Page 1

www.saplastics.co.za

VOL 15 ISSUE 6 – DECEMBER 2017 / JANUARY 2018

Propak Cape 2017

Colourful collaboration at PlastiColors

Plastemat enters EBM market

Gold Pack Awards

ON RECOMMENDATIONS

PLASTIC PRODUCTS EASED! RECYCLABILITY REL

RS

OF TE A)

OF FI

A SS O CI A S OU T

LICATION PUB OF T (PCA) & N P TIO RN AF HE

ICS CONV A ST ER PL TE HE S INSTI STIC TU LA CA (PIS RI

C

L IA

Tederic lists on Beijing exchange Pledges for Penguins

Safrique undergoes metamorphosis

Pelchem steps up its game 14

22

28


GLOBAL MARKET LEADER IN CHEMICAL DISTRIBUTION Welcome to Brenntag South Africa.

Brenntag South Africa (Pty) Ltd 11 Mansell Road Killarney Gardens Cape Town 7441 Cape Town ûÀ”¹•»º¾¿¿ºÂ»¹ Johannesburg ûÀ”¹•ººÂÀ½¹½¹ info@brenntag.co.za

www.brenntag.com

With over 10,000 products and a world-class supplier base, R2KKU)AL62RSLK2SULOSBLOSLHVUCLKSUL)RLVK/ºÁ¾z¹¹¹ -VSULJ2RSAHL,)HH[}!BCSCK-HV/2SSO2-C9-)OOHC-)UCLK technology, extensive technical support and value-added services, such as just-in-time delivery, product mixing, formulation, repackaging, inventory management and drum return handling. Our world class team, is ready to provide you with raw materials, to cater to your requirements, along with our comprehensive technical support. From enquiry to delivery, you can trust us for complete peace of mind.

RUBBERS / PLASTICS / POLYMERS / LUBRICANTS / COATINGS


&ƌĞĞĐŽŶƐƵůƚĂƟŽŶƐ for new projects

We supply & maintain moulding machinery ĂŶĚĐĂƉŝƚĂůĞƋƵŝƉŵĞŶƚĨŽƌƚŚĞƉůĂƐƟĐ and metals industry

^ƚĂīƚƌĂŝŶŝŶŐĨŽƌ ŵĂĐŚŝŶĞƐĞƫ ŶŐ Machine maintenance contracts Free manuals for old ŽƌĞdžŝƐƟŶŐŵĂĐŚŝŶĞƐ

Technical Machine Suppliers is at the forefront ŽĨůĞĂĚŝŶŐŝŶŶŽǀĂƟŽŶƐŝŶŽƵƌŝŶĚƵƐƚƌLJ

TOOL-TEMP has been manufactured temperature control units ĂŶĚǁĂƚĞƌĐŚŝůůĞƌƐƐŝŶĐĞϭϵϳϯ͕ĂƚĮƌƐƚĨƌŽŵ^ƵůŐĞŶŝŶ^ǁŝƚnjĞƌůĂŶĚ ďƵƚĂƚŽƚŚĞƌƐůŽĐĂƟŽŶƐƐŝŶĐĞƚŽŽ͘dKK>ͲdDWƐŝĂǁĂƐƐƚĂƌƚĞĚŝŶ ϮϬϬϯ͘dŚĞĐŽŵƉĂŶLJŵĂŶƵĨĂĐƚƵƌĞƐĂďŽƵƚϵϬϬϬƵŶŝƚƐĂLJĞĂƌ͘ PRESSURISED WATER UNIT TT-DW1609KW • • ͻ ͻ •

up to 160°C with plate heat exchanger ĨĂƐƚƌĞĂĐƟŶŐŚĞĂƟŶŐƐLJƐƚĞŵ ƉƵŵƉǁŝƚŚŵĂŐŶĞƟĐĐŽƵƉůŝŶŐ compact design

We carry spares for these and other Tool-Temp models

NATIONAL OFFICE 031 701 0422 ŶŶĞƩĞsĂƌƌŝĞ͗Ϭϴϯϳϴϴϭϱϲϱ ĂŶŶĞƩĞ@ytsm.co.za

Cape Town Sean Herholdt info@ytsm.co.za 071 155 0981

Eastern Cape ŶŶĞƩĞsĂƌƌŝĞ ĂŶŶĞƩĞΛLJƚƐŵ͘ĐŽ͘njĂ 083 788 1565

Zimbabwe & Africa Raymond Marowa info@ytsm.co.za +263 7734 77740


BY THE WAY

Publisher: Martin Wells (martin@summitpub.co.za) Editor: Tessa O’Hara (tessa@summitpub.co.za) Editorial assistant: Heather Peplow (heather@summitpub.co.za) Financial manager: Lisa Mulligan (lisa@summitpub.co.za) Designer: Jeanette Erasmus Graphic Design (jeanette.erasmus@lateraldynamics.co.za) Bronwen Moys Blinc Design (bronwen.clarke@gmail.com) Summit Publishing cc t: +27 (21) 712 1408 f: 086 519 6089 c: +27 (82) 822 8115 e: saplastics@iafrica.com Postnet Suite 42, Private Bag X16, Constantia 7848, Cape Town, South Africa Unit 8, Bergvliet Village Centre, Cnr Hiddingh & Children’s Way Roads, Bergvliet 7945

www.saplastics.co.za GAUTENG Lowrie Sharp t: (011) 793 4691 f: (011) 791 0544 c: 082 344 7870 e: lowrieplasticsmedia@absamail.co.za KZN Lynne Askew t: (031) 764 2494 f: (031) 764 0676 e: lynne@summitpub.co.za Printed by: Tandym Print, Maitland, Cape Town SA Plastics Composites + Rubber Technology is published six times a year and focuses on these industries in South and southern Africa. We welcome news, articles, technical reports, information in general and photographs about events and developments related to the plastics industry. The views expressed in the magazine are not necessarily those of the publisher. Views expressed are not necessarily those of the Plastics Converters Association, Institute of Materials or Association of Rotational Moulders either. Copyright: All rights reserved. ISSN number: 1684-2855 (ISDS Centre, Paris) Summit Publishing: CK 9863581/23 VAT reg: 4600187902

Plastics Institute of Southern Africa

Association of Rotational Moulders of South Africa

Plastics Converters Association

PET Plastic Recycling

Plastics Federation

South Africa

of SA

Institute of Materials

One of the interesting innovations at the recent Propak Cape show was that of a new retortable oxygen barrier tub for barista-quality coffee, Ella Cappuccino. The developer, Star Gate Innovations, was involved in the introduction of the new concept product, based on the stand of Polyoak, which manufactured the packaging. Read more on page 31

Fundamentals of business practise in 1981 well proven WE CONTINUE with the article about the foundation of what was then, in 1981, known as Polyoak Products from an article uncovered by John Neild of MyPlas, if only because the fundamentals laid out then – nearly four decades ago – apply no less today. Polyoak had been started in 1976 and, at the time of the report, had just taken over the well-established Woodstock blow moulders, Terel Industries, and then Harods Engineering, which enabled it to set up its own toolroom. By 1981 it was already running 15 injection moulding machines and was also involved in blow moulding. The report by the late George Warman reads as follows: ‘Asked why he thought the company had gone ahead so successfully, Mr Peter Nield (then director) was forthright: “Our VXFFHVVLVGXHWRIRXUEDVLFIDFWRUVÂżUVWG\QDPLFPDQDJHPHQW made possible because each partner’s abilities complement the others. Secondly, careful selection of our product range and only producing bread-and-butter lines which will still be selling in 10 years’ time. Thirdly, carefully planned expansion only into areas which are complementary to those we are already working. And lastly, ensuring credibility and not making promises we could not meet.â€? That year the company had a projected turnover of R2-million, which was substantial for the time. The fundamentals laid out by Mr Neild appear to have yielded results.

Funny blue in bags no cause for alarm A BUILDER in Somerset West was in DELWRID¿[DIWHUKLVFOLHQWDSHUVRQ who’s enthusiastic about braaing, became anxious that bags being used to transport wood to the site of the soonto-be-completed lapa showed traces of an unusual blue powder, not quite kryptonite but worrying nonetheless. Various potential explanations were advanced, but it all fell into place after the The bags did have a strange arrival of a photo of the offending bag. The shade of blue laminated woven PP bags were originally XVHGWRWUDQVSRUWPDWHULDOIURPURWRSRZGHUPDQXIDFWXUHU$&'5RWRÀR of Kya Sand and found a new use about 1400kms away. The extremely ¿QHSRZGHUZDVDUHVXOWRI$&'œVHI¿FLHQWPLOOLQJSURFHVVDQG&OLYH 5REHUWVRQRI$&'FRQ¿UPHGWKDWDOOWKHFRPSDQ\œVPDWHULDOJUDGHV were FDA and potable water-approved. The residue was deemed to be harmless. So the braai could HAVE ‌ IF YOU continue. According to Clive, the bags are used for G TO SAY IN H ET M SO an extremely wide variety of post-use applications, de: if you si ht ig br e Look at th wisdom to of m none of which ACD has any control over. ge ve some us at ha to ease write impart, pl com s@iafrica. tic as pl sa


O L ME 15R N6 VU

REGLOPLAS

DECEMBER 2017 / JANUARY 2018

Contents Find out more at www.saplastics.co.za

Recommendations on recyclability released

6

2I¿FLDOformation of Brenntag South Africa

8

Gold Pack Awards

10

Propak Cape 2017

12

Tederic lists on Beijing exchangey Kai Mei blow moulding machine installed at PN D

30

38

42 44

Zerma Africa keeping busy

48

Plastemat enters EBM market

50

Latest SODVWLFVUHF\FOLQJ¿JXUHV

52

New Wired 4Signs acquisition for Perspex SA

54

Sareltech appointed agent for u Ligi Bandera

58

• RT 70 control system • Solid-state relay (SSR)instead of

changer for pump direction (clockwise)

31

• Alarm buzzer • Heating capacity 9 kW • Cooling capacity 24-90 kW

NEW

• Pump capacity 60 litres/min, 3.8 bar

Type 150 Smart

45

DESIGN

Temperature control units for water up to 90°C

heating contactor • Automatic phase-

40

Leadway PDFKLQHUXQQLQJÀDZOHVVO\DW1 /

Bioplastics Awards 2017

… for large injection moulds, extruders, rollers, autoclaves and other processing equipment

New, more efficient Type 90 Smart

INDUSTRY NEWS

ITB bought by o Nvus

High-performance temperature control units

64

Temperature control units for oil up to 150°C • Controller RT61 PID • Outlet temperature max 150°C

PEOPLE Stellenbosch polymer science postgrad

70

shines on international stage

• Heating capacity

64

WORLD NEWS Biodegradable car!

28kW @ 140°C • Pump capacity 60 litres/min, 3.8 bar

80

• Simultaneous readout of temperature set-point and actual value

SPORT Two-layer tyre system

at 400V 6 kW • Cooling capacity

92

88

• Clear arrangement of operating and indicating elements • Solid state relay (SSR) instead of heating contactor • All components exposed to water are made of non-rusting materials, hence long service-life

ON THE COVER

New from Plasticolors is its Value Range of masterbatch, offering a complete range of colours at economical pricing and with excellent dispersion, colour strength, light and heat stability. Read more on page 24

www.plasticolors.co.za

• Achieves estimated 24% reduction in rejects and 20% increase in productivity

JENOWILL SERVICES Contact – Willy Tschopp Tel: 021 551 7241 Fax: 021 551 7243 28C Lilly Park, Railway Rd Montague Gardens, Cape Town jenowill@iafrica.com www.regloplas.com


News Local equipment manufacture – It’s surprising that there is so little machinery manufacture in the South African plastics industry, even though other sectors of the SA economy are extensively involved with this. But one area of the local plastics sector where there is activity is that of packaging automation systems, where a number of manufacturers are proving to be inventive and effective. One of WKHVH3URJHWWRH[KLELWHGLWVDXWRPDWHGLQOLQH¿OOLQJURWDU\FDSSHUV\VWHPDWWKH Propak Cape show in October. Coenie Bantjes of Progetto was there to discuss features of the system, which attracted a number of inquiries – see page 20

THIS ISSUE

We’re going to have to be smart to get out of this hole &KDOOHQJHLVWR¿QGZD\VWRERRVWJURZWKGHYHORSPHQW

S

OME people have decided to write the year off, which is an understandable but unfortunate conclusion to the year.

There’s no doubt, 2017 hasn’t been good and if anything has been even less exciting than 2016. In essence, there’s only one real test for the barometer: whether there is growth in the market, and even a few percent would do. That’s what the industry has been counting on for years, and it’s GHÂżQLWHO\JORRP\ZKHQWKLVIDLOVWR KDSSHQ$SDUWIURPWKHÂżQDQFLDO crisis of 2009, the industry has had almost consistent growth dating back to the 1960s. So how are we going to deal with this? What do winners do in adverse conditions? Successful sports teams and individuals seem almost without exception to have the habit of not focusing on the negatives and setbacks, but rather looking ahead and concentrating on the things they can change. It’s the same with most of the company owners and senior managers in this industry, who are outright winners (yes, I UHIHUWR\RX SHRSOHZKRFRPHXSZLWKVROXWLRQVIRUGLIÂżFXOW SUREOHPVOLNHVHULRXVSHUVRQQHOÂżQDQFLDODQGWHFKQLFDO issues. One needs to be patient yet decisive, but none of that is going to easily overcome the problem now faced: poor economic performance that is retarding development and consumer spending. South Africa needs to achieve a growth rate similar to WKRVHRI&KLQDDQG,QGLD DERYHÂżYHDQGFORVHUWR LIWKH country is going to drag itself out of the hole we presently ÂżQGRXUVHOYHVLQ:HKDYHDPRGHUQHFRQRP\EXWWRRODUJH an informal sector. Ironically, South Africa is a joint BRICS member with these nations, but the trade remains rampantly in their favour. Plastics manufacturing is often regarded as a barometer for the wider economy (cement and cardboard sales are also often cited) and almost all South Africa’s convertors felt

(

sluggish demand throughout the year and even now, going into the last quarter when demand usually peaks, there hasn’t been much momentum. So, what can you do? Firstly be thankful to live on the continent of Africa, a most fabulous place to be – in spite of the massive challenges. But, hey, no-one said it was going to be easy. Then we have to keep on modernizing, make better use of digital remote correspondence and control ‌ and mastery of that will probably lead to job cuts. So what do you do now? One option would be to develop the local community in the close vicinity of your plant or plants, if that is possible. Uplifting people, where there is a massive need in 6RXWKHUQ$IULFDFDQEHGLI¿FXOW but rewarding. Successful individuals become role models on the street and the net and in their communities. It’s a tough one, but it’s virtually incumbent for businesses in the formal sector in South Africa to support people in the informal sector. Many businesses are doing that, and fostering a healthy, winning culture in the organisations. And buy local: people who want South Africa and its neighbours to grow invest in initiatives and the only way these ventures can establish themselves is buy selling their products and services right here. So buy local wherever possible. Exports are obviously also a major potential earner, and that will require for more of us to be outwardlooking, to enable us to be more competitive with the many foreign businesses active here, but on their own doorsteps. So let’s smile and look for opportunities. Best wishes to all of you for a happy and peaceful festive season.

)

4

DEC 2017 / JAN 2018

Buy local wherever possible, help create springboard for exports

Martin Wells Publisher

Martin Wells,

Publisher


75894

Sustaining communities. An attractive characteristic of PE100 piping systems is the creation of leak-free joints through heat fusion, which creates a joint that is as strong as the rest of the pipe. Ensuring on fulfilling the needs of the local potable water pipe market, for generations to come. A Division of KAP Diversified Industrial (Pty) Ltd.


News

Recommendations of plastic products released by Provide a clear path moving forward, guidance for processes THE Working Group assembled by PlasticsSA to help break the impasse between convertors and UHF\FOHUVRQWKHOHYHOVRIÂżOOHU used, particularly in shopping bags but increasingly in other products too, has come up with recommendations to resolve the scenario. The disagreement between the main parties, who themselves were QRWVSHFLÂżFDOO\XQLWHGHLWKHUKDGHYHQ spilt over into the wider industry and threatened to jeopardise the industry’s environmental programmes. The Working Group debated complex and far-reaching issues about the recyclability of plastics products with stake holders and released the outcomes and recommendations of its investigations recently. The task team consists of representatives from Plastics/SA, the Sustainability Retailers Forum, the Plastics Recycling Organisation (SAPRO) and Plastic Converters Association (PCA) who met with one FRPPRQJRDOÂąWRÂżQGVXLWDEOHDQG workable solutions that will assist and EHQHÂżWWKHHQYLURQPHQWWKHFRQVXPHU and will create jobs through increased OHYHOVRISODVWLFUHF\FOLQJWKDWZLOOÂżQG their way into recycled plastic products. The PCA’s involvement in the process was key as its members, the convertors, VWDUWHGWKHSURFHVVRIDGGLQJÂżOOHU VSHFLÂżFDOO\FDOFLXPFDUERQDWH2WKHU ÂżOOHUVKDYHEHHQXVHGWRRDQGDIXUWKHU aspect of the situation was that the DGGLWLRQRIÂżOOHUVKDGVWDUWHGVHYHUDO years ago, possibly even longer than a decade ago. “These recommendations provide a clear path moving forward and guidance for processes that require detailed

(

6

implementation plans that need to be developed. It became clear from the working group activities that similar forums need to be created where various stakeholders can meet and engage on relevant topics,â€? said Anton Hanekom, executive director of Plastics/SA. The Working Group concluded its work on 28 September and FRQÂżUPHGJHQHUDODJUHHPHQWRQWKH recommendations, which deal with the recyclability of plastic products and should not be seen, as sometimes reported on, targeting only plastic bags. “The activities of the working group were unique in the sense that, for the ÂżUVWWLPHYDULRXVUROH players in the broader value chain, sat around a table to discuss packaging problems. These discussions were not always easy as the various roleplayers were affected differently, but they remained committed WRÂżQGLQJZRUNDEOH solutions to the common issues,â€? Hanekom added.

)

‌committed to finding workable solutions to the common issues

DEC 2017 / JAN 2018

Recommendations It is recommended that WKHTXDQWLW\RIÂżOOHUVEH limited in terms of the initial extrusion and moulding materials where the density of the material does not exceed WKH6* VSHFLÂżFJUDYLW\ WDUJHW of <1.This recommendation will JXLGHWKHSURGXFWVSHFLÂżFDWLRQ discussions between retailers and their suppliers/convertors of plastic products. The amount of ÂżOOHULIDQ\ZLOOYDU\GHSHQGLQJ on the product and the type of plastic raw material used in the production process. These discussions have already started between retailers and the converters. The second main recommendation was that the provisions of ISO 14021:2016 Environmental Labels and Declaration â&#x20AC;&#x201C; namely, self-

declared environmental claims (Type II environmental labeling) â&#x20AC;&#x201C; be adopted as an industry voluntary standard to convey the recyclability status of a product. Discussions have initiated a review of the current information on labels and the message print on plastic products to ensure that the correct recyclability status of the product is communicated to the consumer in a clear and simple message. The need also exists to clearly and correctly indicate the SRO\PHULGHQWLÂżFDWLRQFRGHVRQWKH product itself to assist collectors, sorters and recyclers in correctly identifying raw materials â&#x20AC;&#x201C; this will assist in the sorting of products into homogeneous polymer types for recycling. A number of training sessions are scheduled with retailers to provide knowledge and skills in the implementation of the Design for Recyclability Guidelines developed by PackagingSA. These sessions will assist in the design of products with the focus on end of life solution/application and the


Development of new markets for recycled content imperative 7KHGHYHORSPHQWRIQHZPDUNHWVDQGWKHGULYHWRLQFUHDVH WKHGHPDQGIRUUHF\FOHGFRQWHQWZLOODOVRQHHGDWWHQWLRQ It is recommended that recycling processors adopt VWDQGDUGVVLPLODUWR,62IRUWKHLUTXDOLW\RI PDWHULDOVERWKLQFRPLQJDQGRXWSXW ³&XUUHQWO\PRUHWKDQRIRXUZDVWH FROOHFWHGIRUUHF\FOLQJLVSRVWFRQVXPHUZDVWH DQGLVFROOHFWHGRQODQG¿OOV7KHPDWHULDOVDUH YHU\FRQWDPLQDWHGDQGDUHRIWHQQRWFRUUHFWO\ VRUWHG$OORIWKLVKDVDQLPSDFWRQ WKHTXDOLW\RIWKHUHF\FOHGPDWHULDO More needs to be done to improve WKHTXDOLW\RIUHF\FOHGPDWHULDO DQGWRVWLPXODWHWKHGHPDQGIRU UHF\FODWH´+DQHNRPVDLG It is recommended that waste management companies should LQYHVWLQDGYDQFHGSURFHVVLQJSODQWVIRU WKHVHSDUDWLRQRIZDVWHJHRJUDSKLFDOO\ GLVWULEXWHGWR¿WWKHDYDLODEOHZDVWH ³7KLVLVDFRPSOH[ORQJWHUPDFWLYLW\ DQGPLJKWUHTXLUHVXEVWDQWLDOLQYHVWPHQW0RUH ZRUNQHHGVWREHGRQHDQGLWUHTXLUHVEURDGHU consultation and liaison with local government structures. Separation at source is a vital FRPSRQHQWRIWKHYDOXHFKDLQ´+DQHNRPDGGHG The recommendations, which encourage convertors WRUHVWULFWTXDQWLW\RI¿OOHUVDVZHOODVWKH6*RI¿OOHU materials, cover all plastic products, not just HD shopping bags DEC 2017 / JAN 2018 7

<IZQÐ&#x201E;KPIVOMKI][M[N]Z\PMZ\ZW]JTM

7+(XQDGYLVHGWDULIIFKDQJHZKLFKVDZWKHUHLQWURGXFWLRQRI DWDULIIRQ//'3(HDUOLHUWKLV\HDUKDVSUHVHQWHGDYHU\ GLI¿FXOWVLWXDWLRQIRUPDWHULDOLPSRUWHUVDQGFRQYHUWRUV7KH WDULIIRQOLQHDUKDGEHHQSKDVHGRXWDQXPEHURI\HDUVDJR EXWDFFRUGLQJWRDQLQIRUPHGVRXUFHWKHSODFHPHQWRIWKH WDULIIZDVSUREDEO\DPLVWDNHE\6$56&XVWRPVRI¿FLDOV LQFRUUHFWO\SODFHGZKLOHDGMXVWLQJDUDQJHRIWDULIIV0DWHULDO LPSRUWHUVSLFNHGXSWKHSUREOHPEHIRUHFXVWRPVRI¿FLDOV GLGDQGVRPHRIWKHJOREDOVXSSOLHUVUHDFWHGQHUYRXVO\ SRVVLEO\DZDUHWKDWVXFKµWDULIIPLVWDNHV¶KDGKDSSHQHG EHIRUHZKHUHWKH\KDGEHHQIRUFHGWRSD\ 7KHSUREOHPLVQRWWREHWDNHQOLJKWO\DERXW WRQVRIOLQHDUKDYHHQWHUHGWKHFRXQWU\GXULQJDQG WKHWRWDOWDULIIGXHZRXOGEHLQWKHUHJLRQRI5PLOOLRQ 2I¿FLDOVIURP3ODVWLFV6$ZHUHLQWKHSURFHVVRIHQJDJLQJ ZLWK6$56LQODWH1RYHPEHULQDQHIIRUWWRJHWWKHWDULII removed.

JUST BRIEFLY

environmental label and messages. It is recommended that concerned bodies participate in consumer education and recycling activities that are paired with the proposed labeling standards. â&#x20AC;&#x153;Education and creating awareness on the need to UHF\FOHDQGWKHEHQH¿WVWKHUHRIDUHRQJRLQJ,WLVKRZHYHU important to ensure that this education starts at grassroots OHYHOLQVFKRROVDQGLVDOVRDLPHGDWFRQVXPHUVRIDOO ages. Littering is a human behavioral issue and we need WR¿QGZD\VWRHPSRZHUDQGHTXLSSHRSOHWRGRWKHULJKW WKLQJIRUWKHHQYLURQPHQW´VDLG+DQHNRP³5HF\FODEOH SDFNDJLQJDQGWKHUHF\FOLQJRIVLQJOHXVHSDFNDJLQJ DORQHLVQRWJRLQJWRULGRXUEHDXWLIXOODQGRIOLWWHU+XPDQ LQWHUDFWLRQZLWKXVHGSDFNDJLQJQHHGVWREHDGGUHVVHGDW DOOOHYHOV3DFNDJLQJFDQRQO\EHUHF\FOHGLIFDSWXUHGLQ ZDVWHFROOHFWLRQIRUPDORULQIRUPDO´ +DQHNRPDGGHGWKDWFXUUHQWSURJUDPPHVDQGLQLWLDWLYHV need to be expanded and education and awareness creation QHHGWREHVWHSSHGXS7KHVHDFWLYLWLHVZLOOEHOLQNHGXSZLWK proposed Government initiatives such as â&#x20AC;&#x2DC;Billy Bin.

