Page 1


GLOBAL MARKET LEADER IN CHEMICAL DISTRIBUTION Welcome to Brenntag South Africa.

Brenntag South Africa (Pty) Ltd 11 Mansell Road Killarney Gardens Cape Town 7441 Cape Town +27 (0) 21 566 1920 Johannesburg +27 (0) 11 974 9040 info@brenntag.co.za

www.brenntag.com

With over 10,000 products and a world-class supplier base, Brenntag offers one-stop-shop solutions to around 185,000 customers globally. This includes specific application technology, extensive technical support and value-added services, such as just-in-time delivery, product mixing, formulation, repackaging, inventory management and drum return handling. Our world class team, is ready to provide you with raw materials, to cater to your requirements, along with our comprehensive technical support. From enquiry to delivery, you can trust us for complete peace of mind.

RUBBERS / PLASTICS / POLYMERS / LUBRICANTS / COATINGS


T4PC celebrates 21 years’ service to the plastics industry

TECHNOLOGY 4 PLASTIC CONVERSION

We rebuild and upgrade machines used in the plastics industry – from the largest extruders, bag makers, recycling lines, granulators and shredders, to the smallest mould temperature controller.

BAGMAKER: 1971 Arvor bottom seal bagmaker BEFORE

MIDWAY

AFTER

All bag makers are completely stripped to the frame. All cabling and electrical switch gear is new, complete with PLC and servo drive motor, AC infeed motor and gearbox. All pneumatics are new and all bearings are replaced and rollers re-rubberised.

GRANULATOR: SML Granulator rehabbed BEFORE

AFTER

We can rebuild granulators from the smallest 1kw to the largest 75kw. The granulators are completely stripped and new electrics installed. The motor rewound and bearings are replaced, the rotor is balanced and new bearings installed. Old blades are sharpened and a new set made.

… with the ‘Zupta’ exchange rate it pays to rebuild your old equipment … Send us a list of your old machines and we’ll sell them for you! www.t4pc.com

C: +27 83 407 3600 | E: sean@t4pc.com | F: +27 86 505 0655


By the way 3XEOLVKHU 0DQDJLQJ(GLWRU Martin Wells (martin@summitpub.co.za) (GLWRU Tessa O’Hara (tessa@summitpub.co.za) (GLWRULDODVVLVWDQW Heather Peplow (heather@summitpub.co.za) )LQDQFLDOPDQDJHU Lisa Mulligan (lisa@summitpub.co.za) 'HVLJQHUV Jeanette Erasmus *UDSKLF'HVLJQ (jeanette.erasmus@lateraldynamics.co.za) Bronwen Moys Blinc Design (bronwen.clarke@gmail.com) Summit Publishing cc t:    f: 086 519 6089 c:   e: saplastics@iafrica.com Postnet Suite 42, Private Bag X16, &RQVWDQWLD&DSH7RZQ6RXWK$IULFD Unit 8, Bergvliet Village Centre, Cnr Hiddingh & &KLOGUHQ¶V:D\5RDGV%HUJYOLHW

www.saplastics.co.za GAUTENG Lowrie Sharp t:   f:   c: e: lowrieplasticsmedia@absamail.co.za KZN Lynne Askew t:   f:   e: lynne@summitpub.co.za Printed by: 7DQG\P3ULQW0DLWODQG&DSH7RZQ SA Plastics Composites + Rubber Technology is published six times a year and focuses on these industries in South and southern Africa. We welcome news, articles, technical reports, information in general and photographs about events and developments related to the plastics industry. The views expressed in the magazine are not necessarily those of the publisher. Views expressed are not necessarily those of the Plastics Converters Association, Institute of 0DWHULDOVRU$VVRFLDWLRQRI5RWDWLRQDO0RXOGHUVHLWKHU Copyright: All rights reserved. ISSN number: 1684-2855 (ISDS Centre, Paris) Summit Publishing: CK 9863581/23 VAT reg:

Plastics Institute of Southern Africa

Association of Rotational 0RXOGHUVRI6RXWK$IULFD

Plastics Converters Association

PET Plastic Recycling South Africa

,QVWLWXWHRI0DWHULDOV

We again have a lot of design competition news, as well as product development info by some of the world-leading material manufacturers, along with photos … DQGKRSHFRQYHUWRUV¿QGWKLVXVHIXODQG stimulating. The limits of the design potential of plastic materials are constantly being expanded. In the case here, Solvay’s highperforming Radel® PPSU (polyphenylsulfone) has enabled Zhenpeng Plumbing Fittings of China to replace traditional brass in a new line of all-plastic valves targeting pressurised hot water systems used in heating, ventilation and air conditioning (HVAC) applications. Among Zhenpeng’s new products LVWKHLQGXVWU\¶V¿UVWDOO3368VWRSYDOYHWRPHHWVWDQGDUGVWHVWHGE\WKH,QWHUQDWLRQDO $VVRFLDWLRQRI3OXPELQJDQG0HFKDQLFDO2I¿FLDOVFind out more on page 39

Mngt ‘retention’ payments resisted by shareholders ‘RETENTION’ payments to a number of Nampak’s top management WHDPPHWZLWKUHVLVWDQFHDWWKHGLYHUVL¿HGSDFNDJLQJJURXS¶V$*0LQ early February. The payments were described by some shareholders as ‘back-dated bonuses’ and the fact that the group has not paid dividends for the past two years also didn’t helped the recipients’ cause. Shareholder activist Theo Botha (where would the JSE be ZLWKRXWLQGLYLGXDOVOLNHKLPZKRDVNWKHGLI¿FXOWTXHVWLRQV SRLQWHG out that the disgruntled shareholders had not been consulted. Nampak’s share price has declined by about 64% over the past three years, but the group’s results for the year to end-September VKRZHGDLQFUHDVHLQHDUQLQJVDQGWKUHHSHUFHQWLQFUHDVH LQWUDGLQJSUR¿WZKLFKLVDQRWLFHDEOHDFKLHYHPHQWDVLW¶VQRHDV\ task to right a listing ship. It’s also noticeable that the gentlemen who were to receive the payments have been with the company for about four years and one assumes that they have been instrumental in the turnaround. It’s no secret that turnarounds are led by individuals with plans and are not simply circumstantial. But the outcome was that DERXWRIVKDUHKROGHUVUHVLVWHGDQGVLQFHVXSSRUWZDV UHTXLUHGWKHSD\PHQWVZHUHWKXVEORFNHG

BBBEE complications could be factor in petrochem plant problems IT’S anyone’s guess what the main cause of the supply problems at two of South Africa’s main polymers manufacturers, Sasol and Hosaf, last year was. The supply interruptions appear to have had a spill-over into 2018 at Sasol, which in fairness is now a global player, but Hosaf is thankfully running at an estimated 500 tons/day and can again supply all its customers. 7KHVLWXDWLRQLQWKH¿QDOTXDUWHURIZDVQRWSUHWW\DQGVHYHUDO convertors ran out of material and one wonders if the country’s BBBEE legislation isn’t partly a factor in the plant problems? On the RQHKDQGPDQXIDFWXUHUVDUHREOLJDWHGWRSURFXUHPDWHULDOVHTXLS PHQWDQGVHUYLFHVIURPEXVLQHVVHVZLWKWKHUHTXLUHG%%%((FUHGHQ tials, when in some cases no accredited supply exists. In high level applications such as petrochemical plant work, where substantial risks are involved (for plant failure as well as health & safety reasons), it’s surely not feasible for on-site contracts to be undertaken by any other than highly skilled and experienced teams. There is also the aspect that empowerment targets tend to make existing staff nervous about their employment situations, and possibly affect performance. :KDWZH¿QGIUXVWUDWLQJLVWKHIDFWWKDWHPSRZHUPHQWRSSRUWXQLWLHV exist even within non-BBBEE accredited businesses. So don’t ask someone METHING HAVE SO whether he or she can do the job; ask … IF YOU you TO SAY their previous clients whether they can. ht side: if to at the brig Look wisdom e gem of have som to us at te ri w se ea impart, pl com a. ic fr ia s@ saplastic


Volume 16 No 1

REGLOPLAS

FEBRUARY – MARCH 2018

Contents

High-performance temperature control units … for large injection moulds, extruders, rollers, autoclaves and other processing equipment

Find out more at www.saplastics.co.za

New, more efficient Type 90 Smart

INDUSTRY NEWS ARMSA adopts SANS tank standard

6

New servo print systems, real advantages

8

Ultraplast provides ultrasonic solution for BIC

10

Maritime puts Chen Hsong Jetmaster back on the map in SA

12

Volvo Ocean race helps to turn tide on plastics

14

Sasol centralises at impressive Sasol Place

16

Advanced Polymers celebrates 25 years!

20

Challenging materials no problem for Zerma shredders

22

Teqal Creative Packaging gets going at Dube trade port

24

Recycled PS in screeds & blocks at Zeitz MOCCA

26

Holland Colours - truly sustainable colours

29

ASSOCIATION NEWS No direction from DEA leaves tyre dealers with disposal challenges

40

Circular economy the new roadmap to ensure sustainable growth

42

Burgeoning demand for plastics training

48

SAPPMA achieves major accomplishments in 2017

52

Temperature control units for water up to 90°C

38

• RT 70 control system • Solid-state relay (SSR)instead of heating contactor • Automatic phasechanger for pump direction (clockwise) • Alarm buzzer

59

• Heating capacity 9 kW • Cooling capacity 24-90 kW • Pump capacity 60 litres/min, 3.8 bar

Type 150 Smart

62

Temperature control units for oil up to 150°C

70

DESIGN PISA student design competition 2017

60

2017 SPE Automotive Innovation Awards

62

84

88

88

ON THE COVER HUSKY Injection Moulding Systems’ PET preform barrier module, built on the HyPET HPP5 platform, offers manufacturers endless possibilities to explore PET as a packaging material for products requiring enhanced barrier properties. Read more on page 39

www.husky.co/EN-US/

• Heating capacity at 400V 6 kW • Cooling capacity 28kW @ 140°C • Pump capacity 60 litres/min, 3.8 bar

• Simultaneous readout of temperature set-point and actual value

• Solid state relay (SSR) instead of heating contactor

78

SPORT Dow insulation at Olympic Winter Games

• Controller RT61 PID • Outlet temperature max 150°C

• Clear arrangement of operating and indicating elements

WORLD NEWS Plastics news from around the world

NEW

• All components exposed to water are made of non-rusting materials, hence long service-life • Achieves estimated 24% reduction in rejects and 20% increase in productivity

JENOWILL SERVICES Contact – Willy Tschopp Tel: 021 551 7241 Fax: 021 551 7243 28C Lilly Park, Railway Rd Montague Gardens, Cape Town jenowill@iafrica.com www.regloplas.com


Comment Veteran round-the-world sailor, Dee Caffari, has combined her Volvo Ocean race obsession with a deep passion for the ocean in the 2017-18 race by launching a campaign to ‘Turn the Tide on Plastic’ – which the yacht has also been christened. The team’s mission is to amplify United Nations Environment’s ‘Clean Seas: Turn the Tide on Plastic campaign throughout the eight months of the race. They will gather FULWLFDOGDWDRQRFHDQKHDOWKWRFRQWULEXWHWRVFLHQWLÂżFUHVHDUFKDQGRFHDQKHDOWK monitoring as part of a landmark science programme. Read more on page 14

Surprise, surprise! LLDPE tariff problem creates cooperation with Govt Re-introduction of linear tariff confused everyone

T

4 FEBRUARY / MARCH 2018

HE unexpected reintroduction of import tariffs on linear (LLDPE) earlier in 2017 has had an even more surprising result: cooperation between just about everyone involved, notably between convertors, material suppliers and government departments. It’s the latter’s conciliatory involvement which is most welcome, for too long the industry has seen government departments as adversaries.

In what became a complicated case, the 10% tariff RQOLQHDU WDULIIVRQSRO\ROH¿QVKDGEHHQSKDVHGRXW DERXW¿YH\HDUVDJR ZDVUHLQWURGXFHGDQGFRQIXVHG MXVWDERXWHYHU\RQHZLWKPRVWVXSSOLHUVDW¿UVWQRW noticing the minor tariff heading change. It was also surprising that the suppliers noticed before customs RI¿FLDOVGLG7KHSUREOHPZDVVHULRXVDERXW tons of linear entered the country during 2017 and the total tariff due would have been in the region of R180-million. The problem was that it wasn’t that easy to get the tariff reversed. Some of the material importers were paying the tariff and some weren’t, with the former only EHODWHGO\¿QGLQJRXWZK\WKHLUSULFHVZHUHQRORQJHU competitive. A number of international suppliers, having possibly had prior experience of unexpected shifts by import authorities, reacted very cautiously and were even preparing to pay. One of the largest supplier’s estimated its exposure could have been as much as $6-million.

THIS ISSUE An industry delegation, including material suppliers, trekked over to Pretoria in November and were surprised when they were well received and discussions were handled in a professional and informed manner. The people at SARS and DTI even sympathised with them. Following that, delegates from Plastics/SA and the Plastics ‘The problem Convertors Association (PCA) was serious: also headed over to the Union about 90,000 Buildings and received a similar reception. tons of linear It was then decided that the entered the matter needed to be dealt with country at a higher level and the bigwigs during 2017 at the DTI and SARS are now dealing with it. The hope is, and the total obviously, that the tariff will tariff due be withdrawn soon and that would have those who have paid the tariff been in the will be refunded. It’s important that the relationship between region of the industry and government R180-million.’ improves. One would have thought this was obvious since manufacturers and their suppliers are major tax payers. That’s not to say that convertors could not have done more themselves to get on better with government representatives, but it’s hoped that the current problem will be put behind us and we can proceed to a more cooperative situation.

Martin Well s, Publisher


75894

Sustaining communities. An attractive characteristic of PE100 piping systems is the creation of leak-free joints through heat fusion, which creates a joint that is as strong as the rest of the pipe. Ensuring on fulfilling the needs of the local potable water pipe market, for generations to come. A Division of KAP Diversified Industrial (Pty) Ltd.


News

ARMSA adopts SANS tank standard

Sales of water tanks around the country, and particularly the Western Cape, are at alltime high levels, so the introduction of the standard comes at an appropriate time.

6 FEB / MARCH 2018

Standard developed by ARMSA in conjunction with the SABS you purchase has been properly designed A SOUTH African National DQGPDQXIDFWXUHGWREH¿WIRUSXUSRVHIRU Standard (SANS) for polyethylene the length of its warranty life. chemical and water storage tanks “It compels tank manufacturers to has been approved and adopted conform to world best practise,” said after a virtual marathon process ARMSA chairman Wayne Wiid, “and it protects members of the broader by ARMSA. The tank standard construction, LVD¿WIRUSXUSRVH architecture, “It compels tank guarantee on plastic plumbing, landscaping manufacturers to water and chemical and built industries as storage tanks. conform to world well as consumers, The SANS 1731:2017 tank standard was developed in a lengthy project involving ARMSA and the South African Bureau of Standard (SABS). The SANS 1731:2017 tank standard is proof that the polyethylene (plastic) tank

against tanks of lesser quality.” Sales of water tanks around the country, and particularly the Western Cape, are at all-time high levels, so the introduction of the standard comes at an appropriate time.

best practise.”

The standard has the following relevance to tank users: z3URYLGHVVSHFL¿FFULWHULDLQWHUPV of the source of raw material, ultra violet protection, overall weight, wall thickness, light penetration, stress crack resistance and impact strength for a range of different sizes; z Ensures that the production methods used to manufacture the tanks comply with best practise; z Requires that traceability is built into the manufacturer’s control systems; z Includes an audit check for actual storage volumes versus stated volumes; z Evaluates the overall appearance of the ¿QLVKHGWDQNV z&HUWL¿HVWKHUHTXLVLWHQXPEHUDQGW\SH

SU chemistry students develop water THREE chemistry students at Stellenbosch University (SU) have reduced their laboratory’s water consumption by at least 3 000 litres per week by coming up with innovative and relatively inexpensive ways of saving water. Four months ago PhD students Monica Clements, Jonathan Hay and Anton Hamann started to conduct trials in the medicinal and organic chemistry laboratory in the De Beers Building in response to a challenge put out by their head of department, Prof Peter Mallon, to develop ways of saving water.

Front view of the Cold-Water Recycling System (CWRS, red cooler box) connected to a laboratory rotary evaporator supplying ice water to the condenser coil

7KH\¿UVWLGHQWL¿HGWKHODUJHVWFRQVXP ers of water and then developed a system – called a Closed Cold-Water Recycling System (CCWRS) – to be used with waterthirsty lab equipment. The closed system consists of a cooler box, a garden hose and laboratory silicone piping, as well as a garden fountain pump of 80litres/h. The basic principle is that the water is cooled down with ice and then recycled in a closed system, whereas previously perfectly potable tap water would have gone down the drain.


Transpaco buys Future Packaging & Machinery

IRUPDOFHUWL¿FDWLRQWKHUHLVQRJXDUDQWHH We therefore urge all stakeholders and home owners to request the PESC FHUWL¿FDWHIURPWKHPDQXIDFWXUHUSULRUWR purchase. It is your guarantee that tanks delivered to sites or homes have been WKRURXJKO\WHVWHGDQGFHUWL¿HG´

• Any queries relating to the adoption of the standard or information on compliant manufacturers can be sent info@armsa.co.za or to the appointed tank standard auditor, francois@pescon.co.za www.armsa.co.za

saving measures 7KHÂżUVWPDMRUZDWHUXVHULGHQWLÂżHGZDV the lab’s rotary evaporators, which used over 100 litres of water per day when running directly from the tap. The evaporator’s condenser is now connected to the closed system and not to a tap, and only uses about 5 litres of ice water per day. “All three of our rotary evaporators have been running on this setup for over three months, without failures of any kind even though running eight hours a day, Monday WR)ULGD\´-RQDWKDQH[SODLQV They also found that this method of using

ice cold water allowed the solvent to condense far quicker, and that it is also far more effective in condensing low boiling solvents. Prof Peter Mallon, head of the Department of Chemistry and Polymer Science at SU, says this is an outstanding initiative on the part of the postgraduate students: “It shows a high degree of responsibility and social engagement on their part. We have recently instituted these water saving PHDVXUHVLQRXUÂżUVW\HDUODERUDWRULHV ZKHUHQHDUO\ÂżUVW\HDUVDUHQRZXVLQJ it,â€? prof Mallon adds.

Ultrapolymers to supply BASF’s PA extrusion grades ULTRAPOLYMERS South Africa, part of Ravago Group of Belgium, has been appointed distributor of %$6)ÂśVSRO\DPLGHH[WUXVLRQJUDGHV Ultrapolymers took over responsibility for the various PA materials from the beginning of the year. It holds more local stock points, offers shorter lead times, even for smaller minimum order quantities, and also offers locallybased technical support. “We are convinced that this change will offer the market an LPSURYHGEX\LQJH[SHULHQFHDVZH have seen in other markets in which we also successfully partner with Ultrapolymers over many years,â€? noted a BASF statement. Ultra is supplying the following materials: Ultramid Homopolyamid, Ultramid Copolyamid, Ultramid Slow Crystallisation grades and Caprolactam. FEB / MARCH 2018 7

JUST BRIEFLY

RIÂżWWLQJVDQGWKHGDWHRIPDQXIDFWXUH ARMSA appointed an independent third party auditing company, Productivity Engineering Services & Consultants (PESC), who will regularly audit tank manufacturers who wish to comply. If compliant, PESC will issue a FHUWLÂżFDWHJLYLQJLQGHSHQGHQWDVVXUDQFH of a manufacturer’s claim that their products meet the SANS 1731:2017 criteria. Compliant tank manufacturers will be able to market their compliance with the ARMSA/SANS approved sticker on their tanks. They will also be able to XVHWKHFHUWLÂżFDWHDQGVWLFNHULQWKHLU general marketing programmes. A word of warning from Wiid: “Any tank manufacturer can claim to meet the SANS 1731:2017 standard but without

TRANSPACO has completed the purchase of Future Packaging & Machinery, having concluded the deal towards in December for R105-million. FPM supplies industrial and general packaging products as well as a range of packaging machines through distribution centres in Johannesburg, Cape Town and Durban; it also has smaller depots in Bloemfontein and Nelspruit. Transpaco supplies a range of SDSHUEDJVDQGSODVWLF¿OPVDQGEDJV as well as recycled plastic materials and other packaging products including cores. It paid a premium of R37.2-million on the book value of the net assets being acquired. FPM has an estimated turnover of over 5PLOOLRQDQGQHWSUR¿WDIWHUWD[RI R20-million. Transpaco has through the purchase gained access to FPM’s large customer base around the country, including the municipal, industrial, wholesale, retail and agricultural markets and the deal is H[SHFWHGWRHQKDQFHLWVHDUQLQJV Transpaco’s shares rose 1% on the announcement on 19 December.


News

Servo boosted print – Richard Irwin of Bottle Printers with one of the new automated lines at the company’s plant in Kyalami. The machines, from one of China’s internationally rated printer manufacturers, make extensive use of servo motors with improved PLC technology and achieve easier and faster operation; this is the smaller of the two new systems PHOTOS: LOWRIE SHARP

New servo print systems offer real advantages for Bottle Printers 8 FEB / MARCH 2018

Easier set up, faster operation BOTTLE Printers of Johannesburg, which has gone national following the opening of a new plant in Cape Town recently, has increased both capacity and abilities with the commissioning of two servo-driven printers. The new lines, from China, have been installed at the Bottle Printers plant in Kyalami, part of a substantial investment by the company. The systems can

print on a wide variety of plastic or glass containers, including virtually any shape of container, in a single print operation. 6SHFL¿FDGYDQWDJHVLQFOXGHDXWRPDWLF loading of containers, servo pre-registration as well as automated UV curing. The printers’ PLC systems memorise settings for different containers, so job changeovers are quicker and totally predictable, which is a particular need as Bottle Printers is running a wide variety of containers, often with relatively short production runs. The machines print four colours plus white and can print as

many as 60 cylindrical containers a minute, and slightly less for oval and square bottles, and print containers up to 250mm long by 100mm diameter. According to Richard Irwin, marketing manager for Bottle Printers, the commissioning process went smoothly and the lines have been in full operation since shortly after arrival.

• Established in 1991, as a garage-based operation with two staff members and a single machine, Bottle Printers has grown to the point where it is now one of South Africa’s top printers for cosmetic and beverage containers as well as a wide range of promotional goods. The company operates two sites in Johannesburg, a glass printing and coating operation in Bramley View and the plastic bottle printing plant in Midrand, besides its new factory in Epping, Cape Town.

The silkscreen printers are suitable for relatively short UXQVDVWKHMREFKDQJHRYHUSURFHVVLVVLPSOLÂżHGEXW could just as easily be used for extended print jobs

www.bottleprinters.co.za


нϮϳϭϭϳϬϰϬϴϮϰͮŝŶĨŽΛĐĂďůĞƚĞĐŚ͘ĐŽ͘njĂͮǁǁǁ͘ĐĂďůĞƚĞĐŚ͘ĐŽ͘njĂͮ>ĂŶƐĞƌŝĂŽƌƉŽƌĂƚĞƐƚĂƚĞ͕DĂůŝďŽŶŐǁĞZŽĂĚ͕>ĂŶƐĞƌŝĂ


News

Ultrasonic solutions solve a joining problem at BIC

H POTOS:O L WR IE SHAR P

Branson system eliminates reject problems, increases production MANYof you will have heard of ultrasonic welding and the various applications in the manufacturing of plastic components by either joining or sealing. To put it simply, electrical energy is converted into mechanical energy which is transferred through purpose-designed tooling called a horn or sonotrode to the material surface resulting in an extremely fast and HIÂżFLHQWZHOGZKLFKUHPDLQVFRQVLVWHQW throughout the product life of the equipment. The horn is designed to GHOLYHUHIÂżFLHQWZHOGVLQDYHU\VKRUW

cycle time;therefore welds averaging 0.1 of a second are not uncommon. The horn can vibrate between 20 000 to 40 000 times a second. One company that uses ultrasonic welding in the manufacture of their various writing products is IBC South Africa, manufacturers of the iconic IBC pen which has been copied by many – but nothing beats the original. During one of the production cycles, the clear portion of the pen is joined to the main body using an ultrasonic weld. IBC in o Jhannesburg

approached W.L ee-U ltraplast, sole supplier of rBanson welding systems LQ6RXWKHUQ$IULFDZLWKDEULHIWRÂżQG a solution for problems with existing ultrasonic welders in their production line. There were several problems, including the fact that welding was inconsistent in quality and even that welding did not always occur, resulting in rejections. Then, European suppliers of the original equipment were not always helpful or did not have local support to back up their product. o Lcal service engineers were not familiar enough with ultrasonics and battled to troubleshoot correctly. Spares deliveries were unreliable and took extended periods to arrive and, when they did, were often not the solution to the problem. After careful evaluation of the production line, W.L ee-U ltraplast proposed a number of solutions, starting with in-depth training of the technicians. lU traplast also suggested that the welding horns t(hat make contact with the material and cause the weld to take

“In-depth training of technicians�

Owen Pattrick of BIC, who was responsible for setting up the systems, Albert le Grange, technical forman at BIC in Industria, and Craig Parkes of Lee Ultraplast 10 FEB / MARCH 2018


The jig conversion built by Ultraplast allows IRUUDSLGDQGHI¿FLHQW welding of the various pen models produced at the Industria factory

The new Branson units in the welding system have sped up the joining process DQGHI¿FLHQF\RIWKH system, meaning that far fewer – if any – reject welds result

Vehicles still missing but material shows up, sort of

R1,7-million, but the supplier was repaid by the haulers. The erstwhile drivers remain absent, however, missing in action so to speak.

training, BIC SA foreman Albert le Grange was able to visit the plant in North Africa and help resolve their problems. This has resulted in BIC Tunisia also ordering Ultrasonic equipment from W.LeeUltraplast. “We at W.Lee-Ultraplast are always interested in looking for solutions to your problems and look forward to any enquiry that may need our services,” added Bill. Tel: 011 933 3140

www.lee-ultraplast.co.za

in which it participated. Largo was a shrewd businessman who liked joking and pulling employees legs and so on; he returned to his homeland some years ago but unfortunately passed away there.

M&S Plastics shut M&S Plastics of Edenvale, which VXIIHUHGDPDMRUÀRRGLQJRILWVSUHPLVHV earlier in 2017, has closed for business and its plant is to be sold off. M&S was a leading manufacturer of drums up to 220 and 210-litre open-head and tighthead drums as well as 25-litre containers plus ‘Plasti-Flor’ interlocking 39&ÀRRUWLOHV7KHHTXLSPHQWWREH sold includes large blow moulding and injection moulding machines. A substantial insurance claim was ORGJHGE\0 6DIWHUWKHÀRRGDQG the matter was, at the time of going to press, about to be resolved between the directors of the company and their insurers. The company was established by the Frank Largo, a Hungarian, in 1985 and was for years a leader in the markets

DPI ceases production in Cape Town DPI Plastics has ceased production at its pipe extrusion plant in Bellville, Cape Town. About 100 people appear to have been retrenched, with several having shifted over to MacNeil Plastics at Macassar across the peninsula. The decision to end production at the Stikland plant may be at least partly motivated by the Group Five company’s decision to consolidate at its site in Roodekop, Johannesburg, where it now operates 14 extrusion lines and has capacity to produce 2200 tons/month of HDPE pipe, including pipe up to 1m diameter. DPI also has major PVC pipe extrusion capacity in Gauteng. FEB / MARCH 2018 11

JUST BRIEFLY

NEITHER the vehicles, drivers or trailers which disappeared en route to Zambia in September have reappeared, but at least some of the 66 tons of LD and LLDPE which was being transported did appear in Zim – and seems to have been offered for resale in Benoni. After advising people in the industry across southern Africa during October, the supplier, MBT, did receive some feedback – from convertors who became suspicious. After contemplating setting up a sting operation, to ensnare the black market operators, the supplier eventually aborted the ambush and referred the matter to the hauler’s private investigator who apparently approached the police in both Zim and RSA. It appears that at least some of the material never even made it across the border, as it was offered for resale in South Africa. The value of the material was higher than previously estimated, and stood at

place) be completely redesigned. Not surprisingly, it also recommended that existing power supplies be replaced with new technology Branson units as the old ones had become unreliable. “Same day response when support was required” was also a factor, said Bill Lee of Ultraplast. As a result, after these changes BIC achieved a 15% increase in production rate, with no more downtime due to poor or erratic welds. BIC Tunisia was experiencing similar problems and as a result of the Ultraplast


News

PHOTOS: LOWRIE SHARP

Maritime Marketing puts Chen Hsong Jetmaster back on the map in SA

The performance statistics of the MK6 are so impressive that Dario Simoes (left) of Darsim Tool & Die didn’t hesitate in purchasing ¿YHQHZPDFKLQHV+HUHKHDQG Marc Gerasimo, sales director at Maritime, with products manufactured on the machines

12 FEB / MARCH 2018

1HZLQGXVWU\EHDWLQJ0.Ă€DJVKLS UNDER the custodianship of Maritime Marketing, Chen Hsong has started to regain its foothold in South Africa with LWVQHZLQGXVWU\EHDWLQJ0.Ă€DJVKLS product that will keep its traditional competitors awake at night. The performance statistics of the MK6 are so impressive that Darsim Tool & 'LHGLGQÂśWKHVLWDWHLQSXUFKDVLQJÂżYH new machines after evaluating them against competitive products on price and performance. “After seeing the MK6 in action and the notably vast improvements from the previous models, it was a no-brainer for us in purchasing the machines to help drive our rapidly expanding business with over 30 new products launched in 2017,â€? says Dario Simoes, GM at Darsim. “With 15 new products from our Ă“tima range planned for 2018 we need machines that are reliable and fast that include the latest technological advancements and Chen Hsong has done a great job with the MK6, so its’ a perfect ÂżWIRURXUJURZLQJEXVLQHVV´KHDGGV Marc Gerasimo, sales director at Maritime says: “Chen Hsong has found a new home in South Africa with Maritime.

The new MK6 series from Chen Hsong

Both companies’ strategies on growth align seamlessly which makes for a harmonious partnership. The MK6 range of machines are very impressive on all fronts and signals Chen Hsong’s intention to once again stamp their authority as a key player in the supply of plastic injection moulding machinery in SA.â€? “The addition of Chen Hsong’s new 2-platen machines with a larger opening stroke to accommodate larger moulds DQGVLJQLÂżFDQWO\VPDOOHUIDFWRU\IRRWSULQW coupled with a retractable tie bar for side mould entry, along with the recent launch of Chen Hsong’s PET machine, allows us to cover all our clients injection requirements,â€? adds Marc. Greg Gerasimo, managing director at Maritime says: “The uptake of the MK6 machines has been incredible with a further 10 units due to arrive shortly for commissioning. In addition, customers can now have machines readily available in popular sizes as we increase our stock holding. Our strategy is very clear in that Maritime will continue to position itself as the popular choice for plastics converting machinery supply and maintenance in SA.â€?

Chen Hsong’s 60th year anniversary Chen Hsong celebrates its 60th anniversary this year. “For 60 years Chen Hsong has been at the forefront of the injection moulding industry, and we are going to keep being at the forefront for the next 60,â€? said CEO, Lai Yuan Chiang. “In 2018, we are planning a series of events to mark this precious occasion, which will be rolling out gradually throughout the year, and these will include more customer occasions, technical seminars, open houses, and various other activities.â€? “Furthermore, the company will be launching a brand-new image for an everyoung, ever-more-dynamic Chen Hsong to coincide with the start of our next 60 years!â€? she added. ‡7RÂżQGRXWPRUHDERXW&KHQ+VRQJVQHZ0. SURGXFWFRQWDFW0DUF*HUDVLPRDWPDUF# PDULWLPHPDUNHWLQJFR]DRU

The new 2-platen Supermaster from Chen Hsong


News

Skipper Dee Caffari’s crew on Turn the Tide on Plastic is a mixed, youth-focused team with a strong sustainability message

Volvo Ocean race helps

turn tide on plastics Dedicated to the issue of ocean health VETERAN round-the-world sailor, Dee Caffari, has combined her Volvo Ocean race obsession with a deep passion for the ocean in the 2017-18 race by launching a campaign to ‘Turn the Tide on Plastic’ – which the yacht has also been christened. Britain’s Dee Caffari, skipper of ‘Turn the Tide on Plastic’, is the only female VNLSSHULQWKLV\HDUÂśVUDFHDQGWKHÂżUVW woman ever to sail solo non-stop around

the world in both directions. Caffari’s is a mixed, youth-focused team with a strong sustainability message. The campaign, backed by the principle sustainability partner, 11th Hour racing and the Mirpuri Foundation is dedicated to the issue of ocean health. SA Plastics met with Dee while she was in Cape Town at the start of the leg of the Volvo Ocean race from Cape Town to Melbourne in Australia. She explained that her team’s mission is to amplify United Nations Environment’s ‘Clean Seas: Turn the Tide on Plastic campaign throughout the eight months of the race. Dee and her crew, sailing under D8QLWHG1DWLRQVĂ€DJKDYHEHHQFKDUJHG with spreading an important message about ocean health as they race around the world. They will gather critical data on ocean KHDOWKWRFRQWULEXWHWRVFLHQWLÂżFUHVHDUFK and ocean health monitoring as part of a landmark science programme. Turn the Tide on Plastics’ skipper, Dee Caffari, at the wheel during the start of Leg 3 from Cape Town to Melbourne (PHOTO BY JEREMIE LECAUDEY)/

14 FEB / MARCH 2018

“It’s really nice to bring all the teams together for a subject that we’re all committed to,â€? said Dee. “We’re all very passionate about the race’s sustainability focus and ultimately we have to deliver that message as ocean ambassadors. “As sailors we get to play in this unique playground and we see the impact that plastic pollution is having on ocean health. For that reason, we’re the best people to pass the message on, and regardless of which team we’re racing with, collaboratively, we can all make a very big impact. Âł%\WKHWLPHZHÂżQLVKWKHUDFHZH should have lots of real data that we can use to push our message further, and take to governments and decision makers globally,â€? she says. “It’s believed that we only see 1% of the plastic in the ocean – so this is a key measurement, especially in the most remote oceans on the planet,â€? Dee adds. Made possible thanks to the support RI9ROYR&DUVDQGDVFLHQWLÂżFFRQVRUWLXP including NOAA (National Oceanic and Atmospheric Administration), JCOMMOPS (UNESCO-IOC), GEOMAR and SubCtech, the science programme


consists of three areas of research, micro-plastics monitoring, collecting meteorological data and launching drifter buoys.

