTXHRGLQKHLURSRGHVDLUGR VHXEROVRFRPHQRUPHIDFLOLGDGH 6XDYLGDIDPLOLDUSRGHDWUDYHVVDU XPSHUtRGRGHPDLRUSURYDomR 7HQKDSDFLrQFLD 1~PHURVGD6RUWH 36, 39 VIRGEMÂą D Âą9RFr YDLSHUFHEHUDLPSRUWkQFLDGHVH UHFROKHUDÂżPGHDQDOLVDUDOJXPDV TXHVW}HVGRSDVVDGR2H[FHVVR GHVHQVLELOLGDGHSRGHDOWHUDURVHX humor. 1mRVHSUHQGDDPiJRDVHSURFXUH FXLGDUPDLVGRVHXFRUSRSDUD HOHYDUDVXDDXWRHVWLPD 1~PHURVGD6RUWH 31, 64

$QRYHOD³6DUDPDQGDLD´ TXHD*ORERLUiH[LELUQD IDL[DGDVGDQRLWHQmR YDLLQYHVWLUDSHQDVHPQRPHVFRQKHFLGRVFRPR)HUQDQGD0RQWHQHJUR7DUFtVLR 0HLUD/LOLD&DEUDO9HUD +ROW]*DEULHO%UDJD1XQHV H,OYD1LxRHQWUHRXWURV2 DXWRU5LFDUGR/LQKDUHVHD GLUHWRUD'HQLVH6DUDFHQL LQIRUPDVHWDPEpPSUHWHQGHPDSRVWDUHPDOJXQV ODQoDPHQWRVHVFROKLGRV DWUDYpVGHWHVWHV

Bate-rebate ¡AmanhĂŁ Ă s 22h30, na Band, começa a segunda edição do “Mulheres Ricasâ€?. Ă‚5HFRUGQmRSUHWHQGHSURPRYHU PXGDQoDVQRM~ULGR³ËGRORV.LGV´ TXHYROWDDRDUHPPDUoR ¡JoĂŁo Gordo, Afonso Nigro e Kelly Key, portanto, seguirĂŁo no programa. Ă‚2Âł3ODQHWD([WUHPR´TXHD*ORER YDLPRVWUDUHVWHDQRHVWiFRPVHXV WUDEDOKRVEHPDGLDQWDGRV Ă‚*OREREDVWDQWHFRQÂżDQWHQDV negociaçþes com Marcelo Adnet. Ă‚6HJXQGRH[HFXWLYRVGRFDQDOHOH $GQHWYDLHQFRQWUDUOiWRGDDYLVLELOLGDGHTXHSURFXUD ¡Cantora e jurada de programas no SBT, Cynthia Zamorano se daria muito bem comandando um programa de culinĂĄria – na opiniĂŁo dos mais prĂłximos. Ă‚'L]HPTXHHODpDUWLVWDWDPEpPQDFR]LQKD ¡Em versĂŁo para TV, “Gonzaga – de Pai pra Filhoâ€?, dirigido por Breno Silveira, estreia dia 15 na Globo. Apresentação em quatro capĂ­tulos. Ă‚:DOF\U&DUUDVFRTXHHVFUHYHD VXEVWLWXWDGHÂł6DOYH-RUJH´WHUi PDLVXPDUHXQLmRFRPDGLUHomR GH(QWUHWHQLPHQWRGD*ORERQD WHUoDIHLUD ¡Carrasco deverĂĄ dar mais espaço para personagens da periferia, nessa nova novela.

&¡HVWÀQL 2SURJUDPD³4XHPFRQYHQFH JDQKDPDLV´FRPDSUHVHQWDomRGH &KULVWLQD5RFKDSRGHUiDSRVHQWDU R³&DVRVGH)DPtOLD´QR6%7 7XGRYDLGHSHQGHUVHJXQGRLQIRUPDo}HVGHEDVWLGRUGRGHVHPSHQKRGHDXGLrQFLD )LFDPRVDVVLP0DVDPDQKmWHP PDLV7FKDX

ATÉ 8 DE MARÇO LIBRA – (23/9 a 22/10) – Tenha FXLGDGRFRPPHQWLUDVLQWULJDVRX VHJUHGLQKRV2DVWUDOUHYHODDOJXQV DERUUHFLPHQWRV$OJXpPSRGHHVWDU WHQWDQGRSUHMXGLFDUDVXDLPDJHPH VHXVFRQWDWRVGHWUDEDOKR3UREOHPDVGHFRPXQLFDomRQmRHVWmR GHVFDUWDGRV 1~PHURVGD6RUWH 42, 46 ESCORPIĂƒO – (23/10 a 21/11) – (YLWHVHUDYDOLVWDRXID]HUHPSUpVWLPRVQHVWHGLD9RFrSRGHWHUSHUGDV RXSUHMXt]RSRUFDXVDGHIDOVRV DPLJRV1mRpXPGLDIDYRUiYHOSDUD DVFRPSUDVHPJHUDO9RFrFRUUHR ULVFRGHID]HUPDXVQHJyFLRV 1~PHURVGD6RUWH 66, 67 SAGITĂ RIO – (22/11 a 21/12) – 9RFrSRGHWHUGLÂżFXOGDGHSDUD FRQFLOLDURVLQWHUHVVHVSURÂżVVLRQDLV FRPDVXDYLGDIDPLOLDU(VWHpXP GLDHPTXHSRGHUiSHUFHEHUFRP PDLVFODUH]DWRGDVDVFRLVDVTXHR LQFRPRGDPHPVXDVDWLYLGDGHVGH URWLQD1~PHURVGD6RUWH  CAPRICĂ“RNIO – (22/12 a 19/1) – 1mRSHUFDDFKDQFHGHVHOHFLRQDU PHOKRUVXDVDPL]DGHV+RMHYRFr YDLSHUFHEHUTXHDVDSDUrQFLDV HQJDQDP&RP0HUF~ULRHPVHX VLJQRSRGHUiGHPRQVWUDUPDLRU VHJXUDQoDGHWHUPLQDomRHFDSDFLGDGHGHFRQYHQFHURVRXWURV 3HQVDPHQWRSRVLWLYR*UDoDVDR PHXHVStULWRGHLQLFLDWLYDDOFDQoR DTXLORTXHGHVHMR 1~PHURVGD6RUWH 35, 36 AQUĂ RIO Âą D Âą0DLV REMHWLYLGDGHHSODQHMDPHQWRHP WXGRTXHÂż]HU9RFrSRGHUiGHFHSFLRQDUVHFRPDOJXPDVSHVVRDV TXHMXOJDYDVHUGDVXDFRQÂżDQoD 2VDVVXQWRVDIHWLYRVDQGDPPHLR DPDUUDGRV7HQKDSDFLrQFLD 1~PHURVGD6RUWH  PEIXESÂą D 6HXV SODQRVSRGHPVHIUXVWUDUPDVQmR FRQYpPFRORFDUDFXOSDQRVRXWURV $QDOLVHSULPHLURHPTXHSRGHWHUHUUDGR$OJXQVGHVHXVFRPSURPLVVRV SRGHPVHUDGLDGRVRXFDQFHODGRV 6HDVXDDXWRHVWLPDHVWiHPEDL[D SURFXUHGDUXPWUDWRQRYLVXDO 1~PHURVGD6RUWH 

