a product message image
{' '} {' '}
Limited time offer
SAVE % on your upgrade

Page 1


YM ME S RS POLYM POLYMERS LPOLYMERS LY P Y OM LLEM LEEY YR RS R MSE POLYMERS POLYMERS

INEOS Styrolution introduces first standard INEOS Styrolution INEOS introduces Styrolutionfirst introduces standard first ABS standard ABS ABS grades with post-consumer recycled material grades withINEOS grades post-consumer with post-consumer recycled material recycled material Styrolution introduces first standard ABS grades with post-consumer recycled material INEOS Styrolution introduces first standard ABS grades with post-consumer recycled material

Rudi Rudi Verwey Rudi Verwey Verwey Mobile: +27 (0)1888 82 552 552 1888 1888 Rudi(0) Verwey Mobile: +27 Mobile: 82 +27 552 (0) 82 Phone: +27 (0) 10 Mobile: +27 (0) 82020 5529111 1888 Phone: +27 Phone: (0)Verwey 10 +27 020 (0) 9111 10 020 9111 Rudi +27 (0) 10 9100 Phone: +27 (0) 10 9111 Fax: +27 Fax: Fax: (0) 10 +27 020 (0)9100 10 020 9100 Mobile: +27 (0)020 82020 552 1888 rudi.verwey@brenntag.co.za Fax: +27+27 (0) (0) 10 020 9100 rudi.verwey@brenntag.co.za rudi.verwey@brenntag.co.za Phone: 10 020 9111 rudi.verwey@brenntag.co.za Fax: +27 (0) 10 020 9100 www.brenntag.com/en-za rudi.verwey@brenntag.co.za www.brenntag.com/en-za www.brenntag.com/en-za www.brenntag.com/en-za www.brenntag.com/en-za

30071_BT_SouthAfrica-Polymers_Ad-Ineos_210x297mm.indd 1 30071_BT_SouthAfrica-Polymers_Ad-Ineos_210x297mm.indd 1 1 Classifieds 30071_BT_SouthAfrica-Polymers_Ad-Ineos_210x297mm.indd Feb/Mar'2020.indd 96

21.01.20 11:04 21.01.20 11:04 21.01.20 11:04 2020/01/23 10:29


MORE EFFICIENCY

MORE ALTERNATIVES

MORE EXPERIENCE MORE EXPERTISE

MORE OPTIONS

MORE MODULARITY

MORE INDIVIDUALITY MORE SOLUTIONS

www.hestico.co.za

Multi-component injection moulding: we have a lot to offer you in this regard - as a technological pioneer with 55 years of experience! From small to large, from hydraulic to electric, with a wide variety of injection unit arrangements - that‘s how far our range extends. That‘s what really counts! For us. And in your production. www.arburg.com

Multicomponent_SA_PolymerTechnology_210x275_'FCSVBS_SA.indd 1

21.01.2020 13:45:55


BY THE WAY

3XEOLVKHU 0DQDJLQJ(GLWRU  Martin  Wells PDUWLQ#VXPPLWSXEFR]D

(GLWRU  Tessa  O’Hara WHVVD#VXPPLWSXEFR]D  3XEOLVKHUV$VVLVWDQW  Heather  Peplow KHDWKHU#VXPPLWSXEFR]D

)LQDQFLDOPDQDJHU  Lisa  Mulligan OLVD#VXPPLWSXEFR]D

'HVLJQHUV  Jeanette  Erasmus  *UDSKLF'HVLJQ MHDQHWWHHUDVPXV#ODWHUDOG\QDPLFVFR]D

Bronwen  Moys  %OLQF'HVLJQ EURQZHQFODUNH#JPDLOFRP

Summit  Publishing  cc t:     f: c:   e:  WHVVD#VXPPLWSXEFR]D 3RVWQHW6XLWH3ULYDWH%DJ; &RQVWDQWLD&DSH7RZQ6RXWK$IULFD 8QLW%HUJYOLHW9LOODJH&HQWUH&QU+LGGLQJK  &KLOGUHQ¶V:D\5RDGV%HUJYOLHW

www.sapt.co.za GAUTENG  Lowrie  Sharp t:   f:   c: e:  ORZULHSODVWLFVPHGLD#DEVDPDLOFR]D KZN   Lynne  Askew c:   e:  O\QQH#VXPPLWSXEFR]D

We could end up with packaging that backchats – DoseCue, a pill bottle that has a series of lights that signal when it’s time to take medicine, won the US Society of Plastics Engineers’ annual parts competition for 2019. DoseCue is blow moulded by FGH Systems Inc of New Jersey, USA. The container has a steppedin panel inside the HDPE bottle. Patients simply follow the lights: the top light flashes green at dose time; the second light flashes green when a dose is taken; if a dose is missed, then a third light flashes red; and the fourth light flashes yellow when it’s time to order a refill. See page 60

With electricity, optimism is fatal

JUST  a  year  or  two  ago,  some  manufacturers  (not  necessarily  in   WKLVLQGXVWU\ ZHUHFRQ¿GHQWDQGRSWLPLVWLFWKDWWKHZRUVWZDVRYHU DVIDUDVHOHFWULFLW\VXSSO\ZDVFRQFHUQHGDQGHYHQHOHFWHGWRVHOO JHQHUDWRUV RUSHUKDSVLQVRPHFDVHVLWZDVFDVKÀRZWKDWOHGWR WKLV" )DVWIRUZDUGWRWRGD\ZLWKGDLO\SRZHUFXWVWKHQRUPDJDLQ DQGWKRVHZKRLQYHVWHGLQDOWHUQDWLYHSRZHUJHQHUDWLRQDUHLQD VWURQJHUSRVLWLRQ%XWIRUWKRVHZLWKELJJHUSODQWVWKHFKDOOHQJH LVFRPPHQVXUDWHDQGLQVRPHFDVHVH[WUHPHO\GLI¿FXOWWRLQVWDOO DGHTXDWHFDSDFLW\WRNHHSWKHSODQWUXQQLQJ%HLQJZLVHUDWKHU WKDQRSWLPLVWLFLQWKHFXUUHQW RUODFNRILW UHDOLW\LVYLWDO

'RZĆŠVƉ3URMHFW%XWWHUĆ?\ĆŠJHWVWR.HQ\D 7+(3URMHFW%XWWHUĂ€\XQGHUWDNLQJE\'RZDQLQLWLDWLYHDLPHGDW UHGXFLQJSODVWLFVSROOXWLRQZKLFKVWDUWHGLQ6RXWK$IULFDLQ UHDFKHG.HQ\DUHFHQWO\'RZSHUVRQQHODORQJZLWK3ODVWLFV6$ÂśV 'RXZ6WH\QZHUHLQYROYHGLQWKHWKUHHGD\ZDVWHPDQDJHPHQW DQGHGXFDWLRQSURJUDPPHWRZDUGVWKHHQGRI7KH'RZWHDP DQGJXHVWVYLVLWHGFRPPXQLWLHVÂľZDVWHHQWUHSUHQHXUVÂśWRXUHGWKH 0U*UHHQ3ODVWLFV5HF\FOLQJSODQWDQGFRPSOHWHGDFOHDQXSLQWKH .DVDUDQLDUHDRI1DLURELZLWKOHDUQHUVHGXFDWRUVDQGFRXQFLOORUV :HOOGRQHWRDOOLQYROYHG3URMHFW%XWWHUĂ€\VWDUWHGLQ6RXWK$IULFDZLWK 'HVWLQDWLRQ*UHHQLQ7HPELVDDQGVXSSRUWIURPWKH3ODVWLFV6$WHDP

Printed  by: 1RYXV3ULQW3DDUO Southern  African  Polymer  TechnologyLVSXEOLVKHGVL[ times  a  year  and  focuses  on  these  industries  in  South  and   6RXWKHUQ$IULFD:HZHOFRPHQHZVDUWLFOHVWHFKQLFDO UHSRUWVLQIRUPDWLRQLQJHQHUDODQGSKRWRJUDSKVDERXW HYHQWVDQGGHYHORSPHQWVUHODWHGWRWKHSODVWLFVLQGXVWU\ 7KHYLHZVH[SUHVVHGLQWKHPDJD]LQHDUHQRWQHFHVVDULO\ WKRVHRIWKHSXEOLVKHU9LHZVH[SUHVVHGDUHQRWQHFHVVDUL O\WKRVHRIWKH3ODVWLFV&RQYHUWHUV$VVRFLDWLRQ,QVWLWXWHRI 0DWHULDOVRU$VVRFLDWLRQRI5RWDWLRQDO0RXOGHUVHLWKHU Copyright:  $OOULJKWVUHVHUYHG ISSN  number: ,6'6&HQWUH3DULV

Summit  Publishing:&. VAT  reg:

0RXOGHUVRI6RXWK$IULFD

RI6RXWKHUQ$IULFD

3ODVWLFV&RQYHUWHUV $VVRFLDWLRQ

PET  Plastic  Recycling   6RXWK$IULFD

2-3.indd 2

0$18)$&785(56LQWKH:HVWDUHTXLWHXQH[SHFWHGO\EHLQJ DVNHGWRVRXUFHUDZPDWHULDOVIURPRXWVLGH&KLQDDVDUHVXOWRIWKH LPSDVVHFUHDWHGE\WKHFRURQDYLUXVRXWEUHDNVSHFL¿FDOO\FORVHU WR(XURSHDQG1RUWK$PHULFD$FFRUGLQJWR3UDYLQ0LVWU\RI35($ RI(QJODQGKLVFRPSDQ\KDVEHHQUHVKRULQJZRUNIURP$VLDIRU DZKLOHDVFRPSDQLHVKDYHKDGFKDOOHQJHVZLWKGHOLYHU\WLPHV TXDOLW\VXSSO\LQFUHDVLQJFRVWDQGUHGXFWLRQRIFDUERQIRRWSULQW ³7KHTXHVWLRQLVZKHWKHUWKLVLVDNQHHMHUNUHDFWLRQDVWKHUHLV DOZD\VDVPDOOGLVUXSWLRQLQVXSSO\DIWHUWKH&KLQHVH1HZ<HDURU ZLOOWKLVEHWKHFDWDO\VWWKDWPD\VWDUWDQH[RGXVUHYROXWLRQRIWDNLQJ PDQXIDFWXULQJIURP&KLQDEDFNWR(XURSHDQG$PHULFDRUFRXOG WKLVEHWKHRSSRUWXQLW\IRUWKH$IULFDQFRQWLQHQWWRWDNHDGYDQWDJH´

â&#x20AC;˘ 7KHVHFRQGSDUWRI0LVWU\ÂśVFROXPQ

$VVRFLDWLRQRI5RWDWLRQDO 3ODVWLFV,QVWLWXWH

&RURQDYLUXVSUHVHQWVXQH[SHFWHGRSSRUWXQLW\

,QVWLWXWHRI0DWHULDOV

DERXWPHUJHUVDQGDFTXLVLWLRQV LVSXEOLVKHGRQSDJH

â&#x20AC;Ś IF YOU HAVE SOMETHING TO SAY Look at the bright side: if you have some gem of wisdom to impart, please write to us at tessa@summitpub.co.za

2020/02/14 14:07


VOLUME 18  NR  1

CONTENTS FEBRUARY / MARCH 2020

Find out  more  at  www.sapt.co.za

6

INDUSTRY NEWS

Plastics & packaging industries applaud decision to develop industry-managed waste management plan

8 10

SA 3ODVWLFV3DFWDƛUVWLQ$IULFD

18 20

Rare Plastics in management buyout

22

New DFFHOHUDWHGZHDWKHULQJWHVW V\VWHPDW6WHOOHQERVFKODE

24

BASF engineering materials now supplied by Ultrapolymers

26

MGMW acquires Fine Fit engineering company, ups capacity

28

Plastics LQGXVWU\XSEHDWIROORZLQJ VXFFHVVRISODVWLFVFROORTXLXP National 8UHWKDQH,QGXVWULHVEX\V Kasodur TPU plant

44

58

60

64 70

80 60

Advanced 0DQXIDFWXULQJ,QQRYDWLRQ $ZDUGVVKRZFDVHH[FHOOHQFH

Manufacturing • Injection moulding machines from 100-ton up to 500-ton clamp force • R&D expertise specialising in cradle-to-grave solutions, product design

Inkulu IXUWKHULPSURYHVKHDOWKDQG VDIHW\VWDQGDUGV

ENVIRONMENT

Injection moulding for the medical, transportation, engineering, home appliances & houseware markets Various and vast skill sets, coupled with years of experience in quality and production control, R&D, machine setting, mould designing and procurement.

11 37

Quality Systems • Effective quality benchmark tool to ensure the precision of all products • Implemented throughout every process in the supply chain

38

WinnerRIWKH&DUROLQH5HLG$ZDUG IRUFOHDQXSFKDPSLRQRIWKH\HDU

COMPOSITES

Value-Added Services • PAD printing • Product assembly • Re/design consulting • Career development and enhancement

Contact GPS Plastics

‘Britannia’ ERDWFUDGOHVZLWK UHF\FOHGFDUERQƛEUH

DESIGN

Medical, solar energy blow moulding EUHDNWKURXJKV

WORLD NEWS

China to ban all single-use plastics

DIARY

JEC World 2020: ,QVSLULQJH[SHUWV  H[FHSWLRQDONH\QRWHVSHHFKHV

ON THE COVER: ALPLA Group, an international plastic packaging and recycling specialist, has joined a new consortium for chemical recycling of PET. The consortium intends to speed up the commercialisation of enhanced recycling technology, BP Infinia, which turns opaque and difficult-to-recycle PET plastic waste into recycled feedstocks. Read more on page 21

Kevin Govender Tel: 031 700 6900 or email: kevingov@gpsplastics.co.za Diana Govender: 082 997 3205 Preshan Naidoo: 082 768 6114 Email: sales@gpsplastics.co.za

2-3.indd 3

2020/02/14 14:07


COMMENT At the core of the operation â&#x20AC;&#x201C;  MGMW  in  Roodekop,  Germiston,  recently   completed  work  on  one  of  the  largest  barrel-­and-­screw  sets  it  has   SURGXFHG\HW+HUHZHVHH:RO¿0DUDOLNDQGWKH0*0:WHDPZLWKWKH unit  (see  page  26).  Although  the  SA  plastics  industry  does,  surprisingly,   not  have  a  well-­established  machinery  producing  sector  (in  spite  of  having   the  skills),  there  are  a  number  of  barrel/screw  manufacturers  who  are  doing   exceptional  work.  When  these  items,  which  are  at  the  core  of  production  in  our   industry,  run  well  the  chance  of  the  rest  of  your  plant  running  smoothly  is  enhanced

20/20 visionâ&#x20AC;&#x2122;s

going to be ultra-necessary this year Itâ&#x20AC;&#x2122;s  going  to  be  tough

A

4 FEB / MARCH 2020

BOUT  the  only  thing  we  can  be   relatively  sure  of  going  into  2020  is   that  we  are  less  likely  to  have  trouble   with  unions  this  year,  but  thatâ&#x20AC;&#x2122;s  only   because  they  will  probably  be  kept  busy   with  the  woes  of  virtually  all  the  state-­owned   enterprises,  which  are  likely  to  shed  a  large   number  of  jobs. The  hoped-­for  lull  could  provide  an  opportunity   for  convertors  to  do  what  they  are  actually  set  up  to   do  and  want  to  do,  manufacture.  Manufacturing  has   been  going  backward  in  South  Africa,  whereas  itâ&#x20AC;&#x2122;s   our  view  that  the  sector  should  be  growing  steadily.   If  you  disagree  with  the  latter  statement,  maybe  you   should  visit  manufacturing  businesses  around  the   country  and  observe  what  these  people  are  doing.  Itâ&#x20AC;&#x2122;s   a  mosaic  of  entrepreneurial  individuals  taking  massive   responsibility  (for  their  customers  AND  employees)   and  also  huge  risks.  I  have  been  doing  this  for  some   years  and  am  in  awe  of  many  of  the  people  Iâ&#x20AC;&#x2122;ve  been   fortunate  to  meet  on  this  little  journey. Most  convertors  are  facing  huge  challenges  besides,   the  main  one  being  sluggish  customer  demand.  The   pressure  is  industry-­wide  and  the  fact  is  that  some   companies  are  better  equipped  and  geared  to  deal  with   the  situation:  the  result  is  that  those  companies  â&#x20AC;&#x201C;  even   if  they  are  not  doing  quite  as  well  as  they  could  â&#x20AC;&#x201C;  are   getting  further  and  further  ahead  of  the  strugglers,  who   could  end  up  paying  a  high  price.  And  some  already  

THIS ISSUE KDYH6RWKHEHVWWKLQJWRGRLV¿UVWDQDO\VHZKHWKHU\RXU business  has  momentum  or  not.  Due  of  all  the  pressure,  it  is   possible  that  a  manufacturer  may  not  see  the  signs  and  even   be  very  busy  â&#x20AC;¦  and  losing  money  all  the  time. One  option  would  be  to  call  in  a  business  management   specialist  or  consultant  to  analyse  your  operation,  which  is   not  a  service  we  offer  but   what  we  are  offering  here   is  ideas  about  products,   and  quite  a  lot  of  them   actually.   :H¿UVWKDYHDQXPEHU of  industry  association   developments,  including   WKHRI¿FLDOLQWURGXFWLRQ of  the  South  African   Plastics  Pact  (page  8).   The  Pact  has  assembled   a  number  of  impressive   partners  and  an  option  for  all  convertors  would  be  to  follow   the  process  and  aim  to  unearth  new  enviro-­savvy  product   solutions.  In  the  years  before,  some  brand  companies   introduced  packaging  or  other  product  solutions  where  they   knew  the  products  could  not  be  recycled,  or  only  reprocessed   LIH[WUHPHDQGGLI¿FXOWPHDVXUHVDUHWDNHQ:HOOWKDW¶VQRW going  to  work  anymore.  Maybe  you  can  come  up  with  a   product  life  cycle  concept  where  all  the  post-­use  problems   are  anticipated  and  dealt  with?  Solutions  are  urgently   needed.  And,  sorry,  you  canâ&#x20AC;&#x2122;t  do  it  on  your  own  â&#x20AC;&#x201C;  you  will   need  partners. Please  read  on. Martin Wells, Publisher

Follow the process and aim to unearth new enviro-savvy product solutions


JHB 63491/OJ

Sustaining communities. An attractive characteristic of PE100 piping systems is the creation of leak-free joints through heat fusion, which creates a joint that is as strong as the rest of the pipe. Ensuring on fulfilling the needs of the local potable water pipe market, for generations to come.

Classifieds Dec/Jan'2020.indd 96

A Division of KAP Diversified Industrial (Pty) Ltd.

2019/11/08 11:45


NEWS

Plastics & packaging industries develop industry-managed waste Industry  agree  that  it  be  left  in  charge  of  their  own  funds  and  projects

6 FEB / MARCH 2020

DESPITE  the  fact  that  a   considerable  amount  of  time,   money  and  effort  have  been   invested  to  prepare  and  submit   an  Industry  Waste  Management   Plan  (IndWMP)  for  the  paper   and  packaging  industry,  the  SA   government  have  unilaterally   made  the  decision  to  scrap  the   existing  Section  28  plan. However,  SAâ&#x20AC;&#x2122;s  plastics  and  packaging   industries,  represented  by  Packaging  SA   and  Plastics/SA,  have  both  welcomed  the   announcement  made  by  Barbara  Creecy,   Minister  of  Environment,  Forestry  and   Fisheries  (DEFF). Although  the  development  of  this  plan   has  already  been  more  than  three  years   in  the  making,  Minister  Creecy  announced   in  December  that  she  would  be  starting  an   entirely  new  process  under   Section  18,  as  this  would   allow  for  an  

Plastics|SAâ&#x20AC;&#x2122;s  executive   director  Anton  Hanekom tive   Shabeer  Jhetam,  execu A director  of  Packaging  S

industry-­managed  plan  as  opposed  to  a   government-­managed  plan. Admitting  that  the  Ministerâ&#x20AC;&#x2122;s   announcement  came  as  a  surprise,   Shabeer  Jhetam,  executive  director  of   Packaging  SA,  said  that  they  welcomed   the  Ministerâ&#x20AC;&#x2122;s  insight  and  decision.  Industry   leaders  agree  that  a  government-­managed   plan  would  have  had  the  potential  of   nullifying  these  achievements  and  making   LWPRUHGLIÂżFXOWIRUWKHVHRUJDQLVDWLRQV WRDFFHVVWKHIXQGVQHHGHGWRIXOÂżOWKHLU mandates. â&#x20AC;&#x153;Despite  the  fact  that  a  considerable   amount  of  time,  money  and  effort  have   been  invested  to  prepare  and  submit  our   Federation  of  Plans  which  represented  the   entire  packaging  industry,  we  believe  the   Minister  has  made  the  right  decision.   â&#x20AC;&#x153;Through  our  engagements  with  her   over  the  past  few  months,  we  were  able  to   introduce  her  to  the  excellent  work  done   by  the  various  packaging  streams  through   their  various  Producer  Responsibility   2UJDQLVDWLRQVLH3RO\FR 3RO\ROHÂżQ material),  PETCO  (PET),  The  Glass   Recycling  Company  (glass  packaging),   MetPac-­SA  (metal  packaging),  Polystyrene   Association  of  South  Africa  (high  impact   and  expanded  polystyrene),  South  African   Vinyls  Association  (vinyl  products)  and   Paper  Manufacturers  Association  of  South   Africa  (paper  products).â&#x20AC;? â&#x20AC;&#x153;These  organisations  are  all  industry-­

funded  and  managed  and  are  focussed   on  growing  the  collection  and  recycling  of   the  various  packaging  streams  in  order  to   demonstrate  their  membersâ&#x20AC;&#x2122;  commitment  to   Extended  Producer  Responsibility  (EPR).   As  a  result  of  their  consistent  and  concerted   efforts  South  Africa  has  managed  to  grow  its   UHF\FOLQJÂżJXUHVRQD\HDUO\EDVLVRYHUWKH past  10  years  to  become  one  of  the  world   leaders  in  mechanical  recycling.   Âł:HDUHVHQGLQJOHVVPDWHULDOWRODQGÂżOO thanks  to  lightweighting  and  progress  in   developing  a  circular  economy  for  each   industry,â&#x20AC;?  he  said. Industry  have  always  advocated  for   an  industry-­managed  plan   Commenting  on  behalf  of  the  plastics   industry,  Plastics|SAâ&#x20AC;&#x2122;s  executive  director   Anton  Hanekom,  said  they  too  were  relieved   to  learn  of  the  Ministerâ&#x20AC;&#x2122;s  decision  to  develop   a  new  plan  under  Section  18  of  the  Waste   Management  Act,  in  close  consultation  with   industry  representatives. â&#x20AC;&#x153;We  have  always  advocated  for  an   industry-­managed  plan  where  the  producers   of  packaging  materials  are  held  responsible   for  managing  their  waste  through  belonging   to  industry  bodies  that  represent  their   interests  and  drive  their  own  recycling  and   collection  efforts.   â&#x20AC;&#x153;The  failure  of  previous  initiatives  such  as   Buyisa  e-­Bag  and  Redisa  triggered  serious   warning  bells  for  us  and  highlighted  the  


Kasodur sells off plant

applaud decision to management plan need  for  proper  governance,  transparency   and  credibility.  For  this  reason,  we  agree   that  the  industry  be  left  in  charge  of  their   own  funds  and  projects,  albeit  with  very   close  cooperation  and  direct  accountability   to  Government,â&#x20AC;?  he  said. Clarity  on  why  none  of  the  submitted   plans  were  approved Discussing  the  Ministerâ&#x20AC;&#x2122;s  feedback  and   charting  the  way  forward  during  a  recent   EULHÂżQJPHHWLQJDWWHQGHGE\LQGXVWU\UROH players  who  submitted  Industry  Waste   Management  Plans,  DEFF  Director   General,  Nosipho  Ngcaba,  provided   clarity  on  why  none  of  the  submitted  plans   were  approved.  She  also  reported  that   according  to  Treasury,  there  are  no  funds   available  for  a  Government  plan.   â&#x20AC;&#x153;A  total  of  13  industry  plans  were   submitted  to  the  Minister  for  consideration   of  which  the  paper  and  packaging   industry  submitted  seven,  the  electrical   HOHFWURQLFLQGXVWU\VXEPLWWHGÂżYHDQG the  lighting  industry  one.  The  Minister   has  sent  letters  to  each  of  the  parties   who  submitted  plans,  spelling  out  the   UHDVRQVZK\VKHUHMHFWHGWKHVSHFLÂżF plan.  However,  throughout  the  entire   process  it  has  become  abundantly  clear   that  none  of  the  plans  meet  the  criteria  of   a  Government  managed  model,  and  that   a  Section  28  plan  is  therefore  no  longer   the  best  route  to  take.  To  expedite  the   www.plasticsinfo.co.za

process,  she  would  like  to  return  to  the   drawing  board  as  soon  as  possible  to   develop  a  workable  plan.  Receiving  the   VXSSRUWDQGEX\LQRIWKHLQGXVWU\LVYLWDOLI this  plan  is  to  succeed,â&#x20AC;?  Ngcaba  said. She  explained  that  a  framework   needed  to  be  developed  that  would   include  clear  targets  for  each  sector,   with  quarterly  and  annual  reporting,   the  minimisation  of  waste  and   HQFRXUDJHPHQWRIUHF\FOLQJ7KHÂżUVW of  these  engagements  will  take  place   early  in  February  2020  and  will  require   input  in  terms  of  a  possible  structure  and   future  cooperation  between  industry  and   Government. â&#x20AC;&#x153;We  cannot  afford  to  gamble  with  the   future  of  our  environment  or  our  industry,   but  need  a  plan  that  will  allow  us  to  use   collection  and  recycling  mechanisms  that   have  already  been  put  into  place  and   have  proven  to  be  successful.   Âł,DPFRQÂżGHQWWKDWWKLVQHZDSSURDFK will  best  serve  the  interests  of  the  country,   the  environment  and  the  industry.  I  look   forward  to  providing  our  members  with   regular  updates  on  opportunities  for  job   creation  by  incorporating  the  informal   sector,  enabling  access  to  better  quality   and  quantities  of  recyclable  waste  by   LQWURGXFLQJKRXVHKROGVHSDUDWLRQDW source  nationally,  and  contributing  to   economic  growth  through  unlocking  new   opportunities,â&#x20AC;?  Anton  added. www.packagingsa.co.za

.$62'85WKH:HVWHUQ&DSHEDVHG compounder  of  TPU,  TPR  and  TPEs,   has  shut  and  its  plant  has  been   purchased  respectively  by  Gauteng   manufacturers  National  Urethane   Industries  and  Rigifoam.   Kasodur  Polyurethane  started   manufacturing  in  Durban  in  1991,   later  moved  to  Knysna  and  then  to   Clanwilliam  in  the  Western  Cape   where  the  dry  conditions  were  suitable   for  polyurethane  processing,  and   more  recently  to  Wellington,  where   similar  weather  prevailed.  But  in   spite  of  all  the  effort  put  in  by  founder   Alan  Richards,  the  business  lost   momentum  further  after  his  son  Dale   relocated  to  England. Kasodur  also  manufactured   cast  polyurethane  moulds  and   liners  and  that  part  of  the  business   and  equipment  have  been  sold  to   Rigifoam,  also  a  Johannesburg   business. Kasodur  was  the  only  manufacturer   of  thermoplastic  polyurethane  (TPU)   on  the  African  continent.

Transpaco Recycling has closed THE  Transpaco  Recycling  plant  in   Elandsfontein  shut  on  13  December.   That  followed  a  decision  taken  by  the   group  in  September  to  discontinue  its   SRVWFRQVXPHUUHF\FOLQJRSHUDWLRQ which  it  said  was  due  to  restricted   selling  price  levels  as  a  result  of  low   virgin  polymer  prices  while  energy,   labour  and  distribution  costs  keep   rising.  It  said  it  believed  there  was   no  likelihood  of  the  pricing  situation   LPSURYLQJLQWKHVKRUWWRPHGLXPWHUP Most  of  the  plant  had  already  been   VROGRIIE\HQG-DQXDU\DQGQHZ tenants  were  due  to  move  into  the   large  site  (over  10,000m²)  in  February. A  substantial  number  of  workers   were  laid  off  in  December,  with  the   likelihood  that  many  of  them  may   have  found  work  at  other  recyclers   in  Gauteng. FEB / MARCH 2020 7


NEWS

Revival of REDISA looks unlikely, very unlikely 72$//LQWHQWVDQGSXUSRVHVDQ\ SRVVLEOHUHFRYHU\IRUWKHW\UHUHF\FOLQJ YHQWXUH5(',6$LVDSSHDULQJOHVVDQG OHVVOLNHO\7KHSURYLVLRQDOOLTXLGDWLRQ DQGVXEVHTXHQWDFWLRQV±FKLHÃ&#x20AC;\WKH ZLWKGUDZLQJRIWKH5(',6$SODQ± FUHDWHGDVLWXDWLRQWKDWLVGLI¿FXOWWR UHVROYH7KHIDFWWKDWWKHDFWLRQDJDLQVW 5(',6$ZDVLQ$SULOIRXQGWREH XQODZIXOGRHVQRWPHDQWKDWHYHU\WKLQJ FDQVLPSO\EHUHVHWWRWKHVWDWXVDVDW WKHGD\EHIRUHWKHSURYLVLRQDOOLTXLGDWLRQ DGYLVHGDZHOOSODFHGVRXUFH7KH VRXUFHGLGKRZHYHUDGGWKDWIRUPHU 5(',6$SHUVRQQHOZHUHVWLOOZRUNLQJ RQZKDWUHPDLQHGRIWKHYHQWXUHDQG KRSLQJWRUHVROYHWKHPDWWHU 7KHWRSLFFDPHWROLJKWDJDLQUHFHQWO\ DIWHUQHZVHPHUJHGWKDWWKH:DVWH %XUHDXZDVSODQQLQJWRGXPSODUJH TXDQWLWLHVRIW\UHVRQODQGZKLFKLWFRXOG VXSSRVHGO\JDLQDFFHVVWR LQRQHFDVH HYHQDVWUHWFKRIODQGZKHUHDVPDOO WRZQLQWKH:HVWHUQ&DSHZDVVLWXDWHG 

8 FEB / MARCH 2020

SA businesses struggling to [\IaIÃ&#x2020;WI\ 67$766$¶VODWHVWGDWDRQOLTXLGDWLRQV DQGLQVROYHQFLHVVKRZVWKDWLWLVKDV EHFRPHLQFUHDVLQJO\GLI¿FXOWWREHD EXVLQHVVRZQHULQ6RXWK$IULFD7KH QXPEHURIOLTXLGDWLRQVLQFUHDVHGE\ LQFRPSDUHG ZLWK7KLVIROORZHGDQQXDOFKDQJHV RILQDQGLQ 7KHUHZHUHDWRWDORIOLTXLGDWLRQV LQ&RPSDQ\OLTXLGDWLRQVLQFUHDVHG E\ IURPWR DQGFORVH FRUSRUDWLRQOLTXLGDWLRQVLQFUHDVHGE\  IURPWR IURP 7KHWKUHHODUJHVWFRQWULEXWRUVWRWKHWRWDO RIOLTXLGDWLRQVUHODWHGWREXVLQHVVHV LQ¿QDQFLQJLQVXUDQFHUHDOHVWDWHDQG EXVLQHVVVHUYLFHV OLTXLGDWLRQVRU  XQFODVVL¿HG RU  WUDGHFDWHULQJDQGDFFRPPRGDWLRQ OLTXLGDWLRQVRU  $ERXWWKHRQO\WKLQJWREHJUDWHIXOIRULV WKDWFRQYHUWRUEXVLQHVVHVLQRXULQGXVWU\ GLGQRWPDNHWKHOLVW

SA Plastics Pact DÆ&#x153;UVWLQ$IULFD Keeping  plastics  in  the  economy  and  out  of  the  environment 7+(RI¿FLDOODXQFKRIWKH6$ 3ODVWLFV3DFWRQ-DQXDU\ VDZDVHDWHUFRQIHUHQFH URRPOHIWZLWKRQO\VWDQGLQJ URRPDVNH\VWDNHKROGHUVLQWKH SODVWLFVYDOXHFKDLQ±LQFOXGLQJ EXVLQHVVHVJRYHUQPHQWVDQG 1*2V±JDWKHUHGWROHDUQPRUH DERXWWKLVEROGLQLWLDWLYH

GHYHORSPHQWRIVROXWLRQVDPSOLI\ DQWLSODVWLFPHVVDJHVDQGFDVFDGH EHVWSUDFWLFH:KLOHWKH&LW\FDQ¶WLQ LWVRZQFDSDFLW\PDNHFRPPLWPHQWV WRZDUGVDFKLHYLQJWKHSDFW¶VWDUJHWV LWIXOO\VXSSRUWVWKHLQLWLDWLYHDQG LWVHPEHGGHGSULQFLSOHV*RDOV KRZHYHUZLOOQRWEHDFKLHYHGZLWKRXW FROODERUDWLYHLQGXVWU\DFWLRQ´ VKHDGGHG

7KHVWDWLVWLFVDERXWSODVWLFSROOXWLRQ DUHRYHUZKHOPLQJEXWLQLWLDWLYHV VXFKDVWKHQHZO\ODXQFKHGDQG JDPHFKDQJLQJ6$3ODVWLFV3DFWDLP WRWDFNOHWKHSUREOHPKHDGRQE\ NHHSLQJSODVWLFVLQWKHHFRQRP\DQG RXWRIWKHHQYLURQPHQW ³6XFKDV\VWHPUHWKLQNDQG UHGHVLJQFDQQRWEHDFKLHYHGE\D VLQJOHRUJDQLVDWLRQZRUNLQJRQLWV RZQ$OOVWDNHKROGHUVLQFOXGLQJ EXVLQHVVHVJRYHUQPHQWV1*2V DQGRWKHUVQHHGWRFROODERUDWH7KH 6RXWK$IULFDQ3ODVWLFV3DFWSURYLGHV DSODWIRUPIRUFROODERUDWLRQDQG FRQFHUWHGDFWLRQ´VDLG-XVWLQ6PLWK KHDGRIWKH%XVLQHVV'HYHORSPHQW 8QLWDW::)6$ 7KH¿UVWWDUJHWKRZHYHULV WRGH¿QHDOLVWRISUREOHPDWLF XQQHFHVVDU\SODVWLFSDFNDJLQJDQG SURGXFWVDQGDJUHHRQPHDVXUHVWR DGGUHVVWKHVHDVDWRSSULRULW\7KLV ZLOOEHHIIHFWHGWKURXJKDFRRUGLQDWHG HIIRUWOHGE\DVWHHULQJFRPPLWWHH FRPSULVHGRIWKH3DFW¶VIRXQGLQJ PHPEHUVDQG*UHHQ&DSHWKH3DFW¶V QHZO\DSSRLQWHGDGPLQLVWUDWLRQRI¿FH ³7KH&LW\RI&DSH7RZQLVGHOLJKWHG WREHFRPHWKH¿UVWPXQLFLSDOLW\QRW MXVWLQWKHFRXQWU\EXWZRUOGZLGHWR SOHGJHLWVVXSSRUW´VDLGWKH&LW\¶V 0D\FR0HPEHUIRU:DWHUDQG:DVWH ;DQWKHD/LPEHUJ ³7KH&LW\¶VUROHDVDVXSSRUWLQJ PHPEHULVWRFRQWULEXWHWRWKH

Global  Plastics  Pact  network 7KH6$3ODVWLFV3DFWLVDOVRWKH ODWHVWWRMRLQ7KH(OOHQ0DF$UWKXU )RXQGDWLRQ¶V3ODVWLFV3DFWJOREDO QHWZRUNDOLJQHGZLWKWKH1HZ 3ODVWLFV(FRQRP\YLVLRQ7KH¿UVWRI LWVNLQGLQ$IULFDWKH6$3ODVWLFV3DFW MRLQV)UDQFH%ULWDLQWKH1HWKHUODQGV DQG&KLOHWRH[FKDQJHNQRZOHGJH DQGFROODERUDWHWRDFFHOHUDWHWKH WUDQVLWLRQWRWKHFLUFXODUHFRQRP\ IRUSODVWLF 7KH3DFWZDVGHYHORSHGE\ WKH:RUOG:LGH)XQGIRU1DWXUH ::)6$ LQSDUWQHUVKLSZLWKWKH 6RXWK$IULFDQ3ODVWLFV5HF\FOLQJ 2UJDQLVDWLRQ 6$352 DQGWKH 8.¶V:DVWHDQG5HVRXUFHV $FWLRQ3URJUDPPH :5$3 ,W KDVEHHQGHYHORSHGIRUWKH6RXWK $IULFDQFRQWH[WEXWDOVRVKDSHGE\ H[SHULHQFHVRIRWKHUVLQWKHJOREDO 3ODVWLFV3DFWQHWZRUNLQSDUWLFXODUWKH 8.3ODVWLFV3DFWOHGE\:5$3 7KH3DFW¶VIRXQGLQJPHPEHUV DUH&OLFNV*URXS&RFD&ROD$IULFD 'DQRQH'LVWHOO+RPH&KRLFH 0DVVPDUW0\3ODV1DPSDN5LJLGV 3LFNQ3D\3RO\RDN3RO\SODQN 6KRSULWH*URXS63$56SXU+ROGLQJV )RVFKLQL*URXS7LJHU%UDQGV7XII\ 8QLOHYHU$GGLV:DVWH3ODQDQG :RROZRUWKV2WKHURUJDQLVDWLRQV LQFOXGH)UXLW6RXWK$IULFD6$352WKH 3RO\ROH¿Q5HVSRQVLELOLW\2UJDQLVDWLRQ WKH3RO\VW\UHQH$VVRFLDWLRQRI6RXWK


Panel discussion â&#x20AC;&#x201C; Pavitray  Pillay  of  the  WWF-­SA  facilitated  a  panel   discussion  with  Peter  Skelton  (Head  of  Strategic  Partnerships  at   WRAP),  Mandy  NaudĂŠ  (CEO  of  Polyco),  Eric  Leong  Son  (Group  Head   for  Sustainability  at  Distell),  AndrĂŠ  Nel  (GM  for  Sustainability  at  Pick   n  Pay),  Sinethemba  Khameni  (Packaging  Sustainability  Manager  at   Tiger  Brands)  and  Johann  Conradie  (SAPRO)

Africa,  PETCO,  the  Southern  African   Vinyls  Association,  the  Institute  of  Waste   Management  of  Southern  Africa,  the   National  Department  of  Environment,   Forestry  and  Fisheries  and  the  City  of   Cape  Town. Supporting  members  include  Fruit   6RXWK$IULFD6$352WKH3RO\ROHÂżQ Responsibility  Organisation,  the   Polystyrene  Association  of  South   Africa,  the  PET  Recycling  Company,   the  Southern  African  Vinyls  Association,   the  Institute  of  Waste  Management  of   Southern  Africa,  the  National  Department   of  Environment,  Forestry  and  Fisheries   and  the  City  of  Cape  Town. The  SA  Plastics  Pact  was  developed   with  funding  support  from  the  UN   Environment,  Sustainable  Lifestyles   &  Education  Programme,  the  UKâ&#x20AC;&#x2122;s   Commonwealth  Litter  Programme,   and  Department  for  Environment,   Food  &  Rural  Affairs,  the  British  High   Commission  and  the  WWF  Nedbank   Green  Trust.

the  South  African  plastics  collection  and   recycling  sector  and  help  to  create  new   opportunities  in  product  design  and  reuse   business  models.  Following  the  launch,   GreenCape,  with  the  support  of  WWF-­SA   and  WRAP,  will  develop  the  South  African   Plastics  Pact  roadmap  for  2025  towards   collective  action  in  the  local  market  with   annual  public  progress  reporting. Lorren  de  Kock,  WWF-­SA  project   manager:  Circular  Plastics  Economy,   commented:  â&#x20AC;&#x153;The  SA  Plastics  Pact  has   the  advantage  of  working  with   an  established  recycling   sector  but  there  are   challenges.  Weâ&#x20AC;&#x2122;ll  need   to  focus  on  smarter   packaging  design,   alternative  delivery   models  and  ways  to   increase  the  value   of  materials.â&#x20AC;? She  said  the   SA  Plastics  Pact   would  support  the   development  of  a   secondary  resource  or   â&#x20AC;&#x2DC;circular  economyâ&#x20AC;&#x2122;  in  South   Africa  to  drive  investment  in  infrastructure,   support  livelihoods  and  keep  the   environment  free  of  plastic  pollution.   Speaking  at  the  launch  event,  SAPRO   chairman  Johann  Conradie  said  it  was   essential  to  make  plastics  too  valuable  to   discard  as  pollution. â&#x20AC;&#x153;The  best  way  to  keep  plastic  out  of  the   environment  is  to  make  it  too  valuable  to  

waste.  If  products  are  designed  well  and   WKHUHLVVXIÂżFLHQWGHPDQGIRULWZHNQRZ that  the  South  African  entrepreneurial   VSLULWZLOOVWHSLQWRHQVXUHLWÂżQGVDKRPH That  is  why  the  targets  as  set  in  the  South   African  Plastics  Pact  are  so  important   â&#x20AC;&#x201C;  to  stimulate  design  of  products  to  be   reusable  or  recyclable  and  drive  the  use  of   recycled  content  in  new  products.â&#x20AC;? Sander  Defruyt,  New  Plastics  Economy   lead  with  the  Ellen  MacArthur  Foundation,   said  the  Foundation  was  looking  forward   to  working  with  the  SA  industry   and  government. â&#x20AC;&#x153;The  Ellen  MacArthur   Foundation  welcomes   the  announcement   of  the  SA  Plastics   3DFWWKHÂżUVW on  the  African   continent  to  join   the  global  Plastics   Pact  network.   We  are  looking   forward  to  supporting   the  government  and   industry  of  South  Africa   in  driving  real  change  towards   a  circular  economy  for  plastics,  by   eliminating  problematic  and  unnecessary   plastic  items,  innovating  to  ensure  that   the  plastics  they  do  need  are  reusable,   recyclable,  or  compostable,  and  circulating   the  plastic  items  they  use  to  keep  them  in   the  economy  and  out  of  the  environment. â&#x20AC;&#x153;Together  we  can  create  a  world  without   plastic  waste  or  pollution,â&#x20AC;?  said  Derfruyt.