Meteorological data and drifter buoys All of the boats will send 36 data points back to race control at race HQ in Alicante every 10 seconds. This information covers temperature, barometric pressure, wind strength and direction. This data will be passed on to the National Oceanic and Atmospheric Administration and the European Centre for Medium Range Weather Forecasts. This data will contribute to more accurate weather forecasts and climate models in order to better understand the weather tomorrow and climate change in the coming decades. During the most isolated legs in the race, DOOVHYHQERDWVZLOOFDUU\VFLHQWLÂżFGULIWHU buoys that will be launched in the most VFLHQWLÂżFDOO\LQWHUHVWLQJDUHDVDORQJWKH URXWH7KHVHĂ€RDWLQJVHQVRUVDUHHTXLSSHG with satellite communications equipment to transmit information on ocean composition and currents.

www.skyoceanrescue.com

3D printed brace saves sea turtle AN injured sea turtle found in the cooling canal of a US, New Jersey power plant in 2013, is now growing and thriving at a California aquarium thanks to 3D printing. Staff at the Birch Aquarium at Scripps Institution of Oceanography at the University of California, San Diego, collaborated with the digital media laboratory at the university’s Geisel Library to design, build and attach a 3D printed brace that ¿OOVDJDSLQWKHERWWRPULJKWSDUWRIWKH loggerhead sea turtle’s shell. The brace, combined with a neoprene weight pocket, is expected to let her grow and thrive in the protected environment of the aquarium. When the young turtle was rescued, she had a gap in her shell that was only part of her problems. She also had an abnormal

curvature of her spine and paralyzed UHDUÀLSSHUV The lab procured white translucent WJODVHEUDQG3(7*¿ODPHQWVDQGXVHG about a 227g of the materials to print E\E\FHQWLPHWUHEUDFH$V WKHWXUWOHJURZVSRWHQWLDOO\WRNJ VKHZLOORXWJURZWKHEUDFHDQGEH¿WWHG for a larger one. Nozzles of 0.8mm on the Ultimaker maximized clarity of the JO\FROPRGL¿HG3(7¿ODPHQWV Technicians used a two-part underwater marine epoxy compound to attach the brace, which prevents the turtle’s shell from curving further downward and promotes normal growth. Separately, the team attached a Velcro neoprene weight pocket to provide neutral buoyancy while the turtle rests. The sea turtle equipped with a 3D printed brace which can be replaced with larger versions as the turtle grows

IWMP has to be submitted by 6 July THE Department of Environmental Affairs published a government notice on 6 December asking various industries – including the packaging and paper, electrical and electronic and lighting sectors – to provide their industry waste management plans (IWMP). In terms of the legislation, registration is no later than two months from the published date of gazette (6 December) and the IWMP has to be submitted no later than seven months thereafter.

EU lays out ambitious plastics packaging policy THE European Commission adopted the ÂżUVWHYHU(XURSHZLGHVWUDWHJ\RQSODVWLFV on 16 January as part of the transition toward a more circular economy. The strategy calls for changes in product design, production, use and recycling within the European Union and involves investment opportunities and jobs within the sector. Under the new plan, all plastic packaging on the EU market will be recyclable by 2030, the consumption of single-use plastics will be reduced and the intentional use of microplastics will be restricted. As part of the new strategy, the EU ZLOOPDNHUHF\FOLQJSURÂżWDEOHIRUEXVLQHVV by developing new rules on packaging, which will improve the recyclability of plastics used on the market and increase the demand for recycled plastic content. Preparatory work for future revision RIWKHQHZGLUHFWLYHZLOOVWDUWLQWKHÂżUVW quarter of 2018. As part of this, the commission will initiate work on new harmonized rules to ensure that by 2030 all plastics packaging placed on the EU market can be reused or recycled in a cost effective manner. Additionally, the new plans will aim to UHGXFHSODVWLFZDVWHWKURXJKVLJQLÂżFDQW reduction in plastic bag use.

Bounty makes second purchase in Poland BOUNTY Brands has made a second acquisition in Poland, having purchased Stella Pack, a manufacturer of recycled refuse bags. Bounty is also the owner of Tuffy Brands, a manufacturer of recycled UHIXVHEDJVDQGRWKHUÂżOPVDQGEDJV based in Cape Town. Stella generated revenue of R820million in 2016 with about 40% of sales being from outside of Poland. FEB / MARCH 2018 15

JUST BRIEFLY

Micro-plastics monitoring Dee’s crew on Turn the Tide on Plastic carry ground-breaking instruments on board to test salinity, partial pressure of CO2, dissolved CO2 and Chlorophyll-a (algae) directly in the seawater around them. These key metrics for ocean health will be logged in addition to test trials for micro plastics to create a complete snapshot of the world’s oceans. Dee explained that a system on her yacht scoops water from about 1 metre under the hull into ‘test tubes’ and through WKUHHÂżOWHUVHYHU\KRXUVZKLOHWKH\DFKW is sailing. “We are looking at PH levels and CO2 levels that are intrinsically linked, as well as salinity, temperature and chlorophyll levels and the micro-plastics levels. It is the latter that has never been done before and will produce some raw data that will be our reference data going forwards. If we can get more vessels to carry this equipment we will be able to see the rate of change and the danger level we are at with our world’s ocean health,â€? she explained. “Unlike most research to date, that collects water at the surface level to test for micro-plastics, we are looking at water through an inlet used for our water maker, so about 1 metre below the surface. It

collects water and runs it through three OD\HUVRIÂżOWHUV7KHVHÂżOWHUVDUHFKDQJHG every two days and sealed. The GPS logs H[DFWO\ZKHUHWKLVGDWDLVIURPDQGWKHÂżOWHUV are given in at the end of each leg for testing in the labs onshore.


News The inspiration for the new building design was based on Sasol’s logo. The logo comprises a central core which denotes stability while six rotating spheres represent the group’s business units. The combined results supports the view of a force greater than the sum of its parts and is closely aligned with Sasol’s One Sasol, One bottom line approach and highlighting strength through synergy

Sasol centralises at impressive Sasol Place 0DMRUEHQH¿WVIURPKXJH5ELOOLRQSURMHFWEHLQJ\LHOGHG SASOL PLACE, Sasol’s new global headquarters in Sandton, comprises a gross rentable area of 67 000m², seven levels of basement parking of close to 100 000m² and podium landscaping of over 3000m² ±PDNLQJLWWKHODUJHVWFRUSRUDWHRI¿FH rooftop garden in South Africa.

Sasol Place is co-owned by the Sasol Pension Fund and its 50% partner, Elixir 7UXVW7KHQHZFRUSRUDWHRI¿FHVZHUH jointly developed by Alchemy Properties and the Sasol Pension Fund at a construction cost of approximately R2-billion. 6DVROLVOHDVLQJWKHRI¿FHVIURPWKHFR

owners for a 20-year period. The building was designed by Paragon Architects. Previously operating from a number of OHDVHGRI¿FHSURSHUWLHVDFURVV-RKDQ QHVEXUJYLUWXDOO\DOO6DVRO¶VRI¿FHVWDII are now located at Sasol Place, a more PRGHUQFRPIRUWDEOHDQGVSDFHHI¿FLHQW building that is already positively impacting SURGXFWLYLW\DQG\LHOGLQJVLJQL¿FDQWFRVW savings, a company statement said. 7KHSURMHFWKDGVLJQL¿FDQWORFDO HFRQRP\EHQH¿WVZLWKDSSUR[LPDWHO\ of the total project spend being invested into the local South African economy. In addition, procurement policies were implemented in line with Sasol’s requirement to support South Africa’s broad-based black economic empowerment codes of good practice. Spend incurred on qualifying small enterprises was 25% of the total developer procurement expenditure. 16 FEB / MARCH 2018


Sasol Secunda, South Africa

Building on our robust foundation Sasol is an international integrated chemicals and energy company. Through our talented people, we use selected technologies to safely and sustainably source, produce and market chemical and energy products competitively to create superior value for our customers, shareholders and other stakeholders. We develop and commercialise technologies, and build and operate world-scale facilities to produce a range of high value product streams, including liquid fuels, chemicals and lower-carbon electricity. We employ more than 30 000 people working in 33 countries.

Europe North America Asia

South America Southern Africa Follow us on:

SasolSA

www.sasol.com

SasolSA


News Christoph Riedlsperger (Alpla’s AMET regional director) and Len Engelbrecht (CEO of Boxmore)

Competition Commission approves Alpla’s acquisition of Boxmore Packaging

18 FEB / MARCH 2018

Alpla has ambitious growth strategy for Africa THE Alpla takeover of o Bxmore a Pckaging, which was subject to legal and regulatory approval by the competition DXWKRULWLHVKDVRIÂżFLDOO\EHHQDSSURYHG The transaction, which was signed in u Jly 2017 , has been approved without conditions, resulting in Alpla now holding 100% of the issued share capital of o Bxmore 3DFNDJLQJ7KH$XVWULDQJURXSQRZKDV VROHFRQWURORYHU%R[PRUH This acquisition represents the largest for the Austrian manufacturer, which, prior to taking over o Bxmore a Pckaging already operated 163 production plants in more WKDQFRXQWULHV,WZLOODGGDIXUWKHU nine plants in three countries, and 1,000 HPSOR\HHVWKURXJKWKLVDFTXLVLWLRQ The current o Bxmore a Pckaging board and management team under the leadership of e Ln Engelbrecht C ( EO), will remain the same, and Engelbrecht will take on the additional responsibility of integrating

and managing the existing Alpla SA busiQHVV0HDQZKLOH&KULVWRSK5LHGOVSHUJHU $OSODœVUHJLRQDOGLUHFWRUIRU$0(7 $IULFD 0LGGOH(DVWDQG7XUNH\ ZLOORYHUVHHWKH combined business, which will fall under KLVGLYLVLRQDOUHVSRQVLELOLWLHV 5LHGOVSHUJHUH[SODLQHGWKDW%R[PRUH a Pckaging’s well established Southern $IULFDQDQG,QGLDQ2FHDQ,VODQGVIRRWSULQW plus its market strength in the beverage sector in South Africa, were critical decidLQJIDFWRUVLQWKLVEX\RXW³:HOLNHKRZ the company is managed and feel good chemistry with the management team,� he DGGHG Through this deal, Alpla aims to change LWVSDFNDJLQJRIIHULQJWR)0&*FXVWRP HUVLQWKHUHJLRQ,QWKHPDUNHWVWKDW o Bxmore a Pckaging currently operates, Alpla’s global technical team will accelerate project delivery and bring additional H[SHUWLVHWRLPSURYHFXVWRPHUVHUYLFH,Q

Hestico commissions 3 extruders at Plastics|SA PLASTICS|SA recently bought three plastic pipe extruders to increase the scope of the training they offer at their premises in Johannesburg, Cape Town and 'XUEDQ7ZRUHJLRQVKDYHDOUHDG\KRVWHGWKHLU¿UVWVFKHGXOHGSLSHDQGSUR¿OH extrusion training on the new extruders. Pictured here are Hestico’s Danie Boshoff with Mark Malan of Plastics/SA and one of the three plastic pipe extruders

3OHDVHQRWHWKDWIURP0DUFKWKHQHZDGGUHVVIRURXU'XUEDQRIÂżFHZLOOEH $FFHVV3DUN8QLW$OEL]LD3ODFH0D[PHDG3LQHWRZQ

categories that Alpla SA currently services s( uch as extrusion blow moulded bottles), o Bxmore’s national and regional manufacturing footprint will enable the business WRUHDFKQHZFXVWRPHUV7KURXJK$OSOD o Bxmore a Pckaging will be able to better VHUYHQHZ)0&*FDWHJRULHVZLWKQHZ SURGXFWVDQGVHUYLFHV Alpla has an ambitious growth strategy for Africa, which will be prioritised and built on the current footprint, and existing UHODWLRQVKLSVLQ6XE6DKDUDQ$IULFD (QJHOEUHFKWFRQFOXGHG³$OSODLVDJUHDW future partner and we are excited to work with our new shareholders to realize our main goal, which is growing the market and ensuring the long-term sustainability RIWKHEXVLQHVV´ www.alpla.com www.boxmore.co.za


ELASTOMERS

PLASTICS & COMPOSITES

ACM CR EPDM Epichlorohydrin FKM HNBR HTV Silicone IR NBR NR PVC/NBR Blends SBR & BR

ABS Acetal Additives Composites CPE CSM EVA HIPS & GPPS Nylon PC PVC TPE & TPV TPU

FILLERS & ADDITIVES

AUXILIARIES & SERVICES

Aluminas Antimony Products Blowings Agents Carbon Blacks Flame Retardents Hydrocarbon Resins Magnesium Oxide Masterbatches MC & PE Waxes Mineral Fillers Peroxides Process Aids Rubber Chemicals Silanes Silica Sulfur Zinc Oxide

Curing Bladder Machinery Other Services Release Agents Release liners Spares

ANCHOR CHEMICALS Batch Off Bonding Systems Coated Powders Factice Masterbatching Process Aids Toll Mixing


News

Advanced Polymers

celebrates 25 years! Success all due to hard work and more hard work! ADVANCED Polymers recently celebrated 25 years of success. Starting RXWDVDPRGHVWRXW¿WLQVXSSO\LQJ WKH6RXWK$IULFDQSODVWLFVLQGXVWU\ZLWK OHDGLQJSRO\PHUEUDQGVWKHFRPSDQ\ QRZLPSRUWVVHOOVDQGGLVWULEXWHVD diverse range of quality engineering DQGFRPPRGLW\SURGXFWVVRXUFHGIURP WKHZRUOG¶VPRVWUHSXWDEOHVXSSOLHUV :LWKZDUHKRXVHVLQ-RKDQQHVEXUJ 'XUEDQDQG&DSH7RZQWKHFRPSDQ\ LVDEOHWRGHOLYHUSURPSWO\DQ\ZKHUHLQ South Africa. 7HQ\HDUVDIWHU$GYDQFHG3RO\PHUV ZDVHVWDEOLVKHG%UDG-D\QRZ &KDLUPDQERXJKWWKHEXVLQHVVLQ ,Q/HV:KLWWDOMRLQHGWKHFRPSDQ\ DQGLVQRZ0DQDJLQJ'LUHFWRU ³2XUDLPZDVWREXLOGDVWURQJQDWLRQDO VDOHVWHDPWRJURZWKHEXVLQHVVZLWK WKHEDVHRISURGXFWVDWWKHWLPHZLWKD YLHZWRH[SDQGLQJLQWRGLIIHUHQWSURGXFWV i.e. diversify. :KDWZHVHH today is a totally different business to then. Our SURGXFWUDQJH turnover and SUR¿WDELOLW\ KDYHEHHQH[FHHGHGEH\RQG H[SHFWDWLRQ´VD\V/HV ³7KHPDMRULW\RIWKHVDOHVWHDP are shareholders and directors of the EXVLQHVVDOOKDYLQJSXWPRQH\DQGORWV RIWLPHDQGHIIRUWLQWRJHWZKHUHZH DUHWRGD\DQGKDYHDOOEHHQZLWKWKH FRPSDQ\IRURYHU\HDUV´KHDGGV

(

)

Our success is all due to hard work and more hard work!

Overcoming challenges Advanced Polymers has faced some challenges during its 25 years of RSHUDWLRQEXWKDYHDOZD\VPDQDJHGWR overcome them. ³7KHPDMRULW\RIEUDQGVLQRXU EXVLQHVVDUHZHOONQRZQQRZEXWLQ WKH\ZHUHQRW7KLVZDVSUREDEO\ WKHWRXJKHVWSDUWRIRXUJURZWKSKDVH JHWWLQJWKHPDUNHWWRZRUNZLWKXVDQG PRYHDZD\IURPWKHWUDGLWLRQDOZHOO NQRZQEUDQGVDWWKHWLPH´/HVH[SODLQV ³2SHUDWLRQDOO\WKHUHZHUHDORWRI SURFHVVHVZHKDGWRLPSOHPHQW%UDG¶V H[SHUWLVHLQWKLV¿HOGDQGKLVDELOLW\ 20

FEB / MAR 2018

to integrate the various DVSHFWVRIWKHEXVLQHVV WRZRUNDVRQHLVWKH PDLQUHDVRQIRUZKDWZH KDYHLQSODFHWRGD\)RU me to run the business off WKLVEDVHKDVDOORZHGIRU more focus on delivering Advanced Polymers’ Executive Chairman Brad Jay and Les Whittal, Managing Director JURZWK´KHDGGV

Staff is company’s strength ³:KDW¶VH[FLWLQJIRUPHLVWKDWHYHU\ \HDUZHH[FHHGRXUEXGJHWWDUJHWV 7KLVLVSXWGRZQWRDZRUNHWKLFVHFRQG WRQRQHE\DOORIRXUHPSOR\HHV2XU VWDIILVRXUVWUHQJWK:HKDYHDORZ SHUFHQWDJHRIVWDIIWXUQRYHUZKLFK PHDQVZHKDYHDKDSS\HQYLURQPHQWWR ZRUNLQ´VD\V/HV ³:KHQDFRPSDQ\KDVV\QHUJ\ZLWK VWDIIVXSSOLHUVDQGFXVWRPHUVWKH FKDLQLVFRPSOHWHDQGRQHFDQRQO\ EHVXFFHVVIXOIURPWKDWSRLQWZHKDYH WKLV´KHDGGV³2XUVXFFHVVLVDOOGXHWR KDUGZRUNDQGPRUHKDUGZRUN:HQRZ KDYHDZHOOEDODQFHGEXVLQHVVWKDWLV VWURQJ¿QDQFLDOO\DQGRSHUDWLRQDOO\DQG RXUVDOHVWHDPDOOKDYHRYHU\HDUV¶ H[SHULHQFHLQWKHSODVWLFVLQGXVWU\2XU VWUDWHJ\RIGLYHUVLI\LQJKDVZRUNHGYHU\ ZHOOIRUXVDQGZKDWZHKDYHWRGD\LV YHU\GLIIHUHQWWRZKDWZHKDGLQ

$VDSULYDWHO\RZQHGFRPSDQ\ZH DUHH[WUHPHO\SURXGRIZKDWZHKDYH DFKLHYHGWRGDWH´ Global reputation Over and above our current range RIEXVLQHVVHVZHUHSUHVHQWZH KDYHRYHUWKHSDVWFRXSOHRI\HDUV EHHQDSSURDFKHGWRUHSUHVHQWVRPH FRPSDQLHVWRLQWURGXFHRUJURZWKHLU EUDQGVLQ6$WKH3770HWDOORFLQHV $UNHPD)XQFWLRQDO3RO\PHUVDQG %UDVNHP%LR3RO\PHUVDUHUHFHQW LQWURGXFWLRQVWRRXUSURGXFWUDQJHDQG DUHNH\WRXVVXSSO\LQJDIXOOUDQJHRI SURGXFWVLQWRWKHSDFNDJLQJLQGXVWU\ %HLQJDSSURDFKHGE\WKHVHZHOONQRZQ FRPSDQLHVLVDKXJHIHDWKHULQRXUFDS “Our strong service levels in VXSSO\LQJWKHORFDOPDUNHWZLOOFRQWLQXH WKLVVHWVXVDSDUW´FRQFOXGHV/HV www.advancedpolymers.co.za


News

Challenging materials no problem for Zerma shredders ZERMA Africa has commissioned several machines in South Africa in recent months, and sees a growing proportion of the local manufacturing and recycling sector prepared to invest in high quality, high performance recycling machinery. Outside of traditional plastic sizereduction applications, Zerma sees an increase in activity in the wood, rubber and solid waste recycling sectors, for which they have robust solutions. Zerma will be exhibiting at the upcoming Propak East Africa, 27 February to 1 March, in Nairobi, Kenya, and Chinaplas from 24-27 April in Shanghai, China. • Jeff Cawcutt, tel: +27 11 234 0895

22

FEB / MAR 2018

www.zerma.co.za

Zerma ZSS-1500 shredder – Jeff Cawcutt (Zerma Africa) with the new ZSS-1500 single-shaft shredder recently installed at a recycler in the Western Cape. The shredder will process a variety RI¿OPZDVWHDVZHOODVPRUHFKDOOHQJLQJPDWHULDOV VXFKDV33EXONEDJVWULPPLQJVDQGWDSHZLWKWKH shredder being customized accordingly. “There is often no substitute for raw power but many DSSOLFDWLRQVVXFKDVWKLVRQHUHTXLUHH[SHULHQFH DQGDQXQGHUVWDQGLQJRIWKHXQLTXHFKDOOHQJHVRI LQGLYLGXDOPDWHULDOV´H[SODLQV-HII

5LNXV:HLW]ZLWK3HUVSH[6$¶VQHZ&UXVKPDVWHU6KHDY\GXW\JUDQXODWRU which was put straight to work the minute it was installed. The combination of the heavy-duty rotor and restricted cutter-house design of the S-series LVWKHLGHDOFRQ¿JXUDWLRQIRUWKLFNDQGKHDY\PDWHULDODVZHOODVWKRVH PDWHULDOVWKDWDUHWUDGLWLRQDOO\SURQHWRRYHUIHHGLQJDQGRURYHUORDGLQJ more tangential machines

New Zerma ZCS series shredder/granulator combi ±:KHQWKHUH¶VOLWWOHURRPWRPRYH Zerma’s new ZCS series is the one-step solution for applications that call for an integrated shredding and granulation process. With the granulator positioned directly underneath the VKUHGGHUWKH=&6V\VWHPLVWKHLGHDOVHWXSIRU manufacturers wanting to turn-around their in-house waste in a TXLFNFRPSDFWDQGFRVWHIIHFWLYHPDQQHU³2XUQHZVKUHGGHU granulator combination system makes a lot of sense for in-house DSSOLFDWLRQVZKHUHVSDFHLVDWDSUHPLXPHQDEOLQJWKHFXVWRPHU WRUHGXFHWKHLUPDWHULDOWRWKH¿QDOUHTXLUHGUHSURFHVVLQJVL]HLQ RQHFRPSDFWV\VWHP´VD\V-HII&DZFXWWRI=HUPD$IULFD


News

Teqal Creative Packaging gets going at Dube trade port in KZN Sean Kirkham starts anew TEQ ALCreative a Pckaging, a new manufacturer of rigid packaging involving Sean iKrkham of Consupaq fame, has gone into operation at Dube Trade o Prt near iKng Shaka Airport in Z KN. Teqal has three partners, e Rnee .LUNKDP ¿QDQFLDO 'HDQ0LWFKHO RSHUDWLRQDO WRROLQJ DQG6HDQZKRLV the new company’s marketing director and also responsible for product development. 7HTDOKDVDPRGHUQHI¿FLHQWSURGXFWLRQ platform and state-of-the-art toolroom, DFFRUGLQJWR6HDQ0LWFKHOGRXEOHVXS as the company’s designer, using the EHVW&$'&$0VRIWZDUHDYDLODEOHZKLOH e Rnee iKrkham has also implemented 7HTDO¶V(535HDO7LPH0RQLWRULQJ systems. “We have taken everything to the next level by combining the best skills in the industry with modern equipment, mostly sourced from Europe. We wanted to do more than what we had done at Consupaq, so decided to take control of our own design and injection mould tooling. We engage with customers, design, 3D print, manufacture our own tooling and then mould the product, all in-house. This HQVXUHVFRQ¿GHQWLDOLW\DQGVXVWDLQDELOLW\´ said Sean.

The management team at Teqal in KZN includes Dean Mitchel (operations/tooling) and Sean POTO:N Y LNE ASK EW 0' DQG5HQHH.LUNKDP ¿QDQFLDO H

“Our focus is on injection moulded rigid SODVWLFSDFNDJLQJ´VDLG6HDQZKRKDG been s‘ emi-retired’ since 2010. “During the seven years I have been a new dad, built an aeroplane, developed some property on the North Coast and ridden my mountain bike the length and breadth of Southern Africa. a Pckaging has always been close to my heart, so I’ve stayed current with the newest technologies by attending

many international trade shows including Interpack, the ,Ka Lbelexpo, a Fkuma and others. “At the beginning of 2016 I started to make contact with a few old packaging colleagues and in e Fbruary 2017decided WRJHWEDFNLQ´VDLG6HDQ “Teqal will keep developing one stable production platform after another and EXLOGLQJRQRXUVWURQJUHSXWDWLRQ´KH added.

Nampak to revamp plastics business Reducing layers of management, consolidating plant footprint

Nampak CEO Andre de Ruyter. 3,&785(%/220%(5*:$/'2 SWIEGER S

24 FEB / MARCH 2018

ACK P AGING manufacturer Nampak is restructuring its plastics business in SA and Europe amid a fall in SUR¿WVIURPWKHGLYLVLRQPDQDJHPHQWVDLG The group announced impairments of 2 R47 m attributable to Nampak lP astics Europe after a major customer in the dairy industry decided to start making its own bottles. Nampak CEO Andre de u Ryter said the European business had been downsized, with Nampak agreeing to sell some of its plants to that customer. “We’re busy developing other markets to replace WKHYROXPHWKDWZH¶YHORVW´KHVDLG “We are looking at applying the same lightweighting technology that we used so successfully for dairy and selling that same technology to other SODVWLFERWWOHFXVWRPHUV´

1DPSDNKDGDOVRDSSRLQWHGDQHZ0'DQGFKLHI ¿QDQFLDORI¿FHULQ(XURSH “We’re already seeing the results come through LQLPSURYHGVDIHW\SHUIRUPDQFHDQGHI¿FLHQFLHV DQGZHIXOO\H[SHFWLPSURYHGSUR¿WDELOLW\ZLOOIROORZ LQWKHQH[W¿QDQFLDO\HDU´VDLGGH5X\WHU In SA, Nampak was stripping costs out of its plastics business. “We are reducing layers of management and ZH¶UHDOVRFRQVROLGDWLQJRXUSODQWIRRWSULQW´KHVDLG In Gauteng, Nampak will operate from its Isando facility and will close its plant in Industria, a move that de u Ryter expected to yield 1 Rm 7 -R 1m 8 in savings each year. In the year through September, Africa, excluding SA, contributed towards nearly two-thirds of 1DPSDN¶VWUDGLQJSUR¿WVZKLFKURVHWR5EQ


News

The Zeitz MOCCA Museum for Contemporary Art in the V&A Waterfront in Cape Town

Recycled PS in screeds & blocks at Zeitz MOCCA

26 FEB / MARCH 2018

Strength, durability without weight for 94-year old structure ONE of the most spoken about new buildings to open its doors in Cape Town recently, has undoubtedly been the new Zeitz MOCCA Museum for Contemporary Art in the V&A Waterfront. Originally an old grain silo complex that consists of forty-two, 33-metre-high concrete tubes – each with a diameter of 5.5 metres - this was once the tallest building on the Cape Town skyline. The mammoth task of redesigning these silos into a functional exhibition space of the highest possible quality, yet being strongly inspired by its own historic character, was given to internationally acclaimed designer Thomas Heatherwick and his innovative team of architects. Their brief was to create a space that would not only pay tribute to its original industrial design and soul, but would EHFRPHDPDMRUQRWIRUSUR¿WFXOWXUDO LQVWLWXWLRQWKDWKRXVHVWKHPRVWVLJQL¿FDQW collection of contemporary art from Africa and its diaspora. It was clear that this was a project that called for a solution that would be unique WR$IULFD,WZDVWKHUHIRUHRQO\¿WWLQJWKDW a unique construction solution developed and used in South Africa - by making use of recycled polystyrene - was to be used for this project. Greenlite Concrete products ZHUHVSHFL¿HGE\WKHDUFKLWHFWV

*UHHQOLWHFRQFUHWHSURGXFWVVSHFLÂżHG Greenlite Concrete products were VSHFLÂżHGE\WKHDUFKLWHFWVDVWKH structural engineers were concerned about excessive loading to the existing structure. “The original concrete frame of the old silos building was built in 1924, making the building 94 years old. The developers therefore needed a screed solution that would not put unnecessary load on the structure, yet would not compromise on quality, strength and durability,â€? said Greenlite Concrete’s Technical Director, Hilton Cowie. Concrete blocks manufactured with Greenlite Concrete weigh a quarter of typical concrete. They are also produced in sizes that are easy to handle for quick construction. According to Cowie, more than 2 000m2 of lightweight screeds were installed – equating to around 200 cubes of Greenlight lightweight concrete being used at the Zeitz Museum Hotel. The total weight of lightweight screeds once installed was around 100 tons, compared to the 400 tons that conventional screed would have weighed. “We recycle post-consumer polystyrene back into beads through our recycling plants. This material is then used as &RQFUHWHEORFNVPDQXIDFWXUHGZLWK*UHHQOLWH Concrete weigh a quarter of typical concrete

aggregate mixed with cement and additives WRIRUPLQVXODWHGVRXQGSURRIÂżUHSURRI water-resistant lightweight concrete blocks and screeds,â€? Cowie explained, adding that they successfully recycled and diverted PRUHWKDQWRQVRISRO\VW\UHQHIURPODQGÂżOO with the Zeitz project. Âł2XUVFUHHGVZHUHQRWRQO\VSHFLÂżHGIRU their lightweight aspect, but also for their outstanding acoustic performance which ZDVDQLPSRUWDQWIDFWRUIRUVRXQGSURRÂżQJ WKHKRWHOĂ€RRUV “With climate change looming and the rising cost of energy, using recycled polystyrene in building and construction applications is becoming an increasingly popular solution for architects and material VSHFLÂżHUV/DVW\HDUDORQHPRUHWKDQ 2 036 tons of polystyrene were recycled countrywide for this use in a wide variety of different types and sizes of buildings – ranging from schools, shopping malls, stateof-the-art museums and designer homes, to low cost housing solutions, schools and community clinics,â€? Cowie added. This material is lightweight and widely used by fast food restaurants and canteens, or as packaging material for meat, fruit and household appliances. We are urging South Africans to realise the tremendous value of this lightweight material that is not only able to reduce the structural concrete and steel requirements, but offers excellent insulation DQGHQVXUHVVLJQLÂżFDQWHQHUJ\VDYLQJV www.polystyrenesa.co.za www.greenliteconcrete.co.za


SE Series Servo Energy Saving Injection Moulding Machines Main components of Servo machines purposely spec’d for South Africa • PLC • Servo motor • Servo pump

Techmation (Taiwan) Phase (JV of Italy) Eckerle (Germany)

• Servo drive • Transducer • Hydraulic valves

• High performance closed loop servo control system • Shortens cycle times and increases production

Rexroth (Germany) Vashy (France) Rexroth ( Germany)

• Low power consumption saving 40-60% • Low noise

Auxiliary equipment ex stock: • • • • •

Hopper dryers Robots Hopper magnets Chillers Granulators

• • • • •

Mould clamps Auto loaders Colour dosers Glass tube water flow regulators Mould temperature controllers

Assorted heater bands, thermocouples, proximity switches, limit switches, bypass oil filters etc.

Sound represented in Contact: Gauteng Charles Rust 083 227 2593 011 396 1452 Durban - Peter Wessel 084 803 9260 031 702 3997/8

Southern Africa by: Bob Austen 083 679 1159 011 396 1452

Charles Rust Associates 20 Fifth Avenue, Bredell, Kempton Park P O Box 2380 Kempton Park 1620 Tel: 011 396 1452 Email: info@soundsouthafrica.co.za chasrust@acenet.co.za Website: www.soundsouthafrica.co.za


JUST BRIEFLY

News Coca-Cola system sells globally, we aim to take one back so it has more than one life. The company is investing its marketing dollars and skills behind this 100 percent collection goal to help people understand what, how and where to recycle,â€? the company said. “We will support collection of packaging across the industry, including bottles and cans from other companies.â€? “The company is building better bottles, whether through more recycled content, by developing plant-based resins, or by reducing the amount of plastic in each container. Coca-Cola has garnered plenty of attention for years now regarding its PlantBottle, a PET container made partially from renewable material. The company uses plant-based monoethylene glycol, which constitutes 30% of a PET bottle, as part of the formula to make the containers. The UHPDLQLQJLVSXULÂżHGWHUHSKWKDOLF and comes from fossil fuel-based sources.

Coca-Cola wants 50% recycled content by 2030 COCA-COLA wants to see its plastic bottles contain an average of 50% recycled content by the end of the next decade. The US Atlanta-based company is setting out to recycle the equivalent of 100% of its packaging by 2030 as part of an effort it calls World Without Waste. “By 2030, for every bottle or can the

Incledon opens in Free State INCLEDON Bloemfontein was launched RIÂżFLDOO\LQ-DQXDU\KDYLQJVWDUWHG operating in 2017. The business will service the civil, irrigation, mining, and industrial markets in the key Free State area, according to branch manager Conrad Wendelstadt. Incledon Bloem is located at 256 OR Tambo Street in Hamilton, in the heart of the old industrial area. The 1000m² premises includes about 450m² under roof and the balance comprising yard space. “Our aim will be to ensure we keep VXIÂżFLHQWVWRFNRIWKHFRUUHFWSURGXFWV for customers at all times. We will focus on our core business, which is civil tenders, irrigation projects, mining and industrial and cross-border supplies,â€? added Wendelstadt.

28 FEB / MARCH 2018

Putting Putting all all your your eggs eggs in in one one basket? basket?