7:2RI6RXWK$IULFD¶VPDMRUSRO\PHUPDQXIDFWXUHUV+RVDI DQG6DVROHQFRXQWHUHGLQYLGLRXVVXSSO\SUREOHPVGXULQJ WKHVHFRQGKDOIRIWKH\HDUVRVHYHUHLQIDFWWKDWVRPH XVHUVRIOLQHDUDQG3(7UDQRXWRIPDWHULDO %RWKLVVXHGDGYLVRULHVWR6RXWKHUQ$IULFDQFXVWRPHUV DERXWVXSSO\FRQVWUDLQWVZLWK6DVROEHLQJDIIHFWHGE\ SUREOHPVWKDWVHHPHGWRVWHPIURPVWDWXWRU\PDLQWHQDQFH VKXWGRZQVWRLWV//'3(33DQG39&SODQWV7KDWZDV LQWXUQFRPSOLFDWHGE\XQVFKHGXOHGGRZQWLPHRQNH\ XSVWUHDPXQLWVZKLFKLPSDFWHGRQIHHGVWRFNDYDLODELOLW\IRU OLQHDUDQG39&:HXQGHUVWDQGWKDWOLQHDURXWSXWJURXQGWR DFRPSOHWHKDOW7KHQWKHUHZHUHIHHGVWRFNDQGWHFKQLFDO FRQVWUDLQWVIRU33 5&3 DQGWKHQDPHFKDQLFDOIDLOXUHOHG WRWKHH[WHQGHGGRZQWLPHRIWKH33SODQW 6DVROVDLGWKDWLWKDG³LVVXHGPDUNHWDGYLVRULHVZLWK GXHQRWLFHZKHUHYHUSRVVLEOH+RZHYHUZHDUHDZDUH WKDWLQVRPHFDVHVWKHQRWLFHSHULRGWRWKHPDUNHWZDV QRWVXI¿FLHQWDQGSODFHGFXVWRPHUVLQWRGLI¿FXOWVXSSO\ VLWXDWLRQVVSHFL¿FDOO\GXULQJWKHSHDNGHPDQGVHDVRQ´ 7KLVSUHVHQWHGDQH[WUHPHO\GLI¿FXOWVLWXDWLRQIRU FRQYHUWRUVEXWLW¶VVRPHWKLQJWKDWKDVKDSSHQHGQHDUO\ HYHU\\HDUDQGUHHPSKDVLVHGWKHLPSRUWDQWUROHSOD\HGE\ SRO\PHULPSRUWHUVZKRDJDLQ¿OOHGWKHJDSVLQPDQ\FDVHV 7KHSUREOHPVDVWKH+RVDISODQWLQ-DFREV'XUEDQPD\ KDYHEHHQHYHQPRUHVHYHUH(QJDJHGLQDPDVVLYHSURMHFW WRLQFUHDVH3(7RXWSXWIURPWRWRQVSD ZRUNDWWKHSODQWZDV¿UVWKDOWHGE\FRPPXQLW\DFWLYLVP ZKLFKOHGWRWKHHPSOR\PHQWRIORFDOFRQWUDFWRUVZKR SURGXFHGVXEVWDQGDUGZRUN´(YHQPRUHSUREOHPVHQVXHG ZKHQ0*RI,WDO\WKHRZQHUVRI+RVDI¶VWHFKQRORJ\ SDUWQHU&KHPWH[GHFODUHGEDQNUXSWF\7KHQWKHUHZDVD IRUFHPDMHXUHGHFODUDWLRQE\WKHKHDWLQJSODQWVXSSOLHUDQG VHYHUHVWRUPVLQ'XUEDQLQ2FWREHUÃ&#x20AC;RRGHGVHFWLRQVRIWKH SODQWEOHZRYHUFULWLFDOVXSSRUWVWUXFWXUHVDQGGDPDJHG SDUWVRIWKHEXLOGLQJDQGHTXLSPHQW +RVDIKDGIDFWRUHGLQWKHSRWHQWLDOGHOD\VDQGLPSRUWHG VRPHWRQVRI3(7WR¿OOWKHH[SHFWHGVKRUWIDOOEXW WKLVZDVLQVXI¿FLHQWWRPHHWGHPDQG +RVDIVDLGLQDVWDWHPHQWWKDWWKHVHLVVXHVKDGEHHQ UHVROYHGDQGSURGXFWLRQDWWKHSODQWZRXOGEHIXOO\ operational again on 1 December.

World News

on recyclability working group

Hosaf, Sasol encounter invidious plant problems, some run out of material


News Brenntag supplies as many as 185,000 customers in 74 countries around the world; Michael Thomson is chief executive of Brenntag South Africa

2IĂ&#x20AC;FLDOIRUPDWLRQ

of Brenntag South Africa Strengthens chemical distribution in region BRENNTAG, a global market leader LQFKHPLFDOGLVWULEXWLRQKDVRIÂżFLDOO\ established Brenntag South Africa. Following the merger of the separate operating entities, including Lionheart, Plastichem, Multilube and Warren Chem Specialities, Brenntag SA ZDVRIÂżFLDOO\ launched on 1 October. The business includes chemical distribution and services in the life science (food, nutrition, pharma and personal care), material science (plastics, rubbers, SRO\PHUVDQGOXEULFDQWV DVZHOODV industrial sales & services sectors. Michael Thomson, president of %UHQQWDJ$IULFDVDLGWKHÂłQHZFRPSDQ\ has a focused commercial set-up, VSHFLÂżFDOO\WDLORUHGWRFXVWRPHULQGXVWU\

(

sectors and leveraging on the expertise and skills of the former individual companies, ensuring that the business LVVWUDWHJLFDOO\DQGRSHUDWLRQDOO\EHWWHU positioned to realize growthâ&#x20AC;?. â&#x20AC;&#x153;Bringing the individual companies together has allowed for the development of a customercentered approach, DLGHGE\GHGLFDWHG product management, strengthened GHSDUWPHQWVIRUVDIHW\TXDOLW\  UHJXODWRU\DIIDLUVDQGPRUHVWUHDPOLQHG DQGHIÂżFLHQWRSHUDWLRQVIXQFWLRQV´ added Thomson. Carl Blomme, regional president for Brenntag Europe West and MEA, said: â&#x20AC;&#x153;The new structure is a perfect commercial organization leveraging our expertise to serve our valued customers DQGVXSSOLHUV,WLVRIPXWXDOEHQHÂżWWR ERWKHPSOR\HHVDQG WKHFRPSDQ\ â&#x20AC;&#x153;Due to our performance excellence culture, our focused organization will create an environment where individuals can

)

New company has a focused commercial set-up

8

develop and where we can assure delivering the best services to our business partners.â&#x20AC;? Brenntag South Africa is one of the leading chemical distributors for VSHFLDOW\FKHPLFDOVLQWKHVRXWKHUQ $IULFDQUHJLRQ7KHQHZFRPSDQ\KDV DERXWHPSOR\HHVDQGORFDWLRQV in Cape Town, Johannesburg and Durban. About Brenntag %UHQQWDJLVKHDGTXDUWHUHGLQ 0Â OKHLPDQGHU5XKU*HUPDQ\DQG operates a global network with more than 550 locations in 74 countries. ,QWKHFRPSDQ\ZKLFKKDVD global workforce of around 15,000 HPSOR\HHVJHQHUDWHGVDOHVRI â&#x201A;Ź10,5-billion ($11,6-bn). Brenntag connects chemical manufacturers and chemical users. With over 10,000 products and a world-class supplier base, Brenntag offers one-stop-shop solutions to around 185,000 customers. 7KLVLQFOXGHVVSHFLÂżFDSSOLFDWLRQ WHFKQRORJ\DQH[WHQVLYHWHFKQLFDO support and value-added services such DVMXVWLQWLPHGHOLYHU\SURGXFWPL[LQJ IRUPXODWLRQUHSDFNDJLQJLQYHQWRU\ management and drum return handling. Long-standing experience and local excellence in the individual countries characterize the global market leader for chemical distribution.

DEC 2017 / JAN 2018


SE Series Servo Energy Saving Injection Moulding Machines Main components of Servo machines purposely spec’d for South Africa • PLC • Servo motor • Servo pump

• Servo drive • Transducer • Hydraulic valves

Techmation (Taiwan) Phase (JV of Italy) Eckerle (Germany)

• High performance closed loop servo control system • Shortens cycle times and increases production

Rexroth (Germany) Vashy (France) Rexroth ( Germany)

• Low power consumption saving 40-60% • Low noise

Auxiliary equipment ex stock: • • • • •

Hopper dryers Robots Hopper magnets Chillers Granulators

• • • • •

Mould clamps Auto loaders Colour dosers Glass tube water flow regulators Mould temperature controllers

Assorted heater bands, thermocouples, proximity switches, limit switches, bypass oil filters etc.

Sound represented in Contact: Gauteng Charles Rust 083 227 2593 011 396 1452 Durban - Peter Wessel 084 803 9260 031 702 3997/8

Southern Africa by: Bob Austen 083 679 1159 011 396 1452

Charles Rust Associates 20 Fifth Avenue, Bredell, Kempton Park P O Box 2380 Kempton Park 1620 Tel: 011 396 1452 Email: info@soundsouthafrica.co.za chasrust@acenet.co.za Website: www.soundsouthafrica.co.za


News

Shaft Technical

wins Gold Plastics convertors take gold in number of categories THE plastics industry did well again at the IPSA Gold Pack Awards, with Shaft Technical Mouldings of Cape Town taking the overall Gold Pack Trophy for 2017 for its new two-piece spice grinder.

10 DEC 2017 / JAN 2018

Plastics convertors took gold in a number of the categories, with RPC-Astrapak (Consupaq, Durban) getting gold in Health, Beauty & Household for its decorated tube which included a clear window and foiling; Dairypack (part of Polyoak, nationally) for its â&#x20AC;&#x2DC;Greenâ&#x20AC;&#x2122; milk containers for Woolworths in the Sustainability category, containers that include about 30% renewable polymer; Tropic Plastics of Durban for its printed VKULQNÂżOPIRUWKHSDFNDJLQJRIWKH&DVWOH Light â&#x20AC;&#x2DC;18-packâ&#x20AC;&#x2122;; and Goldpack (also Durban) for its â&#x20AC;&#x2DC;Kwik Lokâ&#x20AC;&#x2122; closure with label (an added-value feature for bread bag type tags). For Shaft it was a fantastic night as it also took the golds in the food and substrates (rigid plastics) categories. The substrates

category was the only area where rival materials did not compete, and Tropic came up trumps here too by picking up a second JROGLQĂ&#x20AC;H[LEOHSDFNDJLQJFDWHJRU\ Shaftâ&#x20AC;&#x2122;s Howard Stasin had never attended the Gold Pack Awards events, which have been running for over two decades, and may have wondered why he had been invited. Stasin has for long had a reputation for coming up with novel solutions and the Gold Pack judges must have recognised that. Up till now, plastic spice grinders have LQYROYHGDIRXUSLHFHGHVLJQZLWKWKHÂż[HG teeth, moving teeth, a bottle, and the fourth part being the dust cap. The pre-assembled FRPSRQHQWVRIWKHÂż[HGWHHWKWKHPRYLQJ teeth and the dust cap, would be supplied to WKHVSLFHSDFNHUZKRZRXOGPDNHWKHÂżQDO DVVHPEO\ZLWKWKHERWWOHDIWHUÂżOOLQJ7KH grinder components have been moulded in acetal or acrylic, material which are known to be have good hardness and impact resistance. 6WDVLQORRNHGDWWKHH[LVWLQJ designs, and realised that

WKHÂż[HGWHHWKFRXOGEHPRXOGHGGLUHFWO\LQWR the bottle mouth during the injection phase of the blow moulding process. So he came up with a design where the teeth are part of the bottle, with the teeth being formed during the injection moulding of the preform. This completely eliminated the need to mould DQGDVVHPEOHWKHÂż[HGWHHWKDVDVHSDUDWH component. The physical properties of PET being fairly similar to POM and PMMA, so there was no reason why the grinder parts could not be produced from it. Although Shaft wanted to work with an local mould maker, the tool was eventually manufactured in China. The injection blow mould for the container was manufactured in Japan by Nissei ASB, the machine supplier at Mpact Plastics. Stasin had to drive the project from the outset and, as Shaft is not involved in blow moulding or injection-blow moulding (necessary here in order to produce the teeth), sought participants. A number

Overall Gold Pack Trophy for 2017

IPSA Gold Pack Trophy The new two-piece spice grinder from Shaft Technical Mouldings and Mpact Plastics Atlantis won the Gold Pack Trophy for 2017. The new design places the grinder teeth within the closure with slots in the container neck acting as a sieve for the ground spice. Shaft also won gold in the Food and Substrates categories

Packaging Legend A poll was conducted among IPSA members to identify a pack that has had a marked effect on the local packaging industry and/ or has become an iconic South African pack. From nominations received, the judges narrowed down the list to 12 pack and IPSA members were invited to vote for South Africaâ&#x20AC;&#x2122;s â&#x20AC;&#x2DC;packaging legendâ&#x20AC;&#x2122;. 7ZRSDFNVÂżQLVKHGZD\DKHDGRIWKHUHVWWKHEDJLQDER[SDFN which was second, and the winner was the two-litre PET CSD bottle. The bottle was introduced in the late 1970s, with a distinctive black bottom boot and a metal closure. The PET bottle became popular IRUPDQ\UHDVRQVLWÂśVYLUWXDOO\XQEUHDNDEOHUHVHDODEOHOLJKWZHLJKW and recyclable. The PET solution has evolved further since, with progressive technology leaps, becoming increasingly light and HQYLURQPHQWDOO\VXVWDLQDEOHE\LPSURYLQJPDQXIDFWXULQJHIÂżFLHQF\ increasing recyclability and advancing the use of recycled material

Sustainability Plastics entries did well in this category, which includes domestic goods, hardware, appliances and automotive products.

GOLD award Polyoak got gold for its Green dairy containers for :RROZRUWKVDÂżUVWIRUWKH6$GDLU\PDUNHW7KH and 3-litre bottles contain 30% plant-based polymer derived from Brazilian sugar cane. The recyclable containers with low carbon footprint reduce dependence on less-sustainable non-renewable fossil-based polymers while supporting a developing industry for renewable plant-based feedstocks


Mouldings

Pack Trophy of convertors declined the offer, but Mpact Plastics accepted the challenge and received the accolade as a joint winner of the Gold Pack trophy. The Western Cape has for some years now been a leader in spice grinder production, but for Stasin this is no surprise, adding that â&#x20AC;&#x153;weâ&#x20AC;&#x2122;ve been on the spice route since the 1500s, when WKHÂżUVWH[SORUHUVVDLOHGDURXQGWKH&DSH and traded with India and the Far East and transported all sorts of spices back to Europeâ&#x20AC;?. Shaft shared the award with Mpact Plastics Atlantis, which injection-blow moulded the container.

Consupaqâ&#x20AC;&#x2122;s Annique Rooibos containers was a further joint bronze winner in the HBH category, with its distinctive 6-colour Ă&#x20AC;H[RSULQW

Health, Beauty & Household BRONZE awards New Era Packaging got joint bronze in the category for its Chemico Cleaning containers for Amka Products. The new design was seen as more consumerfriendly and easier to use

Consupaq also got a joint bronze in this category for its new range of baby jelly jars for Johnson & Johnson

Packaging Related This category includes components, materials, machinery, processes, supplies and point-of-sale displays that enhance the packaging products.

GOLD award Goldpack of Durban won the award for its new Kwik Lok solution. Originally the â&#x20AC;&#x2DC;bread bag tagsâ&#x20AC;&#x2122; were used only to close a bag, but now â&#x20AC;&#x201C; with the added on labels â&#x20AC;&#x201C; are used for advertising and to communicate with consumers

Sponsors The sponsors of the awards programme were 6SHFLDOLVHG([KLELWLRQV6DSSL1DPSDN53& Astrapak, Polyoak Packaging, Packaging & Print Media, Paper Manufacturers Association and PackagingSA.

SILVER award rPET solution â&#x20AC;&#x201C; RPC Astrapak Plastech took the silver here for its complete range of rPET containers for (OYLQRI(DVW/RQGRQFRQVLGHUHGWREHWKHÂżUVWWREH produced in commercial quantities for the local market. The judges said this represented a sustainable, costeffective replacement for virgin polymer

BRONZE award rHDPE solution â&#x20AC;&#x201C; The popular organics range from Unilever is now presented in one-litre packs containing 50% rHDPE, a move which substitutes about 90 tons of virgin polymer p/a

Substrate Excellence: Transit GOLD award Each of the various packaging materials competed with their own in the substrates category (including secondary packaging), where Shaftâ&#x20AC;&#x2122;s spice grinder took the gold for rigid plastics. In FUHDWLQJ6RXWK$IULFDÂśVÂżUVW NRB carry pack, Tropic Plastics of Durban used a 75 micron ÂżOPIRUPXODWLRQDQGUHÂżQHG that through the incorporation of special additives to achieve the required shrink and strength SURSHUWLHVWRVXSSRUWERWWOHV or cans. Tropic also got a joint bronze in the Transit (including secondary packaging) category

DEC 2017 / JAN 2018 11

Good record The industry has had a good record in the Gold Pack programme of late, with Bowler Plastics taking the overall title in 2015 for its digitally printed tubes, and in 2013 the trophy was shared between tool manufacturer Spec Tool & Die and JJ Precision, the RPC-Astrapak group injection company for their closure for Robertsonâ&#x20AC;&#x2122;s Spiceâ&#x20AC;&#x2122;s new spice container cap for Unilever South Africa. Ironically, plastic entries came up short in the Beverage category this year, picking up no awards in a category where it has mostly done very well. â&#x20AC;˘ The gold, silver and bronze medals awarded are aligned to the product categories used in the international packaging awards. â&#x20AC;˘ From 2018, the Gold Pack Awards programme is to be presented annually. Up till now it has been held on alternate years.

GOLD award RPC-Astrapak Consupaq won gold with its â&#x20AC;&#x2DC;Sorbet Man 3-in-1â&#x20AC;&#x2122; shower gel in the Health, Beauty & Household category. The tube combines foiling and screen printing and also features a clear window


PROPAK CAPE

Buzz at Suggests interest in packaging sector is gaining momentum THERE was a buzz around the halls at the recent Propak Cape show with some lively interaction between exhibitors and delegates, suggesting that the regional packaging sector was regaining momentum and even lifting optimism. But strangely, the buzz seemed to last from 10am till 2:30pm, whereafter the atmosphere would cool and one can only VXVSHFWWKDW&DSH7RZQ¶VDZIXOWUDI¿F congestion, not to mention the looming threat of a water crisis, gave at least some of the visitors the jitters. It was almost as if visitors were enthusiastic, but were proceeding cautiously and hedging their bets. Held at the impressive Cape Town International Convention Centre from 24-26 October, Propak Cape 2017 actually drew slightly fewer visitors and exhibitors – 5869 and 238 respectively – than the last edition of the show in 2014, when there were over 6000 visitors and 240-plus exhibitors. But we have it on good authority that the ‘quality’ of delegates was good this year, with 98% of visitors either ‘having

purchasing decision power or able to VWURQJO\LQÀXHQFHWKHGHFLVLRQPDNLQJ process’, certainly the type of thing that exhibitors like. Propak Cape supports business in the region by providing a platform for manufacturers and suppliers to showcase the latest products, equipment, machinery and services across the packaging, food processing, plastics, printing and labelling industries. It also provides a networking opportunity for all industry stakeholders. People want to know about latest innovations, trends and technologies, what the future holds for packaging and related industries, and about growth potential in the various sectors. “This year’s Propak Cape attracted just under 6000 visitors, all keen to learn about the latest innovations and technologies. They had the opportunity to talk with technical experts and to engage with 188

Nathan Fortuin of Zakwantu Printing & Packaging with the Mamata WIN 305-CP servo-driven pouch maker it purchased, and Paul Clark of Adex, the Mamata agent. This is a high-speed centre seal pouch machine, capable of running at 250 cpm using just 1,35kwh. The machine was acquired prior to the show with Zakwantu moving it over to its Cape Town plant afterward

12 DEC 2017 / JAN 2018

The impressive Cape Town Int’l Convention Centre hosted Propak Cape 2017, with close to 6000 visitors attending the three-day event

Brendan Burns, one of SA’s most experienced bag-making machine suppliers, was visited on his stand by Claude Miles of Ecopak and Charles Benn of Leader Packaging, both of East London. The Burns stand featured bag-making systems from Gur-is Makina of Turkey, which Brendan has EHHQVXSSO\LQJVLQFH±WKHPDFKLQHVKDYHSURYHGHI¿FLHQWDQG popular, says Brendan


Propak Cape local manufacturers and suppliers and 50 international exhibitors,” said Sven Smit, event director at Propak Cape. “Ten different countries were exhibiting, so we do get quite an international LQÀXHQFHDWWKHVKRZZKLFKLVEHQH¿FLDO to all participants. Products and services related to the newly launched Wine & Olive Production Expo were also an additional attraction this year.” South Africa’s leading Associations support these sustainability initiatives and the Institute of Packaging South Africa, Plastics SA, Printing SA, Packaging SA and the South African National Bottled Water Association exhibited at Propak Cape. Douw Steyn, sustainability director at Plastics/SA, was one of the speakers at the free-to-attend seminars that took place at Propak Cape. His talk provided an overview of what the local plastics industry is doing to design better packaging, increase recycling rates, and introduce new models for making better use for a circular plastics economy. “Plastic is here to stay,” said Steyn. “It’s all around us in our everyday lives. But a lot of work is being done especially in packaging around what materials we

Fully functional tool – Additive manufacturing (previously referred to as 3D printing) is producing some surprising results: instead of spark eroding metal to shape a tool, the team at Central University of Technology in Bloemfontein used the system as a ‘recoater’ to build up 30-micron layers to create a tool which can be used for injection moulding. The system can even generate the cooling channels

DEC 2017 / JAN 2018 13

Pierre Jurgens of Cabletech hosted Qian Shan’guo of Haitian of China on his company’s stand. Now in just its second year as Haitian agent, Cabletech has seen the Haitian machines gain renewed popularity, at least partly due to the improved service level QRZRIIHUHGE\&DEOHWHFKDQGLWV¿HOG service engineers. The company also sold the machine during the show

should use, how it’s produced, what is its usability and what impact it has on the environment. Recycling and sustainability are key to the industry going forward. I’ve been involved with Propak for many years and it provides a great industry networking opportunity where we can think creatively with other companies and speak with likeminded individuals. The standard of this year’s show can be described as ‘Wow’ – it’s beautiful!” Visitors enjoyed viewing the many interactive displays, live demonstrations and technical presentations that took place during the show. “Propak Cape has a built a reputation as a proven brand that delivers results. We are delighted that our exhibitors have enjoyed such a positive experience at this year’s Propak Cape. We look forward to seeing them back in Cape Town in 2020 and many of them will also be exhibiting at Propak Africa, taking place in Johannesburg in March 2019,” added Smit. The Propak Cape exhibition is organised by Specialised Exhibitions Montgomery, a member of the prestigious Montgomery Group, and a member of the Association of African Exhibition Organisers (AAXO).