We need to focus on smarter packaging design, alternative delivery models & ways to increase value of materials.

www.wwf.org.za/our_work/initiatives/the_south_african_plastics_pact.cfm

THE PACT AIMS TO CHANGE THE WAY PLASTIC PRODUCTS AND PACKAGING ARE DESIGNED, USED AND REUSED TO PREVENT PLASTICS FROM ENDING UP IN THE ENVIRONMENT, AND SETS OUT SOME AMBITIOUS TARGETS TO BE MET BY 2025, INCLUDING: 1. Take action on problematic or unnecessary plastic packaging through redesign, innovation or alternative (re-use) delivery models.

2. 100% of plastic packaging to be reusable, recyclable or compostable (in the case of compostables, this is applicable only in closed loop and controlled systems with sufficient infrastructure available or fit-for-purpose applications.)

3. 70% of plastic packaging effectively recycled 4. 30% average recycled content across all plastic packaging

FEB / MARCH 2020 9

GreenCape,  will  develop   roadmap  for  2025 2QHRIWKHÂżUVWDFWLRQVIRUWKH6$3ODVWLFV Pact  after  the  launch  is  the  development   of  a  high-­level  â&#x20AC;&#x2DC;roadmapâ&#x20AC;&#x2122;  for  delivery  to   outline  a  detailed  action  plan  to  meet   the  2025  targets  â&#x20AC;&#x201C;  from  all  actors  in  the   system.  WRAP  has  secured  funding  to   support  this. By  delivering  on  these  targets,  the  SA   Plastics  Pact  will  help  boost  job  creation  in  

Peter  Skelton  (Head  of  Strategic  Partnerships  at  WRAP),  Lorren  de   Kock-­Circular  Plastics  Economy:  Policy  &  Futures  Unit  at  WWF  SA),   Pavitray  Pillay  (WWF  SA)  who  facilitated  the  panel  discussion,  Johann   Conradie  (director  of  MyPlas  and  chairman  of  SAPRO),  Juliet  Lennon,   Project  Manager,  Plastics  Pact  -­  New  Plastics  Economy,  Ellen  MacArthur   Foundation,  and  Lisa  Parkes  (SA  Plastics  Pact  co-­ordination  team)


NEWS

Advanced Manufacturing Indication  of  SA  capability  to  operate  and  excel  in  4IR  technologies SEVERAL  organisations  leading   South  Africa  into  the  Fourth  Industrial   Revolution  (4IR)  were  recognized  at   the  African  Advanced  Manufacturing   Innovation  Awards,  presided  over  by  the   DTI  at  the  Tramways  in  Port  Elizabeth   on  27  November. Awards  were  made  to  11   organisations  in  six  categories  to   identify,  promote  and  reward  innovation   in  the  advanced  manufacturing  and   composites  industry,  including  3D   printing,  robotics,  AI  and  automation. The  top  award  winners  were  Prof   Anton  du  Plessis  of  Stellenbosch   University  (Scholarly  Impact  in   Advanced  Manufacturing)  Rubber   Nano  Products  (Industry  Advancement   in  Advanced  Manufacturing),   Aerosud/Pioneer  Plastics  (Import   Replacement),  Acoustex  (Export   3UR¿FLHQF\ DataProphet  (Innovation)   and  Alvarita  (Best  Start-­up). Aircraft  component  manufacturer   Aerosud  was  acknowledged  for  working  

with  Pioneer  plastics  in  roto-­moulding  of   aircraft  parts  to  develop  the  capability   which  replaced  previously  imported   components. Rubber  Nano  products,  a  chemical   technology  company  that  manufactures   a  novel  activator,  scooped  the  award   for  industry  advancement.  Activ8   realises  a  paradigm  shift  in  the  rubber   curing  process.  This  shift  facilitates   unprecedented  curing  advantages  and   ¿QDOUXEEHUSURSHUWLHVLQWKHVXOIXU based  cure  of  diene  rubbers.  The  nature   of  this  pioneering  technology  allows   it  to  have  an  impact  at  each  stage  of   the  manufacture  of  a  rubber  item,  from   curative  choice,  to  mixing,  to  energy   FRQVXPSWLRQDQG¿QDOSURSHUW\ Activ8  uses  a  proprietary  ionic  liquid   system  which  is  capable  of  dissolving   all  of  the  rubber  curatives  effectively.   This  supersedes  the  surface  particulate   chemistry  that  rubber  curing  has  been   limited  to  for  the  last  century.  This   equates  to  unprecedented  dispersion  

â&#x20AC;&#x153;It is clear that South African companies need not stand back internationally. What is critical is that we widen the base of companies operating at this global standard and that is what in part the awards aim to doâ&#x20AC;?. of  active  species  throughout  the  rubber   PDWUL[DQGDVVXFKLQFUHGLEO\HIÂżFLHQW coordination  of  these  actives  both  in   the  coordinating  phase  of  a  cure  and  in   the  crosslink  formation.  This  has  huge   implications  on  the  amount  of  curatives   needed  and  on  the  energy  needed  to   cure  the  resulting  rationalised  system. In  the  innovation  category,  Data   Prophet  was  rewarded  for  their  AI  work   and  in  the  manufacturing  environment,  

BFG  Africa  showcased  its   range  of  capabilities,  with  Ronel   Bantjes  on  hand  to  answer   questions.  BFG  Africa  is  the   pan-­African  subsidiary  of  one   of  the  largest  composites   manufacturers  in  the  world,  BFG   ,QWHUQDWLRQDO,WLVDOVRWKHÂżUVW investment  made  in  South  Africa   from  Bahrain.  BFG  Africa  is   majority  black-­owned,  with  51%   acquired  in  June  2018  by  the   0HUJHQFHJURXSDGLYHUVLÂżHG ÂżQDQFLDOVHUYLFHVJURXSIRXQGHG in  2014.  BFG  Africaâ&#x20AC;&#x2122;s  9  500m2   factory  produces  materials   PDGHRIÂżEUHUHLQIRUFHG plastic  for  applications  across   the  infrastructure,  mining,   automotive,  transport  and   architectural  sectors.  The  R50m   factory  investment  is  off  the  back   of  an  initial  contract,  entered  into   with  the  Gibela  Rail  Transport   Consortium,  whereby,  BFG  Africa   FODGWKHLQWHULRUVRIDĂ&#x20AC;HHWRI 600  commuter  trains  that  will  be   supplied  to  the  Passenger  Rail   Agency  of  SA  (Prasa)  over  a  10-­ \HDUSHULRG7KHÂżUVWGHOLYHU\RQ this  project  was  met  in  May  2019.   www.bfginternational.com 10

FEB / MAR 2020

NEWS AAMC SHOW.indd 10

2020/02/14 14:09


Innovation Awards showcase excellence

where  an  AI  has  produced   astounding  results  on   IDFWRU\HI¿FLHQF\ Andy  Radford  of  the   Mandela  Bay  Composites   Cluster,  co-­ordinator   of  the  awards,  which   is  an  element  of  the   annual  African  Advanced   Manufacturing  and   Composites  Show,  said   the  awards  submissions   was  an  indication  of  the   capability  South  Africa  has   to  operate  and  excel  in   ,5WHFKQRORJLHV â&#x20AC;&#x153;There  was  once   again  a  high  standard  of   entries  and  it  is  clear  that   Damian  Michael  of  Alvarita  receives  recognition  as  the   South  African  companies   Best  Start-­Up  from  Irish  Tshifhiwa  Bologo  (COO  Special  Economic   Zones  and  Economic  Transformation  at  the  DTI) need  not  stand  back   LQWHUQDWLRQDOO\:KDWLV critical  is  that  we  widen  the  base  of  companies  operating  at  this  global  standard  and  that   LVZKDWLQSDUWWKHDZDUGVDLPWRGR¶¶5DGIRUGVDLG

Caldeaz  Manufacturing  Technologiesâ&#x20AC;&#x2122;  husband   and  wife  team,  Ludrick  and  Mariolize  Barnard   were  proud  to  show  how  far  their  company   has  come  since  its  inception  in  2007.  Caldeaz   supplies  3D  engineering  products  and   services,  all  related  software,  and  3D  cameras.   Ludrick  has  played  a  strategic  and  operational   role  since  the  companyâ&#x20AC;&#x2122;s  inception.  As  one  of   RQO\IRXU6WHLQEHLV&HUWL¿HG&RQVXOWDQWVLQ South  Africa,  Ludrick  can  add  value  in  terms   of  all  aspects  of  manufacturing.  Alongside   KLVUXQQLQJRI&DOGHD]/XGULFNIXO¿OOV various  roles  within  the  Central  University  of   Technology  in  the  Free  State.  During  the  last   decade,  his  role  has  been  that  of  director  of   the  Product  Development  Technology  Station   (PDTS)  and  manager  of  the  Centre  for  Rapid   Prototyping  and  Manufacture  (CRPM).   Caldeaz  is  the  sole  South  African  distributor   of  the  full  range  of  Kreon  Technologiesâ&#x20AC;&#x2122;  (a   company  based  in  France)  3D  products.   Centrally  located  in  Bloemfontein,  the   company  also  supplies  the  Kreon  range  of   3D  scanning  and  3D  measurement  solutions.   Caldeaz  recently  landed  the  Wiiboox  agency  for  SA.  With  a  professional   R&D  team  and  after-­sales  technical  team  from  University  of  Southern   California  and  Zhejiang  University,  Wiiboox  has  provided  integrated  3D   printing  solutions  for  internationally  well-­known  enterprises,  like  P&G,   Oracle,  Jaguar  and  Giant  Bicycles.  Wiiboox  supplies  3D  printing  integrated   solutions  with  products  that  include  FDM,  Food,  DLP,  SLA,  SLS  and  SLM  3D   printers,  White  and  Blue  Light  3D  scanners,  and  Laser  3D  scanners.       www.caldeaz.co.za                      www.wiiboox-­sa.co.za

Alvarita  claimed  the  best   start-­up  award   for  GreenTest,  a   compact  device  that   tests  nitrate  levels   in  fruit,  vegetables,   meat  and  water,   helping  people  to   quantify  their  daily  nitrate  intake  and   make  healthier  choices.  This  device   accurately  detects  dangerous  nitrate   content  in  more  than  64  different   types  of  fruit  &  vegetables.  It  also   measures  background  radiation  of  a   particular  object.   www.alvarita.co.za/products.html

Design  engineer,  Sizwe   Ntimane,  shows  two  of   the  parts  manufactured   by  the  Centre  for   Rapid  Prototying  and   Manufacturing  (CRPM)   at  the  Central  University   of  Technology  in  the   Free  State.  On  the  left,   a  medical  prosthesis   for  the  skull,  and  on   the  right,  a  wheel  made   using  ABS  and  rubber   together  (apparently,   D¿UVWLQWKHLQGXVWU\  Sizwe  designs  the   implants  and  surgical   guides  for  the  surgeons   who  will  use  them.  The   prototypes  are  printed   LQ3$DQGWKH¿QDO implant  in  titanium.  The   CRPM  specialises  in  additive  manufacturing/3D   printing.  The  CRPM  was  established  1997   as  a  centre  for  commercial  work  as  well  as   research  using  rapid  prototyping,  rapid   manufacturing,  rapid  tooling  and  medical   product  development  technologies.  Its   prototypes  are  used  by  product/industrial   designers  for  form  and  function  tests  as  well   DV¿QDOSURWRW\SHVEHIRUHWRROLQJEHJLQV7KH CRPM  can  manufacture  prototypes  in  plastics,   metal  and  sand.      www.cut.ac.za/crpm FEB / MAR 2020

NEWS AAMC SHOW.indd 11

11

2020/02/14 14:10


NEWS

Wayne  Wiid  (Pioneer  Plastics)  and  Joanne  Zambelli  from  Aerosud  Aviation   accept  their  Gold  Award  for  import  replacement  in  advanced  manufacturing   from  Irish  Tshifhiwa  Bologo  (COO  Special  Economic  Zones  and  Economic   Transformation  at  the  DTI)

Andre  Swartbooi  (Acoustex  sales  director)  and  Acoustex  board   PHPEHU:H]D0RVV ULJKW DFFHSWWKHLUDZDUGIRUH[SRUWSUR¿FLHQF\ from  Irish  Tshifhiwa  Bologo  (COO  Special  Economic  Zones  and   Economic  Transformation  at  the  DTI)

Arno  Seyfert,  owner  of  Custom  Works  Composite  Engineering   in  Jeffreyâ&#x20AC;&#x2122;s  Bay,  exhibited  and  was  also  on  hand  to  answer   many  questions  about  the  interesting  and  complex   components  on  display  at  his  stand.  Custom  Works  was   founded  1999.  Arnoâ&#x20AC;&#x2122;s  passion  for  composites  started  in  his   early  teens  which  led  to  experience  in  windsurfer  board   building,  and  manufacturing  aircraft  components  and   automotive  tuning  components.  Custom  Works  has  grown  to   become  the  key  composite  supplier  for  VW  Motorsport  for  the   5DOO\)RUPXOD9:DQG3ROR&XSFDUV&XVWRP:RUNV¶Ã&#x20AC;H[LEOH manufacturing  setup  allows  it  to  manufacture  quality  products   even  in  small  quantities.  Arno  also  assists  Aerontecâ&#x20AC;&#x2122;s   customers  in  the  Eastern  Cape  with  technical  advice.  His  wife,   Gitta,  manages  Aerontecâ&#x20AC;&#x2122;s  branch  in  Jeffreyâ&#x20AC;&#x2122;s  Bay.     www.customworks.co.za/index.php/about-­custom-­works

Grant  Minnie  and  Shannon  Olivier  of   Propella  had  visitors  intrigued  with  their   set-­up  on  display  of  an  IoT  system  for  egg   production  and  delivery  process.  Propella   LVRQHRIWKH¿UVWEXVLQHVVKXEVLQ6RXWK Africa  to  be  fully  geared  for  Industry   4.0.  Propella  helps  commercialise  the   research  and  development  conducted  at   the  Nelson  Mandela  University  (NMU),  as   well  as  other  technology  entrepreneurs   who  either  approach  Propella  for  support   RUZKRDUHLGHQWL¿HGE\3URSHOOD Prospective  incubatees  go  through  a   rigorous  selection  process  to  qualify  for   access  to  the  Propella  and  its  support   services.  Once  they  are  selected  Propella   facilitators  assist  with  mentoring  and  the   evaluation  of  business  concepts.     www.thepropella.co.za 12

FEB / MAR 2020

NEWS AAMC SHOW.indd 12

2020/02/14 14:10


Full list  of  awards  winners Scholarly  Impact Prof  Anton   du  Plessis  of   Stellenbosch   University,   winner  of   the  award   for  scholarly   impact  in   advanced   manufacturing,   shows  his   trophy  –  a  3D   printed  outline   of  Africa  that   reveals  a   woman’s  face   (Mother  Africa)   once  it  is   revolved

WINNER

RUNNER-­UP

Prof Anton  du  Plessis  of  the   University  of  Stellenbosch

Emmanuel Tetteh  of  the  Durban   University  of  Technology

Industry Advancement  in  Advanced  Manufacturing WINNER

RUNNER-­UP

Rubber Nano  Products

Aerosud Aviation  &  Adept  Airmotive

([SRUWSUR¿FLHQF\LQ$GYDQFHG0DQXIDFWXULQJ WINNER

RUNNER-­UP

Acoustex

Shatterprufe

Award that  acknowledges  import  replacement WINNER

RUNNER-­UP

Aerosud Aviation  &  Pioneer  Plastics

Not awarded

Trophy for  Displaying  Innovation WINNER

RUNNER-­UP

Data Prophet

Rhino Sustainability  (Endocube)

Most Promising  Start-­Up  or  Newcomer WINNER

RUNNER-­UP

Alvarita

Tofaa FEB / MAR 2020

13

PIONEER PLASTICS Anything’s Possible

2012 – 2013 – 2014 – 2015 - 2016 – 2017 – 2018 – 2019 ARMSA Product of the Year Winners

With our new SMART Machine we can mould technical components with specialised materials for the Automotive, Medical, Lighting and Aerospace Industry

We can assist in the design, development and manufacture RI\RXUVSHFLÀFSURGXFWV

www.pioneerplastics.co.za

NEWS AAMC SHOW.indd 13

Call us today and let us help you

012 541 6000 2020/02/14 14:10


NEWS Sean Poole  of  Provolution  assists  one  of  the  competitors  in  a  3D  printing   competition  organized  by  his  company  during  the  expo.  Competitors  were   given  six  hours  to  complete  as  many  of  the  six  tasks  as  possible.  Points   were  awarded  on  relative  performance  to  other  competitor.  The  tasks   included  the  3D  printing  of  a  hook  to  hold  the  most  weight;;  a  100mm-­span   bridge  to  hold  the  maximum  weight;;  a  freestanding  ‘Tower  of  Babel’;;  a  tow   with  the  longest  single  part  able  to  tow  1kg  a  distance  of  100mm,  and  a   YDOYHWROLPLWZDWHUÀRZ

Mark de  Voest  of  Invictus  Commodity  Brokers   attended  the  awards  dinner  and  workshops,   with  Max  Krueger  from  SGL  Carbon  Germany   and  Quinton  Nortje,  also  from  Invictus.  

A team  from  Victor  Fortune  CNC  Machine   Tools  took  over  one  of  the  larger  stands  at   the  exhibition  with  their  display  of  milling   and  turning  equipment.  The  team  on   hand  were  Gary  Grainger  (national  sales   manager),  Dudley  Meredith  (managing   director),  Redvers  Harrison  (Guhring   Cutting  Tools)  and  Abraham  Heystek   (Eastern  Cape  branch  manager  based   in  Port  Elizabeth).  Victor  Fortune  in  SA   imports  and  supplies  cutting-­edge  and   top-­quality  CNC  machine  tools,  including   CNC  lathes,  machining  centres  and   plastic  injection  moulding  machines.   The  company  offers  on-­site  machine   orientation  and  operator  training,  as  well   as  after-­sales  service  and  support.         www.victor.co.za

6LOYHUDZDUGZLQQHUIRUH[SRUWSUR¿FLHQF\LQDGYDQFHG manufacturing went  to  Shatterprufe,  represented  here   by  Geoffrey  Höppner  (NPD  &  product  engineering   manager),  with  Wendy  Knott-­Craig,  owner  of  The  PR   Junction  in  Port  Elizabeth

14

FEB / MAR 2020

NEWS AAMC SHOW.indd 14

2020/02/14 14:10


We’ve We’ve bought bought Africa Africa a something We’ve bought special... Africa a little little something special... a little something special...

and and it’s it’s almost almost ready ready to to ship! ship! and it’s almost ready to ship! Contact: 011 865 8360 | Email: info@phoenixpet.co.za | Website: www.phoenixpet.co.za Contact: 011 865 8360 | Email: info@phoenixpet.co.za | Website: www.phoenixpet.co.za Classifieds 96 Phoenixpet Feb/Mar'2020.indd Second Starlinger Launch Campaign Ideas v5 final.indd 1

Contact: 011 865 8360 | Email: info@phoenixpet.co.za | Website: www.phoenixpet.co.za2020/01/07

2020/01/21 10:35 10:53:44 AM


NEWS

Collaboration key to success of 4IR 2nd  edition  of  African  Advanced  Manufacturing  &  Composites  Show  draws  local  &  international  interest By  Wendy  Knott-­Craig

16

FEB / MAR 2020

THE  2nd  Annual  African  Advanced   Manufacturing  Composites  Show  at  the   Tramways  Building  in  Port  Elizabeth,  from   27â&#x20AC;&#x201C;29  November,  once  again  included   a  vibrant  and  interactive  exhibition,  with   approximately  35  exhibitors  covering  all   aspects  of  composites  and  advanced   manufacturing. Exhibitors  were  also  given  a  chance  to   host  a  TED-­talk  type  presentation  in  the   exhibition  area  throughout  the  two  days   of  the  show,  where  they  would  showcase   their  company  and/or  products. The  two-­day  conference  was  well   received  and  included  some  excellent   national  and  international  speakers.   Collaboration  was  a  key  word  throughout   the  two  days  of  conferencing,  with   most  speakers  commenting  on  how   collaborations  will  work  going  forward   to  make  a  success  of  the  4th  Industrial   Revolution.  The  main  message  was,   â&#x20AC;&#x153;Make  use  of  smaller  companies  that   have  the  equipment  or  skills  that  the   larger  companies  do  not  want  to  invest   in.  Collaborate  with  other  corporates  for   social  responsibility  purposes.  Collaborate   with  educational  institutions  to  come  up   with  best  solutions  for  products.â&#x20AC;? Automotive  industry  to  see  greater   export  growth Nigel  Ward,  executive  vice  president   of  Toyota  South  Africa,  gave  a  very   informative  update  on  the  automotive   industry  in  SA  and  the  way  forward.   South  Africa  is  22nd  in  the  world  in   terms  of  volume  sales  of  vehicles,   with  4%  going  towards  the  countryâ&#x20AC;&#x2122;s   GDP.  Ward  anticipates  greater  export   growth  between  now  and  2035.  He   said  South  Africa  needs  to  embrace  the   development  of  the  total  automotive   value  chain,  along  with  OEMs  developing   tier  2  and  3  suppliers  and  the  localisation   of  automotive  component  manufacturing. â&#x20AC;&#x2DC;Staff  in  the  future  need  to  be  able  to   challenge  technology  and  innovation,   not  only  manage  people,â&#x20AC;&#x2122;  said  Ward. Another  sector  of  the  automotive   industry  represented  at  the  conference  

NEWS AAMC SHOW.indd 16

was  the  aftermarket  industry  and  how  it   will  be  affected  by  electronic  vehicles.   Jan  Schoeman,  COO  of  the  Retail   Motor  Industry  Organisation  (RMI),   mentioned  that  workshops  would  need   to  change  the  way  they  operate  due  to   the  new  electronics  that  will  be  found   in  electronic  vehicles.  There  could   also  be  a  longer  time  frame  between   services  of  these  vehicles,  which  will   DIIHFWWKHDIWHUPDUNHWÂżQDQFLDOO\%RG\ repair  shops  will  need  to  be  au  fait  with   the  composites  materials  that  will  be   included  in  the  body  of  vehicles. Progressive  thinking  on  our  doorstep Local  Port  Elizabeth  company,   Jendamark  Automation,  has  been   very  progressive  in  their  way  of   thinking  towards  4IR.  They  make   use  of  virtual  reality,  the  Internet   of  Things,  AR  goggles  and  smart   robotics,  to  name  a  few.  Quinton  Uren,   CEO,  stated  that  their  international   customers  will  have  virtual  reality   training  rooms  in  their  own  countries   where  staff  will  be  trained  via  VR   goggles  and  other  technology.   Jendamark  also  collaborates  with,  and   employs,  millennials  for  their  skills  and   technology  expertise. Manufacturing  facilities  need  to  be  able   to  adjust  to  the  4th  industrial  revolution   as  quickly  as  possible,  and  become   increasingly  agile,  according  to  Dr  Harry   Teifel,  platform  leader  at  Progessus.   Prof  Oliver  Dam,  South  Africa   Fraunhofer  senior  adviser,  mentioned   that  4IR  production  systems  will   become  more  intelligent  and  will  be   able  to  pre-­empt  any  breakdowns. The  DTi  was  represented  by  Ilse  Karg,   chief  director  of  Future  Industrial  and   Production  Technologies,  who  informed   the  delegates  that  the  government  is   currently  working  on  the  â&#x20AC;&#x2DC;New  Instimbi   Future  Production  Technologies  Initiativeâ&#x20AC;&#x2122;   which  can  be  found  on  www.thedti.gov. ]DLQGXVWULDOBGHYHORSPHQWÂżSWMVS The  DTi  have  also  introduced  the  â&#x20AC;&#x2DC;Made   in  Africaâ&#x20AC;&#x2122;  initiative  with  22  African  countries   participating.  Products  made  in  these   countries  will  be  branded  with  this  slogan.  

The  DTi  is  also  investigating  removing   trade  tariffs  between  these  countries. Dr  Kjelt  van  Rijswijk,  from  SAM|XL  @   TU  Delft  (Netherlands)  spoke  about  â&#x20AC;&#x2DC;4IR   from  Vision  to  Revolutionâ&#x20AC;&#x2122;  and  said  that   companies  need  to  share  experiences   and  build  a  common  language.  They   need  to  close  the  gap  between  20th   Century  and  21st  Century  thinking,  but   also  have  fun  discussing  the  way  forward.   â&#x20AC;&#x153;We  need  to  collaborate,  share   knowledge  and  experiences  in  order  to   grow,â&#x20AC;?  he  added. Can  South  Africa  catch  up?   That  was  the  title  of  Tapiwa  Samangaâ&#x20AC;&#x2122;s   presentation.  Samanga,  from  Intsimbi   Future  Production  Technologies   Initiative,  said  South  Africa  is  still   grappling  with  issues  stemming  from  the   2nd  Industrial  Revolution  and  has  a  way   to  go  to  catch  up  with  the  rest  of  the  world.   Samanga  added  that  the  common  thread   in  all  the  revolutions  is  that  they  always   introduced  better  ways  of  doing  things.   According  to  Samanga,  the  Africa   opportunity  looks  like  this: â&#x20AC;˘   55  countries â&#x20AC;˘   33%  GDP  Nigeria,  SA  and  Egypt â&#x20AC;˘   1,2  billion  people â&#x20AC;˘   $2,5  trillion  market Most  of  the  $2,5  trillion  spend  is  in   three  countries:  Nigeria  20%,  Egypt   17%,  South  Africa  11%. 4IR  solutions  should  consider  inherent   fault  lines  in  our  socio-­economic   environment,  namely  racial  and  gender,   unemployment,  poor  service  delivery,   failing  SOEs  and  growing  poverty. Intsimbi  Future  Production  Technologies   partnered  with  government  and  industry   to  develop  learning  programmes  to   prepare  South  Africa.  A  high  percentage   RIOHDUQHUVKDYHTXDOLÂżHGWKURXJKWKLV LQLWLDWLYHLQFOXGLQJWKHÂżUVWEODFNIHPDOH toolmaker  in  South  Africa. What  about  leadership  skills  over  the   next  15  years?   Weza  Moss,  AIDC  Eastern  Cape  board   FKDLUVXJJHVWHGWKHIROORZLQJÂżYHVNLOOV were  essential  for  the  future: 1.  Technology  and  computer  skills

2020/02/14 14:12


in SA

â&#x20AC;&#x2DC;Make use of smaller companies that have the equipment or skills that the larger companies do not want to invest in.â&#x20AC;&#x2122;

2.  Programming  for   robotics  and  automation 3.  Critical  thinking 4.  Working  with  tools  and  technologies 5.  Digital  skills

Moss  also  said  that  there  are  some   expectations  from  leadership,  namely:   â&#x20AC;˘   Embrace  opinions â&#x20AC;˘   Move  fast  with  change  and  donâ&#x20AC;&#x2122;t   micromanage â&#x20AC;˘   Traditional  leaders  â&#x20AC;&#x201C;  lead  effectively,   manage,  inspire  others â&#x20AC;˘   Work  across  the  cultures â&#x20AC;˘   Deal  with  temporal  and  virtual  teams Inclusivity,  diverse  opinions  and  skills A  research  group  at  the  University  of   Stellenbosch,  headed  by  Prof  Anton  du   Plessis,  focuses  on  3D  innovation  using   3D  scanning  to  measure  components   and  carry  out  failure  analysis.  This   method  allows  the  designer  and  

manufacturer  to  immediately  see  where   WKHĂ&#x20AC;DZVDUHLQWKHSURGXFWDQGWR correct  them  before  production. However,  Prof  du  Plessis  said  that   the  main  limitation  to  the  large-­scale   use  of  3D  scanning  was  perceived  cost   and  not  understanding  nor  seeing  value   in  using  the  facility.   According  to  Prof  du  Plessis,  the   winning  strategies  for  4IR  include:   â&#x20AC;˘   Funding â&#x20AC;˘   Positive  attitude â&#x20AC;˘   Collaborate

â&#x20AC;˘  Inclusivity  and  value  diverse  opinions   and  skills Dr  Louis  Tredoux,  senior  expert  for   composites  at  AAT  Composites  gave   an  overview  of  composite  applications   in  various  sectors,  including  wind   turbine  blades,  composite  bridges  and   low-­cost  housing  and  schools. Bernard  Reeksting,  retired  director  for   the  Centre  for  Polymer  Technology VSRNHDERXWUHF\FOLQJFDUERQÂżEUH composites  â&#x20AC;&#x201C;  still  not  possible  in  SA,  but   on  the  increase  around  the  world.  

Jendamark maps clear path through

Industry 4.0 technological maze Tools  to  manage  every  aspect  of  a  manufacturing  &  assembly  process Jendamark  Automationâ&#x20AC;&#x2122;s  CEO,  Quinton  Uren,   opened  the  two-­day  conference  with  a  fascinating   look  into  the  world  of  manufacturing  and  how   Industry  4.0  can  make  a  difference. â&#x20AC;&#x153;The  most  powerful  advanced  manufacturing  tool   is  collaboration,â&#x20AC;?  said  Uren,  and  from  what  each   presenter  delivered  over  the  next  24  hours,  this  was   proven  time  and  again. Based  in  Port  Elizabeth  but  serving  clients   worldwide,  Jendamark  has  mapped  a  clear  path   through  the  Industry  4.0  technological  maze  to   take  customers  into  the  future  of  automotive   manufacturing. The  company  has  pioneered  the  Odin  software   system.  Jendamarkâ&#x20AC;&#x2122;s  fully  integrated  software   platform  is  named  for  the  one-­eyed  Norse  god   of  wisdom  who  sees  all,  â&#x20AC;&#x2DC;Odinâ&#x20AC;&#x2122;.  From  individual   workstations  to  the  entire  production  line,  Odin   provides  the  tools  to  manage  every  aspect  of  a  

manufacturing  and  assembly  process. Common  production  line  problems  include   increasingly  complex  manual  lines,  requiring  costly   operator  training;Íž  human  error  leading  to  potentially   FRVWO\UDPLÂżFDWLRQVDQGWLPHGHOD\VDODFNRI Ă&#x20AC;H[LELOLW\WRPHHWFXVWRPDVVHPEO\DQGG\QDPLF production  requirements;Íž  lack  of  traceability  of   results  due  to  uncontrolled,  unaudited  processes   and  lack  of  real-­time  results  and  self-­service   reporting  on  manual  lines. Jendamarkâ&#x20AC;&#x2122;s  Odin  software  platform  currently   features  three  custom  modules  designed  to  solve   problems  and  integrate  perfectly  with  any  production   facility.  The  platform  includes  a  standard  API,  which   allows  third-­party  developers  to  create  additional   customised  apps  for  optimising  a  production  line. â&#x20AC;˘ 7RÂżQGRXWPRUHYLVLW www.jendamark.co.za/odin-­software/

Quinton  Uren,   Jendamark   Automation,  MD,   who  was  awarded   the  â&#x20AC;&#x2DC;All  Africa   Industrialist  of  the   Yearâ&#x20AC;&#x2122;  at  the  2018   All  Africa  Business   Leaders  Awards

FEB / MAR 2020

NEWS AAMC SHOW.indd 17

17

2020/02/14 14:12


NEWS

Rare Plastics

in management buyout New owners  intend  to  further  improve  the  brand   recognition  in  local,  international  markets RARE  Plastics,  Meyerton-­based  HDPE  pipe  manufacturer   and  distributor,  recently  concluded  a  management  buyout   with  former  CEO,  Renier  Viljoen,  and  former  sales   director,  Ashin  Tasdhary,  taking  over  the  reins. Having  been  involved  in  the  managing  of  the  Rare   Plastics  business  for  some  years,  Viljoen  and  Tasdhary   saw  an  opportunity  to  make  an  offer  to  the  previous   shareholders  of  the  business.  The  MBO  was  concluded   during  the  4th  quarter  of  2019.  The  new   shareholders  will  remain  actively  involved   in  the  day-­to-­day  operations  of  the   company. There  is  no  intention  of  changing   the  name  of  the  company.  Rare   Plastics  is  recognised  both   locally  and  internationally  as   a  producer  of  excellent  quality   HDPE  pipes  and  the  new  owners   intend  to  further  improve  the   brand  recognition  in  both  local   and  international  markets. “Due  to  the  executive  team  being   directly  involved  in  the  management  of   the  company  before  the  MBO,  we  plan  to   simply  continue  with  business  as  usual,”  said   Viljoen. Rare  Plastics  was  previously  part  of  a  larger  group   which  included  a  steel  pipe  division,  Rare  Trading.   The  MBO  transaction  did  not  include  the  steel  assets,   and  as  such  the  steel  division  was  closed  down  by  its   shareholders  in  December  2019.    Rare  Plastics  owns  a   subsidiary  in  Zambia,  Rare  Construction  Zambia,  which   will  also  continue  to  trade  as  per  usual. “Locally,  there  will  be  some  minor  operational  changes,   which  our  clients  will  most  likely  not  even  be  aware  of,  as   we  will  continue  to  offer  the  same  service  and  quality  they   have  become  accustomed  to,”  Viljoen  added.