Putting Puttingall allyour youreggs eggs ininone onebasket? basket? )RURYHU\HDUV0%7KDV EHHQ7+(UHOLDEOHVXSSOLHU RIFKRLFHIRU\RXULLDPE, LDPE, HDPE, PVC, PET, PS, ABS, PP and WaxUHTXLUHPHQWV

www.mbtsa.co.za SPREAD YOUR RISK MBTSouth SouthAfrica Africa MBT Distributors of Plastic Raw Materials Unit 16 (DVWZRRG2IÂżFH3DUN Unit 16, Eastwood Office Park, 8QLW(DVWZRRG2IÂżFH3DUN E5LOH\5RDG%HGIRUGYLHZ 11b Riley Road, E5LOH\5RDG%HGIRUGYLHZ7HO Tel: +27-11-455 2889Bedfordview: Tel: 011 455 2889

Lance vd Merwe 3DXO*ULSSHU Paul Gripper 7LDJRGRV5DPRV Tiago dos Ramos

6WHYHQ&RDWHV

082 901 0477  082 456 6659  082 775 5344 

&DSH7RZQ2IÂżFH &ROOHJH+RXVH Cape Town Office, 4 College House, &DSH7RZQ2IÂżFH&ROOHJH+RXVH 9LOODJH:DON3DUNODQGV Village Walk, Parklands: Tel: 021 556 7787 9LOODJH:DON3DUNODQGV7HO Tel: +27-21-5567787

Carlotta Stafford 082 600 7403 &DUORWWD6WDIIRUG  Helga Ferreira 072 573 4221 +HOJD)HUUHLUD  Ivan Horowitz 072 896 6636 ,YDQ+RURZLW] 


Holland Colours’ Natural Collection - colour pigments that are nonWR[LFDQGGHYHORSHGVSHFL¿FDOO\IRU3(7DQGELRSRO\PHUV

Holland Colours truly sustainable colours Non-toxic colorants made from renewable resources WITH an increasing demand for eco-friendly products, Holland Colours have combined nature and science to help make a product even more alluring to today’s conscious consumer by reducing corporate carbon footprint with non-toxic colorants made entirely from renewable resources. Go truly green $JOREDOVSHFLDOLVWLQFXVWRPHUVSHFL¿FFR ORXULQJSURGXFWV+ROODQG&RORXUVLVWKH¿UVW company to develop a product line in which colour pigments are non-toxic and developed VSHFL¿FDOO\IRU3(7DQGELRSRO\PHUV The Natural Collection represents a truly sustainable solution in polymer packaging, one that combines aesthetics and technology with environmentally friendly materials. Holland Colours’ latest innovation uses www.banbury.co.za

non-petroleum-based pigments and a bio-derived carrier that provides colorants made entirely from renewable resources. Many of these pigments are FDA compliant, making them suitable for packaging and other food-contact applications. The Natural Collection palette also offers converters a 100% non-petroleum based colorant option that can be used for a variety of biopolymer applications. The Natural Collection will initially target the branding and packaging needs of cosmetics and personal care markets. As with other Holland Colours’ Holcobatch SURGXFWVEHQH¿WVRIWKHHQYLURQPHQWDOO\ friendly colorant include low-dosing, lowGXVWIUHHÀRZLQJDQGHDV\SURFHVVLQJ7KH Natural Collection also provides competitive advantages in terms of branding.

About Holland Colours Holland Colours develops, produces and commercializes solid and liquid colorants, masterbatches and additives for colouring ULJLGDQGÀH[LEOH39&IRUWKHEXLOGLQJDQG FRQVWUXFWLRQLQGXVWU\DVZHOODV3(7DQG SRO\ROH¿QVIRUWKHSDFNDJLQJLQGXVWU\7KH company also offer colour concentrates for coatings, elastomers and adhesives and other applications. Holland Colours is D'XWFKFRPSDQ\OLVWHGRQWKH(XURQH[W $PVWHUGDP6WRFN([FKDQJH:LWK committed employee shareholders and RSHUDWLRQVLQWKH$PHULFDV(XURSHDQG Asia, it provides personal local service on a global scale. • Banbury Chemicals are the local agent for Holland Colours in South Africa

www.hollandcolours.com

COLOURING

YOUR WORLD WITH

ACCURATE DOSING DOSING EQUIPMENT - reducing and controlling masterbatch consumption and colour variation Colourants- PET, PVC, PE and PP dry colorants Reheat additives, UV stabilisers and Tint mask Carbon Black Masterbatch Unique Polymer solutions

Tel: 016 365 6760 | Email: info@banbury.co.za www.banbury.co.za

FEB / MARCH 2018 29


People

Kathy Garde’s back in research Polymer researcher develops material solutions for product development AFTER 12 years in technical sales in the rubber and plastics industry, Carst & Walker research and development manager Kathy Garde has been given the opportunity to focus on her main passion again, R+D. Dr Garde is an academic at heart and the time spent in industry has equipped her with relevant perspective and understanding of what is necessary for research projects for both plastics and rubber product development applications. :LWKKHURI¿FHDQGODERUDWRU\QRZORFDWHGDWKHUDOPDPDWHU the Nelson Mandela University in Port Elizabeth, Kathy has access to the university’s facilities and expertise on a fulltime basis. She completed her PhD at the university in 2004. Her main work involves various projects for the Carst & Walker group’s manufacturing businesses, including Davro Compounding and Anchor Chemicals, focussing on optimising chemical syntheses and production processes. She also investigates new materials and products that Carst & Walker could potentially produce. Testing and research is not limited to polymers, however, and includes applications in other areas where C&W is involved, including the coatings, adhesives, chemical, medical, pharmaceutical and food sectors. Kathy enjoys the challenge of stepping out of her comfort zone. Besides the various Carst & Walker projects, she also offers technical assistance to customers and the wider industry involving problem-solving and general testing for application development. Where convertors encounter problems in manufacturing, Kathy conducts full investigations and assists with the development of appropriate solutions. Anyone involved in product development in these sectors will be acutely aware of the importance of grade selection, and the dangers of specifying an unsuitable material grade for a product. Errors can be wasteful and even terminal for new products. Kathy has shown at industry symposia and in her

Back on campus – Kathy Garde’s expertise in material science developed when she studied polymer chemistry at NMU, was put to practical test while she was involved in sales at Carst & Walker and is now going to the next level in on-going research funded by C&W

work that she has a high level of understanding of polymer chemistry, which very few do, and is continually learning more. Recommending material solutions is a high responsibility undertaking, but one which Kathy is totally enthusiastic about. Dr Garde also worked as a lecturer and researcher at the Nelson Mandela University for three years before joining C&W where she continues her work with NMU as a research associate, assisting post-graduate students looking at formulations, additives and methods to reuse waste rubber and SODVWLFPDWHULDOVLQVWHDGRIWKHVHJRLQJWRODQGÂżOO “I suppose you could say I have an obsession for understanding how things work, in science and nature,â€? says Dr Garde. “The more you learn, the more you realise how much there still is to learn! It is IDVFLQDWLQJDQGKXPEOLQJDQG,ÂżQGLWLQWHQVHO\VDWLVI\LQJ´

People on the move Rudi Verwey has recently joined Brenntag South Africa where he has been appointed Head of Product Management in the Material Science Division, based in Johannesburg. Rudi has been one of the most consistent characters in the polymer supply business in SA since the early 1980s when he joined Plastomark, initially in tech services but later in material development. After Dow Chemical bought Sentrachem (original JV owner of 3ODVWRPDUN6DIULSRO KHVSHQW¿YH\HDUV in Holland with Dow Plastics Europe as a technical service & development engineer. Africa beckoned though and on his return in 2004 he joined Protea Polymers. Now, some 13 years later, he’s moved to the former Plastichem (now Brenntag SA), where his life-long career in materials science continues. Rudi has, with his ND in Polymer Technology, IMM Marketing 0DQDJHPHQWFHUWL¿FDWHDQG0DQDJHPHQW 30 FEB / MAR 2018

Studies at the University of Stellenbosch Business School as background, served in many technical, sales and marketing roles over the years and is thus well equipped for his new role and is looking forward to the challenge. Mayuri Naidoo has been Charles Goldman has Mayuri Naidoo has been appointed appointed as a business joined Continental as a business development manager development manager at Compounders at Mpact Polymers as part of the Mpact Polymers as part of management team the management team. She and later moved on to various commercial is responsible for developing and sustainability roles at Dow Plastics the perception of recycled PET across and thereafter Safripol before taking various applications interacting with global up a director’s position in business brand owners, retailers and the plastics development at Philips Lighting Solutions converting industry with a drive towards sustainable plastic packaging. Naidoo has before joining Mpact Polymers recently. Charles Goldman has joined a chemical engineering diploma and a Continental Compounders, where he has Master’s degree in business administration. She began her engineering career at Sasol been appointed business manager for


a star at world amputee games +(67,&2¶V1LFNLH6WU\GRP LQWHUQDO VDOHV KDVHYHU\UHDVRQWREH SURXG±KHUHFHQWO\ZRQWZRPHGDOV DWWKH,:$6:RUOG*DPHV 7KHWKHGLWLRQRIWKH,QWHUQDWLRQDO :KHHOFKDLU $PSXWHH6SRUWV Federation World Games was hosted LQ9LOD5HDOGH6DQWR$QWRQLR 3RUWXJDOIURP1RYHPEHUWR WK'HFHPEHUZKHUHDWKOHWHV FRPSHWHGRYHUIRXUGD\VLQ DUFKHU\DWKOHWLFVVZLPPLQJ WDEOHWHQQLVDQGSDUDWDHNZRQGR 6WU\GRPZKRVHOHIWOHJLV DPSXWDWHGDERYHWKHNQHH±ZDV SODFHGQGLQWKHGLVFXVWKURZ UGLQVKRWSXWDQGWKLQWKH javelin event. $QGWKLVZDVDIWHUKHWRUH ligaments in his right knee in 0DUFKDQGKDGWREHUHFODVVLILHG DVD) ILHOGHYHQWVHDWHG DWKOHWH LQVWHDGRID) ILHOG event, standing athlete). With only three months to train DVDFODVV)FRPSHWLWRUDIWHU KLVLQMXU\LQ0DUFK6WU\GRP IRXQGLWYHU\WRXJKJRLQJDW times, struggling with his shotput WHFKQLTXHDQGZDVUHDG\WR WKURZWKHWRZHOLQ%XWKHGLGQ¶W

Rudi Verwey has joined Brenntag South Africa, where he teams up with Helmut Oellermann

the Engineering Polymers division. Charles, who is a TXDOL¿HGFKHPLVW has spent an extended period in the material FRPSRXQGLQJDQG VXSSO\VHFWRU LQFOXGLQJRYHU\HDUVDW3ODVWDPLG During that period he was involved PDLQO\LQDSSOLFDWLRQGHYHORSPHQWIRU HQJLQHHULQJSODVWLFVDVVLVWLQJFRQYHUWRUV DURXQGWKHFRXQWU\E\WDLORULQJPDWHULDOV IRUH[DFWSURGXFWSHUIRUPDQFHFULWHULD &RQWLQHQWDOKDVEHFRPHRQHRI6$¶V WRS39&FRPSRXQGHUVZLWKDVL]HDEOH H[SRUWPDUNHWDQGLWQRZDOVRFRPSRXQGV SRO\ROH¿QVDQGSRO\DPLGHVDWLWVVHFRQG SODQWLQ1HZ*HUPDQ\'XUEDQ Herman Jacobs has joined Nampak

DQGDIWHUZDWFKLQJWUDLQLQJYLGHRDIWHU YLGHRDQGSXWWLQJLQWKHSUDFWLFHWLPH needed, he eventually got it right. ³:KLOHFRPSHWLQJDJDLQVWVRPH RIWKHZRUOG¶VEHVWDQGVSHDNLQJWR RWKHUDWKOHWHVIURPRWKHUFRXQWULHV

,DOVRSLFNHGXSVRPHJUHDWWLSVRQ KRZWRLPSURYH´VD\V6WU\GRP³,¶P VWLOOH[HUFLVLQJDQGSUDFWLFLQJPRUH WHFKQLTXH0\ELJJHVWJRDOLVWRPDNH LWWRWKH3DUDO\PSLFVLIQRWLQ WKHQ´

Seen at Gold Pack

The who’s who of Extrupet at last year’s Gold Pack Awards – Vijay Naidu (joint MD), Vinod Chhabra (CEO), Harry Havenga (national sales & marketing manager), Chandru Wadhwani (joint MD) and Krishna Somi Doraisamy (GM)

1LJHULD0HWDOVEDVHGLQ/DJRVZKHUHKH KDVEHHQDSSRLQWHG¿QDQFHDQGVXSSO\ FKDLQGLUHFWRU7KLVPDUNVDELJFKDQJHIRU +HUPDQZKRZDVIRUPHUO\ZLWK$VWUDSDNLQ 6RXWK$IULFDEDVHGLQ-RKDQQHVEXUJEXW DOWKRXJKKH¶VVZLWFKHGWRPHWDOFDQVKH¶V VWLOOLQWKHSDFNDJLQJVHFWRU1DPSDNKDV EHHQLQYROYHGLQ1LJHULDVLQFHWKHV LWPDNHVWKUHHSLHFHFDQVIURPPP DVZHOODVDHURVROFDQVDOVRWKUHHSLHFH Lee van der Haer6DOHV$VVLVWDQWLQ Adding some colour to the Gold Pack proceedings the Polymers Division at Carst & Walker were Samantha Choles and Robynne Folkus of the UHWLUHGDWWKHHQGRI'HFHPEHU Paper Association’s publication FEB / MAR 2018

31

People

Hestico’s Nickie


Materials 7KH$UODQ[HRVLWHLQ*HUPDQ\ ZKHUHWKHPDMRUFKORURSUHQH UXEEHUSURMHFWLVWDNLQJSODFH

Arlanxeo in big Chloroprene expansion ARLANXEO, one of the world’s leading suppliers of synthetic elastomers, is expanding its global chloroprene rubber (CR) production at its site in Dormagen, Germany. The production capacity there will be increased to as much as 70,000 tons per year overall and will be available E\WKHÂżUVWTXDUWHURI$UODQ[HRLV investing an upper single-digit million Euro amount in the expansion project overall. “The strong global demand for our chloroprene rubbers will continue in the coming years,â€? said Stefan Rittmann, MD or Arlanxeo Deutschland. Demand for chloroprene rubbers is growing by about 4% per year, particularly in Asia and

especially in Greater China. Arlanxeo produces and markets its chloroprene rubbers under the Baypren and Baypren ALX brands. They are used, for example, in the production of cable sheathing, belts, conveyor belts and wetsuits, as well as in adhesive applications, and feature high weather, UV and oil resistance. • Arlanxeo – a joint venture involving Lanxess and Saudi Aramco estabOLVKHGLQ$SULOÂąLVDZRUOGOHDGLQJ SR manufacturer with sales of around ÂźELOOLRQLQDERXWHPSOR\ HHVDQGDSUHVHQFHDWSURGXFWLRQ sites in nine countries. Its core business is the development, manufacturing and

32 FEB / MARCH 2018

Red card for oxygen -XVWWKUHH\HDUVDIWHULQWURGXFLQJWKHÂżUVW3%7 (polybutylene terephthalate) grade for coffee capsules, %$6)KDVH[SDQGHGLWVSURGXFWOLQHRIIRRGFRQWDFW JUDGH3%7VZLWKD3%7ÂľVXSHULRUÂśZKHQLWFRPHVWR R[\JHQWUDQVPLVVLRQ7KLVPDWHULDOJRHVE\WKHQDPH UltradurÂŽ%DUULHU %)& 'LIIHUHQWLQGHSHQGHQW WHVWUHVXOWVKDYHDOOVKRZQWKHVDPH275 R[\JHQ WUDQVPLVVLRQUDWH YDOXHVDUHEHORZWKHOLPLWRI TXDQWLWDWLRQDFFRUGLQJWR,62',1 test standards

marketing of high-performance rubber for use in, for example, the automotive and tyre industries, construction and oil and gas industries. “There have been shortages of CR LQWKHPDUNHWRYHUWKHSDVWPRQWKV´ said Helmut Oellermann of Brenntag South Africa. “Participants in the rubber and adhesives markets will be acutely aware of this.â€? • People interested in more information regarding Baypren (rubber industry) and Baypren ALX (adhesives) should contact Andrew Bannatyne of Brenntag SA.

andrew.bannatyne@brenntag.co.za


A new generation takes shape.

Take the proven and tested, make it even better and explore something new – that is what makes ENGEL and their customers so successful. Following our claim be the first, we present a new generation of injection moulding machines setting new standards. For now, we will entice you with this: We do not compromise on energy efficiency, ergonomics or precision. Do you want to know more?

www.engelglobal.com www.greentechmachinery.co.za sales@greentechmachinery.co.za


Materials

High gloss in automotive interiors BASF has now succeeded in developing a specialty polyamide that combines the chemical resistance of semi-crystalline polyamides with the high gloss and the depth of view of amorphous plastics. UltramidÂŽ Deep Gloss is therefore particularly suitable for components in automobile interiors which are high-gloss and at the same time resistant without the need for coating. It is characterized by a EDODQFHGSURSHUW\SURÂżOHKLJKJORVVOHYHODQGH[FHOOHQWUHVLVWDQFH to scratching along with high chemical and good UV resistance. UltramidÂŽ Deep Gloss reproduces structures true to detail, thus allowing an interplay of light and shadow high in contrast.

www.ultramid-deepgloss.basf.com

*WZMITQ[ŸÅZ[\ ADCA-free material for data cables %25($/,6DQG%RURXJHKDYHODXQFKHGWKH¿UVWPDWHULDOVROXWLRQ free of azodicarbonamide (ADCA) for use as a blowing agent in foamed communication cables. As an innovative replacement solution, the ADCA-free grade HE4883 will become the material RIFKRLFHIRUQH[WJHQHUDWLRQKLJKHUFDWHJRU\FRPPXQLFDWLRQ cables. Borealis’ HE4883 offers several advantages. It meets requirements for Cat 6, Cat 7 and Cat 8 data cables. It is a fully formulated compound for reliable consistency. HE4883 also has RSWLPDOFHOOVWUXFWXUHVXSHULRUFRQFHQWULFLW\DQGKRPRJHQRXVFHOO structure support higher frequency transmission characteristics. Greater cell homogeneity and uniformity deliver increased resilience; enable higher twisting speeds and jacketing line speed without crush damage to cables. It also offers enhanced process stability with reduced preparation time, longer production runs and less scrap. • Borealis is represented in SA by IMCD South Africa

www.imcdsa.co.za

www.borouge.com

www.borealisgroup.com

New ZnO PRO vulcanization accelerator BRĂœGGEMANN Chemical, a specialist for zincbased additives used in the vulcanization of rubber, has developed a new range of reaction accelerators with its ZnO PRO series. The products, which are produced by a wet chemical SURFHVVFRPELQHWKHODWHVWÂżQGLQJVLQUXEEHU compounding with lower costs and reduced heavy metal content. At the same time, they allow the direct substitution of conventional WKHUPDO]LQFR[LGHZLWKRXWWKHQHHGWRPRGLI\ the formulation or make compromises on performance. ZnO PRO is suitable for the entire range of application of sulfur-vulcanizable rubber – from technical parts and consumer goods to tyres. The product range comprises the A250, R260 and A280. All three result in vulcanizates with a high crosslinking density and uniform mechanical properties. They are also readily dispersible.

www.brueggemann.com 34 FEBRUARY / MARCH 2018


Milliken presents

The Clear, Energy-Saving Alternative for Polypropylene Milliken’s Millad® NX™ 8000 clarifying agent offers injection molders a crystal-clear polypropylene that boosts productivity while saving energy. NX™ UltraClear Polypropylene (PP), which can only be made using Milliken’s Millad® NX™ 8000 clarifier, delivers many clear benefits to injection molders. The resulting lightweight material combines clarity, aesthetics, productivity improvement and sustainability, while setting a new standard in clear, high-transparency PP. Millad NX 8000 dissolves extremely well even at lower temperatures to create a high density of smaller crystals, which contributes to unrivaled clarity.

Download the Energy Savings Calculator on iTunes to calculate your potential savings, or go to chemical.milliken.com.

NX UltraClear PP also can be processed at much lower temperatures, resulting in significant energy savings. This often can cut energy consumption by 10-20% – and in some cases by more than 30% – while producing fewer CO2 emissions.

low

Reduce Cycle

Cycle Time (s)

high

Tests additionally have shown that, in turn, the lower molding temperature reduces the cooling time, resulting in a reduction in cycle time per unit of up to 15%, compared with traditional clarifiers. This allows molders to produce many more pieces per hour and yields a lower cost per unit.

Millad NX 8000 resin

ce du Re

Millad NX 8000 resin

low

Reduce T

Traditional clarifier resin

cle Cy nd a T

Milliken has put the energy-saving potential of its ground-breaking PP clarifying agent at your fingertips with its free Millad NX 8000 Savings Calculator App. This app is the first of its kind to allow the industry to calculate potential energy savings, and estimate cycle time and CO2 reductions by using Millad NX 8000 clarified polypropylene versus traditionally clarified PP to produce clear parts.

Save manufacturing time and money, lower energy use and CO2 emissions, and still produce crystal-clear polypropylene parts using PP resin made with Milliken’s Millad NX 8000 clarifying agent.

Polypropylene clarified with Millad NX 8000 allows Lower Shorter process cooling temperature time

Energy Cycle time savings reduction of ~ 15% of ~ 10%

Magnitude of energy consumption (kW*hr/kg)

IM Temperature (°C)

high

Millad NX 8000

Traditional Clarifier

For more information contact Eurochem@milliken.com or visit our website chemical.milliken.com Please Note: As each customer’s use of our product may be different, information we provide, including without limitation, recommendations, test results, samples, care/labeling/processing instructions or marketing advice, is provided in good faith but without warranty and without accepting any responsibility/liability. Each customer must test and be responsible for its own specific use, further processing, labeling, marketing, etc.

© 2018. Millad® is a registered trademark of Milliken & Company. NX™ and Milliken™ are trademarks of Milliken & Company.


Materials

;WT^IaŸ[ÅZ[\ITT̉ XTI[\QK[\WX^IT^M SOLVAY’s high-performing RadelŽ polyphenylsulfone (PPSU) polymer has enabled China-based CiXi Zhenpeng Plumbing Fittings Company to replace traditional brass in a new line of all-plastic valves targeting pressurized hot water systems used in heating, ventilation and air conditioning (HVAC) applications. Among Zhenpeng’s new products LVWKHLQGXVWU\œV¿UVWDOO3368VWRSYDOYHWRPHHWVWDQGDUGVWHVWHGE\ WKH,QWHUQDWLRQDO$VVRFLDWLRQRI3OXPELQJDQG0HFKDQLFDO2I¿FLDOV (IAPMO). Solvay’s high-performance polymer also enabled a patented one-piece ball valve and valve rod design, a half-ball valve, and L-type and T-type valves. Solvay’s Radel PPSU offers high fatigue resistance, strong chemical resistance and high impact strength, as well as the highest long-term hydrostatic strength (LTHS) of any sulfone polymer, PDNLQJLWZHOOVXLWHGIRU¿WWLQJVXVHGLQPXOWLOD\HUSLSLQJV\VWHPV that can operate under high pressure (up to 10 bar) and temperatures up to 95°C.

www.solvayspecialtypolymers.com

SABIC adds PP =T\ZI5MT\;\ZMVO\P ZM[QV\WOTWJITNWIU XWZ\NWTQW SABIC has added PP-UMS (Ultra Melt Strength) resin, a completely new generation of melt strength polypropylenes, to its foam portfolio. The new resin is unique in the market, with a melt strength of more than 65 cN and outstanding foam-ability. It can be used by all industry segments as a building block to develop new foaming solutions that enable an unprecedented level of light weighting. Looking to the future of light weighting, foaming is a key technology to push the boundaries and create even more down gauging opportunities in the industry. The new SABICÂŽ PP-UMS material can be used to enhance light-weighting in the automotive, packaging and building & construction markets.

www.sabic.com

*]TS̉XIKS[I][IOM[[\IaNZM[PQVXTI[\QKXIQT A GERMAN meat producer is using the SuperLiftŽ plastic pail from RPC Superfos for its bulk-pack sausages. Metten Fleischwaren opted for the RPC bucket for its long shelf-life, easy-handling, and brilliant look, as well as its IML oxygen barrier protection. The company is using the large 4.6 litre injection-moulded SuperLift polypropylene pail, 226mm LQGLDPHWHUIRU¿YHW\SHVRIVDXVDJHVWKDWLWVHOOVLQEXON consumer packs, including Germany’s most popular variety of the veal-based bockwurst, Dicke Sauerländer. The pail’s barrier label allows for a nine-month shelf-life at ambient temperatures. To help achieve this, Metten subjects it to an autoclaving process at high temperatures for 1½ hours. The meat producer’s key target groups for the bulk packs are meat wholesalers, canteens and the foodservice industry. $OOHQGXVHUVUHDSWKHEHQH¿WVRISODVWLFWKHUHLVQRULVNRI harm when touching the rim of the container – which is also easy to open and re-close, while the handle and light weight make it hassle-free to carry. Moreover, it is easy to stack the pails at any time before, during or after use.

www.rpc-superfos.com 36 FEBRUARY / MARCH 2018


Materials

Long-term seal integrity, lower processing costs 1(:PHGLFDOJUDGHWKHUPRSODVWLFYXOFDQL]DWH 739  HODVWRPHUVIRULQMHFWLRQPRXOGHG2ULQJVJDVNHWV DQGGLDSKUDJPVH[KLELWH[FHOOHQWORQJWHUPVHDOLQJ SHUIRUPDQFHFRVWOHVVWRSURFHVVWKDQWKHUPRVHW UXEEHUDQGSURYLGHPDQXIDFWXULQJDGYDQWDJHVRYHU VWDQGDUG739VDQGVW\UHQLF73(V0HGDOLVWŠ0' FRPSRXQGVSURYLGHUXEEHUOLNHHODVWLFLW\VXSHULRU ORQJWHUPFRPSUHVVLRQVHWDQGFKHPLFDOUHVLVWDQFH &RPSRXQGVLQWKHQHZ0HGDOLVWVHULHVDUHQRQ K\JURVFRSLFUHQGHULQJSUHGU\LQJXQQHFHVVDU\DQG WKHLUOLJKWHUQDWXUDOKXHPDNHVWKHPHDV\WRFRORXU 0HGDOLVW0'6HULHVFRPSRXQGVDOVRH[KLELW EHWWHUKLJKWHPSHUDWXUHVWDELOLW\WKDQVW\UHQLF73(V

ZZZWHNQRUDSH[FRP

Total develops new grade HDPE for thermoforming 727$/3HWURFKHPLFDOVDQG5H¿QLQJ86$KDVJHQHUDWHGH[FLWHPHQW LQWKHVKHHWH[WUXVLRQWKHUPRIRUPLQJ 6(7 PDUNHWZLWKWKH LQWURGXFWLRQRIKLJKGHQVLW\SRO\HWK\OHQHJUDGH(7KLVJUDGHLV ZHOOVXLWHGIRUVKDOORZGUDZWKHUPRIRUPHGSDFNDJLQJDSSOLFDWLRQV LQWKHIRRGVHUYLFHDQGIRRGSDFNDJLQJLQGXVWULHVWKDWUHTXLUHKLJK ULJLGLW\DQGWRXJKQHVV7RWDO¶V(KLJKGHQVLW\SRO\HWK\OHQH GHOLYHUVWKHVWLIIQHVVQHHGHGLQ6(7DSSOLFDWLRQV7KHLQFUHDVH LQVWLIIQHVVDOORZVOLJKWZHLJKWLQJ\HWPDLQWDLQVWKHSHUIRUPDQFH FRPSDUHGWRRWKHU+'3(JUDGHVXVHGLQ6(7DSSOLFDWLRQVRUWRPDNH DSURGXFWRIHTXLYDOHQWZHLJKWEXWZLWKLPSURYHGSHUIRUPDQFH2WKHU SRVLWLYHDWWULEXWHVWKDW(RIIHUVDUHLPSDFWVWUHQJWKFKHPLFDO UHVLVWDQFHDQGORZZDWHUYDSRXUWUDQVPLVVLRQUDWH

ZZZSRO\PHUVWRWDOFRP

New routes for post-consumer recycled polystyrene 727$/KDVMXVWFRPSOHWHGDQLQGXVWULDOVFDOHWHVWUXQIROORZLQJ DVHULHVRISLORWSODQWWULDOVGHPRQVWUDWLQJWKHIHDVLELOLW\RI VXVWDLQDEOHLQFRUSRUDWLRQRIDERXWRISRVWFRQVXPHUUHF\FOHG SRO\VW\UHQHZLWKLQYLUJLQSRO\VW\UHQH7KHWULDOZKLFKZDVFDUULHG RXWRQDQH[LVWLQJSURGXFWLRQDVVHWVXFFHVVIXOO\OHGWRSURGXFW ZLWKSURSHUWLHVHTXLYDOHQWWRYLUJLQSRO\PHU³3RO\VW\UHQHLVRQH RIWKHHDVLHVWSRO\PHUVWRUHF\FOH´H[SODLQV-HDQ9LDOOHIRQW YLFHSUHVLGHQW3RO\PHU(XURSH³2XUVXFFHVVKLJKOLJKWVWKDW SRO\VW\UHQHZKLFKQDWXUDOO\SURYLGHVRXWVWDQGLQJSHUIRUPDQFH IRUYDULRXVDSSOLFDWLRQVZLOOEHDVLJQL¿FDQWFRQWULEXWRUWRWKH FLUFXODUHFRQRP\,WLVXQTXHVWLRQDEO\DQLQQRYDWLYHZD\WR HQODUJHWKHDFFHVVLEOHPDUNHWIRUUHF\FOHGSRO\VW\UHQHDQGWR FRQYHUWDODUJHYROXPHRISRVWFRQVXPHUZDVWH´%DVHGRQWKLV HQFRXUDJLQJUHVXOW7RWDOLVODXQFKLQJQHZGHYHORSPHQWVWR PDQDJHFRQWDPLQDWLRQRIUHF\FOHGVWUHDPV7KHREMHFWLYHLVWR FUHDWHDUREXVWSURFHVVLQRUGHUWRKDQGOHFRPSOH[SRO\VW\UHQH ZDVWHVWUHDPVWKDWFDQEHLPSOHPHQWHGRQRXUGLIIHUHQWH[LVWLQJ SURGXFWLRQOLQHV

ZZZSRO\PHUVWRWDOFRP 38 FEBRUARY / MARCH 2018


Husky offers barrier solution as a module of HyPET HPP5 HUSKY Injection Moulding Systems’ PET preform barrier module, built on the HyPET HPP5 platform, offers manufacturers new possibilities to explore PET as a packaging material for products requiring enhanced barrier properties. With the HyPET HPP5 barrier module, packaging manufacturers have the freedom of design to distinguish products for maximum shelf appeal, in ways that were previously impossible. With the highest ever system capability, Husky can produce multi-layer preforms with a wide range of barrier content, even below 3%, while delivering up to 50% savings on barrier material costs for some applications and increasing system availability. 7KLVGHOLYHUVPD[LPXPÀH[LELOLW\DOORZLQJIRUIUHHGRPRIGHVLJQERWKDFURVV and within applications to customize how much barrier content is used. Being able to precisely dose barrier content and adjust the range within an application successfully ensures that seasonal variations are considered with relation to the shelf life of a sensitive product.

www.husky.co/EN-US/ FEB / MARCH 2018 39

        

RotoFloYourHoldings Supplier of Choice Members of:

Largest Supplier of Colour Compounded LLDPE in Sub Saharan Africa Colour Compounding of Rotomoulding Speciality Polymers Pulverising of Rotomoulding and Speciality Powders Agents for PSD Rotoworx PP, LaPlastecnica Vents and MIGSÂŽ &RQWDFW   

&OLYH5REHUWVRQ 0LFKDHO%|OWDX $QGUHZ5REHUWVRQ &KDQGD0XNXND

Website: Address:

ZZZURWRĂ€RFR]D 28 Hilston Road Kya Sands Randburg, Johannesburg South Africa

FOLYH#URWRĂ€RFR]D WHFK#URWRĂ€RFR]D DQGUHZ#URWRĂ€RFR]D VDOHV#URWRĂ€RFR]D

    7HO

+27 11 708 1919 (Fax)

Agents for:

Mold In Graphic SystemsÂŽ www.moldingraphics.com

LaPlastecnica


Association News

No direction from DEA with disposal No indication as to when the ‘new’ plan – SATRUCO or any other – will be promulgated THE end of business operations at REDISA, the tyre recycling plan, ceased on 29 September, effectively bringing the recycling of tyres in South Africa to a dead stop. As an emergency measure, Minister Edna Molewa transferred the operational responsibility to the Waste Management Bureau (WMB). Were it not for an illequipped WMB stepping in, the tyre industry would be facing serious waste tyre abatement challenges, or so we thought. The status of the scrap tyre industry is facing huge challenges with the effected parties all primary and secondary transporters (late or no payments and no SODFHWRGURSRIIVFUDS FROOHFWLRQSRLQWV RYHUĂ€RZLQJDV no or irregular collections are the order of the day), micro collectors (left in the lurch with no loads as scrap is ignored at the dealer and other collection points as the transporters have no place to deliver to, or at best only one load per week if any), depot RSHUDWRUV RYHUĂ€RZLQJ and in most instances closed down due to no income for the WMB.) Waste Management Bureau not coping The bottom line is simply that the WMB is not coping. The Waste Management Bureau was promulgated as an umbrella organisation under the auspices of the DEA to act as watchdog, monitor and distribute funds for the ministry and supply support to the broader waste industry (all waste) where required. It is not equipped in any way to cope with the daily execution and operations of an abatement plan. According to the liquidators’ termination notice, all affected parties were advised at the time of the demise of REDISA to contact the WMB should they have ‘any queries, including queries pertaining to payments, contracts and operational issues’. As much as this pointed to a sound solution at the time, it has come to our notice that industry sources are their at wits end as they just do not, according to them, have any access to the WMB and calls to the mobile number supplied by the liquidators are simply not answered. According to Ika van Niekerk of STISA (Scrap Tyre Industries Southern Africa Consulting), who gave presentations on the situation at IOM meetings in Pretoria and Port Elizabeth in October, it is also a concern that the WMB by virtue of their appointment and status within the 40 FEB / MAR 2018

(

)

Would have been logical business practice to run the REDISA and new plan parallel for at least two months Ika van Niekerk of STISA Consulting with Kerry Kirkman of Orchem and Darryl Walters of Cabot Reinforcement Materials, at the event in Port Elizabeth; Cabot sponsored the function

Stuart Brown, Bright Rwodzi and Joe Barker attended the event in Port Elizabeth in October

DEA, ‘has no executive powers to replace or act as an Integrated Waste Management Plan (IWMP) or business,’ according to industry sources. Additional concerns are that the WMB has no legal mandate to contract with tyre collectors, existing transfer sites or processors. Most disturbing, and in addition to the aforesaid, is that, should such service contracts be entered into, there is no assurance that service providers will be