Abertas as inscriçþes para o 3UrPLR1DFLRQDOGH)RWRJUDÀD

E

stĂŁo abertas atĂŠ 8 de março de 2013 as inscriçþes para o PrĂŞmio 1DFLRQDOGH)RWRJUDĂ€D3LHUUH Verger 2012/2013, um dos maiores concursos para trabaOKRVIRWRJUiĂ€FRVGR%UDVLO Nesta sua 5ÂŞ edição, o certame, promovido pela Fundação Cultural do Estado GD%DKLD )XQFHE HQWLGDGH vinculada Ă Secretaria de Cultura do Governo do Estado 6HFXOW%$ WHYHXPDDPSOLDomRVLJQLĂ€FDWLYDDJRUDVmR5 120 mil distribuĂ­dos em trĂŞs categorias – “Livre TemĂĄtica H/LYUH7pFQLFDÂľ´)RWRJUDĂ€D Documentalâ€? e “Trabalhos de Inovação e Experimentação na ÉUHDGH)RWRJUDĂ€DÂľ²UHIRUçando seu papel no intuito de incentivar, divulgar e valorizar DSURGXomRIRWRJUiĂ€FDEUDVLOHLUD2HGLWDOHVHXVDQH[RVHVWmR GLVSRQtYHLVQRVLWHGD)XQFHE ZZZIXQGDFDRFXOWXUDOEDJRY EU AtĂŠ sua 4ÂŞ edição, o concurso concedia prĂŞmio Ăşnico DXPFRQMXQWRIRWRJUiĂ€FRGH temĂĄtica e tĂŠcnica livres, para FRQGHFRUDomRQRYDORUGH5 PLOVRPDGDDDSRLRĂ€QDQFHLUR para a realização de uma exposição individual em Salvador e publicação de um catĂĄlogo com o ensaio, totalizando entĂŁo XPLQYHVWLPHQWRGH5PLO Assim, a edição 2012/2013 tem um ganho orçamentĂĄria de 100%, transformando o prĂŞmio original, em suas mesmas condiçþes, na categoria “Livre TemĂĄtica e Livre TĂŠcnicaâ€?, e criando dois novos prĂŞmios de 5PLOSDUDDVRXWUDVGXDV PRGDOLGDGHV(VWDFRQTXLVWDp resultante do diĂĄlogo da classe

de fotógrafos com a Funceb HD6HFXOW%$TXHGHPDQGRX a extensão do prêmio para contemplação de trabalhos GLIHUHQFLDGRVQDiUHD 23UrPLR1DFLRQDOGH)RWRJUDÀD3LHUUH9HUJHUpDEHUWR para fotógrafos brasileiros ou estrangeiros com situação de permanência legalizada, PDLRUHVGHDQRVTXHGHYHP apresentar um projeto ainda QmRSUHPLDGRQR%UDVLOQHP QRH[WHULRU$VLQVFULo}HVVmR gratuitas e podem ser feitas exFOXVLYDPHQWHYLD&RUUHLRV$V IRWRJUDÀDVGHYHPVHUDSUHVHQtadas impressas, em formato de 20 x 30 centímetros, e serão avaliadas por uma comissão FRPSRVWDSRUWUrVSURÀVVLRQDLVGD%DKLDHGRLVGHRXWUDV localidades, todos indicados pot meio de fóruns representativos GRVHWRU Criado em 2002, o Prêmio 1DFLRQDOGH)RWRJUDÀD3LHUUH 9HUJHUpXPFRQFXUVRELDQXDO Em sua mais recente edição  UHJLVWUDUDPVH 109 inscriçþes, sendo 44 da %DKLDHGHRXWURVHVWDGRV como Amazonas, Mato Grosso, &HDUi5LR*UDQGHGR1RUWH Pernambuco, Minas Gerais, 5LRGH-DQHLUR6mR3DXOR 3DUDQi6DQWD&DWDULQDH5LR Grande do Sul, alÊm do DistriWR)HGHUDO8PDFRPLVVmRIRUPDGDSRU-RVp&DUORV0DPHGH /HRQDUGR&RVWD%UDJDH6pUJLR %XUJLVHOHFLRQRXRIRWyJUDIR PLQHLUR3HGUR'DYLGTXHSXblicou um catålogo e realizou DH[SRVLomR2-DUGLPH[LELGD no Museu de Arte Moderna da %DKLD 0$0%$ HQWUHGH setembro e 28 de outubro deste DQR


4

DIVERSĂƒO&ARTE

TRIBUNAINDEPENDENTE

MACEIĂ“ - DOMINGO, 6 DE JANEIRO DE 2013

“O que vale na vida nĂŁo ĂŠ o ponto de partida e sim a caminhada. Caminhando HVHPHDQGRQRÂżPWHUiV o que colherâ€? FOTOS BY CHICO BRANDĂƒO

A

Dieta do sexo

ntes e durante o sexo, alguns detalhes fazem a diferença: lingerie, ambiente, tempo livre, vontade e, acredite, a alimentação. Enquanto alguns pratos prometem ser afrodisíacos, outros podem causar inchaço e gases e atrapalhar o clima. Por isso listamos oito alimentos para evitar antes de ir para a cama. São eles: Feijão causa gases e inchaço; adoçantes - podem causar inchaços; brócolis - na mesma lista do feijão e da FRXYHÀRUSRLVFRQWpPXPDo~FDU difícil de digerir; carne vermelha - faz com que seu corpo foque as energias em digeri-lo; bala de alcaçuz preto - traz alteraçþes hormonais e pode diminuir o desejo sexual em homens e mulheres; queijo - 75% das pessoas têm algum tipo de intolerância à lactose; ålcool - a bebida alcoólica ajuda os casais a se soltarem durante o sexo, mas tomar um champanhe ou um vinho pode causar sono; chiclete - não Ê um alimento, mas pode causar gases. 7HQGRXP¿QDOGHDQRQRPDLVDOWRHVWLORDEHOD DUTXLWHWDValeria Cox DVVLQDJUDQGHVSURMHWRVQHVWH LQtFLRGH6RPDQGRQRYRVWUXQIRVDRVHXFXUUtFXOR SDUDDOHJULDGHWRGDVRFLHGDGH

$QREUH]DHHOHJkQFLDGHValderez Tolêdo FrançaXPD DPLJDTXHPDUFDSUHVHQoDQRVDFRQWHFLPHQWRVWRSGD FLGDGH&RPHoDXPQRYRDQRQRPDLVDOWRHVWLOR Feliz 2013!