Dr Stephen van der Spuy of SANCCOB, Douw Steyn (Plastics|SA), Mariette Hopley (SANCCOB) and Charles Muller (PackagingSA) during the cheque hand-over at the recent Propak Cape Exhibition. Behind them is the pledge wall where companies and individuals who donated money to the seabird hospital, could sign their names. The funds were raised for the planned construction of a new centre where rescued seabirds can be treated and, ultimately, returned to the wild

Pledges for Penguins R45 000 for new seabird hospital THE South African plastics and packaging industries managed to raise an impressive R45 000 during Propak Cape by inviting companies and individuals to pledge funds for a much needed seabird hospital at SANCCOBâ&#x20AC;&#x2122;s Cape Town centre. SANCCOB is the Foundation for the Conservation of Coastal Birds (SANCCOB). According to Douw Steyn, sustainability director at Plastics|SA, leaders in the packaging industry and individuals did not hesitate to dig deep into their pockets for the #Ipledgesustainability campaign when they visited the PackagingSA/

Sustainability pavilion where the fundraising took place. â&#x20AC;&#x153;Our sincere thanks to Nampak, Pailpac, Polyoak Packaging, Extrupet, Tetrapak, Polyco, BenĂŠ Water, SANBWA, PETCO and Gundle Plastics for pledging towards the SANCCOB Saves Seabirds Project. We are very proud of the funds that we managed to raise in only three days,â&#x20AC;? said Steyn said. %\SXUFKDVLQJD5UDIĂ&#x20AC;HWLFNHWRQWKH stand, individuals could win one of two picnic tables made from recycled plastic, FRXUWHV\RI7XIĂ&#x20AC;H[3ODVWLF3URGXFWV Francois Louw, fundraising and

www.plasticsinfo.co.za

Kiwi connection â&#x20AC;&#x201C; Jacques Kleynhans of Demaplastech showed off some of the hot runner and other mould components and systems from New Zealandâ&#x20AC;&#x2122;s Mastip, which Demaplastech now represents. The new agency has rounded off the Johannesburg equipment supplierâ&#x20AC;&#x2122;s platform, which runs from injection moulding to ancillaries to 3D printing

14 DEC 2017 / JAN 2018

marketing manager for SANCCOB, FRQÂżUPHGWKDWWKHIXQGVUDLVHGZLOOKHOS them take a big step towards reaching their target of R5-million needed for the new facility. â&#x20AC;&#x153;Our seabird centre in Table View has been in operation for 33 years and has served the needs of more than 95 000 seabirds. However, the elderly buildings and facilities are now in desperate need of renovation. We are deeply grateful for the generosity of the plastics and packaging industries this past week which will help us build a new and better seabird hospitalâ&#x20AC;?.

www.sanccob.co.za

Pelchem was represented by Inbanathan Govender and Tania Halebank. Pelchemâ&#x20AC;&#x2122;s new look seems to have had a motivational effect on the company, which is now exploring new applications IRULWVĂ&#x20AC;XRULQDWLRQSURFHVV and related technologies. 7KHĂ&#x20AC;XRULQDWLRQDSSOLHG in the Pelchem process greatly improves the barrier properties of plastic mouldings

Opack â&#x20AC;&#x201C; Dispak, the sheet extrusion and thermoforming company, is now presenting its own â&#x20AC;&#x2DC;Opackâ&#x20AC;&#x2122; range of proprietary packaging lines from its subsidiary of the same name. The Opack range includes thermoformers, loading OLQHVWUD\VHDOHUVIRUPÂżOO seal and even FFS systems with IML. Ashir Patel, one of the two Patel brothers at Chamdor-based Dispak, was happy to premier the Opack QT-1003 FFS system at the Cape event. The QT-1003 line LVVXLWDEOHIRUWKHÂżOOLQJDQG sealing of small containers


PROPAK CAPE

â&#x20AC;&#x2DC;Intelligentâ&#x20AC;&#x2122; bag makers from Mamata PRWRUWHFKQRORJ\7KHVHUYR MAMATA Machinery has just completed 25 motors are used for controlling years in the industry and has more indexing (position control);line than 3000 machines VSHHG YHORFLW\FRQWURO DQG working in more pressure (torque control). than 75 countries â&#x20AC;&#x153;Their ability to use around the world. VHUYRWHFKQRORJ\IRUDOO It is considered as the different application RQHRIWKHWRS¿YH has resulted in some manufacturers GUDPDWLFDGYDQWDJHV of bag and RIWKHLUV\VWHPV´VDLG pouch making 3DXO&ODUNRI$GH[WKH machinery in the Mamata agent for Africa. world. ³)RUH[DPSOH0DPDWD¶V Cost 8QLYHUVDOEDJPDNHUVDUH FRPSHWLWLYHQHVV known for the fastest while addressing quick-change systems without 7KHµ)ODW%RWWRP3RXFKPDNHU¶ is a new offering from Mamata. compromising ,QFRPLQJ\HDUVÃ&#x20AC;DWERWWRP on quality and SRXFKHVFRXOGEHDUHSODFHPHQW YHUVDWLOLW\KDV for stand-up (Doy pack) pouches. EHHQDFKLHYHGDW 7KHSRXFKPDNHUFDQDOVRSURGXFH OHDVWSDUWO\WKURXJK VHYHUDOYDULHWLHVRIWKUHHVLGHVHDO SUHVVWRFORVH]LSSHUDQGVWDQGXSSRXFKHVIURPVLQJOHRUPXOWLSOHZHEV LWVH[SHUWLVHLQVHUYR

FCB CAPE TOWN 10014153CT/E

www.adex.co.za

The Mamata pouch making system has been designed ZLWKRSWLPXPSURFHVVLQJÃ&#x20AC;H[LELOLW\DQGPRGXODULW\

FKDQJHRYHURIMREVIURPVLGHVHDOWR bottom-seal to mix weld/skirt side-seal MREV7KH8QLYHUVDOPDFKLQHVDUHNQRZQ IRUWKHLUFDSDELOLW\WRPDNHYDULHWLHVRIEDJV RQDVLQJOHSODWIRUP´ 0DPDWD¶VYHUVDWLOHSRXFKPDNHU¶V modular design allows freedom to adapt GLIIHULQJFRQYHUVLRQQHHGVDQGSURFHVV ODPLQDWHGRUFRH[WUXGHG¿OPVZLWK HTXDOHDVH7KHPDFKLQHDSSOLHVVHUYR WHFKQRORJ\WRDFKLHYHDQGHQKDQFH SURFHVVLQJDGYDQWDJHVHVSHFLDOO\LQWKH areas of tension control and real seal time FRQWURODGGHG3DXO DEC 2017 / JAN 2018 15

PROFESSIONAL PROFICIENT PROACTIVE PROGRESSIVE PROCESS OILS

Engen is a member of the PETRONAS Group

At Engen, we have reaffirmed our commitment to the Process Oils market. We supply high quality virgin Group I and II base oils and Naphthenic grades under the Parprol brand. These are available in a variety of packs, including true bulk and mini bulk. Our dynamic, new management team is ready to take your business into the future with a strong focus on supply assurance, and a reliable network that takes advantage of our distribution centres in all major cities and a number of outlying areas. We supply a wide range of industries, including: Adhesives, Pesticides, Cable Compounds, Ink Oils, Plasticisers, Rope Dressing, Rubber, Textiles, Coatings, Paints, Sealants, Detergents and Wood Oils. To find out more on how we can take your business forward, contact us at Engen.ProcessOils@engenoil.com


PROPAK CAPE

Dairypack Cartons launches New and exciting carton shapes POLYOAK Packaging has launched a new division, Dairypack Cartons, specialising in the marketing and distribution of aseptic packaging systems in Southern Africa, in exclusive partnership with IPI. IPI is a full system supplier that has EHHQSURYLGLQJIXOO\LQWHJUDWHGÂżOOLQJPD chines, multilayer packaging and closure solutions for the aseptic packaging of liquid products in multilayer structure for over 35 years. The company forms part of Coesia, a group of innovation-based companies operating globally and headquartered in Bologna, Italy. Dairypack Cartons has partnered with IPI to offer the market new and exciting carton shapes, to push the boundaries of the standard â&#x20AC;&#x153;carton brickâ&#x20AC;?. â&#x20AC;&#x153;Polyoak has a long-established presence in the liquid food packaging market and, along with our core focus on customer service, and on producing high volume, high quality plastic packaging, we DUHFRQÂżGHQWWKDWWKLVSDUWQHUVKLSZLOOGULYH innovation in the local carton market,â&#x20AC;? says Garron Boshoff, Executive for Dairypack Cartons. Dairypack Cartons now offers a broad range of aseptic pack sizes (from 100ml to 1000ml) in different shapes, constituting 28 exciting options for customers to select from. African Closuresâ&#x20AC;&#x2122; â&#x20AC;&#x153;King Twistâ&#x20AC;? cap â&#x20AC;&#x201C; the biggest closure on the market currently â&#x20AC;&#x201C; is also used on the vegetable juice cartons. The full system service includes fully LQWHJUDWHGÂżOOLQJPDFKLQHVPXOWLOD\HU packaging and matching closures, as well as the necessary downstream equipment

for secondary packaging, to produce a ÂżQLVKHGSURGXFWDWWKHKLJKHVWTXDOLW\ This is augmented by Polyoakâ&#x20AC;&#x2122;s technical support on the ground and its extensive distribution networks which are already well-established in the liquid food, juice and dairy markets. A case in point is Greenway Farms, South Africaâ&#x20AC;&#x2122;s leading carrot farm, delivering more than 200 tons of Rugani brand carrots a day. The business started in 1992 as a small farmer growing different types of vegetables for the South African National Fresh Produce Market. In 2000, owners Vito Rugani and Vincent Sequeira decided to specialise in carrot farming and switch their vision to a large-scale production. Today 40% of carrots consumed in South Africa are Rugani. Quality and health are Ruganiâ&#x20AC;&#x2122;s pillars: juice contains 100% carrot juice and no preservatives. To enhance its top-level product, Greenway Farms chose the appealing new SuperSlim aseptic carton from Dairypack Cartons. SuperSlim is a slender carton, impossible to miss on shelf due to its tall, streamlined shape. In addition, its patented King Twist cap on the 750ml â&#x20AC;&#x201C; the largest opening ever on the aseptic carton market â&#x20AC;&#x201C; makes it more convenient and easy to pour.

Dairypack Cartons offers a broad range of aseptic pack sizes (from 100ml to 1000ml) in different shapes.

â&#x20AC;˘ For more information contact Johan De Wet from Dairypack Cartons on johan.dewet@polyoak.co.za or call him on +27 (0)21 710 9200.

www.polyoakpackaging.co.za

After an absence of several years, Fanuc SA made a welcome return to Propak, showing one of its injection machines together with robots as well as a Robodrill CNC and Robocut Wire EDM machine. Formula Onelike, the yellow-and-black clad Fanuc team made sure the production â&#x20AC;&#x2DC;cellâ&#x20AC;&#x2122; was integrating smoothly. Among the personnel was Marc Mahl, here with the Roboshot 130ton injection moulding machine. Fanuc SA in Johannesburg is the local business of Japanbased Fanuc 16 DEC 2017 / JAN 2018

Quality and health are Ruganiâ&#x20AC;&#x2122;s pillars and the juice contains 100% juice and no preservatives. To enhance its top-level product, Greenway Farms chose the appealing new SuperSlim aseptic carton from Dairypack Cartons, with â&#x20AC;&#x153;King Twistâ&#x20AC;? closures

The Fanuc display included an intelligent robot display: working together with a pick-and-place robot, the robot operated at extremely high speed and was able to pick up components from a moving conveyor belt even when deposited randomly


You see a tough, durable liner effectively protecting against moisture

He sees a long-lasting foundation that meets the strictest specifications

• Dart impact resistance • Barrier performance • Flexibility and sealability • Opportunities for tailored liner formulations

Discover how Exceed XP can bring your construction liners to new levels of performance exxonmobilchemical.com

Exceed™ XP when eXtreme Performance matters

E0917-088E49

Liners using Exceed XP offer a new performance benchmark for construction applications, compared to existing linear polyethylene resins. Depending on the grade, Exceed XP offers exceptional or extreme:

©2017 Exxon Mobil Corporation. All rights reserved. ExxonMobil, the ExxonMobil logo, the interlocking “X” device and all product names herein are trademarks of Exxon Mobil Corporation.

The tear, puncture and barrier properties of Exceed XP performance polymers produces construction liners with eXtreme Performance. Builders and engineers can protect and preserve buildings and structures while improving energy efficiency and safety.


PROPAK CAPE

ITAC should protect local manufacturers, says Nampak’s De Ruyter Big need to attract investment by brand groups André de Ruyter (centre), CEO of Nampak group, gave a presentation at the Packaging Indaba conference which took place on the last day of the show. Among the delegates were Johan Visser, GM of Nampak R+D in Cape Town, and Nick Starke, former head of the Cape Town research company, now retired but who remains keenly interested

18 DEC 2017 / JAN 2018

ANDRÉ de Ruyter, CEO of Nampak group, gave a presentation at the Packaging Indaba conference during which he looked at ‘Sustainable Manufacturing and the Effect Imports are having on the SA Economy’ – a topic of very real interest to all in the manufacturing sector, obviously. De Ruyter cited as an example the closure by Colgate of its toothpaste plant in Boksburg in 2015. The plant itself employed some 80 people, and the loss of those jobs was bad enough, but the knock-on effect was substantially greater, with Golden Era group losing the cartons contract and Nampak Tubes losing the tubes business. Other suppliers suffered as a result too. While it is inevitable that global brand companies will choose to centralise manufacturing of certain goods and SDFNDJLQJDWVSHFL¿FFHQWUHVDQG exit locations which they see as less competitive, the problem is that South Africa is at present not seeing a lot of return investment by brand groups. The trend over the past few years has if anything been increased entry to the local market of global packaging manufacturers,

which has increased competition in the FRQYHUWLQJVHFWRUVZLWKRXWVLJQL¿FDQW consumer market growth. De Ruyter covered several topics related to sustainable manufacturing including the fact that he believes the proposed Waste Tax will negatively affect existing recycling programmes. “What about imported packaging? Will there be a tax on that,” asked De Ruyter, who has similar reservations about the proposed carbon and sugar taxes. “One cannot but wander if the real goal here is revenue generation,” he said, pointing out that manufacturing as a share of GDP in South Africa has receded massively, from an estimated 24% in the 1980s to about 13% - and possibly even lower – now. “This has led to the loss of an enormous number of jobs,” said De Ruyter, who suggested a number of options to start the process of turning this around. “We need to change the brief of ITAC (International Trade Administration Commission) around, from being an independent adjudicator to one of rather protecting local manufacturing,” he

Unexpected ‘marriage’ – The Maritime Marketing and Your Technical Solutions (YTS) team shared a stand, somewhat unexpectedly. In a move not frequently practised in the industry in South Africa before, these machinery suppliers now both represent Chen Hsong group of the Far East, YTS for the coastal region and Maritime for the interior, VSHFL¿FDOO\*DXWHQJ*UHJDQG0DUF*HUDVLPRRI0DULWLPH and Annette and Mark Varrie of YTS, with visitor Kyle Varrie, were on the stand. Chen Hsong (with plants in China, Hong Kong and Taiwan) is the manufacturer of the Jetmaster and Supermaster injection machines

proposed, in a sentiment that is quite widely held among SA manufacturers, who see the tendency of landing low-cost goods, particularly from the Far East, as undermining local producers with a more damaging long-term effect than any advantage that could be gained by consumers. “And we need to support Proudly South Africa and work with retailers and brand owners and have a biase for SA products,” he added, although conceding that there has been a lack of local demand. This could, however, be a compound result of the factors mentioned above. De Ruyter was encouraged by the fact that ‘manufacturing’ was mentioned about 15 times in the Minister of Finance’s mid-term budget the day before and sees this as encouraging. The Nampak CEO believes interactions with the Finance Ministry have been positive. However, a number of other plastic packaging sector OHDGHUVRXWRQWKHÀRRUDWWKH&7,&& that day agreed that the discussions with government personnel were always positive, but added that “nothing happens”.

Hussain Chiektey (right) of Coalition Plastics of Cape Town visited the Vishva Exim stand, where he was hosted by Uday Shah of the Indian machine supplier and Iain Mackintosh, Vishva’s local agent. Coalition has purchased a number of Vishva’s EORZQ¿OPOLQHV The mood was upbeat, as usual, on the MCG stand, where Patrick Munyambate, Ian Victor and Jaco Geldenhuys interacted with clients and guests.


PROPAK CAPE

Progettoâ&#x20AC;&#x2122;s Ă&#x20AC;OOHUFDSSHU SURYHVSRSXODU

20 DEC 2017 / JAN 2018

Getting it all together, JIT for show INDUSTRY trade shows provide platforms for machinery manufacturers to introduce new developments, a phenomenon that is common around the world, but this FDQDOVRFUHDWHGLIÂżFXOWFKDOOHQJHVIRU the machine developers. With the cost of development and extended lead-up times, WKHGHYHORSPHQWRIHIÂżFLHQWV\VWHPVFDQEH GDXQWLQJ One of the South African companies that KDVSURYHGYHU\FDSDEOHRIGHYHORSLQJ equipment, and in this case automation V\VWHPVVSHFLÂżFDOO\LV3URJHWWR International of Cape Town. The Killarney Gardens-based company specializes in the production of automation equipment for the PDWHULDOVKDQGOLQJSDFNDJLQJDQGSURFHVV industries, whether it be small units or FRPSOHWHWXUQNH\VROXWLRQV A case in point was its introduction of LWVQHZÂżOOHUFDSSHUOLQHDW3URSDN&DSH Âľ7KH3URJHWWRWHDPKDGIRXQGWKDW the development time for the system was extensive and the team was, prior to the VKRZVOLJKWO\ZRUULHGZKHWKHUWKHOLQHZRXOG EHZHOOUHFHLYHG6RLWZDVZLWKJUHDWUHOLHI that it attracted a number of inquiries from EHYHUDJHPDQXIDFWXUHUVGXULQJWKHVKRZ MXVWLI\LQJWKHHIIRUWDQGFUHDWLQJRSWLPLVP IRURQJRLQJGHYHORSPHQWZLWKWKHV\VWHPÂśV WHFKQRORJ\ A-to-Z for automation 7KHWHDPDW3URJHWWROHGE\5RFN\6WRQH PDQDJHVWKHSURFHVVIURP$WR=IURPWKH basic concept of the automation requirement WKURXJKWKHUHVHDUFKGHYHORSPHQWDQG DVVLPLODWLRQRIDOOIDFWRUVLQYROYHGOHDGLQJ up to construction and assembly of all the

necessary components. This often involves H[WHQVLYHWHFKQLFDOGUDZLQJGUDIWVDQGFORVH FRQVXOWDWLRQDPRQJWKHWHDPPHPEHUV often over many cups of coffee, as every component in the assembled systems needs to function perfectly. Âł:HFRPPLWRXUVHOYHVWRIXOÂżOOFOLHQWVÂś UHTXLUHPHQWVIURPFRQFHSWXDOGHVLJQWR implementation, delivery and after sales VHUYLFH´VDLG5RFN\ZKRJDLQHGYDOXDEOH H[SHULHQFHLQWKHEORZPRXOGLQJVHFWRUSULRU WRVWDUWLQJ3URJHWWRLQ3URJHWWRKDV VLQFHH[SDQGHGLQWRRWKHUÂżHOGVQRWDEO\ WKHSKDUPDFHXWLFDODQGJODVVDQGPHWDO SDFNDJLQJVHFWRUVEXWSODVWLFFRQWDLQHUV and component production remains a core PDUNHWIRUWKHFRPSDQ\ Âł3URJHWWRÂśVDLPLVWRSURYLGHWKHEHVW solutions and equipment at a competitive SULFH:HGHOLYHUWKLVE\PDLQWDLQLQJ DJRRGEDODQFHEHWZHHQWLPHFRVW scope and quality,â&#x20AC;? added Stone, who EHOLHYHV3URJHWWRÂśVDELOLW\WRQHWZRUNZLWK KLJKO\SURIHVVLRQDOVXSSOLHUVKDVEHHQ fundamental in the process. 3URJHWWR,QWHUQDWLRQDOKDVSURMHFW PDQDJHPHQWGHVLJQDQGPDQXIDFWXULQJ FDSDELOLWLHVWRFDWHUIRULWVFXVWRPHUVÂś VSHFLÂżFQHHGVDQGUHTXLUHPHQWV â&#x20AC;&#x153;We have many years of experience ZRUNLQJLQWKHSODVWLFIRRGFKHPLFDODQG DJULFXOWXUDOVHFWRUV´KHDGGHG 7KHFRPSDQ\ZDVHVWDEOLVKHGLQLQ the Western Cape and has expanded with VHUYLFHHQJLQHHUVDQGDJHQWFRPSDQLHVLQ *DXWHQJDQG.=1 â&#x20AC;&#x153;We have successfully supplied equipment and implemented projects WKURXJKRXW6RXWK$IULFDDQGSURXGO\

Laminated cartons, which PDQ\FRQVLGHUWREHULYDOV for plastic containers, had a prominent role on the 3RO\RDNVWDQGZKHUH-HUHP\ 0DFNLQWRVKZDVKDSS\WR GLVFXVV'DLU\SDFN&DUWRQVÂś DFWLYLWLHV3RO\RDNJRW LQYROYHGLQWKHVXSSO\RI these containers as part of its ÂľIXOOVHUYLFHÂśVXSSO\WRLWVGDLU\ customers. The cartons are manufactured in a partnership ZLWK,3,SDUWRIWKH&RHVLD JURXSRI,WDO\

Roelof Walters of =LYD&KHPKRVWHG the visit of Suraj Makhija of KBM of India. KBM is a manufacturer of H[WUXVLRQV\VWHPV DQGKDVUHFHQWO\ LQVWDOOHGDV\VWHP in Southern Africa

Progetto premiered its latest development, an DXWRPDWHGLQOLQHÂżOOLQJURWDU\FDSSHUV\VWHP 7KHPXOWLKHDGSLVWRQÂżOOHU WRS ÂżOOVFRQWDLQHUV IURPPOXSWRDOLWUHWKHQFRQYH\VWKH FRQWDLQHUVWRWKHFDSSHU DERYH ZKLFKFDQ EHXVHGIRUDYDULHW\RIVFUHZFDSVL]HVGXHWR the design of the magnetic clutched heads to ensure a constant tightening torque, and from WKHUHWKHÂżOOHGFRQWDLQHUVFDQH[LWWRDODEHO applicator or packing station

have crossed the borders to Namibia, =DPELD0R]DPELTXH=LPEDEZHDQG Tanzania,â&#x20AC;? he added. 3URJHWWRÂśVPDLQVSHFLDOWLHVOLHLQ the full automation and control of SDFNDJLQJPDFKLQHU\ÂżOOLQJHTXLSPHQW FDSSLQJV\VWHPVODEHOOLQJHTXLSPHQW SDOOHWL]HUVOHDNWHVWHUVDQGWULPPHUV and conveyor and auxiliary systems. www.progetto.co.za


Golden Eagle Plastic Machinery

“We wish all our Loyal customers a very Merry Christmas and a Prosperous 2018”

Flow Regulators JET Engine IML Robotics

MAKO MACHINE MOUNTS

With years of expertise in the Plastic Industry, we can help from start up to large installations. Our specialities are energy saving solutions and advice, assistance with production costing, forecasts and, most importantly, being there for our customers long after we have done our installations. 4 Newton Road, Hughes , Ext. 15 Boksburg P O Box 6250, Dunswart 1508 Tel: +27 11 823 5840/41 • Fax: +27 11 823 4969 Email: mail@pmsplastics.co.za • www.pmsplastics.co.za


PROPAK CAPE

Pelchem steps up its game Fluorination expert expands into new markets

22 DEC 2017 / JAN 2018

THERE is renewed focus at 3HOFKHPWKHRQO\Ă&#x20AC;XRURFKHPLFDO producer in South Africa, which recently completed an internal restructuring process thatâ&#x20AC;&#x2122;s UHVXOWLQJLQLPSURYHGHIÂżFLHQFLHV at its seven production plants as well as better services to customers both locally and around the world. At least part of the new momentum DWWKH3HOFKHPZKLFKLVDVWDWHRZQHG was the appointment of Motheo Moatshe as Executive Sales and Marketing. Originally with Sasol Polymers, Motheo ODWHUVSHQWÂżYH\HDUVZLWKJOREDOSOD\HU SABIC in Saudi Arabia, where he gained valuable international experience. Now heâ&#x20AC;&#x2122;s busy implementing some of the lessons learned and taking the systems

DW3HOLQGDEDEDVHG3HOFKHPWRWKHQH[W level. (The company was originally known as Fluoro Pack, and the rebranding exercise appears to be creating positive energy for the business.) Pelchemâ&#x20AC;&#x2122;s main business is the Ă&#x20AC;XRULQDWLRQRISODVWLFPRXOGLQJV VXFKDV WDQNVSLSHVDQGHYHQÂżOPV EXWVRPH of the new developments are in relatively new market sectors. â&#x20AC;&#x153;Pelchem has developed new a QHZDQWLDJHLQJ active ingredient SHUĂ&#x20AC;XRURGHFDOLQ This active ingredient LVDĂ&#x20AC;XRURFDUERQ and derivative of decalin, which is used in cosmetics formulations to dissolve and deliver oxygen to the skin. There are only four producers of

SHUĂ&#x20AC;XRURGHFDOLQZRUOGZLGH â&#x20AC;&#x153;Addtionally, we have developed PRO\EGHQXPKH[DĂ&#x20AC;XRULGHZKLFKLVXVHGLQ medical applications to identify cancer cells,â&#x20AC;? said Moatshe, who is strengthening the ORQJWHUPUHODWLRQVKLSV with customers and industry, implementing a strategy to sustainably grow the business in these now mature and competitive markets,â&#x20AC;? said Moatshe.

Plans to take advantage of SAâ&#x20AC;&#x2122;s large reserves of fluorspar (calcium fluoride)

Putting Putting all all your your eggs eggs in in one one basket? basket?