Renier Viljoen  and   Ashin  Tasdhary

to focus  its  processes  on  delivery  of  pipes   of  exceptional  quality  to  both  local  and   international  clients. “We  are  in  the  process  of  completing   and  commissioning  our  own  inhouse   butt  welding  facility  at  our  premises  in   Meyerton.  For  this  purpose  we  have   constructed  additional  factory  space   of  close  to  600m2.  The  facility’s  layout   ZDVGHVLJQHGDQGEXLOWVSHFL¿FDOO\ZLWK butt  welding  of  HDPE  pipes  in  mind.  The   facility  will  increase  our  welding  output   due  to  improved  material  handling  as  well  as   provide  a  more  controlled  environment  in  which  to   perform  welding.  This  will  further  increase  the  quality   of  our  product  offering,”  Viljoen  said. When  welding  is  performed  in  a  controlled  environment   E\DSSURSULDWHO\TXDOL¿HGDQGH[SHULHQFHGZHOGLQJ techinicians,  it  drastically  reduces  the  possibility  of   contamination  of  the  pipe  materials,  which  could  lead  to   inferior  connections.   The  facility  will  be  fully  operational  by  the  end  of  March   2020.   5DUH3ODVWLFVKDVDOVRUHFHQWO\LQYHVWHGLQLWVRZQÀHHW of  delivery  vehicles  to  ensure  improved  deliveries  to  its   clients. “We  continue  to  maintain  our  memberships  of  both   SAPPMA  and  IFPA,  which  affords  our  clients  absolute   peace  of  mind  when  using  our  pipes  on  projects,”  Viljoen   added.

“Rare Plastics will continue to strive to set the standard for quality in the HDPE markets”

Future direction Viljoen  says  that  Rare  Plastics  will  continue  to  strive  to   set  the  standard  for  quality  in  the  HDPE  markets  and   18

RARE news.indd 18

www.rare.co.za

FEB / MAR 2020

2020/02/14 14:21


NEWS

Inkulu further improves health & safety standards Safepro  OHS  manages  process  at  KZN  pipe  manufacturer ensure  his  plant  is  a  safe  place  for  all  staff  to  work  in.   INKULU  Plastic  Pipes  of  Hammarsdale,  KZN,  has  further   He  thus  engaged  the  services  of  Safepro  OHS  to  achieve   upped  its  health  &  safety  and  ISO  standards  compliance   this  goal.  After  what  was  a  fairly  lengthy  and  intensive   following  an  intensive  training  programme  over  the  duration   process  for  most  of  2019,  the  presentation  of  the   of  most  of  last  year. FHUWL¿FDWHVZDVPDGHRQ1RYHPEHUDQG The  improved  LTIFR  (Lost  Time  Injury   Inkulu  (which  means  â&#x20AC;&#x2DC;Bigâ&#x20AC;&#x2122;  in  Zulu)  is  proud   Frequency  Rate)  rating  achieved  through  the   â&#x20AC;&#x2DC;The improved to  have  achieved  ISO  45001  OHS   training  and  the  improved  awareness  of   LTIFR rating achieved FHUWL¿FDWLRQWKH6$)(3526WDU personnel  can  only  result  in  a  reduction   Award  and  ISO  14001  Environmental   in  lost  production  time  due  to  accidents   through the training and FHUWL¿FDWLRQ7KHVHFHUWL¿FDWLRQVDUH or  injuries  at  the  work  place  â&#x20AC;&#x201C;  and   the improved awareness FRXSOHGZLWK,QNXOX¶VDOUHDG\FHUWL¿HG therefore  lead  directly  to  improved   of personnel can only ISO  9001  quality  system. SURGXFWLRQHI¿FLHQFLHVDQGHYHQ result in a reduction in â&#x20AC;&#x153;Although  this  has  been  a  huge   better  margins. lost production time due to achievement  for  Inkulu  Plastic  Pipes,   The  process  was  conducted  by   accidents or injuries at Mr  Reddy  has  already  stated  that  his   Safepro  OHS  of  Durban,  an  organisation   QH[WWDUJHWLVWKH6DIHSUR6WDUUDWLQJ specialising  in  safety  compliance.   the workplace.â&#x20AC;&#x2122; to  be  met  by  the  end  of  2020  and  also  said   Safeproâ&#x20AC;&#x2122;s  safety  system  comprises   the  accomplishment  would  have  not  been   of  the  key  services  of  Compliance,  Risk   possible  without  the  team  effort  of  the  Inkulu   Management,  Process  Auditing,  LTIFR  and  training.   staff,  led  by  the  companyâ&#x20AC;&#x2122;s  SHERQ  manager  Leon  Naicker,   The  Safepro  system  is  an  integrated  safety  system   who  spearheaded  this  entire  project  over  the  last  12   which  is  aligned  to  ISO  45001. months,  along  with  the  training  and  coordination  provided   Inkulu  CEO  Gabriel  Reddy,  who  has  close  to  40  yearsâ&#x20AC;&#x2122;   by  Safepro. experience  in  the  industry,  has  always  had  the  vision  to  

20 FEB / MARCH 2020

Safepro  CEO   adu,   Richard  Ponn   ed ag an who  m the  OHS/ISO   ear,   process  last  y EO    C lu ku  In th wi  and   Gabriel  Reddy ale   the  Hammarsd ERQ   companyâ&#x20AC;&#x2122;s  SH n   eo  L er ag an m Naicker  with   V WKHFHUWL¿FDWH presented  in   November

www.inkuluplastics.co.za

www.safepro-­ohs.co.za


Classifieds Oct/Nov'19.indd Inkulu ad '018 12-BLEED.indd92 90

2019/09/11 2019/02/04 12:31 10:48


NEWS

New accelerated weathering test system at Stellenbosch laboratory 22 FEB / MARCH 2020

Roediger  Agencies  installs  third  QUV  test  system ROEDIGER  Agencies,  the   Stellenbosch-­based  polymer  testing   laboratory,  has  recently  commissioned   a  new  QUV  accelerated  weathering   test  system,  further  upping  its  capability   to  run  outdoor  weathering  effect  tests   for  a  wide  variety  of  products. Tests  of  the  damage  caused  to   polymer,  composite  and  rubber   products  by  sunlight,  rain  and  dew  are   among  the  most  popular  conducted  

by  Roediger  Agencies.  This  is  the   third  QUV  test  unit  installed  by  the   company  in  the  almost  three  decades   it  has  been  operating. In  a  few  weeks  or  months,  the  QUV   tester  can  reproduce  the  damage  that   occurs  over  months  or  years  outdoors.   To  simulate  outdoor  weathering,  the   QUV  accelerated  tester  exposes   materials  to  alternating  cycles  of   UV  light  and  moisture  at  controlled,   elevated  temperatures.  It  simulates   the  effects  of  sunlight  using  special   Ă&#x20AC;XRUHVFHQW89ODPSVDQGWKDWRIGHZ and  rain  with  condensing  humidity   and/or  water  spray.  According  to  the   manufacturer  of  the  system,  Q-­Lab   of  the  USA,  the  QUV  accelerated   weathering  tester  is  the  simplest,   most  reliable,  and  easiest-­to-­use   weathering  tester  available. According  to  Dr  Andy  Roediger,  who   has  run  the  lab  since  1993,  the  QUV   test  is  the  closest  method  for  testing   for  degradation  and  although  the  unit   cannot  completely  simulate  the  effects   of  sunlight  (for  obvious  reasons)  or   dew,  the  results  give  a  very  clear   estimation  of  the  performance  of   products.  It  supplies  results  for  up  to  a  maximum  of  10  years  effect.

A  wide  variety  of  products  are  tested,   including  items  such  as  carpet  fabric.  Here   the  panel  positioning  the  test  samples  in  the   GHYLFHKDVEHHQEULHĂ&#x20AC;\UHPRYHGWRVKRZ WKHVDPSOHUHYHDOLQJWKHĂ&#x20AC;XRUHVFHQW89 light  operating  within  (the  chamber  can  test   up  to  48  specimens  simultaneously).  The   WHVWVSURGXFHXVDEOHUHVXOWVZLWKLQGHÂżQDEOH periods,  such  as  for  280  or  400  hours.  One   of  the  challenges  for  the  lab  is  that  UV  bulbs   are  costly

About  85%  of  the  samples  tested   pass. â&#x20AC;&#x153;The  main  factor  resulting  in   successful  product  introductions  is   UV  stabilisation,  as  much  in  amount   used  and  correct  choice  of  UV   stabiliser,  and  certain  pigments  such   as  red  and  purple  require  different   UV  stabilisers  to  say  green  and   beige.  Also,  the  addition  of  carbon   black  adds  to  UV  stabilisation,  more   so  than  white  titanium  dioxide,â&#x20AC;?   said  Roediger. â&#x20AC;&#x153;The  main  reasons  for  failure   are  inadequate  UV  stabilisation   and  incorrect  use  of  antioxidants,â&#x20AC;?   he  added. www.roedigeragencies.co.za

Wernich  Kßhn,  one  of  the  analytical  chemists  at  Roediger  Agencies  in   Stellenbosch,  with  the  new  QUV  accelerated  weathering  test  system   recently  commissioned.  The  unit  is  manufactured  by  Q-­Lab  of  the  USA


Vishva Exim expands its wings in Europe Danish Client  Buys  High  Speed  Flying  Knife  Bottom  Seal  Machine  With  3  Servo  System  From  The  K  Show  2019 VISHVA  Exim,  introduced  its  high   speed  Flying  Knife  Bottom  Sealer   with  a  3-­servo  system  at  K2019  –   and  managed  to  sell  the  machine   to  a  customer  in  Denmark. Vishva  Exim  is  a  leading   manufacturer  and  exporter  of  plastics   processing  machinery,  including  bag   makers,  slitters  and  recycling  lines,   of  which  the  VELOSS  is  a  renowned   brand  very  popular  in  South  Africa.

Mr Shah,  director  of  Vishva  Exim,   VD\VWKH&(FHUWL¿HG)O\LQJ.QLIH Bottom  Sealer  is  a  specially  designed   model  which  has  a  triple  servo  system   –  for  indexing,  one  on  the  cutter   and  one  on  the  sealer.  This  system   allows  customers  to  achieve  high   accuracy  sealing  on  high  speeds  as   the  machine  can  run  at  a  speed  of  120   strokes/min. The  servo  on  the  sealer  also  assists   www.vishaexim.com

Presents

BOPP / CO-EX PE CENTER/LAP SEAL POUCH MAKER

the operator  with  an  extra  setting   –  dwell  timing.  Mr  Shah  says  by   having  the  dwell  timing  facility  in   the  hands  of  the  operator,  allows   the  operator  to  take  more  control  in   the  sealing  of  higher  micron  bags.   The  machine  also  has  option   of  a  ground  pick-­up  facility  which   saves  time  and  energy  and  allows   the  operator  to  change  rolls  in   minimum  time.   FEB / MARCH 2020 23

Machines which pack the world

A GREAT SUCCESS

This machine is designed in such a way that it is able to make CO-EX PE film (Recyclable) Lap Seal pouches. It can also handle BOPP Laminate/Non Laminate Film to Convert Pouch.

TECHNICAL DATA Pouch width : 100 - 500mm* Pouch Length : 50 - 500mm*

200 STROKES/MIN* POUCHES TYPE Center/Lap seal

Center/Lap seal with Gusset

WWW. VISHVAEXIM. COM

Reach us: Vishva Exim Pvt Ltd T: +91 90 99 916 958 // +91 99 09 961 225 // E: info@vishvaexim.com // marketing@vishvaexim.com


NEWS

BASF engineering materials now supplied by Ultrapolymers â&#x20AC;&#x2DC;Ultraâ&#x20AC;&#x2122;  materials  move  to  Ultrapolymers  stable SUPPLY  and  technical  support  for  the  BASF  engineering   plastics  business  portfolio  in  South  Africa  will  from  1  March   be  managed  by  Ultraolymers. â&#x20AC;&#x153;Our  partner  Ultrapolymers  will  take  over  the  responsibility   of  our  engineering  plastics  business  portfolio,â&#x20AC;?  said   Thandeka  Molakeng,  head  of  sales:  Africa  for  BASFâ&#x20AC;&#x2122;s   performance  materials  buisness. â&#x20AC;&#x153;We  are  convinced  this  change  will  offer  you  an   improved  buying  experience  as  we  have  seen  in  other   markets  in  which  we  have  also  successfully  partnered  with   Ultrapolymers  over  many  years,â&#x20AC;?  she  added. The  performance  polymers  UltramidÂŽ,  UltradurÂŽ,   UltraformÂŽ  and  UltrasonÂŽ  are  affected  by  the  change.

â&#x20AC;˘   Established  in  Belgium  in  2002,  Ultrapolymers  is  part  of  Ravago   Group.  It  has  in  the  nearly  two  decades  since  become  a  respected   leader  in  polymer  distribution.  In  South  Africa,  the  company  has   RIÂżFHVLQ-RKDQQHVEXUJDQGVXSSOLHVQDWLRQDOO\ www.ultrapolymers.com

Thandeka  Molakeng,  head  of  sales:  Africa  for  BASFâ&#x20AC;&#x2122;s  Performance   Materials  business;Íž  Geoff  Barends,  director  of  Ultrapolymers  South   Africa;Íž  Dietmar  Telle,  director  for  sales  &  distribution  for  EMEA  at   BASF;Íž  Noel  Macheke,  technical  service  at  Ultrapolymers  SA;Íž  and   Greg  Schneider,  director  of  Ultrapolymers  SA,  following  the   announcement  of  the  change

Sew-Eurodrive sets benchmark for Industry 4.0 in SA Range  of  solutions  for  its  concept  of  the  lean  Sm@rt  factory WITH  the  advent  of  Industry  4.0  set  to  change  the  face   of  industry  and  production,  Sew-­Eurodrive  has  a  range  of   solutions  for  its  concept  of  the  Lean  Sm@rt  Factory.  This  is   based  on  the  paradigm  shift  introduced  by  new  technologies   such  as  big  data,  embedded  computing,  the  Internet   of  Things  (IoT),  and  cloud  computing  in  the  production   environment. The  MovigearÂŽ  mechatronic  drive  system  from  Sew-­ (XURGULYHLVGHVLJQHGIRUĂ&#x20AC;H[LEOHXVHDFURVVYDULRXV communication  infrastructures.  It  is  ideal  for  decentralised   ÂżHOGDSSOLFDWLRQV)HDWXUHVLQFOXGHDFRPSDFWGHVLJQDQG RSWLPDOLQWHJUDWLRQRIFRPSRQHQWVZLWKSHUPDQHQWÂżHOG synchronous  motor,  gear  unit,  and  integrated  electronics. 0RYLJHDULVHVSHFLDOO\WDLORUHGIRUHIÂżFLHQWXVHLQWKH general  materials-­handling  sector.  It  is  available  in  two  sizes   and  three  electrical  performance  classes  for  a  total  of  four   communication  variants.  Energy  savings  of  up  to  50%  are   possible  due  to  the  seamless  interplay  between  the  IE4-­ UDWHGPRWRUHIÂżFLHQWJHDUXQLWDQGLQWHJUDWHGHOHFWURQLFV 24 FEB / MARCH 2020

â&#x20AC;&#x153;Perfectly-­matched  components,  combined  with  the   energy  optimisation  of  the  overall  system,  facilitate  high   V\VWHPHIÂżFLHQF\7KHVHIHDWXUHVPDNHWKH0RYLJHDU mechatronic  drive  solution  a  cost-­effective,  power-­ optimised,  total  solution,â&#x20AC;?  said  Sew-­Eurodrive  MD,  Raymond   Obermeyer. Flexible,  compact  and  intelligent  Movidrive  B  drive   inverters  save  space  in  the  control  cabinet.  In  addition,  they   are  equipped  with  integrated  IPOSplus  positioning  and   sequence  control  as  standard  features.  These  inverters  are   ideal  for  asynchronous  AC  or  synchronous  servo  drives. â&#x20AC;&#x153;The  basic  concept  behind  Industry  4.0  is  to  leverage   information  technology  in  order  to  integrate  business  and   HQJLQHHULQJSURFHVVHVIRUPRUHĂ&#x20AC;H[LEOHHIÂżFLHQWDQG time-­independent  production  in  a  range  of  applications  and   industries.  At  the  same  time,  high  quality  and  lower  costs   are  a  given.  Sew-­Eurodriveâ&#x20AC;&#x2122;s  approach  combines  the  basic   tenets  of  Industry  4.0  with  its  benchmark-­setting  solutions   and  concepts,â&#x20AC;?  Obermeyer  added.

www.sew-­eurodrive.co.za


Classifieds Oct/Nov'19.indd 92

2019/09/13 11:23


NEWS

:RO¿ OHIW DQG*XQWKHU0DUDOLN VHFRQGIURPULJKW  0LNH*UDQGFRXUW ULJKW DQGWKH0*0:WHDPSURXGO\ VKRZRIIDODUJHEDUUHODQGVFUHZVHWUHFHQWO\ VXSSOLHGWRRQHRIWKHLUFOLHQWV PHOTO:  LOWRIE  SHARP

MGMW acquires Fine Fit engineering company, ups capacity

MGMW  now  one  of  the  largest  barrel/screw  refurbishment  companies  in  Southern  Africa MGMW  Trading  has  taken  over  Fine   Fit  Engineering,  a  Johannesburg  metal   working  operation  specialising  in  milling   and  turning, The  two  companies  are  now  working   together  under  one  roof  and  the   introduced  skills  have  enabled  MGMW   to  up  its  capacity  â&#x20AC;&#x201C;  to  the  point  where   MGMW  is  now  one  of  the  largest  barrel   and  screw  refurbishment  company  in   Southern  Africa. Gunther  Maralik,  renowned  in   the  industry  for  his  commitment  to   convertors  for  over  40  years,  handed   RYHUWKHUHLQVWRKLVVRQ:RO¿0DUDOLN HLJKW\HDUVDJR:RO¿KDVPDGHD name  for  himself  as  one  who  is  always   helpful  and  who  accommodates   26 FEB / MARCH 2020

FOLHQWV¶UHTXHVWVHYHQWKHPRVWGLI¿FXOW problems.  He  gained  experience  in   the  barrel  and  screw  sector,  as  well  as   the  wide  range  of  machinery  in  which   these  essential  components  are  used,   from  the  knowledge  and  insight  handed   down  by  his  father.  Gunther,  meanwhile,   remains  involved  by  helping  out  when   needed. MGMW  specialises  in  the   refurbishment  of  barrels  and  screws  for   both  extruders  and  injection  moulding   machines  as  well  as  extrusion  dies   and  T-­dies  and  general  engineering   and  refurbishment  of  granulators  and   VKUHGGHUV,WDOVRVSHFLDOLVHVLQGLI¿FXOW tasks  such  as  joining  broken  screws  and   screenchangers;;  in  fact,  it  handles  all   ZZZPJPZWUDGLQJFRP

jobs  to  service  the  extrusion  sector. The  company  also  represents  Hi-­Tech   China,  a  manufacturer  of  integrated   recycling  systems,  where  â&#x20AC;&#x201C;  no  surprise   â&#x20AC;&#x201C;  the  barrel  and  screw  components  are   tested  to  the  absolute  limit  (due  to  the   nature  of  recycling,  particularly  of  post-­ consumer  material).  It  also  supplies  after   sales  service  for  Hi-­Tech  machines  in   operation  around  the  country. MGMW  can  supply  barrels  and   screws  for  any  application;;  screws   can  be  through  hardened,  nitrided  or   bimetallic,  meeting  the  most  complicated   designs  to  certify  customer  needs.  It   DOVRUHFRPPHQGV¿WIRUSXUSRVHEDUUHOV and  screws  to  improve  performance  and   productivity  of  manufactured  products.


Classifieds Feb/Mar'2020.indd 96

12:08 2020/02/03 10:42


NEWS

Plastics industry upbeat following success of plastics colloquium

28 FEB / MAR 2020

Major step  forward  in  preventing  plastic  from  entering  rivers  and  oceans PLASTICS/SA,  the  umbrella  body  representing  all  sectors  of  the   South  African  Plastics  Industry  (including  polymer  producers  and   importers,  converters,  machine  suppliers,  fabricators  and  recyclers)   has  congratulated  the  Department  of  Environmental  Affairs,   Forestry  and  Fisheries  (DEAFF)  on  the  hosting  of  a  very  successful   Plastics  Colloquium  in  Boksburg  recently. According  to  Anton  Hanekom,  executive  director  of  Plastics|SA,   DEAFF  Minister  Barbara  Creecy’s  pro-­active  approach,  openness   DQGZLOOLQJQHVVWROHDUQ¿UVWKDQGDERXWWKHPDQ\VXFFHVVIXO projects  that  the  various  role-­players  in  the  plastics   industry  have  initiated  and  been  running  over  the   past  10  years  was  admirable. “Plastics/SA  and  the  four  plastic  Producer   Responsibility  Organisations  (PROs);;   Petco,  Polyco,  SAVA  and  the  Polystyrene   Association  of  SA  have  launched  various   recovery  and  recycling  projects,  with   which  we  have  had  great  success.  It  was   encouraging  that  Minister  Creecy  created   an  opportunity  for  the  industry  to  showcase   these  achievements  to  her,  her  department   and  other  environmental  groups.  Instead  of   blindly  bowing  to  the  pressure  of  anti-­plastic   campaigners,  she  expressed  a  willingness  to   engage  with  us,”  Hanekom  added.

An estimated  500  people  representing  the  entire  plastics   value  chain  attended  the  Plastics  Colloquium  over  two  days  in   November  last  year,  which  was  presented  in  collaboration  with  the   Consumer  Goods  Council  South  Africa  (CGCSA)  and  Plastics/SA. More  than  50  exhibitions  demonstrated  the  plastics  industry   and  other  stakeholders’  commitment  to  Extended  Producer   Responsibility,  recycling  and  creating  a  circular  economy.   Attendees  represented  government,  civil  society,  brand  owners,   recyclers,  waste  management  companies,  waste  pickers,   NGO’s  and  SMMEs  who  were  all  encouraged  to  attend   the  presentations,  panel  discussions  and  visit  the   exhibitions.   Minister  Creecy  praised  the  work  done  by   both  government  and  the  private  sector  in   terms  of  the  setting  up  of  infrastructure  for   the  recovery  and  recycling  of  plastic  and   the  informal  sector  for  collecting  much   of  these  materials,  but  warned  that  the   evidence  suggested  much  more  still  needed   to  be  done.   “Evidence  suggests  that  whilst  a  lot  has   been  done,  but  much  more  needs  to  be  done.   It  is  time  to  combine  the  wealth  of  collective   H[SHULHQFHWRUHORRNDWWKHFRPSOH[DQGGLI¿FXOW problem,”  she  added. “It  is  time  to  combine  the  wealth  of  collective  experience  to   UHORRNDWWKHFRPSOH[DQGGLI¿FXOWSUREOHP&RQVLGHULQJWKH whole  value  chain  and  lifecycle  of  products,  the  aim  is  to  develop   a  comprehensive  plan  part  of  an  ongoing  initiative  that  would   engage  all  citizens  to  create  a  love  for  South  Africa  and  the   environment,”  Creecy  said,  highlighting  the  need  for  a  holistic  

It is time to combine the wealth of collective experience to relook at the complex and difficult problem.

Toasting the  success  of  the  2019  Plastics  Colloquium  are  Anton   Hanekom  (Plastics/SA),  Minister  Barbara  Creecy  (DEAFF),  Patricia   Pillay  (CGCSA)  and  Simon  Mbata  (SA  Waste  Pickers  Association)


approach  to  be  taken  in  line  with  the   principles  of  the  circular  economy.     â&#x20AC;&#x153;We  found  it  hugely  reassuring  to  hear   that  the  Minister  shares  our  passion  to  get   South  Africans  recycling  and  separating   their  waste  at  home.  By  implementing   effective  waste  management  services   at  municipalities  around  the  country,  we   will  be  able  to  get  access  to  good  quality,   recyclable  waste  and  reduce  the  burden   RQRXUFRXQWU\ÂśVODQGÂżOOV7KLVZLOODOVREH a  major  step  forward  in  preventing  plastic   from  entering  our  rivers  and,  eventually,   the  sea,â&#x20AC;?  Hanekom  added. Another  major  focus  at  the  Plastics   Colloquium  was  the  importance  and     value  of  creating  a  circular  economy.     â&#x20AC;&#x153;Waste  can  be  converted  into  value.   Every  ton  of  waste  that  ends  up  on   dumpsites  creates  one  job  opportunity.   However,  every  ton  of  waste  that  gets  

recycled  creates  18  jobs,â&#x20AC;?  the  Minister   stressed. Key  to  creating  a  circular  economy   is  ensuring  that  plastic  products  and   packaging  are  designed  with  their   UHF\FODELOLW\LQPLQG7RWKLVHQGWKH challenge  was  made  to  brand  owners,   packaging  designers  and  manufacturers   to  design  products  that  are  not  only   ÂżWIRUSXUSRVHEXWDOVRHQYLURQPHQWDOO\ responsible.   Looking  ahead  and  explaining  what   the  next  steps  will  be,  Hanekom  said  the   Minister  and  her  team  will  be  drawing  up   a  master  plan,  consisting  of  targets  and   timeframes,  in  consultation  with  industry. Âł7KHZRUNLQJJURXSVRIWKH6$,QLWLDWLYH to  End  Plastic  Waste  will  continue  their   work  and  will  be  giving  quarterly  feedback   WRWKH0LQLVWHUDERXWWKHLUSURJUHVV7KH\ KDYHEHHQWDVNHGWRGHYHORSHYLGHQFH

EDVHGVROXWLRQVWKDWZLOOÂżWRXUXQLTXH South  African  context,  and  come  back   with  suggestions  and  recommendations.   A  second  Plastics  Colloquium  is  proposed   for  next  year  to  monitor  the  progress   made  and  ensure  that  the  plans  are   implemented  effectively  and  that  all  of   the  talking  that  has  happened  until  now,   doesnâ&#x20AC;&#x2122;t  end  up  as  empty  promises,â&#x20AC;?     he  explained.   â&#x20AC;&#x153;We  are  optimistic  about  what  the   future  holds  for  the  plastics  industry  and   WKHUHVWRIWKHFRXQWU\DVDZKROH,WLV FOHDUWKDWIRUWKHÂżUVWWLPHLQPDQ\\HDUV a  relationship  of  trust  has  developed   between  government,  industry  and   RWKHUUROHSOD\HUV7KHUHLVDVSLULW of  cooperation  and  a  willingness  to   ZRUNVKRXOGHUWRVKRXOGHUWRÂżQGWKH best  solution  possible  for  everybody   concerned,â&#x20AC;?  Hanekom  concluded.

FEB / MARCH 2020 29

Trade. Create. Elevate.

> www.meraxis-group.com

Deep insights, deep impact. Meraxis South Africa (Pty) Ltd Johannesburg +27 11!455!2889 Cape Town +27 21!556!7787 Durban +27 31!816!9381

Meraxis is your trustworthy and reliable source for all your polymer requirements. Ask our experts for an individual solution.


30 FEB / MAR 2020

NEWS

National Urethane Industries

buys Kasodur TPU plant Shifts  production  to  Johannesburg  and   gets  thumbs  up  from  customers NATIONAL  Urethane  Industries  of  Johannesburg  completed   the  purchase  of  the  thermoplastic  polyurethanes  business   of  Kasodur  in  November  last  year  in  a  move  which  NUIâ&#x20AC;&#x2122;s   Donovan  Slade  says  has  been  well  received  by  its  customers. NUI  is  an  already  well  established  manufacturer  of  â&#x20AC;&#x2DC;CASEâ&#x20AC;&#x2122;   products  (coatings,  adhesives,  sealants  and  elastomers)  

,QHRV6W\UROXWLRQLQWURGXFHÆ&#x153;UVW standard ABS grades with PCR material The  two  new  ABS  grades  contain  50%  and  70%  of  post-­consumer  recycled  material INEOS  Styrolution,  the  global  leader   LQVW\UHQLFVKDVLQWURGXFHGLWV¿UVW ABS  (acrylonitrile  butadiene  styrene)   grades  with  mechanically  recycled   FRQWHQWPDNLQJWKHPWKH¿UVW products  of  the  newly  launched   ECO  family.   The  new  Terluran®  ECO  GP-­22   JUDGHLVWKH¿UVWFRQWULEXWLRQIURP Ineos  Styrolution  to  meet  Ineosâ&#x20AC;&#x2122;   pledge  to  incorporate  at  least  325  kilo   tons  per  year  of  recycled  materials   into  its  products. The  two  new  grades  Terluran  ECO   GP-­22  MR50  and  Terluran  ECO   GP-­22  MR70  contain  50  and  70%  of   recycled  post-­consumer  waste  from   electrical  and  electronic  equipment   www.brenntag.com/south-­africa

(WEEE),  respectively.  Both  grades   will  be  available  in  black. The  new  material  is  intended   to  address  primarily  application   designers  of  new  household  and   electronics  applications.  Several   European  blue-­chip  companies  have   already  started  to  evaluate  the  new   PDWHULDODQGSODQ¿UVWDSSOLFDWLRQVWR enter  the  market  soon.

â&#x20AC;¢   Brenntag  represents  Ineos  Styrolution  in   SA.  For  more  info,  contact  Rudi  Verwey,   head  of  product  management:   cell:  +27  (0)82  552  1888,   tel:  +27  (0)10  020  9111,   email:  Rudi.Verwey@brenntag.co.za  

www.ineos-­styrolution.com


Donovan Slade  of  National  Urethane  Industries  with  the  TPU   compounding  extruder  and  downstream  plant  purchased  from   Kasodur.  It  is  now  manufacturing  the  Kasodur  range  of  TPU   materials  at  its  Joburg  premises,  whereas  it  was  previously   supplying  the  ingredients  to  the  company  in  the  Western  Cape

for the  polyurethanes  sector.  It  had   previously  been  supplying  various  PU   materials  and  ingredients  to  Kasodur,   which  was  based  in  Wellington  in  the   Western  Cape,  and  supplying  a  range   of  TPU  material  grades  to  component   manufacturers. It  was  if  anything  a  fortuitous   development  when  Kasodur  decided   to  exit  the  sector  last  year,  creating  the   opportunity  for  NUI  to  take  over  the   production  itself  and  supply  its  customers   directly  from  its  premises  in  Isando. NUI  purchased  the  entire  plant  and   moved  it  to  Johannesburg  and,  after  a   few  teething  issues,  production  got  off  to   a  smooth  start. “I  don’t  know  why  we  didn’t  do  it   before,”  said  Slade,  who  complimented   Alan  Richards  of  Kasodur  for  the  manner   in  which  the  transaction  was  handled.   NUI  and  Kasodur  had  been  cooperating  

for an  extended  period  before  and  the   exchange  was  completed  smoothly,   VSHFL¿FDOO\WKDWWKHHTXLSPHQWDUULYHGLQ fully  serviced  and  operational  condition. NUI  had  been  upgrading  its  plant  –   including  extruders,  reactors/blenders   DQGGULHUV±DQGWKH.DVRGXUHTXLSPHQW ¿WWHGLQQHDWO\,WV738PDWHULDOVDUH used  in  a  variety  of  sheet  and  component   products  for  abrasive  and  high-­impact   applications  (such  as  the  mining   and  agriculture  sectors)  where  the   material’s  resilience  allows  for  extended   performance. Exports  have  become  important  to  NUI   and  it  is  achieving  success  in  markets  in   SE  Asia,  such  as  Thailand  and  Vietnam,   which  was  previously  considered   impossible. www.urethanes.co.za FEB / MARCH 2020 31


NEWS

Pastoral  scenes  such  as  this  of  a   rubber  plantation  belie  the  crisis   WKHQDWXUDOUXEEHUVHFWRU¿QGVLWVHOI in  presently.  Small  growers  (over   RI15LVSURGXFHGE\IDUPHUV on  average  each  cultivating  a  two-­ KHFWDUHVLWHV VWUXJJOHWRGHDOZLWK WKHSULFHYRODWLOLW\DQGKDYHYHU\ORZ comprehension  of  the  futures  market   WKDWGRPLQDWHVJOREDO15WUDGH

BOUNCE,

Initiative  aims  to  create  industry  and  consumer  awareness  for  fair,  equitable  and  sustainable  NR  trade HALCYON  Agri,  the  worldâ&#x20AC;&#x2122;s  leading  natural  rubber  supply   company,  has  launched  BOUNCE,  a  movement  to  drive   industry  and  consumer  change  for  an  equitable  NR  industry. BOUNCE  is  a  call-­to-­action  for  suppliers,  manufacturers  and   stakeholders  to  develop  and  adopt  a  set  of  sustainability  standards   for  natural  rubber  production.  The  movement  also  aims  to  increase   consumer  awareness  of  how  NR  is  made  and  to  encourage  them   to  demand  a  sustainable  option  when  purchasing  rubber  goods. NR  is  a  staple  component  in  consumer  goods  across  the   transport,  health  and  leisure  sectors  and  is  used  daily  by  billions   of  people  worldwide.  For  all  the  evolutions  and  innovations  in   automotive  and  aviation  manufacturing  over  the  last  decade,   there  has  been  no  replacement  for  the  role  of  NR  in  transport   and  mobility  sectors.  In  fact,  we  are  far  closer  to  replacing  the   driver  in  a  car  than  the  NR  in  its  tyres.  However,  its  journey   from  rubber  tree  to  consumer  is  poorly  understood  by  most,  and   therein  lies  one  of  the  main  reasons  for  the  materialâ&#x20AC;&#x2122;s  struggles.   Demand  for  NR  continues  to  grow  worldwide:  global   consumption  rose  from  an  estimated  10  million  tonnes  in   2010  to  14  million  in  2019,  yet  at  the  same  time  its  supply   is  becoming  less  and  less  sustainable.  According  to  Robert   Meyer,  CEO  of  Halcyon  Agri,  an  outdated  pricing  system,   severe  pay  inequality  in  the  industry  and  underinvested  and   uneducated  farming  practices  have  left  many  smallholders   IDFLQJÂżQDQFLDOUXLQKDYLQJFDXVHGVLJQLÂżFDQWGHIRUHVWDWLRQ when  prices  were  excessively  high  only  a  few  years  ago. About  92%  of  NR  output  globally  is  produced  by  an  estimated   six  million  subsistence  small  farmers  across  South-­East  Asia  and   Africa.  Now,  in  a  reverse  of  the  recent  high  prices,  unsustainably   low  prices  are  putting  immense  pressure  on  these  famers  and   the  natural  environments  they  work  in  â&#x20AC;&#x201C;  which  has  left  the   rubber  industry  in  disarray,  verging  on  collapse. â&#x20AC;&#x153;Simply  put,  the  natural  rubber  industry  is  headed  for   crisis  â&#x20AC;&#x201C;  one  that  will  have  a  huge  ripple  effect  across  all  of  the   sectors  it  supplies,â&#x20AC;?  said  Meyer. To  address  these  issues,  BOUNCE  proposes  six  key  changes   (see  adjacent  panel)  for  the  industry  to  adopt,  each  anchored   by  a  United  Nations  Sustainable  Development  Goals  initiative.   7KHVH6'*VIRUPWKHJXLGLQJSULQFLSOHVWKDWGHÂżQHWKH%281&( movement.  It  is  BOUNCEâ&#x20AC;&#x2122;s  long-­term  aim  that  these  standards   be  used  to  develop  a  framework  for  sustainable  rubber  and  a   stamp  of  approval  that  consumers  understand  and  trust. â&#x20AC;&#x153;When  buying  almost  any  other  product,  consumers  have  a   sustainable  or  fair  trade  option  to  consider  â&#x20AC;&#x201C;  and  increasingly   they  are  making  that  choice,â&#x20AC;?  said  Singapore-­based  Meyer. â&#x20AC;&#x153;The  end  goal  for  BOUNCE  is  to  be  a  hallmark  for   sustainable  rubber  produced  in  a  fair  and  equitable  manner   to  all  supply  chain  participants.  This  will  allow  the  producers   32

WAG news .indd 32

Objectives of BOUNCE THE  main  objectives  of  BOUNCE  include  to: â&#x20AC;˘   pay  farmers  at  least  their  domestic  minimum  wage â&#x20AC;˘   factor  production  costs  into  the  price  of  natural  rubber â&#x20AC;˘   invest  in  innovation  and  digitization â&#x20AC;˘   support  a  transparent  and  sustainable  supply  chain â&#x20AC;˘ LQFHQWLYLVHIDUPHUVWRÂżJKWFOLPDWHFKDQJH â&#x20AC;˘   encourage  sustainable  farming  practices For  more  info  about  the  Sustainable  Development   Goals,  visit    https://www.undp.org/content/undp/en/home/ sustainable-­development-­goals/ $VDÂżUVWVWHSRIFUHDWLQJDFRDOLWLRQRILQGXVWU\DQG consumer  backing  for  positive  change,  BOUNCE  is  calling   for  pledges  of  support.  Pledges  can  be  made  via  BOUNCEâ&#x20AC;&#x2122;s   website    https://www.demandsustainablerubber.org/ of  products  that  contain  NR  to  carry  the  BOUNCE  hallmark  all   WKHZD\WKURXJKWRWKHÂżQDOFRQVXPHUZKRFDQLQWXUQPDNH an  educated  choice,â&#x20AC;?  said  Meyer. Price  volatility Part  of  the  problem  for  the  NR  sector  is  that  it  takes   extended  periods  for  new  capacity  to  enter  the  market.  The   RXWSXWIURPVLJQLÂżFDQWQHZSODQWLQJVRIUXEEHUÂąPDLQO\LQ non-­traditional  origins  such  as  the  Mekong  delta  in  Vietnam   and  West  Africa,  but  also  in  northern  and  NE  Thailand  â&#x20AC;&#x201C;  had   come  to  market  from  2013  to  2018.  This  new  supply  brought   market  prices  down  and  masked  a  dearth  of  replanting  in   the  traditional  sources  of  rubber  production,  in  places  like   Indonesia,  southern  Thailand  and  Malaysia.  In  these  areas,   farmers  have  over-­tapped  their  trees  to  combat  low  prices. Yet,  the  farmers  have  no  choice  but  to  over-­tap.  A  farmerâ&#x20AC;&#x2122;s   income  is  price  multiplied  with  volume:  when  one  goes  down,   the  other  must  go  up  in  order  to  maintain  income  levels.  Add   FRQVXPHUSULFHLQĂ&#x20AC;DWLRQRILQWKHVHDUHDVDQGWKHSOLJKW these  farmers  have  had  to  face  becomes  obvious. In  late-­2016,  a  new  force  emerged  on  the  global  NR  stage:  non-­ governmental  organisations  (NGOs)  and  civil  society  organisations   (CSOs)  started  to  investigate  the  NR  industry,  especially  recent   cases  of  deforestation  and  land-­grabbing.  Aided  by  modern  satellite   imagery,  they  quickly  concluded  that  the  last  rubber  bull  market   (which  ended  in  2012)  had  caused  widespread  deforestation   in  ecologically  very  sensitive  areas  such  as  the  Mekong  Delta   in  Vietnam  and  central  Borneo.  Just  as  the  automotive  industry   began  pleading  mea  culpa  on  charges  of  rigging  diesel  exhaust   emission  tests,  a  couple  of  activist  CSOs  shone  the  spotlight  on   the  tyre  industry  and  its  impact  on  the  biosphere.