'H]GLFDVSDUDHPDJUHFHUGHSRLVGDVIHVWDVGHÂżPGHDQR

1- Aproveite o estímulo do início do ano e estabeleça metas diårias. É importante ter um REMHWLYRDVHUSHUFRUULGRTXHVHMDFODURHUHDOLVWD$RDOFDQFHGHFDGDPHWD¿FDPDLVIiFLO DWLQJLURREMHWLYR¿QDO 2 - A temperatura Ê quente e pede comida leve: bastante salada, crua ou cozida, cereais integrais, carnes brancas, feijão e frutas frescas. 3 - Esqueça aqueles alimentos muito calóricos e gordurosos. Evite frituras, molhos à base de maionese, à base de queijo, doces, creme de leite, manteiga etc. 4 - Faça de cinco a seis refeiçþes ao dia, com pequena quantidade de alimentos. O cafÊ

Colado

T

alvez vocĂŞ nunca tenha ouvido falar em bodycon dress, mas certamente jĂĄ o viu no corpo de algumas celebridades. O modelo de vestido ĂŠ aquele justĂ­ssimo ao corpo, com efeito de “embalado a vĂĄcuoâ€?, que pode ser curto e com decote. O bodycon dress ĂŠ para sensualizar mesmo, jĂĄ que deixa cada centĂ­metro do corpo em evidĂŞncia e ressalta as formas – o que pode nĂŁo ser muito legal para quem estĂĄ acima do peso. E nĂŁo ĂŠ sĂł por aqui que o vestido virou queridinho, nĂŁo. Aproveite o VerĂŁo e ouse tambĂŠm!

Alecrim Verde

liane, Elaine e Zilma Tenório feliz da vida com o novo espaço do Alecrim Verde, localizado na Ponta Verde. AlÊm do menu variado, do sabor maravilhoso e do cafÊ regional, a casa agora oferece um espaço climatizado, que se harmoniza com os demais ambientes. Uma excelente dica SDUDHVWH¿PGHVHPDQD

D

Imaginarium

epois do sucesso absoluto nesta temporada de presentes de ¿PGHDQRD Imaginarium, da amiga Mårcia Marques, reforça os estoques dos produtos de volta às aulas. Mas a dica da coluna Ê para as divertidas garrafas hidratantes. Perfeitas, para combater o calor escaldante da cidade. ParabÊns, amiga!

A

Niver

semana chegou DR¿PFRP aniversariantes super festejados, entre eles os empresårios Gilbert Cavalcante Farias e Geraldino Gonçalves, que tiveram os telefones congestionais na quinta (3) por mais uma virada de calendårio. Neste såbado (5) a festa serå toda para a colunista social Ana Monteiro. Querida por todos, Aninha celebrarå o niver entre poucos e bons, à beira da piscina da sua residência. Felicidades, amiga!

A

da manhã, almoço e jantar devem ser equilibrados e completos. Faça tambÊm lanches entre as refeiçþes com frutas ou barra de cereais, sucos ou ågua de coco. 5 - Para hidratar e nutrir beba sucos de frutas. Escolha os mais refrescantes e menos calóricos: melão, limão, abacaxi, melancia. 6 - Evite os doces em excesso. Quando tiver vontade, coma uma porção pequena, mas não faça disso uma rotina. Se você não vive sem sobremesa, escolha a fruta de sua preferência e bom apetite. 7- Beba muita ågua, de 1,5 a 2 litros de ågua por dia. A ågua hidrata, estimula a circulação sanguínea, o metabolismo, o funcionamento intestinal, a digestão, e com isso contribui tambÊm para o processo de emagrecimento. 8 - Faça as preparaçþes no vapor, assadas, cozidas ou grelhadas. São mais nutritivas, menos gordurosas e muito mais saudåveis. 9 - Chega de bebidas alcoólicas. O ano que se passou jå foi comemorado e agora mãos à obra para estar em forma no Verão. 10 - Apenas alimentação não faz milagre. O conjunto alimentação saudåvel e exercício físico regular Ê fundamental para mandar embora os quilinhos extras.

A

Derretendo

credite, quando o assunto Ê moda, ainda não inventaram de tudo. A URB criou meias-calças e leggings que dão a impressão de que uma borracha estå derretando na sua perna. E Ê exatamente disso que as melting tights (meias-calças derretendo) são feitas. Låtex e talco de bebê compþem uma mistura elaborada à mão, que resulta nessas belezinhas. Tem atÊ versão masculina! Elas estão à venda on-line e custam entre US$ 50 e US$ 55 (aproximadamente R$100 e R$110), ou seja, não são nenhuma pechincha. E aí, vai encarar?

V

Papada

A

Maria CecĂ­lia

conhecida dermatologista Maria Cecília Pugliesi nos comunicando que depois das IHVWLYLGDGHVGH¿PGHDQRHVWDUi de volta nesta segunda (7) às atividades na Clínica Dermis Dermatologia Avançada, localizada no 5º. andar do novo Harmony.

ocĂŞ sente incomodada com a temĂ­vel “papadaâ€? embaixo do queixo provocada pela Ă€DFLGH]? EstĂĄ aterrorizada com as rugas que começaram a surgir no pescoço? Muita calma, para esse problema tem solução e prevenção. A Ă€DFLGH]IDFLDO ĂŠ resultado do envelhecimento cronolĂłgico que infelizmente vem acompanhado de rugas, sulcos, depressĂľes na pele, principalmente ao redor das pĂĄlpebras, maças do rosto, queixo e pescoço. O uso exclusivo de alguns produtos e tratamentos SRGHPUHWDUGDURHQYHOKHFLPHQWRHHYLWDUDĂ€DFLGH](QWUHRV tratamentos mais indicados estĂŁo carboxiterapia facial, peeling de diamante, hidratação ouro 24k, vacina antiage, endermolift.