Ika van Niekerk at the event in Pretoria, with Wendy Knott-Craig, Oscar Tarique, runner-up of the SA leg of the Young Persons’ Lecture Competition, and John Lithgow of Karbochem, which sponsored the evening

remunerated for their services. According to industry sources this is now the case as transporters and depot managers alike have either closed down operations or are ‘sitting it out’, faced with irregular or no payments for services rendered. The March 2017 Section 28 notice by the DEA was followed up with yet another during October asking interested parties to submit proposals for a Waste Tyre Management Plan for the recycling of tyres. It is believed that two plans were submitted. Of the two known submissions the SATRUCO plan was made public for comment. Sources within the DEA indicate that the plans have been under revision and are now ready for the Minister’s signoff for publishing in the Gazette. It has come to our notice that the possibility exists that the Minister is not fully aware of the status the scrap industry is in and questions arise as to if her staff are feeding her correct information. She and the DEA clearly have no idea of VWRFNSLOHVVWDUWLQJXSDOORYHUWKHFRXQWU\GHSRWVRYHUĂ€RZLQJ and contracted service providers either not being paid or paid in arrears. At a rate of over 400mt scrap tyres being generated daily with no plan in place, it is no longer a paw-paw approaching the fan and it is clearly not what the likes of a competent Minister Molewa would want to be held accountable for. There is no indication, at time of publication, as to when the ‘new’ plan – albeit SATRUCO or any other – will be promulgated. This in effect means that for the time being compliant abatement of scrap tyres will virtually come to a standstill as the WMB is not geared to manage the process properly. Comparison to plastic bag levy The scrap tyre levy is legislated as per the Waste Tyre Act. It is drawn from locally manufactured and imported tyres as well as tyres on imported vehicles. It is levied at the point of

manufacture and, for imported tyres, at customs clearing points. Dealers voluntarily show the levy on their invoices at point of sale for client awareness purposes. The situation has some telling similarities to that of the SODVWLFEDJOHY\ZKLFKZDVOHJLVODWHGLQ$WÂżUVWWKH HQWLW\FUHDWHGWRPDQDJHWKHEDJVHFWRUVSHFLÂżFDOO\WR set up structures to collect and recycle bags, was able to access the funds but then ran into administration and management problems and was wound up. The scenario with REDISA was slightly different, but the affect was the same – namely that collection and processing structures were not created, although the plans were bold. Backlog and possible illegal dumping Complaints from the public regarding illegal dumping of tyres started during July and is increasing daily. An estimated 170,000 tons of passenger and truck tyres arise as scrap DQQXDOO\/DQGÂżOOVLWHVQRORQJHUDFFHSWW\UHGXPSLQJDVZDV the accepted method of disposal pre-REDISA. Considering this, it stands to reason that illegal dumping will be the only method of disposal until the IWMP is promulgated. At a rate of 465 tons disposed of/dumped daily, the challenge to clean up will most certainly be bigger than ever. As it stands and without the extra burden of stockpiles being created, the shortage of active processors has over the past few months caused surplus scrap to be stockpiled in existing and new, illegal overfull depots nationally. Adding the unknown period until the new plan is operational will exacerbate the problem. In addition to this, it is to be noted that the SATRUCO and certainly no other plan has or would have budgeted for this additional waste. The question arises as to who will be responsible for this and at what cost? ‘New plan’ challenges Considering the REDISA legacy and the interim WMB emergency support, the ‘new plan’ will inherit the challenge of virtually starting from scratch in terms of creating a processing industry and other new legal takers of scrap tyres to succeed. Research shows that there is only one crumbing plant out of eight existing that is fully operational with a throughput capacity of 12,000 tons p/a. Out of the seven known pyrolysis plants, only two, as far as can be determined, are fully licensed and legal. Only one of these is fully operational with FEB / MAR 2018 41

Association News

leaves tyre dealers challenges


Association News

Update on Waste Road Map Strengthening capabilities in SA, pipeline of skilled post-graduates into the waste and secondary resources sector THE outputs of the waste road map would mean improved operational HI¿FLHQFLHVRIFXUUHQWRSHUDWLRQVQHZ HQGXVHPDUNHWVDQGQHZUHVHDUFK DYHQXHVIRU6RXWK$IULFDVDLG3URI /LQGD*RGIUH\ &6,5 DWD3(7&2 IXQFWLRQ ,QWKH'HSDUWPHQWRI6FLHQFH DQG7HFKQRORJ\ '67 DQGWKH&6,5 HPEDUNHGRQDSURFHVVWRGHYHORS DZDVWHUHVHDUFKGHYHORSPHQWDQG LQQRYDWLRQ 5' , URDGPDSWRJXLGH 6RXWK$IULFD¶VSXEOLFDQGSULYDWH VHFWRULQYHVWPHQWLQZDVWHUHVHDUFK

GHYHORSPHQWDQGLQQRYDWLRQWKURXJK WKHVXEVHTXHQW\HDUV 3XEOLVKHGLQZLWKDQ LQYHVWPHQWRIDSSUR[LPDWHO\5 ELOOLRQRYHU\HDUVWKHURDGPDSLV H[SHFWHGWRDVVLVWJRYHUQPHQWDQG LQGXVWU\LQVLJQL¿FDQWO\LQFUHDVLQJWKH GLYHUVLRQRIZDVWHDZD\IURPODQG¿OOV WRZDUGVYDOXHDGGLQJDOWHUQDWLYHV WKURXJKPRUHHIIHFWLYHGHFLVLRQ PDNLQJIDVWHULQVHUWLRQRIFRQWH[W DSSURSULDWHWHFKQRORJ\VWUHQJWKHQHG 5' ,FDSDELOLW\DQGWKHWUDQVIHURI NQRZKRZDQGWHFKQRORJ\

1RZWZR\HDUVODWHUDVSDUWRI WKHµ3(7&2 )ULHQGV¶VHULHV3URI Godfrey provided an update on SURJUHVVPDGHRQWKH:DVWH5',5RDG 0DS6KHRXWOLQHGWKHPDLQPLOHVWRQHV VLQFHWKHURDGPDSZDVFRPSOHWHG • 6WUHQJWKHQLQJFDSDELOLWLHVLQ 6RXWK$IULFDWKURXJKSURYLGLQJD SLSHOLQHRIVNLOOHGSRVWJUDGXDWHV LQWRWKHZDVWHDQGVHFRQGDU\ UHVRXUFHVVHFWRUDQGLQFUHDVLQJWKH VXSHUYLVRU\FDSDFLW\WRPHQWRUSRVW JUDGXDWHVWXGHQWV • 6XSSRUWLQJ5HVHDUFKDQG 'HYHORSPHQWDQG ,QQRYDWLRQWKURXJK VXSSRUWLQJWKHJHQHUDWLRQ RIQHZVFLHQWL¿FHYLGHQFH WKDWZLOOLQIRUPSROLF\ SODQQLQJGHFLVLRQ PDNLQJ VXSSRUWLQJ the development of QHZWHFKQRORJ\DQGRI DGDSWLQJWHFKQRORJ\WR 6RXWK$IULFDFRQGLWLRQV WKURXJK5 'DQG GHYHORSLQJWHFKQRORJLFDO solutions unique to South $IULFDQFRQGLWLRQV •(YLGHQFLQJGHFLVLRQ PDNLQJWKURXJKWDUJHWHG UHVHDUFKSURMHFWVDQG FRODXQFKLQJWKH6RXWK $IULFDQ%LRSODVWLFV)RUXP DPRQJVWRWKHU DQG •6WUHQJWKHQLQJ partnerships between LQGXVWU\DQGVFLHQFH DQGZLWKLQUHVHDUFK FRPPXQLW\

%DFNJURXQG<U :DVWH5RDGPDS

© Department of Science and Technology



www.petco.co.za

42 FEB / MAR 2018

IURPSDJH DFDSDFLW\RIWSD$OOWROGWKHRSHUDWLRQDOSURFHVVLQJ SODQWVKDYHDFRPELQHGFDSDFLW\RIWSDZKLFKLVD IDUFU\IURPWKHUHTXLUHGWRWDNHFDUHRIWKHVFUDS JHQHUDWHGDQQXDOO\ 6$758&2ZKHQDVNHGLILWVSODQZRXOGFRSHZLWKDEDWLQJ WKHDQQXDOWRQQDJH WSD JDYHWKHDVVXUDQFH WKDWµJLYHQWKHRSSRUWXQLW\ZHDUHZHOOSUHSDUHGWRFRSH ZLWKLQWKHUHTXLUHGWKHWRQQDJHZLWKLQWKHHQYLURQPHQWDO OHJLVODWLRQ¶$VNHGLIWKH\ZRXOGRUFRXOGFRSHZLWKWKH DGGLWLRQDOGDLO\WRQQDJHFXUUHQWO\EHLQJJHQHUDWHGZKLOHWKH '($LVµGUDJJLQJLWVIHHW¶WKHVLPSOHDQVZHUZDVWKDWLWLV QRWFDWHUHGIRULQWKHLUSODQDQGXQOHVVDGGUHVVHGVRRQHVW WKHSUREOHPZRXOGFHUWDLQO\RYHUWLPHEHFRPHYLUWXDOO\

LPSRVVLEOHDQGDWEHVWYHU\H[SHQVLYHWRFRSHZLWK,WLV TXLWHFOHDUWKDW'($ZLOOKDYHWRVKRXOGWKH\ZDQWWRVDYH WKHPVHOYHVWKHHPEDUUDVVPHQWRIEHLQJWKHFDXVHRIWKH ELJJHUSUREOHPJHWWKHQHZSODQSURPXOJDWHGVRRQHVW Time will tell if this is yet another paw-paw to hit the SURYHUELDOIDQ7KLVZRXOGEHPRVWXQIRUWXQDWHDVLWLV NQRZQWKDW'($LVDUJXDEO\RQHRIWKHWRSEHVWUXQ JRYHUQPHQWGHSDUWPHQWVLQWKHFRXQWU\ /HW¶VKRSHWKDW'($ZLOOQRWGLVDSSRLQWWKHLQGXVWU\DQG HVSHFLDOO\WKHVSRQVRUVZKRLQHVVHQFHDUHWKHPRWRULQJ SXEOLFZKRSD\WKH5SHUNLORJUDPFROOHFWHGE\6$56IRU PDQDJHPHQWE\7UHDVXU\WRIXQGWKHDEDWHPHQWRIVFUDSW\UH 2QO\WLPHZLOOWHOO www.iom3.co.za


Speak to usâ&#x20AC;Ś. we know Cooling!

TEL: 011 462 2990

info@demaplastech.co.za

www.demaplastech.co.za


Association News Seen at the 2017 PlasticsSA AGM were Anton Hanekom, Jeremy Mackintosh and Bernhard Mahl

Circular economy

the new roadmap to ensure sustainable growth Redesign systems and processes for a more sustainable future

44 FEB / MAR 2018

PLASTICS|SA, hosted a well-attended Annual General Meeting for 20162017 in Midrand during late November. Addressing the audience, Plastics|SA Chairman, Bernhard Mahl, stated that 2016 marked the lowest economic growth rate since 2000, barring the 2009 recession. “South Africa is a diverse country in terms of its resources and poses extreme challenges to an industry that is trying to create a more fertile environment for growth on the socioeconomic front,” Mahl said. He added that political uncertainty constitutes the biggest stumbling block to foster GDP growth and it continues to weigh KHDYLO\RQEXVLQHVVFRQ¿GHQFHDQG delay future investment that could have boosted the local plastics industry. Growth in manufacturing production and virgin material consumption Despite these challenges, seasonally adjusted manufacturing production increased by 1,3% in the three months ended August 2017 compared with the previous three months. “Six of South Africa’s ten manufacturing divisions reported positive growth rates over this period. The second largest contributions to the reported increase were made by petroleum, chemical products, rubber and plastic products (1,6% and contributing 0,4 of a percentage point). In addition, 2016 also saw a 1.9 % growth in virgin material consumption (to 1,518 000 tons per annum),” Mahl said. “Plastics continue to be an integral part of our modern society and have proved indispensable. However, locally and internationally, there is an

increasing amount of pressure from certain groups to ban the plastic bag and other single use plastics. This highlights the importance of effective plastic waste management and the plastics industry will have to innovate and adapt if it is to survive this negative wave,” Mahl warned. “Plastics should not only be seen as bags, straws and litter, but rather as a valuable enabler of quality of life required by a modern society, such as used in road and air transportation, communication and networking, leisure, entertainment, health and safety. Growth in plastics recycling Plastics|SA Executive Director, Anton Hanekom highlighted Plastics|SA’s various successes achieved this past year, most notable being the 5,9% increase in the recycling rate of plastics and diversion of waste from the FRXQWU\¶VODQG¿OOV “The latest plastics recycling rates clearly show that we are not merely paying lip service to our sustainability promises and commitments. As an industry, we are now diverting approximately 330 000 tons per annum IURPODQG¿OO7KHOHDGLQJPDUNHWV for recycled material continue to be packaging, building and construction and the automotive industries,”

Hanekom said. “South Africa currently only makes use of mechanical recycling, as no other commercial facilities currently exist for alternative plastics recycling. Compared to Europe’s mechanical recycling rate of 29.7 %, South Africa can indeed be proud of its recycling rate of 41.8 % for all plastics”. Public-private partnerships Another highlight of Plastics|SA’s successes this past year, was the forming of various Public-Private Partnerships aimed at stimulating and building relationships with Government. “The purpose was to create solid relationships and to set up forums where the industry leaders can openly engage in dialogue with Government on matters that impact their business. This has proven to be very successful and mutually EHQH¿FLDO:H are seeing the positive results from these engagements. A recent opportunity was to present at the Portfolio Committee on Environmental Affairs’ parliamentary colloquium on ‘Maximising the Circular :DVWH(FRQRP\LQ6RXWK$IULFD¶7KHVH discussions will guide future plans on the waste economy and will continue to be one of the association’s strategic initiatives going forward,” Hanekom said.

( ) “By adopting and embracing the circular economy, we are able to redesign systems and processes for a more sustainable future…”


3+272/2:5,(6+$53

www.plasticsinfo.co.za Thokozani Masilela of the DTI and Vuyo Sikwebu of Clariter of East London were welcomed at the event by Jeremy

Proudly South African synthetic rubbers for every step of your journey www.karbochem.co.za SALES AND MARKETING

Eastgate Office Park, Ground Floor, Block A South Boulevard, Bruma 2026, South Africa

WKDWQRWKLQJZHSURGXFHEHFRPHV ZDVWH´ The Plastics|SA Board of Directors ZKRZLOOEHUHVSRQVLEOHIRUGULYLQJWKH VWUDWHJLFGLUHFWLRQLQFRPSULVHV â&#x20AC;¢ $QWRQ+DQHNRP3ODVWLFV_6$ â&#x20AC;¢ %HUQKDUG0DKO &KDLUSHUVRQ 6DIULSRO 3W\ /WG â&#x20AC;¢ %RE%RQG3,6$ â&#x20AC;¢ *HRII%DUHQGV8OWUD3RO\PHU â&#x20AC;¢ *HURPH0DUULDQ6DVRO%DVH &KHPLFDOV â&#x20AC;¢ +HOPXW2HOOHUPDQQ%UHQQWDJ6RXWK $IULFD 3W\ /WG â&#x20AC;¢ -DQ9HQWHU6$330$ â&#x20AC;¢ -HUHP\0DFNLQWRVK 9LFH &KDLUSHUVRQ 3RO\RDN3DFNDJLQJ 3W\  Ltd â&#x20AC;¢ 0LNH0\HUV(36$6$ â&#x20AC;¢0[ROLVL.KXWDPD1DPSDN Limited â&#x20AC;¢5XGL-RKDQQHV3RO\PDUN Recycling â&#x20AC;¢:D\QH:LLG3LRQHHU Plastics

T +27 (0)11 601 1660 F +27 (0)11 616 6651 E kbcinfo@karbochem.co.za

FEB / MAR 2018 45

Looking forward /RRNLQJDWZKDWWKHIXWXUHKROGVIRUWKH ORFDOSODVWLFVLQGXVWU\LQWKHVKRUWWR PHGLXPWHUPERWK+DQHNRPDQG0DKO VWUHVVHGWKHLPSRUWDQFHRIWKH circular economy becoming WKHQHZURDGPDSWRHQVXUH sustainable growth. ³3ODVWLFSURGXFWVDUHVRPXFK more than just the once-used VKRSSLQJEDJVVWUDZVDQG OLWWHUWKDWKDYHFRPHXQGHU¿UH UHFHQWO\:HPDNHYDOXDEOH FRQWULEXWLRQVWRWUDQVSRUWDWLRQ URDGDQGDLUTXDOLW\ZDWHUDQG VDQLWDWLRQFRPPXQLFDWLRQDQG QHWZRUNLQJKHDOWKDQGVDIHW\ leisure and entertainment.

3ODVWLFVDUHOLJKWZHLJKWYHUVDWLOHDQG GXUDEOHDQGDOORZXVWRPDNHDVWURQJ contribution to a more environmentally sustainable South Africa by saving energy and major resources â&#x20AC;&#x201C; such as food and water â&#x20AC;&#x201C; across the different VHFWRUVLQFOXGLQJSDFNDJLQJEXLOGLQJ DQGFRQVWUXFWLRQDXWRPRWLYHHWF %\DGRSWLQJDQGHPEUDFLQJWKH FLUFXODUHFRQRP\ZHDUHDEOHWR UHGHVLJQV\VWHPVDQGSURFHVVHVIRUD more sustainable future. A change in the global and local economy brings SRWHQWLDOIRULQQRYDWLRQMREFUHDWLRQ DQGHFRQRPLFJURZWK:HORRNIRUZDUG WREULQJLQJNH\VWDNHKROGHUVWRJHWKHU DSSO\LQJWKHSULQFLSOHVRIWKH&LUFXODU (FRQRP\DQGEXLOGLQJPRPHQWXPWR UHWKLQNWKHIXWXUHRISODVWLFVWRHQVXUH

Association News

Plans to increase employment Plastics|SA is currently collaborating with a number of manufacturing industry associations in the â&#x20AC;&#x2DC;MAP-to-a-Millionâ&#x20AC;&#x2122; initiative which aims to create a million jobs by strengthening and growing the manufacturing sector in South Africa. ³2XU¿UVWVWHSLVWRLGHQWLI\ERWWOHQHFNV and constraints that the manufacturing sector is facing. It will highlight remedies DQGVXSSRUWUHTXLUHGIURP*RYHUQPHQW DQGLQGLFDWHWKHH[SHFWHGJURZWKLQWKH manufacturing sector and ultimately the SODVWLFVLQGXVWU\´+DQHNRPVDLG


Association News

Collaboration on plastics marine litter Inaugural event maps out action plan THE inaugural African Marine Waste Conference in Port Elizabeth in July was attended by approximately 200 delegates from nine African states and a further 10 countries from other continents. The event was managed by the Sustainable Seas Trust (SST) under the leadership of Dr Tony Ribbink, CEO of SST, and aimed to continue the concerted effort of better managing marine litter with the help of governments, NGOs, researchers and other stakeholders across the African continent. 3ODVWLFV_6$KRVWHGWKHÂżUVWWZR African Marine Debris Summits that took place in Cape Town in 2014 and 2016 with the support of UNEP (United Nations Environmental Programme), the Department of Environmental Affairs and SANBI (SA National Biodiversity Institute) and also participated in the launch of the African Marine Waste Network that took place in Port Elizabeth in July last year. â&#x20AC;&#x153;This yearâ&#x20AC;&#x2122;s conference built on the initiative started three years ago to create a platform for African and international delegates and experts to discuss issues relating to marine waste around the African continent, including data and research, capacity building, prosperity through the development of economic enterprises centred on waste management, education and awareness and the role of the consumer, government, industry and municipalities. The focus at this yearâ&#x20AC;&#x2122;s event was on ÂżQGLQJLQQRYDWLYHVROXWLRQVWKDWZRXOG cater to African circumstances and cultures and using opportunities to shape a brighter future for the human health, economies and environments of Africa,â&#x20AC;? explained Douw Steyn, sustainability director at Plastics|SA. â&#x20AC;&#x153;By bringing together delegates primarily from Africa, along with advisors from other continents, a variety of different sectors and insights were represented. We participated in various fruitful discussions and debates on issues relating to marine waste in Africa, enabling us to develop a strategic plan entitled â&#x20AC;&#x2DC;Marine Waste Strategy: 46 FEB / MAR 2018

Besides Plastics|SA, all the industryâ&#x20AC;&#x2122;s main trade associations were present at the Marine Waste Conference, including PETCO, POLYCO and the PSPC â&#x20AC;&#x201C; and thankfully for them, there ZHUHQÂśWDQ\ÂżUHVSLWWLQJSURWHVWRUVDURXQGZKLFKPD\KDYHEHHQWKHFDVHLQVRPHQRUWKHUQ hemisphere countries

Guide to Action for Africaâ&#x20AC;&#x2122;, for tackling and alleviating the continentâ&#x20AC;&#x2122;s waste problems,â&#x20AC;? Steyn disclosed. In addition to presentations, panel discussions and parallel sessions, workshops on microplastics, data and research, and mobile applications were also held over the duration of the conference. Plastics|SA chaired an industry workshop featuring participants from various sectors. Industry representatives, scientists, educators, waste disposal experts and the maritime sector were encouraged to engage in a debate which aimed to identify the issues that have the biggest impact on the marine environment. Points highlighted during panel discussion One of the main points raised during the panel discussion was that it is vital that industry has awareness of marine waste issues. Other points raised included Communication between industry members needs to be improved in order to integrate fragmented initiatives, avoid duplication and promote best environmental practices. Focus should not be exclusively on packaging companies but should expand to include the maritime industry; Industry should take responsibility of marine waste issues and be encouraged to be compliant and accountable; Alliances and partnerships between sectors are also lacking and current public partnerships are too few and ineffectual. Industry needs to collaborate more openly and sincerely;

Knowledge gaps in technology and data should be addressed;

Recycling levels in South Africa and the perceived value of waste should be improved; Clear master plans need to be developed with tangible outcomes ZLWKLQVSHFLÂżFWLPHIUDPHVDQGZLWK impactful marketing plans to increase participation and buy-in by the general public. â&#x20AC;&#x153;The plastics industry has long been involved in efforts to reduce plastic marine litter, from conducting research to enhancing product stewardship to cleaning up beaches. As the umbrella body representing the entire South African plastics industry and a signatory of the Declaration of the Global Plastics Associations for Solutions on Marine Litter, Plastics|SA will continue to support and collaborate with industry efforts aimed at combatting marine litter. â&#x20AC;&#x153;We recognise that there is still a lot of work that needs to be done, but look back at very big inroads that we have already managed to make to address the problem head-on and offer real solutions. If we continue to take the right steps, we believe waste can indeed become SURÂżWDEOHWRFRXQWULHVRI$IULFD The environment, human health and tourism are but a few areas that stand to EHQHÂżWVLJQLÂżFDQWO\LIZHDUHWRGHYLVHD workable strategy for managing waste in and around our continent,â&#x20AC;? Steyn concluded. The next African Marine Waste Conference is set to take place in 2019. For more information or a detailed report about the conference, visit

https://africanwastenetwork.org.za

www.plasticsinfo.co.za


Association News

Challenging waste in the worldâ&#x20AC;&#x2122;s waters World-renowned oceanographer and explorer, Dr Sylvia Earle with Polyco CEO, Mandy NaudĂŠ

Polyco hosts international expert in SA to share solutions on marine pollution worldâ&#x20AC;&#x2122;s second most polluted continent on the planet and that waste accumulation is accelerating due to Africaâ&#x20AC;&#x2122;s rapidly rising population and urbanisation rates.â&#x20AC;? She added that in South Africa, only 177 000 out of 540 000 WRQVRISRO\ROHÂżQSODVWLFZDVWHZDVUHF\FOHGODVW\HDU â&#x20AC;&#x153;We still have a really good chance to make things better than they are. They wonâ&#x20AC;&#x2122;t get better unless we take action and inspire others to do the same. No one is without power. Everybody has the capacity to do something. There is plenty of reason for hope. This is the best time ever for change,â&#x20AC;? said Dr Earle.

www.polyco.co.za

CONSIDERING the millions of tons of plastic and other discarded material that go from the land into the sea every year, itâ&#x20AC;&#x2122;s no wonder that there is no place in the ocean that is free of it. We need to respect the oceans and take care of them as if our lives depended on it, because they do. This is according to world-renowned oceanographer and explorer, Dr Sylvia Earle who was brought to South Africa by Polyco to deliver the keynote address at the recently held inaugural African Marine Waste Conference. Polyco CEO, Mandy NaudĂŠ, said: â&#x20AC;&#x153;The Conference, and Dr Earleâ&#x20AC;&#x2122;s presence at it, were critical given that Africa is the

Upsurge in marine litter prevention programmes by Global Plastics Alliance Meeting in Malaysia shows commitment of numerous industry associations including Canada, India, Japan, Malaysia, Russia, South Africa, Thailand, Turkey, Vietnam, Colombia, the United States and Europe. One of the highlights of the meeting was updating the Global Declaration that was launched originally in March 2011 DWWKHÂżIWK,QWHUQDWLRQDO0DULQH'HEULV Conference. At the end of the event, signatories of the Declaration have grown to 70 plastics associations from regions across the globe that recognize and acknowledge the important role

WKH\KDYHWRSOD\LQÂżJKWLQJPDULQH litter. Africaâ&#x20AC;&#x2122;s voice in these matters is represented by Plastics|SA, PackagingSA and Ghana, which recently became a signatory. â&#x20AC;&#x153;Plastics|SA is proud to be one of the ÂżUVWVLJQDWRULHVDQGLVDFWLYHO\VXSSRUWLQJ projects in six key areas aimed at contributing to sustainable solutions, namely education, research, public policy, sharing best practices, plastics recycling/recovery and plastic pellet containment,â&#x20AC;? added Steyn.

This is the group of individuals who are most likely to direct the short-term future for the impact plastics SDFNDJLQJLVKDYLQJRQWKHPDULQHHQYLURQPHQWRQHRIWKHPRVWGLIÂżFXOWFKDOOHQJHVHYHUIDFHGE\WKH LQGXVWU\JOREDOO\'RXZ6WH\QRI3ODVWLFV6$ (middle row right, next to the gentleman from Ghana)

FEB / MAR 2018 47

REPRESENTATIVES of the Global Plastics Alliance (GPA) met in Penang, Malaysia from 13-15 December 2017 as guests of the Malaysian Plastic Manufacturers to accelerate and advance the Declaration of the Global Plastics Associations for Solutions on Marine Litter, also known as the â&#x20AC;&#x2DC;Joint Declarationâ&#x20AC;&#x2122;. According to Douw Steyn, Plastics|SAâ&#x20AC;&#x2122;s sustainability director, 19 countries from across four continents are participating in this joint initiative,


Association News

Burgeoning demand

for plastics training Manufacturers unlock the value of investing in their staff THE evolution of the plastics industry over the last two decades has been substantial. Looking at the growing world population and their never ceasing demand for better products, scenario analysts agree that manufacturing pressures will only intensify over the next ten years. This will put growing pressure on plastics manufacturers to demonstrate an ability to reinvent themselves â&#x20AC;&#x201C; a skill that will become pivotal for the survival of the plastics industry. Whilst South Africa boasts many local plastic manufacturers who are successfully demonstrating this dynamic side to the industry, there are still challenges that remain when it comes to monitoring those that help keep the industry going, namely the staff complements. According to Kirtida Bhana, Training Executive at Plastics|SA, an employeeâ&#x20AC;&#x2122;s ability to understand what is required in terms of producing a quality product for shipping is vital for the growth of an organisation. â&#x20AC;&#x153;While the employee may have the will and intention to learn and do well in their position, without the correct training, the employee will not be able to convert their intention into the desired results without excessive trial and error occurrencesâ&#x20AC;?, she says. Fortunately, it seems that a growing number of plastics manufacturers are realising the value of investing in training their staff. According to Bhana, stats for the past three years suggest that training spend has increased steadily year on year.

www.plasticsinfo.co.za/training-2/

(

)

Plastics manufacturers are realising the value of investing in training their staff

Training undoubtedly adds value â&#x20AC;&#x153;We see this as the growing realisation and acceptance that training undoubtedly adds value. â&#x20AC;&#x153;Employers who feel that training will empower their employees to seek alternative employment, should consider that training their employees is less costly than trying to run a business with untrained personnel. Also, if no one 48 FEB / MAR 2018

wants your employees, perhaps you should consider that you might be stuck with inferior personnel draining your resources and ultimately costing your company more in terms of resourcesâ&#x20AC;?, she argues. Despite making these compelling arguments for the case of investing in training, the Plastics|SA teams in Johannesburg, Cape Town and Durban donâ&#x20AC;&#x2122;t spend their time convincing industry partners that training is essential. Instead, their focus is on spurring on this realisation through visits, awareness campaigns and events. Thereafter they facilitate the process of identifying training needs with the willing. â&#x20AC;&#x153;We build a close working relationship with our clients and get to understand their business, their challenges and their future dreams very well. Based on their individual mission and the objectives they have set for themselves to achieve in the next year or two, and LQVRPHFDVHVHYHQDÂżYH\HDUSODQ we set out to determine with them what skills are needed to achieve these goals and what are the current gaps? Out RIWKRVHLGHQWLÂżHGZHGHWHUPLQHWKH priorities and the budget. This helps us plan the most suitable and sustainable intervention for the organisation that not only effectively meets, but even surpasses the expectation,â&#x20AC;? she explains.

Focus on the actual manufacturing processes The most popular training programmes being offered by Plastics|SA and which continue to be in high demand, are those which focus on the actual manufacturing processes, with quality and safety programmes being part of these. â&#x20AC;&#x153;The legacy in the plastics industry is to promote good operators to learn setting skills. From there, good setters are usually promoted to the rank of supervisors. The skills sets required

WRIXOÂżODQRSHUDWLRQDOPDQDJHULDO and eventually a supervisory role are completely different, and Plastics|SA SURYLGHVKDQGVRQWUDLQLQJIRUHDFK of these,â&#x20AC;? Bhana expands. She adds that they are continuing to see growing numbers of students being enrolled for the Supervisory Management Programmes, providing reassuring evidence that the correct gaps are EHLQJLGHQWLÂżHGIRUGHYHORSPHQW Plastics|SA has also recently launched various new training offerings, VXFKDVD1DWLRQDO&HUWLÂżFDWHLQ Production Technology (NQF2) and Generic Management (NQF5). â&#x20AC;&#x153;We will continue to run our scheduled Pipe and 3URÂżOH([WUXVLRQ3URJUDPPHVZKLFKZH started in the second half of 2017, using our newly acquired extruders in each region,â&#x20AC;? she divulged. Plastics|SA plays an active role through the Plastics Chamber of the MerSETA by being a voice for the Plastics industry ensuring that the industryâ&#x20AC;&#x2122;s interests are always represented in skills related matters. This good working relationship enables Plastics|SA to facilitate funding access on behalf of their industry partners and helps to ease the intensive administrative processes required by the SETA. However, Bhana highlights that whilst tax incentives, grants from the SETA for submitting Workplace Skills Plans and annual training reports and BBBEE VFRUHFDUGEHQHÂżWVDUHDOOWKHREYLRXV ÂżQDQFLDOUHDVRQVWRWUDLQSHRSOHWKH DFWXDOEHQHÂżWVDFFRXQWIRUVRPXFK PRUHRQWKHVKRSĂ&#x20AC;RRU â&#x20AC;&#x153;A knowledgeable employee (with the right attitude) is an asset to any company. For this reason, training should be seen as the ultimate motivational tool that every company needs to invest in. By having an adequately trained workforce, you will help create a culture in which your employees care and contribute to the business. Upskilling people transforms lives and increases their value add. Ultimately, this is what human dignity is all about,â&#x20AC;? Bhana concludes.


changes name 5HSRVLWLRQLQJUHĂ&#x20AC;HFWVLQFOXVLYHIRFXVRQQRQSURÂżW VRFLDOXSOLIWPHQWUHF\FOLQJSURMHFWV THE Polystyrene Packaging Council â&#x20AC;&#x201C; the product recovery organisation (PRO) for expanded polystyrene (EPS) and high impact polystyrene (HIPS) in South Africa â&#x20AC;&#x201C; has announced that it is changing its corporate name to the Polystyrene Association of South Africa. â&#x20AC;&#x153;With the recent steps taken to formalize industry bodies representing the various PROâ&#x20AC;&#x2122;s, and in our dealings with government and end-markets, it became clear that we needed to relook our purpose, role and positioning within the Industry Waste Management Plan (IWMP). Whilst technically council is regarded a statutory body, we will not EHIXOÂżOOLQJWKLVUROHLQOLJKWRIWKHPRUH formalized industry representation which is currently underway,â&#x20AC;? says Adri Spangenberg, explaining the rationale

for the rebranding. By far the vast majority of PROâ&#x20AC;&#x2122;s in South Africa are established as voluntary associations. In line with the general characteristics, the Polystyrene Association is regulated by Common Law, has an open membership and is managed from within by general members or a management/steering committee according to a constitution drawn up by members. â&#x20AC;&#x153;By doing away with the word â&#x20AC;&#x2DC;Packagingâ&#x20AC;&#x2122; in our name, we also wanted to include more players in the industry wanting to join us as members. The polystyrene market has grown considerably since we started more than 10 years ago, and participation is no longer just limited to the manufacturers of food packaging

New, revised logo of the polystyrene trade body

material. In addition, the IWMP requires all producers and convertors of polystyrene to support our objective of increasing the recycling of polystyrene through our various projects that all have a strong charity and social upliftment motivation,â&#x20AC;? Adri explains. www.polystyrenepackaging.co.za FEB / MAR 2018 49

I.P.P Inkulu Plastic Pipes

(Pty) Ltd

Quality Pipe Manufacturers of HDPE pipe Think big, â&#x20AC;&#x153;Inkuluâ&#x20AC;? is Gabriel Reddyâ&#x20AC;&#x2122;s motto, who started the new pipe manufacturing business Inkulu Plastic 3LSHVLQ+DPPDUVGDOH.=1$QGVHOOLQJLWPLQG\RX7KHÂżUVWSLSHVSURGXFHGDWKLVQHZFRPSDQ\ZHQW GLUHFWO\IURPPDFKLQHWRWKHEDFNRIWKHGHOLYHU\WUXFNÂąZLWKRXWHYHQWRXFKLQJWKHIDFWRU\Ă&#x20AC;RRU Inkulu Plastic Pipes leased a 3440m2 factory in Hammarsdale. Inkulu Plastic Pipes has not looked back since, and the machines DUHQRZUXQQLQJ7KHFRPSDQ\KDVDOVRDFTXLUHG6$%6FHUWLÂżFDWLRQ*DEULHOÂśVWKLUGPDFKLQHDUULYHGLQ$XJXVW*DEULHO believes in always making a plan and satisfying his clients and keeping them happy. His success is due to the support and the good wishes of his very loyal customers and suppliers. Products include: HDPE (High Density Polyethylene) Pipes, LDPE (Low Density Polyethylene) Pipes, PP (Polypropylene) Pipes and Fabricated Fittings

Contact us: Unit 6B Coveway Industrial Park, Hammersdale, 3700 | Tel: 031 736 1055/56 | Fax: 031 736 1054 Gabriel: 084 446 6384 | Nikieta: 083 229 7161 | Email: gabriel@inkuluplastics.co.za | www.inkuluplastics.co.za

Association News

Polystyrene Packaging Council


Association News

HDPE pipes help Drakenstein water-loss reduction 20-year master plan to replace old or aging asbestos pipes :$7(5OHDNDJHDQGQRQUHYHQXH water have become two of the biggest problems facing municipalities around South Africa in recent years. Under WKHOHDGHUVKLSRI$QGUp.RZDOHZVNL Senior Engineer: Water Services, and LQOLQHZLWKWKHLUYLVLRQRIEHLQJDÂľ&LW\ RI([FHOOHQFHWKH'UDNHQVWHLQ/RFDO 0XQLFLSDOLW\LQ3DDUO:HVWHUQ&DSH EHJDQD\HDUPDVWHUSODQWRUHSODFH old or aging asbestos pipes with HDPE pipes, thereby allowing them to achieve VLJQLÂżFDQWVXFFHVVHVLQUHGXFLQJZDWHU loss throughout the municipal area. (YHULQFUHDVLQJZDWHUORVVHVLQ WKH'UDNHQVWHLQ0XQLFLSDOLW\ZHUH surpassing demand growth. By 1999, the water losses stood at 34% and were increasing, thereby forcing them to investigate the reasons for the high ZDWHUORVVHVDQGÂżQGZD\VWRPLWLJDWH these on a broader front. The municipality began prioritising

projects that included pipe replacements, WKHUHSODFHPHQWRIEXONDQGGRPHVWLF water meters, pressure management, OHDNGHWHFWLRQDQGUHSDLUSXEOLF awareness and upgrading information and management tools. Reaction time to attend to burst pipes was also reduced to less than one hour. These initiatives have brought water losses down to an average of 16% â&#x20AC;&#x201C; and 11% at its lowest. The lower losses enabled the municipality to delay the construction of reservoirs and large pipelines for several years. There was also a decrease in the occurrence of burst pipes. However, the reduction in residual pressures in various pressure zones had the biggest water saving effect. Replacing aging pipes with HDPE pipes 7KHPXQLFLSDOLW\KDVSODFHGVLJQLÂżFDQW HPSKDVLVRQUHSODFLQJNPRIROG asbestos pipes with new HDPE pipes, at a value of R120 million.