FEB / MAR 2020

2020/02/14 14:15


ZRUOGƉVƛUVWVXVWDLQDEOH UXEEHUPRYHPHQW

WRDWRQEHWZHHQDQG7KH¿JXUHFRXOG continue to  climb  and  could  reach  $1650  later  in  the  year.  He   estimates  that  a  price  level  around  $2200  is  needed  to  stabilize   the  decline  in  future  output  –  and  prevent  widespread  NR  shortage   from  2021  onwards.  Runaway  rubber  prices  might  sound  appealing   for  some  (manufacturers  and  suppliers),  but  their  impact  is   temporary  for  the  market,  and  disastrous  for  the  planet.  High   prices  cause  widespread  deforestation  and  new  plantings,  which   only  serves  to  bring  prices  crashing  back  down  a  few  years  later. “This  feast-­to-­famine  price  cycle  is  the  result  of  a  futures  market   that  doesn’t  understand  fundamentals  anymore,”  said  Meyer. This  is  not  an  issue  unique  to  NR.  Coffee  and  cocoa  farmers   –  to  name  but  two  –  are  suffering  the  same.  Never  has  demand   for  mobility,  coffee  or  chocolate  been  higher,  and  never  have   the  farmers  producing  these  crops  been  more  destitute.

• West  African  Group  is  the  representative  of  Centrotrade,  into   www.halcyonagri.com

33

which group  Halcyon  Agri  falls,  in  Southern  Africa

FEB / MAR 2020

Fast forward  to  today,  where  stakeholders  have  joined  forces   in  the  Global  Platform  for  Sustainable  NR  (GPSNR).  Why  is   this  relevant?  Because  recent  plantings  of  NR  in  controversial   areas  have  quietly  been  declared  ‘off-­limits’  for  conscientious   purchasers  of  NR,  which  includes  many  of  the  world’s  leading   tyre  makers.  They  simply  cannot  reconcile  their  sustainability   policies  and  OEM  supply  contracts  with  the  heavily  scrutinised   and  penalised  automotive  industry  with  the  notion  of  buying   rubber  from  questionable  origins. Against  this  background,  the  International  Tripartite  Rubber   &RXQFLOZDUQVRIDVXSSO\GH¿FLWRIXSWRRQHPLOOLRQPHWULFWRQV for  2020,  which  equates  to  a  reduction  in  output  of  as  much  as   seven  percent.  The  supply  issues  faced  are  structural.  There   is  no  amount  of  money  that  can  make  rubber  trees  grow  faster,   or  reverse  their  age.  But  what  about  demand?  According  to   virtually  all  forecasts  that  are  available,  demand  will  do  what  it   always  does:  track  global  GDP. According  to  Meyer,  prices  of  tyre  grade  NR  appreciated  by  

www.westafricangroup.co.za

NATURAL RUBBER.   THE  SUSTAINABLE  CHOICE. West  African  Group  in  partnership  with  Centrotrade supplying  Natural  Rubber  to  the  South  African  market.

Tel: +27  31  202  3900   Email:  info@westafricangroup.co.za   Website:  www.westafricangroup.co.za  

WAG news .indd 33

2020/02/14 14:15


NEWS

BT Industrial invests in

HDPE pipe plant

34 FEB / MAR 2020

Pipes  are  a  fundamental  driver  of  industrialisation %7,1'8675,$/KDVPDGHDVLJQL¿FDQWLQYHVWPHQWLQ LWVVWDWHRIWKHDUW+'3(SLSHPDQXIDFWXULQJIDFLOLW\LQ 5RRGHNRS*HUPLVWRQZKHUHLWKDVHPEUDFHGWKHODWHVW WHFKQRORJ\WRJXDUDQWHHKLJKTXDOLW\SURGXFWV ³3LSHVDUHDIXQGDPHQWDOGULYHURILQGXVWULDOLVDWLRQ´VDLG 0'.JRPRWVR/HNROD³7KHUHLVPXFKWDONDERXWUHEXLOGLQJ 6RXWK$IULFD¶VLQGXVWULDOEDVH7RGRWKDWZHQHHGDPRQJ RWKHUVJRRGLQIUDVWUXFWXUHFOHDQZDWHUHOHFWULFLW\DQGDFFHVV WRSHWURFKHPLFDOV$WWKHPRVWEDVLFOHYHODOORIWKLVUHTXLUHV WKHFRQYH\DQFHRIZDWHUDQGFKHPLFDOVZKLFKLPSOLHVSLSHV´ KHDGGHG ³,ZDQWHGWREXLOGDEXVLQHVVWKDWZLOOSOD\DPHDQLQJIXO UROHLQUHEXLOGLQJP\FRXQWU\DQGFRQWULEXWLQJDVEHVW,FDQLQ GULYLQJRXUQDWLRQDODJHQGD´/HNRODVWUHVVHV%7,QGXVWULDO ZLOODFKLHYHWKLVYLVLRQE\KDUQHVVLQJWKHPRVWHI¿FLHQW SURGXFWLRQFDSDFLW\SRVVLEOHDQGRIIHULQJLWVFOLHQWV¿WIRU SXUSRVHVROXWLRQV /HNRODVD\V%7,QGXVWULDODPXOWLDZDUGZLQQLQJ EODFNRZQHGDQGPDQDJHGFRPSDQ\DLPVWREHFRPHWKH OHDGLQJLQGXVWULDOVROXWLRQVSURYLGHULQ$IULFD 7KHQHZIDFWRU\ZLOOPDQXIDFWXUH+'3(SLSHVWRFRQYH\ IUHVKDQGZDVWHZDWHUSHWURFKHPLFDOVDQGJDVDVZHOODV

GXFWLQJIRU¿EUHRSWLFFDEOLQJ,WDOVRSURYLGHVDQDUUD\RI UHODWHGFRPSRQHQWVDQGHQJLQHHULQJVHUYLFHV%7,QGXVWULDO KDVDSURGXFWLRQWKURXJKSXWRIWRQVDPRQWK±DPRQJ WKHKLJKHVWLQ6RXWK$IULFD %7,QGXVWULDO¶V6$%6FHUWL¿FDWLRQLVDOVRDQLPSRUWDQWVWDPS RIDSSURYDO CEO  Circle  Entrepreneurs  2019  Award %7,QGXVWULDOZDVUHFHQWO\RQHRIVHYHQUHFLSLHQWVRIWKH SUHVWLJLRXV&(2&LUFOH(QWUHSUHQHXUV$ZDUG7KH DGMXGLFDWLRQSDQHOFRQVLVWHGRI'LVFRYHU\&(2$GULDQ*RUH DV&KDLUPDQ,QYHVWHF&(2)DQL7LWL9RGDFRP&(26KDPHHO -RRVXEDQG6DVRO&(2%RQJDQL1JTDEDED %7,QGXVWULDOZDVVHOHFWHGDVRQHRIVHYHQPHGLXPVL]HG EODFNRZQHGDQGPDQDJHGEXVLQHVVHVIURPDQLQLWLDOWDOO\RI WREHWUDQVIRUPHGLQWRQDWLRQDOFKDPSLRQVRYHUWKHQH[W ¿YH\HDUV7KHVHYHQEXVLQHVVHVVHOHFWHGDOOFXUUHQWO\KDYH UHYHQXHVEHWZHHQ5PLOOLRQDQG5PLOOLRQDQGZLOOEH QXUWXUHGRYHUWKHQH[W¿YH\HDUVWRDFKLHYHDYDOXHLQH[FHVVRI 5PLOOLRQ 7KH\ZHUHVHOHFWHGIROORZLQJDULJRURXVDGMXGLFDWLRQSURFHVV E\(QGHDYRU6FDOH8SXQGHUWKHDXVSLFHVRIWKH60()XQGD

Amcor unveils modern PET bottle concepts and collaboration NEW  concepts  in  PET  bottles  are  the  next  big  thing  in  wine  and  Amcor  unveiled   LWVPRVWUHFHQWGHVLJQVDWWKH8QL¿HG:LQH *UDSH6\PSRVLXPLQ6DFUDPHQWR &DOLIRUQLDLQ)HEUXDU\,QDGGLWLRQWRFXVWRPGHVLJQV$PFRUDQQRXQFHGLWV FROODERUDWLRQZLWK%ULWLVKPXOWLDZDUGZLQQLQJVWDUWXS*DUoRQ:LQHVWRPDNH WKHLUVLJQDWXUHDQGPRUHVXVWDLQDEOHÃ&#x20AC;DWZLQHERWWOHVDYDLODEOHWRWKH86PDUNHW $PFRU¶VFRQFHSWVDUHVOHHNPRGHUQDQGSHUIHFWO\PDWFKHGWRWRGD\¶VOLIHVW\OH UHTXLUHPHQWVIRUFRQYHQLHQFHDQGVXVWDLQDELOLW\3(7ERWWOHVDUHXQEUHDNDEOH EHDFKDQGSRROIULHQGO\DQGWKHGHVLJQVDUHRQO\OLPLWHGE\WKHLPDJLQDWLRQ 7KHUHDUHDOVRHQYLURQPHQWDOEHQH¿WVRXUERWWOHVDUHOLJKWZHLJKWLQ¿QLWHO\ UHF\FODEOHDQGKDYHDORZHUFDUERQIRRWSULQWWKDQJODVVERWWOHVRUDOXPLQXPFDQV $PFRUDQG*DUoRQ:LQHVZLOODOVREHFROODERUDWLQJWRSURGXFHWKHÃ&#x20AC;DWZLQHERWWOHV PDGHZLWKSRVWFRQVXPHUUHF\FOHG3(7SODVWLFLQWKH86

ZZZDPFRUFRPFKRRVHSHWERWWOHV


The new  factory   will  manufacture   HDPE  pipes  to   convey  fresh   and  wastewater,   petrochemicals   and  gas,  as  well   as  ducting  for   ¿EUHRSWLFFDEOLQJ

CEO Circle  initiative  supporting  small  business  development.   The  CEO  Circle  itself  consists  of  50  of  South  Africa’s  largest   companies. “Entrepreneurship  is  incredibly  daunting.  You  have  to   overcome  many  challenges.  One  of  the  biggest  is  self-­doubt,   because  not  everything  that  you  do  works,  and  it  takes  a  long   time  before  your  vision  is  actually  realised.  I  think  that,  for  me,   winning  this  award,  and  having  our  business  evaluated  by  these   esteemed  CEOs,  who  are  effectively  driving  the  South  African   economy,  is  testament  to  the  fact  that  I  am  on  the  right  course,   and  that  what  I  am  doing  delivers  real  value,”  Lekola  comments. “The  developmental  trajectory  of  Africa  is  dependent  on   basic  infrastructure  such  as  electricity  and  freshwater  supply.   The  company’s  current  strategy  is  to  expand  its  footprint  in   South  Africa,  in  addition  to  supplying  the  Southern  African   Development  Community  (SADC)  community  at  present,”  

he adds. In  addition,  BT  Industrial  intends  to  establish  production   hubs  to  service  burgeoning  regions  like  East  and  West  Africa,   where  major  water  and  power  generation  projects  are  underway   at  present.  “In  terms  of  exports,  we  also  plan  to  diversify   LQWRDQFLOODU\PDUNHWVVXFKDV¿EUHRSWLFVDQGDXWRPRWLYH components.  This  will  afford  us  the  opportunity  to  intensify  our   export  drive  both  on  the  continent,  and  even  into  Latin  America,”   Lekola  said. As  a  continent-­wide  player,  BT  Industrial  is  aiming  for  a  60:40   export  ration.  “In  order  to  secure  South  Africa’s  economic  future,   we  need  to  drive  exports.  A  key  differentiator  for  us,  compared   to  our  competitors,  is  our  high  level  of  product  development.  We   do  not  want  to  restrict  ourselves  to  being  a  price-­only  player,   DQGWKHUHIRUHKDYHLQYHVWHGVLJQL¿FDQWO\LQGHYHORSLQJRXU intellectual  property,”  Lekola  concludes.

www.bt-­industrial.co.za

FEB / MARCH 2020 35


NEWS

What is

the cost of NOT

recycling?

Well-­intentioned  actions  to  protect  the  environment  can  be  counter-­productive

IDFWVDV³ZHOOLQWHQWLRQHGDFWLRQVWRSURWHFWWKHHQYLURQPHQW INDUSTRY  experts  are  calling  for  consumers  to  learn  about   FDQDFWXDOO\EHFRXQWHUSURGXFWLYH´VXFKDVLJQRULQJWKHHQWLUH WKHHQYLURQPHQWDOEHQH¿WVRIUHF\FOLQJ0LFKHOHQH/RFNHVDOHV environmental  footprint  of  products  that  are  believed  to  be  better   GLUHFWRUDW,7%)OH[LEOH3DFNDJLQJ6ROXWLRQV ,7% D1RYXV IRUWKHHQYLURQPHQW +ROGLQJVFRPSDQ\VD\VWKDWFRQVXPHUVQHHGWRXQGHUVWDQG ³$FXFXPEHUZUDSSHGLQJUDPVRI ZK\UHF\FOLQJLVNH\WRNHHSLQJSODVWLFRXWRIWKH SODVWLFODVWVGD\VZKLOHRQHZLWKRXW HQYLURQPHQWDQGRXURFHDQV Sustainable VWD\VIUHVKIRUWKUHHGD\V7KHFRVWRI 6KHVD\VWKDWSODVWLFLIUHF\FOHGXQGHUSLQV material management re-­producing  a  cucumber  to  replace  the   WKHHFRQRPLFFRQFHSWRIWKHµFLUFXODUHFRQRP\¶ suggests there is a one  that  has  gone  bad  is  far  higher   LQZKLFKSURGXFWVDQGPDWHULDOVDUHNHSWLQXVH far higher cost to the WRWKHHQYLURQPHQWWKDQWKHFRVW WREXLOGHFRQRPLFQDWXUDODQGVRFLDOFDSLWDO environment to use RISURGXFLQJJUDPVRISODVWLF She  adds  that  while  plastic-­free  shopping   provided  that  the  plastic  is  then   EDJVVXFKDVELRGHJUDGDEOHRUFRPSRVWDEOH plastic-free alternatives, UHF\FOHG´ bags  are  being  explored  as  alternatives  to  plastic   than using plastic /RFNHDGGVWKDWFRQVXPHUVVKRXOG EDJVDQGDGRSWHGE\VRPH6$UHWDLOHUVWKH responsibly by understand  that  sustainable  material   UHVHDUFKVKRZVWKDWWKLVPD\DFWXDOO\EHDWKLJKHU recycling PDQDJHPHQWZKLFKORRNVDWWKHOLIHF\FOH FRVWWRWKHHQYLURQPHQWWKDQFRQWLQXLQJWRXVH DVSHFWVRISDFNDJLQJDQGWKHXVHRIQDWXUDO SODVWLFEDJV UHVRXUFHVVXJJHVWVWKDWWKHUHLVDIDUKLJKHUFRVW )XUWKHUPRUHDUHSRUWFRPSLOHGIRUWKH$PHULFDQ&KHPLVWU\ WRWKHHQYLURQPHQWWRXVHSODVWLFIUHHDOWHUQDWLYHVWKDQXVLQJ &RXQFLOE\UHQRZQHGUHVHDUFK¿UP7UX&RVWLQHVWLPDWHV SODVWLFUHVSRQVLEO\E\UHF\FOLQJ WKDWVXEVWLWXWLQJSODVWLFLQFRQVXPHUSURGXFWVDQGSDFNDJLQJ ³,WLVDERXWXQGHUVWDQGLQJWKHFKRLFHVZHPDNH7RPDNHD with  alternatives  that  perform  the  same  function  would  increase   WUXHHQYLURQPHQWDOLPSDFWZHPXVWPDNHLQIRUPHGFKRLFHV HQYLURQPHQWDOFRVWVIURPELOOLRQWRDWRWDORIELOOLRQ DQGEHKDYHUHVSRQVLEO\´FRQFOXGHV/RFNH /RFNHVD\VWKDWFRQVXPHUVPXVWDUPWKHPVHOYHVZLWKWKH 36 FEB / MARCH 2020


Shisalanga paves way, has 11 factories in SA

Coca-Cola Beverages SA reduces plastic use Launches  new  2L  returnable  PET  plastic  bottles &2&$&2/$%HYHUDJHV6RXWK$IULFD &&%6$ KDVLQWURGXFHGDOLWUHUHWXUQDEOH ERWWOHPDGHRI3(7SODVWLFWKDWRIIHUVFRQVXPHUVYDOXHIRUPRQH\DQGLVDOVRJRRG for  the  environment.   7KHVHQHZUHWXUQDEOHERWWOHVFDQEHUHXVHGXSWRWLPHV7KHUHDIWHUWKH\FDQ EHUHF\FOHGDQGPDGHLQWRQHZERWWOHV7KHUROORXWLVEHLQJSLORWHGLQWKH0DQGHOD %D\DQG%RUGHU.HLGLVWULFWVLQWKH(DVWHUQ&DSHDQGLIVXFFHVVIXOLVH[SHFWHGWR EHUROOHGRXWWRWKHUHVWRIWKHFRXQWU\ 7KHUHWXUQDEOHERWWOHVDUHPDGHRI3(7SODVWLFDQGDUHODEHOOHGZLWKDQHZSDSHU ODEHOZLWKµ5HWXUQDEOH¶DSSHDULQJLQJUHHQRQWKHIURQWRIWKHERWWOH ³7KURXJKLQQRYDWLRQDQGRXULQIUDVWUXFWXUHLQYHVWPHQWLQWKLVSDFNDJLQJOLQHZH DUHSURYLGLQJFRQVXPHUVZLWKJUHDWHUYDOXHIRUPRQH\ZKLOVWLQWURGXFLQJD3(7 SODVWLFERWWOHWKDWFDQEHUHXVHG´VD\V9HODSKL5DWVKHIROD0'RI&&%6$ 2WKHUEUDQGVOLNH&RFD&ROD1R6XJDU6SULWHDQG)DQWDDUHDOVREHDYDLODEOHLQ WKHQHZOLWUHUHWXUQDEOH3(7SODVWLFERWWOH ³7KHODXQFKRIWKHVHUHWXUQDEOH3(7ERWWOHVLVRQHZD\LQZKLFKZHDUHLQYHVWLQJ LQLQQRYDWLYHDQGPRUHVXVWDLQDEOHSDFNDJLQJ´VD\V5DWVKHIROD³7KHQHZ UHWXUQDEOHOLWUH3(7SODVWLFERWWOHDOVRVXSSRUWV7KH&RFD&ROD&RPSDQ\¶VJOREDO FRPPLWPHQWVWRDGGUHVVWKHZRUOG¶VZDVWHSUREOHP´ 2QFHDERWWOHLVUHWXUQHGWR&RFD&ROD%HYHUDJHV6RXWK$IULFDLWZLOOJRRQD ORRSHGMRXUQH\WREHFOHDQHGWR&RFD&ROD¶VVWULQJHQWPHDVXUHVDQGUHTXLUHPHQWV WKHQUH¿OOHGDQGVWDUWLWVQH[WOLIHF\FOH:KHQWKHERWWOHUHDFKHVWKHHQGRILWV XVHDEOHOLIHF\FOHVDIWHUEHLQJUHWXUQHGWR&RFD&ROD%HYHUDJHV6RXWK$IULFDLWZLOO EHUHF\FOHGDQGWXUQHGLQWRDQRWKHU3(7SODVWLFERWWOH ³:H¶UHFRPPLWWHGWRLQFUHDVLQJUHF\FOHGPDWHULDOLQRXUSDFNDJLQJDQGHQVXULQJ PRUHSDFNDJLQJLVFROOHFWHGDQGUHF\FOHG´DGGV5DWVKHIROD³7KHODXQFKRIWKH 5HWXUQDEOH3(7SODVWLFERWWOHLVDQRWKHUZD\ZHFDQXVHLQQRYDWLRQWRXQORFNWKH YDOXHLQZDVWHDQGVXSSRUWDFLUFXODUHFRQRP\LQ6RXWK$IULFD´

SHISALANGA  Construction,  which  last   \HDUEHFDPHWKH¿UVWURDGFRQVWUXFWLRQ FRPSDQ\WRVXFFHVVIXOO\XVHUHF\FOHG SODVWLFDVDELQGLQJDJHQWLQDVSKDOWLQ 6$QRZRSHUDWHVIDFWRULHVDURXQGWKH country. &RLQHGµ(FR$VSKDOW¶WKHUHF\FOHG SODVWLFSURYLGHVDWZRIROGVROXWLRQLQWKH 6RXWK$IULFDQFRQWH[WE\XVLQJUHF\FOHG +'3(DVDVXEVWLWXWHELQGLQJDJHQWLQ URDGVXUIDFLQJWKHFRPSDQ\VXFFHVVIXOO\ FUHDWHGDXQLTXHVROXWLRQWKDWHQVXUHV DVXVWDLQDEOHDQGGXUDEOHDOWHUQDWLYHIRU URDGFRQVWUXFWLRQ7KLVHFRIULHQGO\H[SORLW also  positively  impacts  the  country  by   UHPRYLQJVLJQL¿FDQWDPRXQWVRIUHF\FOHG plastic  from  waste  sites. ³:HKDYHQ¶WEHHQDIUDLGWRLQQRYDWH´ VDLG6KLVKDODQJD0''HDQH.RHNHPRHU ³0RVWRIWKHWLPHLWLVRXWRIQHFHVVLW\ WKDWZHKDYHSXVKHGWKHERXQGDULHVDQG IRXQGQHZSURGXFWV 6KLVDODQJDZDVHVWDEOLVKHGDVDVPDOO DVSKDOWSODQWLQ'XQGHH.=1LWRSHQHG LWVPRVWUHFHQWVLWHVLQ+OXKOXZHDQG3DUN 5\QLHLQ.=1ODVW\HDU

RPM re-enters rollers sector 58%%(53URGXFWV 0RXOGLQJVKDV VWDUWHGDQHZEXVLQHVVGLYLVLRQ530 5ROOHUVHIIHFWLYH)HEUXDU\5305ROOHUV ZDVFRQFHLYHGE\:D\QH7R]HUDQG6XH 6XSDVDULQZKRKDGFRPSOHWHGWKHLU purchase  of  the  Cape  company  earlier  in   WKH\HDU3ULRUWRWKDW530KDGEHHQD VXSSOLHURIUROOHUVIRURYHU\HDUVDQG KDGRULJLQDOO\PDQXIDFWXUHGWKHPLQ KRXVH2YHUWKH\HDUVWKLVSURGXFWLRQZDV RXWVRXUFHG:KHQVKHEHFDPHLQYROYHG DW5306XSDVDUQRWLFHGWKDWSRWHQWLDO H[LVWHGWRUHLQWURGXFHWKHPDQXIDFWXUH RIUROOFRYHUVLQKRXVH(TXLSPHQWXVHG LQWKHSURGXFWLRQRIH[LVWLQJSURGXFWVZDV suitable  for  roll  covers. $VUHSRUWHGSUHYLRXVO\530KDV HQWHUHGLQWRDVROHGLVWULEXWRUDJUHHPHQW ZLWKJOREDOUXEEHUFRPSRXQGHU+H[SRO 5305ROOHUVLQWHQGVPDNLQJH[FOXVLYHXVH RIWKH+H[SROUDQJHRIFRPSRXQGVRQDOO UROOHUVLWSURGXFHV 5305ROOHUVLQWHQGVGHYHORSLQJLWVHOI LQWRDZRUOGFODVVUROOFRYHULQJIDFLOLW\ FEB / MARCH 2020 37


What a shot! â&#x20AC;&#x201C; The  Fanuc  Roboshot  injection  moulding   machines  operate  with  robots  in  a  separate  unmanned  room  at   Pressure  Die  Castings  in  Pietermaritzburg,  the  result  being  that   the  systems  operate  24/7  with  minimal  attention  required

NEWS

Pressure Die Castings uses full range of Fanuc systems Maritzburg  manufacturer  uses  Fanuc  CNC  controls,  industrial  robots,  CNC  milling  and  injection  machines PRESSURE  Die  Castings  in  Pietermaritzburg,  one  of  South   Africaâ&#x20AC;&#x2122;s  top  metal  castings  businesses  (actually  one  of  only  a   few  to  survive  and  remain  competitive),  is  making  extensive  use   of  technology  from  Fanuc,  including  the  Japanese  equipment   manufacturerâ&#x20AC;&#x2122;s  CNC  control  systems,  industrial  robots,  CNC  milling   machines  and  now  also  its  injection  moulding  machines. PDC,  as  the  Willowton-­based  enterprise  is  known,  has  been   committed  to  automating  production  for  some  time  (without   reducing  staff  numbers  mind  you),  at  least  partly  due  to  the  fact  that   PDQ\RIWKHPHWDOFRPSRQHQWVLWPDNHVFDQEHGLI¿FXOWWRKDQGOH at  the  elevated  temperatures  used  during  production.

The  tie-­up  between  the  companies  started  some  years  ago   when  PDC  purchased  various  Fanuc  controlled  CNC  machines.   Following  that  successful  introduction,  the  process  went  up  a  gear   when  PDC  installed  one  of  the  Fanuc  â&#x20AC;&#x2DC;iâ&#x20AC;&#x2122;  series  robots.  With  its  user-­ friendly  R-­30iB  controllers,  these  robots  are  capable  of  demanding   production  and  related  actions.  Fanuc  manufactures  a  truly  wide   range  of  robots,  for  â&#x20AC;&#x2DC;payloadsâ&#x20AC;&#x2122;  from  500g  up  to  2,3  tons  and  a   substantial  number  of  these  robots,  big  and  small,  are  now  at  work   at  PDC. This  was  followed  progressively  by  the  introduction  of  Fanuc   Robodrill  CNC  milling  machines,  working  together  with  the  Fanuc  

Hoses for demanding applications in injection moulding tools +$6&2RIIHUVDZLGHUDQJHRIGLIIHUHQWKRVHVVSHFL¿FDOO\ for  demanding  applications  in  injection  moulding  tools.   7KHQHZKLJKO\Ã&#x20AC;H[LEOHPXOWLOD\HU+$6&2 PFA  high-­temperature  hose  Z8560,  made   RISHUÃ&#x20AC;XRURDONR[\FRSRO\PHU 3)$  is  protected  by  a  hard  silicone   VKHDWKLQJ7KHÃ&#x20AC;XRURSODVWLF has  outstanding   resistance  to   virtually  all   chemicals   and  

can  be  used  for  mould  temperature  control  with  media  such   as  water,  steam,  oil  and  air.   :LWKWKHKLJKO\Ã&#x20AC;H[LEOHWZLVWIUHHDQGNLQNUHVLVWDQWKLJK temperature  hoses,  minimal  bending  radii  can  be  achieved.   The  hoses  are  available  in  blue  and  red  to  allow  unmistakable   LGHQWL¿FDWLRQRIWKHKHDWLQJFRROLQJOLQHV The  ready-­made  PFA  high-­temperature  hoses,  in  versions   ZLWKPPGLDPHWHU 0[DQG*FRQQHFWLRQ DQG PPGLDPHWHU 0[DQG*FRQQHFWLRQ DUH GHVLJQHGIRURSHUDWLQJSUHVVXUHVRIXSWREDUDQG media  temperatures  up  to  +200  °C.  In  addition  to  the   standard  lengths  of  300  to  2,500  mm,  other  customised   lengths  are  also  available  on  request.

â&#x20AC;¢  Availabe  from  Ipex  in  South  Africa www.ipex.co.za 38 FEB / MAR 2020

Anz_


The  Fanuc  robots  perform  a  vital  role  at  PDC,   in  both  the  injection  moulding  and   metal  castings  divisions  of  the   EXVLQHVVZLWKWKHLUÃ&#x20AC;H[LELOLW\ UHOLDELOLW\DQGFRQVLVWHQF\ boosting  production

robots,  to  cut  metal  for  the  production  of  their  products.  These   systems  run  continuous  production  with  no  human  intervention. Then  the  next,  and  possibly  least  anticipated,  step  was  to  get   involved  in  the  injection  moulding  of  plastic  components,  including   items  such  as  handles  and  parts  for  the  building,  plumbing  and   lighting  sector,  which  are  the  core  of  PDCâ&#x20AC;&#x2122;s  product  output.   Production  of  these  components  was  previously  contracted  out.   PDC  has  since  2016  commissioned  a  number  of  the  Fanuc   Roboshot  injection  moulding  systems.  Not  surprisingly,   Fanuc  robots  are  also  used  in  the  injection  â&#x20AC;&#x2DC;production  cellâ&#x20AC;&#x2122;.

â&#x20AC;¢     Fanuc,  which  is  well-­known  for  its  distinctive  livery  (of  its   machines,  overalls  as  well  as  the  exteriors  and  interiors  of  its   buildings)  operates  its  own  subsidiary,  Fanuc  South  Africa,   one  of  the  few  global  equipment  suppliers  to  do  so.  The  group   RSHUDWHVVXFKRI¿FHVJOREDOO\

www.fanuc.co.za

FEB / MARCH 2020 39

HASCO systematically supports your success. We supply a complete line of ready-to-install system components for mouldmaking. ¶=HYPHISLÃ&#x2026;L_PISLTHPU[LUHUJLMYPLUKS` ¶/PNOLYX\HSP[` ¶>VYSK^PKLZLY]PJL www.hasco.com Represented by IPEX, www.ipex.co.za

Anz_Precision_99x210_EN.indd 1

03.12.19 13:51


NEWS

Former  Nampak  CEO,  AndrÊ  De  Ruyter,  cuts  the   ribbon  at  the  new  Technical  Hub  in  Roodepoort

Nampak Liquid Cartons opens new tech hub NAMPAK,  Africaâ&#x20AC;&#x2122;s  largest  packaging   company,  opened  the  Liquid  Carton   divisionsâ&#x20AC;&#x2122;  new  Technical  Hub  in   Roodepoort,  Johannesburg  in   December  2019.  In  one  of  his  last   RIÂżFLDODFWVEHIRUHOHDYLQJWRKHDGXS Eskom,  Nampak  CEO  AndrĂŠ  de  Ruyter,   unveiled  the  Nampak  Liquid  Cartons   Technical  Hub. The  new  plant  complements   Nampakâ&#x20AC;&#x2122;s  existing  liquid  carton   IDFLOLWLHVZKLFKLQFOXGHDVDOHVRIÂżFHLQ Bryanston,  Gauteng,  a  printing  plant  in   Isithebe,  KZN,  an  R+D  facility  in  Cape   Town,  and  sister  carton  producing  plants   in  both  Malawi  and  Zambia. Nampak  Liquid  Cartonsâ&#x20AC;&#x2122;  new   Technical  Hub  was  custom  built  to   maintain  and  service  the  growing  pool  of   OLTXLGFDUWRQÂżOOLQJPDFKLQHVIRUWKHIRRG and  beverage  industry,  such  as  dairy,   water  and  fruit  juice.

Nampak Plastics Europe sold NAMPAK  Plastics  Europe  has  been   sold  to  investment  fund  group  to   Bellcave  for  an  undisclosed  amount.   Former  Nampak  CEO  AndrĂŠ  de   Ruyter  said  the  sale  was  â&#x20AC;&#x153;in  line  with   Nampakâ&#x20AC;&#x2122;s  ongoing  strategy  to  sharpen   our  focus  on  strategic  substrates,  to   optimise  and  improve  returns  on  capital   and  reinforce  our  strategic  intentâ&#x20AC;?. The  sale  took  place  on  12  December   and  was  effective  immediately  and   included  a  pension  fund  liability.  There   were  no  conditions  precedent  and  no   regulatory  approvals  were  required.   Nampak  Plastics  Europe  is  a  market   leading  manufacturer  and  packaging   supplier  to  the  UK  dairy  sector  of   HDPE  bottles  with  a  34%  share  of  the   UK  milk  bottle  market. 40 FEB / MAR 2020

Yizumi injection systems prove a hit at Marula KZN  manufacture  likes  Yizumi  technology,  service  by  Mould  Base  SA

DAVE  Moore  of  Mould  Base  SA,  who   represents  Guangdong-­based  Yizumi   Precision  Machinery  in  Southern   Africa,  had  a  busy  end  to  2019  with  the   installation  of  three  injection  moulding   machines  at  KZN-­based  Marula  Plastics   in  October. Rob  Lang  of  Marula  made  the  move   over  to  Yizumi  around  three  years  ago   with  the  purchase  of  a  1100-­ton  machine   for  the  manufacture  of  large  plastic   crates,  which  is  Marulaâ&#x20AC;&#x2122;s  core  business.   Lang  was  so  impressed  with  the  machine   that  he  has  developed  a  strong  liking   for  the  Yizumi  technology.  An  increase   in  orders  resulted  in  the  purchase  of  the   three  Yizumi  machines,  including  480,   650  and  700-­ton  units,  a  veritable  bank   of  Yizumis. 7KHWRQV\VWHPZDVWKHÂżUVW two-­platen  unit  of  Yizumiâ&#x20AC;&#x2122;s  D1  range  to   be  installed  in  the  SA  market.  All  three   of  these  machines  were  ordered  with   Yizumi  robotic  systems  for  part  removal   to  improve  productivity  and  to  prevent   operator  fatigue.  (Another  1200-­ton  

two-­platen  machine  has  since  been   installed  at  another  Durban  automotive   component  manufacturer,  for  Toyota.) Yizumi  is  now  one  of  the  largest   manufacturers  of  plastic  processing   equipment  globally.  Its  focus  is  to  be  the   best,  not  the  biggest,  which  is  contrary   to  the  aim  of  many  Chinese  machine   makers.  Sales  have  increased  annually   in  the  South  African  market  and  have  put   Yizumi  in  the  top  four  suppliers  of  Asian   made  equipment  regularly. â&#x20AC;&#x153;I  base  this  business  on  service,â&#x20AC;?   said  Moore. â&#x20AC;&#x153;Many  customers  are  not  happy  with   the  service  they  receive  from  agents,  and   this  has  allowed  us  to  improve  our  sales   every  year  since  2015.  Itâ&#x20AC;&#x2122;s  a  competitive   market  and  our  prices  and  quality  are   excellent.  We  now  have  machines  in   the  automotive  sector  as  well  as  the   packaging,  housewares  and  industrial   components  segments. â&#x20AC;&#x153;Yizumi  has  solutions  for  complicated   automotive  parts,  high-­speed  packaging,   two-­colour  parts,  PET  preforms,  

7KHQHZ<L]XPLPDFKLQHVKDYH¿WWHGLQQHDWO\DW0DUXODœVSODQWLQ+DPPDUVGDOHDQG with  the  addition  of  Yizumi  part  removal  robots,  have  upped  production  rates


Arrie Louwrens  (Yizumi  technician),  Preston  Pandaram  (factory  manager  at  Marula),  Rob  Lang  (owner  of  Marula  Plastics),   Dave  Moore  of  Mould  Base  SA  and  Nonkosi  Zondo  (production  manager  at  Marula)

cosmetic packaging,  silicon  moulding  and   conventional  mouldings,”  added  Moore. Marula  Plastics  is  primarily  a  contract   moulding  company  with  moulding   machines  ranging  from  60  to  1100  tons.   The  business  manufactures  parts  for  a   diverse  range  of  blue-­chip  companies,   ranging  from  automotive  goods  to  reusable  

industrial packaging.  Marula  opened  for   business  in  2001  and  has  grown  annually   ever  since  in  spite  of  tough  trading   conditions,  said  Lang. ³:HSXUFKDVHGRXU¿UVW<L]XPLPDFKLQH in  2016  and  were  so  impressed  with  the   machine’s  performance  and  the  backup   service  supplied  by  Dave  Moore  and   www.mouldbasesa.co.za

the team  at  Mould  Base  that  they  have   now  become  our  preferred  supplier  for   injection  moulding  machines  and  auxiliary   equipment,”  added  Lang.