Todas as correspondĂŞncias, como convites para esta coluna, e para Elenilson Gomes, deverĂŁo ser enviadas para Av. Sandoval Arroxelas, 840, Edf. Calliate Ap. 204 PV CEP: 57035-230

Iloa abre suas portas para o pĂşblico

Ritz Lagoa da Anta

M

årcio e Mirella Coelho, leia-se Ritz Lagoa da Anta e Ritz Suítes, neste Verão comemorando 100% de ocupação nos hotÊis, que são referência em todo o país. ParabÊns, amigos, pelo merecido sucesso.

Adyelle Oliveira

+iYDJDV

proximidade da Copa e das eleiçþes, em 2014, deve manter em alta a criação de emprego com carteira assinada em 2013. AlÊm de obras de infraestrutura, o consumo tambÊm impulsionarå o mercado formal de trabalho. A expectativa Ê de criação de 1,3 milhão de vagas em 2013, segundo a mÊdia das previsþes dos analistas mais otimistas - os que apostam em um crescimento maior da economia, de 4%. Bom para todos!

Assine a Tribuna Independente e esta coluna

pelo telefone (82) 3311-1308

Acesse o portal Tribunahoje.com e leia na Ă­ntegra a coluna Top News no Blog Elenilson Gomes

elenilsontopnews@gmail.com

M

ais novo complexo turĂ­stico-imobiliĂĄrio de Alagoas, o ILOA Vida em FamĂ­lia, na Barra de SĂŁo Miguel, acaba de iniciar suas atividades. Operando em sistema soft-open desde o dia 3 de janeiro, o empreendimento, projeto pioneiro da Vivendi no Estado, reĂşne em uma ĂĄrea verde de 90.000 m², composta por um gigante complexo de lazer e esportes, duas propostas: o ILOA Resort, hotel com 96 apartamentos de alto padrĂŁo, administrado pela BHG Solare, terceira maior rede hoteleira do paĂ­s, e o ILOA Residence, condomĂ­nio com 156 unidades habitacionais de um, dois ou trĂŞs quartos, com os serviços, lazer e segurança de um hotel. “Foram trĂŞs anos de planejamento e mais outros trĂŞs anos de obras para tornar este sonho uma realidadeâ€?, diz. Felipe Cavalcante, idealizador do projeto, sĂłcio-diretor da Vivendi, e presidente da Associação para o Desenvolvimento ImobiliĂĄrio e TurĂ­stico do Brasil, Adit. â€œĂ‰ com muito orgulho que entregamos agora mais este importante equipamento turĂ­stico para Alagoas, que inserirĂĄ a Barra de SĂŁo Miguel no circuito dos grandes resortsEUDVLOHLURV´DÂżUPD

A

coleção Primavera/Verão GDFRQKHFLGD6SDWL¿OXVGD empresåria Adryelle Oliveira, estå belíssima. A mulherada chic ¿FDUiDLQGDPDLVHOHJDQWHQHVWH promissor início de ano. Vale a pena conferir!

J

O

Natal e o RĂŠveillonVHIRUDPHXPDQRQRYRVHLQLFLD(RTXHÂżFRX"5HVVDFD TXLOLQKRVDPDLVHPXLWDVSURPHVVDV"6HYRFrHVWiQHVVHEDUFRDSURYHLWHR9HUmRH FRPHFHMiDFXLGDUGDDOLPHQWDomRHGDDWLYLGDGHItVLFD $ÂżQDOHPDJUHFHUID]HUGLHWDSDUDDEXVDUGHVDLDVVKRUWVEOXVLQKDVHELTXtQLVFRP WUDQTÂ LOLGDGHUHTXHUHVIRUoR9HMDDVGLFDVTXHCyberDietSUHSDURXSDUDWHDMXGDUD LQLFLDUEHPRDQR(QmRGHL[HGHFRQIHULURTXDQWRSUHFLVDHPDJUHFHUHFRPHFHVXD UHHGXFDomRDOLPHQWDU

E

$DUTXLWHWDCeres VasconcelosXPQRPH TXHHQJUDQGHFHDVRFLHGDGHIRLXPDDQIULWm SHUIHLWDQR~OWLPRGLDQDVXDEHODFREHUWXUD Feliz 2013DPLJD

A empresåria Mårcia Maciel, que vem ditando a moda entre as elegantes da seara, nos apresentando mais um modelo da grife Bebesh para a sua maison Mårcia, para você arrasar na estação


VAMOS

BRINDAR MAIS DE 250 MIL TURISTAS PASSARÃO POR ALAGOAS NA ALTA TEMPORADA, SEGUNDO ABIH-AL

Com ampla atuação no mercado nacional para atrair cada vez mais turistas, a Associação Brasileira da Indústria de Hotéis de Alagoas (ABIH-AL), anunciou durante balanço anual com associados e trade turístico, a chegada de mais de 250 mil turistas durante a alta temporada de verão. De acordo com o presidente do ABIH-AL, Glênio Cedrim, o número compreende passageiros que visitam o Estado no período de 15 de dezembro a 15 de fevereiro. “Todos os resultados alcançados são frutos de um trabalho integrado entre iniciativa pública e privada, planejada há sete anos e coordenada pela ABIH-AL, SETUR e SEMPTUR. Estamos comemorando a chegada de novos investimentos, que superaram a meta de 16 mil leitos da capital Maceió; mais voos e turistas. A perspectiva para os próximos anos é ainda melhor”, explica. Segundo o presidente da entidade, hoje, Alagoas é reconhecido em todo o mercado turístico como um destino desejado e de alta qualidade. Se 2012 foi bom, as perspectivas para 2013 são ainda melhores. Com novos voos da Avianca, Azul, Tam e Trip, totalizando 23 voos regulares diários, o número de desembarques aumenta a cada mês. Para a alta temporada, a operadora CVC colocou mais 16 voos extras para atender a demanda crescente. Novos hotéis também mostram o potencial de desenvolvimento do Estado. Até o fim de 2012 serão inaugurados dois empreendimentos no litoral Sul: Hotel Ponta Verde Praia do Francês, em Marechal Deodoro, e o complexo ILOA, na Barra de São Miguel. Para o ano que vem estão previstos mais cinco hotéis e resorts: Barra Bali, na Barra de São Miguel, R1 Express, Havengrid e GJP, em Maceió. “Nossa responsabilidade é ainda maior agora, pois devemos surpreender nossos turistas e chegar ao grau de excelência. Temos a felicidade de hoje poder contar com o poder público estadual e municipal de Maceió, que irá continuar com o trabalho integrado na prefeitura de Rui Palmeira. O trabalho não para, pois o turismo ainda só representa 8% do PIB alagoano e podemos chegar a 10% em 2013.”, destaca Glênio. Para que todas essas conquistas chegassem, a entidade investiu em ações de Marketing, sempre em parceria com as secretarias de turismo. De acordo com a diretora executiva da ABIH-AL, Tereza Bandeira, foram realizados este ano 55 eventos em 30 cidades do Brasil e também

Entidade fez confraternização entre o trade e anunciou uma das melhores temporadas dos últimos anos

Argentina e Peru. “Ainda fizemos 10 famtours com 333 agentes de viagens, 14 operadores e 12 jornalistas, para divulgar ainda mais o destino”, afirma a diretora. Estiveram presentes ao evento o prefeito eleito Rui Palmeira, a secretária de Turismo de Maceió Cláudia Pessoa, a secretária adjunta de Estado do Turismo Raquel Tenório e representantes do trade. A equipe do ABIH fez homenagem à secretaria de Turismo de Maceió pela atuação nos últimos seis anos de gestão. A Secretaria de Estado do Turismo também recebeu homenagem pelos resultados alcançados e parceria.