Willem Liebenberg and Andre Kowalenski of Drakenstein Municipality

Âł3ULRUWRHPEDUNLQJRQWKHSURMHFW we carefully compared steel pipes with HDPE pipes. We were fully convinced WKDWWKHODWWHURIIHUHGXVVLJQLÂżFDQW more advantages and impressive cost VDYLQJEHQHÂżWV7DNLQJWKHOLIHF\FOHRI the HDPE pipe as a material into account, it surpasses most other pipe materials. 7KHSLSHVFDQDOVRKDQGOHWKHĂ&#x20AC;XFWXDWLRQ LQZDWHUSUHVVXUHDQGĂ&#x20AC;RZFKDUDFWHULVWLFV within the pipe design limits better than DQ\RWKHUĂ&#x20AC;H[LEOHSLSHV\VWHPV,I correctly designed, and with proper installation, an HDPE system â&#x20AC;&#x201C; together ZLWKWKHÂżWWLQJVÂąZLOOSURYLGHWKHORZHVW

www.polystyrenepackaging.co.za

Celebrating 10yrs of touching lives THE Breadtags for Wheelchairs Project celebrated a decade of touching and improving the lives of handicapped recipients last year. According to Adri Spangenberg, Director of the Polystyrene Association of SA, more than 3 000 wheelchairs were donated WRUHFLSLHQWVZKRDUHSK\VLFDOO\GLVDEOHGDQGÂżQDQFLDOO\XQDEOH to purchase their own wheelchairs over the past 10 years. â&#x20AC;&#x153;We are proud to say that we have diverted more than 4 WRQVRISRO\VW\UHQHIURPRXUFRXQWU\ÂśVODQGÂżOOVWKDQNVWRWKH buyers of the breadtags made from high density polystyrene, more than 200 collection points and 1 000 coordinators who assist with the breadtag collection,â&#x20AC;? Adri said. ,WWDNHVDSSUR[LPDWHO\NJRIEUHDGWDJVWREX\DVWDQGDUG wheelchair, costing around R1 600. $QHWZRUNRIEX\HUVVXFKDV=LER&RQWDLQHUVDQG0), 0RXOGLQJVZKRSD\5NJIRUWKHEUHDGWDJVUHF\FOHWKHP LQWRVHHGOLQJWUD\VFRUQLFHVVNLUWLQJVRXWGRRUIXUQLWXUHFRDW KDQJHUVSROHVDQGGHFNLQJ)DFLOLWDWLQJWKHSURFHVVLVWKH Polystyrene Association which administers the programme by arranging for the breadtags to be collected and receives the Late last year, the life of 5-year old Buhlebenkosi Mene from Kraaifontein was forever changed thanks to the donation of a muchneeded wheelchair. The WP Stormers rugby team were instrumental in raising the funds needed. â&#x20AC;&#x153;As part of National Disability Rights Awareness Month (3 November â&#x20AC;&#x201C; 3 December), we wanted to encourage people to start collecting their breadtags,â&#x20AC;? said WP Stormersâ&#x20AC;&#x2122; Damian Willemse. Pictured at the handover are, front: DB Janse van Rensburg (Paul Roos Gymnasium), Buhlebenkosi Mene (wheelchair recipient) and Damian Willemse (WP Stormers). Back, Adri Spangenberg (Polystyrene Association), Zikhona Mene (mother), Paul Spangenberg (Paul Roos Gymnasium) and Celista Gerber (Tygerberg Association for Persons with Physical Disabilities) 50 FEB / MAR 2018

payment from the recyclers. Once enough tags have been collected to cover the cost of the wheelchair selected, this money is then paid over to the pharmacy or wheelchair supplier of their choice. Because it is important to ensure that the correct wheelchair LVSXUFKDVHGZKHQVHDWLQJTXDGULSOHJLFVWKH$VVRFLDWLRQZRUNV FORVHO\ZLWK&(0RELOLW\DQGWKH4XDG3DUD$VVRFLDWLRQRI6RXWK $IULFD 4$6$ LQDVVHVVLQJWKHUHTXLUHPHQWVRIWKHUHFLSLHQWDQG ensuring they get the right wheelchair for their needs. Âł2XUKDQGVDQGRXUZRUNKDYHEHHQVLJQLÂżFDQWO\VWUHQJWKHQHG WKDQNVWRFRUSRUDWHVVXFKDV6$6.2&(0RELOLW\4$6$DQG Dischem who have come alongside us by providing additional IXQGLQJLQIUDVWUXFWXUHH[SHUWLVHDQGDGYLFH:LWKRXW their help, we would never have been able to grow the project to where it stands today,â&#x20AC;? Adri said


Association News

municipality become pioneer no longer an issue. Insisting on SAPPMA and IFPA FHUWLÂżFDWLRQ â&#x20AC;&#x153;Workmanship is very important when it comes to the manufacturing of HDPE pipes,â&#x20AC;? Kowalewski says. He explains that theyâ&#x20AC;&#x2122;ve had incidents in the past ZKHUHSLSHVQRWEHDULQJDPDUNRITXDOLW\ fails soon after installation. Âł,WLVDOPRVWLPSRVVLEOHWRLGHQWLI\ ZKHWKHURUQRWDSLSHLVRILQIHULRUTXDOLW\ SULRUWRLQVWDOODWLRQDQGSXUHO\EDVHGRQ appearances. However, we have learned through trial and error and the school RIKDUGNQRFNVWKDWXQOHVVDSLSHEHDUV a SAPPMA mark, it will not meet the TXDOLW\VWDQGDUGVRIFHUWLÂżFDWLRQERGLHV such as the SABS or SATAS.â&#x20AC;? â&#x20AC;&#x153;For this reason, we have changed our WHQGHUVSHFLÂżFDWLRQVE\LQVLVWLQJWKDWDOO VXSSOLHUVRI+'3(SLSHVDUHPHPEHUV of SAPPMA, and that all welders and LQVWDOOHUVRIWKHSLSHOLQHVDUH,)3$FHUWLÂżHG When we see the SAPPMA mark on the pipes of the IFPA stamp on the welds, we know that the pipeline will stand the test of time and that we have recourse if it fails to deliver,â&#x20AC;? he concludes.

Steel screws show corrosion

Sources: AndrĂŠ Kowalewski, Senior Engineer: Water Services, the Drakenstein Local Municipality, Paarl Western Cape (www.drakenstsein.gov.za) Danielle Petterson, 3S Media (www.3smedia.co.za) www.sappma.co.za

FEB / MAR 2018 51

maintenance compared to any other pipe material system,â&#x20AC;? Kowalewski explains. He adds that the most attractive advantage of HDPE is a pipe system without pipe joints. â&#x20AC;&#x153;We no longer have the issue of corrosion, failing joints or costly maintenance issues due to downtime, as PRVWRIWKHÂżWWLQJVXVHGLQ+'3(V\VWHPV are moulded out of polyethylene material. 2WKHUÂżWWLQJVXVHGE\WKHPXQLFLSDOLW\ LQFOXGHĂ&#x20AC;DQJHVDQGWHHSLHFHV predominately manufactured using grade 316 stainless steel. Âł7KHSKLORVRSK\EHKLQGWKHXVH RIDKLJKJUDGHPDWHULDOLVWRKDYHD total system where the pipe material DQGÂżWWLQJVZKHQXVHGWRJHWKHUZLOO guarantee a useful operating life that surpasses 50 years. It means that the FKHPLFDOUHVLVWDQFHDQGGXUDELOLW\RIWKH ÂżWWLQJVPXVWEHWKHVDPHDVWKRVHRIWKH pipes,â&#x20AC;? states Kowalewski. Tests and calculations done on HDPE have shown that the pipe materialâ&#x20AC;&#x2122;s useful lifespan runs up to 100 years. In addition to this, HDPE is the most popular pipe material to use when replacing pipes using trenchless construction methods, and downtime due to repairs on pipes is


Association News

SAPPMA achieves major accomplishments in 2017 Audited more than 40 companies in 2017 THE Southern African Plastic Pipe Manufacturers Association (SAPPMA) celebrated its successes achieved over the past 12 months at its AGM late last year. CEO Jan Venter said SAPPMA could look back at the past year with a great deal of satisfaction at what KDGEHHQDFKLHYHGGHVSLWHGLIÂżFXOW VRFLRHFRQRPLFFRQGLWLRQVDQGÂżQDQFLDO pressures bearing down on the industry. â&#x20AC;&#x153;It is clear that the unstable political climate in the country has taken its toll on the economic front - in particular the countryâ&#x20AC;&#x2122;s infrastructure. Whilst plastic pipes continue to dominate this market, a serious lack of growth was also recorded in the industry over the past ten years,â&#x20AC;? he said. â&#x20AC;&#x153;This fact is UHĂ&#x20AC;HFWHGLQWKHODWHVW'JUDGLQJRIWKH countryâ&#x20AC;&#x2122;s infrastructure by the South African Institute for Civil Engineers (SAICE). Business conditions are not ideal and long-term planning is a very shaky science at present. Even so, we managed to not only survive, but in many regards grow and expand our footprint this past year.â&#x20AC;? 0DLQWDLQLQJDQGLQĂ&#x20AC;XHQFLQJ standards SAPPMAâ&#x20AC;&#x2122;s main focus fell on maintaining standards and ensuring that only top quality pipes are manufactured and enter the local market. This was done through disseminating technical and design information to the decision makers and consulting engineers, marketing the SAPPMA and IFPA brands to external and internal audiences and ensuring ongoing training for manufactures and installers. â&#x20AC;&#x153;We continue to strive for unquestionable quality when it comes to the production and installation standards of plastic pipes. To achieve this, we audited more than 40 companies this past year, and SAPPMA members received at least one unannounced visit,â&#x20AC;? Venter said. Additional quality standards that will further differentiate SAPPMA members are also being developed. This is an extension to work that was started years ago and will address approximately 14 SANS Standards by evaluating the type of testing, test frequency, materials etc. 52 FEB / MAR 2018

3XEOLVKLQJ XSGDWHGUHOHYDQW SXEOLFDWLRQV Other important and far-reaching projects that SAPPMA initiated during 2017 include a Structured :DOO+'3(SURMHFW that evaluated approximately 16 different tests, sampling procedures and raw material requirements; 6$330$0HULW$ZDUG:LQQHUVIRU*HRUJH'LOL\DQQLV publishing South ,DQ9HQWHUDQG-DFTXHVYDQ(FN $IULFDÂśVÂżUVWSROLF\ international speakers and almost statement with regards to gas pipe and the same number of local experts the practical application of SANS4437; who presented their papers,â&#x20AC;? Venter DQGÂżQDOLVLQJWKHODWHVWHGLWLRQRI declared. SAPPMAâ&#x20AC;&#x2122;s Technical Manual to offer 6$330$%RDUGRI'LUHFWRUVIRU updated, more accurate and more comprehensive information to designers 6$330$ÂśV%RDUGRI'LUHFWRUVIRU 2018 are Jan Venter (CEO), Brett and the end-users of plastic pipes when .LPEHU 0DUOH\3LSH6\VWHPV 'HUHN it comes to selecting, designing and Faulds (Macneil Plastics), Mark constructing plastic piping systems with Berry (Safripol), Renier Viljoen (Rare FRQÂżGHQFH Plastics), Terence Hobson (Sun Ace) 6SUHDGLQJZRUOGFODVVNQRZOHGJH and Vijay Naik (Flo-tek). DQGH[SHUWLVH 0HULW$ZDUG:LQQHUV Other important and far-reaching ,DQ9HQWHU*HRUJH'LOL\DQQLVDQG projects that SAPPMA initiated during Jacques van Eck were recognised LQFOXGHD6WUXFWXUHG:DOO+'3( for their hard work and dedication on project that evaluated approximately SAPPMAâ&#x20AC;&#x2122;s Technical Committee by 16 different tests, sampling procedures receiving this yearâ&#x20AC;&#x2122;s Merit Awards. and raw material requirements; â&#x20AC;&#x153;Each year the competition for the Merit SXEOLVKLQJ6RXWK$IULFDÂśVÂżUVWSROLF\ Awards gets stiffer as our TC meetings statement with regards to gas pipes are very well attended by knowledgeable and the practical application of and supportive group of experts who 6$16DQGÂżQDOLVLQJWKHODWHVW truly bear the best interest of the industry edition of SAPPMAâ&#x20AC;&#x2122;s Technical Manual on their heartsâ&#x20AC;?, the CEO remarked. to offer updated, more accurate and Venter concluded by once again more comprehensive information to urging SAPPMA members not to lose designers and the end-users of plastic their long-term view, particularly in terms pipes. RITXDOLW\Âł'RQRWEHWHPSWHGWRWDNH â&#x20AC;&#x153;Undoubtedly, one of our biggest short cuts that will later come back at a successes this past year was the FRVW'LIÂżFXOWFRQGLWLRQVDOZD\VSURYLGH hosting of our PIPES XI Conference. 7KLVZDVWKHÂżUVWWLPHWKDW6RXWK$IULFD new challenges â&#x20AC;&#x201C; also to an association such as ours. At the same time however, had the opportunity to host a dual it reinforces the need for a central international event of this magnitude organization such as this. We therefore for the plastic pipe industry, and we appeal to you to continue participating can say that it was a huge success in all our activities â&#x20AC;&#x201C; together we are by all accounts. Apart from a record making a difference!â&#x20AC;? Venter concluded. number of delegates who attended this 2-day event, we also had 20 ZZZVDSSPDFR]D


Association News

The clean-up crews who will be responsible for ensuring the routes and surrounding areas used for this yearâ&#x20AC;&#x2122;s Cape Town Cycle Tour and Old Mutual Two Oceans Marathon are kept clean and litter free, are once again being trained and prepared to pick up litter quickly, HIIHFWLYHO\DQGZLWKDVOLWWOHGLVUXSWLRQWRWUDIÂżFDVSRVVLEOH

Keeping it clean! Plastics|SA-trained clean-up crews at two major sporting events collaboration when they sweep the routes by picking up all the water and energy drink sachets used by the athletes or litter left behind by the spectators with as little disruption to the events RUWKHWUDIÂżF´.LHVHUVDLG The majority of the waste collected during these events is plastic waste, which has a high recycling value. Several truckloads of plastic waste are collected and recycled annually at these events. Food waste is sent to Noordhoek for composting, whilst all non-organic event waste collected during the OMTOM are recycled and upcycled into unique school desks for under-resourced schools as part of the eventâ&#x20AC;&#x2122;s #GoGreen campaign. â&#x20AC;&#x153;Over the years, the active and visible involvement of the Plastics|SA clean-up team and the PETCO branded bins and truck at these events have helped to create an awareness of the plastics industryâ&#x20AC;&#x2122;s dedication to keeping plastic litter out of WKHHQYLURQPHQW´.LHVHUVD\V+HDGGVWKDWWKH&LW\RI&DSH Town plays a major role in boosting their clean-up efforts by ensuring that the routes for these annual events are cleaned prior to the race days. www.plasticsinfo.co.za

FEB / MAR 2018 53

THE Plastics|SA clean-up crews will once again help to ensure that the waste footprint of two of Cape Townâ&#x20AC;&#x2122;s biggest sporting events taking place in March this year, is kept as small as possible. For the 11th consecutive year, Plastics|SAâ&#x20AC;&#x2122;s sustainability manager, John Kieser, will be coordinating clean-up crews who will be working around the clock to keep the routes and surrounding areas used for the 40th Cape Town Cycle Tour (Sunday, 11 March 2018) and the 49th Old Mutual Two Oceans Marathon (Saturday, 31 March 2018) clean and litter-free. In the meantime, the Two Oceans Marathon and the Cape Town Marathon are considering banning plastics at their HYHQWVVSHFLÂżFDOO\WKHVDFKHWVZLWKZDWHUWKDWDUHKDQGHG out to runners. The competitors are inclined to hang on to the sachets and drop them later, wherever, which is irresponsible. â&#x20AC;&#x153;This year, our group of more than 200 cleaners who have been employed from various townships in and around Cape Town - including Joe Slovo, Kayamandi, Masiphumelele, Ocean View and Khayelitsha - will once again demonstrate what can be achieved through unity, teamwork and


Middle East

Fruit from around the world in a supermarket in Dubai. This is RQO\SRVVLEOHEHFDXVHRIHI¿FLHQW global logistic networks which exist because of the trade liberalisation of the last 20-30 years

Increased protectionism a concern for polymer producers in Middle East China increasingly becoming a champion of free trade

BY NIALL MARSHALL

WALK into any supermarket in the Middle East and you are offered the fruits of global trade â&#x20AC;&#x201C; literally â&#x20AC;&#x201C; blueberries from the USA, grapes from South Africa, oranges from Spain, mangoes from India, and bananas from Kenya! Vegetables, IUHVKPHDWDQGÃ&#x20AC;RZHUV¿QGWKHLUZD\ to the Middle East from countries as IDUDZD\DV%UD]LO1HZ=HDODQGDQG Thailand. This is only possible because RIHI¿FLHQWJOREDOORJLVWLFQHWZRUNVZKLFK exist because of the trade liberalisation of the last 20-30 years. Trade liberalisation, or â&#x20AC;&#x2DC;globalisationâ&#x20AC;&#x2122;, ZDVVHHQDVDSRZHUIXOWRROIRUUDLVLQJ countries out of poverty by removing protectionist measures such as arbitrary LPSRUWWDULIIVZKLFKGLVWRUWHGJOREDO trade. Countries joining the World 7UDGH2UJDQL]DWLRQDJUHHGRQFHUWDLQ principles, most importantly relating to limiting state subsidies and setting maximum import tariffs. This multilateral approach meant that every country 54

FEB / MAR 2018

that joined the WTO immediately had a EDVLFWUDGHDJUHHPHQWZLWKHYHU\RWKHU FRXQWU\WKDWZDVDPHPEHUZLWKRXW having to negotiate hundreds of bilateral agreements. Countries are free to VHWORZHUGXWLHVWKDQWKH:72WDULIIV but, except for antidumping or similar SHQDOWLHVZKLFKFDQEHLPSRVHGE\D FRXQWU\RQVSHFL¿FFRXQWULHVIRUVSHFL¿F products, duties cannot be higher than the agreed tariffs. )UHHWUDGHKDVDOORZHGSRO\PHU producers in the Middle East to OHYHUDJHLWVORZFRVWIHHGVWRFNVWR become the most important supplier of polymer globally. Countries that are signatories to the WTO cannot protect uncompetitive domestic polymer producers by imposing higher than agreed tariffs on Middle East polymer. Where there is free movement of goods the price of commodities, like polymers, ZLOOHIIHFWLYHO\EHVHWE\WKHFRVWVRI WKHORZHVWFRVWSURGXFHUVWKDWPHHW the volume demand. Large volumes RIORZFRVWSRO\ROH¿QVDYDLODEOHIURP

the Middle East have contributed to SRO\ROH¿QSULFHVWKDWKDYHLQLQÃ&#x20AC;DWLRQ adjusted terms, become cheaper over the last 20 years. +RZHYHUWKHUHLVDJURZLQJ scepticism by various groups and 1*2VZKRIHHOWKDWVWULFWHUWUDGH rules could address other social and HQYLURQPHQWDOLVVXHV*OREDOLVDWLRQKDV also become a convenient scapegoat for various problems and populist governments are increasingly moving in a more protectionist direction. Most visible is Donald Trumpâ&#x20AC;&#x2122;s â&#x20AC;&#x2DC;America Firstâ&#x20AC;&#x2122; approach. The USA has already H[LWHGWKHSURSRVHG733 7UDQV3DFL¿F Partnership) discussions intending to establish a free trade agreement EHWZHHQ3DFL¿FULPFRXQWULHVDQG Trump has threatened to tear-up the 1$)7$DJUHHPHQWXQOHVV0H[LFRDQG Canada agree to renegotiate it. The :72KDVDOVRLGHQWL¿HGRWKHUFRXQWULHV LQFOXGLQJWKH8.*HUPDQ\DQG)UDQFH as becoming increasing protectionist by introducing â&#x20AC;&#x2DC;non-tariff barriersâ&#x20AC;&#x2122;.


- passionate about the plastic industry.

Tel: +27 11 824 3103 - Fax: +27 11 824 6018 email: sales@sescc.co.za - www.sescc.co.za Unit 1, 16 Davidson Place, Wadeville, 1428

Supplier of:

ty t o G

Injection Moulding Machine

Servo Klockner

Rebuild

JIANGSU VICTOR MACHINERY


Equipment

Graham Engineering commissions Mega 26 dual-parison system *5$+$0(QJLQHHULQJKDVLQVWDOOHGWKH¿UVW*UDKDP® URWDU\ZKHHOH[WUXVLRQEORZPRXOGLQJV\VWHPIRUXVHLQ PDLQODQG&KLQD7KHSURGXFWLRQOLQHD0HJDGXDO SDULVRQV\VWHPZDVFRPPLVVLRQHGDWWKH*XDQJ]KRX IDFLOLW\RIDFRQYHUWHUIRUDOHDGLQJ86EDVHGJOREDO FRQVXPHUSDFNDJHGJRRGV &3* EUDQG,QWURGXFHGWRWKH SURMHFWE\WKH86KHDGTXDUWHUHG&3*WKHOHDGLQJEUDQGLQ LWVFDWHJRU\WKH*UDKDPWHDPZRUNHGZLWKWKHFRPSDQ\WR GH¿QHWKHSURMHFWVFRSHHYDOXDWHSURGXFWLRQDOWHUQDWLYHV DQGEXLOGWKHEXVLQHVVFDVH7KH\XOWLPDWHO\GHFLGHG WRSURFHHGZLWKRQHRIWKHLUFRQYHUWHUVZKRFRPPLWWHG WRDQHDUVLWH*UHHQ¿HOGSODQWZLWKDIXOO\DXWRPDWHG SURGXFWLRQOLQH7KHYROXPHMXVWL¿HGDVWDWLRQGXDO SDULVRQTXDGFDYLW\ZKHHOSURGXFLQJERWWOHVSHU KRXUUHSODFLQJORFDOO\PDQXIDFWXUHGVKXWWOHPDFKLQHV 7KHOLQH¶VVSHHGFDSDFLW\DQGDXWRPDWLRQDOORZVJUHDWHU HI¿FLHQFLHVLQSURGXFWLRQDQGLQGRZQVWUHDPERWWOH KDQGOLQJ,WDOVRHQDEOHVWKHEUDQGRZQHUWRPRYHDZD\ IURPDVWRFNSDFNDJHWRDQHZERWWOHGHVLJQFRQVLVWHQW ZLWKLWVJOREDOVWDQGDUG

ZZZJUDKDPHQJLQHHULQJFRP

High-performance shredding for plastics, other waste :,7+WKHVKUHGGHUVHULHV0LFURPDW+3/LQGQHU5HF\FOLQJWHFK KDVDGGHGH[WUHPHO\HI¿FLHQWPDFKLQHVWRWKHLUUDQJHRI XQLYHUVDOVKUHGGHUVIRUSURFHVVLQJSODVWLFVDQGRWKHUZDVWH :KLOHWKHPDFKLQHVL]HVDQGWHFKQRORJ\DUHWKHVDPHDV LQWKHWULHGDQGWHVWHG0LFURPDWDQGV\VWHPV LQFUHDVHVLQRXWSXWRIXSWRDUHQRZDUHDOLW\-XVWOLNH WKHSUHVHQWVLQJOHVKDIWVKUHGGHUVRIWKHVDPHW\SHWKHQHZ YHUVLRQVFDQEHÃ&#x20AC;H[LEO\FRQ¿JXUHGWRDQ\GHVLUHGSXUSRVH DQGERDVWDORZHQHUJ\GHVLJQZLWKPLQLPDOPDLQWHQDQFH UHTXLUHPHQWV/LQGQHUUHGHVLJQHGWKHURWRUJHRPHWU\WR DOORZWKHNQLYHVWREHXVHGPRUHHI¿FLHQWO\SHUURWDWLRQ7KH RSWLPLVHG6LHPHQVFRQWUROXQLWDOVRFRQWULEXWHVWRZDUGV WKLVJRDOPHDQLQJWKDWQRZPRUHWKDQHYHUEHIRUHWKHQHZ 0LFURPDW+3LVDQLGHDOFKRLFHIRUFXVWRPHUVZKRZDQW DQH[WUHPHO\FRVWHI¿FLHQWDQGSURGXFWLYHPHDQVWRVKUHG SODVWLFZDVWHDQGDOORWKHUNLQGVRIPXQLFLSDOLQGXVWULDODQG FRPPHUFLDOZDVWHWRDQH[DFWSUHGH¿QHGJUDLQVL]H$VZLWK DOO/LQGQHUPRGHOVWKHNQLYHVFDQEHUHSODFHGZLWKPLQLPDO HIIRUWNHHSLQJPDLQWHQDQFHGRZQWLPHVKRUW7KHURWRU FRROLQJDOVRFRQWULEXWHVWRRSWLPLVHGPDWHULDOSURFHVVLQJ PDNLQJWKHRSHUDWLRQYHU\FRVWHIIHFWLYH

ZZZOUWFRP

Success with innovative injection moulding technology )$0,/<RZQHG)U|EHOEDVHGLQ%ODXIHOGHQ%DGHQ :XHUWWHPEHUJHQWHUHGWKHSODVWLFVLQGXVWU\LQSURGXFLQJ WKHUPRPHWHUV7RGD\WKHFRPSDQ\¶VPDMRUFXVWRPHUV LQFOXGHZKLWHJRRGVIXUQLWXUHEXLOGLQJFRQVWUXFWLRQDQG LQVWDOODWLRQSDFNDJLQJDQGWR\LQGXVWULHV)U|EHOPDQXIDFWXUHV LWVSURGXFWVLQEDWFKVL]HVIURPWRXQLWV7KH FRPSDQ\SURFHVVHVYLUWXDOO\DOOHQJLQHHULQJSODVWLFVLQFOXGLQJ WUDQVSDUHQWSODVWLFVSODVWLFVZLWK¿OOHUFRQWHQWFRQGXFWLYHDQG DQWLVWDWLFPDWHULDOVDQGWKHUPRSODVWLFHODVWRPHUV7RHQVXUH SURGXFWLRQUHOLDELOLW\DQGFRQVLVWHQF\RIWKHLQMHFWLRQ PRXOGLQJPDFKLQHVLQVWDOOHGDW)U|EHOUDQJLQJIURPWR N1FODPSLQJIRUFHDUHIURP:LWWPDQ%DWWHQIHOG7KH¿UVW RQHZDVGHOLYHUHGLQWKHODVWRQHLQ7KHPDFKLQHV GHOLYHUHGPRVWUHFHQWO\DUHWKUHHIURPWKH0DFUR3RZHUVHULHV ZLWKN1FODPSLQJIRUFHDQGDFRPSRQHQWPDFKLQHZLWK N1FODPSLQJIRUFHZKLFKLVXVHGIRUH[DPSOHWRPRXOG WKHERWWRPSDUWVRIVWRROVDVVHHQLQWKHSKRWR$¿QLVKHG VWRROPDGHRISRO\SURS\OHQHZLWKDURXQGHGFRPSRQHQWEDVH IRUFRQWUROOHGIUHHPRYHPHQWV â&#x20AC;¢ ,SH[GLVWULEXWHV:LWWPDQQ%DWWHQIHOGHTXLSPHQWLQ6RXWK $IULFD 56 FEB / MAR 2018

ZZZLSH[FR]D

ZZZZLWWPDQQJURXSFRP

ZZZIURHEHONXQVWVWRIIGH


HOLOGRAPHIC Origination & Machineries of India has recently introduced its new UV hologram cast and cure machines, which is no mean feat. Rajebanada Roy, sales executive of the Salt Lake City, Kolkata, company has been involved in export development of these machines, which rival systems manufactured in Europe, up until now the leader in this high-tech area. “We offer comprehensive knowhow transfer, supervision during installation, on-site training and guidance on marketing

of cast and cure products and commercial trials,” said Roy. “You are probably aware that hologram cast and cure products DUHKLJKO\SUR¿WDEOHEXVLQHVVDQGXVXDOO\RXUFXVWRPHUV are able to recover their entire investment in plant and machinery within six months to one year of commencement of commercial production,” he added.

www.hologramproject.com

www.homl.in FEB / MAR 2018

57

Equipment

Holographic cast and cure machines from India


Equipment

ProTec develops system for integrated physical foaming 3527(&3RO\PHU3URFHVVLQJ*PE+LV developing a peripheral system which HQDEOHVVWUDLJKWIRUZDUGLQWHJUDWLRQ of a novel physical polymer foaming SURFHVVLQWRH[LVWLQJLQMHFWLRQ moulding lines. The process involves &2ORDGHGSHOOHWVDUHSUHSDUHGDQGIHGFRPSOHWHO\DXWRPDWLFDOO\E\DQLQWHJUDWHG ORDGLQJGULHGSHOOHWVZLWK&2LQD peripheral solution from ProTec consisting of dryer, autoclave and conveying unit pressure vessel and then feeding them WRWKHLQMHFWLRQPRXOGLQJPDFKLQH7KHQRYHOSURFHVVWKXV FRPELQHVWKHHDV\RIKDQGOLQJRIFKHPLFDOIRDPLQJSURFHVVHV with the high foaming pressure of physical foaming. Good IRDPLQJUHVXOWVDQGWKXVFRQVLGHUDEOHPDWHULDOVDYLQJVFDQ EHDFKLHYHGHYHQZLWKWKLQZDOOHGPRXOGLQJV([WHUQDO&2 ORDGLQJKDVDOUHDG\EHHQWHVWHGRQYDULRXVW\SHVRISODVWLFV ZKLFKUHPDLQUHSURGXFLEO\IRDPDEOHRYHUDQXPEHURIKRXUV 3UR7HF¶VLQWHJUDWHGSHULSKHUDOVROXWLRQZLOOVRRQPDNHWKLV LQQRYDWLRQLQGXVWULDOO\YLDEOHIRUDZLGHUDQJHRIXVHUV 3URFHVVRUVZLOOLQIXWXUHEHDEOHWRLQWHJUDWHWKHQHZV\VWHP TXLFNO\LQWRWKHLUPDQXIDFWXULQJOLQHVVLQFHH[LVWLQJLQMHFWLRQ moulding machines, depending on the particular model; will UHTXLUHOLWWOHRUQRPRGL¿FDWLRQ7KHSHOOHWVDUHSUHSDUHGDQG IHGFRPSOHWHO\DXWRPDWLFDOO\WKDQNVWRDQLQWHJUDWHGSHULSKHUDO PC component foamed solution from ProTec consisting of dryer, autoclave and using the new physical FRQYH\LQJXQLW6LQFHWKHSHULSKHUDOFDQVXSSO\DQXPEHURI process with an approx. PDFKLQHVVLPXOWDQHRXVO\PDQXIDFWXUHRIERWKVPDOODQGODUJH 16% weight saving EDWFKHVLVHFRQRPLFDOO\YLDEOH www.sp-protec.com

58 FEB / MAR 2018

Rapid Granulator makes SICK Automation track major investment and trace systems debut in SA tyre plants LEADING size reduction equipment manufacturer, Rapid Granulator, has invested in machining equipment at its headquarters in Bredaryd, Sweden. Installation of three highprecision, highly automated machining centres, with a total investment of â&#x201A;¬4.5 million, will provide the company with extra capacity to produce core components to very tight tolerances ZKLOHLPSURYLQJRYHUDOOSURFHVVÃ&#x20AC;RZ$QHZ³'RQHLQ2QH´ turning and milling machine and a two horizontal machining centres are now in operation. The machining centres are IXOO\LQWHJUDWHGZLWKDQ)06 Ã&#x20AC;H[LEOHPDQXIDFWXULQJV\VWHP  centre, involving automatic rail-guided vehicles that have WKHFDSDELOLW\RIUXQQLQJZLWKRXWDQ\RSHUDWRULQWHUYHQWLRQ &RPSRQHQWVSURGXFHGRQWKHQHZHTXLSPHQWZLOOEHXVHG in granulators that Rapid produces in Bredaryd and also at LWV86IDFLOLW\LQ3LWWVEXUJK3$³,QWKHIXWXUHZHZLOOEHDEOH WRSURGXFHWROHUDQFHFULWLFDOFRPSRQHQWVLQPXFKELJJHU QXPEHUVDQGLQODUJHUVL]HVLQKRXVHWKDQEHIRUH´VD\V 5DSLG¶V&(2%HQJW5LPDUN7KHWZRYHU\ODUJHKRUL]RQWDO machining centres each hold over 200 different tools and can FDUU\RXWDZLGHUDQJHRIWDVNVLQFOXGLQJJULQGLQJGULOOLQJ DQGWKUHDGLQJ%HFDXVHWKH³'RQHLQ2QH´PDFKLQHFDQ SHUIRUPERWKWXUQLQJDQGPLOOLQJ5DSLGFDQSURGXFHPDMRU FRPSRQHQWVOLNHURWRUVLQDVLQJOHVWHS%HIRUHWKLVZDVDMRE that required several separate setups. â&#x20AC;¢ )UDQN%OXHVRI)G%&RQVXOWLQJUHSUHVHQWV5DSLG Granulators in South Africa

www.rapidgranulator.com

6,&.$XWRPDWLRQUHFHQWO\VXSSOLHGWZRWXUQNH\WUDFN and trace systems for multinational tyre manufacturers %ULGJHVWRQHDQG6XPLWRPR5XEEHUDWWKHLU6RXWK$IULFDQ SODQWVPDUNLQJWKH¿UVWLQVWDOODWLRQVZRUOGZLGHRIWKHVHQVRU VSHFLDOLVW¶VODWHVWLPDJHEDVHGFRGHUHDGHUVWKH7LUH/HFWRU $UUD\ 7/$ LQWKHW\UHPDQXIDFWXULQJLQGXVWU\%\WUDFNLQJ DQGWUDFLQJEDUFRGHGW\UHVDFURVVWKHPDQXIDFWXULQJ and internal handling cycle, the TLA plays a critical role LQPDQDJLQJDQGFRQWUROOLQJWKHµMXVWLQWLPH¶SURGXFWLRQ SURFHVVHVRIWKHSODQWVDVZHOODVDXWRPDWHGEDWFKDQG GLVWULEXWLRQPDQDJHPHQW³$VXFFHVVIXOWHFKQRORJLFDO solution for this application ensures that, no matter the height, diameter or orientation and position of the tyre on WKHFRQYH\RUEHOWHYHU\XQLWLVUHOLDEO\LGHQWL¿HG´H[SODLQV Prishan Chain, Key Account Manager, SICK Automation 6RXWKHUQ$IULFD³7KHKLJK resolution Lector65x sensors, with intelligent technology features including dynamic focus and adaptive illumination, SURYLGHGWKHFDSDELOLWLHVUHTXLUHG for Japanese process quality VSHFL¿FDWLRQV´7HQV\VWHPV were supplied to the Bridgestone plant in Pretoria in 2016, while WKH6XPLWRPR5XEEHUSODQWLQ Ladysmith has a total of four systems. Both plants manufacture the full range of standard and lowSUR¿OHW\UHVIRURQURDGYHKLFOHV from 13 to 20 inch.