Putting Puttingall allyour youreggs eggs ininone onebasket? basket? )RURYHU\HDUV0%7KDV EHHQ7+(UHOLDEOHVXSSOLHU RIFKRLFHIRU\RXULLDPE, LDPE, HDPE, PVC, PET, PS, ABS, PP and WaxUHTXLUHPHQWV

www.mbtsa.co.za SPREAD YOUR RISK MBTSouth SouthAfrica Africa MBT Distributors of Plastic Raw Materials Unit 16 (DVWZRRG2IÂżFH3DUN Unit 16, Eastwood Office Park, 8QLW(DVWZRRG2IÂżFH3DUN E5LOH\5RDG%HGIRUGYLHZ 11b Riley Road, E5LOH\5RDG%HGIRUGYLHZ7HO Tel: +27-11-455 2889Bedfordview: Tel: 011 455 2889

Lance vd Merwe 3DXO*ULSSHU Paul Gripper 7LDJRGRV5DPRV Tiago dos Ramos

6WHYHQ&RDWHV

082 901 0477  082 456 6659  082 775 5344 

&DSH7RZQ2IÂżFH &ROOHJH+RXVH Cape Town Office, 4 College House, &DSH7RZQ2IÂżFH&ROOHJH+RXVH 9LOODJH:DON3DUNODQGV Village Walk, Parklands: Tel: 021 556 7787 9LOODJH:DON3DUNODQGV7HO Tel: +27-21-5567787

Carlotta Stafford &DUORWWD6WDIIRUG Helga Ferreira +HOJD)HUUHLUD Ivan Horowitz ,YDQ+RURZLW]

082 600 7403  072 573 4221  072 896 6636




7KHÃ&#x20AC;XRULQDWLRQRISODVWLFFRQWDLQHUV XVLQJÃ&#x20AC;XRULQHJDVJUHDWO\LPSURYHV EDUULHUSHUIRUPDQFHRISODVWLF FRQWDLQHUVSUHYHQWLQJSHUPHDWLRQ RIYDSRXUDQGRGRXUWRSURWHFWIRRG SURGXFWVDQGEHYHUDJHVLQSDFNDJLQJ DQGHYHQIRUWKHSDFNDJLQJDQG WUDQVSRUWRIJDVVHVDQGIXHOVQRZ 3HOFKHPLVEXLOGLQJIURPWKDWSODWIRUP DQGHQWHULQJQHZPDUNHWV

2WKHUVHUYLFHV 3HOFKHPDOVRPDQXIDFWXUHDZLGH UDQJHRIÃ&#x20AC;XRURFKHPLFDOVPDLQO\ K\GURJHQÃ&#x20AC;XRULGHZKLFKLVDNH\ LQSXWLQSHWURFKHPLFDOV2WKHU VSHFLDOLVHGSURGXFWVXVHGLQFRVPHWLFV VXFKDVSHUÃ&#x20AC;XRURGHFDOLQHRU PRO\EGHQXPKH[DÃ&#x20AC;XRULGHLQPHGLFDO DSSOLFDWLRQV;HQRQGLÃ&#x20AC;XRULGHLQ HOHFWURQLFVDQGRWKHUVSHFLDOWLHVVXFKDV SHUÃ&#x20AC;XRULQDWHGRUJDQLFVROXWLRQSHUÃ&#x20AC;XRUR KHSWDQHSHÃ&#x20AC;XRURDONDQHVRGLXP ELÃ&#x20AC;XRULGHFDOFLXPVXOSKDWHDQGVRGLXP

VLOLFDKH[DÃ&#x20AC;XRULGH ³6RXWK$IULFDKDVWKHODUJHVWUHVHUYHV RIÃ&#x20AC;XRUVSDU FDOFLXPÃ&#x20AC;XRULGH WKHUDZ PDWHULDOIURPZKHQFHRXUSURGXFWVDUH SURGXFHG:HSODQWRWDNHDGYDQWDJH RIWKLVLQOLQHZLWKJRYHUQPHQW¶V )OXRURFKHPLFDO([SDQVLRQ,QLWLDWLYH $OWKRXJKVWLOOLQLWVHDUO\GHYHORSPHQW VWDJHVRXUSODQVDUHWRVFDOHXSWR PXOWLSOHVRIFXUUHQWSURGXFWLRQFDSDFLW\ ZKLOHDOVRDGGLQJQHZSURGXFWOLQHV KLJKHUXSLQWKHYDOXHFKDLQZLWKDQH\H IRUWKHH[SRUWPDUNHW´KHVDLG ³,DPSDVVLRQDWHDERXWFUHDWLQJD FXOWXUHZKHUHFROOHDJXHVDQGWHDPVDUH HPSRZHUHGDQGPRWLYDWHG,VSHQGDORW RIWLPHHQJDJLQJFXVWRPHUVVXSSOLHUV DQGRWKHULQGXVWU\SOD\HUVVWDNHKROGHUVWR DQDO\VHWUHQGVDQGRSSRUWXQLWLHV´DGGHG 0RDWVKH ZZZSHOFKHPFRP

DEC 2017 / JAN 2018 23

0DLQEHQH¿WVRIÃ&#x20AC;XRULQDWLRQ 7KHPDLQEHQH¿WVRIÃ&#x20AC;XRULQDWLRQDIWHU WUHDWPHQWRIWKHSODVWLFFRQWDLQHULVWKDW LWLVOHVVUHFHSWLYHWRSHUPHDWLRQWKXV PLQLPLVHVORVVRISDFNHGOLTXLG ³7KLVUHGXFHVRGRXUHPLVVLRQIRU H[DPSOHUHWHQWLRQRIIUDJUDQFHVRUHYHQ IXHOYDSRXUV:KDWLVDOVRHVSHFLDOO\ LPSRUWDQWLVWKDWWKHSURFHVVUHGXFHV µSDQHOLQJ¶ZKHUHÃ&#x20AC;XRULQDWLRQPDLQWDLQV WKHVKDSHRIWKHERWWOHVRUFRQWDLQHUV HYHQDIWHUORQJSHULRGVRIVWRUDJH´VDLG 0RWKHRDGGLQJWKDWÃ&#x20AC;XRULQDWLRQHQDEOHV SODVWLFFRQWDLQHUVWRVHUYHDVVDIHFRVW

HIIHFWLYHUHSODFHPHQWVIRUJODVVDQG PHWDOFRQWDLQHUV 7KHSURFHVVKDVEHHQXVHGPDLQO\ IRUSRO\ROH¿QSURGXFWVEXWFDQDOVREH DSSOLHGWR39&Q\ORQDQGHODVWRPHUV VXFK(3'09DULRXVRWKHUPRXOGLQJV± VXFKDVFDSVOLGVDQGEDJV±FDQDOVREH Ã&#x20AC;XRURWUHDWHG

0RWKHR 0RDWVKHLVWKH QHZ([HFXWLYH 6DOHVDQG 0DUNHWLQJ 0DQDJHUDW 3HOLQGDED EDVHG3HOFKHP

Buzz Trading â&#x20AC;&#x201C; ready for contract work Capacity available: ready for contract moulding work Servicing the domestic appliance market in Southern Africa since 2003 â&#x20AC;¢ Injection moulding capability from 60 to 1300 tons clamp force â&#x20AC;¢ Own toolroom: we offer development from concept to finished product â&#x20AC;¢ We operate our own transport fleet: delivery to anywhere in SA within 48hrs

Buzz Trading 104 (Pty) Ltd t/a Master Products 16 Moller Street, Germiston Tel: 011 873 8050 | Email: orders@buzztrading104.co.za www.buzztrading104.co.za


PROPAK CAPE

Colourful collaboration at PlastiColors The Plasticolors stand showcased Milliken UltraClear PP packaging solutions. Carolyn Kellock, Plasticolorsâ&#x20AC;&#x2122; new technical manager (right), was there with the companyâ&#x20AC;&#x2122;s key account manager, Chris Botha, and Amber Botha, who helped out during the three days of the show. New from Plasticolors is its Value Range (right) of masterbatch, offering a complete range of colours at economical pricing and with excellent dispersion, colour strength, light and heat stability

PLASTICOLORS represented Milliken at Propak Cape; displaying the Milliken FODUL¿HG33IRUERWKWKHUPRIRUPLQJDQG H[WUXVLRQEORZPRXOGLQJPDUNHWVDV ZHOODV0LOOLNHQ¶V&OHDUVKLHOG89EDUULHU WHFKQRORJ\IRU3(7 3ODVWL&RORUVGLVWULEXWH0LOOLNHQ¶V QXFOHDWRUVDQGPDVWHUEDWFKVROXWLRQV IRUWKHLQGXVWU\±+\SHUIRUP1XFOHDWRUV 1;8OWUDFOHDU&ODUL¿HUPDVWHUEDWFKHV &OHDU7LQW&RORXUVDVZHOODV0LOOLNHQ¶V &OHDUVKLHOGIRU3(7 &DURO\Q.HOORFNZKRSUHYLRXVO\ZRUNHG IRU0LOOLNHQDQG&RPSDQ\MRLQHGWKH 3ODVWL&RORUV*URXSDVWKHLUQHZ7HFKQLFDO 0DQDJHULQ6HSWHPEHUVWUHQJWKHQLQJWKH 3ODVWL&RORUVDQG0LOOLNHQUHODWLRQVKLS ³3ODVWL&RORUVKDYHDSDVVLRQIRUEULQJLQJ WHFKQLFDOVROXWLRQVWRWKHLUFOLHQWVDQGKDYH ZRUNHGYHU\FORVHO\ZLWK0LOOLNHQVLQFH LQXQGHUVWDQGLQJDQGGHYHORSLQJ PDUNHWRSSRUWXQLWLHVIRUQXFOHDWHG FRORUDQWV,DPH[FLWHGWREHSDUWRIWKLV VWURQJWHFKQLFDOWHDPDQGWREHDEOHWR WDNHWKHVHVROXWLRQVHYHQZLGHUZLWKLQ WKH6RXWK$IULFDQSODVWLFVLQGXVWU\´VD\V

&DURO\Q 3ODVWL&RORUVPDUNHWWKH0LOOLNHQ QXFOHDWHGPDVWHUEDWFKHVXQGHUWKHEUDQG QDPHRI3ODVWL¿[0DVWHUEDWFKHV3ODVWL¿[ 0DVWHUEDWFKHVDUHGHVLJQHGIRUERWK33 DQG+'3(DQGJLYHEHQH¿WVRI â&#x20AC;¢ Colour independent processing â&#x20AC;¢ ,QFUHDVHGSURGXFWLYLW\ â&#x20AC;¢ 5HGXFHGZDUSDJH â&#x20AC;¢ ,PSURYHGEDUULHUUHVLVWDQFH Launch of Value Range 3ODVWL&RORUVDOVRODXQFKHGWKHLU9DOXH 5DQJHDW3URSDN&DSH0LFKHOOH)OHPLQJ 'LUHFWRUDW3ODVWL&RORUVH[SODLQHGWKDW 3ODVWL&RORUVIRXQGDQHHGLQWKHPDUNHW IRUDUDQJHRIVWDQGDUGTXDOLW\FRORXUVWKDW ZRXOGEHDYDLODEOHWRFOLHQWVDWHFRQRPLFDO SULFLQJUHJDUGOHVVRIYROXPH2QHRIWKH GLI¿FXOWLHVIDFHGZLWKLQRXULQGXVWU\LV FRORXUPDWFKLQJDVSHFL¿FFRORXUVKDGH IRUDVPDOORSSRUWXQLW\7KLVUHVXOWVLQ H[FHSWLRQDOO\KLJKSULFHGPDVWHUEDWFKHV DVZHOODVOHQJWK\FRORXUPDWFKLQJDQG SURGXFWLRQOHDGWLPHV ³7KHUHDUHPDQ\FOLHQWVZLWKRXWD

VSHFL¿FFRORXUVKDGHLQPLQGZKRZRXOG EHPRUHWKDQZLOOLQJWRFKRRVHRQHRI EOXHUHGJUHHQHWFFRORXUVKDGHZLWKRXW KDYLQJDVSHFL¿FSDQWRQHPDWFKHG:H KDYHIRUPXODWHGFRVWHIIHFWLYHVWDQGDUG FRORXUVWKDWZLOOEHPDQXIDFWXUHGLQ YROXPHORWVDQGZLOOEHPDGHDYDLODEOH WRVPDOODQGODUJHXVHUVDWWKHVDPHSHU NLORJUDPSULFH´0LFKHOOHDGGHG 7RDVVLVWWKHFRQYHUWRUVZLWKPRYLQJ WKHLUFOLHQWVWRZDUGVWKHHDVHRIXVH 9DOXH5DQJH3ODVWL&RORUVKDYHSUHSDUHG FRORXUHGFKLSVDPSOHFKDLQVWKDWDUH DYDLODEOHIRUWKHLUVDOHVUHSUHVHQWDWLYHVWR VKDUHZLWKSRWHQWLDOFOLHQWV 0LFKHOOHEHOLHYHVWKDWWKH9DOXH5DQJH ZLOO¿OODPXFKQHHGHGJDSZLWKLQWKH PDVWHUEDWFKLQGXVWU\³7KLVGHYHORSPHQW LVQRWQHZVFLHQFHKRZHYHUZHVHHWKLV DVDQRWKHUXQLTXHVROXWLRQRIIHULQJWKDW 3ODVWL&RORUVKDYHEURXJKWWRWKHPDUNHW NHHSLQJXVDVDOHDGLQJVROXWLRQVSURYLGHU ZLWKLQWKHPDVWHUEDWFKLQGXVWU\´VKH added www.plasticolors.co.za

24 DEC 2017 / JAN 2018

$NXUD¶V0DJJLH6PLWKDQG-DFRGX7RLWZHUHKDYLQJD¿QHWLPHVKRZLQJ off their vertical balers. New out this year is the B4 vertical baler, one of the smallest vertical balers on the market. A big advantage is that it runs off single phase power, so it can literally be plugged in anywhere and be ready to operate. And itâ&#x20AC;&#x2122;s so reasonably priced that even small businesses can afford it, says Jaco www.akura.co.za

Glynnis Lyon at the AGQPE stand with the new Cookpac dual ovenable packaging from UK company, Colpac Packaging. Colpac also offer heat sealed extended life shelf products. &ROSDFSURGXFWVUHÃ&#x20AC;HFWWKHVWURQJJUHHQFUHGHQWLDOVDFURVV the companyâ&#x20AC;&#x2122;s stock portfolio, from products made from compostable materials which are EN13432 standard, to recyclable and biodegradable packaging. AGQPE, the representative for Colpac in SA, specialises in supplying and implementing food packaging systems with products and technologies amongst the latest and most advanced. The company is also a leader in â&#x20AC;&#x2DC;greenâ&#x20AC;&#x2122; products, offering a range of bio-degradable and compostable food packaging under its trade mark Enviropackâ&#x201E;¢ www.foodpackagingsystems.com


Wishing all a prosperous 2018

erda.co.za

Thank you to family, friends, clients and suppliers for your support during 2017. Wishing you a safe and joyous festive season.


PROPAK CAPE

West African Group customers About 120 set sail with Sea Princess WEST African Group hosted a sunset cruise on the second evening of the show with customers from across the country joining the WAG team and delegates from its principal ExxonMobil on the wellappointed Sea Princess for a short trip around Table Bay and the V&A itself. A powerful vessel, the Sea Princess is a double-decker 23,5m catamaran with twin 1350 HP turbo diesel engines which

Guido Denys of Accent Manufacturing and Alan Wassung of WAG

Vincent Cartier, SA cluster manager at ExxonMobil Lubricants

26 DEC 2017 / JAN 2018

Nick Lambrechts, Conrad Shearon and Haydon Wood of Prefpak

is capable of carrying 140 passengers and crew â&#x20AC;&#x201C; and there were enough passengers on the evening. Tony Stopford of PolyGo, the WAG representative in the Western Cape, brought the show together for the fun occasion, with excellent drinks and snacks, and itâ&#x20AC;&#x2122;s just as well that the boat didnâ&#x20AC;&#x2122;t go down â&#x20AC;&#x201C; the industry might have too.

Rob McQueen of WAG, Paul Visagie of Mpact KZN and Jannie van Tonder of Plaslantic

Brian McCleary of Pacrite of Durban, Rick Johnston of Flowe-Pac Maritzburg, Brent Hean of enX Polymers and Anthony McCleary, also of Flowe-Pac

Based in Port Elizabeth, Baypacâ&#x20AC;&#x2122;s Aoron Raven and Donovan Biljon were kept very busy at the company stand. Over and above a wide range of general packaging materials, Baypac highlighted its pallet load stability adhesive, Lock â&#x20AC;&#x2DC;n Pop, which is water-based and manufactured from FDA DSSURYHGRUJDQLFPDWHULDOV/RFNÂľQ3RSKDVLQÂżQLWHVKHDUVWUHQJWKZKLFK prevents packages moving from side to side, providing excellent pallet load stabilisation. However, it also has relatively low tensile strength (vertical) which allows packages to be easily separated. Lock â&#x20AC;&#x2DC;n Pop has a wide range of formulated products for a multitude of packaging applications, including poly-woven and plastic bags, that does not damage the packaging surface or leave unsightly residues. The company is also the South African agent for the full range of SIAT packaging equipment and has recently added Leuenberger (Italy) hot melt and water based adhesives to its range of packaging products. www.baypac.co.za

Patrick Munyembate and Natasha Adams of MCG Flexibles

At the BMSC Engineering stand, Andrag Simon and William Boltman showcased the companyâ&#x20AC;&#x2122;s rare earth permanent plate magnets that remove all ferrous metal contamination form bulk, wet or dry goods. The company also offers permanent magnetic in-line metal traps for pumped or ZHWSURGXFWVDQGSHUPDQHQWPDJQHWLFWUDSVIRUGU\IUHĂ&#x20AC;RZLQJSURGXFWV in chutes or spouts. Also on the stand were examples of the latest in Mesutronic metal detectors. The company celebrates its 27th year in 2017. William explained that BMSC brings in the rare earth magnets from China and then does all its own design and manufacturing and custom builds to a client spec. www.bmscengineering.com


on sunset cruise As the Sea Princess cruised majestically out into Table Bay, the passengers calmed down and absorbed the beautiful views of the Fairest Cape â&#x20AC;¦ well nearly

Frederica Smith and Myles Ryan of WAG with Abdul Rasheed of Taghleef Industries (centre)

Duncan Brown of enX Polymers, Michael Vinck of ExxonMobil and Adrian Jackson of Liqui-Box SA

DEC 2017 / JAN 2018 27


PROPAK CAPE

Safrique undergoes metamorphosis, becomes machine supplier

28 DEC 2017 / JAN 2018

SELDOM has a company gone through as dramatic transition as Safrique has of late, one could say itâ&#x20AC;&#x2122;s virtually a metamorphosis. Formerly a dedicated supplier of materials (including recycled grades), preforms and a variety of other ÂżQLVKHGDQGLQWHUPHGLDWHJRRGVDFURVV Africa, often into countries seldom heard of, the Safrique personnel noticed companies required better quality equipment compared to the existing equipment they had. By contrast, Mervyn Moodley and the Safrique team have built up the expertise, skills and knowhow to deal in Africa since the company was established in 1996. Mervyn and his marketing team have travelled the length and breadth of the continent and at any moment in time could be in any of 20 or 30 countries (there are 54). So Safrique began putting together what is already a virtually complete range of

converting equipment, and their decision has been to partner with established, mainly European machine makers, arguably because there is comparatively reduced risk of machine problems growing their business in the African continent. At Propak Cape Safrique was able to lay out its new stall. It now represents, in markets of Southern Africa: â&#x20AC;˘ WindmĂśller & HĂślscher Machinery (complete woven bag equipment) â&#x20AC;˘ Nordmeccanica (coating, lamination and metalizing equipment) â&#x20AC;˘ Cadel Deinking (deinking technology) â&#x20AC;˘ NGR (recycling machinery) In addition Safrique also represents in selected East, West and Central African countries: â&#x20AC;˘ WindmĂśller & HĂślscher (extrusion and printing) â&#x20AC;˘ Garant (paper bag converting) â&#x20AC;˘ Flexo Wash (anilox and plate cleaning)

â&#x20AC;˘ Vetaphone (corona treatment) â&#x20AC;˘ OFRU Recycling (solvent recycling) The result was that the Safrique stand at the CTICC was a hive of activity, with representatives from several of its new principals there. One of the most recent additions to Safriqueâ&#x20AC;&#x2122;s mini-arsenal is Cadel Deinking of Spain, a supplier of deinking technology. This unique patented process expedites the removal of printed ink from 3(ÂżOPDQG33ZRYHQEDJHQDEOLQJ recyclers to reduce or even eliminate one of their biggest problems over many years, the result being an ink-free plastic with a quality very similar to that of virgin polymer. The company is working on deinking technology for laminates (watch this space). www.safrique.com

â&#x20AC;&#x2DC;One-stop shopâ&#x20AC;&#x2122; for Africa â&#x20AC;&#x201C; Among those on the Safrique stand were Llewellyn Moodley (Safrique); Sven Ortner, area sales manager for NGR (Austria, recycling systems); Klaus Keller, regional sales manager for WindmĂśller & HĂślscher (Germany, PP woven bag machinery); Mervyn Moodley (Safrique CEO); Simon Pollock, area sales manager of Southern Africa (WindmĂśller & HĂślscher); and Pablo Cartegena, business development manager at Cadel Deinking of Spain, (deinking technology). Missing just then was Ivano Andrighetto Africa representative of Nordmeccanica of Italy, the manufacturer of lamination equipment, which Safrique also represents north of the border

Back to Black - Burcap Plastics was very noticeable at the show with an attentiongrabbing stand â&#x20AC;&#x201C; a massive black shipping container split into two â&#x20AC;&#x201C; inside products were displayed cleverly, a state-of-the-art coffee station for visitors was well attended and knowledgeable (and gorgeous) staff circulated, answering questions. The thorn among the URVHVKHUHLV1LFKRODV+HDQĂ&#x20AC;DQNHGIURPOHIW by Lindique van Zyl, Nolene Lotz and Vicky van Romburgh. Burcap are launching a new â&#x20AC;&#x2DC;Back to Blackâ&#x20AC;&#x2122; corporate identity that is mirrored by their range of recycled PP products â&#x20AC;&#x201C; Tuffskid, Waterform drainage system and pails in all shapes and sizes. www.burcap.co.za


reaching new heights +27 11 704 0824 | info@cabletech.co.za | www.cabletech.co.za | Lanseria Corporate Estate


PROPAK CAPE $ÂżUVWWLPHH[KLELWRU ZDV65))OH[LSDNDQG PDQQLQJWKHVWDQGZHUH 7RPYDQ+HU]HHOH VDOHV DQGPDUNHWLQJPDQDJHU  *UDQW3DJH VHQLRUYLFH SUHVLGHQWDQGFRXQWU\ KHDG DQG5RKLW9HUPD VHQLRUPDQDJHUIRU LQWHUQDWLRQDOPDUNHWLQJ  65)KDYHEHHQSUHVHQW LQ6$IRUIRXU\HDUVDQG DVWKHRQO\PDQXIDFWXUHU RI%233LQ6RXWK$IULFD DQGWKHSULPDU\VXSSOLHU RI%23(7LQWR6$7RP VD\VWKDWWKHLUGHFLVLRQ WRH[KLELWDW3URSDNZDV EDVHGRQDQHIIRUWWRUDLVH WKHLUSURÂżOHHYHQPRUH ZZZVUIFRP

3RO\RDN3DFNDJLQJ KDVQXPHURXV VDOHVZDUHKRXVHV DFURVVWKHFRXQWU\ ZKHUHVPDOOWR PHGLXPVL]HG EXVLQHVVHVFDQ SXUFKDVHLWV SODVWLFSDFNDJLQJ GLUHFWO\8VHWKH 45FRGHKHUHWR ORFDWH\RXUQHDUHVW ZDUHKRXVH

Printing flair $IULFDQ&ORVXUHVÂś FORVXUHSULQWLQJ FDSDELOLW\LV JURZLQJUDSLGO\ 3ULQWLQJRQ FORVXUHVLVDQ HIIHFWLYHZD\WR PD[LPL]HEUDQGLQJ DQGVKHOIDSSHDO DQGLVVXLWDEOH RQDQG PPFORVXUHV

30 DEC 2017 / JAN 2018

Presents

RANGE OF BAG MAKERS In this competitive market processer cannot afford to run dedicated machines for speciďŹ c jobs. So the Veloss 800s is the perfect choice for customers. Their new Veloss 800s, multi-purpose, side seal machine â&#x20AC;&#x201C; 300 cycles/min â&#x20AC;&#x201C; is a huge hit in the market because of its varsitility with running many different jobs and materials with minimum change over time. One can run hdpe, ldpe, pp, cpp and bopp on the same machine just by changing the jaw of the machine. Talk to us about our work horse machine. They also stock spares in the country to give faster after sales services.