CMYK

plus!

Gourmet: APRESENTAMOS O PERNAMBUCANO NEZ BISTRÔ

ano 2 | #73

2

Luxo: NEO FRAGRÂNCIA DA DSQUARED

LOGO DO COMEÇO DE SEU MANDATO, NOVO PREFEITO DE MACEIÓ, RUI PALMEIRA, COMEMORA A VINDA DE MAIS DE 250 MIL TURISTAS NA ALTA TEMPORADA

QUENTE!


(',725,$/ Primeiro Tudo! de 2013... viram?!? O mundo nĂŁo acabou... embora o Facebook – e as redes sociais como um todo – quase tenham vindo a baixo com as inĂşmeras reclamaçþes dos foliĂľes que escolheram o Celebration ou o Absoluto para a hora da virada. ‘Faltou infra’, dizem as mĂĄs lĂ­nguas... NĂŁo sei, nĂŁo fui a nenhum deles (embora minhas equipes de TV e site tenham registrado tudo)... estava curtindo uma enxaqueca daquelas para começar bem o ano... Mas nosso assunto aqui nĂŁo ĂŠ necessariamente a polĂŞmica dos rĂŠveillons, embora tenha a ver com o tema, jĂĄ que falaremos de turistas a granel em nosso solo – fruto, em parte, da campanha MaceiĂł: capital nacional do rĂŠveillon. Por isso estampamos na capa nosso neo big boss, Rui Palmeira. O prefeito demonstra ser pĂŠ quente e, logo no inĂ­cio de sua gestĂŁo, jĂĄ comemora o recorde de ocupação turĂ­stica da cidade... Na sessĂŁo Gourmet, logo aĂ­ ao lado, nosso foco converge para Recife, apresentando aos bons gourmands o Nez BistrĂ´... Na jĂĄ tradicional coluna Luxo!, na pĂĄgina ao lado, mostramos os must haves da temporada – que vĂŁo de pingentes do bem Ă ĂĄgua deluxe, passando por news com celebrities e mais e mais... Na sessĂŁo Beauty, apresentamos um verdadeiro arsenal para ajudar vocĂŞ a enfrentar esse calorĂŁo que o alto verĂŁo nos inflige, com cosmĂŠticos de Ăşltima geração para pele e cabelos... E nossa darling, Zenita Almeida, volta Ă  cena com seu suprassumo do finess e da high society... Quer mais?!? Isso ĂŠ Tudo! James Silver Editor

INSTITUTO VERIFICADOR DE CIRCULAĂ‡ĂƒO

Presidente - Antonio Pereira Filho !EN@IłJ=J?AENK'KOÀ-=QHK$=>NEAH@KO0=JPKO "@EPKN$AN=H/E?=N@K =OPNK !EN KIAN?E=H*=NEHAJA =JQPK KIAN?E=Hĥ /A@=žKĥ

'=IAO0EHRAN„"@EPKNAOLA?E=HIAJPA?KJRE@=@K *KNC=J=$ANI=JK„OOEOPAJPA@ALNK@QžK 1KI!Q=NPA„1N=P=IAJPK@AEI=CAI #KPKOĥ0EHREK"QCà JEK  =@Q-NEIKH='=?GOKJ/K@NECQAV A@ERQHC=žK !E=CN=I=žKĥ'KJ=PD=J =JQPK

Entrada com camarĂľes em cama siciliana e toque de amĂŞndoas; trilogia de bacalhau e de sobremesa,

Quinteto de chocolate com contraste de cupuaçu

FRANCO-ITALIANO! NEZ BISTRĂ” BRINDA ANIVERSĂ RIO, COMEMORA O INGRESSO NA ASSOCIAĂ‡ĂƒO DOS RESTAURANTES DA BOA LEMBRANÇA E RECEBE NOVO CHEF O restaurante Nez BistrĂ´ tem motivos de sobra para comemorar. AlĂŠm do aniversĂĄrio de cinco anos de funcionamento do Nez BistrĂ´ Casa Forte e de um ano do Boa Viagem, o restĂ´ comemora o ingresso, em janeiro de 2013, na Associação dos Restaurantes da Boa Lembrança, recebe o novo chef Bruno Didier no comando de ambas as casas e renova os cardĂĄpios em 2013. Para comemorar, a casa apresenta menu exclusivo desenvolvido por Marcella Souto Maior para a data: suaves camarĂľes em cama siciliana e um leve toque de amĂŞndoas de entrada, seguido por uma trilogia de bacalhau como prato principal e um surpreendente quinteto de chocolate com contraste de cupuaçu de sobremesa. Deu ĂĄgua na boca?!? As trĂŞs opçþes custam, juntas, R$ 90,00. O Nez tambĂŠm compartilha com seus clientes a alegria de ingressar na Associação dos Restaurantes da Boa Lembrança, que a partir de janeiro de 2013 passa a incluir o bistrĂ´ na rota dos restaurantes contemplados com a avaliação nacional por sua excelĂŞncia. A inspiração para os novos menus de 2013, inclusive, ficarĂĄ a cargo de outra novidade: apĂłs 12 anos na Espanha, o chef Bruno Didier passa a comandar as duas casas – Casa Forte e Boa Viagem – e conduzir, da melhor forma possĂ­vel, a tradicional e ousada cozinha franco-italiana jĂĄ conquistada ao longo desses cinco anos de histĂłria.