ZZZVLFNDXWRPDWLRQFR]D


SIDEL has collaborated in the new ‘spiral’ PET bottle project from The Coca-Cola Company, with the company’s 40-year expertise in PET packaging instrumental in the successful rejuvenation of the Fanta brand and the challenges involved in getting it right. First appearing on shelves in the1940s, Fanta is Coca-Cola’s biggest brand after Coke. After years of success in the international soft drinks market, the Fanta Splash shape had effectively become owned by the carbonated soft drinks category rather than the brand. Sidel has played a key role in the packaging project development, qualifying the new Fanta bottle for industrial production. The new bottle shape required precise understanding of how PET behaves under pressure, particularly with regard to how the carbonation of the beverage can potentially deform the bottle sections, which could lead to the drink spilling. Just like its predecessor, the new bottle was to be produced to be 100% recyclable. The new creative and differentiating bottle in PET represents a ‘rule-breaker’ in terms of bottle design for CSD (carbonated soft drinks). It features a spiral, inspired by the twisting of an orange to release its juice. It is based on a series of ribs decorated with small bubbles,

including a torsion in the bottom half. This spiral gives the Fanta bottle an unusual, asymmetric structure which presented a real challenge in terms of developing a container able to withstand deformation and stability issues. ³,WLVGH¿QLWLYHO\FULWLFDOWKDWDOORSSRVLQJ sides of the bottle have the same developed length to avoid issues with perpendicularity,” explains Jérome Neveu, packaging expert at 6LGHO³:HRSWLPLVHGWKHJULSSUR¿OHDQGWKH angular base orientation to retain the bottle JHRPHWU\RQFH¿OOHG´ The Spiral bottle involved the production of 15 pilot moulds and feasibility tests successfully managed with Sidel to achieve YDOLGDWLRQRIWKH¿QDOERWWOHGHVLJQ7KH physical strength of the new bottle is as good as the previous Fanta Splash bottle. Other line stability tests were also conducted by Sidel, achieving suitable results for high speed ¿OOLQJ´ A similar bottle shape has been deployed for the whole Fanta bottle family and it is now available for 500ml, 1L, 1.5L and 2L formats.

Equipment

Sidel partners Coca-Cola for new Fanta PET bottle design

Sidel Coca-Cola Fanta bottle and base

www.sidel.com FEB / MAR 2018

59


Design

PISA design competition 2017 â&#x20AC;&#x201C; strong evidence of SA student talent

(

THE Plastics Institute of South Africa (PISA) presented a challenge to young designers by way of a Student Design Competition last year. The event was RUJDQLVHGE\-DFTXHV/LJKWIRRW6XVWDLQDELOLW\0DQDJHUDW3ODVWLFVâ&#x20AC;ŤŰ&#x201E;â&#x20AC;Ź6$DQG KRVWHGDWWKH3ODVWLFVâ&#x20AC;ŤŰ&#x201E;â&#x20AC;Ź6$RIÂżFHVLQ0LGUDQG The students were required to design a gas lighter. The product had to meet the demands of the injection moulded component manufacturing process and had to demonstrate a clear understanding of multiple plastic component DVVHPEO\6WXGHQWVDOVRKDGWRGHVLJQWKHOLJKWHUZLWKQRĂ&#x20AC;DWVXUIDFHVDQGLW had to be in line with the high-quality image set by one of the following leading brands: Smeg 50â&#x20AC;&#x2122;s retro style, Stanley, Jeep or Adi Alessi. Students also had to ensure the gas lighter was fully functional and did not weigh more than 100 grams. The students demonstrated that in South Africa there is no shortage of product design and innovative and creative thinkers being guided through their design studies at tertiary level. Tshwane University of Technology (TUT) and the University of Johannesburg (UJ) are two institutions where young aspirant designers can take up the challenges of a three- or four-year industrial design course. Graduating students from these courses will have a detailed understanding of value added functional product design, ergonomics, aesthetics and manufacturing processes.

)

â&#x20AC;&#x2DC;â&#x20AC;Ś no shortage of product design and innovative and creative thinkers â&#x20AC;Śâ&#x20AC;&#x2122;

In second place was the design by TUT student Victor Valcarcel

Third place went to UJ student Suhail Richards for his design 60 FEB / MAR 2018

The winning design from UJ student Shane Keates


Design

Celanese takes top

SPE Automotive CELANESE Corporation, a global technology and specialty materials company, has received the highest Automotive Innovation Award from the Society of Plastics Engineers (SPE) for its engineered material critical to the award-winning active grille shutter developed for the all-new Ford Expedition. The SPE Automotive Innovation Awards programme honours the best companies in automotive plastics and is the oldest and largest competition of its kind in the automotive and plastics industries.

At the 47th Annual SPE Automotive Innovation Awards Competition and Gala, SPE recognized Celanese with the Grand Award and a category award for its innovation in the Body Exterior category. The award-winning active grille shutter uses Celanese’s Celstran®ORQJ¿EUHUHLQIRUFHGWKHUPRSODVWLF (LFRT) technology to deliver an enhanced two-shot injection moulded part that is 1.4kg lighter than alternative metal-nylon hybrids. Celanese’s technology enables the elimination of a full front-end module.

GRAND AWARD Celanese walked away with the Grand Award and a category award for its innovation in the Body Exterior category for its active grille shutter

AFTERMARKET

Integrated Floor Bedliner Divider 2017 General Motors Co Chevrolet Silverado General Motors Co walked away with this award for a backlit chrome emblem on the 2017 Chevrolet Camaro sports car and the Silverado and Colorado pickups. Production requires the combination of a two-shot overmoulded lens and two-shot light guide along with laser welding in one package. Windsor Mold Group and its automotive components division Emerick Plastics supply the system and tooling, using Sabic’s Lexan polycarbonate and Arkema’s Plexiglas acrylic material.

62 FEB / MAR 2018


Innovation Awards

BODY INTERIOR

CHASSIS & HARDWARE

Instrument Panel Carrier

Powertrain Mounting Clevis Bracket

2017 BMW Countryman

2017 General Motors Co. Cadillac XT5

$QLQQRYDWLYHSURFHVVFRPELQHGZLWKOLJKWZHLJKWHQDEOLQJ PDWHULDOVIURP6$%,&KHOSVUHGXFHWKHSDUW¶VZHLJKWE\DERXW YHUVXVDFRPSDUDEOHVROLGSODVWLFFRPSRQHQW7KHLQMHFWLRQ PRXOGHGSDUWXVHVDKLJKÃ&#x20AC;RZFRQFHQWUDWHORQJJODVV¿EUH UHLQIRUFHGSRO\SURS\OHQH /*)33 PDWHULDO 67$0$;Â&#x152;UHVLQ  IURP6$%,&DQGDGHGLFDWHGPDVWHUEDWFKVROXWLRQLQDVWUXFWXUDO IRDPLQJSURFHVVZLWKFRUHEDFNWHFKQRORJ\ ,QWKLVDSSURDFKWKHPDWHULDOLQMHFWVLQWRDQGFRPSOHWHO\¿OOVWKH PRXOG7KHPRXOGWKHQRSHQVWRDOORZIRUIRDPLQJRQWKHFRUHVLGH RIWKHPRXOG7KLVIRDPLQJSDUWRIWKHFRUHEDFNWHFKQLTXHLQFUHDVHV WKHZDOOWKLFNQHVVRIWKHSDUWIURPWRPP7KLVGHOLYHUVWKH UHTXLUHGVWUHQJWKDQGULJLGLW\FKDUDFWHULVWLFVZLWKRXWDGGLQJZHLJKW 7KLVIRDPHGVROXWLRQZLWK67$0$;UHVLQDOVRW\SLFDOO\UHTXLUHVOHVV PDWHULDOGXULQJSURFHVVLQJDQGHQDEOHVVKRUWHUF\FOHWLPHV

7KHPDWHULDOXVHGIRUWKLVDSSOLFDWLRQZDV8OWUDPLG $:*&5%.3$*)7KLVHQJLQHFOHYLV EUDFNHWLVWKH¿UVWFRPSRVLWHPRXQWGHVLJQHGIRUD F\OLQGHUHQJLQHDQGSDVVLQJSHDNORDGVRI.LOR QHZWRQVRIIRUFH7KHLQMHFWLRQPRXOGHGSDUWUHSODFHV PHWDOOLFVROXWLRQV VWDPSLQJZHOGLQJDQGGLHFDVWLQJ  XVHGSUHYLRXVO\UHVXOWLQJLQDZHLJKWVDYH19+ ZDVDOVRLPSURYHG UHGXFWLRQLQFDELQQRLVH GXHWRWKH GDPSLQJFKDUDFWHULVWLFVRIWKHSRO\DPLGHFRPSDUHGWR DOXPLQLXP&RUURVLRQUHVLVWDQFHLVLPSURYHGDQGWKHSDUW FDQEHUHF\FOHGDWHQGRIOLIH6HYHQFOHYLVEUDFNHWVZHUH GHYHORSHGIRUGLIIHUHQWSRZHUWUDLQFRPELQDWLRQVDQGWKHUH DUHQRZDUUDQW\FODLPVDIWHU\HDUVRISURGXFWLRQ

ENVIRONMENTAL

Next Generation Sustainable Content Bio Foam 2018 Ford Motor Co. Ford Fusion 7KHPDWHULDOXVHGIRUWKLVDSSOLFDWLRQZDV(ODVWRÃ&#x20AC;H[5HVLQ ,VR387KLVDSSOLFDWLRQSURYLGHVDVXVWDLQDEOHDOWHUQDWLYHWR FRQYHQWLRQDOSHWUROHXPEDVHGIRDPV±DWDORZHUZHLJKWDQGFRVW ZLWKPRUHGHVLJQÃ&#x20AC;H[LELOLW\&DVWHUEDVHGIRDPSURYLGHVIRUDORZHU PRXOGHGGHQVLW\DQGDELOLW\WREHIRDPHGLQDVOLWWOHDVPPFURVV VHFWLRQVDQGVXSHULRUERQGVWUHQJWKWRPDWLQJPDWHULDOV)RDPLQ SODFHWRROLQJZKHUHDFDVW39&73(RU738VNLQLVSODFHGLQWKH PRXOGZLWKDKDUGSODVWLFUHWDLQHUDQGWKHIRDPLVLQMHFWHGEHWZHHQ WKHVHWZRFRPSRQHQWVLVXVHGIRUSURFHVVLQJ$ZHLJKWVDYLQJV RI GHSHQGLQJRQIRDPWKLFNQHVV DQGDFRVWVDYLQJVRI SHUDYHUDJHIRDPHGLQSODFHLQVWUXPHQWSDQHOLVDFKLHYHG FEB / MAR 2018

63

Design

honour at 2017


Design MATERIALS

Low Friction Polymer for Chain Tensioner Arms 2017 Ford Motor Co. Ford F150 / Mustang The material used for this application was Stanyl +*53$ 37)( 7KLVXVDJHRIDPRGLÂżHG3$ resin to enhance stiffness, on vehicles powered by a 5.0L V8 engine, was a drop-in replacement for PA66, for enhanced wear and friction performance. The resultant fuel economy savings (0.4%), from rotational torque reduction in the cam-shaft (0.5Nm), was equivalent to a 40lb weight reduction, and at tenth RIWKHFRVW$QQXDOHQYLURQPHQWDOEHQHÂżWVLQFOXGH reductions in gas consumption by12,000 barrels and green-house gas emissions by 5,000 tons. This innovation is highly translatable, to provide affordable fuel economy improvement, and will be utilized on more Ford vehicles, beginning in 2018. The total potential environmental impact of translations, at Ford, may be multiple times the values noted for the Mustang and F-150.

POWERTRAIN Turbo Charger Outlet T-Joint 2018 Hyundai Motor Co. Genesis G80, Kia Stinger The material used for this application was PA66. A 42% weight and 35% cost reduction, and improved DLUĂ&#x20AC;RZUHGXFLQJWKHSUHVVXUHGURS N3D WRLQFUHDVH fuel economy and improve NVH performance was achieved by designing and moulding this part with plastic compared to the previous aluminium die cast SDUW$LUĂ&#x20AC;RZQRLVHZDVDOVRUHGXFHGDQGORQJWHUP durability increased via the rib pattern design. Special 3-gate positioning tooling was designed to minimize stress in weld-line area for strength and durability and IRUSURFHVVLQJRSWLPL]DWLRQ$QHZJODVVÂżEUH reinforced, heat stabilized polyamide 66 resin was developed for good retention of properties over time at temperatures up to 220 degrees C.

PROCESS, ASSEMBLY ENABLING TECHNOLOGIES

Two Shot Interior Decoration Bezel 2018 Ford Motor Co. Ford Fiesta The material used for this application was INFINO LT120 PC and Starex LX0760. This unique 3-D decorative effect was achieved with 2K â&#x20AC;&#x2DC;reverseâ&#x20AC;&#x2122; injection moulding (1st shot tinted PC) with overmoulding of grained surface with 2nd shot VHOIFRORXUHGSLJPHQWHG$%6 7KLVLVWKHÂżUVWWLPH this process was used to achieve the 3-D visual effect (colour and texture) for a part of this size and geometry. A 30% cost save was achieved vs IMD/ IML/high gloss painting and there was a 20% scrap reduction vs conventional 2-layer high gloss piano black appearance.

64 FEB / MAR 2018


Design SAFETY

Gen-3 4-Way Head Restraint 2018 Ford Motor Co. Ford F150 The material used for this application was Hylon N1000STHL PA. This low cost, low mass, head restraint provides exceptional rigidity for whiplash SURWHFWLRQ,WVÀH[LEOHGHVLJQDOORZVWKHIURQWVXUIDFHRIWKHKHDGUHVWUDLQWWR be translated closer to or further from the occupant by 60mm without incurred costs (allowing for the precise balancing of comfort and safety). Using plastic, in place of steel, as the primary load bearing component is new to front row head restraints. The part design eliminates manufacturing complexity making use of intelligent geometries so that readily available materials could be used. A $10.73 Million savings ($2.80/vehicle) is projected by the end of 2020.

HALL OF FAME

Thermoplastic Polyolefin Skin Instrument Panel 2000 General Motors Co. Pontiac Bonneville The use of TPO skin on IPs was recognized in the industry in 1999, when GM won the SPE® Most Innovative Use of Plastics Award in the Body Interior category. It improved safety by enabling air bag deployments, and reduced windshield fogging with the reduction of VOCs and odours without plasticizers and toxic stabilizers. The environmentally friendly DOOSRO\ROH¿QV\VWHPDOVRHQDEOHGFORVHGORRSUHF\FOLQJ and the replacement of PVC while reducing mass 10%. The TPO skin also improved interior quality by preventing brittle cracking, colour fading (UV protection is improved by 4 times) and warping. Overall aesthetics were improved by the dry haptic leather-like feel inherent in TPO skin.

VEHICLE ENGINEERING TEAM AWARD General Motors Co for Significant Use of Innovative Plastic Content on the 2018 Chevrolet Traverse *HQHUDO0RWRUV&RIRU6LJQL¿FDQW Use of Innovative Plastic Content on the 2018 Chevrolet Traverse 7KHWHDP,QWURGXFHGD¿UVWVXUIDFH appearance, thin wall, structural, long glass ¿EUHSRO\SURS\OHQHRQWKHÀRRUFRQVROHFDUULHU saving the program 30% mass or 2.2lbs. This eliminated the need for metal reinforcements to take $1.50/assembly out of the part as ZHOO7KHWHDPDOVRODXQFKHGWKH¿UVWVHULDO production polyamide clevis bracket reducing the part weight by 45% relative to the previous aluminium design while increasing damping by a factor of 10. The team developed a new LED headlamp system that includes nine tailored elements – nine individual lenses on top of nine 1x1 LEDs producing approximately 720 lumens. These lenses include three large lenses (2 low beam / 1 high beam) coupled with six smaller ones (4 low / 2 high beam) and enabled lamp performance that is balanced with the customer requirements. The team also extended the use of low density (0.96 g/cc) TPO on the front and rear fascias, wheel opening mouldings, claddings and rocker mouldings. The use of plastics and composites contributed to enhanced performance (8% power gain with the 3.6L V6), weight savings (7% lower than the previous program), improved fuel economy (17% increase) with best in class cargo space and up to 14 available advanced safety features. 66 FEB / MAR 2018


Design

2017 IMDA

- creativity in design,

Best in-mould labelled packaging and in-mould decorated durable products THE In-Mould Decorating Association (IMDA) in the US has announced the winners of its 11th Annual Awards Competition, among them a Gold Award for the Best Thin Wall Packaging to plastic packaging producer Dairypack Tubs, a Division of Polyoak Packaging. The 2017 IMDA Awards Competition honours the industry’s best in-mould labelled packaging and in-mould decorated durable products. The winning entries were chosen based on creativity in design, engineering and innovation.

Best of Show & Best Injection Moulded (IML) Package

Tartex vegetarian paté BEST IN W H S O

The judges were so impressed by this little but mighty submission from Sonoco. This plastic package connotes natural ÀDYRXUZLWKDJUDSKLFGHVLJQDQGVKDSHWKDWPLPLFVDZRRGHQ barrel. The design is conveyed via barrier in-mould labels that deliver more than premium graphics with strong shelf appeal. They appreciated that the IML also delivered high barrier properties that work in concert with the plastic package to provide a shelf-stable pate product that is good for a full year. For its line of 100% plant-based, meat alternative spreads, the Tartex

brand uses specially designed PermaSafe® IML packaging by Sonoco. This solution combines maximum convenience and long shelf life with an eye-catching appearance at the point of sale. 7KHODEHOIHDWXUHVDVSHFLDOPDWWH¿QLVKGHYHORSHGE\6RQRFR for a natural, paper-like feel. These qualities underscore the naturalness of the product and give it an appetizing appearance. After sterilization, the spreads have a twelve-month shelf life without refrigeration, providing a modern and consumer-friendly alternative to metal cans.

Vibs & Wöw Oxo IML Container SuperLock® Pots

68 FEB / MARCH 2018

Submitted by: RPC Superfos Pamplona Brand owner: Cool Vega Moulder: RPC Superfos Pamplona Label supplier: Korsini-SAF

ER SILV RD A AW

Biobrush turns wood scraps into toothbrushes. The handle, as well as the packaging, are made from bioplastics based on cellulose made from wood waste from sustainable forestry. The bristles are made of 100% renewable polyamide, and the main component is castor oil without harmful emollients. The manufacturing of the colour master batches is adapted to the bioplastic and contains carefully selected pigments in which the concentration of heavy metal is way below threshold value.


Awards winners

engineering, innovation Best Thin Wall Package

Country Fresh Ice Cream Package

Best Label Design

DĂźfa Zeolit Paint Bucket GOLDD R AWA

Plastic packaging producer Dairypack Tubs, a Division of Polyoak Packaging, joined forces with Verstraete IML for the development of the new Dairymaid icecream packaging. And successfully so, because the new Country Fresh IML packaging is WKHÂżUVWLFHFUHDP packaging in South Africa with an IML label that covers the entire lid. 7KHHIÂżFLHQWVWDFNLQJRIWKHQHZ IML packaging has made transport more stable. Thanks to advanced injection moulded technology the packaging weighs 10% less than conventional packages which reduce the ecological footprint.

Best Injection Moulded Durable (IMD) Part

Telescopic Cylinder Cover for Industrial Trucks GOLDD R AWA

Submitted by: Kayalar Kimya Brand owner: DĂźfa Moulder: Etkin Plastik Label supplier: Korsini-SAF

GOLDD R AWA

This is not your standard paint bucket for mineral paint. Everything about it is unusual, starting with its well-balanced industrial-size oval shape with integrated handle thatâ&#x20AC;&#x2122;s easy to hold for larger hands. While graphics are simple, theyâ&#x20AC;&#x2122;re also elegant in shades of grey with spot UV coating that adds to the premium quality complemented by an artistic burst of colour.

SNO-BALLS TO-GO Submitted by: Verstraete In-Mould Labels/Berry Plastics Brand owner: SNO-BALLS TO-GO Moulder: Berry Plastics Label supplier: Verstraete In Mold Labels

ER SILV RD A AW

Packaging producer Berry Plastics has many years of experience and expertise in optimizing and developing packaging. Berry suggested IML packaging to brand owner Sno-Balls as an alternative to their previous packaging. The result is an IML package beyond Sno-Ballsâ&#x20AC;&#x2122; wildest dreams: Their product stays in perfect condition in the freezer and the contrasting IML labels from Verstraete IML attract attention on store shelves. The combination of Matte and UltraGloss IML is the perfect answer. Matte IML gives the packaging a matte and natural look, while UltraGloss ,0/SURYLGHVDKLJKJORVVÂżQLVKWKDWLQWHQVLÂżHVWKHFRORXUV The contrasting combination of the two look and feel options highlights the details in the artwork of the IML label. FEB / MARCH 2018 69

This award winning IMD part is a dust cover for front end telescopic cylinders used on industrial trucks. HYVA required a replacement for the older silk screen low quality print labels with a more attractive resistant Cover, made to withstand both extreme weather conditions, with superior UVA and abrasion resistance. Moulder Guarnitec SRL answered this challenging request making the cover visually more attractive with Korsini â&#x20AC;&#x2122;s twoOD\HUKLJKUHVLVWDQWODEHODGGLQJDVWURQJUHĂ&#x20AC;HFWLQJVLOYHUEDQGEHKLQGWKHORJR7KHHQGUHVXOWLV increased visual and functional quality with decreased production time.


Design Best Part Design

Artemis Spectrumâ&#x201E;˘ Sideplate Submitted by: Zomazz Brand owner: Logitech Moulder: Unique-Sill Precision PTE Label supplier: Zomazz

GOLDD R AWA

The sideplate is an interchangeable insert for the right and left sides of Logitechâ&#x20AC;&#x2122;s Artemis Spectrumâ&#x201E;˘ wireless surround-sound gaming headset. It can be switched out by the consumer, providing literally endless possibilities for FXVWRPL]DWLRQDQGEUDQGLQJZLWKPD[LPXPĂ&#x20AC;H[LELOLW\1HZ graphic designs can be produced by switching out labels without so much as a tool or resin change, and can be on store shelves in just weeks to coincide with game launches. 0DQXIDFWXUHGWRH[DFWLQJWROHUDQFHVWRÂżWWKHFXUYHRIWKH headset, the Spectrum sideplate featuring ZoMazz DigitalIMD graphics gives the brand owner and the consumer PD[LPXPĂ&#x20AC;H[LELOLW\WRFXVWRPL]HZLWKDPLQLPXPLQYHVWPHQW of resources.

Eila Lactose-Free Panna Cotta ER SILV RD AWA

The Finnish dairy producer Valio Ltd presented a lactosefree panna cotta in a specially developed package that allows the consumer to serve this dessert quickly and attractively. A new customized pot with a convenient clickand-push feature at the bottom was developed by packaging company RPC Superfos. Valio was looking for premium quality and opted for an IML decoration. The IML labels of Verstraete IML are strong, hygienic and resistant to moisture DQGH[WUHPHWHPSHUDWXUHĂ&#x20AC;XFWXDWLRQV

70 FEB / MARCH 2018

Pauluns & Lovemade Oxo IML Container SuperLockÂŽ Pots GOLDD R AWA Thanks to RPC Superfosâ&#x20AC;&#x2122; re-closeable SuperLockÂŽ solution, ambient shelf life of up to 24 months is possible for a wide range of products including baby food, ready meals, soups, sauces, nuts, jams, vegetable spreads and pickles. The SuperLockÂŽ solution in combination with Korsini-SAFâ&#x20AC;&#x2122;s autoclave resistant R[\JHQEDUULHUODEHOVDOORZVIRUSRVWÂżOOLQJVWHULOL]DWLRQXSWR Â&#x192;&IRUPLQXWHVGHFRUDWLRQĂ&#x20AC;H[LELOLW\DQGSURORQJHG shelf life, all of which gives a great advantage for commercial purposes. You can choose to have decorations made anywhere on all surfaces and also decide to leave some space undecorated for transparency. The end-user gets the visual impression and feel of glass â&#x20AC;&#x201C; as well as all the great properties of plastic. This means it is possible to get a product placement in retail stores under ambient temperatures alongside competing products sold in glass. And like glass products, the pot can be re-used at home multiple times, which adds value to the product.

Pennzoil Platinum High Mileage Motor Oil

ÂŽ

Submitted by: Verstraete In Mold Labels Brand owner: Valio Ltd Moulder: RPC Superfos Label supplier: Verstraete In Mold Labels

Best Product Family

ER SILV RD A AW Product differentiation in the automotive lubricants space is an important tool in validating price point comparisons among multiple product offerings. During a global bottle re-launch the brand owner decided to use a single bottle colour for all their individual brandsâ&#x20AC;&#x2122; product grades in the 1RUWK$PHULFDQPDUNHWZKLFKPDGH the decoration a critical component in communicating product line differentiation. WS Packagingâ&#x20AC;&#x2122;s In-Mould labelling provided an aesthetically superior look, and this metallized in-mould label was chosen for the Ă&#x20AC;DJVKLSEUDQGÂśVWRSRIWKH line product because its visual DSSHDOUHĂ&#x20AC;HFWVDSUHPLXP image for a premium product.


Design Best Prototype Part

Crystal Coaster

GOLDD R AWA Best Thermoform IML Package

The ZoMazz Crystal Coaster began life as a proof-ofconcept part to demonstrate our ability to incorporate crystals from Swarovski (through our exclusive partnership with the Austrian crystal manufacturer) into the ZoMazz Digital-IMD process. Utilizing DFOHDU¿OPZLWKFU\VWDOVDWWDFKHG to the moulded side allows for the secure display of crystals, as well as the appearance of different coloured crystals based on the imaged colour of WKHFOHDU¿OP7KHSURSULHWDU\ crystal placement/adhesion technology, combined with the ZoMazz Digital-IMD process, results in an eye-popping yet durable decoration for any brand or product.

72 FEB / MARCH 2018

Pillsbury Peanut Butter/ Chocolate Frosting Submitted by: Verstraete In Mold Labels Brand owner: J.M. Smucker Moulder: Tech II Label supplier: Verstraete In Mold Labels

GOLDD R AWA

As a leader in the consumer packaged goods industry, J.M. Smucker partnered with Tech II and Verstraete IML to launch a new and exciting Pillsbury Peanut Butter/Chocolate Frosting product. Using Tech II’s uniquely shaped Apollo™ thermoform in-mould labelled (T-IML) container, this package provides visibility of the product, an oxygen barrier layer to increase product shelf life, picturesque graphics and is fully recyclable.

www.imdassociation.com

9LN5V

With 35 years’ experience in supplying engineering polymers to the industry, our logistics & technical backup provide the highest level of service and support.

ABS – Polylac MABS – Polylac ASA – Kibilac SAN – Kibisan GPPS – Taitarex / Denka / Polyrex / Supreme Q-RESIN – Kibiton / Denka HIPS – GPPC / Supreme EPS – Taitacell / King Pearl  PMMA – Acryrex SMMA – Acrystex PC – Wonderlite Johannesburg Jeremy Goosen (T) 011 626 1030 jeremy@rawmac.co.za

Cape Town Shanaaz Wardien (T) 021 933 331/2 shanaaz@rawmac.co.za

PC/ABS ALLOY – Wonderloy PA 6 – Zissloy PA 66 – Gramid / Zissloy POM – Kocetal PBT – Spesin EVA – APC SBS – Kibiton 330,1(5$/),//±:RRUL&RÀHQ&DOSHW PP GLASS FILL – Woori PE – HDPE / LLDPE  UREA COMPOUND – Sprea  Durban Muthu Sagree (T) 031 577 0505 sagree@rawmac.co.za

www.rawmacplastics.co.za

Port Elizabeth Delene Williams Glen Kedikiloe 041 626 484 1030 3390 (T) 011 glen@rawmac.co.za


A global leader in the development and production of PVC Stabilisers and Metallic Soaps

Well Done Team South Africa

erda.co.za

THINKING GLOBALLY - WORKING LOCALLY At SUN ACE we believe it is imperative that we protect our people and stakeholders in all that we do, plus taking care of our environment. We are pleased to announce that we have achieved ISO 9001:2015, as well as being ISO 14001:2004 and OHSAS 18001:2007 certified. These certifications are an acknowledgement of the hard work and dedication of the entire team. While we celebrate this achievement, we continue to strive for excellence and improve on the way we work.


Books

Strong growth for stand-up pouches 67$1'83SRXFKHV 683V KDYHEHFRPHRQHRIWKHIDVWHVWJURZLQJĂ&#x20AC;H[LEOH packaging formats with global demand expected to pass 90 billion units in 2017, according to a new report from specialist industry consultants, AMI. The favourable development of the total supply chain cost of stand-up pouches and their stronger proposition to promote sustainability compared with rigid packaging alternatives will continue to be the key drivers of demand. Âł'HVSLWHWKHLQLWLDOKLJKFDSLWDOLQYHVWPHQWLQVWDQGXSSRXFKÂżOOLQJOLQHVWKH overall savings on packaging costs in tandem with stand-up pouchesâ&#x20AC;&#x2122; good HQYLURQPHQWDOSURÂżOHZLOOFRQWLQXHWRNHHSEUDQGRZQHUVLQWHUHVWHG´VD\V$0, Consulting senior market analyst MĂĄrta Babits. The growth of speciality pouch contract packers has also contributed to driving down costs and expanding interest in SUPs. Currently the fastest growth can be seen in the high-performance food category, particularly ready-to-eat baby food and fruit compotes driven by glass jar replacement and growing consumer demand for light weight, safe and convenient packaging for on-the-go consumption. Other segments such as liquid yoghurts are still niche but enjoying GRXEOHGLJLWJURZWKEHQHÂżWLQJIURPQHZ large scale investments by leading global brand owners. AMI Consulting forecasts that demand overall for SUPs will reach 113 billion units by 2021, a CAGR 201621 of almost 6%, but growth in some segments will be well above the average.