• Contact  Dave  Moore  083  675  8325 •  Rob  Lang  of  Marula  082  555  3002

FEB / MARCH 2020 41


FEATURE

Mergers, acquisitions, restructuring, re – Africa has enormous potential China and  India  are  no  longer  competitive PREA  of  England,  a  global  consultancy  focussed  on   mergers  and  acquisitions  (M&A),  business  restructuring   and  recruitment  in  the  plastics,  rubber,  composites,   chemicals,  and  engineering  business,  is  currently  involved   in  a  number  of  projects  in  Africa. In  this  second  of  two  articles,  we  speak  with  Prea  MD   Pravin  Mistry,  about  this  important  background  to  business   operation.  According  to  Mistry,  Prea  is  “quite  unique  in  that   we  are  from  this  industry  and  have  worked  previously  for   both  small  and  multinational  companies  in  the  industry”. Is  any  sector  of  the  moulding  industry,  such  as   packaging,  automotive  or  medical,  for  example,   attracting  interest? Most  sectors  are  busy.  However,  the  automotive  sector  is   slowing  down  slightly  due  to  the  conversion  of  cars  from   petrol  and  diesel  to  hybrid  and  electric  vehicles.  We  should   see  this  sector  ramp  up  soon.  Food,  pharmaceutical,   medical  and  general  packaging  are  always  in  demand.   As  a  specialist  focussing  on  this  area,  what  is  your   assessment  of  the  attraction  of  European  moulding   businesses  in  M&A  potential  in  Africa? Not  just  from  a  European  point  of  view,  but  from  a   global  point  of  view,  the  African  continent  has  enormous   potential.  A  plastic  injection  and  blow  moulding  business   we  are  selling  in  Johannesburg  at  the  moment,  has   the  foundations  of  a  well-­established  business  with  a   portfolio  of  products,  and  well-­established  and  trained   staff  and  operators  to  supply  the  market.  This  makes  it   very  attractive  if  you  want  a  base  in  Africa  with  a  low-­cost   manufacturing  base.  This  is  more  attractive  than  setting   up  an  operation  from  ground  zero,  where  you  would  have   to  go  through  the  bureaucracy,  acquire  land,  build,  buy   machinery,  recruit  and  train  staff.   We  have  also  seen  the  recent  acquisition  of  a  plastics   business  in  South  Africa  by  an  internationally  known   group,  acquisitions  of  chemical  distribution  businesses   and  the  setting  up  of  a  composites  business  in  SA  by   an  international  concern.  We  will  see  more  and  more   transactions  occurring. 42

PREA.indd 42

Why? Let’s  be  realistic,  China  and  India,  once  low-­cost   manufacturing  places,  are  no  longer  competitive.  From  our   recruitment  side  where  we  operate  globally  as  well,  we   have  seen  wages  increase  in  these  countries  more  or  less   on  a  par  with  Europe. So,  where  does  it  leave  the  next  low-­cost  manufacturing   base?  Answer:  the  African  continent.  And  Africa  is  closer  to   Europe  and  America. We  are  not  saying  everything  is  perfect  on  the  African   continent,  there  are  challenges,  but  they  can  be  overcome. For  the  brave,  be  it  external  or  internal  investors,  now   would  be  the  time  to  invest.  We  also  see  great  potential   to  set  up  thermoplastic  masterbatch  and  compounding   businesses,  as  well  as  more  composite  companies. By  the  same  token,  we  are  seeing  SA  companies  and   investors  looking  to  acquire  outside  SA  as  well,  again  this   is  on  the  increase. One  recommendation  we  would  make  is  that  the  SA   government  needs  to  get  involved  more  if  it  is  to  attract   inward  investment. What  are  the  main  characteristics  sought  by   businesses  hoping  to  enter  a  new  market  through   acquisition  of  a  business  in  that  market? Merger  or  acquisition:  what’s  most  suitable  for  a  business   planning  to  expand?  With  a  merger  it  all  depends  on  if   you  need  a  partner,  if  you  have  limited  funds,  do  not  want   to  take  on  higher  risk  and  want  access  to  technology  and   markets. Acquisitions  are  mainly  for  companies  that  have  had   experience  of  these  processes  before  and  are  looking   to  quickly  build  their  brand  globally  by  grabbing  the   market  share  and  taking  out  the  competition-­  subject  to   regulations. As  a  specialist  in  this  area,  what  do  you  believe  are   the  factors  most  likely  to  make  a  merger  or  acquisition   successful? It  is  rather  like  an  arranged  marriage,  both  sides  have  to   get  on.  You  need  total  transparency  and  personalities  are  a   key  issue.  You  need  to  be  honest;;  do  we  really  need  to  or  

FEB / MAR 2020

2020/02/14 14:14


Prea is a technical consultancy focussed on the industry globally

recruitment Prea MD Pravin Mistry

want to merge/acquire? Do we have the financial backing? Do we have the resources? Why are we doing this? You must ensure that whilst the process is going on that you keep track of your existing business too as a merger or acquisition can be very distracting and costly. One of the mistakes we see is that both parties always get excited and try and fast-track the transaction. Patience is needed. You need to be clear about what you are selling/ buying – is it the business, order book, machinery IP, land buildings or lease? The easiest way to answer this is to ask yourself what is not for sale. As a seller you need to prepare the business for sale. Often, it is not until external advisors enter the process that the gaps in your business become apparent. You need a two-tier management system in place, regardless of whether you are buying or selling. Spend time with the company, meet the people, have a good look around – don’t just sit in an office looking at spreadsheets and figures. www.prea.co.uk FEB / MAR 2020

43

201

Classifieds Dec/Jan'2020.indd 96 PREA.indd 43

2020/02/14 14:14


ENVIRO

Winner of the

Caroline Reid Award

for clean-up champion of the year ¿QDOLVWVDOOSURYHGWKHLUSDVVLRQDQGFRPPLWPHQWIRURXUHQYLURQPHQW ALISON Bryant  of  the  Keep  Plett  Clean   Campaign  is  the  winner  of  the  Caroline   Reid  Award  for  the  Cleanup  Champion   of  2019  –  a    new,  annual  award   established  by  Plastics|SA  to  recognise   and  reward  excellence  in  South  Africa   E\DQLQGLYLGXDOLQWKH¿HOGRIPDULQH and  coastal  clean-­ups.   Making  the  announcement  during   a  gala  dinner  to  celebrate  the  20th   anniversary  of  the  Marine  &  Coastal   Educators  Network  (MCEN)  held  at  the   Zeekoevlei  Yacht  Club  in  Cape  Town   in  January,  Douw  Steyn,  Sustainability   Director  at  Plastics|SA  and  John  Kieser   Plastics|SA  Sustainability  Manager,   awarded  Alison  with  a  R10  000  cash  

was central  in  the  work  done  with  the   SUL]HDQGDÀRDWLQJWURSK\ loss  of  the  plastic  pellets  (nurdles)  in   Caroline  Reid  was  a   the  Durban  harbour  in  2017. passionate  ocean   “Caroline  was  a  very   conservation  warrior   This award dear  friend  who  worked     from  KwaZulu-­Natal   shows that if we all do tirelessly  to  increase  the   who  tragically   our bit and care for our awareness  of  plastics   passed  away  at   pollution  on  the  KwaZulu-­ the  age  of  42   communities, together Natal  Coastline.  The   after  she  was   we can really push South conservation  community   involved  in  a   Africa forward and help suffered  a  huge  loss   fatal  motorcycle   our country go from with  her  untimely  death.   accident  in   strength to strength. We  therefore  wanted  to   2018.  She  was   establish  this  annual  award   a  dynamic  cleanup   to  not  only  remember  and   champion  who   honour  this  wonderful  person,  but   coordinated  hundreds  of   also  to  recognise  and  thank  similar   beach  and  diving  clean-­ups  and  who  

Shell uses plastic waste to produce resin feedstocks First cargo  of  pyrolysis  liquid  to   Shell’s  chemical  plant  in  Norco,   Louisiana,  USA SHELL  has  successfully  made   high-­end  chemicals  using  a  liquid   feedstock  made  from  plastic  waste.   The  technique,  known  as  pyrolysis,  is   considered  a  breakthrough  for  hard-­ to-­recycle  plastics  and  advances   Shell’s  ambition  to  use  one  million  tons   of  plastic  waste  a  year  in  its  global   chemicals  plants  by  2025. “This  makes  sense  for  the   environment  and  our  business,”  said   Thomas  Casparie,  executive  vice   44 FEB / MARCH 2020

president of  Shell’s  global  chemicals   business.  “We  want  to  take  waste   plastics  that  are  tough  to  recycle  by   traditional  methods  and  turn  them   back  into  chemicals  –  creating  a   circle.  These  chemicals  will  meet  our   customers’  growing  demands  for  high   quality  and  sustainable  products.” Atlanta-­based  Nexus  Fuels  LLC   UHFHQWO\VXSSOLHGLWV¿UVWFDUJRRI pyrolysis  liquid  to  Shell’s  chemical  plant   in  Norco,  Louisiana,  USA  where  it  was  

made into  chemicals  that  are  the  raw   materials  for  everyday  items.  Shell  is   working  with  multiple  companies  who   collect  and  transform  plastic  waste  in   order  to  scale  this  solution  to  industrial   DQGSUR¿WDEOHTXDQWLWLHVDFURVVLWV chemicals  plants  -­  in  Asia,  Europe  and   North  America. Shell  is  a  founding  member  of  the   Alliance  to  End  Plastic  Waste  (AEPW).   7KLVQRWIRUSUR¿WRUJDQLVDWLRQLV bringing  together  top  minds  from  across  


Douw  Steyn  (left)   and  John  Kieser   (right)  of  Plastics/ SA  award  the  cash   cheque  and  trophy   to  Alison  Bryant   of  the  Keep  Plett   Clean  Campaign

individuals  who  altruistically  give  up   their  time  to  make  our  marine  and   coastal  environment  a  better  place  by   combating  pollution,â&#x20AC;?  said  Steyn. â&#x20AC;&#x153;This  annual  award  not  only   remembers  and  honours  this  wonderful   person,  but  also  recognises  and  thanks   similar  individuals  who  altruistically  give   up  their  time  to  make  our  marine  and   coastal  environment  a  better  place  by   combating  pollution.â&#x20AC;? This  yearâ&#x20AC;&#x2122;s  inaugural  competition   drew  entries  from  around  the  country.     â&#x20AC;&#x153;We  were  very  impressed  with  the   quality  and  quantity  of  nominations   that  were  submitted  for  this  award.   The  judges  had  a  tough  time  selecting  

DZLQQHUIURPWKHÂżQDOLVWVZKRDOO proved  their  passion  and  commitment   for  our  environment  and  were  making   a  tangible  difference  through  removing   litter  from  our  oceans  and  waterways,â&#x20AC;?   said  Kieser.     About  the  Keep  Plett  Clean  Campaign   Alison  Bryant  is  the  driving  force   behind  Keep  Plett  Clean  Campaign  â&#x20AC;&#x201C;   a  community  initiative  that  was  started   in  February  2014  with  the  aim  of   keeping  Plettenberg  Bay  spotless  and   a  premier  holiday  destination.  With  the   help  of  a  group  of  30  volunteers  and  a   few  permanent  staff  members,  Alison   ventures  out  with  bibs  and  pickers  every  

week  to  make  sure  every  bit  of  waste  is   picked  up  and  removed  from  the  townâ&#x20AC;&#x2122;s   beaches  and  streets. Accepting  her  award,  Alison  thanked   Plastics|SA  for  launching  the  initiative   and  stressed  the  importance  of  ongoing   education  to  teach  the  public  and   school  children  how  they  can  help  keep   the  environment  beautiful  and  clean.   The  prize  money  awarded  to  the   Keep  Plett  Clean  campaign  will  be  used   to  assist  with  paying  for  the  transport   of  staff  members  and  volunteers  who   need  to  reach  outlying  areas  of  the   town  in  order  to  do  clean-­ups. â&#x20AC;&#x153;I  would  like  to  pay  special  tribute   to  eco-­warrior  Caroline  Reid  who   embodied  everything  that  we  are   striving  for  in  our  efforts.  This  award   shows  that  if  we  all  do  our  bit  and  care   for  our  communities,  together  we  can   really  push  South  Africa  forward  and   help  our  country  go  from  strength  to   strength,â&#x20AC;?  Alison  concluded.

www.shell.com/chemicals

the  plastics  value  chain  (chemical  and   plastic  manufacturers,  consumer  goods   companies,  retailers,  converters  and  waste   management  companies)  and  partnering   ZLWKWKH¿QDQFLDOFRPPXQLW\JRYHUQPHQWV and  civil  society.  The  AEPW  has  committed   ELOOLRQRYHUWKHQH[W¿YH\HDUVWRKHOS end  plastic  waste  in  the  environment. Shell  is  also  working  with  its  retail,   business  fuels  and  lubricants  customers   to  help  reduce,  reuse  and  recycle  plastic   packaging.  

FEB / MARCH 2020 45

Shellâ&#x20AC;&#x2122;s  ambition  is   to  use  one  million   tonnes  of  plastic   waste  a  year  in  its   global  chemicals   plants  by  2025.


ENVIRO

First recycling tests to turn GLVXVHGĆ&#x153;VKLQJ nets into sportswear

ÂŁ8m prize to help â&#x20AC;&#x2DC;revolutioniseâ&#x20AC;&#x2122; plastic use UK  RESEARCH  and  Innovation  (UKRI)  has  launched   two  new  competitions  to  help  develop  plastics  that  are   greener,  safer  and  more  easily  recyclable.   The  competition  will  provide  up  to  £8m  of  funding   to  help  researchers  develop  recycling  systems  that   can  cope  with  the  rising  volumes  of  plastic  waste.   This  investment  is  part  of  the  governmentâ&#x20AC;&#x2122;s   commitment  to  transform  the  plastic  packaging  and   production  industry. Paul  Davidson,  challenge  director  of  the   competition,  said:  â&#x20AC;&#x153;Plastic  is  a  major  part  of  our  lives   and  as  we  all  become  greener,  the  calls  to  move   away  from  plastic  to  preserve  the  planet  have  become   louder.  Our  challenge  and  the  governmentâ&#x20AC;&#x2122;s  strategy   for  clean  growth  offers  an  alternative.  We  will  seek   ways  to  ensure  continued  use  of  safe,  clean  and   easily-­recyclable  plastic.  This  will  boost  productivity   and  prevent  disruption  to  business  and  consumers.   Industrial  and  academic  cooperation  is  a  vital  part   of  this  process  to  bring  these  ideas  to  market.â&#x20AC;?

DOMO to source 100% renewable energy for nylon Ă&#x2026;TUXZWL]K\QWV DOMO  Film  Solutions  will  start  sourcing  100%   renewable  energy  for  the  production  of  its  nylon   ÂżOPIURP-DQXDU\7KHPRYHUHĂ&#x20AC;HFWV'202ÂśV continuous  commitment  to  providing  low-­carbon   Q\ORQÂżOP â&#x20AC;&#x153;Thanks  to  this  reduction  in  carbon  footprint,   NYLEENâ&#x201E;˘  has  made  another  step  forward  towards   RIIHULQJLQGXVWU\DVXVWDLQDEOHQ\ORQÂżOPVROXWLRQDV we  continue  to  improve  our  production  processes.   7KLVIDPLO\RIQ\ORQÂżOPVKDVDSURYHQORZFDUERQ footprint  and  this  use  of  renewable  energy  will   help  to  lower  that  even  furtherâ&#x20AC;?,  said  Attilio  Annoni,   MD  at  DOMO  Film  Solutions. DOMO  Film  Solutions  has  already  achieved   VLJQLÂżFDQWLPSURYHPHQWVLQLWVSUHFLVHFDUERQ IRRWSULQWDVVHVVPHQW,QWKHFRPSDQ\ accurately  measured  the  amount  of  COemitted  by   WRQRILWVQ\ORQÂżOPSURGXFWLRQ7KLVDVVHVVPHQW was  implemented  by  DOMOâ&#x20AC;&#x2122;s  partner  Quantis   which  performed  a  detailed  and  complete  Life   Cycle  Assessment.  It  found  NYLEENâ&#x201E;˘  to  have  a   VLJQLÂżFDQWO\ORZHUFDUERQIRRWSULQWZKHQFRPSDUHG WRVWDQGDUGQ\ORQÂżOP 7KHLQWURGXFWLRQRI1</((1Â&#x152;LVRQO\WKHÂżUVW step  in  the  business  unitâ&#x20AC;&#x2122;s  sustainability  journey.   '202)LOP6ROXWLRQVLVDOVRZRUNLQJRQWKHÂżUVW HYHUYHUWLFDOO\UHF\FOHGUHF\FODEOHQ\ORQÂżOPDQGRQ developing  strategic  partnerships  with  the  aim  of   investigating  bio-­based  solutions.   ZZZGRPRÂżOPFRP

Bio-based masterbatch enables colouring of renewable bioplastics Consists  of  renewable  raw  materials IN  RESPONSE  to  limited  resource  availability  and  greenhouse  gas   emissions,  three  approaches  are  currently  being  pursued  to  make   plastics  sustainable:  while  compostable  biopolymers  are  a  biodegradable   option,  bioplastics  based  on  renewable  resources  provide  a  non-­fossil   alternative  to  conventional  polymers  and  recyclates  pursue  the  goal   of  multiple  use  of  valuable  already  produced  plastics  via  the  circular   economy.  Each  of  these  three  alternatives  poses  individual  demands  on   colorization  and  additivation. With  the  introduction  of  the  BASF  SicolenÂŽ  B  bio-­based  masterbatch,   the  comprehensive  Colors  &  EffectsÂŽ  portfolio  now  includes  a  solution   for  each  of  these  three  approaches.  BASF  Color  Solutions  GmbH   FRPSOHPHQWVLWV6LFRYHUVDO%DFHUWLÂżHGELRGHJUDGDEOHPDVWHUEDWFK for  colouring  compostable  plastics,  as  well  as  Sicolen  and  Sicovinyl,   established  concentrates  for  colouring  recycled  polyethylene  and  PVC.   With  these  four  products,  all  three  ecological  alternatives  to  conventional   plastics  can  be  coloured  in  an  environmentally  friendly  manner,  without   the  respective  advantages   â&#x20AC;&#x201C;  composability,  renewable  raw   material  or  circular  economy  â&#x20AC;&#x201C;   being  limited  by  the  addition. 46 FEB / MARCH 2020

Clas


THE  Oceanets  project  has  started  testing  a   tool  to  prevent  the  loss  and  abandonment  of   ¿VKLQJJHDUDQGWRIDFLOLWDWHUHFRYHU\7KH project  has  also  begun  research  on  chemical   DQGPHFKDQLFDOUHF\FOLQJSURFHVVHVWKDW can  be  implemented  to  make  use  of  these   ¿VKLQJQHWVWRSURGXFHVSRUWVZHDUDQGRWKHU high  added-­value  products ,QSDUWLFXODUWKH¿UVWWHVWVZHUHFDUULHGRXW RQWKH*36WUDFNLQJWRROZKLFK¿VKHUPHQ FDQXVHIRUSUHYHQWLYHSXUSRVHVWRLGHQWLI\ DUHDVZKHUHWKH\GHWHFWREVWDFOHVWKDWWUDS WKHLU¿VKLQJJHDUDVZHOODVDUHDVZKHUH WKH\KDYHORVWQHWVVRWKDWWKH\FDQEH FROOHFWHG 7KHSURMHFW¶VZRUNRQODQGKDVDOVR VWDUWHGZLWKWKH¿UVWWHVWVWRGHYHORS innovative  mechanical  and  chemical   UHF\FOLQJPHWKRGVWR¿QGQHZXVHVIRU UHFRYHUHG¿VKLQJQHWVDWWKHHQGRIWKHLU OLIHF\FOH 7KH2FHDQHWVSURMHFWLVIXQGHGE\WKH (XURSHDQ8QLRQDQGOHGE\$,03/$6

WKH3ODVWLFV7HFKQRORJ\&HQWUH,QWKHWHQ months  since  the  project  started,  the  Port   RI9LJR6KLSRZQHUV¶&RRSHUDWLYH $59,  KDVFRQWDFWHGVHYHUDODJHQWVLQWKH¿VKLQJ JHDUYDOXHFKDLQ PDQXIDFWXUHUVXVHUV UHSDLUDQGZDVWHPDQDJHPHQWVHUYLFHV WR JDLQ¿UVWKDQGLQIRUPDWLRQRQWKHOLIHF\FOHRI ¿VKLQJQHWVDVZHOODVWKHFKDOOHQJHVSRVHG E\WKHLUORVVDWVHDDQGUHF\FOLQJDWWKH HQGRIWKHLUOLIHF\FOH$59,PHPEHUVKLSV are  chartered  to  bring  disused  nets  to  the   SRUW7KHFRRSHUDWLYHDOVRZRUNVZLWKZDVWH managers  and  net  makers  that  manufacture   DQGUHSDLU¿VKLQJJHDU ,QLWLDOFKHPLFDOUHF\FOLQJWHVWVDUH FXUUHQWO\EHLQJSHUIRUPHGRQSRO\DPLGHQHWV WRREWDLQ¿EUHVWKDWFDQEHXVHGWRSURGXFH VSRUWVZHDU)RURWKHUNLQGVRI¿VKLQJQHWV $,03/$6LVGRLQJUHVHDUFKRQPHFKDQLFDO UHF\FOLQJDQGFRPSRXQGLQJSURFHVVHVWR improve  the  properties  of  the  material  so   that  it  can  be  used  in  different  value-­added   DSSOLFDWLRQV

www.aimplas.net FEB / MARCH 2020 47

www.colors-­effects.basf.com

Classifieds Oct/Nov'19.indd 92

2019/09/13 11:13


ENVIRO

NestlĂŠ creates market for food-grade recycled plastics NESTLĂ&#x2030;  will  invest  up  to  CHF  2  billion  to   lead  the  shift  from  virgin  plastics  to  food-­ grade  recycled  plastics  and  to  accelerate   the  development  of  innovative  sustainable   packaging  solutions. Building  on  its  2018  commitment  to  make   100%  of  its  packaging  recyclable  or  reusable  by   2025,  NestlĂŠ  will  reduce  its  use  of  virgin  plastics   by  one  third  in  the  same  period  whilst  working   with  others  to  advance  the  circular  economy   and  endeavour  to  clean  up  plastic  waste  from   oceans,  lakes  and  rivers. Food  quality  and  safety  are  paramount,  and   packaging  plays  a  major  role  in  assuring  this.   0RVWSODVWLFVDUHGLIÂżFXOWWRUHF\FOHIRUIRRG packaging,  leading  to  a  limited  supply  of  food-­ grade  recycled  plastics.  To  create  a  market,   NestlĂŠ  is  therefore  committed  to  sourcing  up  to   2  million  tons  of  food-­grade  recycled  plastics   and  allocating  more  than  CHF  1.5  billion  to  pay   a  premium  for  these  materials  between  now  and   1HVWOpZLOOVHHNRSHUDWLRQDOHIÂżFLHQFLHVWR keep  this  initiative  earnings  neutral. Packaging  innovation,  including  new   PDWHULDOVUHÂżOOV\VWHPVDQGUHF\FOLQJVROXWLRQV is  another  key  challenge  on  the  path  towards   DZDVWHIUHHIXWXUH,QDGGLWLRQWRLWVVLJQLÂżFDQW inhouse  research  through  the  NestlĂŠ  Institute  of   Packaging  Sciences,  the  company  will  launch  a   CHF  250  million  sustainable  packaging  venture   fund  to  invest  in  start-­up  companies  that  focus   on  these  areas.

Microplastic pollution â&#x20AC;&#x2DC;raining down on city dwellersâ&#x20AC;&#x2122; London  has  highest  level  yet THE  Guardian  Weekly  reports  that  â&#x20AC;&#x153;microplastic  pollution  is  raining   down  on  city  dwellersâ&#x20AC;?,  with  research  revealing  that  London  has   the  highest  levels  yet  recorded.  The  health  impacts  of  breathing  or   consuming  the  tiny  plastic  particles  are  unknown,  and  experts  say   urgent  research  is  needed  to  assess  the  risks. Only  four  cities  have  been  assessed  to  date  but  all  had  microplastic   pollution  in  the  air.  Scientists  believe  every  city  will  be  contaminated,   as  sources  of  microplastic  such  as  clothing  and  packaging  are  found   everywhere. Recent  research  shows  the  whole  planet  appears  to  be   contaminated  with  microplastic  pollution.  Scientists  have  found  the   particles  everywhere  they  look,  from  Arctic  snow  and  mountain  soils,   to  many  rivers  and  the  deepest  oceans.  Other  work  indicates  particles   can  be  blown  across  the  world. The  research,  published  in  the  journal  Environment  International,   collected  the  microplastics  falling  onto  the  roof  of  a  nine-­storey   building  in  central  London.  This  ensured  that  only  microplastic  from   the  atmosphere  was  collected. They  were  found  in  all  eight  samples,  with  deposition  rates  ranging   from  575  to  1  008  pieces  per  sq  metre  per  day,  and  15  different   SODVWLFVZHUHLGHQWLÂżHG0RVWPLFURSODVWLFVZHUHÂżEUHVPDGHRI acrylic,  most  likely  from  clothing.  Just  8%  of  the  microplastics  were   particles,  and  these  were  mostly  polystyrene  and  polyethylene,  both   commonly  used  in  food  packaging. The  microplastic  particles  in  London  were  between  0.02mm  and   0.5mm.  These  are  large  enough  to  be  deposited  on  to  the  airways   when  inhaled  and  would  be  swallowed  in  saliva.  Smaller  particles   that  can  get  into  the  lungs  and  bloodstream  represent  the  greatest   potential  health  hazard.  These  were  seen  in  the  samples  but  their   FRPSRVLWLRQFRXOGQRWEHLGHQWLÂżHGZLWKFXUUHQWWHFKQRORJ\ But  the  potential  health  impacts  of  inhaling  plastic  particles  from  the   air,  or  consuming  them  via  food  and  water,  are  unknown.  People  eat   at  least  50  000  microplastic  particles  per  year,  according  to  one  study. 48 FEB / MARCH 2020

Clas


Plastics sector working to improve recycling of multilayer food packaging processes that  raise  the  price  of  the  entire   process  and  make  it  much  less  technically   and  economically  feasible.  Another   GLI¿FXOW\LVWKHFXUUHQWORZGHPDQGIRU recycled  plastics,  which  account  for  only   6%  of  total  plastics  demand  in  Europe   and  are  often  limited  to  low  added-­value   applications,  the  study  suggested.   The  project  aims  to  develop  new   recycling  processes  to  obtain  polyamides   (PA)  from  multilayer  packaging  waste  for   foodstuffs.  A  delamination  process  will   be  included  to  separate  the  polyamides,   as  well  as  a  compatibilisation  process  

to reprocess  them  with  other  plastic   materials  in  order  to  obtain  compounds  of   VXI¿FLHQWTXDOLW\ The  goal  is  to  create  a  multilayer   packaging  recycling  chain  by  involving   and  collaborating  with  the  entire   value  chain  through  the  industrial   implementation  of  the  recycling  processes   developed  and  following  the  validation   of  the  technical  performance  and  quality   of  the  recycled  polyamides  by  using   them  instead  of  virgin  plastics  in  high   value-­added  applications,  including  those   involving  food  contact.  

FEB / MARCH 2020 49

THE RECIPAM  project,  funded  by  the   Spanish  Valencian  Innovation  Agency   (AVI),  is  developing  new  recycling   methods  for  multilayer  food  packaging   that  improve  the  quality  of  the  resulting   materials  so  they  can  be  incorporated  into   high  value-­added  applications.   Multilayer  plastic  packaging  waste   represents  a  serious  environmental   concern  because  it  is  not  always   managed  in  the  best  possible  way,  and   LQFLQHUDWLRQDQGODQG¿OOUDWHVDUHVWLOO very  high.  Separating  the  different  layers   calls  for  new  technologies  and  recycling  

www.aimplas.net

Classifieds Oct/Nov'19.indd 92

2019/09/13 11:17


PEOPLE www.skyeplastics.co.za Mark  Smith  of  Skye  with  one  of  the  new  machines   installed,  in  this  case  a  Sika  unit  commissioned  last   year.  The  double-­station  DS  3000  system,  built  by   Sika  of  Taiwan  and  supplied  by  Seecor,  can  produce   FRQWDLQHUVXSWRIRXUOLWUHV7KHV\VWHPLV¿WWHGZLWK a  conveyor  along  with  leak  tester

Skyeâ&#x20AC;&#x2122;s the limit

as Joburg blow moulder rejiggs

50 FEB / MARCH 2020

Spartan  blow  moulder  enters  some  new  markets THEREâ&#x20AC;&#x2122;S  new  energy  at  Skye  Plastics   and  a  lot  of  thatâ&#x20AC;&#x2122;s  got  to  do  with  fresh   OHJVFRPLQJRQWRWKH¿HOGVRWRVSHDN VSHFL¿FDOO\ZLWKWKHHQWU\RI0DUN6PLWK WRSOD\LQODWH 1RZWKH6SDUWDQEDVHGFRPSDQ\ UXQE\)UHG0RUDZLW]DQG&\ULO6KDQG KDVH[SDQGHGLWVSODQWDQGFDSDFLW\ DQGHQWHUHGDQXPEHURIQHZPDUNHWV with  Smith  having  arrived  with  some  of   WKHFOLHQWVKHKDGEHHQVXSSO\LQJLQKLV FDUHHUWRGDWH6PLWKZDVRULJLQDOO\DW /DSDFNMXVWDFURVVWKH5IUHHZD\IRU QHDUO\WKUHHGHFDGHV/DSDFNZKLFKKDG EHHQVWDUWHGE\KLVIDUWKHU(ULFDQGXQFOH %RE6PLWKZDVIRUORQJRQHRIWKHPRVW VXFFHVVIXOEORZPRXOGLQJFRPSDQLHVRQ WKH+LJKYHOG%XWWKLQJVZHQWVRXWKDIWHU WKH\HOHFWHGWRVHOOWRDPXOWLQDWLRQDO 7KHULVNVSRVHGIRUHQWUHSUHQHXUVZKHQ

HQWHULQJWKHFRUSRUDWHVHFWRUZHUHERUQH DQG0DUNIRXQGKLPVHOILQWKHXQHQYLDEOH SRVLWLRQRIEHLQJRXVWHGLQDFRPSOLFDWHG FDVH$IWHUZDWFKLQJIURPWKHVLGHOLQHV IRUVRPHWLPHKHZDVIRUWXQDWHWRMRLQ %RZOHU DOVRLQ6SDUWDQ ZKHUHKHVSHQW DQXPEHURIVXFFHVVIXO\HDUV %XWWKHGHVLUHWREHPDVWHURIKLVRZQ VKLSDVLWZHUHUHPDLQHGDQGWKH6N\H RZQHUVVKRZHGIRUHVLJKWE\RIIHULQJKLP WKHSRVLWLRQRI%'06LQFHWKDWSRLQWKH¶V EHHQDEOHWRSXWLQWRXVHWKHH[SHULHQFH and  many  lessons  learned  over  his   QHDUO\IRXUGHFDGHFDUHHULQSODVWLF SDFNDJLQJ7KHUHVXOWVDUHHYLGHQWD QXPEHURI6PLWK¶VFXVWRPHUVIURPWKH FRVPHWLFVDQGKRXVHKROGSURGXFWV sectors  have  followed  and  Skye  has  in   WKHSURFHVVHQWHUHGDQXPEHURIQHZ VHFWRUV0RUDZLW]DQG6KDQGKDYHDOVR

KDGWKHFRQ¿GHQFHWRSURFXUHVRPH QHZDQGYHU\LPSUHVVLYHZRUOGFODVV HTXLSPHQWWRUHDOLVHWKHFXUUHQWDQG ORQJWHUPREMHFWLYHVVHWRXWE\WKH 6N\HWHDP 3RVVLEO\RQHRIWKHPRVWUHOHYDQW DVSHFWVLVWKHLPSRUWDQFHRIEXLOGLQJ XSWKHIDLWKRIEUDQGFXVWRPHUVWRWKH SRLQWZKHUHWKH\DUHFRQ¿GHQWWKDWWKHLU FRQWDLQHUVZLOOEHSURGXFHGRQWLPHDQG WRKLJKVWDQGDUGGHVSLWHDQ\H[WHULRU IDFWRUVVXFKDVODERXUDFWLRQZKLFKLV QRVPDOOFKDOOHQJH 7KHFRPSDQ\KDVVLQFHH[SDQGHG LQWRDGMDFHQWSUHPLVHVDQGDIXUWKHUDQG LPSRUWDQWVSLQRIIKDVEHHQWKDWWKH6N\H SURGXFWLRQVWDIIDSSHDUWREHHQMR\LQJ WKHQHZPRPHQWXPDQGHQHUJ\FUHDWHG 6N\HHVWDEOLVKHGLQ¶KDVOLWHUDOO\ FRPHRIDJH

3D-printed lampshades from recycled plastics Printed  on-­demand  using  recycled  plastic /21'21EDVHGOLJKWLQJEUDQG3OXPHQ KDVSDUWQHUHGZLWK'SULQWLQJVSHFLDOLVW %DWFKZRUNVWRGHYHORSDUDQJHRIVKDGHV IRULWV/('EXOEVWKDWDUHSULQWHGRQ GHPDQGXVLQJUHF\FOHGSODVWLF 7KHVKDGHVDUHSURGXFHGDW%DWFK ZRUNV¶HDVW/RQGRQZRUNVKRSXVLQJ SODVWLFUHF\FOHGIURPZDWHUERWWOHVIULGJHV

DQGRWKHUVRXUFHVRISODVWLFSROOXWLRQ (DFKODPSVKDGHZDVGHYHORSHGWR¿W RQHRIWKHGHVLJQHUORZHQHUJ\OLJKWEXOEV SURGXFHGE\3OXPHQZKLFKZDVIRXQGHG LQE\0LFKDHO*HRUJH+HPXVDQG 1LFRODV5RRSH7KH¿UVWWZRGHVLJQVE\ )UHQFKVWXGLR%ROGDQG*HUPDQSURGXFW GHVLJQHU0DWWKLDV/DXFKHODXQFKHGLQ

1RYHPEHUZLWKWKHUHPDLQLQJ VKDGHVVHWWREHXQYHLOHGLQ 7KHODPSVKDGHVDUHSULQWHGXVLQJD ¿ODPHQWVRXUFHGIURP$PVWHUGDPVRFLDO HQWHUSULVH5HÃ&#x20AC;RZZKLFKUHF\FOHVDQG UHSXUSRVHVZDVWHSODVWLFV3ULQWLQJWKH SURGXFWVWRRUGHUUHGXFHVWKHDPRXQWRI ZDVWHSURGXFHGDQGWKHODPSVKDGHV FDQEHUHWXUQHGWRWKHPDQXIDFWXUHUIRU GLVDVVHPEO\DQGUHF\FOLQJDWWKHHQGRI WKHLUOLIHVSDQ

www.batch.works.com


Classifieds Oct/Nov'19.indd 92

2019/09/11 12:37


PEOPLE www.swanplastics.co.za

Itâ&#x20AC;&#x2122;s no swansong

52 FEB / MARCH 2020

as Swan consolidates plants

along:  Amanda  is  a  lawyer,  now  focusing   RQ¿QDQFLDOPDQDJHPHQWDQG*UHJLV TXDOL¿HGDVDPDUNHWLQJPDQDJHUDQG heâ&#x20AC;&#x2122;s  been  thrown  in  at  the  production   deep-­end. But  thereâ&#x20AC;&#x2122;s  nothing  like  adding   different  skills  to  a  venture  and  Swan  is   now  surging  ahead  with  the  combined   strengths  of  the  newcomers  and  its   experienced  group  of  industry  veterans,   including  the  astute  Mike  Harrison  and   Trevor  Sweet,  both  of  who  have  been   with  Swan  Plastics  for  many  years. Swan  has  also  reemployed  a  number   of  the  individuals  who  lost  their  jobs  in  the   DPI  closure  and,  two  years  before  that,   when  Sangio  exited  the  KZN  market  (the   company  was  bought  by  DPI  and  the   plant  moved  to  Roodekop)  â&#x20AC;¦  and  who   are  now  returning  to  Cato.

SWAN  Plastics  has  an  unusual  problem:   it  has  more  equipment  than  it  had   anticipated,  which  is  not  a  bad  problem   to  have  â&#x20AC;¦  if  the  sums  add  up.  This  is   the  result  of  its  purchase  of  the  PVC   pipe  extrusion  and  injection  moulding   machinery  from  DPI  when  the  latter   auctioned  off  its  plant  at  the  end  of  2018.   Swan  is  now  busy  consolidating  the   equipment  at  its  new  plant  in  Cato  Ridge,   KZN,  with  the  process  involving  moving   the  purchased  machinery  from  the  ex-­ DPI  site  in  Roodekop,  Gauteng,  as  well   as  that  from  its  Swan  Mouldings  plant  in   Pinetown,  which  is  being  closed. Included  among  the  machines  from   '3,DUHDQXPEHURIWRSÃ&#x20AC;LJKW(QJHO and  KraussMaffei  injection  machines,   including  a  number  of  2018  models.  Both   the  extruders  and  injection  machines  are  

being  sequentially  started  up  at  the  large   8000m²  site. This  scenario  unfolded  quite   unexpectedly  for  Swan  MD  Mike   Swanson,  who  had  been  thinking  of   retiring  about  now.  But  when  he  saw  an   opportunity  begging,  in  the  form  of  DPI   ZLWKGUDZLQJIURPWKHSLSHDQG¿WWLQJV market,  he  changed  tack.  The  strategy   since  has  been  to  consolidate  the  entities   at  the  site  on  Old  Main  Road  just  off  the   N3  in  Cato  Ridge,  ironically  the  same   premises  used  by  Mikeâ&#x20AC;&#x2122;s  late  friend,  Gary   Warren,  who  passed  away  in  2013  (Gary   had  run  an  HD  pipe  extrusion  plant,   Sangio  Pipe,  at  the  site). The  second  part  of  the  plan  for  Mike   involved  â&#x20AC;&#x2DC;invitingâ&#x20AC;&#x2122;  his  daughter  Amanda   and  son  Greg  to  join  the  company.  The   newcomers  have  brought  different  skills  

www.vapsupplies.co.za

Xen Syrrafos takes over at VAP

Xen  Syrrafos  and  Anthony  Eedes   with  some  of  the  most  popular   products  supplied  by  VAP

Tool  accessory  supplier  continues  with  what  it  does  best VAP  South  Africaâ&#x20AC;&#x2122;s  unintentional  long-­term   PDQDJHPHQWVXFFHVVLRQSODQLV¿QDOO\ paying  off,  with  Xen  Syrrafos  taking  over   from  his  mother  Linda.  Linda  had  been   forced  into  running  the  company  after  her   husband  died  in  a  motorcycling  accident   in  1996.  Putting  down  her  camera  to  learn   about  VAP,  she  did  a  sterling  job  for  the   ensuing  two  decades-­plus. Xen  was  still  at  school  at  the  time  but   thereafter  remained  with  the  company,  in   spite  of  offers  to  study  further  or  embark   on  other  courses.  He  has  in  the  process   come  to  understand  exactly  whatâ&#x20AC;&#x2122;s  involved   at  VAP  and  is  now  putting  those  lessons   WRZRUNZLWKKLVVWHSGDG$QWKRQ\(HGHV E\KLVVLGHIRUWKHODVW¿YH\HDUVPDNLQJD winning  team.   VAP  is  a  supplier  of  a  wide  range  of   tooling  components  for  the  toolmaking  and   press  tooling  sector  around  the  country,   and  has  been  for  close  to  three  decades.   It  supplies  the  range  of  accessories  from   (XURSH%HVLGHVPRXOGEDVHVLWVXSSOLHV

a  virtual  A-­to-­Z  for  toolrooms,  including   alignment  pins  and  bushes,  cooling,  ejection   parts  and  many  more.  Having  started  at   base  level,  Xen  knows  the  range  inside-­out. Key  to  VAPâ&#x20AC;&#x2122;s  success  and  sustainability   has  been  on-­going  availability  of   components  and  quick  response  times.  In   the  Gauteng  area,  driver  David  Madisha   has  been  with  the  company  for  23  years   and  done  a  great  job  of  ensuring  parts  are   delivered  on  time. Linda    is  always  in  the  background,   having    her  photographic  studio  and  Vap   RI¿FHVWRJHWKHUDWWKHVDPHSUHPLVHV Management  of  VAP  is  in  the  capable   hands  of  Xen. Being  of  Greek  decent,  Xen  knows  the   importance  of  business  fundamentals  and   LWFDQWKXVEHFRQ¿UPHGWKDWWKHUHLVDORW going  on  at  VAP  SA  besides,  with  virtually   all  of  it  stemming  from  the  companyâ&#x20AC;&#x2122;s   interaction  with  customers  in  the  converting   and  toolmaking  sectors  in  terms  of  goods   supply.