SERVIÇO NEZ BISTRÔ Praça de Casa Forte, nº314 (81) 3441.7873

Trio que faz o staff de diretores da FAA/EstĂĄcio: Cristina Suruagy, Ana FlĂĄvia e JessĂŠ Holanda

COMPETĂŠNCIA

]LN

Por Zenita Almeida zenitaalmeida@gmail.com www.zenitaalmeida.com

 FKNJ=HEOP= @AH=E@A +KCQAEN= @AQ QI ODKS @A ?KILAPà J?E= ?KIKOOAOOKN=@A KIQJE?=žK?KJPN=P=@=LAHKOAILNAOšNEKO ENXAQUECA E CASAMENTO @K>OKHQPKHÀI@K?NA@AJ?E=IAJPK@=EILNAJO= BKEQI=LANğ#EMQAE?=O=@=LKNREJPA=JKOAPEJD=QI=AJT=MQA?=PANNÄRAH BAEP==JłPNE?KIKO?KJRE@=@KO3ELO@KARAJPK .Q=J@KIAOAL=NAE =AJT=MQA?=BKEAI>KN=‡"OOAÀK?KJ?AEPK @=*EJEOPN="HE=J= =HIKJOK>NA?=O=IAJPK

NEGĂ“CIO FECHADO

PARCERIA Olhando para um bambuzal, podemos entender como Ê bonita a parceria, a soma, a ajuda mútua: todos os finos bambus se ajudam na grande touceira do bambuzal. Só quando compreendemos que a união com outras pessoas nos dar verdadeira força, Ê que nos tornamos realmente pessoas equilibras e maduras.

REDE DE CONTATO Ao longo da nossa vida, necessitamos de fazer contato com pessoas especiais, que estĂŁo em nosso caminho para nos ajudar, para somar e fazer fantĂĄsticas parcerias conosco. NinguĂŠm sobrevive sozinho. Todos nĂłs temos quem nos oriente, e essas pessoas podem estar dentro da nossa prĂłpria famĂ­lia ou nĂŁo. Pode ser aquele amigo que vocĂŞ ver de vez em quando, ou mesmo aquele ex-chefe que soube dar grande estĂ­mulo no seu inĂ­cio de carreira. VocĂŞ deve ter contatos com pessoas fundamentais para o seu crescimento profissional, pessoas em perfeita sintonia com vocĂŞ, com valores essenciais com os seus. Alimente esses relacionamentos que sĂł lhe engrandece e ajuda na sua carreira.

Matheus Vilela e a pop star Ivete Sangalo

,NC=JEV=žKNJKJ@A*AHHK KI=EKNCNQLKAILNAO=NE=H@A?K- GAROTA DEVASSA IQJE?=žK@AH=CK=O =?=>=@A?KILN=N=13*=N@KAILNAOšNEK HEJA*KN=AOAOPNA=Nš=JKR=?=IL=JD=@=?ANRAF=!AR=OO= MQA RAI?KIPQ@KL=N=B=PQN=N=HPKJK?=NJ=R=H )Q?E=JK=N>KO=

SALVE JORGE

COMUNICAĂ‡ĂƒO A fala ĂŠ a maior ferramenta de persuasĂŁo, e geralmente ĂŠ atravĂŠs dela que vendemos idĂŠias, projetos, produtos e serviços. Todos dependemos um do outro, e a comunicação ĂŠ sem dĂşvida ĂŠ o maior elo entre todas as pessoas. O que vocĂŞ diz traz conseqßências para vocĂŞ mesmo, para outras pessoas, para sua organização, e – por que nĂŁo? – para o mundo. Falar com clareza, objetividade e inteligĂŞncia ĂŠ um sinal de respeito ao outro, seja esse quem for. Reflita sobre a sua capacidade de se comunicar.

queiramos ou não, somos escolhidos pela qualidade da nossa identidade pessoal e profissional. A marca de uma pessoa insere na sua identidade como pessoa e como profissional. Essas pessoas impactam com sua presença em qualquer empresa. Uma marca serve principalmente para diferenciar produtos, serviços, idÊias, pessoas etc. As empresas de hoje estão muito mais exigentes na suas escolhas, e a prioridade são pessoas com boas marcas. Invista na sua marca para ter uma brilhante carreira.

KJ@AJ=@K š OAEO =JKO LAHK 01# LAHK LNK?AOOK @K IAJO=HK  'KOÀ$AJKÄJKPKIKQLKOOA?KIK!ALQP=@K#A@AN=HA@EOOAAOP=N ?KI=?KJO?Eà J?E=OANAJ= OACQEJ@K=OJKNI=O@=@AIK?N=?E=A @= KJOPEPQEžK"JMQ=JPKOQ=?KJO?Eà J?E=AOP=NOANAJ= IQEPKO ?E@=@KO>N=OEHAENKOAOPKOAI@KNIENLKNB=HP=@AAO?KH=L=N=KO łHDKO B=IEHE=NAOIKNNAJ@KJKOLKOPKO@AO=Î@A AP=JP=OKQPN=O IEOÀNE=O/AOQHP=@K@=ORAN>=O@AORE=@=OLAHKNKQ>K@AHAA@= OQ=MQ=@NEHD=@AH=@NËAO@KO?KBNAOLÎ>HE?KO

CONSCIĂŠNCIA SERENA

)ANFKNJ=EOĂ€=HCK@ALNEIAJPAL=N=MQAIAOLAN=QIN=OEHIAHDKN+KPĂ„?E=OOK>NALKHĂ„PE?KO@KOLNABAEPKOAOPÂťKAJRKHRE@KOAI@AOREK@ARAN>=O KOIQJE?Ă„LEKOMQA>N=@KO A=LKLQH=žKAIPKP=HB=HĂ J?E= KIK@EVQILANOKJ=CAI@=JKRAH=)=@K =)=@KÄĄÄź,MQAĂ€MQAĂ€EOOK‡

"O?NEPKN=B=IKO=LKNAO?NARANJKRAH=O?KI=OOQJPKO@=RE@=NA=H  @AOP=RAV$HÉNE=-ANAVJQJ?=AO?NARAQPKNQEI"I0=HRA'KNCA= NOVO AFFAIR /A?ÀIOAL=N=@K@AE=JPKJU /KJ=H@K?QNPEQKOAQNÀRAEHHKJ JKRAH=OANAOQIAJ=BQC=@A*KNAJ=A'ÀOOE?=+EJCQÀI=C�AJP= AICN=J@AAOPEHK"I-QJP=!AH)AOPA JK2NQCQ=E @=JžKQ PK- I=EOHEC=N=13L=N=IAOIE?A@KO?=LÄPQHKO@APK@K@E= IKQIQEPK?D=IL=JDAA?QNPEQ>K=OL=NPE@=O@AL=EJP>=HH1Q@K J=?KIL=JDE=@AQI=>AH=C=P= OAQJKRK=BB=ENA-=QH=*KN=EO  OK>NEJD=@K?=JPKN,NH=J@K*KN=EO LNEI=@==PNEV HÀK-ENAO "JMQ=JPKEOOKE=P=I>ÀI?QNPE=OAQOIKIAJPKO@AOKHPAEN=AI LEITURA DE JORNAL &>EV= J="OL=JD= =?KIL=JD=@=@A=IEC=O KEO=O@A AHA>NEdades.