SAPPMA technical manual for pipe manufacturing, pipeline designenergy, optimise operation THE 5th edition of the Technical Manual compiled and published by SAPPMA (Southern African Plastic Pipe Manufacturers Association) has been released. -DQ9HQWHU&KLHI([HFXWLYH2IÂżFHURI6$330$ says the publication is a valuable tool aimed at assisting designers and the end-users of plastic pipes in producing pipelines that will last for a very long time. â&#x20AC;&#x153;It is now eleven years since SAPPMA started publishing an independent, technical manual on the manufacturing of plastic pipes and we believe the 2017-2018 edition is yet another big step forward â&#x20AC;&#x201C; both in terms of accuracy and ease of use of this handbook. It offers information, guidance and best in class technical information on how to select the right material, produce accurate designs and choose the correct installation procedures,â&#x20AC;? Venter says. â&#x20AC;&#x153;The purpose of publishing the SAPPMA Technical Manual is not to replace other publications and codes on the subject. Instead, our hope is that it will serve as a basic, user-friendly guide throughout the various steps of design,â&#x20AC;? Venter explains. He highlights that the information FRQWDLQHGLQWKHPDQXDOLVREMHFWLYHDQGIUHHRIDQ\FRPPHUFLDOLQĂ&#x20AC;XHQFH 6$330$LVDUHJLVWHUHGQRQSURÂżWRUJDQL]DWLRQ  Copies of the publication are available to design and civil engineers via SAICE or can be purchased directly from SAPPMA. â&#x20AC;˘ )RUPRUHLQIRUPDWLRQFRQWDFW/RXLVH0XOOHUDW$GPLQ#VDSSPDFR]D

IISRP publishes worldwide rubber statistics THE International Institute of Synthetic Rubber Producers (IISRP) has published the 2017 edition of Worldwide Rubber Statistics, the worldâ&#x20AC;&#x2122;s leading source for authoritative data about synthetic rubber. This edition of the book, which has been published annually for more than 30 years, has revisions to elastomer plant capacities as the synthetic rubber market continues to be dynamic. Additionally, IISRPâ&#x20AC;&#x2122;s &KLQDRIÂżFHKDVSOD\HGDNH\SDUWLQWKLV publication to enhance the intelligence on the Chinese market. The book provides a comprehensive analysis of capacity by elastomer type, by geographical distribution, and by corporate ownership. It also features a graphics VHFWLRQWKDWHPSKDVL]HVVWDWLVWLFVLQHDV\ to-read format and a section on capacities of synthetic rubber production facilities throughout the world, including a section on planned and announced expansions of synthetic rubber plants. The book is available for order on the IISRP website at www.iisrp.com/publications

74 FEB / MAR 2018


7+(FDWDVWURSKLF¿UHDW*UHQIHOO7RZHULQ/RQGRQKDV VKRZQKRZLPSRUWDQW¿UHSURWHFWLRQLV0DUNHWUHVHDUFK LQVWLWXWH&HUHVDQDKDVDQDO\VHGWKHZRUOGPDUNHWIRU Ã&#x20AC;DPHUHWDUGDQWVIRUEURPLQDWHGDQGFKORULQDWHGW\SHV DVZHOODV$7+RUJDQRSKRVSKRUXV$72DQGRWKHUW\SHV $FFRUGLQJWRWKHVWXG\DERXWPLOOLRQWRQVRIÃ&#x20AC;DPH UHWDUGDQWVSHU\HDUDUHFXUUHQWO\XVHGZRUOGZLGHLQSODVWLF SURGXFWVHOHFWURQLFGHYLFHVFRQVWUXFWLRQPDWHULDODQG WH[WLOHV $FFRUGLQJWR&HUHVDQDWKHFRQVWUXFWLRQLQGXVWU\LV WKHPRVWLPSRUWDQWVDOHVPDUNHWIRUÃ&#x20AC;DPHUHWDUGDQWV $ERXWRIJOREDOGHPDQGRULJLQDWHLQWKLVVHJPHQW )ODPHUHWDUGDQWVDUHHVSHFLDOO\QHHGHGLQLQVXODWLQJ IRDPVPDGHRIH[SDQGDEOHSRO\VW\UHQH (36  H[WUXGHGSRO\VW\UHQH ;36 SRO\YLQ\OFKORULGH 39& RU SRO\XUHWKDQH 385  $OXPLQXPWULK\GUR[LGH $7+ ZDVE\IDUWKHEHVW VHOOLQJÃ&#x20AC;DPHUHWDUGDQWLQUHFHQW\HDUV$7+LVXVHGLQ WKHSKDUPDFHXWLFDOLQGXVWU\DVDFKHPLFDOLQWHUPHGLDWH DVD¿OOHULQSODVWLFVUXEEHUFRVPHWLFVDQGSDSHUDV DJODVVDGGLWLYHDQGLQFHUDPLFV$GGLWLRQDOO\$7+LV XVHGDVDQRQVPRNHHPLWWLQJORZWR[LFLW\KDORJHQ IUHHÃ&#x20AC;DPHUHWDUGDQWXVHGIRUSODVWLFVSDLQWVDGKHVLYHV VHDODQWVDQGUXEEHU'HPDQGIRUWKHÃ&#x20AC;DPHUHWDUGDQW $7+LQ(XURSHDQGWKH$PHULFDVDPRXQWVWRRYHU %URPLQDWHGFRPSRXQGVXVHGLQHOHFWURQLFDQG HOHFWULFDOSURGXFWVDVZHOODVIRDPVDUHLQVHFRQGSODFH

Books

Lifesaver!

Market S Flame tudy: Retard ants (

5 th ed.)

%URPLQDWHGÃ&#x20AC;DPH UHWDUGDQWVDUHYHU\HIIHFWLYHEXWDOVR FRQWURYHUVLDO'XHWROHJDOSURYLVLRQVWKHUHDUHVLJQL¿FDQW UHJLRQDOGLIIHUHQFHV,Q:HVWHUQ(XURSHDQG1RUWK $PHULFDEURPLQDWHGFRPSRXQGVKDGPDUNHWVKDUHVRI RQO\DQGUHVSHFWLYHO\ZKLOHDFFRXQWLQJIRU LQ$VLD

KWWSZZZFHUHVDQDFRPHQPDUNHWVWXGLHVFKHPLFDOVÃ&#x20AC;DPHUHWDUGDQWV FEB / MAR 2018 75

YOUR LOCAL EREMA CONTACT RELLOY S.A. (Pty) Ltd P.O.Box 8190, ZA-1613 Edenglen www.relloy.co.za

HIGH THROUGHPUT. WE DRIVE THE DIAMEETS ECONOMY. QUALITY. CIRCULAR

Whether it is inhouse, postconsumer or bottle recycling: you can only close loops in a precise and profitable way if machines are perfectly tuned for the respective application. Count on the number 1 technology from EREMA when doing so: over 5000 of our machines and systems produce around 14 million tonnes of high-quality pellets like this every year â&#x20AC;&#x201C; in a highly efficient and energy-saving way. Thatâ&#x20AC;&#x2122;s Careformance!

CAREFORMANCE We care about your performance.


World News

Clariant launches 3D printing business Will provide solutions for fast-changing Additive Manufacturing market CLARIANT has launched its new dedicated 3D printing business to meet the demand of the fast-changing Additive Manufacturing market for premium and FXVWRPL]HG'SULQWHU¿ODPHQWV Additive Manufacturing (AM) is growing at a rapid pace globally, with over 28% average annual growth for each of the last 7 years, and generating a total of ELOOLRQLQVDOHVLQ :RKOHUV 5HSRUW $GGLWLYH0DQXIDFWXULQJ has moved from a niche technology to an industry where unique products are SURGXFHGIRUH[DPSOHWRGD\RYHU of the plastic shells for in-the-ear hearing DLGVDUHPDQXIDFWXUHGXVLQJ$0 :RKOHUV 5HSRUW 3URGXFWVPDQXIDFWXUHG using AM are often complex end-use parts such as air ducts, drones, lights, and parts

IRUPDQXIDFWXULQJHTXLSPHQW7KHVH products can be enhanced with tailored high quality and ready-to-print materials that also withstand the wear and tear of SURORQJHGXVDJH 7KHQHZ&ODULDQW'3ULQWLQJEXVLQHVV leverages the companyâ&#x20AC;&#x2122;s numerous years of experience in tailoring polymers for a broad range of end market applications with pigments, additives and masterbatches, to provide high-grade, 'SULQWHU¿ODPHQWVDQGVSHFLDOO\PDGH VROXWLRQV&ODULDQW'SULQWVDQGWHVWV all of its materials to ensure printability DQGWKHUHTXLUHGFRQVLVWHQWKLJKTXDOLW\ Extensive material, application and production expertise allows Clariant to work closely with customers on polymer, additive and colorant selection

to address typical end-use conditions such as weathering (sunlight, UV exposure), Ã&#x20AC;DPHUHWDUGDQF\DQGHOHFWULFDOSURSHUWLHV In addition to tailored materials, a portfolio of high quality standard material will also

SABICâ&#x20AC;&#x2122;s new PP extrusion line operational SABIC has a new polypropylene extrusion facility in Geleen, The 1HWKHUODQGV7KHQHZH[WUXVLRQ line adopts state-of-the-art process technology to produce SABIC®33 SURGXFWVDQGWKHQH[WJHQHUDWLRQ33 FRSRO\PHUV6$%,&VD\VWKLVXQGHUOLQHV the companyâ&#x20AC;&#x2122;s drive to provide

advanced materials that can support customers developing new lightweight applications in industries such as packaging, appliances, automotive, healthcare and help them reduce energy consumption in their process PDQXIDFWXULQJ Across industries there is an

increasing need for material solutions WKDWDUHVXVWDLQDEOHFRVWHI¿FLHQWDQG FRPSOLDQWZLWKHYHUWRXJKHUUHJXODWLRQV At the same time, they must provide LQFUHDVHGSURFHVVHI¿FLHQF\ZKLOH GHOLYHULQJLPSURYHGIXQFWLRQDOLW\ SABIC says it is pursuing cutting-edge technologies, both in production and new PDWHULDOGHYHORSPHQW 7KHQHZ33H[WUXVLRQIDFLOLW\LVORFDWHG next to the existing polymerization plant in Geleen where SABIC has a full-scale plant and the Global Technology Centre IRU(XURSH

www.sabic.com

SABICâ&#x20AC;&#x2122;s new polypropylene extrusion line in Geleen, The Netherlands, is now on-stream.

76 FEB / MARCH 2018


EHRIIHUHG7KH'SULQWLQJPDWHULDOV DUHPDQXIDFWXUHGE\&ODULDQWDQGDUH DYDLODEOHLQÃ&#x20AC;H[LEOHORWVL]HVWRPHHW WKHVSHFL¿FQHHGVRIFXVWRPHUV

1 Wohlers Report 2017, Fort Collins, USA: Wohlers Associates, Inc. ZZZFODULDQWFRP

Mondi grows with acquisition, recyclable pouch product MONDI Group plc is building up its Ã&#x20AC;H[LEOHSDFNDJLQJEXVLQHVVZLWK DQDFTXLVLWLRQRI8QLWHG.LQJGRP EDVHG([FHOVLRU7HFKQRORJLHVDQGE\ LQWURGXFLQJDQHZOLQHRIUHF\FODEOH IRRGSRXFKHV0RQGLDOVRKDVEHHQ EXLOGLQJLWVLQKRXVHÃ&#x20AC;H[LEOHSDFNDJLQJ FDSDELOLWLHVDQGSUHPLHUHGLWV(FR)UHVK SRXFKDWWKH3DFNDJLQJ,QQRYDWLRQV WUDGHVKRZLQ%LUPLQJKDP(QJODQGODVW

\HDU7KH(FR)UHVKSRXFKLVPDGHRQO\ IURPSRO\SURS\OHQHUHVLQVZKLFKPHDQV LWLVHDVLHUWRUHF\FOHWKDQSRXFKHV PDGHIURPDPL[WXUHRIUHVLQV7KH (FR)UHVKSRXFKGRHVQRWFRQWDLQRXWHU ¿OPPDWHULDOVVXFKDVSRO\HVWHUDQG WKHVSHFLDOO\GHYHORSHGSRO\SURS\OHQH ODPLQDWHXVHGLQWKHFRQVWUXFWLRQRIWKLV SRXFKKDVEHHQGHVLJQHGWRKDYHVLPLODU SURSHUWLHVWRWKDWRIWUDGLWLRQDOODPLQDWH

National Sword cuts through global recycling markets &+,1$¶61DWLRQDO6ZRUGSURJUDPPHFRQ WLQXHVWRLPSDFWSODVWLFVUHF\FOLQJDURXQG WKHZRUOG3URFHVVRUVLQWKDWFRXQWU\³PD\ KDYHWRVZLWFKWRSULPHUHVLQRUPRYHWKHLU UHF\FOLQJIDFLOLWLHVHOVHZKHUHLQ6RXWKHDVW $VLD´DVDUHVXOWRIWKHSURJUDPPH,+6 0DUNLWDQDO\VW.DLOLQ)XVDLGDWWKHUHFHQW *OREDO3ODVWLFV6XPPLWLQ&KLFDJR )XLVDVVRFLDWHGLUHFWRURISRO\ROH¿QVDQG HQJLQHHULQJUHVLQVIRU+RXVWRQEDVHG ,+6 1DWLRQDO6ZRUGLVDFUDFNGRZQRQ LOOHJDOLPSRUWVDQGIRUHLJQZDVWHODXQFKHG LQ-XO\ODVW\HDU5HF\FOHGPDWHULDOFRPLQJ LQWR&KLQDQRZLVEHLQJLQVSHFWHGDW PDLQSRUWVFDXVLQJGHOD\VRIWKUHHWRVL[ PRQWKVLQVRPHFDVHV/RFDOIDFWRULHV DOVRDUHEHLQJLQVSHFWHGZLWKVRPHEHLQJ VKXWGRZQRUKDYLQJWKHLULPSRUWOLFHQVHV VXVSHQGHGRUFDQFHOOHG &KLQDLVWKHZRUOG¶VODUJHVWUHF\FOLQJ PDUNHW)XVDLGWKDWUHF\FOHGPDWHULDOKDG DFFRXQWHGIRURI&KLQHVHSODVWLFV FRQVXPSWLRQEXWWKDWDPRXQWQRZLV GRZQWRWR 3ULRUWR1DWLRQDO6ZRUG:HVWHUQ (XURSHKDGVKLSSHGPRUHWKDQKDOIRI LWVUHF\FOHGSODVWLFVWR&KLQD)XDGGHG ZKLOHRISODVWLFVUHF\FOHGLQWKH86 KDGEHHQVHQWWKHUH7KDWPDWHULDOQRZ ZLOOHQGXSLQODQG¿OOVRUEHVHQWWRRWKHU FRXQWULHVVKHVDLG

UK government declares war on plastics 8.3ULPH0LQLVWHU7KHUHVD0D\KDV XQYHLOHGDSODQWRHUDGLFDWHDOODYRLGDEOH SODVWLFZDVWHE\7KHRQO\LPPHGLDWH QHZSROLF\KRZHYHUZDVWRH[WHQGD SHQFHFKDUJHIRUSODVWLFEDJVWRVPDOOHU VKRSVLQ(QJODQG 7KHSODQDOVRHQFRXUDJHVWKH GHYHORSPHQWRIµSODVWLFIUHHVXSHUPDUNHW DLVOHV¶7KHJRYHUQPHQWZLOOH[SORUH ZKHWKHUVXSHUPDUNHWVFDQLQWURGXFH DLVOHVZKHUHWKHUHLVQRSODVWLFSDFNDJLQJ DQGDOOWKHIRRGLVORRVH 7KH\HDUJUHHQSODQDOVRLQFOXGHV DQXPEHURIH[SORUDWRU\SURSRVDOVWR H[SDQGKDELWDWIRUZLOGOLIHDQGSURWHFWHG DUHDVDORQJWKHFRDVWDQGFUHDWHD VWDWXWRU\HQYLURQPHQWDOZDWFKGRJ 5HVSRQGLQJWR0D\¶VVSHHFKWKH%ULWLVK 3ODVWLFV)HGHUDWLRQ %3) VDLGLQDSUHVV UHOHDVHWKDWLWZDV³GLVWXUEHG´E\WKHWRQH ZKLFK³GRHVQRWUHFRJQLVHWKHLPSRUWDQW EHQH¿WVWKDWWKHSODVWLFVLQGXVWU\EULQJVWR WKH8.LQFOXGLQJMREV´

FEB / MARCH 2018 77

AROUND THE WORLD

Clariant logo printed with Clariant 3D SULQWHU¿ODPHQW


World News

):7=6,<0- WORLD *QWĚ&#x2030;Ă&#x2026;JZMĚ&#x2030;ZMQVNWZKMLKWUXW[Q\M[ KIVJMI\\IKSMLJaUW]TL

National environmental charity Surfers Against Sewage said Storm Eleanor had been the worst storm for dumping plastic litter on beaches all over the UK

Plastic â&#x20AC;&#x2DC;war zoneâ&#x20AC;&#x2122; on Cornwall beaches BEACHES across Cornwall have been left looking like a â&#x20AC;&#x2DC;plastic war zoneâ&#x20AC;&#x2122; after the worst wave of plastic pollution in four years was washed up in the wake of Storm Eleanor. The coastline has been covered ZLWKSODVWLFGHEULVEURNHQÂżVKLQJ nets, pieces of Lego and everything from plastic straws and bottles to shredded bags and polystyrene. Huge ghost nets have also been removed from Perranporth beach. National environmental charity Surfers Against Sewage said Storm Eleanor had been the worst storm for dumping plastic litter on beaches all over the UK. The organisation said the good news was that plastic pollution was increasingly at the front of peopleâ&#x20AC;&#x2122;s minds and more and more volunteers are both reporting plastic pollution incidents and doing their bit by picking up plastic from beaches. â&#x20AC;&#x153;We havenâ&#x20AC;&#x2122;t seen such plastic 78 FEB / MARCH 2018

devastation since Storm Hercules in 2014,â&#x20AC;? Hugo Tagholm, chief executive of Surfers Against Sewage, said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a plastic war zone. This has happened all around the South West,â&#x20AC;? he said. â&#x20AC;&#x153;We have had thousands of our volunteers out tackling the plastic WLGHEXWZHQHHGWRFXWWKHĂ&#x20AC;RZ of plastic at source. This pollution causes harm and ruins the beautiful beaches the South West relies on.â&#x20AC;? Claire Wallerstein, organiser of Rame Peninsula Beach Care, said the condition of beaches in South East Cornwall was â&#x20AC;&#x153;pretty horrendous. It looks like confetti has been thrown all over the beaches.â&#x20AC;? She said much of the big pieces of plastic has been cleared in previous beach cleans, leaving tiny fragments that are too small to collect.

),%5(6VXFKDVĂ&#x20AC;D[KHPSFHOOXORVHQDQRÂżEHU and kenaf have been used as reinforcements in composite materials for automotive applications, with kenaf in particular having made commercial inroads, However, a word of caution has been sounded by The University of British Columbiaâ&#x20AC;&#x2122;s Okanaganâ&#x20AC;&#x2122;s School of Engineering, which says that mould of the fungal type is proving increasingly important in the domain of engineering materials and can lead to early deterioration and structural failure. This is especially the case as manufacturers adopt more bio-derived materials in the drive towards a greener future, explains researcher Bryn Crawford. At UBCâ&#x20AC;&#x2122;s Okanagan campus, a multi-disciplinary team of researchers from the Composites Research Network and the Department of Biology, in collaboration with MIT and the National Research Council of Canada, have been studying the development and application of bio-sourced FRPSRVLWHV²VSHFLÂżFDOO\Ă&#x20AC;D[DQGKHPSÂżEUHV 7KHUHVHDUFKWHDPH[DPLQHGĂ&#x20AC;D[DQGKHPS ÂżEUHVDORQJVLGHRWKHUQDWXUDOPDWHULDOVWR determine what would happen over time to these ÂżEUHV7KH\FUHDWHG¾¿EUHVKHHWVÂśDQGWKHQDGGHG fungi to some, water to others, and left another group of sheets untreated. â&#x20AC;&#x153;It was a huge experiment and we found that in ERWKWKHKHPSDQGĂ&#x20AC;D[ÂżEUHVZKHQQRIXQJLZHUH added, we still had fungi growing,â&#x20AC;? Crawford adds. Âł%DVLFDOO\ZKHQUDZQDWXUDOÂżEUHVDUHH[SRVHG to high relative humidity, mould will grow and the potential for premature structural failure can occur.â&#x20AC;?

)`QWVTI]VKPM[ÂťLM[QOVNWZ ZMKaKTQVOÂź[MZ^QKM UK recycled plastics supplier Axion Polymers Ltd, has launched a new â&#x20AC;&#x2DC;design for recyclingâ&#x20AC;&#x2122; service to help ensure that the plastic packaging placed on the market is optimised for end of life, while maintaining its primary function of product protection. The service is aimed at the food and beverage supply chain. The service builds on Axionâ&#x20AC;&#x2122;s experience of the resource recovery sector which includes the design, build and operation of its own plastics recycling facilities. To put the service in context, Axion said nearly 70% of the UKâ&#x20AC;&#x2122;s plastic packaging waste that was collected for recycling was exported, mainly to Asia, in 2016.


McDonaldâ&#x20AC;&#x2122;s tosses EPS cups and trays All foam products will be eliminated by the end of 2018 McDONALDâ&#x20AC;&#x2122;S Corp will stop using expanded polystyrene worldwide after the company faced opposition to the products from a shareholder advocacy group. Just weeks after another call for the company to reconsider its use of EPS in cold beverage cups and trays, the US-based company now indicates foam products will be eliminated by the end of 2018. News of the latest move comes after McDonaldâ&#x20AC;&#x2122;s transitioned from foam to paper coffee and hot beverage cups a few years ago. And most recently, McDonaldâ&#x20AC;&#x2122;s is now vowing to only create guest packaging that FRPHVIURPUHQHZDEOHUHF\FOHGRUFHUWLÂżHG sources by 2025. The restaurant giant plans to also provide

guest packaging recycling at all restaurants, also by the same deadline. McDonaldâ&#x20AC;&#x2122;s EPS decision comes with a backdrop of a larger battle regarding the use of the material as municipalities debate the issue. Industry forces call EPS recyclable and say the material is, indeed, recycled. But opSRQHQWVVD\WKHPDWHULDOLVMXVWWRRGLIÂżFXOW to handle or not recyclable on a large scale as a practical matter. EPS, unlike its rigid PS cousin, is made up of about 98% air. Its light weight and bulk present recycling challenges compared to some other plastics. But Dart Container Corp, for example, has been a strong advocate for EPS packaging and its recyclability. The company has

offered to create a system to handle New York Cityâ&#x20AC;&#x2122;s EPS, for example, in the face of Mayor Bill de Blasio push to outlaw the materialâ&#x20AC;&#x2122;s use in takeout food packaging. Dart also has created a network of EPS recycling facilities in different parts of the country. McDonaldâ&#x20AC;&#x2122;s, on the companyâ&#x20AC;&#x2122;s website, indicates â&#x20AC;&#x153;the environmental impact of our packaging is a top priority.â&#x20AC;? â&#x20AC;&#x153;We also plan to eliminate foam packaging from our global system by the end of 2018. While about 2% of our packaging, by weight, is currently foam, we believe this small step is an important one on our journey. These actions represent successes that will continue to raise the bar for our system and our industry,â&#x20AC;? the company said. FEB / MARCH 2018 79


World News

Mazda is using Durabio, a bio-based polycarbonate resin jointly developed with Mitsubishi Chemical Corp, on the front grille of the 2017 CX-5 compact crossover

Bio-based PC gets a front view on Mazda CX-5 Transparency allows for mirror-like smooth surface and vivid colours SINCE 2013, Mazda Motor Corp and Mitsubishi Chemical Corp have been developing a range of new materials for use on vehicle interiors and exteriors, but now the companiesâ&#x20AC;&#x2122; bio-based polycarbonate resin called Durabio â&#x20AC;&#x201D; made from plant-derived isosorbide â&#x20AC;&#x201D; is being used to mould large exterior components. Take the 2017 Mazda CX-5 compact crossover, for example, where the Japanese automaker placed Durabio in a front-and-centre position on the front grille. A spokesman for Mazdaâ&#x20AC;&#x2122;s team in Hiroshima, Japan, said that compared with conventional petrochemical-based plastics, Durabio exhibits â&#x20AC;&#x153;superior chemical resistance,â&#x20AC;? enabling the frontend plastic part to withstand abrasive road debris. The material also features â&#x20AC;&#x153;superior propertiesâ&#x20AC;? compared with other bio80 FEB / MARCH 2018

based plastics in areas like impact resistance, heat resistance and weathering, Mitsubishi Chemical Corp. said in a news release. Its transparency allows for a â&#x20AC;&#x153;mirror-like smooth surfaceâ&#x20AC;? and vivid colours when pigments are added. Durabioâ&#x20AC;&#x2122;s hard surface and scratch resistance also eliminates the need for any coating process, reducing volatile organic compound emissions during the manufacturing stage, the company said. â&#x20AC;&#x153;In terms of the surface design ÂżQLVKZHDFWXDOO\H[FHHGHGRXUJRDO DQGSURGXFHGDÂżQLVKRIKLJKHUTXDOLW\ than traditional painted parts,â&#x20AC;? Mazdaâ&#x20AC;&#x2122;s spokesman said. Most of Mazdaâ&#x20AC;&#x2122;s vehicle models are already using the material, which was ÂżUVWXVHGIRUDQLQWHULRUSDUWRQWKH Mazda MX-5 Miata and an exterior part on the Mazda CX-9 midsize crossover, the spokesperson said.

Durabio has also been used on various interior parts, ranging from gear shift covers and cup holder bezels to console side decorative panels; and exterior parts, such as C pillar garnishes, among other applications. $GGLWLRQDOO\LQ)UHQFK automaker Renault used Durabio on the outer mask of the speedometertachometer combo for the dashboard of the Clio. In 2013, Japanese automaker Suzuki Motor Corp., which also partnered with Mitsubishi on the development of Durabio, used the bio-based plastic on the interior colour panels of the Suzuki Hustler. Durabio was later used on interior colour panels for Suzukiâ&#x20AC;&#x2122;s 2015 Alto Lapin.


Asahi Kasei to expand capacity for nylon Ã&#x2026;TIUMV\ Exceptional strength, heat resistance, durability, light weight $6$+,.DVHL¶V)LEUHV 7H[WLOHV6%8 ZLOOH[SDQGLWVSURGXFWLRQFDSDFLW\IRU /HRQDÂ&#x152;Q\ORQ¿ODPHQWLQ1REHRND 0L\D]DNL Japan

:LWKH[FHSWLRQDOVWUHQJWKKHDW UHVLVWDQFHGXUDELOLW\DQGOLJKWZHLJKW /HRQDQ\ORQ¿ODPHQWLVZLGHO\ XVHGLQLQGXVWULDODSSOLFDWLRQVQRWDEO\ DLUEDJVDQGW\UH cord for the automotive LQGXVWU\ satisfying rigorous TXDOLW\ requirements. /HRQDQ\ORQ ¿ODPHQW LVHQMR\LQJ UHPDUNDEOH

JURZWKLQLWVSUHGRPLQDQWDSSOLFDWLRQRI DLUEDJVDVYHKLFOHSURGXFWLRQLQ$VLD LQFUHDVHVDQGWKHDLUEDJLQVWDOODWLRQ UDWHULVHVLQOLQHZLWKKHLJKWHQHG VDIHW\UHTXLUHPHQWV7KLVFDSDFLW\ H[SDQVLRQZLOOHQDEOH$VDKL.DVHLWR meet increasing demand as the market FRQWLQXHVWRJURZ &DSDFLW\LVFXUUHQWO\DWWRQV D\HDUDQGWKLVZLOOEHLQFUHDVHGE\ DSSUR[LPDWHO\WRQV\HDUZKLFK VKRXOGFRPHRQWROLQHGXULQJWKH¿UVW KDOIRI www.asahi-kasei.co.jp/asahi/en/

/HRQDQ\ORQ¿ODPHQWLVZLGHO\XVHGLQLQGXVWULDODSSOLFDWLRQVQRWDEO\DLUEDJVDQGW\UH FRUGIRUWKHDXWRPRWLYHLQGXVWU\

5<,_QV[JQOVW\QKMNWZ^MZa^MZa[UITTXIZ\[ )RXUFRPSDQLHVKDYHUHDFKHGWKH¿QDOLVW VWDJHIRU3ODVWLFV1HZV¶3URFHVVRURIWKH <HDU$ZDUGDPRQJWKHP07'0LFUR 0ROGLQJZKLFKGRHVPLFURPRXOGLQJRI PHGLFDOSDUWVLQ&KDUOWRQ0DVVDFKXVHWWV in the US. 07'0LFUR0ROGLQJKDVIRUJHGDVWURQJ LGHQWLW\LQWKHFKDOOHQJLQJ¿HOGRIPLFUR PROGLQJVRPHRIWKHSDUWVDUHVRVPDOO \RXFDQPDNHSDUWVIURPDVLQJOH SHOOHWRIUHVLQ7KHFRPSDQ\VKLSV PLOOLRQSDUWVD\HDU 7KHVHDUHFULWLFDOWLQ\SDUWVPRXOGHG LQ,62&ODVVFOHDQURRPV$ERXW RIWKHFRPSRQHQWV07'PRXOGV JHWLPSODQWHGLQWRWKHERG\2IWKRVH DUHELRUHVRUEDEOHDSSOLFDWLRQVOLNH LPSODQWDEOHVWDSOHVPLFURVFUHZVWDFNV DQGPLFURSOXJV )HZPRXOGHUVFDQWDFNOHWKHFKDOOHQJH $ERXWRIQHZSURMHFWVFRPHWR 07'DVµUHVFXHV¶LQRWKHUZRUGVIDLOHG DWWHPSWVE\RWKHUPRXOGHUV$QRWKHU DUHSURMHFWVGHHPHGµLPSRVVLEOH¶ WKDWRWKHUPRXOGHUVZRXOGQRWHYHQWU\WR www.mtdmicromolding.com

PDNH07'EXLOGVWKHPLQLVFXOHPRXOGV LQKRXVHDQGSOD\VDQLPSRUWDQWUROHZLWK part design. 2QWKHTXDOLW\VLGHRQWLPHGHOLYHU\ KDVVWHDGLO\LPSURYHGLQUHFHQW\HDUVWR PRUHWKDQ7KHFRVWRIQRQTXDOLW\ KDVJRQHGRZQGUDPDWLFDOO\2Q07'¶V ODUJHVWSURGXFWOLQHDQLPSODQWDEOH ELRDEVRUEDEOHSURGXFWWKHFRPSDQ\ UHSRUWVLWKDVPRXOGHGDQGVKLSSHGPRUH WKDQPLOOLRQSDUWVVLQFHSURGXFWLRQ EHJDQDQGDYHUDJHGRQO\UHWXUQV SHU\HDUZLWK]HURUHWXUQV $QGWKHFRPSDQ\LVDERXWWRJURZ SK\VLFDOO\DVZHOOSODQQLQJWREUHDN JURXQGWKLVVSULQJIRUDVTXDUHIRRW DGGLWLRQWRLWVEXLOGLQJLQ&KDUOWRQ7KH H[SDQVLRQZLOOLQFOXGHDQHZWRROLQJ GHSDUWPHQWPRUHFOHDQURRP VSDFHDGGLWLRQDOVWRUDJHDQG D¿WQHVVFHQWUHIRUWKH¿UP¶V HPSOR\HHV 7HFKQRORJ\LVDPDMRU SDUWRI07'DQGLWV unique components.

7KHFRPSDQ\UXQVLQMHFWLRQPRXOGLQJ PDFKLQHVPRVWRIWKHP6RGLFNV$OORI WKHPKDYHURERWVRWKHUDXWRPDWLRQDQG vision systems. 7KHFRPSDQ\UHFHQWO\DGGHGDYHUWLFDO URWDU\6RGLFNWRLQFUHDVHRYHUPRXOGLQJ of the micro parts. $PDMRULQYHVWPHQWZDVD6DUL[PLFUR ('0V\VWHP6DUL[HTXLSPHQWFDQPDNH corners that can measure 5 microns. American company MTD Micro Molding, makes micro plastic parts, some so small you can make 520 parts from a single pellet RIUHVLQ3LFWXUHGKHUHDUH¿YHRIWKHLUPLFUR plastic parts on an American one dime coin which measures just 17.91mm in diameter


Diary

â&#x20AC;&#x2DC;Behind the scenesâ&#x20AC;&#x2122;

highlighted Naked Winery²7KH3(7ERWWOHVIURP$PFRULQ WKH86$DUHPDNLQJLWSRVVLEOHIRUSHRSOHWRIRUJHW DERXWWKHHOHFWURQLFVIRUDVKRUWZKLOHDWOHDVW DQGHQMR\ZLQHLQXQFXVWRPDU\VSRWV

COMING UP

AMCOR SHOWS PET WINE BOTTLES AT CALIFORNIA SHOW WINE consumers are demanding portable, lightweight bottles for home delivery and consumption at venues where glass is prohibited or isnâ&#x20AC;&#x2122;t practical. With this in mind, Amcor Rigid Plastics showcased its portfolio of PET packaging at the 8QLĂ&#x20AC;HG:LQH *UDSH 6\PSRVLXP in Sacramento, California, in January. Amcorâ&#x20AC;&#x2122;s solutions cater to needs of the â&#x20AC;&#x2DC;anytime, anywhereâ&#x20AC;&#x2122; wine consumer. â&#x20AC;&#x153;Consumers are active and living on-the-go lifestyles. They are taking wine with them when they hike, hit the beach, and visit friends. Amcorâ&#x20AC;&#x2122;s PET bottles are a lightweight and durable solution for consumersâ&#x20AC;&#x2122; increasing demands,â&#x20AC;? said Beth 5HWWLJRI$PFRUÂśV'LYHUVLÂżHG3URGXFWV'LYLVLRQ Naked Winery, based in Hood River, Oregon, USA, uses lightweight PET bottles from Amcor for its â&#x20AC;&#x2DC;Outdoor Vinoâ&#x20AC;&#x2122; brand. The shatter-proof and portable 750ml PET bottles play a major role in an everchanging wine market by differentiating the Outdoor Vino brand, which is sold exclusively online. â&#x20AC;&#x153;We believe that if youâ&#x20AC;&#x2122;re in the middle of an outdoor adventure you should absolutely be able to enjoy a great bottle of wine,â&#x20AC;? said Becky Williams, marketing and brand manager for Naked Winery. Amcorâ&#x20AC;&#x2122;s stock PET wine bottles are PDQXIDFWXUHGLQ)DLUÂżHOG&DOLIRUQLDDQGDUH compatible with twist-off aluminium closures. They utilize a unique barrier coating technology that delivers the portability and recyclability of plastic, with an internal glass-like barrier that protects wine from oxidation and provides a 12 to 18-month shelf life. Incidentally, Naked Winery is on a â&#x20AC;&#x2DC;mission to cut Americaâ&#x20AC;&#x2122;s divorce rate in half by inviting couples to shut off the electronics and share a glass of wine nightlyâ&#x20AC;&#x2122;. The companyâ&#x20AC;&#x2122;s high-quality wines enhance the romance of wine by pleasing the palate and other senses with provocative brands that change the conversation.