VELOSS 800S â&#x20AC;&#x201C; MULTI PURPOSE â&#x20AC;&#x201C; SIDE SEAL MACHINE â&#x20AC;&#x201C; SPEED: 300 BAGS/MIN Side sealing: www.youtube.com/watch?v=uSO9JxfHFa8

THE TYPE OF BAGS THAT CAN BE MADE: 1. Patch Handle Bags 2. Die Cut / Handle Punch Bags 3. Courier / Dhl Bags 4. Postal Bags

5. Simple Side Seal Bags 6. Low Microns Bags 7. Grape / Nursary Bags 8. Chicken Bags 9. Pen Bags

WWW. VISHVAEXIM. COM Contact us: Vishva Exim Pvt Ltd T: +91 98 797 97910 M: +91 909 991 6958 1225 E: info@vishvaexim.com

MORE THAN 50 INSTALLATIONS IN 3 YRS


Cappuccino time! A GROUND-breaking innovation at the Polyoak stand was a new retortable oxygen barrier tub for barista-quality coffee, Ella Cappuccino. Cassandra Hellmann of Star Gate Innovations (pictured here) explained that the invention is Neil Hellmannâ&#x20AC;&#x2122;s, an entrepreneur and serial inventor who runs Star Gate and who spent four years working on the innovation before approaching Polyoak to help with the packaging of the product. What makes Ella Cappuccino unique is that the product contains real milk and espresso - simply shake for 20 seconds, break the lid and seal, and pour into a mug before adding 150ml boiling hot water. The resulting blend not only looks like a cappuccino, it tastes as good as the fare youâ&#x20AC;&#x2122;re served by any barista or artisanal coffee house. Hellmannâ&#x20AC;&#x2122;s team has devised a special type of plastic to keep the coffee preserved, based on a license from Sweden. To that the team has developed a unique foaming ring which generates the perfect IRDP,Q*HUPDQ\+HOOPDQKDVHQOLVWHGWKHKHOSRIDSULYDWHÂżUPWR perfect the taste. And he has even built a processing plant to bring these disparate elements together. After four years of graft, the hard work has been worth it. Hellmann has disproved the innumerable packaging and food industry experts who called Ella a pipe dream. www.ella.coffee

DEC 2017 / JAN 2018 31

011 704 0824 info@cabletech.co.za Lanseria Corporate Estate www.cabletech.co.za


PROPAK CAPE

Big capex venture: Propet launches PRO-10 packaging strapping

32 DEC 2017 / JAN 2018

Local production due to start before year end PROPET provided a surprise highlight at Propak Cape when it launched its new PRO 10 packaging strapping. The Cape Town-based PET recycled ÂżEUHSURGXFHUKDVVRXUFHGWHFKQRORJ\ to manufacture the strapping from recycled PET and PP, which â&#x20AC;&#x201C; since the company already has a well-established PET container collection and recycling infrastructure â&#x20AC;&#x201C; it believes will give the company an important competitive advantage. Used in a wide variety of packaging DSSOLFDWLRQVVSHFLÂżFDOO\IRUFRQWDLQHU or pallet securing and stabilization, the strapping was manufactured locally until just a few years ago, but local production was ceased after former manufacturer Afcom found it could not compete with import prices. Propet has purchased a strapping extrusion line from SIMA of Italy, part of a multi-million rand investment project, which is to be installed at the companyâ&#x20AC;&#x2122;s plant in Killarney, Cape Town, and is due to be operational by year-end. The worldâ&#x20AC;&#x2122;s leading PET strap producers run on SIMA technology and their track record has been proven.

7KHÂżUVWVDPSOHVRIWKH3(7DQG33 strapping, produced on the line during trials in Italy, were exhibited at the Cape show. One of the advantages for Propet is that material from green recycled PET bottles, for which there were limited applications, can now be used in the strapping. It may even be possible to make use of the volumes of brown rPET, sourced mainly from â&#x20AC;&#x2DC;Stoneyâ&#x20AC;&#x2122; and related CSD containers, which up till now have also had limited post-use application. With the PP tape, however, virgin material will be used, at least initially, as there are doubts whether the MFI of recycled PP will function. â&#x20AC;&#x153;We need to demonstrate to government that we are being proactive,â&#x20AC;? said Chandru Wadhwani, director of Propet, who along with Vijay Naidu were part of the team which was instrumental in motivating the project. The fact that the rand exchange rate has depreciated since local production ceased may be a further factor in Propetâ&#x20AC;&#x2122;s favour. The estimated tonnage of the packaging strapping market in SA is 4000 tons per annum.

On the roll â&#x20AC;&#x201C; Vijay Naidu and Chandru Wadhwani of Propet were pleased as punch to be able to launch their PRO-10 PET and PP packaging strapping at the show

First-time exhibitor at Propak Cape was Evotec, best known for their range of personal care products. MD Gernot Liebentritt (right) and his able team, including Rozanne Edson pictured here with Gernot, offer an array of services to the packaging industry: injection moulding, injection blow moulding, extrusion blow moulding, clean-room moulding, as well as design, assembly and decorating. The companyâ&#x20AC;&#x2122;s in Montague Gardensâ&#x20AC;&#x2122; industrial area in Cape Town has been designed and constructed according to global plastic moulding and converting industry best practice. www.evotec-plastics.com

The Classic Closures stand looked as good as ever with Desiree Schulte and Martin Gassner adeptly handling the many visitors passing through. Their IML rigid packaging was well showcased with a plethora of examples on display, including tubs of Marcelâ&#x20AC;&#x2122;s frozen yoghurt which was offered to visitors to tasteâ&#x20AC;Ś and taste again! Classic Closures are well-known for their range of yoghurt closures, margarine, ice cream and other containers and tubs; cleanroom medical components and irrigation products, including a patented dripper. Interestingly, Martinâ&#x20AC;&#x2122;s IDWKHU(UQVW*DVVQHUÂąDQLOOXVWULRXVÂżJXUHLQWKHSODVWLFVLQGXVWU\IRU many years, celebrates his 96th birthday this year www.classicclosures.co.za


PROPAK CAPE

34 DEC 2017 / JAN 2018

Midrand-based Motion Plasticsâ&#x20AC;&#x2122; stand was a veritable treasure of engineered plastic components manufactured using German igus equipment. Juan-Eric Davidtz (product manager, bearings) and Vishay Sudamma (technical sales rep) spent their time explaining WKHEHQH¿WVRIOXEULFDWLRQIUHH and maintenance-free dry-tech bearings and bushes. The Motion Plasticsâ&#x20AC;&#x2122; bearings are made of high-performance plastics and Juan-Eric says that clients have managed to reduce costs by up to 40% using these plastic bearings and bushes. www.igus.com

$ZRUOG¿UVWIURP0SDFWLVWKH+¶HDWDZD\7UD\DQ insulating food tray made from PET bottles. The tray is WKH¿UVWWLPHLQ6$WKDWLQVXODWLQJIRRGWUD\VPDGHIURP recycled PET bottles can be recycled into other products. Mpactâ&#x20AC;&#x2122;s Edzard Alleman (PET manager) and Chris Botha (national sales manager) shared the AGQPE stand to show off this recent innovation. Chris explained that the +¶HDWDZD\7UD\LVDOVRPLFURZDYDEOHDQGRYHQDEOH±DQG LW¶VVDIHWRKROGZKHQKRW7KHWUD\LVOLJKWEXWVWURQJ±QHZ Ad-air technology expands the plastic with millions of air EXEEOHVWRFUHDWHWKH+¶HDWDZD\¶VXQLTXHVWUXFWXUH www.mpact.co.za

Polyoak Packagingâ&#x20AC;&#x2122;s Michelle Penlington (national marketing executive) and Nikki van Schalkwyk (sales manager for Polypet & Dairypack) at the companyâ&#x20AC;&#x2122;s attentiongrabbing stand. Polyoak showcased its latest packaging innovations, LQFOXGLQJQHZOLJKWZHLJKWDQGOLWUHGULQNLQJZDWHUERWWOHV7KHUHYLVHGVSHFL¿FDWLRQ reduces the neck size from 46mm to 38mm which reduces weight and also saves on material. Polyoak are well-known for their 1881 CSD closures - besides the reduction LQPDVVIXUWKHUHQYLURQPHQWDOEHQH¿WVDUHUHDOLVHGLQWKHPLJUDWLRQWRZDUGVWKHVH one-piece 1881 closures. Previously a large portion of 1810 closures produced were two-piece closures consisting of a PP outer shell with a moulded EVA liner. Today most &6'FORVXUHVDUHSURGXFHGDVDVLQJOHSLHFHFORVXUHXVLQJ+'3(7KHUHVXOWLVD VLPSOL¿HGPDQXIDFWXULQJSURFHVVDQGDFORVXUHWKDWLVHDVLHUWRUHF\FOH

Tamper-evident fliptop closures - To eliminate the risk of food tampering, Polyoakâ&#x20AC;&#x2122;s award-winning range of 28mm one-piece, tamper-evident Fliptop closures offers impressive cost-savings, as no extra wads, liners or shrink wrap are required. Fliptop closures for sauces, in particular, are gaining traction, says Andrew Tucker (Polyoak plant manager). Investment in new tooling and technology enabled African Closures to eliminate the liner in the Fliptops. The interior plug seals securely while the tamper-evident band eliminates the need for liners, foil seals or shrinkwrap which add costs and complexity. This one-piece, tamper evident closure is manufactured completely from PP, making it easy to recycle and a smart sustainable choice

Feeding time! â&#x20AC;&#x201C; <HWDQRWKHU¿UVWWLPHH[KLELWRUDW Propak Cape was Zerma Africa, which made its presence felt every time the Zerma granulator on the stand was fed more scrap! Zerma Africa MD, Jeff Cawcutt and his team certainly meant business: their VWDQGZDVPRVWGH¿QLWHO\RQHRIWKHEHWWHUDSSRLQWHG and eye-catching and showed off both Zerma and Crushmaster granulators and shredders. Zerma Africa MD, Jeff Cawcutt (2nd from right) with Richard Monkhouse (Zerma UK general manager), Max Paeslack (Zerma international sales director) and Chantal Shaw (Zerma Africa) were present all three days www.zerma.com


A new generation takes shape.

Take the proven and tested, make it even better and explore something new â&#x20AC;&#x201C; that is what makes ENGEL and their customers so successful. Following our claim be the first, we present a new generation of injection moulding machines setting new standards. For now, we will entice you with this: We do not compromise on energy efficiency, ergonomics or precision. Do you want to know more?

www.engelglobal.com www.greentechmachinery.co.za sales@greentechmachinery.co.za


News

World-first automatic from SAâ&#x20AC;&#x2122;s Conver-Tek Handles design, electronics, programming, tools, production and assembly 685(6,*+7DZRUOG¿UVW KXQWLQJERZVLJKWKDVUHFHQWO\ HPHUJHGIURPWKHGHYHORSPHQW SURFHVVDW&RQYHU7HNLQ %UDNSDQ 'HYHORSHGLQDOHQJWK\¿YH\HDU SURMHFW6XUH6LJKWLVDIXOO\DXWRPDWLF FRPSDFWODVHURSHUDWHGHOHFWURQLF KLJKWHFKERZVLJKWZKLFKXVHVXQLTXH LQQRYDWLYH WHFKQRORJ\ JHQHUDWHGLQ 6RXWK$IULFD 7KHLQMHFWLRQ PRXOGHG LQVWUXPHQW GHVLJQHGWREH H[WUHPHO\UREXVW FDQEH¿[HGWR DQ\FRPSRXQGERZ7KHEUDFNHWVDQG FDVLQJVDUHPRXOGHGLQTXDOLW\JODVV ¿OOHGHQJLQHHULQJSRO\PHUVWRKDQGOH HYHQH[WUHPHRXWGRRUFRQGLWLRQVDV ZHOODVVKRFNLQWKHFDVHRILPSDFW 7KHSDWHQWKROGHUVRULJLQDOO\SODQQHG WRPDQXIDFWXUHWKHVLJKWRXWRI&1& PDFKLQHGVROLGDLUFUDIWDOXPLQLXPEXW ±JLYHQWKHRSSRUWXQLW\±&RQYHU7HN¶V GHYHORSPHQWWHDPUHGHVLJQHGWKH FRQFHSWIRULQMHFWLRQPRXOGLQJ ³:HZLOOQRZPRXOGWKLVLQDUREXVW

(

36

DEC 2017 / JAN 2018

VWDEOHHUJRQRPLFDOO\SOHDVLQJVPDOO FRPSDFWSDFNDJHXVLQJTXDOLW\GHVLJQ KRWUXQQHUWRROVDQGKLJKWHFKUREXVW VWDEOHHQJLQHHULQJSRO\PHUV¿WIRUXVH´ VDLG%HYDQ'DYLVRI&RQYHU7HN (YHQKLJKTXDOLW\PHFKDQLFDOERZ VLJKWVIRUFRPSRXQGERZVIRUKXQWLQJ RUWDUJHWVKRRWLQJKDYHVHULRXV OLPLWDWLRQVRQDFFXUDF\7RDFFXUDWHO\ MXGJHGLVWDQFHIURPWKHKXQWHUWRWKH WDUJHWGHPDQGV DVHSDUDWH H[SHQVLYH HOHFWURQLFUDQJH ¿QGHU7KLV LQVWUXPHQWQHHGV WREHDLPHGWKHQ SXWGRZQWKHERZ WKHQQHHGVWREH OLIWHGDQGWKHFRUUHFWVLJKWSLQIRUWKH PHDVXUHGGLVWDQFHVHOHFWHGEHIRUH ZKLFKWKHERZFDQEHGUDZQDLPHGDW WKHWDUJHWDQGWKHDUURZUHOHDVHG 7KHWDUJHWPD\PRYHFRQWLQXRXVO\ ZKLFKWKHQFRPSRXQGVWKHYDULDEOHV RIPRYHPHQWUHFKHFNLQJWKHGLVWDQFH VLJKWSLQVHOHFWLRQDQGGUDZLQJWKH ERZ8VLQJ6XUH6LJKWWKLVGHWDLOFDQ EHFKDQJHGDWIXOOGUDZ6XUH6LJKW QRZRIIHUVWKHSURIHVVLRQDORUVSRUW ERZKXQWHUDSRWHQWLDOVKRWRSSRUWXQLW\ IRUHYHU\VLJKWLQJ6KRWVFDQQRZEH

)

100% South African patented development

WDNHQIURPPFRQ¿GHQWO\ :KDWPDNHVWKLVSURGXFWXQLTXH LVWKDWHYHQIRUDQRYLFHERZ KXQWHULWWDNHVRQO\PLQXWHVWR VHWWKHERZDFFXUDWHO\DWP7KH SUHVHOHFWHGSURJUDPPHVZLOOWKHQJLYH SLQSRLQWDFFXUDF\ZLWKRXWFKDQJLQJ SURJUDPPHVRUVHWWLQJV ³:HKDYHGHVLJQHGDQGEXLOWYDULRXV 'UDSLGSURWRW\SHVLJKWVWR¿HOGWHVW DQGWULDO7KHVLJKWKDVEHHQWHVWHG E\WKHZRUOGFKDPSLRQDQGDQRWKHU LQWHUQDWLRQDOO\UHQRZQHGERZKXQWHU ZLWKYHU\KLJKUDWLQJV´VDLG'DYLV 7KHGHVLJQHOHFWURQLFVPDWKV SURJUDPPLQJERDUGVWRROVSURGXFWLRQ DQGDVVHPEO\DUHD6RXWK $IULFDQSDWHQWHGGHYHORSPHQW6XUH 6LJKWZLOOEHSURGXFHGDVVHPEOHG WHVWHGDQGH[SRUWHGLQWHUQDWLRQDOO\WRD SRWHQWLDORI 7KH6XUH6LJKWLQVWUXPHQWVZLOOEHJLQ WRFRPHRIIWKH&RQYHU7HNSURGXFWLRQ OLQHVE\PLG 7KLVLVDIROORZRQ6$VXFFHVVVWRU\ IRU&RQYHU7HNZKLFKZDVDOVRWKH PDQXIDFWXUHURIWKHOHJHQGDU\.UHHS\ .UDXO\SRROFOHDQHU$QRWKHUXQLTXH 6$SKRWRYROWDLFSRZHUDQGKRWZDWHU K\EULGSDWHQWHGV\VWHPIURP&RQYHU 7HNZLOODOVREHFRPSOHWHGLQ


bow sight

SoftBev going well

AROUND THE WORLD

BOWCALF appears to have turned the corner with SoftBev, the softdrink venture involving the Bowler subsidiary Quality Beverages and Shoreline Beverages of KZN. Friedl Sass of Bowler said SoftBev KDGWUDGHGDKHDGRIEXGJHWIRUWKHÂżUVW IRXUPRQWKVRIWKHQHZÂżQDQFLDO\HDUDQG had broken even in October. 2017 has been tough in the CSD sector, with sugar prices having escalated and the threat of the implementation of the sugar tax, not to mention the sluggish economic rate. According to Sass, SoftBev has â&#x20AC;&#x201C; after Coca-Cola â&#x20AC;&#x201C; the most advanced infrastructure in the CSD market in Southern Africa. This market, like virtually all consumer sectors, is characterised by tight competition, with some of the leadersâ&#x20AC;&#x2122; nearest rivals being unlisted and thus free of close examination by the investment sector. SoftBev has apparently received a number of offers to buy, but Sass and non-executive director Michael Brain VDLGWKH\ÂżUVWZDQWHGWRÂłUHWXUQYDOXHWR shareholders,â&#x20AC;? but might entertain offers in ÂżUVWTXDUWHU

E Cape painting Co liquidated

www.convertek.co.za

7KH6XUH6LJKWERZDZRUOGÂżUVW for South Africa

COEGA Auto Spray of Port Elizabeth, which as its name suggests specialised in the painting of plastic components, as well as the injection moulding of parts, has JRQHLQWROLTXLGDWLRQDQGLWVHTXLSPHQWZDV auctioned off in mid-October. DEC 2017 / JAN 2018 37

MOULD BASE SA TOPSTAR ANCILLIARY EQUIPMENT â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

Granulators Servo Robots Mould Temperature Controllers Hopper Loaders Hopper Dryers Dosing Units Conveyors Dehumidifying Driers Centralised Loading Systems Hopper Magnets Mould Clamps Full range of spare parts ex stock Custom Automation Projects from Design to Completion

Dave Moore: 083 675 8325 | Fax: 086 540 0908 | www.mouldbasesa.co.za

Dave Moore: 083 675 8325 Email: mouldbasesa@gmail.com

OCK IN STR KZN U O IN EHOUSE WAR


News

ITB bought by Novus Printing and bag-making are ,7%ÂśVPDLQEXVLQHVVDQGÂżWWKH requirement of Novus Holdings, new owner of the company, to diversify from its main media print business

The large ITB plant in Isithebe, on the KZN north coast, where extrusion, printing and bag-making are conducted; the company also operates a plant for courier envelope and other specialised bags in Gauteng

New owner expands to markets outside of print media NOVUS Holdings, a leader in commercial print and manufacturing, has purchased ITB Manufacturing, one of South Africaâ&#x20AC;&#x2122;s leading plastic bag as well as tamper-evident and courier bags manufacturers. The Competition Commission approved the proposed merger in June and it was announced on SENS on 19 September; the merger came into effect on 1 October. This acquisition forms part of Novus Holdingsâ&#x20AC;&#x2122; business strategy to diversify into related and new markets to boost SURÂżWDELOLW\DQGLQFUHDVHFDVKĂ&#x20AC;RZ through sourcing new revenue streams for the group. â&#x20AC;&#x153;Acquiring ITB Manufacturing will allow Novus Holdings to access revenue streams outside of the print media sector, which to date has been the source of the majority of our income. This investment in the packaging industry further entrenches us in the broader industrial and manufacturing sectors, and is complementary to our existing operations,â&#x20AC;? said Keith Vroon, CEO of Novus Holdings Group. ITB, currently with operations in KwaZulu-Natal and Gauteng, produces DZLGHUDQJHRIĂ&#x20AC;H[LEOHSDFNDJLQJ 38

DEC 2017 / JAN 2018

solutions, servicing customers in the )0&*VHFWRUZLWKSDFNDJLQJÂżOPVIRU dry goods (both food and non-food), industrial bulk packaging for polymers and chemicals, retail checkout bags, tamper-evident security bags, courier HQYHORSHVDQGJHQHUDOĂ&#x20AC;H[LEOHSODVWLF packaging. ITBâ&#x20AC;&#x2122;s sales strategy is synergistic with that of Novus Holdings as it is centered on long-lasting, collaborative relationships evident in its loyal customer base. Novusâ&#x20AC;&#x2122; subsidiaries and ITB aim to leverage off each otherâ&#x20AC;&#x2122;s existing customer network with its combined offering and broader spectrum of products. â&#x20AC;&#x153;ITBâ&#x20AC;&#x2122;s manufacturing capabilities are aligned with that of the Novus Holdings group of companies. Novus Holdings has packaging and label equipment that caters to the long and short-run market. ITBâ&#x20AC;&#x2122;s capabilities are a perfect ÂżWRIIHULQJVROXWLRQVWKDWWKDWERWK FRPSOLPHQWVDQGÂżOOVWKHJDSEHWZHHQ the Groupâ&#x20AC;&#x2122;s current capabilities,â&#x20AC;? added Vroon. Novus, in conjunction with ITB, plans to expand on the current ITB offering DQGJDLQRUJDQLFJURZWKLQWKHĂ&#x20AC;H[LEOH plastic packaging and wrap around label sectors. ITB has recently added new capacity to its operation at Isithebe

in KZN to increase its extrusion and print production capabilities to further service its diverse customer base. Tim Stewart, the MD of ITB, had the following to add about the merger: â&#x20AC;&#x153;Novus Holdings is a market leader in the printing and manufacturing industry, with a reputation for high quality and personalised service, which we uphold in our own dealings with clients. We are delighted to join forces with the Novus Holding group of companies and look forward to the opportunities to offer an expanded range of packaging solutions, with an improved geographical footprint and an enhanced range of products and services from synergies with the technical and production capabilities of Novus. â&#x20AC;&#x153;We are also excited that we can EHJLQWRZRUNWRJHWKHUIRUWKHEHQHÂżW of both parties and towards achieving Novusâ&#x20AC;&#x2122; overall growth strategy, as Novus continues to look to other industries for ORJLFDOH[SDQVLRQDQGGLYHUVLÂżFDWLRQ initiatives,â&#x20AC;? added Stewart. Novus was previously known as Paarl Media and was part of Media24 but was separated from the parent company after the Competition Commission ruled that Medi24â&#x20AC;&#x2122;s 66% holding was too large; that stake has now reduced to 19% of Novus. www.saplastics.co.za


News The production of large numbers of machines is standard at enterprises such as Tederic

Tederic lists on Beijing exchange SA agent Userve invited over for celebration TEDERIC, the Chinese injection moulding machine manufacturer, listed on the Beijing Stock Exchange on 31 October with an initial public offering with 51 million shares at RMB7.83 per share. The listing, which represents Tedericâ&#x20AC;&#x2122;s entry to the capital market, drew an estimated $46-million in investment funds. Staff of the Hangzhou-based apparently purchased about 25% of the stock. Tederic was established as recently as 2001, then later started Tederic Heavy Machinery in 2010. It has since become one of Chinaâ&#x20AC;&#x2122;s top manufacturers of injection machines. It makes a large number of machines and also focusses on the production of large machines, possibly to a greater extent than most of its rivals internationally. Tedericâ&#x20AC;&#x2122;s core business is the manufacture of injection moulding 40

DEC 2017 / JAN 2018

machines and its goal is to supply professional, turnkey solutions. Its range of machines includes the DT toggle structure, DH two-platen, DE all-electric, DM thinwall and fast speed and two-colour (multi-component) machine series. The company is by now involved in a wide range of market sectors, from medical and IRRGSDFNDJLQJSLSHÂżWWLQJVDXWR parts and home appliances, industrial, HOHFWURQLFVRIÂżFHDXWRPDWLRQDQG PDQ\RWKHUÂżHOGV Its machines are now operating in almost 100 countries, such has been the growth of its reputation and the high level of customer trust gained. Tederic chairman Jianguo Zheng said the company had also made outstanding contributions to promote the development of Chinaâ&#x20AC;&#x2122;s injection moulding machine industry. The company is a member of the China

Umberto Favini of Userve of Johannesburg was a guest of Tedericâ&#x20AC;&#x2122;s chairman, Jianguo â&#x20AC;&#x2DC;Terryâ&#x20AC;&#x2122; Zheng, on the occasion of the injection moulding machine manufacturerâ&#x20AC;&#x2122;s listing on the Shanghai Stock Exchange recently

Plastic Machinery Industry Association (CPMIA) and Zhejiang Machinery Industry Federation (ZMIF). Tederic was selected as a â&#x20AC;&#x2DC;Top 10â&#x20AC;&#x2122; enterprise in Chinaâ&#x20AC;&#x2122;s plastic injection moulding machinery industry for six years in a row (2011-16) and a Top 25 enterprise in Chinaâ&#x20AC;&#x2122;s plastic machinery industry, as adjudged by the CPMIA. www.userve.co.za


Plastic Machinery Injection moulding machines and ancillaries for the plastic converting industry and suppliers of and

robotics fom Italy

robots from China

Professional >> Precise>> Power-Saving >> Short Cycle >> Stable

• • • •

Toggle system injection moulding machines Clamping force 60 - 4000 ton Two-platen clamping injection moulding machines Clamping force 850 - 7000 ton

Applications Automobile parts, IT, construction industry, civilian and industrial goods, transportation and logistics, home appliances Visit us at our new showroom: Unit A6, Strydom Industrial Park, No 13 Hammer Avenue, Strydom Park. OFFICE: +27 11 791 3145 Mobile: +27 82 075 7192 Email: umberto@userve.co.za info@userve.co.za

Website: www.userve.co.za


News

Kai Mei blow moulding machine installed at PND 'HĂ&#x20AC;DVKLQJXQLWFXVWRPPRGLÂżHGE\.DL0HLWRDFFRPPRGDWH31'SURGXFWGHVLJQ NEWCOMER to the rigids plastics market in South Africa is 18-monthold PND Plastics in Pinetown which recently commissioned a Kai Mei blow moulding line from suppliers YTS (Your Technical Solution) to manufacture large HDPE containers. PND Plastics was launched in 2016 when partners Gordon Pieterse, Les Nel and Mike Datson decided it was an opportune time to break into the rigid plastics market. â&#x20AC;&#x153;Albeit in a small way - with a modest factory operation manufacturing 20L 42

and 25L containers,â&#x20AC;? explained Les Nel. Âł7KHÂżUVWWDVNRIWKHWULRZDV to choose a suitable name for the company, and yes you guessed it, PND Plastics (taken from the partnersâ&#x20AC;&#x2122; surnames) was born. We were well warned by some of the most experienced operators in the blow moulding industry, that this was not as easy as it looked, and sure enough we were very soon to pay haunting school fees,â&#x20AC;? Nel added. Some 18 months on, and the operation has really â&#x20AC;&#x2DC;come up trumpsâ&#x20AC;&#x2122;

and the companyâ&#x20AC;&#x2122;s second line, the Kai Mei PBS-905 was commissioned during the middle of this year, assisted all the way by Mark and Annette Varrie of YTSM, the Kai Mei agents in South Africa. Âł7KLVLVRXUÂżUVW.DL0HLPDFKLQH and we are very impressed with both the quality and the performance,â&#x20AC;? said Nel. â&#x20AC;&#x153;Our initial entry into the market was cautious, testing the market to VHHLIWKHUHZDVVXIÂżFLHQWVSDFHIRUDQ additional converter. Having established WKDWWKHUHZDVGHÂżQLWHO\DQRSSRUWXQLW\

DEC 2017 / JAN 2018

YOUR LOCAL EREMA CONTACT RELLOY S.A. (Pty) Ltd P.O.Box 8190, ZA-1613 Edenglen www.relloy.co.za

HIGH THROUGHPUT. WE DRIVE THE DIAMEETS ECONOMY. QUALITY. CIRCULAR

Whether it is inhouse, postconsumer or bottle recycling: you can only close loops in a precise and profitable way if machines are perfectly tuned for the respective application. Count on the number 1 technology from EREMA when doing so: over 5000 of our machines and systems produce around 14 million tonnes of high-quality pellets like this every year â&#x20AC;&#x201C; in a highly efficient and energy-saving way. Thatâ&#x20AC;&#x2122;s Careformance!