ATUANTE

0ACQJ@KJKPE?EšNEKHK?=H K0AJ=@KNAJA@EPK@A)UN=?KJOACQEQ /IEHDËAOL=N=?HEI=PEV=NK AJPNK@A KJRAJžËAO0AEOOK BKNRAN@=@A

RÉVEILLON

KIKOAQFAEPK=>OKHQPK@ANAEJ=NKJ@ALEO=AIMQ=HMQANL=H?K  &RAPA0=JC=HK=CEPKQK/ÀRAEHHKJ@KO=H=CK=JKO?KII=EO@A@Q=O DKN=O@AODKSHÀI@A&RAPA ==J@= =JE>=H B=NN=A!'%=J@O 2L?KILHAP=N=I==JEI=žKMQA@QNKQ=PÀšOOAPA@=I=JD

MEU RECADO O ano começou e muitos planos são feito para quem almeja crescimento profissional ou atÊ mesmo um novo emprego como desafio na busca de novos conhecimentos. Veja boas dicas abaixo. SEJA IMPRESCIND�VEL Uma das coisas mais interessantes na arte de viver Ê sermos únicos e imprescindíveis, apesar de a cada dia vivermos situaçþes e personagens diferentes. Serå que paramos para pensar como as pessoas que convivem conosco nos vêem e que tipo de imagem tem de nós? Serå que nos entendemos do nosso real valor? Serå que somos claros quando nos comunicamos? Como gostaríamos de sermos lembrados profissionalmente? O que jå fizemos atÊ agora para fortalecer a nossa identidade e marca pessoal? Reflita sobre essas perguntas e faça algo sobre sua carreira nesse início de ano. Boa sorte. ACREDITE Nos dias atuais não só apenas produtos de boa marca são preferidos e escolhidos, mas pessoas tambÊm e, com elas, os serviços. Quer


CMYK

*HO&RUSRUDO&Ki9HUGHH9LWDPLQD( J5  HQULTXHFLGRFRPH[WUDWRGH&Ki9HUGH DQWLR[LGDQWH TXHUHGX]RVGDQRVFHOXODUHVSURYRFDGRVSHODUDGLDomR VRODU HPLFURHVIHUDVGH9LWDPLQD(TXHSRVVXLDomR DQWLR[LGDQWHDQWLVVpSWLFDHKLGUDWDQWH

Ampola Blindagem da Cor e Brilho Amend 7UHDWPHQW([SHUWLVH&RORU5HÀHFWSDUDFDEHORV FRORULGRV 5 VXDIRUPXODomRKLGUDWDH UHSDUDSURIXQGDPHQWHD¿EUDFDSLODUFRORULGD RXGHVFRORULGDUHWpPRVSLJPHQWRVGHFRUHVH QXWULHQWHVGHQWURGDHVWUXWXUDGRFDEHORSDUD XPDFRUGHORQJDGXUDomRH¿RVVDXGiYHLV

26HUXP5HSDUDGRU 5PO GD OLQKD0RQRLGD:DLLpLGHDOSDUDGLVFLSOLQDU HKLGUDWDUFDEHORVUHVVHFDGRV&RPDOWRWHRU GHYLWDPLQDVHEDVHIHLWDFRPPDQWHLJDH[WUD YLUJHPGRFRFRGDV)LOLSLQDVH[WUHPDPHQWH KLGUDWDQWHSURSRUFLRQDXPDURPD QDWXUDOPHQWHDJUDGiYHOHLUUHVLVWtYHO

ÏOHRWULIiVLFRGHVRGRUDQWHFRUSRUDO1DWXUD (NRV0DUDFXMi5R[R PO SRVVXL SURSULHGDGHVHPROLHQWHVTXHGHL[DPDSHOH PDFLDDRWRTXHHGHOLFLRVDPHQWHSHUIXPDGD HKLGUDWDPSRUKRUDV

%($87<

%LR%URQ]H)36$'&266XQ&DUHPO 5  DH[FOXVLYDFRPELQDomRGHYLWDPLQDV DFHOHUDGRUDVGREURQ]HDGRFRPRIDWRU$5/ DQWLUUDGLFDLVOLYUHV SURSRUFLRQDFRUGRXUDGD LQWHQVDGXUDGRXUDHSUHYLQHDGHVFDPDomR

/RomR8OWUD'HIHQVH)36± PO5 LQGLFDGRSDUDD IDPtOLDDWLYDTXHSUDWLFDHVSRUWHVRXJRVWDGHDSURYHLWDUXPGLDGHVRO QDSUDLDRXQRFOXEH Spray cRQWtQXR8OWUD0LVW8OWUD'HIHQVH)36± PO5  FRQWDFRPDWHFQRORJLD$YR7ULSOH[TXHJDUDQWHXPDSURWHomR SURORQJDGDHHIHWLYDFRQWUDUDLRVVRODUHV&RPXPDIyUPXODQmRROHRVD HGHUiSLGDDEVRUomR

'D%HQH¿W&RVPHWLFVXPGRVSURGXWRVEHVWVHOOHUV QRPXQGRDPiVFDUD7KH\¶UH5HDO

FRANCO-ITALIANO!

EDIÇÃO JAMES SILVER FOTOS DIVULGAÇÃO

COSMÉTICOS PAUTADOS EM CUIDADO COM A PELE E AS MADEIXAS PÓS-SOL, ALÉM DE MAKES INTELIGENTES, VÃO DEIXAR VOCÊ APAIXONADA

VERÃO

UM AMOR DE

Connelly

EJMQEAP=@AOECJAN+EH@=/KO=KBANA?AQ?D¹@AP=N@A1DÀH†=LN¿O IE@E LKNAOOAO@E=O L=N=>=PAL=LKOK>NA=OJKRE@=@AO AIOQ= JAKHKF=J=*=JC=>AEN=O ?KHQJ=?=EQ@A=IKNAOLKNQI?KH=NAINAJ@=OA>KN@=@K?KI LA@N=OBAEPK¸I»K@AOQ==QPKNE=

FOR MAN

0DEOAE@K?AHA>N=OAQg=JERANO¹NEKAI=JQJ?E=J@K = =PNEV 'AJJEBAN KJJAHU ?KIK C=NKP= LNKL=C=J@= @= ?=IL=JD=IQJ@E=H@=HEJD=LNAIEQI#QPQNA0KHQPEKJ)5%¹ MQ=OA@Q=O@À?=@=O=PN¹O  KJJAHHUL=NPE?ELKQ@A?=IL=JD=O LQ>HE?EP¹NE=O@=HEJD=@AI=GAQL@=0DEOAE@KRAE?QH=@=OJK '=L»KA=CKN=OA@EVDKJN=@=AINALNAOAJP=N=HEJD=#QPQNA 0KHQPEKJ)5CHK>=HIAJPA