Our Winning Formula Sets Us Apart ELASTOMERS

PLASTICS & COMPOSITES

ACM CR EPDM Epichlorohydrin FKM HNBR HTV Silicone IR NBR NR PVC/NBR Blends SBR & BR

ABS Acetal Additives Composites CPE CSM EVA HIPS & GPPS Nylon PC PVC TPE & TPV TPU

FILLERS & ADDITIVES

AUXILIARIES & SERVICES

Aluminas Antimony Products Blowings Agents Carbon Blacks Flame Retardents Hydrocarbon Resins Magnesium Oxide Masterbatches MC & PE Waxes Mineral Fillers Peroxides Process Aids Rubber Chemicals Silanes Silica Sulfur Zinc Oxide

Machinery Other Services Release Agents Release liners Spares

ANCHOR CHEMICALS Batch Off Bonding Systems Coated Powders Factice Masterbatching Process Aids Toll Mixing

P O LY M E R S D I V I S I O N

Johannesburg

Durban

Cape Town

Port Elizabeth

(T) 011 489 3600 (F) 011 489 3601

(T) 031 313 8500 (F) 031 313 8516

(T) 021 506 4598 (F) 021 506 4561

(T) 041 3999 529 (F) 041 3999 401

www.carst.co.za

Classifieds Oct/Nov'19.indd Apr/May'19.indd 92 92

2019/09/12 2019/04/11 12:50 12:21


PEOPLE

Herman  Coetzee   has  started  Hyco   Enterprises  in   Somerset  East

Lourens  van  Deventer  has   been  appointed  ops  manager   at  MCG  Flexibles  in  Durban

54 FEB / MARCH 2020

On the move Grant  Page  has  been  appointed   managing  director  for  Sub-­Saharan   Africa  at  Amcor  Flexibles  in  Durban.  This   represents  something  of  a  return  to  his   roots  for  Grant,  who  was  at  Nampak   Flexible  until  2013,  when  he  joined  SRF   Flexipak,  the  manufacturer  of  BOPP   ÂżOPVLQ&DWR5LGJHZKHUHKHUDPSHG XSWKHEXVLQHVVIURPJUHHQÂżHOGWRIXOO capacity.  In  the  interim,  the  original   Nampak  Flexibles  business  became   part  of  the  international  Amcor  group   KHDGRIÂżFHLQ=XULFK DQGLVQRZNQRZQ as  Amcor  Flexibles  SA,  having  been   purchased  by  Amcor  in  2015.  The  main   difference  for  Grant,  who  has  a  bit  of   a  reputation  as  a  turnaround  specialist   and  systems  organiser,  is  that  he  will  no   longer  be  dealing  with  the  production   RISODLQÂżOPVRQO\DW$PFRUKHZLOOEH heading  up  the  three  SA  manufacturing   XQLWV 'XUEDQ3(&DSH7RZQ LQYROYHG in  printing,  extrusion,  laminating  and   bag-­making. Pieter  Jordaan  has  replaced  Grant   DV0'RI65))OH[LSDNLQ.=13LHWHU KDV%&RPPDQG0%$GHJUHHV+HZDV previously  MD  of  Flint  Group  (which   LQFOXGHV&RQWLQHQWDO3ULQWLQJ,QNVDQG (DJOH,QN6\VWHPV IURPDQG before  that  with  Eagle  Ink  Systems  from   DQGSULRUWRWKDWDW$%6$ Industrial  Finance  from  1993.   Lourens  van  Deventer  recently   MRLQHG0&*,QGXVWULHVÂś)OH[LEOHV'LYLVLRQ in  Durban  where  he  has  been  appointed   operations  manager.  Lourens  has  30   \HDUVÂśH[SHULHQFHLQWKHSODVWLFVLQGXVWU\ having  worked  for  top  companies   such  as  Sasol,  Transpaco  and  Gundle   3ODVWLFV/RXUHQVEHOLHYHVLWÂśVLPSRUWDQW for  a  company  to  listen  to  its  employees   as  â&#x20AC;&#x153;some  suggestions  can  prove  even  

Pieter  Jordaan  has  been   appointed  MD  of  SRF  Flexi-­ pak  in  Cato  Ridge,  KZN

PRUHVLJQLÂżFDQWWKDQLQYHVWLQJLQQHZ machineryâ&#x20AC;?. Training  is  another  crucial  aspect   within  the  ever-­changing  plastics   packaging  sector,  said  Lourens,  and  with   â&#x20AC;&#x153;many  technicians  and  artisans  having   JRQHDEURDGZHÂśUHORRNLQJDWSURYLGLQJ intern  and  learnership  opportunitiesâ&#x20AC;?. ,QRWKHUQHZVIURP0&*)OH[ Mike  Taylor  has  returned  to  the  Durban   company  after  close  to  a  decade  away.   Mike  has  had  a  somewhat  unusual   career,  having  worked  for  two  companies   RQWZRVHSDUDWHRFFDVLRQVKHVWDUWHG RXWDWZKDWZDV:5*UDFH&U\RYDFDQG later  became  Sealed  Air  in  Johannesburg   LQDQGZDVWKHUHIRUWZRGHFDGHV XSWLOO+HWKHQPRYHGWR/5 Plastics  in  Durban  but  returned  to  Sealed   $LURQWKH5HHILQ,QWKHLQWHULP /5ZDVERXJKWE\0&*,QGXVWULHVLQ DQGDIWHUDQXPEHURIRSHUDWLRQV managers  were  trialed,  was  in  turn  lured   EDFNWRWKH0REHQLÂżOPDQGEDJPDNLQJ business  in  late-­2017.  Last  year  Mike   ÂľUHDFKHGUHWLUHPHQWÂśDJHDQGVLQFHKH knows  the  company  better  than  anyone   else,  has  been  retained  as  a  consultant   on  a  renewable  contract. Ian  Victor  KDVOHIW0&*,QGXVWULHVRI ZKLFKKHZDV0'+HKDVEHHQUHSODFHG by  Selwyn  Grimsley. Wessel  Oelofse  has  been  appointed   general  manager  Versapak  in  Paarl,   which  is  part  of  the  Mpact  Plastics   EXVLQHVVLQWKH:HVWHUQ&DSH7RZQ+H ZDVSUHYLRXVO\DW3RO\RDNLQ&DSH7RZQ for  12  years  as  an  executive  and  prior  to   WKDWDW+HUGPDQV/LQHQ Mthandeni  Mkhize  has  been   appointed  MD  of  Krones  Southern  Africa.   +HZDVIRUPHUO\WHFKQLFDOPDQDJHUDW NP  Liquid  Plastics.

Leroy  Thangamuthu   has  succeeded  Mthandeni   and  taken  over  as  technical   manager  at  Nampak  LP. Anton  Buchner  has  joined   Kaydyl  Injection  Moulders  in  Stormill,   -RKDQQHVEXUJ+HZDVSUHYLRXVO\DW material  supplier  Plastomark.  Kaydyl   LVUXQE\$QWRQÂśVEURWKHU&DUOVRWKH appointment  is  in  fact  a  reuniting  for  the   Buchner  family.  Kaydyl,  which  has  just   FHOHEUDWHGLWVÂżUVWGHFDGHLQRSHUDWLRQ having  been  established  in  2009,   RSHUDWHVDĂ&#x20AC;HHWRIPDFKLQHVXSWR tonnes  clamp  force  and  also  builds  its   own  tools. Ian  Edwards  is  now  working  at   Sotara  in  Germiston,  a  division  of  Sinica   Manufacturing  of  Benoni,  operating  a   seven-­layer  oxygen  barrier  vacuum  bag   extrusion  and  bag  sealing  plant.  Sotara   DOVRUXQDFDVWOLQHIRUSDOOHWZUDSÂżOP Herman  CoetzeeKDVVWDUWHG+\FR Enterprises  in  Somerset  East.  After   more  than  a  decade  as  production   PDQDJHUDW:LUTXLQLQWKH(DVWHUQ&DSH WRZQ+HUPDQZDVREOLJDWHGWRVWDUWRQ KLVRZQLQRQFHKHUHDFKHGWKH retirement  age  applied  by  the  French   company.  But  what  for  others  may   have  been  a  challenge  has  proved  to   EHDEOHVVLQJIRUWKHPDQWKHSODWIRUP provided  by  the  new  business  created   the  opportunity  for  his  daughter  Yvonne   WRMRLQ +\FRVWDQGVIRU+HUPDQQ DQG<YRQQH <YRQQHLVDTXDOLÂżHG toolmaker,  an  unusual  distinction  among   females,  and  now  under  the  tutelage  of   KHUGDGLVDGGLQJYDOXHIRU+\FR7KH FRPSDQ\ÂśVFKLHIIRFXVLVK\GUDXOLFVVDOHV and  service  as  well  as  mould  design   and  manufacture  as  well  as  custom   moulding.    www.hycoenterprises.co.za

New appoinments at Safripol Peta-­Ann  Lord  and  Marco  Correia  have  joined  Safripol  and  were   welcomed  to  the  team  by  Safripol  commercial  executive  Mark  Berry   (left)  in  January.  Peta-­Ann  Lord,  who  has  a  BA  in  criminology  and   psychology,  has  been  appointed  as  an  executive  and  marketing   assistant;͞  Marco,  who  has  a  BSc  (UJ)  and  MBA  (Wits  Business  School),   KDVEHHQDSSRLQWHGPDQDJHUIRULQODQGVDOHVSRO\ROH¿QV+HKDV experience  in  the  distribution  of  commodity  and  speciality  chemicals

Class


Going further with Experience. More than 70 years of experience speaks for itself. As a long-standing partner of local and global businesses alike, ENGEL delivers reliable solutions worldwide. Thirty years ago, our experience and passion for our work inspired us to make one of the most groundbreaking developments in our companyâ&#x20AC;&#x2122;s history. At that time, we began to eliminate the use of tie bars, a move that represented a milestone in our industry. Tie-bar-less technology ensures an accessible mould area, even greater precision and excellent mould protection. The concept has allowed us to give our customers long-lasting success â&#x20AC;&#x201C; from 1989 until the present.

Telephone Number: +27 (011) 595 8320

Classifieds Feb/Mar'2020.indd 96

engelglobal.com/tie-bar-less

2020/01/23 12:40


COMPOSITES

Crafted  in  Sweden,  the  Candela  7  is  a  stylish  7.7m  open   PRWRUERDWWKDWFRPELQHVFDUERQ¿EUHFRQVWUXFWLRQDQG hydrofoils  to  create  a  near  silent  100%  electric  craft

www.sicomin.com

4XLHW FOHDQÆ&#x;LJKWDW&DQGHOD%RDWV Sicomin  supplied  high-­performance  epoxy  laminating  resins CANDELAâ&#x20AC;&#x2122;S  new  all-­electric  foiling  boat   uses  Sicominâ&#x20AC;&#x2122;s  epoxy  infusion  resins   and  adhesive  products  in  the  series   production  of  the  boat. Crafted  in  Sweden,  the  Candela  7   is  a  stylish  7.7m  open  motorboat  that   FRPELQHVFDUERQ¿EUHFRQVWUXFWLRQDQG hydrofoils  to  create  a  near  silent  100%   electric  craft  with  a  range  of  50  nautical   miles  (at  25  knots)  on  a  single  charge.     With  a  wet  weight  of  only  1  300kg,   the  Candela  is  around  45-­50%  lighter   WKDQDWUDGLWLRQDOJODVV¿EUHIRVVLOIXHO powered  boat.

7KHIXOO\IRLOLQJFDUERQ¿EUHKXOODQG deck  structure  is  capable  of  supporting   the  230kg  battery  pack  whilst  only   weighing  240kg  itself. Sicomin  joined  the  project  at  an  early   stage,  working  with  Candela  to  supply   high-­performance  epoxy  laminating   resins  for  the  manufacture  of  the  initial   prototype  vessels.  With  the  ramp  up   of  series  production,  the  company  has   also  been  able  to  support  Candelaâ&#x20AC;&#x2122;s   targets  to  industrialise  the  production   process,  providing  materials  and   process  support  that  are  then  validated  

with  extensive  on  the  water  testing. By  switching  the  epoxy  system  for   the  hull  and  deck  to  Sicominâ&#x20AC;&#x2122;s  SR1710   LQIXVLRQSURGXFW&DQGHODQRZEHQH¿W from  a  cleaner  and  more  consistent   process  technology  whilst  also   producing  laminates  with  extremely   high  mechanical  properties  and  an   LPSUHVVLYH7JRIÃ&#x203A;&DIWHUSRVWFXUH Bonding  of  the  Candela  7â&#x20AC;&#x2122;s  internal   VWUXFWXUHVDQG¿QDODVVHPEO\RIWKH ¿QLVKHGFUDIWKDVEHHQGHVLJQHG DURXQG6LFRPLQ¶VÃ&#x20AC;DJVKLSHSR[\ adhesive,  Isobond  SR7100TH.    

Developing compositesawareness early

schools  in  Nelson  Mandela  Bay.   The  R30-­million  Nelson  Mandela   Bay  Science  and  Technology  Centre   was  launched  in  March  2013,  offering   schools  and  learners  the  opportunity   to  be  exposed  to  science  and   technology  initiatives  such  as  SciFest,   National  Science  Week,  the  FameLab   Competition,  as  well  as  other  science   and  career  expos. www.nmbt.co.za/listing/nelson_ mandela_bay_science__technology_ centre.html

JEC  World  earlier  this  year.  The  tank   features  an  epoxy  system  designed   by  Sika  that  reportedly  helps  to  reduce   SROOXWLRQLQXUEDQWUDI¿F,WFRQWDLQVXS to  320  litres  and  is  the  same  size  as   a  conventional  diesel  fuel  tank.  The   high-­performance  resin  can  be  adapted   to  all  design  constraints,  particularly   for  very  high-­pressure  hydrogen  tanks,   up  to  700  bar.  Ullit-­Sika  composites   reduce  the  weight  of  the  tank  by  a   IDFWRURIIRXUDKXJHEHQH¿WZKHQ one  ton  saved  on  a  truck  saves  four   OLWUHVRIIXHOSHUNPLQXUEDQWUDI¿F The  resin  can  reportedly  withstand   the  cyclic  pressurisation  loads  on  the   ¿ODPHQWZRXQGWDQNV,QFRPELQDWLRQ ZLWKFDUERQ¿EUHWKHUHVLQSURYLGHV mechanical  resistance  for  different  tank   shapes  including  those  for  vehicles   running  on  natural  gas.

A  permanent,  mobile  exhibition  display   showcasing  composites  has  been  set-­ up  at  the  Nelson  Mandela  Bay  Science   and  Technology  Centre  in  Uitenhage.   Composite  samples  for  the  interactive   display  were  donated  by  NCS  Resins,   Industrial  Composites  and  Scott  Bader.   The  display  explains  what  a  composite   is,  how  it  is  made,  its  features,  uses   and  interesting  facts. Programmes  at  the  centre  are   designed  to  build  enthusiasm  and   DQDI¿QLW\IRUVFLHQFHWHFKQRORJ\ and  mathematics  through  fun  and   interactive  engagements.  The  schools   outreach  programme,  attached  to  other   programmes  run,  targets  grades  6,  9   and  12  learners  from  disadvantaged   56 FEB / MAR 2020

Composite tank helps reduce pollution SIKA  Advanced  Resins  and  tank   manufacturer  Ullit  exhibited  a  new   composite  tank  for  trucks  that  run  on   compressed  natural  gas  (CNG)  at  


Est.2003

WE BELIEVE  IN  BEING  BETTER  THAN  YESTERDAY. OUR  METHODS  ARE  SIMPLE, CREATIVITY  PASSION  AND  EXCELLENCE Skyland  Masterbatch  is  a  South  African  producer  &  exporter  of Masterbatch,  polymer  additives  and  pigments. Our  commitment  to  outstanding  customer  service,  consistent  quality   and  competitive  prices  make  us  the  preferred  partner  to  both  local   and  international  customers. Contact  : Tel  :  031  403  8152 Bruce  :  083  788  8152 Email  :  Info@Skylandcc.co.za www.Skyland.co.za

Skyland Masterbatch Magazine ad.indd 8 Classifieds Feb/Mar'2020.indd 96

Head Office  Address  : 40  Dawnview  Road,  Silverglen,  Durban Factory  Address  :   109  Lakeview  Drive,  Silverglen,  Durban

2020/01/20 7:30 PM 2020/01/22 17:06


COMPOSITES

â&#x20AC;&#x2DC;Britanniaâ&#x20AC;&#x2122; boat cradles with recycled FDUERQÆ&#x153;EUH

INEOS  Team  UK,   Britannia  cradle

58 FEB / MARCH 2020

Technology  ideal  for  cradles  application AS  the  36th  Americaâ&#x20AC;&#x2122;s  Cup  campaign   gathers  momentum,  ELG  Carbon   Fibreâ&#x20AC;&#x2122;s  technical  partnership  with   ,1(267HDP8.FRQWLQXHVWRÃ&#x20AC;RXULVK 7RGDWHWKHUHF\FOHGFDUERQ¿EUH convertor  has  processed  over   WRQVRIWKH%ULWLVK&KDOOHQJHUV ZDVWHPDWHULDOVDQGXVHGWKHVH¿EUHV WRSURGXFHWZRFUDGOHVIRUUDFHERDW µ%ULWDQQLD¶0RXOGVIRUWKHKXOOUHJLRQV RIWKHWHDP¶VWHVWERDWVKDYHDOVR EHHQPDQXIDFWXUHGXVLQJWKHVDPH WHFKQRORJ\ INEOS  Team  UKâ&#x20AC;&#x2122;s  waste  comprised  

RISUHLPSUHJQDWHGDQGFXUHGSDUWV IURPWKHFXUUHQWFDPSDLJQZKLFK ELG  has  subsequently  reprocessed   into  thermoset  and  thermoplastic   FRPSRXQGVDQGQRQZRYHQPDWV %ULWDQQLDZDVRI¿FLDOO\ODXQFKHGLQ 1RYHPEHUDWWKH,1(267HDP 8.¶VKHDGTXDUWHUVLQ3RUWVPRXWK7KH IWIRLOLQJPRQRKXOOLVWKH¿UVWRILWV size  and  represents  an  entirely  new   EUHHGRIUDFHERDW$VWUXFWXUHRIWKLV proportion  requires  a  strong  and  stable   FUDGOHWRVXSSRUWWKHERDWLQWUDQVLW (/*¶VQRQZRYHQFDUERQ¿EUHPDWV

were  used  to  produce  the  curved   FUDGOHVWKHKXOOVLWVXSRQ9DFXXP LQIXVLRQZDVVHOHFWHGDVWKHPRVW HFRQRPLFPHWKRGIRUPDQXIDFWXULQJ these  parts,  although  ELG  materials   can  also  be  used  in  prepreg  and  liquid   FRPSUHVVLRQPRXOGLQJSURFHVVHV ELGâ&#x20AC;&#x2122;s  products  were  also  incorporated   into  the  hull  mould,  which  again  was   PDGHXVLQJDYDFXXPLQIXVLRQSURFHVV $ODQ%RRW1DYDO$UFKLWHFWDW INEOS  Team  UK,  comments  â&#x20AC;&#x153;ELGâ&#x20AC;&#x2122;s   WHFKQRORJ\ZDVLGHDOIRUWKHFUDGOHV DSSOLFDWLRQ7KHLUUHF\FOHGPDWHULDOVDUH

Composite insert as a structural Pioneering  for  lightweight  applications  in  electric  vehicles

The  3D  hybrid   A-­pillar  extends   upward  from   the  vehicle   rocker  panel,   accommodates   the  door  hinges   and  holds  the   windshield  in  place   at  the  side

7+(SRWHQWLDORI7HSH[DOLQH RIFRQWLQXRXV¿EUHUHLQIRUFHG thermoplastic  composite  material   IURP/DQ[HVVIRUXVHLQOLJKWZHLJKW DSSOLFDWLRQVH[WHQGVWRWKHGHVLJQRI structural  components  in  passenger   FDUVZKLFKQHHGWREHFDSDEOHRI meeting  very  stringent  requirements   LQWKHHYHQWRIDFUDVK 2QHH[DPSOHRIWKLVLVD OLJKWZHLJKW$SLOODUGHYHORSHGE\ 3RUVFKH¶V'K\EULGGHVLJQ,WLV LQWHQGHGIRUXVHLQFDUVVXFKDV convertibles  and  roadsters,  and  is   EHLQJHPSOR\HGIRUWKH¿UVWWLPH LQWKH3RUVFKH&DEULROHW7KH

SLOODUFRQWDLQVDQLQVHUWPDGHIURP KLJKVWUHQJWKVWHHO7KLVLVVXSSRUWHG IURPWKHLQVLGHE\DIRUPHGEODQN RIWKHSRO\DPLGHEDVHG7HSH[ G\QDOLWH5*  DQG E\DULEEHGVWUXFWXUHPDGHIURP 'XUHWKDQ$.9+ZKLFKLVEDVHG on  polyamide  66  and  contains  short   JODVV¿EUHV 7KLVVWUXFWXUHLVERQGHGE\IULFWLRQ ZLWKWKH/VWUXFWXUDOIRDP GHYHORSHGE\/ /3URGXFWV7KH VWUHQJWKDQGULJLGLW\RIWKHK\EULG LQVHUWHQVXUHVWKDWWKH$SLOODULVMXVW as  good  at  withstanding  rollovers  as   SUHYLRXVGHVLJQVIHDWXULQJKLJK


Umatex setting up in SA

ELG  Britannia   composite  cradles

easy  to  handle,   perform  well   DQGÂżWWHG straight  into   our  production   processes.  This   is  a  game  changing   approach  to  marine   manufacturing  that  we  are   delighted  to  be  part  of.â&#x20AC;?

Durable, safe tools for cleaning composites

reinforcement for A-pillars response  to  heat.  The  coated   part  is  mounted  on  the  body   and  goes  through  the  cathodic   GLSFRDWLQJ .7/ SURFHVVZLWK it.  The  high  temperatures  of   WKH.7/SURFHVVFDXVHWKH structural  foam  to  expand  and   ERQGZLWKWKHKLJKVWUHQJWK sheet  steel,  which  is  also   DI¿[HGWRWKH$SLOODUFDVLQJWR produce  the  reinforcing  hybrid   insert.  This  last  step  takes   place  in  an  entirely  automated   manufacturing  process  that   was  developed  by  Porsche   and  is  subject  to  ongoing   quality  control.

www.lanxess.com

Performance  Plastics  Ltd  has  moulded  the  latest   additions  to  its  EnduroSharpâ&#x201E;˘  line  of  aircraft   PDLQWHQDQFHWRROVIURP6ROYD\ÂśVKLJKSHUIRUPDQFH TorlonÂŽSRO\DPLGHLPLGH 3$, DJODVV ÂżEUHUHLQIRUFHGUHVLQ'HVLJQHGWRUHPRYHWRXJK PDWHULDOVIURPGHOLFDWHÂżEUHUHLQIRUFHGFRPSRVLWH surfaces,  the  latest  additions  to  Performance  Plasticsâ&#x20AC;&#x2122;   SRUWIROLRLQFOXGHJDSEODGHVJDSÂżOOHUUHPRYDOELWV and  discs,  as  well  as  adhesive  cutters  and  reamers.   www.performanceplastics.com

FEB / MARCH 2020 59

www.ELGCF.com

strength  steel  tubes.  However,   it  is  around  5kg  lighter.  The   weight  reduction  is  achieved   in  the  greenhouse  area  of  the   vehicle,  lowering  the  carâ&#x20AC;&#x2122;s   centre  of  gravity  and  thereby   improving  vehicle  dynamics. 7KHÂżUVWVWHSLQWKH manufacture  of  the  reinforcing   elements  involves  forming  and   overmoulding  the  Tepex  blanks   in  a  single  operation  using  the   hybrid  moulding  technology.   The  resultant  composite   component  is  then  coated  with   DQHSR[\EDVHGIRDPERQGLQJ system  that  expands  in  

UMATEX,  which  owns  a  high  tech,  high  quality  and   cost  effective  composite  materials  producer  in  Russia,   is  in  the  process  of  setting  up  in  South  Africa.   Umatex  is  a  100%  subsidiary  of  Russian  energy   giant  Rosatom,  and  manages  the  so  called  â&#x20AC;&#x153;Promising   Materials  and  Technologies  divisionâ&#x20AC;?  of  the  State   Corporation  Rosatom. Ryan  Collyer,  deputy  CEO  of  Rosatom  Central  and   6RXWKHUQ$IULFDVD\VWKHVFLHQWLÂżFDQGWHFKQRORJLFDO potential  of  Umatex  supports  improvement  and   introduction  of  production  technologies  for  PAN   SUHFXUVRUDQGFDUERQÂżEUH$VSDUWRIWKH6WDWH Corporation  Rosatom,  Umatex  is  Russiaâ&#x20AC;&#x2122;s   largest  producer  of  a  wide  range  of  carbon   ÂżEUHV Âł$ORQJZLWKSURGXFWLRQRIFDUERQÂżEUH DQGÂżEUHEDVHGLWHPV8PDWH[FDUULHVRXW research  and  development  and  provides   engineering  support  to  its  partners.  Umatex   runs  the  mission  of  a  complete  import   SKDVHRXWDQGFUHDWHVJOREDOO\FRPSHWLWLYH KLJKWHFKSURGXFWV7KHFRPSDQ\QRZDOVR exports  into  numerous  markets  across  the   globe,â&#x20AC;?  he  adds. www.en.umatex.com


DESIGN

Medical, solar energy, blow moulding breakthroughs THE  US  Society  of  Plastics  Engineersâ&#x20AC;&#x2122;   annual  parts  competition  saw  DoseCue,   a  pill  bottle  that  has  a  series  of  lights   that  signal  when  itâ&#x20AC;&#x2122;s  time  to  take   medicine  â&#x20AC;&#x201C;  and  lets  you  know  if  you   miss  a  dose  â&#x20AC;&#x201C;  won  three  awards  for   FGH  Systems  Inc  at  the  SPEâ&#x20AC;&#x2122;s  blow   moulding  divisionâ&#x20AC;&#x2122;s  annual  parts   competition. New  Jersey-­based  FGH  made  the   blow  moulds  and  moulded  the  container,   which  won  the  Peopleâ&#x20AC;&#x2122;s  Choice  for   packaging,  the  pharmaceutical  award   in  the  packaging  category  and  the  blow   moulding  division  award  for  packaging. DoseCue  has  a  stepped-­in  panel   inside  the  high  density  polyethylene  pill   bottle.  Patients  simply  follow  the  lights:   7KHWRSOLJKWÃ&#x20AC;DVKHVJUHHQDWGRVHWLPH WKHVHFRQGOLJKWÃ&#x20AC;DVKHVJUHHQZKHQD GRVHLVWDNHQLIDGRVHLVPLVVHGWKHQ DWKLUGOLJKWÃ&#x20AC;DVKHVUHGDQGWKHIRXUWK OLJKWÃ&#x20AC;DVKHV\HOORZZKHQLW¶VWLPHWR RUGHUDUH¿OO The  other  Peopleâ&#x20AC;&#x2122;s  Choice  award,   for  industrial  parts,  went  to  Western   Case  Inc  of  California  for  SolarTub,  a   modular,  ground-­mounted  array  of  solar   panels  that  can  be  quickly  installed   using  hand  tools.  SolarTub  also  picked   up  the  â&#x20AC;&#x2DC;otherâ&#x20AC;&#x2122;  award  in  the  industrial   category. SolarTub  allows  solar  panels  to   be  installed  in  virtually  any  location   worldwide  to  provide  power  where   needed.  The  product  replaces  traditional   concrete  and  steel  racking  with  an   +'3(EDVHWKDWFDQEH¿OOHGZLWKZDWHU or  other  ballast  material  to  stabilise   SolarTub  in  windy  conditions.  The  low-­ SUR¿OHGHVLJQPDNHVLWHDV\WRPDLQWDLQ and  easy  to  move  to  other  locations. Silgan  Plastics  Corp.  won  the   packaging  award  in  food  for  a  PET   container  for  McCormick  Old  Bay   Seasoning  and  black  pepper,  replacing   the  iconic  metal  canister.  The  metal-­

60 FEB / MARCH 2020

Overall winner!

DoseCue,  a  pill  bottle  that  has  a  series  of  lights   that  signal  when  itâ&#x20AC;&#x2122;s  time  to  take  medicine

to-­plastic  conversion  gives  a  16%   reduction  in  carbon  emissions  and   eliminates  BPA  in  the  package. Silgan  produced  the  PET  container   on  a  Sidel  SBO-­8  Universal  blow   moulding  machine.  The  recyclable   oblong  PET  container  is  trimmed  inline,   and  shrink  sleeve  decorated  inline  and   RIÃ&#x20AC;LQHWRWKHEORZPRXOGLQJPDFKLQH Nissei  ASB  Co  won  the  beverage   award  in  packaging  for  a  returnable   5-­gallon  polycarbonate  water  container  

with  a  hollow  handle  called  the   7UX+DQGOHIRUKRPHDQGRI¿FHXVH TruHandle  is  injection  stretch  blow   moulded  on  Nissei  ASB  machines.  The   LQMHFWHGQHFN¿QLVKKDGQREDVHZHOG giving  improved  impact  resistance,  the   FRPSDQ\VDLG1RWRSRUWDLOÃ&#x20AC;DVKJLYHV DVLJQL¿FDQWO\EHWWHUYLVXDOORRNWKDQ extrusion  blow  moulding. Bekum  America  Corp  of  Michigan   picked  up  the  â&#x20AC;&#x2DC;otherâ&#x20AC;&#x2122;  category  in   packaging  for  an  ecobottle  for   Ecological  Brands  Inc,  known  for   its  bottles  made  of  100%  recycled   cardboard  and  newspapers,  with  a   thin-­wall  blow  moulded  liner  made  from   post-­consumer  HDPE  from  Envision   3ODVWLFV7KHPRXOGHG¿EUHVKHOO provides  the  structure,  so  the  blow   moulded  liner,  which  only  needs  to   provide  barrier  and  closure  features  to   protect  the  contents,  uses  60%  less   plastic  than  rigid  blow  moulded  bottles.   Patented  blow  moulded  features  in   the  liner  neck  interface  have  mating   IHDWXUHVLQWKHWKHUPRIRUPHG¿EUH outer  shells.  That  provides  a  reclosable   bottle  without  the  need  for  lamination  or   adhesives. Mann+Hummel  USA  Inc  of  Michigan   won  the  awards  for  both  automotive/ transportation  in  the  industrial  category   and  the  division  award  for  a  blow   moulded  clean  air  duct  assembly  for  

The  packaging  award  in  food  for  a  PET  container  went   to  McCormick  Old  Bay  Seasoning  and  black  pepper,   replacing  the  iconic  metal  canister


Peopleâ&#x20AC;&#x2122;s  Choice  award,  for  industrial  parts  â&#x20AC;&#x201C;  SolarTub Nissei  ASB   Co  won  the   beverage  award   in  packaging   for  a  returnable   5-­gallon   polycarbonate   water  container   with  a  hollow   The  HDPE  dog   handle  called   kennel  feeder  was   the  TruHandle designed  to  be  an  easy   method  to  feed  dogs  in   medium-­  to  large-­scale   kennels  without  the   employee  having   to  enter  into  the   kennel  area

SolarTub,  a  modular,  ground-­mounted  array  of  solar   panels  that  can  be  quickly  installed  using  hand  tools

the  Ford  F150  truck.  The  assembly   of  parts,  most  of  them  blow  moulded,   FDUULHVDLUIURPWKHDLU¿OWHUER[WRWZR turbo  inlets.  The  main  blow  moulded   components  integrate  silencers  and  air   connections  used  to  activate  and  control   critical  functions  such  as  crankcase   ventilation  and  evaporative  emissions.   The  plastic  overmoulding  seals  the   silencer  assembly.  Mann+Hummel  uses   double-­cavity  moulds  to  handle  the  

production  volume  of  more  than  750  000   units  a  year. Agri-­Industrial  Plastics  of  Iowa,   snapped  up  the  award  for  consumer   products  in  the  industrial  category  for   a  dog  kennel  feeder  it  blow  moulds  for   Kane  Manufacturing  Co  Inc.  The  HDPE   part  was  designed  to  be  an  easy  method   to  feed  dogs  in  medium-­  to  large-­scale   kennels  without  the  employee  having  to   enter  into  the  kennel  area.  The  feeder  

slides  under  an  opening   outside  of  the  kennel,  and  food  is   added  through  a  lid  opening   attached  to  the  top.   Features  include  a  living   hinge  to  mould  the  lid   and  base  as  one   piece.  The  lidâ&#x20AC;&#x2122;s   snap-­close   feature  eliminates   additional  hardware.

Students compete to improve on existing designs WINNER

THE  Society  of  Plastics  Engineers  blow  moulding  division  also   hosted  its  annual  Student  Design  Contest  last  year  to  promote   interest  in  blow  moulding  applications.  A  winner  and  two   honourable  mentions  were  made.

MANHOLE Â COVER By Kevin Cummings & Hunter Fantechi

Above  is  the  manhole  cover  design  currently  in  use   in  NYC.  The  drawings  depict  the  studentsâ&#x20AC;&#x2122;  design

FEB / MARCH 2020 61

The  part  was  designed  to  replace  manhole  covers  currently  in  use   in  New  York  City.  Maintaining  the  current  dimensions  (38  inches   in  diameter,  sitting  on  a  36-­inch  frame)  was  crucial  to  ensure  the   QHZFRYHUV¿WLQSODFHRIWKHROGFRYHUV7RHQKDQFHWKHGHVLJQ the  bottom  has  tack-­offs  to   provide  structural  support,   that  span  across  the  bottom   reaching  almost  to  the  outer   edge.  The  top  of  the  manhole   FRYHUKDVDWH[WXUHGVXUIDFH with  small  grooves  on  the   top  to  provide  traction.  The   part  is  manufactured  using   unplasticised  rigid  PVC  and   has  a  nominal  wall  thickness   of  3mm.


DESIGN

Students improve on existing designs HONOURABLE MENTIONS

ROOFTOP,  POP-­UP  TENT By Alexandra Oliver and Bradley Boreali

The  proposed  idea  for  the  new  hard-­ shell  rooftop  tent  involves  extrusion   blow  moulding  an  upper  and  lower   hard-­shell  case.  The  case  will  be   double  walled  for  strength.  Additionally,   ribs  will  be  moulded  into  the  cases   for  increased  rigidity.  The  slots  for   the  vehicle  crossbars  will  also  be   incorporated  into  the  design.  This   eliminates  the  need  to  insert  these   features  after  the  moulding  process  for   the  upper  and  lower  shell.  The  shell   will  house  a  pop-­up  tent.  The  shell   will  open  with  hinges  on  the  right  side   of  the  case.  The  upper  half  will  fold   180°  outwards  to  become  additional  

sleeping  space.   This  design  is   unique  and  innovative   for  this  product  sector.   The  feature  that   makes  this  product  unique  is  the   addition  of  the  second  sleeping  area   created  by  opening  the  top  of  the  case.   The  design  for  the  extrusion  blow   moulded  camper  shell  allows  for  both   the  top  and  bottom  shells  to  be  used   as  viable  living  space.  Due  to  the  large   surface  area,  this  tent  is  designed  to   hold  up  to  four  people  with  a  maximum   weight  capacity  of  430kg.  The  bottom   half  is  entirely  supported  on  the  roof  

An  example  of  a  typical  rooftop  pop-­up   tent  and  the  studentsâ&#x20AC;&#x2122;  design

racks  of  the  car  while  the  top  half  is   supported  by  sliding  rails  from  the   bottom  half  and  by  extendable  legs   touching  the  ground.  These  extendable   legs  are  stored  in  the  top  part  of  the  top   shell.  The  part  is  manufactured  using   HDPE.  