CAREFORMANCE We care about your performance.


News

PND team celebrates â&#x20AC;&#x201C; Mike Datson, Monique Datson, Les Nel and Gordon Pieterse toast the arrival of their new Kai Mei blow moulding machine

we made the decision to increase production. We then proceeded to consider a number of machinery options and settled on the decision to purchase the Kai Mei blow moulder which represented a value for money option.â&#x20AC;? The new machine runs a continuous parison and is fully automated. Nel said that aspects RIWKHGHĂ&#x20AC;DVKLQJXQLWZHUH FXVWRPPRGLÂżHGE\.DL0HLDWQR DGGLWLRQDOH[SHQVHWRDFFRPPRGDWH WKHGHVLJQXQLTXHQHVVRI31'ÂśV FRQWDLQHUV7KH.DL0HLKDVDGHVLJQ FDSDFLW\RI/FRQWDLQHUVSHU day and the performance to cost ratio LVPDUJLQDOO\LQH[FHVVRIZKLFKLV excellent. â&#x20AC;&#x153;There are very few wasted costs that FDQFRPSDUHWRÂľGRZQWLPHÂśDQGVRWR

have YTSbased very close to our factory has been DQDGYDQWDJH0DUNZDVD ÂľURFNVWDUÂśZKHQLWFDPHWR FRPPLVVLRQLQJWKHPDFKLQHDQG as usual he is readily available IRUDQ\VXSSRUWDQGWUDLQLQJ QHHGVWKDWPD\DULVH´1HO added. â&#x20AC;˘ 31'3ODVWLFVWHO DEC 2017 / JAN 2018 43

www.


News The new Leadway machine at N&L Quality Products in Port Elizabeth is ZRUNLQJĂ&#x20AC;DZOHVVO\ and quietly, with Dries Viljoen being happy with the ease with which the controls can be set, as well as its low energy consumption. The plant was supplied by Willy Nelson of OA (Omega Africa) Agencies

Leadway machine running flawlessly at N&L Low energy consumption and eased controls prove popular N & L QUALITY Products, the Port Elizabeth injection moulding company, is more than happy with the Leadway machine it installed last year, especially with its power consumption performance â&#x20AC;&#x201C; so happy in fact that it has ordered two more of the Chinese-built machines. The â&#x20AC;&#x2DC;Blazeâ&#x20AC;&#x2122; 170-ton machine, from Leadway Machine Technology of Ningo, was supplied by Willy Nelson of Omega Africa Agencies, who is also based in PE. N&L, which manufactures various technical components, is using the

PDFKLQHWRSURGXFHDVSHFLÂżFSDUWIRU automotive batteries. Asked about the machineâ&#x20AC;&#x2122;s energy HIÂżFLHQF\1 /ÂśV'ULHV9LOMRHQKDVWKLV WRVD\Âł7KHPDFKLQHXVHV.9$DQ hour, versus a standard 200-ton machine ZKLFKXVHV.9$KU$QRWKHUVLPLODU 90-ton machine would use far more power than this 170-ton machine.â&#x20AC;? 2WKHUDGYDQWDJHVIRU9LOMRHQDQGKLV team are that the machineâ&#x20AC;&#x2122;s controls, from Keba of Austria, are â&#x20AC;&#x153;very userfriendly and easy to train our staff onâ&#x20AC;?.

Willy expedited the process by training the N & L operators during the commissioning phase, towards the end of 2016. Leadway previously functioned as an OE supplier to a leading Italian machine manufacturer, before going on its own and building its own range of machines. It produces only servo-controlled machines, versus conventional direct drive technology. N & L, phone 041 453 9750 www.oa-agencies.co.za

Biggest plastics wash plant in Africa

7XIĂ&#x20AC;H[LQ*HUPLVWRQKDV installed what is almost certainly the biggest wash plant in Africa. The line, from Herbold RI*HUPDQ\FDQFOHDQ SRVWFRQVXPHUSRO\ROHÂżQ materials and process about 500 tons a month, in other words over 15 tons/ day, which is substantial. 7XIĂ&#x20AC;H[ÂśV&KDUOHV0XOOHU DQGWKHFRPSDQ\ÂśVQHZ production manager, Deon Swart, estimate the line will be operational by early December. The Herbold system involves successive washing steps along with thermal drying DQGGXVWH[WUDFWLRQEHIRUH WKHPDWHULDOLVUHH[WUXGHG into pellets

44

DEC 2017 / JAN 2018


News

SABIC introduces new resins for

LED automotive lighting

www.

marks and potentially even resulting in a part with cosmetic defects. To help the industry meet this challenge, SABIC has developed LEXAN™ HF4010SR resin which enables customers to target draft angles between 0.5 and 1.0 degrees lower than the recommended draft angle for PC tools (typically between 3 and 5 degrees). Bezels injection moulded in LEXAN HF4010SR can be directly metallized (no need for priming) and gloss and UHÀHFWLYLW\SHUIRUPDQFHXQGHUKLJK temperature environments are The bezel mould – A recent moulding both very good. Parts perform in study carried out by SABIC indicated that a bezel moulded in LEXAN™ environments requiring a maximum XHT2171, for example, could weigh 37% less than constant use temperature of up to a bezel in a rival PBT material, thanks to possible 130°C. reductions in wall thickness and the lower density A recent moulding study carried out by SABIC indicated that a bezel to 40% per bezel, by avoiding the use of moulded in LEXAN XHT2171 could complex tools, potentially enabling faster weigh 37% less than a bezel in a rival moUlding and part integration as well as PBT material. LEXAN XHT2171 resin reducing weight. can potentially enable cost savings of up

DEC 2017 / JAN 2018 45

LEXAN™ HF4010SR resin is a new offering from SABIC. This PC material makes it possible for customers to develop complex headlight bezels with enhanced aesthetics. SABIC has also added new grades to its existing LEXAN™ XHT resin line, which can RIIHULPSURYHGÀRZDWKLJKWHPSHUDWXUHV compared to other high-heat polycarbonate materials available today. Current high-end LED headlamps weigh close to 6kg with up to 200 components, thanks to the additional functionality they incorporate. Automakers are also striving to create highly distinctive lighting parts to help differentiate and increase the appeal of their vehicles. When designing injection-moulded parts, a low draft angle is important because it enables greater styling freedom as well as a larger optical surface. However, the lower this angle, the more problems arise with parts sticking in the mould, creating scuff


Polyco CEO, Mandy NaudĂŠ and Packa-Ching Project Co-ordinator, Brooke KĂźhne at the RIÂżFLDOODXQFKLQ2FWREHU

Phumeza Kalolo (2nd from left) and Elizabeth Betha (far right) from Polyco, with the group of Langa residents who help to facilitate the Packa-Ching project in Langa. From left: Songezo Matiza, Patience Majali and Qhamani Ngmalana

PACKA-CHING turning trash into cash

46 DEC 2017 / JAN 2018

*RDOLVWRGLYHUWWRQVÂśSDFNDJLQJZDVWHIURPODQGÂżOO POLYCOâ&#x20AC;&#x2122;S Packa-Ching project is changing attitudes rapidly in Langa where it has been launched as a pilot project. With the support of a core of Langa residents, training and information, the people of Langa now see that household waste has value and can be exchanged for money! 6SHDNLQJDWWKHRIÂżFLDOODXQFKRIWKH project in October, Jeremy Mackintosh, Polyco chairman, said it was an auspicious occasion. â&#x20AC;&#x153;Since its launch, Polyco has distributed over R30 million to 39 SRO\ROHÂżQUHF\FOLQJSURMHFWV3RO\FRZDV established by a group of responsible SRO\ROHÂżQSDFNDJLQJSURGXFHUVDQG was inspired by extended producer responsibility (*EPR). We believe that plastic packaging serves a key purpose in todayâ&#x20AC;&#x2122;s society, however, we also believe in doing all that we can to reduce

plastic in the environment,â&#x20AC;? he said. Polyco CEO, Mandy NaudĂŠ, said the organisationâ&#x20AC;&#x2122;s recent rebranding (note the new logo), speaks to a wider audience through three strategic pillars of action â&#x20AC;&#x201C; celebrate, collaborate, activate. Polycoâ&#x20AC;&#x2122;s purpose is to encourage more South Africans to recycle in order to divert used packaging IURPODQGÂżOO7KLVLVGHVSHUDWHO\QHHGHG when statistics show that only 5% of the population currently recycles.â&#x20AC;? â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ll be working with like-minded organisations to implement a range of solutions to bring about the required change in behaviour. Packa-Ching, one RI3RO\FRÂśVQHZHVWSURMHFWVLVDÂżUVWIRU South Africa and one which we believe can positively impact the growth of recycling,â&#x20AC;? she explained. â&#x20AC;&#x153;Packa-Ching presents an income earning opportunity, whereby everyday

South Africans are encouraged to take part in recycling in order to improve their own lives, the community as a whole and the environment in which they live,â&#x20AC;? she added. Packa-Ching Project Co-ordinator, Brooke KĂźhne, explained that by incentivising and encouraging community members to recycle and reduce waste pollution, it aims to positively change behaviour and shift the way in which people perceive recyclable packaging, to show them that packaging waste has value. 7KH3DFND&KLQJUHF\FOLQJWUDLOHU YLVLWVGHVLJQDWHGDUHDVRQVSHFLÂżF days of the week to collect recyclable plastic, paper, metal cans and glass that has been collected and separated by community members. In exchange for these materials, they are rewarded with an amount of money determined by the current market price of each PDWHULDOW\SH7KHPRQH\LVORDGHGRQWR their Kilorands Cardâ&#x201E;˘ (a special debit card) and can be spent at any shop that accepts MasterCard. â&#x20AC;&#x153;In order to ensure sustainable Langa residents are rewarded with an amount of money determined by the current market price of each material type they hand in for recycling. The money is loaded onto their Kilorands Cardâ&#x201E;˘ (a special debit card) and can be spent at any shop that accepts MasterCard


Association News

change in behaviour over the long-term, Packa-Ching also provides additional incentive to individuals by rewarding loyalty and frequency. Spot cash bonuses will be loaded onto individuals’ cards at certain milestone drop-offs. This will be funded by Packa-Ching by setting aside R1 for every kilogram of material recycled by the community (except for glass, for which the value is matched),” Kühne said. Just four days after Packa-Ching was launched in Langa in August, residents had brought in 9 tonnes of recyclable material to the Packa-Ching trailer in their area and, in exchange, received a cumulative value of R5,400.00. By the end of October 2017, this had risen to 46 tonnes, with the community receiving a cumulative value of R43 000.00. The project launch followed weeks of distributing specially designed educational material in the area and visiting primary and high schools to educate learners about the value of and opportunities offered by recycling, as well as to encourage them to take the

message home to their families. During these presentations, the children were introduced to the project mascot, Packa-Man, who taught them which materials can be recycled and how to separate them correctly. They were also given specially designed DJHVSHFL¿FHGXFDWLRQDOERRNOHWVDQG board games to get them excited about recycling. Packa-Ching aims to roll out a QDWLRQDOIRRWSULQWRYHUWKHQH[W¿YH years. *EPR = Extended Producer Responsibility (EPR) is a policy approach under which producers DUHJLYHQDVLJQL¿FDQWUHVSRQVLELOLW\ ±¿QDQFLDODQGRUSK\VLFDO±IRUWKH treatment or disposal of post-consumer products. Assigning such responsibility could in principle provide incentives to prevent wastes at the source, promote product design for the environment and support the achievement of public recycling and materials management goals.

Siseko Ntwana and Sirvaun Kickley with project mascot, Packa-Man. Children are introduced to Packa-Man who teaches them which materials can be recycled and how to separate them correctly

www.polyco.co.za www.packaching.co.za

DEC 2017 / JAN 2018 47


News

Zerma Africa keeping busy ZERMA Africa has been raising its SURÂżOHUHFHQWO\ZLWK0'-HII&DZFXWW DQGKLVWHDPH[KLELWLQJDQGYHU\YLVLEOH

DWERWK3URSDN&DSHDQGQHZSODVWLFV VKRZ&RPSODVWLQ*DXWHQJ=HUPD KDVDOVRUHFHQWO\VROGDQGLQVWDOOHGD

FRXSOHRIPDFKLQHVDURXQGWKHFRXQWU\ LQFOXGLQJDQHZEODGHVKDUSHQLQJ PDFKLQHDQGJUDQXODWRUV

Atlantic Plastic Recyclers of Cape Town recently installed a new blade sharpening machine from Zerma Africa, enabling them to sharpen multiple blades simultaneously, reducing the overall time and cost associated with this critical task and increasing the level of quality control by doing so in-house. Here is Shawn Duddy of Atlantic holding a newly sharpened granulator blade, ready to be put back to work

Another small Zerma ZBS series shredder with a big appetite for lumps. Here, Donovan Eagar of Supaplas Plastic Recyclers in Cape Town, stands with a lump of PP about to be reduced into a re-usable size. With an 11kW direct drive and aggressive tangential cutting-chamber design, the Zerma ZBS-600 makes light work of lumps and purgings, ideal for recyclers and plastics manufacturersâ&#x20AC;&#x2122; in-house lumps alike The new Zerma GSE-700/1000 granulator feels right at home at Atlantic Plastic Recyclers next to their Zerma ZXS series shredder. Equipped with a heavy-duty 5-blade rotor and third stator blade, along with full rotor and cutting-chamber wear protection, Atlanticâ&#x20AC;&#x2122;s new granulator gladly accepts a wide variety of input material at high-output rates. Fred Cheetham of Atlantic is pleased with the new member of the family

48

DEC 2017 / JAN 2018

Several new Zerma GSC-300 series soundproofed granulators were recently installed at one of the South Africaâ&#x20AC;&#x2122;s major thermoforming companies, DGGUHVVLQJWKHNH\UHTXLUHPHQWRIHIÂżFLHQWO\UHWXUQLQJVNHOHWDOZDVWHWR the production process in a closed-loop system. Zermaâ&#x20AC;&#x2122;s new roller-feeder system eliminates the need for dancing bars by employing an intelligent torque monitoring system to accurately control the speed and tension of the incoming skeletal waste, minimizing the risk of interfering with often-times sensitive thermoforming machines. The new system is simple to setup and operate, offering reliable and consistent performance and most importantly quality granulate

www.zerma.co.za


News Gersh and Jackie Kauzil of Plastemat with their new baby, the large container blow moulding machine, and the supplier of the system, Bob Austen of Charles Rust & Associates

Plastemat puts plusses together, enters EBM market Kya Sands convertor makes own tools, injection moulds too PLASTEMAT, the Johannesburg tool and die making and injection moulding business, entered new territory recently ZKHQLWFRPPLVVLRQHGLWVÂżUVWH[WUXVLRQ blow moulding machine. Established by Gersh and Jackie Kauzil in 2005, Plastemat made the move in response to the downturn in the economy of late, deciding to diversify in order to offer a more comprehensive option. They have invested in an EBM machine from Bob Austen of Charles Rust & Associates and are currently manufacturing 20 and 25-litre containers.

Plastemat has already been servicing the engineering, industrial and retail market and has the advantage that it also has the injection moulding capacity to manufacture related components, such as closures. Plastemat also has a fully equipped computerised toolroom, where it is able to manufacture and maintain all moulds in-house. The new blow moulder has allowed the Kya Sand-based company to enter a new market, and it has more projects in the pipeline for 2018 with the capability to manufacture other large hollow plastic parts and containers. The

Chinese machine has proven to be both well designed, compact and fully capable of intricate changes to manufactured parts, whilst receiving excellent backup from Bob Austen and Charles Rust. The family-owned business has grown extensively since inception and Plastemat continues to strive to provide the best possible quality and service, said Gersh. www.plastemat.co.za

Wedgies 4 wobbles Gillian & Andrew Goodchild-Brown of Plastique

PLASTIQUE, Benoni-based injection moulder, has launched an innovation that has taken the hospitality industry by storm. 50

DEC 2017 / JAN 2018

â&#x20AC;&#x2DC;Wedgies 4 Wobbblesâ&#x20AC;&#x2122; are small plastic wedges designed and PDQXIDFWXUHGWRÂżWXQGHUWDEOHOHJVWR balance unstable tables. These have

been sold extensively throughout South Africa, Namibia, and Mauritius and HYHQDVIDUDÂżHOGDV'XEDL Andrew Goodchild-Brown of Plastique says that the product has sold to some of the top hotels, including Beverley Hills, 12 Apostles, Oyster box and the Michelangelo. â&#x20AC;&#x153;We are also proud to be able to say that upmarket eateries such as Tashas, Spur Steak Ranches, Olive & Oil in KZN are using our Wedgies 4 Wobbles,â&#x20AC;? he added. â&#x20AC;&#x153;Most food and beverage managers agree that the Wedgies 4 Wobbles are a must in any restaurant or catering environment as they look so much tidier and are more effective than folded serviettes or sugar sachets, for H[DPSOHWKDWZHÂżQGDUHXVHGVRRIWHQ in restaurants,â&#x20AC;? he added. The Wedgies 4 Wobbles can also be used as door stops and can be stacked to take up any gap under a table as well as to balance stoves, refrigerators and other appliances. www.plastique.co.za


- passionate about the plastic industry.

Tel: +27 11 824 3103 - Fax: +27 11 824 6018 email: sales@sescc.co.za - www.sescc.co.za Unit 1, 16 Davidson Place, Wadeville, 1428

Supplier of:

ty t o G

Injection Moulding Machine

Servo Klockner

Rebuild

JIANGSU VICTOR MACHINERY


News

/DWHVWSODVWLFVUHF\FOLQJĂ&#x20AC;JXUHV

show more South Year-on-year increase of 5,9% SOUTH Africans are recycling more plastics than ever before. According to the results of Plastics|SAâ&#x20AC;&#x2122;s annual recycling survey for the period ending December 2016, there is a growing awareness of recycling and public pressure to recycle â&#x20AC;&#x201C; resulting in more post-consumer and post-industrial plastics being made available for reuse. â&#x20AC;&#x153;Last year, 1.144 million tons of recyclable plastic entered the waste stream, of which 41.8% was recycled, based on input tonnages. This is a year-on-year increase of 5,9%,â&#x20AC;? said Anton Hanekom, executive director of Plastics|SA, who released the latest plastics UHF\FOLQJÂżJXUHVUHFHQWO\ A growing number of organisations and consumer groups became actively involved in upstream collection efforts during the period, resulting in a positive impact on the amount of plastics collected and recycled. Recycled tonnages have grown by 35% since 2011, which is a major increase.

(

Between them, they provided formal, permanent employment to 6,140 staff and supported the informal employment of 51,500 waste pickers and collectors. For WKHÂżUVWWLPHLQPDQ\\HDUVUHF\FOHUVKDG an oversupply of recyclate in 2016. It is clear that the survival of the industry depends on creating more demand for recycled materials in order to prevent bottlenecks and stock that does not PRYHRIIWKHLUIDFWRU\Ă&#x20AC;RRUV´KHXUJHG Markets for recycled plastics The largest market (20%) for recyclate ZDVLQĂ&#x20AC;H[LEOHSDFNDJLQJ  ZLWK PE-LD/LLD and PE-HD sold to refuse and carrier bag manufacturers. Following closely in second position (18%) was the market for clothing and footwear where products such as rPET were turned LQWRÂżEUHDSSOLFDWLRQV DQGĂ&#x20AC;H[LEOH39&IRU shoe soles and gumboots. Recycled rigid packaging applications made up 15% of the market, where plastics were recycled into items such as drums and buckets made from recycled PE-HD and PP as well as rPET for thermoformed sheet applications. PE-LD/LLD recyclate used for irrigation pipes for the agricultural sector used 5% of the material and the furniture sector, where recycled PP is used in injection moulded chairs and tables and rPS in picture frames, made up a further 5%.

)

52

DEC 2017 / JAN 2018

We cannot afford to ease up on our recycling efforts

Industry takes strain â&#x20AC;&#x153;The increase in recycling that was recorded was not as a result of increased plastic products that entered the market. In fact, 1.518 million tons of virgin polymer was converted into products in South Africa during this period â&#x20AC;&#x201C; a mere 1.9% increase compared to 2015,â&#x20AC;? Hanekom said. He added that plastics manufacturing and recycling industries in South Africa and around the world have been taking strain over the past two years and that more end-market applications needed to be developed as a matter of urgency to ensure take-off for recycled materials. â&#x20AC;&#x153;Towards the end of 2016, South Africa had 204 active recyclers who mechanically reprocessed plastics materials such as plastic packaging.