WATER LEAKS & INFRASTRUCTURE AT BIRCHWOOD END-FEB THE :DWHU/HDNV ,QIUDVWUXFWXUH)RUXPtakes place on 28 February at the Birchwood Hotel in Boksburg. An exhibition will run in parallel with the conference sessions, with exhibitors including Sika, Invincible Valves, Cascade, Atlas Plastics, N&Z Instruments and others present. The event is targeted at government and PXQLFLSDORIÂżFLDOVZKRDUHLQYROYHGLQZDWHU reticulation and in fact anyone who is involved in water supply. Main speakers include Mark Shamley of Elster Kent Metering, Colte Smit of Sanika and Weaver Simmons of Motheo Construction. â&#x20AC;˘ Inquiries: Levi on 079 189 1299 or levim@mogorosicomms.co.za 82FEB / MAR 2018

,QQRYDWLRQ$OOLDQFHZLOOEULQJÂżYHVSHFLDOLVHGH[KLELWLRQVWRJHWKHU )520WKHIRRGSURGXFWVWKDWZHÂżQGRQWKHVXSHUPDUNHWVKHOYHVDQGWKHERRNVWKDW ZHSHUXVHLQWKHERRNVKRSWRWKHKRXVHVZHOLYHLQDQGWKHFDUVWKDWZHGULYHÂľEHKLQG WKHVFHQHVÂśRIRXUHFRQRP\ÂśVPRVWFHQWUDOSURGXFWLRQVHFWRUVOLHVDOHQJWK\FKDLQRI RXWVWDQGLQJDQGWHFKQRORJLFDOLQGXVWULDOPDFKLQHU\DZRUOGRIWHFKQRORJLHVWKDWVSDQV IURPWKHSURFHVVLQJRIPDWHULDOVVXFKDVWKHZLGHUDQJHRISODVWLFV XVHGIRUH[DPSOH WRPDNHSURGXFWVEXLOGFDUFRPSRQHQWVRULQVXODWHDQGKHDWLQVXODWHEXLOGLQJV WRWKH SURFHVVLQJRIUDZPDWHULDOVDQGWKHLUSDFNDJLQJ IRUERWKIRRGSURGXFWVVXFKDVSDVWD DQGFROGFXWVDQGWKRVHIRUSHUVRQDOFDUH DQGÂżQDOO\WKHSULQWLQJRIWKHSDFNDJLQJ RUSHUVRQDOLVHGJUDSKLFVZKLFKWUDQVIRUPHDFKDQGHYHU\REMHFWLQWRDPHDQVIRU FRPPXQLFDWLRQEHIRUHDUULYLQJDWWKHLPSRUWDQWUROHWKDWWKHJRRGVÂśVWRUDJHDQG KDQGOLQJV\VWHPVKDYHRQWKHVXSSO\FKDLQDQGRSWLPLVDWLRQRIFRVWV 7KLVLVWKHEDFNJURXQGWRWKHSHQGLQJPlastVKRZGXHWRWDNHSODFHDWWKH)LHUD 0LODQRLQ0LODQ,WDO\IURP0D\WR-XQH ,QGXVWULDOPDFKLQHU\LQIDFWKDVDFHQWUDOUROHLQPDQ\GLIIHUHQW\HWFRPSOHPHQWDU\ VHFWRUVDQGUHSUHVHQWVDQLPSRUWDQWLQGXVWU\LQ,WDO\ZKLFKDFFRUGLQJWRWKHSUHOLPLQDU\ GDWDIRULVZRUWKÂźELOOLRQLQWHUPVRIRYHUDOOWXUQRYHUDQGHPSOR\VRYHU LQGLYLGXDOV7KLVVDLGLQGXVWULDOPDFKLQHU\FRQVWLWXWHVDERYHDOODSRZHUIXOGULYLQJIRUFH IRUÂľ0DGHLQ,WDO\ÂśH[SRUWVÂąLHFUHDWHGLQ,WDO\WREHVROGDEURDGÂąFRQVLGHULQJWKDWDQ DYHUDJHRIRIWKHWHFKQRORJLHVSURGXFHGLQWKHVHVHFWRUVLVH[SRUWHG VRXUFHV ,WDOLDQ$VVRFLDWLRQV$&,0*$$0$3/$67$1,0$$5*,DQG8&,0$  5HSUHVHQWDWLRQIURPDQHVWLPDWHGFRXQWULHVKDVEHHQFRQÂżUPHGIRUWKHVKRZWKXV IDUZLWKDWRWDORIPĂ°H[KLELWLRQVSDFHERRNHG 3DUWRIWKHVKRZWKH,QQRYDWLRQ$OOLDQFHZLOOEULQJWRJHWKHUÂżYHVSHFLDOLVHG H[KLELWLRQVWKDWHDFKUHSUHVHQWOHDGLQJHYHQWVLQWKHLUUHODWLYHVHFWRUV7KHSURMHFW LVSURPRWHGE\)LHUD0LODQRZKLFKLVFRPPLWWHGWRVXSSRUWLQJWKHGHYHORSPHQWRI V\VWHPHYHQWVDQGLQGXVWU\WUDGHIDLUVXQGHUVWRRGDVEXVLQHVVWRROVDVZHOODV JURZWKRSSRUWXQLWLHVIRUWKHLQGLYLGXDOVHFWRUVLQYROYHG )RUWKHYHU\ÂżUVWWLPHWKHIROORZLQJWUDGHVKRZVZLOOEHWDNLQJSODFHVLPXOWDQHRXVO\ Ipack-IMAWKHOHDGLQJHYHQWIRUWHFKQRORJLHVLQWKHSURFHVVLQJDQGSDFNDJLQJLQGXVWU\ Meat-TechDQHYHQWVSHFLDOLVHGLQSURFHVVLQJDQGSDFNDJLQJIRUWKHPHDWLQGXVWU\ PLASTWKHHYHQWRIUHIHUHQFHIRUWKHSODVWLFDQGUXEEHULQGXVWU\Print4AllWKHQHZ IRUPDWGHGLFDWHGWRWKHFRPPHUFLDODQGLQGXVWULDOSULQWLQJLQGXVWU\Intralogistica ItaliaWKHHYHQWWKDWFRPELQHVLQQRYDWLYHVROXWLRQVDQGLQWHJUDWHGV\VWHPVGHVWLQHGIRU LQGXVWULDOKDQGOLQJZDUHKRXVHPDQDJHPHQWPDWHULDOVWRUDJHDQGSLFNLQJRSHUDWLRQV The Innovation AllianceZLOOEHDQRSSRUWXQLW\WRVKDUHNQRZOHGJHDQGVWUDWHJLHV DQGFRQÂżUPWKHFURVVFXWWLQJQDWXUHRIDQLQQRYDWLYHSURGXFWLRQFKDLQWKDWLV LQFUHDVLQJO\ORRNLQJWRZDUGVWKHRSSRUWXQLWLHVSURYLGHGE\,QGXVWU\VRDVWRRIIHU PRUHDGGHGYDOXHIRUERWKWKHSURGXFWLRQVHFWRUWKDWLWVHUYHVDQGWKHHQGFXVWRPHU WKHXQNQRZLQJEHQHÂżFLDU\RIWKHVHRUJDQLVDWLRQV %RWKWKH,WDOLDQDQGLQWHUQDWLRQDOPDUNHWVKDYHZHOFRPHGWKHLQLWLDWLYHZLWK JUHDWHQWKXVLDVPFRQVLGHULQJWKHVLJQLÂżFDQWQXPEHUVDOUHDG\DFKLHYHGZLWKVRPH PRQWKVWRJRXQWLORSHQLQJGD\ GLUHFWH[KLELWRUVDOUHDG\FRQÂżUPHG ZLWKJRRG SURVSHFWVIRUJURZWKLQWKHFRPLQJPRQWKV


Diary

technologies will be

at Plast in Italy ,QIDFWRIWKHVHFWRUVUHSUHVHQWHGE\WKH,QQRYDWLRQ $OOLDQFHWKHLQGXVWULDOSULQWLQJDQGFRQYHUWLQJPDFKLQHU\ VHJPHQWKDVVHHQJURZWKRIDQGDWXUQRYHUHTXLYDOHQWWR ¼ELOOLRQ VRXUFH$FLPJDDQG$5*, 7KHUXEEHUDQGSODVWLF processing machinery sector is worth â&#x201A;¬ 4,45-billion, representing DLQFUHDVHLQWHUPVRIWXUQRYHU VRXUFH$0$3/$67  The packaging and processing sector, with an overall value DPRXQWLQJWR¼ELOOLRQKDVVHHQDLQFUHDVHLQ WXUQRYHU VRXUFH,3$&.,0$5HVHDUFK&HQWUHGHULYHGIURP 8FLPDDQG$1,0$GDWD (YHQWKHLQWHUQDOORJLVWLFVVHJPHQW KDVVHHQJURZWKRIZLWKDQRYHUDOOWXUQRYHUHTXDWLQJWR ELOOLRQHXURV VRXUFH$1,0$  Italy therefore plays a fundamental role on an international scale and is able to compete on a par with manufacturing JLDQWVVXFKDV*HUPDQ\WKH86$DQG&KLQD$QDGYDQWDJH of the Italian offer lies in its ability to innovate and develop tailor-made manufacturing systems, characteristics that have enabled Italy to establish itself as one of the worldâ&#x20AC;&#x2122;s leading PDFKLQHU\H[SRUWHUV www.plastonline.org

â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU%$6)

RQ738(ODVWROODQ®7KHUPRSODVWLF3RO\XUHWKDQH

â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU(ODVWURQ RQ73(739(ODVWURQ®6(%6DQG(3'033

â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU &*)6(RQ)6(® )OXRURHODVWRPHUVDQG 3HUÃ&#x20AC;XRURHODVWRPHUV

â&#x20AC;¢ 'LVWULEXWRUIRU:HLIDQJRQ:HLSUHQ &3( â&#x20AC;¢ 6XSSOLHUVRI(369DULRXV*UDGHV â&#x20AC;¢ (QJLQHHULQJ3RO\PHUV â&#x20AC;¢ 3RO\ROH¿QV â&#x20AC;¢ 5HZRUNHGDQG5HSDOHWLVHG0DWHULDOV ®

At Formnext 2017, SABIC introduced a new family of high-performance THERMOCOMPâ&#x201E;¢ AM compounds that addresses the unique requirements of large format additive manufacturing (LFAM). Print parameters and mechanical property data for the materials â&#x20AC;&#x201C; developed by SABIC using test specimens printed on the companyâ&#x20AC;&#x2122;s in-house BAAM®SULQWHU±FDQVLJQL¿FDQWO\DLGFXVWRPHUVLQH[SHGLWLQJPDWHULDO selection and optimizing processing. Reinforced with carbon or JODVV¿EHUVIRUDGGHGVWUHQJWKWKHQHZFRPSRXQGVFDQEHXVHG for applications in the tooling, aerospace, automotive and defense industries. On 13-16 November 2018, the next international Formnext conference in Frankfurt, Germany, will showcase current and future cutting-edge applications of additive technologies. The experts on hand will have plenty to offer visitors and exhibitors alike as they discuss a broad range of hot industry topics, including everything from the latest product developments in industrial manufacturing to design, training, and related regulatory concerns.

www.basf.com

83

SABIC launches materials for Large Format Additive Manufacturing

FEB / MAR 2018

To round out the technology and materials on display for the plastics and rubber sector (core and secondary machinery, equipment, auxiliary, moulds, virgin and recycled raw materials, VHPL¿QLVKDQG¿QLVKSURGXFWVVHUYLFHV 3/$67ZLOO also feature three satellite fairs: Rubber 2018 (in collaboration with Assogomma 3D Plast (3D printing and associated WHFKQRORJLHV DQG3ODVW0DW LQQRYDWLYHPDWHULDOV  3/$67ZLOOWKXVUHSUHVHQWWKHPRVWLPSRUWDQW(XURSHDQGDWH LQIRUWKHSODVWLFVDQGUXEEHULQGXVWU\ 7KH,QQRYDWLRQ$OOLDQFHZLOOHVVHQWLDOO\RFFXS\WKHHQWLUHDUHD WKDWFRQVWLWXWHVWKH)LHUD0LODQRH[KLELWLRQGLVWULFWUHSUHVHQWLQJ the largest event dedicated to industrial machinery in Italy and RQHRIWKHOHDGLQJVHFWRUHYHQWVLQ(XURSH7KHVSHFLDOLVHG RIIHULQJSURYLGHGE\WKH¿YHHYHQWVZLOOEHWKHIRFXVRIWKH exhibition project;however, there will also be opportunities IRUFURVVFXWWLQJUHÃ&#x20AC;HFWLRQDVUHJDUGVQHZPDWHULDOVQRYHO technologies and indispensable R+ D opportunities to enable FRPSDQLHVWRFRQWLQXHWREHFRPSHWLWLYHLQWRGD\¶VPDUNHW The importance of these production sectors for Italy is demonstrated by the overwhelmingly positive forecasts from


Diary GULF PRINT FOR PRINT PROFESSIONALS

COMING UP

THE Gulf Print & Pack Summit, a comprehensive event for senior level print industry professionals involving a two-day conference programme and table-top exhibition, will be held at Dubaiâ&#x20AC;&#x2122;s Roda Al Bustan Hotel on 4-5 March. ;HUR[KDVEHHQFRQÂżUPHGDVWKHHYHQWÂśV RIÂżFLDOSODWLQXPVSRQVRUDQGWKHVXPPLWZLOOEH supported by some of the largest manufacturing names operating in the international printing community as well as leading trade publications. Aimed at printers/convertors, brand owners, retailers and graphic, packaging and label designers, the summit will discuss cutting-edge print technologies and applications, future trends in print production and effective strategies for business excellence and economic growth. Other exhibitors include AFRA International, Anoop Plastic Products, Bobst, Durst, Heidelberg, Konica Minolta and Nilpeter. Lisa Milburn, MD of Gulf Print & Pack said: â&#x20AC;&#x153;Gulf Print & Pack Summit will be taking a hard look at the major issues affecting the printing sector both in the Middle East and the wider international scene. The event is set to be a lively forum for ideas and interactive discussion with a heavy focus on innovative production strategies and key technological developments.â&#x20AC;? www.gulfprintpack.com

84 FEB / MAR 2018

PLASTICS REGULATIONS TIES IN WITH EU, US FOOD CONTACT LEGISLATION EVENT AMIâ&#x20AC;&#x2122;s second Plastics Regulations conference will bring together legal professionals once again in Cologne on 14-15 March. There is also the opportunity to attend the pre-conference workshop dedicated to EU and US food contact material legislation. With the last REACH registration deadline for existing chemicals fast approaching, and the evolving nature of food contact legislation, Plastics Regulations 2018 provides a well-timed opportunity to gain impartial and well-informed guidance focused VSHFLÂżFDOO\RQWKHQHHGVRIWKHSODVWLFVLQGXVWU\ The second edition of Plastics Regulations offers a rare opportunity to gain focused advice on a range of legal and compliance issues impacting polymer producers, compounders, processors and end users incorporating the wider plastics and packaging supply chain â&#x20AC;&#x201C; all at one event. The conference SURYLGHVDFRVWDQGWLPHHIÂżFLHQWZD\WRSURWHFW and future-proof your business. This year also sees the introduction of Steptoeâ&#x20AC;&#x2122;s Food Contact Materials Workshop â&#x20AC;&#x201C; Food Contact Materials 101 EU and US: What you need to know. Members of Steptoeâ&#x20AC;&#x2122;s transatlantic Food Contact Materials and Food Safety Practice join forces for a one-day workshop covering all the basics you need to know today about food contact compliance in the EU and the US. Steptoeâ&#x20AC;&#x2122;s workshop is targeted at legal and UHJXODWRU\FRPSOLDQFHRIÂżFHUVZLVKLQJWRDFTXLUH solid understanding of all the current aspects of EU and US food contact compliance. This workshop is a one-stop-shop opportunity for participants of Plastics Regulations 2018 to get a comprehensive overview RIUHTXLUHPHQWVIRU(8DQG86IRRGFRQWDFW compliance, also informing global compliance, given that regulators follow each otherâ&#x20AC;&#x2122;s suit. As a team based in Brussels and Washington, DC, Steptoe and Johnson work together on FOLHQWÂżOHVHYHU\GD\DQGZLOOEHRQWKHJURXQG to share their expertise, how to achieve FRPSOLDQFHDQGUHVSRQGWRTXHVWLRQV www.plasticpipesconference.com

Propak East Africa unwraps recycling, sustainability ahead of the 2018 edition PROPAK East Africa is the regionâ&#x20AC;&#x2122;s largest and most established packaging, plastics and processing exhibition and conference. Over 3,500 senior industry representatives are expected to gather from 27 February to 1 March 2018 at the KICC in Nairobi, Kenya. The exhibition will bring together packaging, plastics and processing professionals from across the East African region to share knowledge and network over three inspiring days. The largest regional trade show dedicated to the plastics and packaging industry, Propak East Africa hopes to provide enough of a focus on sustainability to contribute to changing peopleâ&#x20AC;&#x2122;s perception of packaging by showcasing innovative solutions and technology. With a changing mindset from both the average consumer as well as larger businesses, there is a real opportunity to take the lead and make a difference. Showcasing products and services from a variety of sub-sectors including packaging materials, packing and ancillary machinery, packaging suppliers, converting, rubber & plastics, processing and labelling, Propak East Africa 2018 is the most comprehensive trade show in the region. Among the features at Propak East Africa 2018 is the Conference, where visitors can sit in on compelling sessions hosted by industry experts as they discuss market opportunities, economic landscapes, technology trends and much more. Topics and themes are yet to be announcedâ&#x20AC;Ś www.propakeastafrica.com

CHINAPLAS 2018 Paves the Way to Plasticsâ&#x20AC;&#x2122; Future Innovation is key to the future CHINA is rapidly becoming a preeminent new market in the world. With over RMB 1.5 trillion spent in R&D in 2016, a 10.6% annual increase, and of which 77.5% was contributed by businesses, the overall productivity and comprehensive national SRZHURI&KLQDLVVWUDWHJLFDOO\EHLQJERRVWHGHQKDQFLQJWKHFRXQWU\ÂśVLQĂ&#x20AC;XHQFHLQ technology innovations. High-speed rails, an aircraft carrier, the BeiDou Navigation Satellite System, the FAST telescope F ( ive-hundred-meter Aperture Spherical radio Telescope), the EAST E ( xperimental Advanced Superconducting Tokamak)nuclear fusion reactor, etc. are but a few glimpses of the technological advancements achieved by China in the 21st century. As a major and recognized platform to promote technological innovations, CHINAPLAS addresses the latest needs of many application industries including automotive, E&E, IT & Telecom, packaging, building and medical, presenting leading and hot solutions from all over the world. The theme of the next edition of CHINAPLAS is Iâ&#x20AC;&#x2DC;nnovation is Key to the Futureâ&#x20AC;&#x2122;, highlighting the roles of technology and innovation. CHINAPLAS has relocated to the National Exhibition and Convention Center N ( ECC), Hongqiao, Shanghai, PR China and takes At CHINAPLAS place from 24-27 2018, machines April. An estimated and materials 4,000 exhibitors for developing from 40 countries large diameter SRO\ROHÂżQ and regions will drainage will be showcase their the highlights advanced exhibits on for visitors from 2 an over 320 000m the construction of exhibition area. industry www.ChinaplasOnline.com


ODUJHUV\VWHPV,WLVDYDLODEOHZLWKVKRWVL]HVRIRU ON display at Graham Engineering Corporationâ&#x20AC;&#x2122;s NPE2018 NJ KDVDIRRWSULQWRIDSSUR[LPDWHO\E\PDQG ERRWKZLOOEHVRPHRIWKHFRPSDQ\¶VÃ&#x20AC;DJVKLSH[WUXVLRQEDVHG LVPKLJKZLWKVLQJOHRUGXDOKHDGFRQ¿JXUDWLRQDQG V\VWHPVIRUEORZPRXOGLQJVKHHWPHGLFDOWXELQJZLUHDQG FDEOHDQGRWKHUDSSOLFDWLRQVHDFKHTXLSSHGZLWKDSURSULHWDU\ ERWWRPRUVLGHGLVFKDUJH7KHUDSLGFRORXUFKDQJHIHDWXUH Navigator®FRQWUROV\VWHPIRUOLYHGHPRQVWUDWLRQRILWVDFFXUDF\ LVPDGHSRVVLEOHE\DSURSULHWDU\VSLUDOÃ&#x20AC;RZGLYHUWHUKHDG Available on all of the companyâ&#x20AC;&#x2122;s DQGHDVHRIXVH The Mini Hercules accumulator head blow moulder combines a small DFFXPXODWRUKHDGPDFKLQHV 5HDOWLPHJUDSKLFDOGLVSOD\ the diverter head also provides LVDKDOOPDUNRI1DYLJDWRU+LJK shot size and space-saving footprint with one-hour colour and material change and other advanced features available with the companyâ&#x20AC;&#x2122;s FRQWLQXRXVLQWHUQDOFOHDQLQJ YLVXDOFRUUHODWLRQEHWZHHQ larger systems GXULQJSURGXFWLRQHOLPLQDWLQJ WKHWRXFKVFUHHQDQGPDFKLQH the need to disassemble the IXQFWLRQHQVXUHVDQLQWXLWLYH head for cleaning and increasing XVHUH[SHULHQFHWKDWHQDEOHV SURGXFWLRQDYDLODELOLW\ ERWKQHZDQGH[SHULHQFHG 13(7KH3ODVWLFV6KRZ operators a rapid learning from 7-11 MayLQ2UODQGR FXUYHDQGHDVHRIXVH )ORULGDLQWKH86$SURYLGHV Plastics processing H[FOXVLYHDFFHVVWRWKHSHRSOH systems on display at Graham SURFHVVHVVFLHQFHDQGLGHDV (QJLQHHULQJV¶ERRWKZLOOLQFOXGH WKDWDUHVKDSLQJWKHIXWXUHRI WKH0LQL+HUFXOHVDFFXPXODWRU SODVWLFV%XLOGFRQQHFWLRQV KHDGEORZPRXOGHU7KLV H[FKDQJHLGHDVDQGH[SORUH system combines a small the largest concentration of VKRWVL]HDQGVSDFHVDYLQJ PDFKLQHU\WRROVWHFKQRORJ\DQG IRRWSULQWZLWKRQHKRXUFRORXU professional training available in and material change and WRGD\¶VLQGXVWU\PDUNHWSODFH RWKHUDGYDQFHGIHDWXUHV available with the companyâ&#x20AC;&#x2122;s www.grahamengineering.com FEB / MAR 2018

85

Diary

Innovative blow moulding, sheet, extrusion systems at NPE2018


Diary

COMING UP

PLASTIC CLOSURES IN BERLIN IN MAY PLASTIC Closure Innovations, Europeâ&#x20AC;&#x2122;s leading international forum dedicated to plastic caps and closures organised by specialist plastics industry consultancy AMI, is expected to attract industry professionals from around the world. The event takes place in Berlin from 22-24 May. Now in its sixth year, Plastic Closure Innovations has been regarded as the ideal place where the industry meets to get a comprehensive overview of emerging trends, technical advancements and to discuss key challenges evolving in the plastic closures industry. It highlights where the future is headed and what the opportunities are for businesses across the value chain. Global brand owners will explore how end-user demands are shaping product development addressing various technical and commercial issues. Coca-Cola will talk about brand ownersâ&#x20AC;&#x2122; greatest challenges for closures such as HQYLURQPHQWDOLVVXHVSURGXFWLRQHIÂżFLHQF\DQG consumer expectations while NestlĂŠ will discuss the changing requirements around safety and compliance for closures with a focus on off-favoures. Multinational home and personal care company Henkel will focus on trends and developers for liquid detergents, and Kao will present a case study for sealing technology in functional hair-bleaching packaging. Delegates will also gain comprehensive insights into industry trends and developments. Leading Japanese closure producer Nippon Closures will explore the evolution and future of hinge-cap development for sauces in the Japanese market while an overview of the plastic closures market will be provided by AMI Consulting, and Pacproject will discuss the impacts of the changing consumer trends and habits on the closure business. Leading plastic closure producers will present their views and experiences on the challenges for their development projects. Weener Plastics will focus on developments in dosing and dispensing cap solutions; United Caps will give a joint presentation with NestlĂŠ looking at opportunities for shelf differentiation; trends and developments in airless dispending pumps will be discussed by RPC Bramlage Division; Universal Closures will talk about how to optimise closure design with computer analysis tools while Corvaglia will look at closure design from the perspective of digital printing; Vitop will highlight new closure and system requirements for fountain drinks; delegates will hear about trends and developments in one-handed closure design from Amaray and Tetra Pak will discuss opportunities in improving processes for polymer screening for closures. The conference in 2017 sold out with delegates from Anheuser-Busch InBev, Danone, Henkel, MOM Group, NestlĂŠ, Unilever, Suntory and many more all gaining a comprehensive perspective of innovative technical advancements, emerging trends and challenges which are shaping the industry.

ROTOMOULD FIJI THIS yearâ&#x20AC;&#x2122;s Australasian roto moulding conference, RotoMould Fiji 2018, takes place as its name suggests in the beautiful archipelago of Fiji (it has about 330 islands, of which only two are inhabited much) from 3-5 June. The event is of interest to people involved in the roto sector globally, who want to throw in a bit of a holiday too. 86 FEB / MAR 2018

Pouch event should draw wide interest LEADING industry professionals and experts from around the world will come together in Vienna, Austria, on 24-25 April for Plastic Pouches, organised by specialist plastics industry consultancy AMI. Packaging pouches have recorded possibly the most growth in the industry overall, worldwide, over the past few years, including in Southern Africa. Plastic Pouches will provide a networking opportunity and high level forum to discuss the latest developments and issues in the dynamically evolving plastic pouches industry. Featuring a diverse programme of presentations by industry leaders, the focus for Plastic Pouches 2018 will be on innovation, sustainability, adding value and optimising performance across the value chain. Major multinational brand owners will explore how end-user demands are shaping product development addressing various technical issues. NestlĂŠ will focus on safety and compliance of food contact materials for pouches, multinational snack company MOM Group will talk about the successes and challenges of the standup pouch development, while Podravka will discuss technical requirements towards pouches for retort and highpressure processing. Other issues for discussion include trends in rigid packaging replacements, an overview of the global stand-up pouches market, and recycling and 2018 Plastindia Gandhinagar, Gugarat, India

7-12 February www.plastindia.org

Water Leaks & Infrastructure Forum 28 February Birchwood Hotel, Boksbur www.mogorosicommunications.co.za Propak East Africa KICC, Nairobi, Kenya

27 Feb-1 March www.propakeastafrica.com

World Pultrusion Vienna, Austria

1-2 March www.pultruders.com

Gulf Print & Pack Dubai, UAE

4-5 March www.gulfprintpack.com

Foam Expo Novi, Michigan, USA

6-8 March www.foam-expo.com

AMIâ&#x20AC;&#x2122;s Spec Packaging Films Asia 13-14 March Bangkok, Thailand www.ami.international/events Plastics Regulations Cologne, Germany

14-15 March www.ami.international.com

Plastic Pouches Vienna, Austria

24-25 April www.amiplastics.com

The lightweight pouches offer a number of advantages for brand suppliers and can be colourfully decorated too Images courtesy of MOM Group

exploring design guidelines for the circular economy for plastic pouches. Plastics Pouches 2018 will also look DWDGYDQFHPHQWVLQEDUULHUÂżOPDQG coating technology, material innovations in retort grades and mono material pouch solutions and new generation of water-based inks. â&#x20AC;˘ The event takes place at the Imperial Riding School at the Renaissance Hotel in Vienna. www.amiplastics.com Plast Italia Milan, Italy

29 May-1 June www.plastonline.org

Rotomould 2018 Fiji

3-5 June www.rotomouldconference.com.au

Polymer Foam Pittsburgh, USA

19-20 June www.ami.international/events

Compounding World Expo 27-28 June Messe Essen, Germany www.compoundingworldexpo.com Complast Kenya Nairobi Propak West Africa Lagos, Nigeria Plastic Pipes XIX Las Vegas, USA

Medtech Innovation Expo 25-26 April Ricoh Arena, Coventry, UK mtiexpo@dynamail.co.uk

2019

NPE Orlando, Florida, USA

K DĂźsseldorf, Germany

22-24 May www.ami.international

24-26 September www.pvc4pipes.com

PU Tech Africa 20-21 November Sandton Convention Centre expo@technobiz-asia.com Valve World Expo DĂźsseldorf, Germany

Plastic Closure Innovations Berlin, Germany

18-20 September www.propakwestafrica.com

Intâ&#x20AC;&#x2122;l Composites Congress 5-6 November Stuttgart, Germany www.composites-germany.org

Chinaplas 24-27 April Hongqiao, Shanghai, China www.chinaplasonline.com

7-11 May www.npe.org

13-15 July www.complastexpo.in

27-29 November www.valveworldexpo.de

16-23 October 2019 www.k-online.com


CLASSIFIED ADVERTS

Advertisers:– Feb / Mar 2018 ACD Rotoflo Advanced Polymers Banbury Chemicals Brenntag SA Cabletech Marketing Carst & Walker Charles Rust Associates DemaPlastech DH Polymers GreenTech Machinery Inkulu Plastic Pipes Jenowill Karbochem Maritime Marketing Masterbatch SA MBT MGMW Trading Milliken Mould Base Nissei ASB Orion Engineered Carbons Performance Colour Systems Plastomark Protea Chemicals Rapid Granulator Rawmac Relloy (Erema) Safripol SAPY Colours Sasol Polymers SES Skyland Masterbatch Sun Ace T4PC Ultra Polymers W D Hearn Machine Tools Zerma Africa

39 21 29 IFC 09 19 27 43 83 33 49 03 45 13 23 28 25 35 51 53 67 71 57,59 IBC 61 72 75 05 65 17 55 79 73 01 37 85 OBC

THERMOFORMING, SHEET EXTRUSION, AND MATERIALS THERMOFORMING TECHNOLOGY SAVE 90% of your electricity use with GN! • GN (Canada): machines for reduced waste and reduced energy • Thermoforming Moulds for GN and other thermoformers • ToolVu technology for productivity and NEW quality improvement on thermoforming machines • Complete lines for EPS foam trays and EPS cup moulding NEW

EXTRUSION TECHNOLOGY FROM AGRIPAK OF ITALY Mono & multi-layer extrusion lines for the production of: • ‘Cartonplast’ (twinwall/hollow profile sheet) • Multilayer sheet for packaging • Semi-foamed sheet for thermoforming

MATERIALS FOR THERMOFORMED PACKAGING

• Sealing films for trays and top web for FFS machines • OPS, PP, PET sheet for general packaging • PP/EVOH/PP for high barrier containers

BRE INNOVATIONS 7RSODFHDFODVVLÀHG DGYHUWSOHDVH Fax: 086 519 6089 or Tel: 021 712 1408 or E-mail: saplastics@iafrica.com ZZZVDSODVWLFVFR]D

Recycle your plastic with us We buy most forms of clean factory waste

Contact: Desiré Preston for more info Tel: 011 894 3520 | Cell: 083 774 6038 | Email: desire@jcl.co.za www.jcl.co.za

Contact: Tim Forshaw (083 381 5253) or Phil Hopkinson (083 408 5253) or 021 671 5253 or mail to tim@bre.co.za

FOR SALE Negri Bossi 250Ton injection moulding machine in daily use JHB Price: R170K negotiable Please contact: Matthew@maritimemarketing.co.za or on cell: 078 308 1013 FEB / MAR 2018

87


Sport

An ice sculpture of the Olympic rings is illuminated during the Pyeongchang Winter Festival, near the venue for the opening and closing ceremony of the PyeongChang 2018 Winter Olympic Games in Pyeongchang, South Korea

Dow insulation at Olympic Winter Games

88 FEB / MARCH 2018

0DNHKRXVLQJFRPIRUWDEOHDQGHQHUJ\HIÂżFLHQW A RANGE of high-performance technology solutions powered by The Dow Chemical Company were used in several venues at the 2018 Olympic and Paralympic Winter Games in PyeongChang, South Korea. These included modular houses and the Olympic village. Dowâ&#x20AC;&#x2122;s solutions were applied to help reduce energy usage while making accommodations comfortable for athletes, attendees, media and drivers. With average February temperatures just above freezing, effective insulation was essential in PyeongChang. PIR (polyisocyanurate) panels incorporating Dow PAPIâ&#x201E;˘ Polymeric MDI were used to insulate the walls and roofs of the modular houses that accommodated

drivers who will be responsible for transporting people around the Olympic host city. The modular houses are built from manufactured panels consisting of boards, insulation and foam. Constructed within hours, rather than days, for less than half the usual cost, WKHVHHQHUJ\HI¿FLHQWVWUXFWXUHVKHOS protect the environment as they require roughly half the energy compared to standard EPS and are 98% recyclable. The modular houses were weatherVHDOHGZLWKGXUDEOH¿UHUHVLVWDQW'RZ CorningŽ 1001 Perimeter Silicone Sealant, which is inherently impervious to damaging ultraviolet (UV) light from sun, and, when cured, is stable at temperatures from -40°C to 150°C. www.dow.com

Besides helping create a more comfortable living environment, Dow is also contributing to a more comfortable sleeping environment. Some of the mattresses in the Olympic Village employ Dow VORANOLâ&#x201E;˘ Technology in the slab foam to help the athletes get the quantity and quality of sleep that they need â&#x20AC;&#x201C; 10 hours a night or more . Outside of the Olympic Village, VORANOâ&#x201E;˘ Technology is also employed in a number of mattresses in hotels across the host city. VORANOL technology helps improve foam shape upon compression to create comfortable, EUHDWKDEOHĂ&#x20AC;H[LEOHPDWWUHVVHVWKDW stay cool to the touch and with reduced odor and emissions.


The Protea Chemicals Team offers innovative solutions to industry with the backing of world class products, suppliers and industry professionals.

JOHANNESBURG 011 821 3300 jhbsales@ proteachemicals.co.za

CAPE TOWN 021 550 8100 capeorders@ proteachemicals.co.za

DURBAN 031 468 5424 orderskzn@ proteachemicals.co.za

www.proteachemicals.co.za

PORT ELIZABETH 041 403 1000 peorders@ proteachemicals.co.za


The Home of Size Reduction

SA Plastics Feb-Mar 2018  

SA Plastics, Composites & Rubber is published six times a year. The magazine includes news and information about issues, products and techno...

SA Plastics Feb-Mar 2018  

SA Plastics, Composites & Rubber is published six times a year. The magazine includes news and information about issues, products and techno...

Advertisement