SIDE-­BY-­SIDE  BED By Matt Feldbauer & Greg Streiff, Penn State Erie, The Behrend College

The  Polaris   Ranger,  one   of  the  most   popular   utility vehicles   (UTVs)  on  the   market,  and   the  studentsâ&#x20AC;&#x2122;   design  for  a   lighter  side-­ by-­side  bed

Currently,  the  Polaris  Ranger  is  one  of  the  most  popular  utility   vehicles  (UTVs)  on  the  market.  It  is  a  powerful  â&#x20AC;&#x2DC;side-­by-­sideâ&#x20AC;&#x2122;  with   both  power  and  functionality  that  can  be  used  for  both  work  and   play.  The  main  reason  for  the  versatility  of  this  machine  is  the   large  cargo  bed.  The  570cc  model  equipped  with  the  cargo  bed   can  support  a  load  up  to  225kg.   The  proposed  design  will  be  manufactured  using  Nylon  and   provides  a  more  solid,  rounded  bottom  so  the  underside  wonâ&#x20AC;&#x2122;t   get  packed  with  mud  and  snow  and  will  maintain  or  improve  the   strength  and  rigidity  of  the  box.  When  designing  the  new  bed   IRUDPLGVLVH3RODULV5DQJHUWKH¿UVWWKLQJFRQVLGHUHGZDVWKH overall  dimensions.  The  bed  that  comes  equipped  on  the  Ranger   has  inside  dimensions  of  81  x  107  x  29cm  (l  x  w  x  h).  The  most   LPSRUWDQWVSHFL¿FDWLRQWKRXJKLVWKDWWKHEHGPXVWEHDEOHWR withstand  a  distributed  weight  of  225kg  across  its  width.   The  bed  has  relatively  vertical  walls  besides  the  recommended   draft  on  them  which  allows  for  accessories  to  be  mounted  into   the  holes  on  the  edges  of  the  bed.  Because  of  this,  the  back   RSHQLQJLVVTXDUHGRIIVRWKDWDWDLOJDWHZLOO¿WDQGWKHEUDFNHWV WKDWJHWPRXQWHGRQWRWKHEHGZLOOKDYHDÃ&#x20AC;DWVXUIDFHWRPRXQW to,  just  like  on  the  other  side.   62 FEB / MAR 2020


Classifieds Feb/Mar'2020.indd 96

2020/01/28 10:15


WORLD NEWS French consortium to develop chemical recycling of plastic $FRQVRUWLXPRIÂżYHFRPSDQLHVÂą&LWHR Total,  Recycling  Technologies,  Mars   DQG1HVWOHÂąDUHSDUWQHULQJWRGHYHORS industrial  chemical  recycling  of  plastics   in  France.  The  consortium  will  examine   feasibility  of  recycling  products  currently   considered  non-­recyclable,  such  as   Ă&#x20AC;H[LEOHIRRGJUDGHSDFNDJLQJ 7KHÂżUVWRIDNLQGFRQVRUWLXPRIZRUOG leading  players  from  across  the  plastic   packaging  value  chain  will  examine  the   technical  and  economic  feasibility  of   recycling  complex  plastic  waste,  such  as   VPDOOĂ&#x20AC;H[LEOHDQGPXOWLOD\HUHGIRRG grade  packaging.   â&#x20AC;&#x153;By  addressing  the  circular  economy   challenges  of  food-­grade  plastics,   chemical  recycling  is  a  perfect  addition   to  our  existing  mechanical  recycling   activities,â&#x20AC;?  said  Bernard  Pinatel,  president   RI5HÂżQLQJ &KHPLFDOVDW7RWDOÂł7KH project  announced  today  to  develop  an   industrial  sector  involving  major  players  in   the  packaging  value  chain  is  an  important   step  in  our  ambition  to  produce  30%   recycled  polymers  by  2030.â&#x20AC;? â&#x20AC;&#x153;We  are  aiming  for  100%  of  our  packaging   to  be  reusable  or  recyclable  by  2025.   Combining  our  expertise  in  a  collective   project  to  improve  recycling  is  something  we   need  to  do  to  tackle  the  global  plastic  issue,â&#x20AC;?   said  Mathieu  Tuau,  head  of  packaging  and   sustainability  at  NestlĂŠ  France.                        

Complete divestment of Covestroâ&#x20AC;&#x2122;s PC sheets business

COVESTRO  has  successfully  closed   the  sale  of  its  European  polycarbonates   sheets  business  to  the  Munich-­based   6HUDÂżQ*URXSHIIHFWLYH-DQXDU\7KLV includes  key  management  and  sales   functions  throughout  Europe  as  well  as   production  sites  in  Belgium  and  Italy.  The   segment  generated  total  sales  of  â&#x201A;Ź130   PLOOLRQLQ6HUDÂżQZLOOFRQWLQXH operations  with  the  250  employees  at   all  locations.  Moreover,  Covestro  will   continue  to  serve  as  key  raw  materials   supplier  in  the  foreseeable  future. From  now  on,  the  former  polycarbonate   sheets  business  of  Covestro  will  operate   under  the  new  company  name  Exolon   *URXS ZZZH[RORQJURXSFRP :LWKLQ 6HUDÂżQ*URXS([RORQ*URXSZLOOEH established  as  an  independent,  mid-­sized   company.          ZZZVHUDÂżQJUXSSHGH 64

WORLD NEWS-.indd 64

China to ban

all single-use Â

Single-­use  and  non-­degradable  plastic  bags  will  be  banned    

CHINA,  one  of  the  worldâ&#x20AC;&#x2122;s  largest  consumer  of  plastics,  plans  to  ban  single-­ use  plastics  across  the  country.  The  proposal,  announced  on  19  January,  aims   to  reduce  plastic  waste  that  has  become  ubiquitous  in  Chinese  cities,  promote   UHF\FOLQJDQGJUHHQSDFNDJLQJDQGFXUEWKHLURYHUĂ&#x20AC;RZLQJJDUEDJHGXPSV The  policy  will  ban  the  production  and  sale  of  disposable  plastic  tableware  and   cotton  swabs  by  the  end  of  2020.  Production  of  household  products  containing   microbeads  will  be  banned  by  the  end  of  2020  and  sales  of  such  products  will  be   banned  two  years  after  that. Single-­use  and  non-­degradable  plastic  bags  will  be  banned  in  major  Chinese   cities  by  the  end  of  2020  and  across  the  country  by  2022.  In  addition,  single-­use   straws  will  be  banned  by  the  end  of  2020. By  2025  the  proposal,  which  was  introduced  by  both  the  National  Development  

New materials high-

9HUVDWLOHDSSOLFDWLRQV

In  cooperation  with  the  Italian  INAF  Institute,  Covestro  has   GHYHORSHGWDLORUPDGH%D\IRO+;SKRWRSRO\PHU¿OPVLQ ZKLFKKLJKO\HI¿FLHQWYROXPHKRORJUDPVFDQEHLQVFULEHG to  effectively  decompose  starlight  into  its  colours

WHILE  todayâ&#x20AC;&#x2122;s  astronomical   high-­performance  telescopes   are  getting  bigger  and  bigger   with  the  aim  of  achieving   an  even  higher  image   resolution  and  penetrating   into  even  greater  depths   of  space,  current  material   developments  aim  at  a   further  improvement  of   the  spectroscopic  analysis   of  starlight  while  at  the   same  time  reducing  the   complexity  of  the  necessary   instruments. The  National  Institute  for   $VWURSK\VLFVLQ,WDO\ ,1$)  is  working  on  holographic   optical  elements  based  

FEB / MAR 2020

2020/02/14 14:23


plastics in  major  Chinese  cities  by  the  end  of  2020 and  Reform  Commission  and  the  Ministry  of  Ecology   and  Environment,  would  ban  all  single-­use  plastics   across  the  country. The  phased  approach  will  allow  time  for  China  to   ramp  up  manufacturing  of  biodegradable  and  alternate   products  to  replace  single-­use  plastics. The  ban  comes  on  the  heels  of  China  announcing  that   itâ&#x20AC;&#x2122;s  mega-­dump,  the  largest  in  the  country  is  full  25  years   DKHDGRIVFKHGXOH7KH-LDQJFXQJRXODQGÂżOOLQ6KDDQ[L 3URYLQFHLVWKHVL]HRIIRRWEDOOÂżHOGVDQGZDVEXLOWWR UHFHLYHWRQVRIZDVWHSHUGD\,QVWHDGWKHODQGÂżOO received  10  000  tons  of  waste  per  day.

ALPLA joins crossindustry consortium for chemical recycling Innovative  technology  enables  circularity  for   difficult-­to-­recycle  PET  plastic  waste ALPLA  Group,  an  international  plastic  packaging  and  recycling   specialist,  has  joined  a  new  consortium  for  chemical  recycling  of   PET.  The  consortium  intends  to  speed  up  the  commercialisation  of   HQKDQFHGUHF\FOLQJWHFKQRORJ\%3,QÂżQLDZKLFKWXUQVRSDTXHDQG GLIÂżFXOWWRUHF\FOH3(7SODVWLFZDVWHLQWRUHF\FOHGIHHGVWRFNV 7KHFRQVRUWLXPLQWHQGVWRFRPELQHWKHFDSDELOLWLHVDQGH[SHULHQFH of  its  members  â&#x20AC;&#x201C;  packaging  and  recycling  specialist  ALPLA;Íž  food,  drink   and  consumer  goods  producers  Britvic,  Danone  and  Unilever;Íž  waste   management  and  recycling  specialist  Remondis;Íž  and  energy  and   petrochemicals  producer  BP  â&#x20AC;&#x201C;  to  develop  a  new  circular  approach  to   dealing  with  PET  plastic  waste. Georg  Lässer,  Head  of  Recycling  at  ALPLA  said:  â&#x20AC;&#x2DC;ALPLA  is  delighted   to  join  this  cross-­functional  project  with  partners  from  the  entire  value   chain.  It  completes  our  intense  activities  besides  mechanical  recycling   DQGIRFXVHVRQSRVWLQGXVWULDO3(7ZDVWHGLIÂżFXOWWRUHF\FOH3(7 packaging  and  PET  thermoform  trays.  With  BP  in  the  lead,  we  have   DYHU\VWURQJDQGKLJKO\H[SHULHQFHGSDUWQHUWKDWFRQWULEXWHVZLWK knowledge  about  virgin  polyester  production.â&#x20AC;&#x2122; www.alpla.com

improve performance telescopes in astronomy

GXHWRWDLORUPDGHSKRWRVHQVLWLYHSKRWRSRO\PHUÂżOPV

without  any  chemical  pre-­treatment  or   post-­treatment.

The  new  â&#x20AC;&#x153;reach  for  the  starsâ&#x20AC;? INAF  has  already  succeeded  in   LQWURGXFLQJWKHÂżOPLQWRREVHUYDWRULHV worldwide  with  several  instruments  each   LQÂżYHKLJKSHUIRUPDQFHWHOHVFRSHV The  oldest  holographic  optical  element   produced  this  way  has  been  working   reliably  for  over  eight  years. BayfolÂŽ+;ÂżOPVFRQVLVWRID WUDQVSDUHQWFDUULHUÂżOPRQZKLFKD light-­sensitive  layer  and  an  additional   SURWHFWLYHRXWHUÂżOPDUHSODFHG7KH\DUH manufactured  on  an  industrial  scale.  In   BayfolÂŽ  HX,  volume  holograms  can  be   LPSULQWHGLQWKHÂżOPVLQDXVHUIULHQGO\ purely  optical  manner  and  reproducibly,  

Wide  range  of  applications ³2XUSKRWRSRO\PHU¿OPVFDQEH successfully  used  in  demanding   applications  such  as  spectrometers   in  high-­performance  telescopes  for   astronomy.  They  are,  of  course,   particularly  suitable  for  many  consumer   DSSOLFDWLRQV´H[SODLQV)ULHGULFK.DUO Bruder,  Head  of  Application  Development   Holography.  These  include  transparent   windshield  displays,  innovative   holographic  car  lighting,  forgery-­proof   documents,  smart  and  augmented  reality   glasses,  as  well  as  cockpit  use  to  protect   pilots  from  laser  attacks  from  the   ground. www.covestro.com

65

65.indd 65

effectively  into  its  spectral  components   than  is  known  from  a  prism.

FEB / MAR 2020

on  volume  holograms,  which  very   effectively  decompose  the  light  of  stars   into  their  colours  in  order  to  study  it   spectroscopically.  During  many  years   of  cooperation  with  the  materials   manufacturer  Covestro,  its  tailor-­made   BayfolÂŽ+;SKRWRSRO\PHUÂżOPVSURYHGWR be  ideal  for  the  reproducible  production   RIKLJKO\HIÂżFLHQWYROXPHKRORJUDPVLQ high-­performance  telescopes  for  very   different  and  novel  spectrometers  for   each  of  the  cases  realized  to  date.   7KLVDOORZVSHULRGLFUHIUDFWLYHLQGH[ SDWWHUQVWREHĂ&#x20AC;H[LEO\LQVFULEHGLQWRWKH volume  of  thin  BayfolÂŽ+;ÂżOPVXVLQJ DQDSSURSULDWHODVHUH[SRVXUHVHWXS 7KHVWDUOLJKWLVGLIIUDFWHGYHU\HIÂżFLHQWO\ DWWKLVSHULRGLFUHIUDFWLYHLQGH[SDWWHUQ This  separates  the  starlight  much  more  

2020/02/14 14:23


WORLD NEWS

Borealis to acquire Nova Chemicals ownership interest in Novealis JV

Beyond Plastic Award 2020

Borealis  AG  and  NOVA  Chemicals   Corporation  have  reached  an   agreement  for  Borealis  to  buy  NOVA   Chemicalsâ&#x20AC;&#x2122;  50%  ownership  interest  in   Novealis  Holdings  LLC. Formed  in  2018,  Novealis  is  the  joint   YHQWXUHEHWZHHQDIÂżOLDWHVRI%RUHDOLVDQG NOVA  Chemicals,  which  subsequently   formed  a  50/50  joint  venture  with  an   DIÂżOLDWHRI7RWDO6$WRODXQFK%D\SRUW 3RO\PHUV//&LQ+RXVWRQ7H[DV86 Closing  of  the  acquisition  is  subject   to  customary  regulatory  approvals  and   other  conditions  but  is  not  subject  to   DQ\ÂżQDQFLQJFRQGLWLRQ7KHSDUWLHV H[SHFWWKHWUDQVDFWLRQWRFORVHLQWKH ÂżUVWKDOIRI

7+(JOREDORQOLQHSODWIRUPIRUHFRGHVLJQHGSDFNDJLQJVROXWLRQVEH\RQGSODVWLF QHWKDVODXQFKHGWKHKRVWLQJRIWKH%H\RQG3ODVWLF$ZDUG7KHDZDUGœV motto  is:  Let  us  design  and  create  eco-­responsible  packages  and  transform   plastic  products  into  solutions  made  of  environmentally  sound  materials. 7KHDZDUGZLOOKRQRXUWKHLQQRYDWLRQDQGFUHDWLYLW\LQVXVWDLQDEOHSDFNDJLQJ design  in  three  categories:     1.  Most  practical  impact  to  reduce  the  use  of  plastics   2.  Most  innovative  approach   3.  Most  beautiful  solution  

China aims to boost domestic plastic recycling While  Chinaâ&#x20AC;&#x2122;s  move  to  stop  imports   of  scrap  plastics  has  altered  global   WUDGHĂ&#x20AC;RZVDQGXSHQGHGWKHUHF\FOLQJ industry,  thereâ&#x20AC;&#x2122;s  a  shift  going  on   within  the  country  that  may  be  just  as   important  for  plastics  recyclers. 6LQFHHDUO\PRUHWKDQ&KLQHVH cities  have  rolled  out  pilot  waste  sorting   programmes  for  recyclables  and  trash.  Itâ&#x20AC;&#x2122;s   a  big  change  for  Chinese  homes,  and  itâ&#x20AC;&#x2122;s   inspired  debate,  confusion  and  humorous   online  memes  among  residents  as  they   grapple  with  being  forced  to  separate   recyclables,  wet  kitchen  trash,  dry  waste   DQGKD]DUGRXVZDVWHIRUWKHÂżUVWWLPH For  the  scrap  plastics  industry,  the   focus  on  sorting  waste  could  have   SRVLWLYHV,QGXVWU\RIÂżFLDOVVD\WKH mood  is  changing:  while  government   campaigns  over  the  past  few  years  like   *UHHQ)HQFHDQG1DWLRQDO6ZRUGKDYH made  the  industry  feel  targeted,  the  new   prioritization  of  domestic  recycling  could   lead  the  industry  to  being  more  valued. It  is  estimated  that  the  volume  of   imported  pellets  has  increased  three-­  or   four-­fold  since  the  scrap  import  ban  but   imported  pellets  are  only  a  fraction  of   the  volume  of  scrap  that  used  to  come   GLUHFWO\WR&KLQD7KDWVWLOOOHDYHVDJDS in  demand  in  China. 66

65.indd 66

FEB / MAR 2020

Celebrating  the  excellence  in  eco-­responsible  packaging   design  across  the  world

Who  can  participate?   7KH$ZDUGLVGLUHFWHGWRZDUGVVWXGHQWVGHVLJQHUVHQJLQHHUVPDNHUVFUHDWRUV LQYHQWRUVDUWLVWV(YHU\RQHZKRKDVDQLGHDFRQFHSWSURMHFWSURWRW\SHRU even  a  solution  already  in  market  which  supports  less  plastic  packaging.  It  can   HLWKHUEHDQHQWU\ZKLFKUHSODFHVDQH[LVWLQJHQYLURQPHQWDOO\QRQUHVSRQVLEOH package  or  it  can  be  a  completely  new  solution. 7KHHQWULHVZLOOEHMXGJHGDQGVHOHFWHGE\DMXU\SDQHODQGWKHZLQQHUVZLOOEH announced  and  celebrated  at  the  Award  Ceremony  in  May  2020.   Beyondplastic.net  is  a  global  initiative  dedicated  to  reduce  the  use  of  single-­ XVHSODVWLFSURGXFWVWRGHFUHDVHSODVWLFSROOXWLRQ,QLWODXQFKHGDVDQ online  platform  for  environmentalists,  packaging  designers  &  engineers  and   FRPSDQLHVWRSUHVHQWDQGH[FKDQJHLGHDVFRQFHSWVDQGSURGXFWVRIHFR responsible  packaging  solutions.   www.beyondplastic.net For  details  how  to  participate  go  to

BASFâ&#x20AC;&#x2122;s light stabilizer protects playground slides from UV light Improves  strength,  antistatic  performance  of  polyethylene  slides BASFâ&#x20AC;&#x2122;s  light  stabilizer  TinuvinÂŽ  has  been  adopted  by  Suiko  Co  Ltd  in  Japan,   to  make  rotationally-­moulded  low-­density  polyethylene  (LDPE)  playground   slides,  complete  with  UV  stabilised  and  antistatic  properties.  Suiko  added   Tinuvin  to  the  polymer  resin  in  the  slide  to  provide  UV  stabilization  and  to   ensure  that  the  colour  of  the  playground  slide  remains  bright  and  colourful   for  years  to  come.  Hiroyuki  Sakaki,  head  of  R&D  at  Suiko,  said,  â&#x20AC;&#x153;Our  big   challenge  was  to  maintain  not  only  the  physical  properties  of  polyethylene  but   also  the  antistatic  performance  under  such  severe  conditions.â&#x20AC;?

www.plasticadditives.basf.com

2020/02/14 14:23


Classifieds Dec/Jan'2020.indd 96

2019/11/25 09:10


Middle East.indd 68

2020/02/14 14:31


Classifieds Oct/Nov'19.indd 92

2019/09/30 10:48


DIARY

Solo  sailor  Thomas  Coville  with  his  technical   coordinator  Elie  Canivenc,  will  be  representing   Team  Sodebo  Voile

Inventor  and  genius  entrepreneur,   Franky  Zapata,  aka  â&#x20AC;&#x2DC;the  Flying  Manâ&#x20AC;&#x2122;,   will  be  one  of  the  star  speakers  at   JEC  World  2020

JEC World 2020:

Inspiring experts & exceptional $IÂżUPVJOREDOOHDGHUVKLSLQFRPSRVLWHVLQQRYDWLRQEXVLQHVVQHWZRUNLQJ FROM  leaders  to  entrepreneurs  and  high-­performance  athletes   â&#x20AC;&#x201C;  JEC  World  2020  will  welcome  an  exclusive  lineup  of  special   guests  during  the  three-­day  event  from  3-­5  March  in  Paris. Inventor  and  genius  entrepreneur,  Franky  Zapata,  aka  â&#x20AC;&#x2DC;the   Flying  Manâ&#x20AC;&#x2122;,  will  be  one  of  the  star  speakers  at  JEC  World   2020.  As  the  CEO  and  founder  of  the  company  that  bears   his  name,  he  became  well-­known  for  his  famed  crossing  of   the  English  Channel  in  August  2019  on  his  FlyboardÂŽ  Air.  His   keynote  speech,  â&#x20AC;&#x2DC;Back  to  the  Future:  Flying  Man  Becoming   Real  â&#x20AC;&#x201C;  How  I  Built  the  Flyboardâ&#x20AC;&#x2122;  will  undoubtedly  be  one  of   the  highlights  of  the  show. Representatives  from  major  industries  that  use  composites   will  also  be  in  attendance,  including  HervĂŠ  Gilibert,  CTO  of  

ArianeGroup,  who  will  lead  a  conference  for  the  aerospace   sector  titled  â&#x20AC;&#x2DC;Towards  a  More  Sustainable  Strategyâ&#x20AC;&#x2122;.  Alan   Banks,  UK  innovations  supervisor  at  Ford  Motor  Company,   will  deliver  his  keynote  speech  regarding  the  automotive   sector,  â&#x20AC;&#x2DC;The  Right  Material  in  the  Right  Placeâ&#x20AC;&#x2122;. High-­performance  athletes  will  also  share  their   experiences.  Some  of  the  notable  speakers  include   solo  sailor  Thomas  Coville,  together  with  his  technical   coordinator  Elie  Canivenc,  who  will  be  representing  Team   Sodebo  Voile;Íž  and  wheelchair  tennis  player  StĂŠphane   Houdet,  with  a  presentation  titled:  â&#x20AC;&#x2DC;The  Composites  Trifecta:   Design  Flexibility,  Performance  and  Comfortâ&#x20AC;&#x2122;. The  composite  materials  industry  will  be  well-­represented  

JEC World 2020 unveils â&#x20AC;&#x153;The JEC Composites Industry Programsâ&#x20AC;? JEC  World  is  presenting  the  JEC   Composites  Industry  Programs,  a  range   of  conferences  and  discussion  groups   bringing  together  the  decision-­makers   of  the  end-­users  industries  from  around   the  world.  This  year,  the  sessions   will  focus  on  the  on  the  automotive,   aerospace,  and  sports  &  health   industries,  and  cover  all  issues  relating   to  composites  in  these  strategic  sectors. Each  day,  industry  decision-­makers   70

DIARY-.indd 70

using  composites  will  come  together   to  discuss  the  latest  developments   in  composites  in  their  respective   VHFWRUV/DUJHLQWHUQDWLRQDOÂżUPVOLNH ArianeGroup,  GE  Aviation,  Embraer,   VoltAero,  Ford  Motor  Company,  the   Renault-­Nissan-­Mitsubishi  alliance,   Porsche,  Volkswagen,  Corima,  Look   Cycle  or  Ă&#x2013;ssur  will  be  presenting  their   solutions. The  purpose  of  these  sessions  is  to  

share  with  these  decision-­makers  the   latest  trends  and  innovations  in  the   entire  value  chain  of  composites. Through  the  â&#x20AC;&#x2DC;Executive  Guided   Toursâ&#x20AC;&#x2122;,  selected  participants  will  be   able  to  explore  the  subjects  addressed   in  exclusive,  made-­to-­measure  visits   to  the  trade  fair  and  the  Innovation   Planet  of  each  sector,  punctuated  by   encounters  with  innovative  exhibitors. www.jec-­world.events

FEB / MAR 2020

2020/02/14 14:18


Com in up g Technical conference on PVC industry trends Wheelchair tennis  player,  Stéphane   Houdet,  will  give  a  presentation  titled:   ‘The  Composites  Trifecta:  Design   Flexibility,  Performance  and  Comfort’

keynote speeches by Marcio  Sandri,  president  of  the  Composite  Materials  business  unit  at  Owens   Corning,  with  his  keynote  speech  titled  ‘Reframing  Glass’  Role  in  Infrastructure’.   Carmelo  Lo  Faro,  president  of  the  composite  materials  business  unit  at  Solvay,   will  deliver  a  presentation  titled  ‘The  Industrialization  Era’. Finally,  architect  Maximiliano  Arrocet,  one  of  the  directors  at  award-­winning   architecture  and  design  studio  AL_A,  will  share  his  vision  of  nanocomposites   for  the  architecture  industry  in  collaboration  with  Ed  Clarke,  associate  director   at  Arup. Cutting-­edge  technical  conferences  over  the  three-­day  event  include  ‘Mixing   Materials,  Technologies  and  Robots  in  an  Automated  Composite  Production’,   µ&RPSRVLWHVDQGWKHLU)RUPLQJ3URFHVVHVLQWKH(UDRI'DWDDQG$UWL¿FLDO Intelligence:  Composite  Twins’,  and  ‘How  to  Design  and  Print  a  4-­metre  long   Structural  Pedestrian  Bridge’. www.jec-­world.events

Plastics shows in China cancelled due to coronavirus

The 12th  Africa  Energy  Indaba  which   takes  place  from  3-­4  March  at  the   Cape  Town  International  Convention   Centre  has  assembled  the  leaders   and  key  stakeholders  in  the  energy   sector  for  the  continent’s  annual   energy  event.  As  per  the  latest  report   from  the  International  Energy  Agency   (IEA),  Africa  is  experiencing  the  fastest   progression  of  urbanisation  the  world   over.  The  report  states  that  cumulative   investments  of  $2.6  trillion  are  required   between  2019  and  2040  to  meet  this   rising  energy  demand  and  provide   more  accessible  energy  facilities  to   African  citizens. Created  around  the  2020  theme,   “African  Energy  –  Catalysing   Investment  and  Business   Opportunities”,  the  newly  released   2020  Conference  Programme  is  set   to  establish  the  ideal  platform  to   discuss  how  Africa  can  accelerate  the   development  of  energy  infrastructure   and  projects  to  meet  the  demand  for   energy  on  the  continent.           www.africaenergyindaba.com  

71

DIARY-.indd 71

Africa Energy Indaba 2020

FEB / MAR 2020

DUE to  the  banning  of  mass  gatherings  in  China  to  prevent  the  spread  of   the  Wuhan  coronavirus,  Chinaplas  2020  and  Asia  Rubber  &  Plastics  Expo   2020  will  be  postponed.   Chinaplas  was  scheduled  to  be  held  on  21-­24  April  at  National  Exhibition   and  Convention  Centre  in  Shanghai.  New  dates  for  the  show  will  be   announced  at  a  later  time. The  Asia  Rubber  &  Plastics  Expo  2020  was  to  be  held  from  19-­21  March at  the  Shenzhen  Convention  &  Exhibition  Centre.

THE only  annual  technical  conference   focussed  on  PVC  industry  trends,   recipes,  compounding  and  technical   developments  is  returning  from   24–26  February  at  the  Dorint  An  der   Messe  Hotel  in  Cologne,  Germany.   PVC  Formulation  2020  offers  a  forum   for  PVC  chemists,  compounders,   converters,  suppliers  of  additives,   materials  and  technology  as  well  as   industry  associations  to  discuss  the   RSWLPLVDWLRQRIULJLGDQGÀH[LEOH39& formulations.   In  addition  to  unique  networking   opportunities,  PVC  Formulation   provides  a  comprehensive  session  on   market  trends,  features  developments   in  rigid  PVC  across  various   applications  and  discusses  the  impact   of  legislation  on  materials,  applications   and  the  supply  chain.  Industry   experts  will  cover  market  trends  in   additives,  advances  in  plasticisers,   and  cover  how  to  improve  processing,   performance  and  durability  of  PVC   compounds.                        

2020/02/14 14:18


DIARY

72

FEB / MAR 2020

Coming up

Cables conference celebrates its 20th anniversary!

DIARY-.indd 72

Top  players  from  across  the  entire   cable  supply  chain  will  be  discussing   the  latest  trends  and  developments   at  Cables  2020,  AMIâ&#x20AC;&#x2122;s  20th  annual   Cables  conference.  With  the  demand   for  cables  continuously  growing  this   is  a  must  attend  event  taking  place   on  3-­5  March  at  the  Crown  Plaza  in   Düsseldorf,  Germany. The  growth  of  the  cable  industry   continues  to  be  strongly  affected  by  key   investment  sectors  such  as  infrastructure,   construction  and  transportation.  While   the  increasing  requirements  on  cablesâ&#x20AC;&#x2122;   technical  performance,  together  with   a  move  towards  renewable  energies,   e-­mobility  and  digitalisation  continue  to   shape  the  future  of  this  industry.  Overall,   the  current  market  environment  creates   opportunities  and  challenges  throughout   this  high  demanding  industry,  and  it  is   essential  for  the  companies  involved  to   be  aware  of  the  latest  developments  in   markets,  materials,  testing,  regulation,   process  technologies  and  end-­use   applications.                  www.ami.international                   TH

7 International Seminar on Biopolymers & Sustainable Composites

THE  Plastics  Technology  Centre   will  hold  the  seventh  edition  of  its   International  Seminar  on  Biopolymers   and  Sustainable  Composites  from   4-­5  March,  where  more  than  20   speakers  will  discuss  trends  in   biopolymers.  The  seminar  will   address  developments  in  materials,   current  legislation  and  other  topics   VXFKDVHFRODEHOVDQGFHUWL¿FDWLRQV In  addition,  a  full  day  will  be  dedicated   WRELRWHFKQRORJ\DQGELRUH¿QHULHV Various  topics  will  be  discussed  at   this  long-­standing  seminar,  which  is   highly  regarded  within  the  sector.  These   include  trends  in  biodegradable  plastic   materials  and  plastic  materials  obtained   from  renewable  sources;;  innovations   in  biotechnology  and  the  sustainable   waste  recovery  options  offered  by   these  materials;;  and  developments  in   VWDQGDUGL]DWLRQFHUWL¿FDWLRQDQGOLIH cycle  assessment  (LCA).  Attendees  will   also  hear  success  stories  from  leading   companies.                              www.aimplas.net

Africaâ&#x20AC;&#x2122;s energy is focus of AEI PREVALENT  topics  with  particular   reference  to  Africaâ&#x20AC;&#x2122;s  energy  sphere,   are  set  to  form  the  core  of  discussions   at  the  12th  Africa  Energy  Indaba  from   3â&#x20AC;&#x201C;4  March  at  Cape  Town  International   Convention  Centre,  Cape  Town. Various  thought-­provoking  session   themes  involve  the  following: What  African  energy  ministers  are   doing  to  stimulate  investment  in  the   energy  sectors  of  their  countries?   African  leaders  are  proactively  striving   to  improve  aspects  relating  to  three  core   dimensions:  energy  security,  energy   equity  (accessibility  and  affordability),   and  environmental  sustainability  of   energy  systems,  all  of  which  require  

funding.  The  upcoming  event  will   unpack  integrated  strategic  endeavours   that  governments  plan  to  implement  to   RIIHUVLJQL¿FDQWFDWDO\WLFUDPL¿FDWLRQV for  long-­term  investment  prospects   across  Africaâ&#x20AC;&#x2122;s  energy  sectors. In  an  effort  to  reduce  national   emissions  and  decrease  their  reliance   on  energy  imports  whilst  increasing   clean  air  in  cities  and  towns,  African   nations  will  inevitably  observe  a   considerable  shift  in  the  transport  sector   and  the  Africa  Energy  Indaba  is  set  to   delve  into  the  details  of  such.  Moreover,   Africaâ&#x20AC;&#x2122;s  decarbonisation  endeavours,   driven  by  the  environmental   sustainability  agenda,  is  shifting  the  

Propak West Africa

PROPAK  West  Africa  welcomes  the  new  decade  with  plans  for  the  eighth  edition  to   be  the  biggest  one  yet  having  almost  completely  sold  out.    2019  saw  Propak  West   Africa  in  its  most  successful  edition  to  date.  An  impressive  89%  of  exhibitors  said   they  achieved  their  goals  at  the  exhibition.   Propak  West  Africa  is  the  regionâ&#x20AC;&#x2122;s  largest  exhibition  and  conference  dedicated  to   the  rapidly  expanding  sectors  of  packaging,  plastics,  printing  and  food  processing.   Taking  place  in  West  Africaâ&#x20AC;&#x2122;s  economic  hub;;  Lagos,  Nigeria,  the  exhibition  will  be   held  between  the  15â&#x20AC;&#x201C;17  September  at  the  Landmark  Centre.  

2020/02/14 14:19


Clariant  HYDROCEROL  CFA   masterbatches  cut  plastics   content  in  packaging  by  10%

sphere 2020

gears up for massive 2020

73

there  are  multiple  divergent  ground-­ Adopting  technology,  cultivating  talent   breaking  discussions  to  be  presented   across  the  generations  and  encouraging   by  relevant  luminaries  of  the  energy   digital  skills  acquisition  are  fundamental   realm,  incorporating  the  recent  and   IDFWRUVWRHQKDQFLQJHI¿FLHQF\ZLWKLQ profound  African  Continental  Free   the  energy  sector.  Well-­versed  industry   Trade  Agreement  (AfCFTA)  as  well   leaders  attending  the  event,  will   as  the  opportunities  associated  with   impart  their  knowledge  of  opportunity   development  and  management  of  related   Independent  Power  Producers  (IPPs).     AP AD-13.5x9.5cm.ai 1 04-Feb-20 2:38:44 PM threats  whilst  proactively  implementing   www.africaenergyindaba.com strategies  to  fortify  competitive  advantage   DQGERRVWSUR¿WV through  the   digitalisation  of   operations  within   the  landscape   that  is  energy.   In  addition,  

FEB / MAR 2020

energy  mix  at  an  accelerated  pace,  to   a  point  that  is  predicted  to  position  gas   ahead  of  coal  by  2030.  This  yearâ&#x20AC;&#x2122;s  event   is  set  to  reveal  the  intricacies  concerning   this  exciting  phase  of  transformation  and   disruption  transpiring  in  Africa. The  prevalent  energy  transition  is  also   expected  to  generate  broader  socio-­ HFRQRPLFEHQH¿WVLQFOXGLQJWKHLPSDFW of  expenditure  in  human  capital  and   education,  reduced  health  impacts  from   air  pollution,  reduction  of  greenhouse  gas   (GHG)  emissions  and  depletion  of  natural   resources.  Discussions  will  centre  around   how  such  socio-­economic  impacts  of   the  energy  transition  will  be  converted  to   acceptable  outcomes.

C

M

September  2020  will  mark  the  showâ&#x20AC;&#x2122;s  8th  edition  and  is   Y expected  to  welcome  more  than  5  000  key  industry  stakeholders   CM and  more  than  200  leading  industry  brands  as  they  showcase   MY their  products  and  services.  Propak  West  Africa  is  set  to  grow   LQQHWVSDFHPDNLQJWKHÃ&#x20AC;RRUSODQDUHPDUNDEOHP2CY.   But  thatâ&#x20AC;&#x2122;s  not  all  thatâ&#x20AC;&#x2122;s  new  this  year.  Propak  West  Africa   KDVKDGDPDNHRYHUUHÃ&#x20AC;HFWLQJWKHJURZWKDQGGHYHORSPHQWCMY of  the  largest  packaging,  plastics,  food  processing,  labelling  K and  print  exhibition  in  the  West  African  Region.  Later  in  the   year,  a  brand-­new  website  will  be  rolled  out  and  organisers   will  introduce  the  brand  new  Propak  West  Africa  Connect  App.   The  new  app  will  effectively  serve  as  a  matchmaking  tool  for  all   exhibitors  and  visitors.  All  registered  users  will  be  able  to  pre-­ organise  meetings  with  every  exhibitor,  visitor  and  speaker,  as   well  as  earmark  conferences  theyâ&#x20AC;&#x2122;d  like  to  attend  and  create   a  personal  schedule  to  maximise  their  time  at  the  event.   This  yearâ&#x20AC;&#x2122;s  line-­up  of  exhibiting  brands  will  include  Sasol   as  platinum  sponsors  for  the  event  in  addition  to  Atlas  Copco,     Beaumont  Aromatic  and  SkySat  Technologies.   www.propakwestafrica.com

DIARY-.indd 73

2020/02/14 14:19


DIARY Printpack Alger 2020 EXCELLENT  prospects  await  visitors  of   Printpack  &  Plast  Alger  2020  as  more   than  220  of  the  worldâ&#x20AC;&#x2122;s  leading  companies   will  again  be  presenting  products  and   WHFKQRORJLHVVSHFL¿FDOO\WDLORUHGWRWKH Algerian  and  regional  market. The  6th  International  Printing,   Packaging  &  Plastics  Trade  Show  takes   place  at  the  Centre  International  de   Conférences  Abdelatif  Rahal  CIC  in   Algiers  from  9-­11  March.  Exhibitors   from  19  countries  are  expected  and  a   conference  will  be  held  simultaneously,   titled  â&#x20AC;&#x2DC;Current  challenges  for  the  print   and  packaging  sector  in  Algeria  and  the   Maghrebâ&#x20AC;&#x2122;.                www.printpackalger.com

Coming up

Plastics Regulations 2020 PLASTICS  Regulations  2020  in   Cologne,  Germany  from  11-­12  March   is  a  two-­day  conference  from  AMI   which  will  provide  an  ideal  environment   for  regulatory  updates.  Companies   and  brand  owners  discuss  the  latest   developments  in  compliance  and   regulation  to  ensure  the  most  effective   ways  to  protect  your  business.                      www.ami.international.com/events

Injection moulding event in Chicago in March THE  Molding  Conference,  a  conference   that  focusses  exclusively  on  injection   moulding,  is  to  be  held  in  Chicago,  USA,   from  17-­19  March,  making  it  the  30th   edition  of  the  event  â&#x20AC;&#x201C;  and  one  of  the  longest   running  such  events  in  the  industry  globally.   7KH¿UVWHGLWLRQZDVLQWKH0ROGLQJ Conference  has  been  the  gathering  point   for  thought  leaders  in  the  injection  moulding   sector  in  the  US  to  discuss  where  the   technology  is  and  where  itâ&#x20AC;&#x2122;s  headed. The  showâ&#x20AC;&#x2122;s  at  the  Westin  Chicago  in   Lombard,  Illinois.                                    www.moldingconference.com

Plastics Recycling Show Europe in March THE  Plastics  Recycling  Show  Europe   show  is  to  take  place  at  the  RAI,   Amsterdam,  on  25-­26  March.  The   free-­to-­attend  conference/exhibition   will  have  the  biggest  names  in  recycled   materials,  recycling  machinery  and   services  on  display,  showing  the  latest   innovation  from  this  exciting  industry. 74

DIARY-.indd 74

DuPont introduces

for advanced

New  products  address  needs  in  5G DUPONT  Interconnect  Solutions  has   introduced  several  new  products   across  its  DuPontâ&#x201E;¢  Pyralux®  and   Riston®  product  families  to  address   a  diverse  set  of  needs  for  both  the   manufacture  and  performance  of   advanced  electronics  devices.  DuPont   showcased  these  new  products   and  many  other  innovations  at  the   IPC  APEX  tradeshow  in  San  Diego,   California,  from  4-­5  Feb.