Developing export markets â&#x20AC;&#x153;While weak domestic currency favours the exportation of recycled material, only

5% of South Africaâ&#x20AC;&#x2122;s plastic recyclate was exported. SAPRO is currently also investigating possible cooperation with virgin raw material traders who have a footprint in other African countries and elsewhere in the world, as developing this PDUNHWZRXOGEHEHQHÂżFLDOWRERWKWKH recycling industry and the virgin traders,â&#x20AC;? said Rudi Johannes of SAPRO. South Africa currently makes use of only mechanical recycling, as no other commercial facilities currently exist for alternative plastics recycling methods. &RPSDUHGWR(XURSHÂśVPHFKDQLFDO recycling rate of 29.7%, South Africa can indeed be proud of its recycling rate of 41.8% for all plastics. 3ODVWLFV_6$KDVLGHQWLÂżHGWKH following priorities to drive the industryâ&#x20AC;&#x2122;s recycling efforts: â&#x20AC;˘ Separation at source is essential. Local government and NGOâ&#x20AC;&#x2122;s need to make it as effortless as possible for the householder to get rid of recyclables in the format that is acceptable to the collectors and waste management companies; â&#x20AC;˘ One-way packaging must be designed for recycling. In a country where there is a vibrant mechanical recycling industry, recyclability must form part of the brand owner product design checklist; â&#x20AC;˘ Closer cooperation between role players. Waste producers, recyclers and brand owners need to work closer together with regards to understanding which packaging can be recycled or not, how to meet the needs and demands of brand owners and getting all the parties concerned to commit to a circular economy;

Tonnages recycled into raw material â&#x20AC;&#x201C; In 2016, 1,14 million tons of recyclable plastic material entered the waste stream in South Africa, of which 41,8% was recycled, based on input tonnages. This is a year-on-year increase of 5,9 percent


News

fricasnrecylcin g •

DEC 2017 / JAN 2018 53

Greater awareness of recycling through education. Better knowledge and improved understanding are required about what products can or cannot be recycled, how the collection and recycling process works and the type of end-products that are generated. “Plastics recycling does, and will continue to, offer sustainable solutions for plastics waste. Whilst we are working tirelessly to satisfy the legislative requirements and zero waste ambitions aimed at reducing our carbon footprint, we also need to invest in development and innovation if we are to have plastics manufacturing and recycling industries that are sound and robust. All the members of the plastics value chain must engage with each other and commit to a true circular economy where the need for sustainable business practices are not ignored,” Hanekom concluded. Markets for recycled plastics

www.plasticsinfo.co.za


News The purchase of Wire 4 Signs gives Perspex more access to the LED lighting market

New Wired 4 Signs acquisition lights the way forward for Perspex SA Opportunity to lighten up with LED solution PERSPEX South Africa has acquired leading lighting business Wired 4 Signs, a manufacturer of LED lighting SUR¿OHVDQGÃ&#x20AC;H[LEOHVWULSV Wired 4 Signs, trading as W4S Enterprises, has been supplying LED VROXWLRQVWRWKHVLJQDJHVKRS¿WWLQJ architectural, marine, refrigeration, lighting and related sectors since it was HVWDEOLVKHGLQ 3HUVSH[6$¶VGHFLVLRQWRSXUFKDVH :LUHG6LJQVZDVODUJHO\LQÃ&#x20AC;XHQFHG by their desire to provide customers 54

with more comprehensive and innovative solutions, and it is set to further strengthen their position in the PDUNHW This new acquisition will add to the FRPSDQ\¶VH[LVWLQJSURGXFWVVXFKDV 3HUVSH[®/('6SHFWUXP3HUVSH[® cast DFU\OLFVDVZHOODVH[WUXGHGDFU\OLFV and will complement them with a wide UDQJHRI/('DQGOLJKWLQJVROXWLRQV A variety of industries, including signage, architectural and design, can look forward to the enhanced technical

DEC 2017 / JAN 2018

Proudly South African synthetic rubbers for every step of your journey www.karbochem.co.za SALES AND MARKETING

Eastgate Office Park, Ground Floor, Block A South Boulevard, Bruma 2026, South Africa

T +27 (0)11 601 1660 F +27 (0)11 616 6651 E kbcinfo@karbochem.co.za

support, more holistic offerings and improved service that will be available WKURXJKWKLVUHFHQWEXVLQHVVH[WHQVLRQ â&#x20AC;&#x153;Our passion for creativity, backed by our promise to provide solutions to our customers is evident with this DFTXLVLWLRQDQGZHDUHH[FLWHGDERXW the new opportunities it is sure to bring ZLWKLW´VDLG3HUVSH[6$0DQDJLQJ 'LUHFWRU6WXDUW+XJKHV www.wired4signs.co.za www.perspex.co.za


Polyoak signs pledge to prevent pellet loss issue of plastics in the marine environment, which includes Operation Clean Sweep, which was launched in March 2011. Stuart Allen (Polyoak Operations Manager), Jacques Lightfoot (Sustainability Manager at Plastics|SA), Jeremy Mackintosh (Group Managing Director at Polyoak Packaging group) and Rowan le Roux (Polyoak Sustainability Manager)

DEC 2017 / JAN 2018 55

POLYOAK Packaging has become part of a worldwide drive by plastics leaders to reduce the amount of plastic pellets ending up in rivers and ultimately in the ocean, by signing a SOHGJHWRSUHYHQWUHVLQSHOOHWĂ&#x20AC;DNHDQGSRZGHUORVVDVSDUW of Plastics|SAâ&#x20AC;&#x2122;s Operation Clean Sweep. Explaining the importance of making a public declaration to prevent pellet loss, Jeremy Mackintosh, Group Managing Director at Polyoak Packaging group, said: â&#x20AC;&#x153;Because 3RO\RDNXVHODUJHTXDQWLWLHVRISODVWLFSHOOHWVDQGĂ&#x20AC;DNHV on a daily basis to produce items such as plastic bottles, closures and containers, it is important that we adhere to strict environmental standards and take a leading role as a responsible producer. By signing the Operation Clean Sweep pledge, we want to highlight our commitment to making zero pellet loss a priority by ensuring that pellets are kept out of the natural environment, including waterways and oceansâ&#x20AC;?. Plastics|SA has been promoting Operation Clean Sweep to the industry, developed resource materials for its members and is in the process of developing systems aimed at containing plastics since it launched the initiative on World Oceans Day (8 June) at the uShaka Marine World in Durban earlier this year. Plastics|SA is a signatory of the Declaration of the Global Plastics Associations for Solutions on Marine Litter, a global declaration and public commitment made by the international plastics community to address the

www.

9LN5V

With 35 yearsâ&#x20AC;&#x2122; experience in supplying engineering polymers to the industry, our logistics & technical backup provide the highest level of service and support.

ABS â&#x20AC;&#x201C; Polylac MABS â&#x20AC;&#x201C; Polylac ASA â&#x20AC;&#x201C; Kibilac SAN â&#x20AC;&#x201C; Kibisan GPPS â&#x20AC;&#x201C; Taitarex / Denka / Polyrex / Supreme Q-RESIN â&#x20AC;&#x201C; Kibiton / Denka HIPS â&#x20AC;&#x201C; GPPC / Supreme EPS â&#x20AC;&#x201C; Taitacell / King Pearl  PMMA â&#x20AC;&#x201C; Acryrex SMMA â&#x20AC;&#x201C; Acrystex PC â&#x20AC;&#x201C; Wonderlite Johannesburg Jeremy Goosen (T) 011 626 1030 jeremy@rawmac.co.za

Cape Town Shanaaz Wardien (T) 021 933 331/2 shanaaz@rawmac.co.za

News

Plastics|SA rolls out Operation Clean Sweep

PC/ABS ALLOY â&#x20AC;&#x201C; Wonderloy PA 6 â&#x20AC;&#x201C; Zissloy PA 66 â&#x20AC;&#x201C; Gramid / Zissloy POM â&#x20AC;&#x201C; Kocetal PBT â&#x20AC;&#x201C; Spesin EVA â&#x20AC;&#x201C; APC SBS â&#x20AC;&#x201C; Kibiton 330,1(5$/),//Âą:RRUL&RĂ&#x20AC;HQ&DOSHW PP GLASS FILL â&#x20AC;&#x201C; Woori PE â&#x20AC;&#x201C; HDPE / LLDPE  UREA COMPOUND â&#x20AC;&#x201C; Sprea  Durban Muthu Sagree (T) 031 577 0505 sagree@rawmac.co.za

www.rawmacplastics.co.za

Port Elizabeth Delene Williams (T) 041 484 3390 glen@rawmac.co.za


News

Dow innovations that encourage SAâ&#x20AC;&#x2122;s growth

56

DEC 2017 / JAN 2018

ZZZGRZGXSRQWFRP

0D[LPLVHUHVRXUFHHIÂżFLHQF\LQĂ&#x20AC;XHQFHSDFNDJLQJFRVWV HQKDQFLQJUHF\FODELOLW\ THE packaging team from Dow Packaging and Specialty Plastics, a business unit of DowDuPont Materials 6FLHQFHGLYLVLRQPHWLQ2FWREHUZLWKLWV NH\YDOXHFKDLQSDUWQHUVDQGFXVWRPHUV WRKLJKOLJKWLQQRYDWLRQVIRFXVHGRQ making the African region safer, healthier, cleaner and more sustainable. â&#x20AC;&#x153;Dow is focusing on Africaâ&#x20AC;&#x2122;s GHYHORSPHQWE\GHYHORSLQJLQQRYDWLYH and sustainable solutions within key VHFWRUVWKDWDUHFULWLFDOGULYHUVRIJURZWK DQGSURVSHULW\´H[SODLQHG-DYLHU &RQVWDQWH'RZÂśVFRPPHUFLDOYLFH president for Packaging & Specialty 3ODVWLFVLQWKH(0($,UHJLRQÂł+RZHYHU LQRUGHUWRGRWKLVHIIHFWLYHO\LWLVYLWDOWKDW we work with our strategic partners to WDNHWKHVHLQQRYDWLRQVHYHQIXUWKHU´ â&#x20AC;&#x153;Flexible plastic packaging plays a VLJQLÂżFDQWUROHLQVSXUULQJHFRQRPLF GHYHORSPHQWDQGVXSSRUWLQJDPRUH VXVWDLQDEOHZRUOG7ZRRI'RZÂśVLQLWLDWLYHV )UHVKWR7DEOHDQG0RYHLW6DIHO\IRFXVRQ

how sustainable packaging can protect IRRGLQWUDQVLWDQGRQVWRUHVKHOYHV guarding against contaminates and VHDOLQJLQIUHVKQHVV´VDLG&RQVWDQWH

6DPHK$WWDODK 6DOHV'LUHFWRU0LGGOH(DVW

%DUULHUDGKHVLYHIRUĂ&#x20AC;H[LEOH $IULFDDQG7XUNH\ DQG$OHVVDQGUR&RUWLFHOOL 'RZ 6XVWDLQDELOLW\/HDGHU0LGGOH(DVW$IULFDDQG packaging 7XUNH\ VD\WKDW'RZLVFROODERUDWLQJZLWKVHYHUDO 2QHRI'RZÂśVODWHVWLQQRYDWLRQV FRPPXQLW\OHGSURMHFWVLQ6RXWK$IULFDDVZHOO KLJKOLJKWHGDWWKHFXVWRPHUHYHQW DV3ODVWLFV_6$WRSURPRWH]HURSODVWLFVZDVWHWR ZDVLWVJURXQGEUHDNLQJ$'&27(Â&#x152; ODQGÂżOOÂł7KHFKDOOHQJHLVWRPDNHUHF\FOLQJDQ LQKHUHQWDWWULEXWHDQG'RZLVKHOSLQJE\DFWLQJDVDQ /EDUULHUDGKHVLYHIRUĂ&#x20AC;H[LEOH HQDEOHU´VDLG&RUWLFHOOL packaging. This product helps WRPD[LPLVHUHVRXUFHHIÂżFLHQF\ For plastic packaging, this means IDYRXUDEO\LQĂ&#x20AC;XHQFHSDFNDJLQJFRVW PDWHULDOVFDQEHFROOHFWHGYLDWKHFXUUHQW HQKDQFHUHF\FODELOLW\DQGRSWLPL]HWKH collection infrastructure and all materials VKHOIOLIHRIIRRGSDFNDJLQJ that are suitable for mechanical recycling ,Q'RZDQQRXQFHGDVWUDWHJLF VHWRIFRPPLWPHQWVGHVLJQHGWRUHGHÂżQH are turned into plastic pellets for making new plastic articles. Items that arenâ&#x20AC;&#x2122;t the role of business in society, to be UHF\FOHGLQWRSHOOHWVDUHFRQYHUWHG DFKLHYHGE\7KLVLQFOXGHVD into chemical feedstock or used as an FRPPLWPHQWWRDGYDQFHWKHZRUOGÂśV energy resource. Dowâ&#x20AC;&#x2122;s Energy Bag Pilot transition to a circular economy, where UHVRXUFHHIÂżFLHQF\LVGUDVWLFDOO\ Program illustrates that it is possible to LPSURYHGDQGZDVWHLVGHVLJQHGDQG GLYHUWQRQUHF\FOHGSODVWLFVIURPODQGÂżOOV UHF\FOHGLQWRQHZSURGXFWVDQGVHUYLFHV DQGFRQYHUWWKHPLQWRHQHUJ\

'RZODXQFKHV3URMHFW%XWWHUĂ \LQ6$ DOW Packaging and Specialty Plastics, in partnership with Plastics|SA and Destination Green, has launched its Project %XWWHUĂ&#x20AC;\LQLWLDWLYHZLWKDQLQWHQVLYHOLWWHUFOHDQXSRSHUDWLRQ LQ7HPELVD'RZH[HFXWLYHVDQGFXVWRPHUVUHSUHVHQWDWLYHV IURPWKH'HSDUWPHQWVRI(QYLURQPHQWDO$IIDLUVDQG:DWHU and Sanitation, as well as learners from Mashemong Primary 6FKRRODQG7HPELVDUHVLGHQWVDOOSDUWLFLSDWHGLQWKHFOHDQXS Âł$VDSODVWLFVPDQXIDFWXUHU'RZEHOLHYHVWKDWOLWWHUHGSODVWLFV DQGPDWHULDOVRIDQ\NLQGGRQRWEHORQJLQWKHHQYLURQPHQW +RZHYHUHYHU\GD\SODVWLFVFDQSRVLWLYHO\FRQWULEXWHWR HQYLURQPHQWDOVXVWDLQDELOLW\E\HQDEOLQJXVWRUHGXFHUHXVH UHF\FOHDQGUHFRYHUPRUHRIWKHUHVRXUFHVWKDWZHUHO\RQ â&#x20AC;&#x201C; and by helping to lower energy use and greenhouse gas HPLVVLRQV(YHQDIWHUSODVWLFVKDYHIXOÂżOOHGWKHLULQLWLDOSXUSRVH WKHVHPDWHULDOVVKRXOGEHWUHDWHGDVYDOXDEOHUHVRXUFHVDQG UHF\FOHGZKHQHYHUSRVVLEOHRUUHFRYHUHGIRUWKHLUHQHUJ\ YDOXHZKHQWKH\FDQQRW´VDLG-DYLHU&RQVWDQWH&RPPHUFLDO Vice President Packaging & Specialty Plastics EMEA at Dow.

A good start to addressing South Africaâ&#x20AC;&#x2122;s litter problem is educating young people on recycling and reusing plastic, ZKLFKLVRQHRIWKHSULPDU\DLPVRI3URMHFW%XWWHUĂ&#x20AC;\7KH ODXQFKHYHQWLQFOXGHGDSUHVHQWDWLRQE\$TXD$PD]LQJDQ RUJDQL]DWLRQWKDWSURYLGHVZDVWHPDQDJHPHQWHGXFDWLRQ through shark dissection, which clearly shows how inland litter ultimately impacts on the sea and marine life. 2QHRIWKHNH\SDUWQHUVLQ3URMHFW%XWWHUĂ&#x20AC;\LV3ODVWLFV_6$ Âł:HZRUNFORVHO\ZLWK'RZRQDQXPEHURILQLWLDWLYHVIRFXVHGRQ DGGUHVVLQJRXUFRXQWU\ÂśVVHULRXVOLWWHUSUREOHP3URMHFW%XWWHUĂ&#x20AC;\ LVDQH[FHOOHQWHGXFDWLRQDOLQLWLDWLYHWKDWHQVXUHVWKHOHDGHUVRI WRPRUURZDUHEHLQJWDXJKWWKHYDOXHRIRXUSODQHWÂśVUHVRXUFHV´ said Douw Steyn, Sustainability Director at Plastics|SA. $QRWKHUDVSHFWRIWKH3URMHFW%XWWHUĂ&#x20AC;\LQLWLDWLYHZDVLQVSLUHGE\ the idea that transformation is always possible, and that with support DQGLPDJLQDWLRQVRPHWKLQJRUGLQDU\GXOORUHYHQXQSOHDVDQW FDQEHWUDQVIRUPHGLQWRVRPHWKLQJEHDXWLIXODQGYDOXDEOH7KLV VXSSRUWV'RZÂśVORQJWHUPYLVLRQIRUUHVRXUFHPDQDJHPHQW ZKHUHDOOPDWHULDOVDUHUHFRYHUHGDQGSXWWREHQHÂżFLDOXVH Destination Green Recycling, a waste management organisation, PDQDJHGWKHZDVWHFROOHFWLRQDVSHFWRI3URMHFW%XWWHUĂ&#x20AC;\

([SODLQLQJZKDW3URMHFW%XWWHUĂ&#x20AC;\LVDOODERXWZHUH'RXZ6WH\Q 6XVWDLQDELOLW\'LUHFWRUDW 3ODVWLFV_6$ -XG\+LFNV 'RZ6HQLRU&RPPXQLFDWLRQ0DQDJHU DQG6WHYHQ0DEXJDQD RZQHURI$TXD$PD]LQJ


Complastâ&#x20AC;&#x2122;s launch attracts good turnout Serves as launch pad for PlastIndia in February THE Complast show at the Sandton Convention Centre in November came at a somewhat inconvenient time, around about the stage when convertors are usually under serious year-end pressure â&#x20AC;Ś but that unfortunately wasnâ&#x20AC;&#x2122;t the case this year and some of the guys had time to chat, so the show attracted quite a bit of interest. Organised by Smart Expos of Chennai, India, Complast attracted about 40 exhibitors from the subcontinent who vied for attention with the estimated 20 South African suppliers. The result: time to consult, but also to virtually marvel that India was able to muster such DODUJHFRQWLQJHQWIRUWKHÂżUVW edition of a show in Africa. Besides that, Smart Expos also heralded the PlastIndia show, due in Gugarat (7-12 February) and a cocktail event was held at WKHFORVHRIEXVLQHVVRQWKHÂżUVW day to promote the show, during ZKLFKDQLPSUHVVLYHVKRUWÂżOPRQ the Indian industry, as well as the countryâ&#x20AC;&#x2122;s economy and culture was shown, very impressive.

Toyota exits Australia TTHE closure of Toyotaâ&#x20AC;&#x2122;s manufacturing plant in Melbourne, Australia, effectively marked the end of the countryâ&#x20AC;&#x2122;s automotive manufacturing sector. About 2,700 workers were directly affected and estimates suggested that as many as 6000 could be indirectly, if the component manufacturing sector and other service suppliers are included. The plant in Altona, Victoria, had been in operation for more than half a century. Australiaâ&#x20AC;&#x2122;s automotive manufacturing sector stretched back to 1925 ZKHQ)RUGÂżUVWVHWXSDPDQXIDFWXULQJSODQW Ford shut its Australian plant last year.

+TW[M[PI^MI[Ă&#x2026;ZM\ISM[W]\ \ZIQTMZ[I\8WTaWIS Paul Ferreira of PMS was visited by Eden and Luke van AS of Golden Axe Industries

Josef Netzer of Motan Germany, JC Jonker, Vanessa James and Patrick Bracke on the Greentech stand

A QUICK-THINKING driver prevented a disaster at Polyoak in Cape Town in October DIWHUDÂżUHIURPDFXVWRPHUÂśVIDXOW\OLJKW commercial vehicle erupted and nearly spread to a bank of trailers loaded with moulded packaging goods. With very strong winds blowing across the trailer parking zone, the ÂżUHLJQLWHGWKHJRRGVRQRQHRIWKHWUDLOHUV and was spreading rapidly when the driver, returning to the Diep River plant, sprang into action. He was able to hitch up and move IRXUDGMDFHQWWUDLOHUVDVWKHÂżUHMXPSHGWRD second parked trailer. The explosion of a tyre in the inferno led people in the vicinity to even suspect a terror attack was underway. That was not the case and, fortunately for the &DSHSDFNDJLQJPDQXIDFWXUHUWKHÂżUHWRRN place outside of its main manufacturing area.

)-+1UISM[Ă&#x2026;Z[\-]ZWXM X]ZKPI[M

Deon Holtzhausen of DH Polymers visited WKHVKRZZLWK0LWKDW$NDQDQG+DQLÂż Topaloglu, representatives of DHâ&#x20AC;&#x2122;s principal Elastron of Turkey

The Favini family was out in force at Complast with â&#x20AC;&#x2DC;Donâ&#x20AC;&#x2122; Cesare Favini (second from right) there to check on the performance of son Umberto and his team

Gordon Williams, Natasha Adam and Justine van Heerden were in attendance on the MCG stand

HND Films has gone HND Films, the BOPP manufacturing plant in Krugersdorp, was closed down recently after the owners, Everest Flexibles, deemed the operation to be uncompetitive, largely due WRORZLQWHUQDWLRQDO%233ÂżOPSULFHV)RUD long time South Africaâ&#x20AC;&#x2122;s only manufacturer of ELRULHQWHGSRO\SURS\OHQHÂżOPWKHFRPSDQ\ was originally known as Trespaphan and later Treofan (part of the global Treofan group) and then, after an MBO, was rebranded FIMA in 2010 before going into business rescue in 2014. It had been operated by Everest Flexibles since May 2015. Everest, one of KZNâ&#x20AC;&#x2122;s top ÂżOPDQGEDJPDQXIDFWXULQJEXVLQHVVHV recently took the decision to exit the BOPP sector. It is presently in the process of selling the equipment, including the large BrĂźckner extruder and the property in Chamdor.

DEC 2017 / JAN 2018 57

Graham Randall of Samchem (right) with Philipp Krauss and Elham Yaou of Sojitz, a Japanese-international supply operation

AECI has purchased Schirm, a European PDQXIDFWXUHURIDJURFKHPLFDOVDQGÂżQH chemicals, for â&#x201A;Ź110,5-million. Besides Africa, AECI is already involved in SE Asia, Australia and the United States. Schirm was actually purchased from Imperial Chemical Logistics, which is a subsidiary of Imperial Holdings, the South African transport group. Schirm operates from four sites in Germany and one in the US.