Miss

#KHE?@AOAJRKHRAQ@KEOIK@AHKO@AAO?=LQH¹NEKOAT?HQOERKO„ @AQIH=@KQILEJCAJPA?KIKR=OEJDKAPNARKAQI=IA@=HDEJD= @=I=N?=A@KKQPNKH=@KLK@AOANQI=IAJEJ=KQQIIAJEJK „L=N==&JOPEPQE¾»K-NÉ NE=J¾= =N@Ä=?= MQA@AO@ALNAOP= =LKEK¸OB=IÄHE=O?=NAJPAO &JPANAOOKQ , LNA¾K @A ?=@= ?KH=N À  /  A BKN=I LNK@QVE@KO=LAJ=OLA¾=O?KINAJ@=NARANPE@=¸EJOPEPQE¾»K

Do bem

Causa nobre

HÀI @= =LNAOAJP=@KN= @NE=JA $=HEOPAQ  KQPNKO JKIAO @= 13 >N=OEHAEN= QJEN=IOA NA?AJPAIAJPA¸&%-" J=?=IL=JD=ļ-A@KłHE=ġ+»KBA?DAKOKHDKOL=N=EOOK‡, =LNAOAJP=@KN/K@NECK#=NKĠBKPK AKO=PKNAO#AHELA#KHCKOEA1D=EH=U=H=CN=R=N=I @ALKEIAJPKOMQAAOP»KOAJ@KRAE?QH=@KOJKO?=J=EOKł?E=EO@=?=IL=JD=J=ONA@AO OK?E=EOAMQAOANRAIL=N==HANP=NPK@KOKO?E@=@»KO?KIQJO@KEILKNP=JPAL=LAH@A ?=@=QIJK?KI>=PA=AOOA?NEIA QI=NA=HE@=@AJKL=ÄO-=N==OOEOPEN=KORÄ@AKO =?AOOAġSSSUKQPQ>A?KI?NEIALA@KłHE= "K=HANP=PAI@=@K?ANPK+KOMQ=PNKLNEIAENKOIAOAO@A Kļ!EOMQA‡„ !EOMQA!AJÎJ?E=+=?EKJ=H@A NEIAO KJPN= NE=J¾=OA@KHAO?AJPAO„NA?A>AQ I=EOHEC=¾ËAOAINAH=¾»K=KIAOIKLANÄK@K@K=JK=JPANEKN

jamessilver@smag.aO

0EJÊJEIK@AOKłOPE?=¾»K¸IAO= =¹CQ=IEJAN=H=@KEPĮÀJ=PQN=HIAJPA C=OAEł?=@==@KEPĮÀ=AO?KHD=JÎIANK@KOBN=J?AOAOL=N==?KIL=JD=N =HIK¾KOAF=JP=NAOCKQNIAP/A?AJPAIAJPA BKEAHAEP==IAHDKN@KIQJ@KJ= ?=PACKNE=ļ¦=¹CQ=MQAIAHDKN?KI>EJ=J»KOÉ?KIKOIAQO?HEAJPAO I=O ?KI=IEJD=C=OPNKJKIE=0AQO=>KN =NKI=APATPQN=O»KÎJE?KOALKNEOOK ÀQILNK@QPK?D=RAJ=IEJD=?KVEJD= MQAF¹IA=?KIL=JD=D¹=HCQI=O @À?=@=O‡ @EOOA1DEANNU*=NT ?DAB@KNAOP=QN=JPA@K*=J@=NEJ,NEAJP=H@A -=NEOAAI>=ET=@KNIQJ@E=H@==@KEPĮ =@KEPĮJ=O?AJKLKN»K@A0»K$=HIEAN =LKQ?KOMQEHÊIAPNKO@A0=EJP ¦PEAJJA JK?QIA@K*KJPA=@KEPL=NPEN@=BKJPA =¹CQ=EJE?E=OQ=HKJC= FKNJ=@=JQI=LNKBQJ@E@=@A@AIAPNKOOK>NAQIOKHK@ACN=JEPK MQA= AJNEMQA?AJ=PQN=HIAJPA?KI@EÉTE@K@A?=N>KJK?KJOP=JPAPAILAN=PQN=@A ` @¹=¹CQ=LNKLNEA@=@AODE@N=P=JPAOAKHECKAHAIAJPKO?KIKI=CJÀOEK  ?¹H?EKAQI=HPKJÄRAH@A>E?=N>KJ=PK BKNPAO=HE=@=OJ=>K=@ECAOP»K

!AQ =PÀ OA@A -ANPAJ?AJPAO ¸ @EREO»K @A ŸCQ=O @K $NQLK !=JKJA  @Q=O I=N?=ONA?KJDA?E@=OLAH=LQNAV=AOQ?AOOKIQJ@E=H?DAC=I@AłJEPER=IAJPA =KN=OEHġARE=J=@KEP  ARE=JĮ À OQ?AOOK @A RAJ@=O AI  L=ÄOAO ¦ AJR=O=@= @ENAP=IAJPA AIQI=BKJPA @AO?K>ANP=@QN=JPA=/ARKHQ¾»K#N=J?AO=AMQAJ=O?AJK =HPK@KOHLAO MQ=OAJ=BNKJPAEN=?KI=0Qľ=%KFA AOP¹J=OIAO=OI=EO OKłOPE?=@=O@KIQJ@K =@=CKP=@AARE=JĮÀQILNAOAJPA@=J=PQNAV= PAI OQ=KNECAIJ=?DQR=AJ=JARAMQA?=AIJKOIKJPAO D=>H=EOAÀłHPN=@= @QN=JPA=JKO OAILNK?AOOKEJ@QOPNE=H LKN=NAE=OCH=?E=NAOL=N==PEJCEN OQ= LQNAV= AT?AL?EKJ=H KI QI AMQEHÄ>NEK ÎJE?K @A IEJAN=EO  = ARE=JĮ P=I>ÀIÀ?KJDA?E@=LAHKO>AJABÄ?EKOMQAPN=V¸O=Î@A =HÀI@KOKłOPE?=@K @AOECJ@=OC=NN=B=O

Alpes Franceses

/8;2

T

Edição 1637 - 6 de janeiro de 2013  
Edição 1637 - 6 de janeiro de 2013  

edicaodigital tribunaindependente tribunahoje

Advertisement