DuPontâ&#x20AC;&#x2122;s  newest  product   innovations  include: â&#x20AC;¢   Pyralux®  AG  â&#x20AC;&#x201C;  an  all-­polyimide   double  sided  copper  clad  laminate   that  is  offered  in  both  sheets  and   rolls  with  global  availability  and   is  ideal  for  use  in  high  volume   consumer,  medical  and  automotive   applications. ®   Pyralux  GPL  â&#x20AC;&#x201C;  an  adhesive  that  is   â&#x20AC;¢ VSHFL¿FDOO\IRUPXODWHGIRUKLJK

Sensor-based sorting systems at Plast Combines  material  and  colour  perception  in  one  machine TOMRA  Sorting  Recycling  exhibited  its  sensor-­based  sorting  systems  and  latest   technologies  at  Plast  Eurasia  Istanbul,  the  largest  plastics  industry  exhibition  held   in  December. Plast  Eurasia  brought  together  exhibitors  from  45   countries  and  approximately  60  000  professional   visitors  from  105  countries  at  Istanbul  Tüyap  Fair   and  Congress  Centre.  TOMRA  Sorting  Recycling   exhibited  its  Innosort  Flake  sorting  machine  and   performed  tests  with  real  materials  from  PET   recycling  facilities  at  the  fair. Underlining  that  technologies  such   as  TOMRAâ&#x20AC;&#x2122;s  sorting  solutions   are  essential  to  achieve  a  truly   circular  economy  by  eliminating   waste  and  reusing  limited   natural  resources.  The  Innosort   Flake  machine  was  launched   in  March  2019,  and  has  received   great  interest  from  customers  in  Turkey.   Innosort  Flake  combines  material  and   colour  perception  in  one  machine  and   is  able  to  detect  different  polymers,   including  PET,  PVC,  PP,  PE  and   metal  by  means  of  2mm  polymer   detection.  This  enables  the  

FEB / MAR 2020

2020/02/14 14:19


new materials electronics devices â&#x20AC;¢ 5LVWRQ®',±KLJKGHQVLW\

'X3RQW,QWHUFRQQHFW6ROXWLRQVEULQJVD GHHSXQGHUVWDQGLQJRIPDWHULDOVVFLHQFH WRWKHSULQWHGFLUFXLWERDUG 3&% PDUNHW,W SURYLGHPDWHULDOVWKDWVXSSRUWDOODVSHFWV RI3&%PDQXIDFWXULQJIRUPDQ\W\SHVRI 3&%VVLQJOHRUGRXEOHVLGHGERDUGVDQG Ã&#x20AC;H[LEOHULJLGÃ&#x20AC;H[RUULJLGFRQ¿JXUDWLRQV

75

LQWHUFRQQHFW¿OPIRUSULQWDQGHWFK SURFHVV+LJKUHVROXWLRQDQGDGKHVLRQ FRPELQHGZLWKH[FHOOHQWODPLQDWLRQ FRQIRUPDWLRQHQVXUHVKLJK\LHOGV )DVWSKRWRVSHHGDWPXOWLSOH/', ZDYHOHQJWKVHQVXUHVKLJKSURGXFWLYLW\

FEB / MAR 2020

VSHHGKLJKIUHTXHQF\Ã&#x20AC;H[LEOHFLUFXLW DSSOLFDWLRQVLWKDVRXWVWDQGLQJWKHUPDO UHVLVWDQFHSHHOVWUHQJWKDQG89ODVHU GULOOLQJSURFHVVFDSDELOLW\ ®  5LVWRQ ',±PXOWLZDYHOHQJWK â&#x20AC;¢ GU\¿OPSKRWRUHVLVWIRUSDWWHUQSODWLQJ RQPXOWLOD\HUERDUGV+LJKDGKHVLRQ DQGFKHPLFDOUHVLVWDQFHGHOLYHUV\LHOG E\HOLPLQDWLQJOLIWLQJDQGEUHDNGRZQ GHIHFWVLQFRSSHUWLQRUJROG â&#x20AC;¢ 5LVWRQ®',±RSWLPXPVROXWLRQIRU WKHP6$3SURFHVV0DGHIRUVPRRWK FRSSHUKLJKDGKHVLRQRQLVRODWHGUHVLVW OLQHVWKLV¿OPGHOLYHUVWKHXOWLPDWHKLJK GHQVLW\FLUFXLWVPDGHWRGD\

Eurasia in Istanbul UHPRYDORIHYHQQRQSRO\PHULPSXULWLHVDQGSURYLGHVKLJK SXULW\FOHDQ3(7Ã&#x20AC;DNHV www.dupont.com

 â&#x20AC;¢  2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU%$6)

RQ738(ODVWROODQ®7KHUPRSODVWLF3RO\XUHWKDQH

 â&#x20AC;¢  2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU(ODVWURQ RQ73(739(ODVWURQ®6(%6DQG(3'033

 â&#x20AC;¢  2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU   &*)6(RQ)6(®  )OXRURHODVWRPHUVDQG   3HUÃ&#x20AC;XRURHODVWRPHUV

&3(  â&#x20AC;¢  'LVWULEXWRUIRU:HLIDQJRQ:HLSUHQ   â&#x20AC;¢  6XSSOLHUVRI(369DULRXV*UDGHV â&#x20AC;¢  (QJLQHHULQJ3RO\PHUV â&#x20AC;¢  3RO\ROH¿QV â&#x20AC;¢  5HZRUNHGDQG5HSDOHWLVHG0DWHULDOV â&#x20AC;¢    2I¿FLDOGLVWULEXWRUIRU3ROLWHPRQ3$3$ ®

XQ¿OOHGDQG¿OOHGFRPSRXQGV

DIARY-.indd 75

2020/02/14 14:20


Coming up

DIARY

Recycling Awards

?WZTL8WTaWTMĂ&#x2026;V[+WVNMZMVKM

The  Plastics  Recycling  Awards  Europe   2020,  which  are  open  to  organisations   and  individuals  throughout  Europe,  will  be   presented  at  PRS  Europe  in  March.  The   seven  award  categories  are  Automotive,   Electrical  or  Electronic  Product;Íž  Building   &  Construction  Product;Íž  Household   &  Leisure  Product;Íž  Plastic  Packaging   Product;Íž  Product  Technology  Innovation;Íž   Recycling  Machinery  Innovation  and   Plastics  Recycling  Ambassador. Âł7KHÂżUVWWZRHGLWLRQVRIWKHDZDUGV witnessed  an  impressive  number  and   FDOLEUHRIHQWULHV7KLVLVDWHVWDPHQW to  todayâ&#x20AC;&#x2122;s  outstanding  innovation  and   continuous  progress  towards  circular   economy  in  the  plastics  recycling   sector,â&#x20AC;?  said  Ton  Emans,  PRE  president. )RUYLGHRKLJKOLJKWVRIWKH3ODVWLFV Recycling  Awards  Europe  2019  visit:                                      https://youtu.be/sltM6NjiLUk                                            www.prseventeurope.com

7+(QLQWK:RUOG3RO\ROHÂżQV&RQIHUHQFHWDNHVSODFHIURP$SULODWWKH5LW] Carlton  in  Vienna,  Austria. +RZKDYHJOREDOHFRQRPLFFRQGLWLRQVDIIHFWHGWUDGHG\QDPLFVDFURVVWKH ZRUOG"+RZKDV&KLQDÂśVSRVLWLRQLQWKHSRO\ROHÂżQVPDUNHWVKLIWHGLQOLJKWRIWDULIIV and  investments  in  the  region?  Are  you  up  to  date  with  the  market  opportunities   IRUUHF\FOHGSRO\ROHÂżQV" ,QDG\QDPLFWLPHIRUWKLVIRUZDUGIDFLQJLQGXVWU\WKH:RUOG3RO\ROHÂżQV &RQIHUHQFHLV\RXUVRXUFHIRUWKHODWHVWPRVWUHOHYDQWPDUNHWLQVLJKWDQGD PHHWLQJSODFHIRUWKHIXOOYDOXHFKDLQWRJDWKHUDQGFROODERUDWH7KHVHTXHVWLRQV and  so  much  more  will  be  addressed  at  this  yearâ&#x20AC;&#x2122;s  event.              www.icisevents.com

Epoxy & Resins Technology Africa 2020 Conference 7+((SR[\DQG5HVLQV7HFKQRORJ\$IULFD &RQIHUHQFH([KLELWLRQ :RUNVKRS WDNHVSODFHIURP25-­27  March  at   Emperorsâ&#x20AC;&#x2122;  Palace  Hotel  in  Johannesburg.   )RUWKHÂżUVWWLPHLQ$IULFD6-*&DSLWDO will  be  hosting  the  Epoxy  &  Resins   &RQIHUHQFH([KLELWLRQ :RUNVKRSWR SURPRWHWKHGHYHORSPHQWRIWKHHSR[\ resin  industry  and  its  applied  technologies   LQ$IULFD7KHFRQIHUHQFHZLOODOORZ companies  to  present  their  products  as   ZHOODVEHWWHUXQGHUVWDQGWKH$IULFDQ market  and  meet  potential  customers   and  suppliers.  Delegates  will  learn  on  the   new  developments  in  composites  use,   new  applications,  current  innovations  in   WKHLQGXVWU\DQGWKHIXWXUHFKDOOHQJHVLQ epoxy  and  resins  technology.   Presentations  will  cover  topics  such   as  application  status  and  development   SURVSHFWVRIJHQHUDODQGVSHFLÂżFHSR[\ UHVLQVPDUNHWDQDO\VLVRIHSR[\UHVLQV new  techniques  and  products  relating  to   adhesives,  coatings,  pouring  materials,   casting  materials,  plastic  packaging   materials  and  compound  materials;Íž  and   an  introduction  to  new  techniques  and   products  on  curing  agents,  accelerators,   GLOXHQWVDGGLWLYHVPRGLÂżHUVDQGÂżOOHUV â&#x20AC;˘ )RUPRUHLQIRFRQWDFW3DXOLQD Mamotselisi  on  011  052  2330 76

DIARY-.indd 76

Machine Tools Africa +,*+3(5)250$1&(PDFKLQHWRROVWRXFKHYHU\DVSHFWRIRXUOLYHV,QIDFW WKHZRUOGPD\VWRSWXUQLQJZLWKRXWWKHP0DFKLQH7RROV$IULFDZKLFKWDNHV SODFHIURP0D\DWWKH-RKDQQHVEXUJ([SR&HQWUHZLOOEHWKHELJJHVWWUDGH H[KLELWLRQRILWVNLQGLQ$IULFDDQGDVKRZFDVHRIHYHU\WKLQJWKDWWZLVWVWXUQV URWDWHVFXWVIRUPVEHQGVRUVKDSHV,WœVWKHVKDSHRIWKLQJVWRFRPH                                                         ZZZPDFKLQHWRROVDIULFDFR]D

Recovered Carbon Black )2//2:,1*WKHRYHUZKHOPLQJVXFFHVVRIWKHODXQFKLQRI5HFRYHUHG &DUERQ%ODFNWKHVHFRQGHGLWLRQRIWKHHYHQWWDNHVSODFHIURP0D\ LQ%HUOLQ*HUPDQ\7KHRUJDQLVHUVDUHORRNLQJIRUWKRVHDWWKHIRUHIURQWRI innovation  to  share  their  latest  research,  insights  or  case  studies  to  an  audience   RIFDUERQEODFNW\UHUXEEHUSODVWLFVFRPSRXQGVDQGLQNLQGXVWU\SURIHVVLRQDOV                                        www.carbonblackworld.com

2020 ,&,6$VLDQ5HF\FOLQJ&RQIHUHQFH )HEUXDU\ Bangkok,  Thailan            www.icisevents.com/asianrecycling :RUOG3XOWUXVLRQ&RQIHUHQFH)HEUXDU\ Antwerp,  Belgium   www.pultruders.com $IULFD(QHUJ\,QGDED 0DUFK &7,&&&DSH7RZQ ZZZDIULFDHQHUJ\LQGDED com &RPSODVW6RXWK$IULFD 0DUFK *DOODJKHU(VWDWH-RKDQQHVEXUJ www.smartexpos.in %LRSRO\PHUV 6XVWDLQDEOH&RPSRVLWHV0DUFK Valencia,  Spain   www.aimplas.es Printpack  Alger  2020                                                          9-­11  March GÂľ$OJHU$EGHODWLI5DKDO&,&ZZZSULQWSDFNDOJHUFRP Plastics  Regulations   11-­12  March &RORJQH*HUPDQ\ZZZDPLLQWHUQDWLRQDOHYHQWV 3URSDN(DVW$IULFD 0DUFK .,&&1DLUREL.HQ\D ZZZSURSDNHDVWDIULFD com ,20)RXQGDWLRQ/HFWXUH 0DUFK Emperorsâ&#x20AC;&#x2122;  Palace,  Joburg   &RQWDFW:HQG\.QRWW&UDLJLRPVD#PZHEFR]D Asia  Plastic  &  Printing  Expo                              19-­21  March 6KHQ]KHQ&KLQDZZZSDFNSULQWLQJIDLUFRP SODVWSULQWSDFN1LJHULD 0DUFK Victoria  Island  in  Lagos  ,  Nigeria            www.ppp-­ nigeria.com   PRS  (Plastics  Recycling  Show)  Europe          25-­26  March Rai,  Amsterdam                          www.prseventeurope.com (SR[\ 5HVLQV7HFKQRORJ\$IULFD0DUFK Emperorsâ&#x20AC;&#x2122;  Palace  Hotel,  Johannesburg     www.sjgcapital.com   PU  Tech  India   1-­3  April New  Delhi,  India   www.putechindia.com $IULFDQ0DULQH:DVWH1HWZRUN $SULO 7KH%RDUGZDON+RWHO3RUW(OL]DEHWK ZZZDIULFDQZDVWHQHWZRUNRUJ]D :$,7(;  $SULO $FFUD*KDQD ZZZZDLWH[FRPJK

,&,6:RUOG3RO\ROH¿QV&RQIHUHQFH $SULO 5LW]&DUOWRQ9LHQQD$XVWULDZZZLFLVHYHQWVFRP Interpack  2020   ' VVHOGRUI*HUPDQ\

7-­13  May ZZZLQWHUSDFNFRP

0DFKLQH7RROV$IULFD 0D\ Expo  Centre,  Nasrec,  Johannesburg   ZZZPDFKLQHWRROVDIULFDFR]D 5HFRYHUHG&DUERQ%ODFN 0D\ %HUOLQ*HUPDQ\ZZZFDUERQEODFNZRUOGFRP 3ODVWLFV5HF\FOLQJ:RUOG([SR -XQH 0HVVH(VVHQ*HUPDQ\ ZZZDPLLQWHUQDWLRQDO 0DQXIDFWXULQJ,QGDED -XQH Sandton  Convention  Centre,  Jhb   ZZZPDQXIDFWXULQJLQGDEDFR]D Vinyls2020   12  June Emperors  Palace,  Kempton  Park   ZZZVDYLQ\OVFR]D $IULFDQ$XWRPRWLYH0IJ6\PSRVLXP -XO\ Kigali  Intâ&#x20AC;&#x2122;l  Convention  Centre,  Rwanda   ZZZDXWRDIULFDDIULFD (OHFWUD0LQLQJ$IULFD 6HSWHPEHU Expo  Centre,  Nasrec,  Johannesburg   ZZZHOHFWUDPLQLQJFR]D No  Dig  Live   Peterborough,  England  

15-­17  September www.nodiglive.co.uk

3ODVWLFV3DFNDJLQJDQG3ULQW$VLD6HSW2FW Karachi,  Pakistan   www.eventseye.com ,03&  Cape  Town  

2FWREHU www.impc2020.com

3URSDN&DSH &7,&&&DSH7RZQ

2FWREHU ZZZSURSDNFDSHFR]D

7UHQFKOHVV$VLD Kuala  Lumpur,  Malaysia  

1RYHPEHU www.trenchlessasia.com

2021 3/$67 Milan,  Italy     NPE     2UODQGR)ORULGD86$

0D\ www.plastonline.org  17-­21  May  2021 ZZZQSHRUJ

FEB / MAR 2020

2020/02/14 14:20

Clas


Com in up g

Manufacturing Indaba THE  annual  Manufacturing  Indaba  will  be  hosted  at  the   Sandton  Convention  Centre  in  Johannesburg  on  9-­10  June.   The  two-­day  event  has  shown  impressive  growth  year  on  year   and  has  proved  its  value  in  catalyzing  business  connections  and   helping  manufacturers  to  innovate  and  grow  their  potential. The  aim  of  the  annual  Manufacturing  Indaba  and  its   provincial  roadshows  is  to  bring  together  manufacturers,   LQGXVWU\OHDGHUVJRYHUQPHQWRI¿FLDOVFDSLWDOSURYLGHUVDQG professional  experts  to  explore  opportunities  and  grow  their   PDQXIDFWXULQJRSHUDWLRQV7KHHYHQWLVGHVLJQHGVSHFL¿FDOO\ for  private  and  public  company  representatives  to  hear  from   LQGXVWU\H[SHUWVDVWKH\XQSDFNFKDOOHQJHVDQG¿QGVROXWLRQV for  growth  across  the  manufacturing  sectors  and  explore   regional  trade  into  Africa.      www.manufacturingindaba.co.za

African Automotive Manufacturing Symposium (AAMS) .,*$/,5ZDQGDKDVEHHQLGHQWLÂżHGDVWKHKRVWIRUWKHLQDXJXUDO annual  African  Automotive  Manufacturing  Symposium  aimed   at  facilitating  the  development  of  an  intra-­African  automotive   manufacturing  supply  chain.  The  event  takes  place  at  the  Kigali   International  Convention  Centre  in  Rwanda,  from  22-­23  July. This  ministerial  level  symposium,  which  is  endorsed  by   the  African  Union,  will  facilitate  outcomes  based  dialogue   between  key  role-­players  concerned  with  Africaâ&#x20AC;&#x2122;s  automotive  

industrialisation  and  the  journey  towards  sustainable   economic  growth. According  to  Inkanyezi  Events  CEO  Andrew  Binning,   the  symposium  is  unique  in  its  focus  on  actual  automotive   manufacturing. â&#x20AC;&#x153;The  rise  of  income  levels  in  many  African  countries  and  the   HPHUJHQFHRIDPLGGOHFODVVPDNHV$IULFDWKHÂżQDOIURQWLHUIRU the  global  automotive  industry,â&#x20AC;?  said  Binning. â&#x20AC;&#x153;What  is  essential  is  that  regional  integration  is  developed   to  ensure  that  manufacturing  capability  and  jobs  are  created   LQ$IULFDQFRXQWULHVDQGWKDWWKHFRQWLQHQWLVWKHEHQHÂżFLDU\RI this  market  opportunity,  and  not  simply  a  dumping  ground  for   used  or  cheap  imported  vehicles,â&#x20AC;?  he  added. Trade  and  Investment  Ministers  from  relevant  African   countries  will  present  their  policies,  goals  and  plans  for  the   future  of  the  automotive  and  manufacturing  industry,  while   automotive  and  investment  organisations  will  share  ways  in   which  they  would  support  these  plans,  Binning  said.                  www.autoafrica.africa

Propak Cape 2020 in October VISITORS  to  Propak  Cape  2020,  from  20-­22  October  at  the   Cape  Town  International  Convention  Centre,  will  have  one   PDLQJRDOLQPLQGWR¿QGSURGXFWVDQGVHUYLFHV,I\RXZDQWWR generate  sales,  gain  valuable  sales  leads,  develop  business   connections  and  ultimately  grow  your  business  in  the  Western   Cape,  you  need  to  be  there!                                    www.propakcape.co.za FEB / MAR 2020

77

9LN5V

/07:Âś.77:Âś,7:Âś

763@:;@9,5,!.77:,7:/07:

With  35  yearsâ&#x20AC;&#x2122;  experience  in  supplying  engineering  polymers  to  the  industry,  our  logistics  &  technical  backup   -69(33(7730*(;065: Âś():Âś:(5Âś(*9@30*Âś(*,;(3 provide  the  highest  level  of  service  and  support. Âś5@365Âś7);Âś7*Âś:)*Âś /+7,Âś33+7,Âś,=(Âś77 ABS  â&#x20AC;&#x201C;  Polylac MABS  â&#x20AC;&#x201C;  Polylac ASA  â&#x20AC;&#x201C;  Kibilac SAN  â&#x20AC;&#x201C;  Kibisan GPPS  â&#x20AC;&#x201C;  Taitarex  /  Denka  /  Polyrex  /  Supreme Q-­RESIN  â&#x20AC;&#x201C;  Kibiton  /  Denka 7:Âś():Âś(*9@30*Âś7* HIPS  â&#x20AC;&#x201C;  GPPC  /  Supreme 5@365Âś77Âś/+7,Âś3+7, EPS  â&#x20AC;&#x201C;  Taitacell  /  King  Pearl  PMMA  â&#x20AC;&#x201C;  Acryrex SMMA  â&#x20AC;&#x201C;  Acrystex =(906<:=(*65;,5;: PC  â&#x20AC;&#x201C;  Wonderlite 20)0;65 PC/ABS  ALLOY  â&#x20AC;&#x201C;  Wonderloy Johannesburg Jeremy  Goosen   (T)  011  626  1030   jeremy@rawmac.co.za  

Cape Town Pam  Magill   (T)  021  933  3331/2   ct@rawmac.co.za  

+,52(

PA  6  â&#x20AC;&#x201C;  Zissloy 763@3(*051,*;06546<3+05. PA  66  â&#x20AC;&#x201C;  Gramid  /  Zissloy :/,,;,?;9<:065 POM  â&#x20AC;&#x201C;  Kocetal 20)03(* PBT  â&#x20AC;&#x201C;  Spesin 20)0:(5 EVA  â&#x20AC;&#x201C;  APC SBR/SBS  â&#x20AC;&#x201C;  Kibiton 7(7(7(Âś051,*;065 46<3+05.Âś,?;9<:065 TPV  â&#x20AC;&#x201C;  Globalene TPE  â&#x20AC;&#x201C;  Kprene 26*,;(3 330,1(5$/),//Âą:RRUL&RĂ&#x20AC;HQ&DOSHW >65+,930;, PP  GLASS  FILL  â&#x20AC;&#x201C;  Woori PE  â&#x20AC;&#x201C;  HDPE  /  LLDPE >65+,936@  (*9@9,? UREA  COMPOUND  â&#x20AC;&#x201C;  Sprea  Durban Sagree  Muthu   (T)  031  577  0505   sagree@rawmac.co.za  

www.rawmacplastics.co.za

DIARY-.indd 77 Classifieds Oct/Nov'19.indd 92

(*9@:;,?

Port Elizabeth

Glen  Kedikiloe :7,:05

(T)  041  484  3390 glen@rawmac.co.za

+LSLUL>PSSPHTZ

2020/02/14 2019/09/13 14:20 10:46


BOOKS

BASF presents â&#x20AC;&#x2DC;Material Selection N°1â&#x20AC;&#x2122; Trend  book  shows  the  latest  results  of  the  interplay  of  material  and  design IN  its  trend  book,  BASF  designfabrikÂŽ,   which  is  part  of  the  new  Creation   Centres,  presents  the  results  of  an   international  study  that  combines   current  social  trends  with  innovative   new  materials  and  design.   7KHÂżUVWWUHQGSUHVHQWHGLQWKH study  describes  an  â&#x20AC;&#x2DC;Aspirational   Societyâ&#x20AC;&#x2122;.  This  is  a  society  that  strives   for  exclusivity,  but  at  the  same  time   wants  to  act  sustainably  and  not   commit  itself  to  ownership.  The   transformation  of  such  a  society,  which   wants  to  own  everything,  to  one  which   wants  to  use  everything,  also  creates   new  demands  on  materials,  services   and  products,â&#x20AC;?  says  Alex  Horisberger,  

designfabrikŽ  Ludwigshafen,  BASF. The  trend  researchers  have   therefore  developed  a  material  that   combines  all  these  contrasts:  It  can   reproduce  textures  and  structures   individually  and  yet  shines  like  a  liquid.   A  mono-­material  special  polyamide   that  meets  sustainable  demands  and   at  the  same  time  offers  durability. The  second  trend  originated  in  India   and  describes  an  attitude  to  life  that  is   rarely  found  in  Western  society:  the  art   of  improvising.  Lack  and  need  breed   invention  and  thus  innovations  arise  from   temporary  arrangements  in  the  shortest   time.  In  our  society,  however,  lack  and   need  occur  at  completely  different,  

78

FEB / MAR 2020

Market for plastic caps New methods of and closures recycling polymers

BOOKS.indd 78

diverse  levels:  In  the  age  of  digitalization,   for  example,  the  lack  of  haptic  feedback   is  ubiquitous,  because  we  touch  smooth   display  glass  surfaces  every  day,   blank  and  without  texture.  With  a  world   ÂżUVW%$6)LVQRWRQO\EULQJLQJKDSWLF experiences  back  into  everyday  life,  but  it   also  breaks  with  what  previously  seemed   to  be  established  contradictions.  With   the  help  of  an  innovative  PU  coating,   the  natural  surface  of  the  stone  can  be   FRPELQHGZLWKOLJKWQHVVDQGĂ&#x20AC;H[LELOLW\ thus  opening  up  completely  new   design  possibilities.   www.creation-­center.basf.com

Plastics in the Environment

Ceresana  has  analysed  the  European   market  for  plastic  caps  and  closures,   from  beverages  and  food  items,   cosmetics  and  pharmaceuticals  (OTC)   to  household  chemicals  and  other   applications.  Various  subcategories   and  closure  types  are  examined  in   detail.  Ceresana  expects  an  increase  in   (XURSHDQVDOHVRIOLGVRYHUFDSVĂ&#x20AC;LSWRS closures,  dispensers,  and  other  closures   of  around  2.4%  per  year  until  2026. This  market  study   examines  the  demand   for  the  following  types   of  plastic  closures  in  22   FRXQWULHVVFUHZFDSVĂ&#x20AC;LS top  and  disc-­top  closures,   dispensers  and  sprays,  as   well  as  lids  and  overcaps.   Plastic  lids  and  overcaps   are  recording  high   growth  rates,  especially   in  the  food  sector.  A  wide   range  of  ready  meals,  which  are  often   made  for  consumption  on  the  go,  are   equipped  with  these  types  of  closures.   The  trend  towards  convenience   products  currently  leads  to  a   VLJQLÂżFDQWLQFUHDVHLQGHPDQGÂąZLWK no  end  in  sight  for  this  development.  

IDTECHEXâ&#x20AC;&#x2122;S  latest  report,   â&#x20AC;&#x2DC;Green   Technology   and  Polymer   Recycling   2020-­2030:   Technology   for  a   Sustainable   Circular   Economy   in  Plastic  Wasteâ&#x20AC;&#x2122;,  by  Dr  Bryony  Core,   presents  the  key  recycling  processes   that  are  helping  to  address  the  problem   of  waste  plastic. These  new  processes  tend  to   fall  into  three  categories:  solvent   extraction,  plastic  to  fuel  conversion  or   depolymerisation.   The  need  for  improved  waste   management  protocols  for  polymers   that  have  reached  the  end  of  their   useful  life  is  evident.  Although  some   of  the  challenges  are  economic  and   social,  developing  new  processes   to  address  the  technical  barriers  to   increased  global  rates  of  polymer   recycling  will  substantially  assist  in   realising  a  circular  economy.

Edited  by  Alessio  Gomiero,   Norwegian  Research  Center  AS

https://www.ceresana.com/en/market-­ studies/packaging/plastic-­caps-­europe/ Â

www.idtechex.com/en/research-­report/ green-­technology-­and-­polymer-­recycling-­ market-­analysis-­2020-­2030/695

www.creation-­center.basf.com

PLASTICS  in  the  Environment  is  a   collection  of  reviewed  and  relevant   research  chapters,  offering  a   comprehensive  overview  of  recent   GHYHORSPHQWVLQWKH¿HOGRISODVWLF pollution  and  how  it  is  affecting  the   environment.   The  book  comprises  single   chapters  authored  by  various   researchers  and  edited  by  an  expert   active  in  the  research  area.  All   chapters  are  complete  in  themselves   but  united  under  a  common  research   study  topic.   This  publication  aims  at  providing   a  thorough  overview  of  the  latest   research  efforts   by  international   authors  on  the   trending  topic  of   plastics  in  the   environment   and  opens   new  possible   research  paths   for  further  novel   developments.

2020/02/14 14:21


Classifieds Feb/Mar'2020.indd 80

2020/02/14 14:28


SPORTS

Groundbreaking Together  with  Chinese   designer  Axis  Liu,  Covestro   has  created  this  running   shoe.  The  dynamic,   extraordinary  structure  of   the  midsole  was  produced   by  a  3D  printer.  A  special   INSQIN  coating  ensures   that  the  upper  material   is  water  resistant  and   breathable

athletic shoes

The  midsole  of  this  basketball  shoe  was   made  using  in-­mould  foaming  and  contains   expanding  TPU,  which  provides   good  shock  absorption.  Both   shoes  use  a  newly  developed   0DH]LRFDUERQ¿EUHUHLQIRUFHG TPU,  which  is  very  light,   but  also  extremely  stiff  and   torsion  resistant

The  perfect  combination  of  performance,   design  and  sustainability COVESTRO  has  unveiled   groundbreaking  material  concepts   for  running  and  basketball  shoes   which  it  has  created  together  with   Chinese  designer  Axis  Liu.   Various  material  solutions  from   Covestro  are  worked  in  a  seamless   design,  exemplifying  the  individual   EHQH¿WVRIHDFKPDWHULDO,164,1 water-­based  polyurethane  (PU)  textile  coatings  and   DGKHVLYHV38IRDPVWH[WLOH¿EUHVDQG¿OPVPDGHRI thermoplastic  polyurethane  (TPU)  and  Maezio  continuous   ¿EUHUHLQIRUFHGWKHUPRSODVWLFFRPSRVLWHV &)573  The  cooperation  between  Liu  and  the  Covestro  team   resulted  in  athletic  shoe  concepts  that  set  standards  in   PDQ\UHVSHFWVWKH\DUHKLJKO\VXVWDLQDEOHDQGOLJKW\HW extremely  durable.  They  provide  increased  foot  stability   and  help  to  compensate  for  the  forces  acting  on  the  feet,  in   order  to  achieve  improved  athletic  performance. On  the  running  shoe,  the  dynamic,  extraordinary   structure  of  the  midsole  was  produced  by  a  3D  printer.   Because  running  shoes  are  often  worn  outdoors  for   several  hours  at  a  time,  it  is  particularly  important  for  the   upper  material  to  be  water  resistant  and  breathable.  This   functionality  is  achieved  on  the  concept  running  shoes  by   XVLQJDVSHFLDO,164,1FRDWLQJ Conventional  adhesives  based  on  Dispercoll  U   dispersions  join  together  the  individual  athletic  shoe   FRPSRQHQWVVHFXUHO\HDVLO\DQGHI¿FLHQWO\ ,QDFFRUGDQFHZLWKWKHGLIIHUHQWUHTXLUHPHQWVRI both  sports,  there  are  also  differences  in  the  individual   FRPSRQHQWVRIWKHPDWHULDOVXVHG)RUH[DPSOHWKH midsole  of  the  basketball  shoe  was  made  using  in-­mould   80

SPORTS.indd 80

FEB / MAR 2020

foaming  and  contains   expanding  TPU   (ETPU),  which   provides  good   shock  absorption  and  at   the  same  time  features  particularly   high  restoring  forces.  This  enhances   SHUIRUPDQFHIRUWKHMXPSLQJDQGTXLFN acceleration  that  are  common  in  basketball.   Both  shoes  use  the  newly  developed  Maezio  carbon   ÂżEUHUHLQIRUFHG738 &)573 ZKLFKLVYHU\OLJKWEXWDOVR H[WUHPHO\VWLIIDQGWRUVLRQUHVLVWDQW7KLVXQLTXHPDWHULDO combination  offers  a  high  degree  of  design  freedom  and  a   VWURQJDHVWKHWLFDSSHDOZLWKXQLTXHXQLGLUHFWLRQDOFDUERQ ÂżEUHRSWLFVLQDGGLWLRQLWLVUHF\FODEOH Apart  from  that  there  are  many  similarities  between  the   WZRFRQFHSWDWKOHWLFVKRHV â&#x20AC;˘ 7KHXSSHUVRIERWKVKRHVFRQWDLQ738ÂżEUHV7KHVHDUH highly  resistant  to  abrasion  and  tearing,  yet  they  feel   extremely  comfortable.   â&#x20AC;˘   The  running  shoe  upper  is  applied  with  screen  printing.   7KLVLVWKHSULQWLQJVROXWLRQXVLQJ,164,1WHFKQRORJ\ which  is  now  used  by  world-­leading  manufacturers  and   EUDQGRZQHUV,WSURYLGHVDYLVXDOKDSWLFHIIHFWDQG improves  the  performance  of  design  and  manufacture. â&#x20AC;˘   The  Shoe  tongue  label  with  Chinese  Character  â&#x20AC;&#x153; â&#x20AC;?(jĂš)  is   DSSOLHGXVLQJD738KRWPHOWÂżOPZLWKJRRGSULQWDELOLW\ â&#x20AC;?  means  gather  together,  it  demonstrates  how  well   ÂżOPVRIEUDQGQDPHV'XUHĂ&#x20AC;H[DQG3ODWLORQDGKHUHWR textile  materials  with  soft  surface  feel.   â&#x20AC;˘ ,QVROHVPDGHRIYLVFRHODVWLF38IRDPHIIHFWLYHO\DEVRUE mechanical  loads.   www.covestro.com

2020/02/14 14:24


Milliken presents

Millad NX 8000 clarifier for PP helps processors & brand owners on the path to better sustainability ®

®

Enhancing plastics with Color, Care, Clarity and Performance. Together. Milliken’s Millad® NX® 8000 clarifier for polypropylene (PP) — a key component in nearly 80 percent of the world’s clear PP today —is helping that cause. It not only transforms the resulting polypropylene, NX® UltraClear™ PP, into a lightweight, crystal-clear replacement for alternative materials, but also reduces processor cycle times and contributes to lowering related greenhouse gas (GHG) emissions and improving its environmental performance in injection molded products. UL Environment, a business unit of UL (Underwriters Laboratories), has documented that use of Millad NX 8000 clarifier can result in significant energy savings when injection molding transparent PP products. Numerous industrial trials indicate that use of this highly soluble clarifier can lower

processing temperatures from 235°C to 190°C (455°F to 374°F), compared with third-generation clarifiers that require high temperatures to achieve the desired transparency. UL has shown that these lower temperatures result in the energy savings of between 8 and 12%, while also reducing associated CO2 emissions. This independent, third-party certification means that those using NX UltraClear PP can add the UL Environmental Claim Validation (ECV) label to their products. This provides an obvious marketing advantage to those aiming to demonstrate their commitment to a more circular economy. But, just as importantly, the eco-label helps to confirm to all involved that they have made the more sustainable choice when it comes to doing the right thing for the planet.

Visit us at booths P81 & P84 at COMPLAST, and learn how you can gain a clear advantage with Milliken. Learn more at chemical.milliken.com. Vernon Ramiah, Ph.D. Territory Manager: South Africa and Sub-Saharan Africa • West Wing, 6 Kikuyu Road, Sunninghill, 2191, South Africa T [+27 11 236 8723] / C [+27 76 114 6727] vernon.ramiah@milliken.com

EUROPE : eurochem@milliken.com | NORTH AMERICA : millichem@milliken.com LATIN AMERICA : lachem@milliken.com | ASIA : asiachem@milliken.com © 2020 NX, Millad, and Milliken are registered trademarks of Milliken & Company. UltraClear and the Milliken logo are trademarks of Milliken & Company.

Classifieds Feb/Mar'2020.indd 96

2020/01/21 10:37


Classifieds Feb/Mar'2020.indd 96

2020/01/31 11:01

Profile for SA Plastics, Composites & Rubber

SA POLYMER TECHNOLOGY  

Summit Publishing - based in Cape Town, South Africa - launched SA Polymer Technology magazine in 2002 (then know by the title, SA Plastics,...

SA POLYMER TECHNOLOGY  

Summit Publishing - based in Cape Town, South Africa - launched SA Polymer Technology magazine in 2002 (then know by the title, SA Plastics,...

Profile for tohara
Advertisement