News

Sareltech appointed agent for

Luigi Bandera )LHOGVHUYLFH&RLVQRZIXOO\Ă&#x20AC;HGJHGSURGXFWLRQV\VWHPVVXSSOLHU SARELTECH, the Cape Town-based ÂżHOGVHUYLFHHQJLQHHULQJEXVLQHVVLQ WKHSULQWLQJDQGSDFNDJLQJÂżHOGVKDV EHHQDSSRLQWHGDVWKH6$DJHQWIRU/XLJL %DQGHUD6S$RI,WDO\DZRUOGOHDGLQJ H[WUXVLRQPDFKLQHU\PDQXIDFWXUHU 6DUHOWHFKOHGE\6DUHO2RVWKXL]HQKDV LQIDFWEHFRPHDIXOO\Ă&#x20AC;HGJHGPDFKLQHU\ VXSSO\EXVLQHVVRYHUWKHSDVWIHZ\HDUV GXHWRWKHVXFFHVVIXOV\VWHPVVXSSRUW VHUYLFHLWÂśVEHLQJUHQGHULQJWRFRQYHUWRUV DURXQGWKHFRXQWU\8SWLOOMXVWDIHZ\HDUV DJR6DUHOWHFKÂśVPDLQDFWLYLW\ZDVWKH VXSSO\DQGLQVWDOODWLRQRIH[WUXVLRQDQG SULQWDFFHVVRULHV VXFKDVZHEJXLGLQJ SULQWLQVSHFWLRQFRURQDDQGSODVPD WUHDWPHQWDQGDQWLVWDWLFFRPSRQHQWV DPRQJRWKHUV  *URZWKDFKLHYHGLQWKHSURFHVVRSHQHG VRPHGRRUVDQGWKHFRPSDQ\KDVWDNHQ LWWRWKHQH[WOHYHOVRWRVSHDNDQGEHHQ DSSRLQWHGDVWKHORFDOUHSUHVHQWDWLYHRID QXPEHURIWRSHTXLSPHQWPDQXIDFWXUHUV LQFOXGLQJ8WHFR SULQWHUV DQG'RWHFR JUDYLPHWULFEOHQGLQJDQGIHHGLQJ ERWKRI ZKLFKDUHDOVR,WDOLDQ 58

7KLVZDVFDSSHGUHFHQWO\E\6DUHOWHFKÂśV DSSRLQWPHQWDVWKHDJHQWIRU%DQGHUDÂśV EORZQÂżOPDQGĂ&#x20AC;DWGLHH[WUXGHUV 2RVWKXL]HQZKRLVDTXDOLÂżHG LQVWUXPHQWDWLRQDQGHOHFWURQLFV WHFKQLFLDQKDVYLVLWHGWKH%DQGHUDSODQW QHDU0LODQDQGHDUOLHUWKLV\HDUYLVLWHG PDQ\RIWKH%DQGHUDXVHUVLQ6RXWK $IULFDDORQJZLWKWKH,WDOLDQFRPSDQ\ÂśV &DUOR3DWWLQLDUHDVDOHVPDQDJHU IRUEORZQÂżOP0DQ\RIWKH%DQGHUD PDFKLQHVLQ6$DUHVRPHZKDWGDWHG EXWDFFRUGLQJWR2RVWKXL]HQWKDWLVPRUH DUHVXOWRIODFNRIDFWLYHUHSUHVHQWDWLRQ WKDQWKHTXDOLW\RILWVWHFKQRORJ\ %DQGHUDLVZLGHO\UHFRJQLVHGDVRQHRI WKHWRSH[WUXGHUPDQXIDFWXUHUVLQWKH ZRUOGDQGLWVV\VWHPVRIIHUDKLJKSULFH WRSHUIRUPDQFHUDWHKHDGGHG Anti-static ,I6DUHOWHFKDSSHDUVWRKDYHV\QHUJ\ZLWK ,WDOLDQPDFKLQHPDNHUVWKLVEHLQJLWVWKLUG DJHQF\IURPWKH$SHQQLQHSHQLQVXODLWLV DOVRKDYLQJVXFFHVVZLWK)UDVHUD%ULWLVK PDQXIDFWXUHURIDQWLVWDWLFV\VWHPV

*RLQJLQWRVXPPHULQWKHVRXWKHUQ KHPLVSKHUHZLWKORQJGD\OLJKWKRXUVDQG RIWHQGU\DQGKRWFRQGLWLRQVVWDWLFOHYHOV FDQSHDNPHDQLQJWKDWSODVWLFÂżOPDQG EDJPDQXIDFWXUHUVIDFHGLIÂżFXOWVWDWLF SUREOHPV$FFRUGLQJWR6DUHOWKH)UDVHU HTXLSPHQWGRHVWKHWULFNDQGLVSURYLQJ YHU\SRSXODU$ZLGHUDQJHRIV\VWHPVLV

DEC 2017 / JAN 2018

I.P.P Inkulu Plastic Pipes

(Pty) Ltd

Quality Pipe Manufacturers of HDPE pipe Think big, â&#x20AC;&#x153;Inkuluâ&#x20AC;? is Gabriel Reddyâ&#x20AC;&#x2122;s motto, who started the new pipe manufacturing business Inkulu Plastic 3LSHVLQ+DPPDUVGDOH.=1$QGVHOOLQJLWPLQG\RX7KHÂżUVWSLSHVSURGXFHGDWKLVQHZFRPSDQ\ZHQW GLUHFWO\IURPPDFKLQHWRWKHEDFNRIWKHGHOLYHU\WUXFNÂąZLWKRXWHYHQWRXFKLQJWKHIDFWRU\Ă&#x20AC;RRU Inkulu Plastic Pipes leased a 3440m2 factory in Hammarsdale. Inkulu Plastic Pipes has not looked back since, and the machines DUHQRZUXQQLQJ7KHFRPSDQ\KDVDOVRDFTXLUHG6$%6FHUWLÂżFDWLRQ*DEULHOÂśVWKLUGPDFKLQHDUULYHGLQ$XJXVW*DEULHO believes in always making a plan and satisfying his clients and keeping them happy. His success is due to the support and the good wishes of his very loyal customers and suppliers. Products include: HDPE (High Density Polyethylene) Pipes, LDPE (Low Density Polyethylene) Pipes, PP (Polypropylene) Pipes and Fabricated Fittings

Contact us: Unit 6B Coveway Industrial Park, Hammersdale, 3700 | Tel: 031 736 1055/56 | Fax: 031 736 1054 Gabriel: 084 446 6384 | Nikieta: 083 229 7161 | Email: gabriel@inkuluplastics.co.za | www.inkuluplastics.co.za


News

BASF develops first semi-transparent polyamide ZZZEDVIFRP

7KH7HFKQRÃ&#x20AC;H[EORZQ¿OPWHFKQRORJ\ LVRQHRI%DQGHUD¶VWRSVHOOLQJV\VWHPV

www.sareltech.com

%$6)KDVQRZVXFFHHGHGLQGHYHORSLQJDVHPLFU\VWDOOLQHSRO\DPLGHWKDWDOORZVOLJKWWR SDVVWKURXJKODUJHO\XQKLQGHUHG8OWUDPLG®9LVLRQFRPELQHVYHU\KLJKOLJKWWUDQVPLVVLRQ ZLWKORZOLJKWVFDWWHULQJ7KLVPDNHVLWWKHZRUOG¶V¿UVWVHPLFU\VWDOOLQHSRO\DPLGHIRUVHPL WUDQVSDUHQWRUWUDQVSDUHQWFRPSRQHQWVLQFKHPLFDOO\FKDOOHQJLQJHQYLURQPHQWV0RUHRYHU WKHXQLTXHSRO\DPLGHLV89DQGWHPSHUDWXUHUHVLVWDQWVFUDWFKSURRIDVZHOODVVXLWDEOHIRU Ã&#x20AC;DPHUHWDUGDQWUHTXLUHPHQWV8OWUDPLG®9LVLRQUHFRPPHQGVLWVHOIHVSHFLDOO\IRUSDUWVIRU YLVXDOFKHFNLOOXPLQDWLRQRUOLJKWGHVLJQ

DEC 2017 / JAN 2018 59

available from Fraser, notably for uses VXFKDVODEHODSSOLFDWLRQDQG¿OP winding. Fraser also supplies systems for static generation, which is necessary in applications where adhesion is required.


PISA

Anton Hanekom of PlasticsSA and Dr Ray Patel, chairman of the MERSETA, gave keynote addresses

Big Five winner â&#x20AC;&#x201C; Conference organiser Bob Bond received the â&#x20AC;&#x2DC;Big Five of Additive Manufacturingâ&#x20AC;&#x2122; award from Prof Oliver Damm of the Fraunhofer Institute of Germany

Industry 4.0 remains elusive for all but those who comprehend digital control

60 DEC 2017 / JAN 2018

â&#x20AC;Ś and you may not need a new machine for the next job GETTING to grips with Industry 4.0 but the number of actual presentations may prove challenging for ordinary on Industry 4.0 was limited. Mind mortals, but one thing is certain: if you you, even if there was just one can combine the advantages of the comprehensive presentation it would digital capabilities of remote control have been worthwhile for delegates. and communication Such was the you will very probably case, fortunately, â&#x20AC;&#x153;The strategy is DFKLHYHPRUHHIÂżFLHQW when Prof-Dr to use the cloud to production at your Stephan Kallweit access data business. of the University With that in mind, of Aachen, in a and electronic PISA presented presentation titled systems to manage LWVÂżUVWDQQXDO â&#x20AC;&#x2DC;Mobile Robotics production.â&#x20AC;? conference in many in the Context of years at Spier near Industry 4.0â&#x20AC;&#x2122; outlined Stellenbosch in November on exactly some of the advantages that can be that topic. The event ran over two days achieved.

Surprising delegates, Kallweit kicked off by mentioning that he knew very little about Industry 4.0. â&#x20AC;&#x153;Maybe it could mean the adaption of machines with the possibility of UHFRQÂżJXUDWLRQIRUQHZDSSOLFDWLRQV"´ said Prof Kallweit, pointing out that, if that was the case, â&#x20AC;&#x153;there wouldnâ&#x20AC;&#x2122;t be a need to buy a new machine for the DSSOLFDWLRQ´ The strategy is to use the cloud to access data and electronic systems to manage production, he added. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s somewhere between robotics DQG$, DUWLÂżFLDOLQWHOOLJHQFH ,I DFKLHYHGWKHEHQHÂżWZLOOEHWKH ÂłĂ&#x20AC;H[LEOHLQWHJUDWLRQRIDVVHPEO\ SURFHGXUHV´VDLG3URI.DOOZHLW â&#x20AC;&#x2DC;Map to a Millionâ&#x20AC;&#x2122; project Anton Hanekom opened the conference with a summary of the state of the South African plastics industry, highlighting some of the >>

Bob welcomed Dr Caroline Khoathane of the Tshwane University of Technology Lorika Kruger of TUT with Prof-Dr Josef Gochermann of Osnabrueck University


ELASTOMERS

PLASTICS & COMPOSITES

ACM CR EPDM Epichlorohydrin FKM HNBR HTV Silicone IR NBR NR PVC/NBR Blends SBR & BR

ABS Acetal Additives Composites CPE CSM EVA HIPS & GPPS Nylon PC PVC TPE & TPV TPU

FILLERS & ADDITIVES

AUXILIARIES & SERVICES

Aluminas Antimony Products Blowings Agents Carbon Blacks Flame Retardents Hydrocarbon Resins Magnesium Oxide Masterbatches MC & PE Waxes Mineral Fillers Peroxides Process Aids Rubber Chemicals Silanes Silica Sulfur Zinc Oxide

Curing Bladder Machinery Other Services Release Agents Release liners Spares

ANCHOR CHEMICALS Batch Off Bonding Systems Coated Powders Factice Masterbatching Process Aids Toll Mixing


PISA

Skyland wins Western Cape golf day Sharks steal show The Skyland Masterbatch team, led by a couple of Sharks from Durban, snuk in and stole the trophy at the recent PISA Western Cape golf day, right under the noses of the guys who are supposed to know the wind better than anyone anywhere. Seen here are Billy MacMillan (left) and Nina Dimitru (right), the organisers of the event at Strand GC, and Bruce Naidoo of Skyland, Guido Fratini and Guiseppi Nusca of Odyssey Packaging and Garth Taylor, the Durban consultant.

areas of opportunity, notably the ‘Map to a Million’ jobs project. “We need to stimulate demand, local demand I mean,” said Anton, pointing out the dire need to drive capacity utilization. One of the areas where opportunities could lie, he suggested, was in the production of sports goods. At present the SA plastics industry is producing no sports goods at all. Given the exchange rate, SA-made goods could gain market.

Look at training differently Dr Ray Patel, director of the MERSETA, the industry training authority in which the plastics industry falls, gave a presentation in in which he looked at how Industry 4.0 could boost the local industry manufacturing sector. And very necessary it is. Ray acknowledged that there are shortcomings in the South African education formula. For example, the State is spending about four times more

on primary school education than India but appears to be achieving nothing like four times the outcome – if anything, the results seem to be poorer than those in India. “We need to start doing what the rest of the world is doing. We have to start looking at different demand in different areas. For example, demand in the different provinces is different.”

The event was well attended by polymer chemistry students at Stellenbosch University

The organisers of the Industry 4.0 conference included Dr SJ Jacobs, Lorika Kruger and Bob Bond, all of TUT

62 DEC 2017 / JAN 2018

The lecture theatre at the Spier conference centre was well designed; all the facilities were of a high standard


Speak to us.. We know material handling! TEL: 011 462 2990

info@demaplastech.co.za

www.demaplastech.co.za


Design

Bioplastics )LYH¿QDOLVWVZLOOEDWWOHLWRXWIRUWKHµ2VFDU¶ THE 12th annual Bioplastics Award has narrowed the VHOHFWLRQGRZQWR¿YH¿QDOLVWV,QWHUQDWLRQDOWUDGHSXEOLFDWLRQ µELRSODVWLFV0$*$=,1(¶SUHVHQWVWKHµ%LRSODVWLFV2VFDU¶WR SURMHFWVWKDWVKRZLQQRYDWLRQVXFFHVVDQGDFKLHYHPHQWV E\PDQXIDFWXUHUVSURFHVVRUVEUDQGRZQHUVRUXVHUVRI ELRSODVWLFPDWHULDOV

TU/e Technische Universiteit Eindhoven (The Netherlands)

Fully biobased pedestrian bridge $IXOO\ELREDVHGSHGHVWULDQEULGJHWKH¿UVWLQWKHZRUOGKDVEHHQUHDOLVHG DWWKH78HFDPSXV(LQGKRYHQ1HWKHUODQGVVSDQQLQJWKHULYHU'RPPHO $IWHUUHVHDUFKLQJDQGWHVWLQJYDULRXVELREDVHGPDWHULDOSURSHUWLHVDQG RSWLPLVLQJDOWHUQDWLYHVWUXFWXUDOGHVLJQVWKHEULGJHKDVEHHQSURGXFHG ZLWKWKHKHOSRIVWXGHQWVLQDOOVWDJHVRIGHVLJQDQGSURGXFWLRQXVLQJRQO\ ELREDVHGPDWHULDOV)OD[DQGKHPS¿EUHVSURYLGHWKHVWUHQJWKFRPELQHG LQDELREDVHGHSR[\UHVLQDURXQGDQLQWHUQDOFRUHRI3/$ELRIRDP7KH 3/$IRDPLVXVHGDVORVWIRUPZRUNIRUWKHVWUXFWXUDOELREDVHGFRPSRVLWH VNLQ$VWKHZKROHEULGJHZDVWUDQVSRUWHGWRLWV¿QDOORFDWLRQDQGSXWLQ SODFHLQRQHSLHFHOLJKWZHLJKWLQJZDVDYHU\LPSRUWDQWLVVXH $IWHUDVXFFHVVIXOORDGWHVWIRUWKHEXLOGLQJLQVSHFWLRQRIWKHFLW\RI (LQGKRYHQ N1P2 WKHEULGJHZDVLQVWDOOHGLQWKH'XWFK'HVLJQZHHN GXULQJ2FWREHU7KHSURMHFWLVWKHUHVXOWRIDUHVHDUFKFROODERUDWLRQ RIWKHXQLYHUVLWLHVLQ(LQGKRYHQDQG'HOIWDVZHOODVWKH&HQWUHIRU %LREDVHG(FRQRP\DQGWKHFRPSDQ\1363EY8VLQJKLJKWHFKJODVV VHQVRUWHFKQRORJ\WKHEULGJHLVPRQLWRUHGGXULQJXVH www.tue.nl

Biobrush (Germany)

64 DEC 2017 / JAN 2018

Bioplastic toothbrush made of wood scraps %LREUXVKWXUQVZRRGVFUDSVLQWRWRRWKEUXVKHV 7KHKDQGOHDVZHOODVWKHSDFNDJLQJDUH PDGHIURPELRSODVWLFVEDVHGRQFHOOXORVH PDGHIURPZRRGZDVWHIURPVXVWDLQDEOH IRUHVWU\7KHEULVWOHVDUHPDGHRI UHQHZDEOHSRO\DPLGHDQGWKHPDLQFRPSRQHQW LVFDVWRURLOZLWKRXWKDUPIXOHPROOLHQWV7KH PDQXIDFWXULQJRIWKHFRORXUPDVWHUEDWFKHVLV DGDSWHGWRWKHELRSODVWLFDQGFRQWDLQVFDUHIXOO\ VHOHFWHGSLJPHQWVLQZKLFKWKHFRQFHQWUDWLRQRI KHDY\PHWDOLVZD\EHORZWKUHVKROGYDOXH www.biobrush-berlin.com


Awards 2017 MAIP (Italy)

I am NATURE: WKHÃ&#x20AC;UVW%LR 7HFKQRSRO\PHU

www.maipsrl.com

)ROGDEOH UHXVDEOH LQVXODWLQJ ER[ Since commercial production of expandable polystyrene in 1952, the industry worldwide has been attempting to mould a durable, living hinge in particle foam. ICEEâ&#x20AC;&#x2122;s patented innovation means insulated boxes are no longer disadvantaged by their bulk as they can now be HFRQRPLFDOO\VWRUHGDQGWUDQVSRUWHGÃ&#x20AC;DWPDNLQJWKHP easy to return for reuse or recycling. ICEE has successfully moulded a living hinge in various particle foams, including BASFâ&#x20AC;&#x2122;s ecovio®, a plant based compostable biofoam. The superior insulating and cushioning properties of particle foam makes them ideal for the expanding ecommerce grocery market, paddock to plate and the traditional markets such as pharmaceuticals, fresh produce and seafood. ,&((¶VIROGÃ&#x20AC;DWLQVXODWHGER[HVDUHDLU recyclable and now available in compostable plant based biofoam. Theyâ&#x20AC;&#x2122;re able to deliver perishables in unrefrigerated vehicles making the boxes ideal for disruptive delivery options such as Uber, bicycles, couriers, taxi apps, drones etc further adding to their attractive eco-friendly footprint. www.iceefoldingbox.com

Adidas and Amsilk (Germany)

)XWXUHFUDIW%LRIDEULFVKRH The adidas Futurecraft Biofabric shoe features DQXSSHUPDGHIURP%LRVWHHOÂ&#x160;¿EUHD nature-based and completely biodegradable KLJKSHUIRUPDQFH¿EUHGHYHORSHGE\WKHELRWHFK company AMSilk (Planegg, Germany). The PDWHULDORIIHUVDXQLTXHFRPELQDWLRQRISURSHUWLHV WKDWDUHFUXFLDOLQSHUIRUPDQFHVXFKDVEHLQJ OLJKWHULQZHLJKWWKDQFRQYHQWLRQDOV\QWKHWLF¿EUHV as well as having the potential to be the strongest fully natural material available. %LRVWHHO¿EUHDOVRSURYLGHVDIDUPRUH sustainable offering. According to Amsilk, who have invested more than 200.000 bioengineer man KRXUVDQGNQRZKRZLQWRWKHLUSURGXFWVWKH¿EUHV www.amsilk.com

www.adidas-group.com

DUHPDGHRIQDWXUHEDVHGELRSRO\PHUV DUHYHJDQDQGELRGHJUDGDEOH%HLQJ biodegradable in a fully natural process, the %LRVWHHO¿EUHDOVRSURYLGHVDVXVWDLQDEOHRIIHULQJ This continues adidasâ&#x20AC;&#x2122; journey of sustainable innovation â&#x20AC;&#x201C; from a starting point of virgin plastics, to recycled plastics, to its partnership with Parley for the Oceans and now a totally new frontier of investing in solutions that leverage science and nature as an integral part of innovation.

DEC 2017 / JAN 2018 65

I am NATURE is a special PHBH-based compound, available in tailor-made grades and suitable for high temperature applications. It offers a sustainable solution, preserving the technical properties of a traditional thermoplastic material. Maip has developed different bioplastics that are sold under the name of I am NATURE for several years. These PHBH-based grades are FRPSRXQGHGZLWKQDWXUDO¿OOHUVDQGDGGLWLYHV of vegetable origin as well as functional FRPSRQHQWVIRUVSHFL¿FUHTXLUHPHQWV ABB was looking for a bioplastic material that could replace technopolymers such as ABS or PC/ ABS for switch covers. In a joint development, ABB and Maip succeeded in creating a special I am NATURE grade that is suitable IRUWKHPXOWLSOHUHTXLUHPHQWVRIWKH component. The new compound exhibits particular properties such as high dimensional stability, thermal resistance (about 130°C), superior UV and light resistance, easy colourability and easy mouldability in multi cavity moulds.

ICEE Containers (Australia)


Equipment Gravi-Dryers from Labotek

Reduce

energy consumption to absolute minimum with Labotek FOUNDED in 1943, Labotek A/S has been a pioneer of high quality, cutting-edge solutions to the plastic industry since its inception. Today Labotek A/S is a leading provider of ancillary equipment, developed on the basis of the newest technologies and designed to reduce energy consumption to the absolute minimum. Labotek supplies equipment designed for drying, WUDQVSRUWGRVDJHDQGVWRUDJHRIIUHHĂ&#x20AC;RZLQJSODVWLF granules and powdered materials. The company is 100% 66

Danish owned, with its headquarters in Frederikssund, Denmark. Labotek is member of the Labotek group placed in Scandinavia, Germany and India, and have a worldwide distribution network of more than 50 dealers and agents. In South Africa and sub-Saharan Africa, Labotek is represented by FdB Consulting, providing a wide range of expertise and know-how. â&#x20AC;˘ Contact Frank Blues at +27 (0)82 651 3315 or frank@fdbconsulting.co.za

DEC 2017 / JAN 2018

Rapid Granulator Appoints New Distributor for South Africa Effective from December 15th 2016, Rapid Granulator AB, the Swedish-based world leader in plastics granulation technology, has signed up FdB Consulting, Johannesburg, as its sole distributors for the South Africa and SubSahara Market

Regrind Material Bin Bulk Bag Discharge Station with 2 Ton Elec Hoist

Representative in Africa

CONSULTING Frank Blues Engineering Design High value processing of films fibers in-house production scarp and wasted post consumer waste. For materials: PE, PP, PS, PPS

+27 (0)82-651 3315 frank@fdbconsulting.co.za

We are the recently appointed Agents for Labotek Material feeding and Drying systems


Middle East

The world around Saudi Arabia is changing. Weak oil prices necessitate new revenue streams. Saudi women can get behind the wheel and drive, but Crown Prince Mohammed bin Salman still has his work cut out for him. Unveiled at the Future Investment Initiative conference in Riyadh, NEOM is a proposed 26 000km2 business and industrial zone in northwest Saudi Arabia meant to attract domestic and international investment

Saudi Arabia drives forward reforms under Vision 2030 programme

68 DEC 2017 / JAN 2018

For polymer converters the changes are both welcomed and feared

IN October 2015, Sophie was awarded Saudi Arabian citizenship. This event didnâ&#x20AC;&#x2122;t get the same level of international attention as the announcement earlier this year that the Saudi law is to be changed to allow women to drive, or the news that eight princes and numerous formerMinisters and businessmen had been arrested for â&#x20AC;&#x153;corruptionâ&#x20AC;?. But it is, perhaps, HYHQPRUHVLJQLÂżFDQWEHFDXVH6DXGL Arabian citizenship is usually reserved for the children of Saudi men. Having a Saudi mother and foreign father doesnâ&#x20AC;&#x2122;t allow for citizenship. Being resident doesnâ&#x20AC;&#x2122;t provide a path to citizenship (unless the king decides to reward you for some service to the country). Even being born in Saudi Arabia of parents born in Saudi Arabia (but not Saudi citizens) doesnâ&#x20AC;&#x2122;t confer citizenship. But Sophie, who is a robot, is now a Saudi citizen. Saudi Arabia is undergoing a lot of changes as the young Crown Prince Mohammed bin Salman drives forward UHIRUPVXQGHUKLVĂ&#x20AC;DJVKLS9LVLRQ programme. Some of these changes may be cynically viewed as a power grab, such as the consolidation of powerful Ministries under the Crown Prince, but many of these initiatives are important (such as GLYHUVLÂżFDWLRQRIWKHHFRQRP\IURPLWV dependence on oil), challenging (such as reducing unemployment) and ambitious (such as the $500 billion Neom Special Economic Zone which will be 26 000 square kilometres â&#x20AC;&#x201C; about the size of Israel â&#x20AC;&#x201C; focusing on technologies important to the future of human civilization). Neom

will rely on sustainable energy and will be developed to, in the words of Prince Mohammed â&#x20AC;&#x153;allow for a new way of life to emerge that considers the ambitions and outlooks of humankind, paired with best future technologies and outstanding economic prospects. Repetitive and arduous tasks will be fully automated and handled by robots, which may exceed the populationâ&#x20AC;?. Ambitious. And Sophie got citizenship. For polymer converters the changes are both welcomed and feared. For most Saudi converters their market is regional, they sell their products within an area deÂżQHGE\WKHLUDELOLW\WRFRPSHWHRQSULFH More distant markets are more expensive to service, even if only because of transport costs. And so, any developments in Saudi Arabia that creates jobs, stimulates the economy or invests in infrastructure ZLOOEHQHÂżWORFDOFRQYHUWHUV More challenging for converters is the availability of skills. Saudi Arabia relies on foreign skills â&#x20AC;&#x201C; more than half the workforce is foreign (while this seems unbelievably high it is important to also bear in mind that more than 26% of the Saudi population are under 14 years old) â&#x20AC;&#x201C; and while programmes to reduce the dependency of the country on ex-pat workers are largely welcomed, the challenges relate to how â&#x20AC;&#x2DC;Saudizationâ&#x20AC;&#x2122; is implemented, and how fast. Unemployment in Saudi Arabia presentO\VWDQGVDW7KH9LVLRQWDUJHW is to reduce unemployment among Saudis to under 9% by 2020 â&#x20AC;&#x201C; a challenge made

PRUHGLIÂżFXOWE\WKHQXPEHURI6DXGLVWKDW will enter the workforce. To achieve this goal they will need to create an additional 800 000 jobs in the next three years. Since 2011 companies were required to have a certain percentage of their workforce made up of Saudi nationals. This system seemed to work well even if it couldnâ&#x20AC;&#x2122;t keep up with the number of new jobs required. In 2015 the law was amended, one of the changes was that certain job categories were reserved for Saudis. The lists of reserved jobs have continued to grow, bringing with it challenges for certain sectors. The latest challenge for plastic converters is that from 1 January 2018 they can only employ foreign engiQHHUVZLWKPRUHWKDQÂżYH\HDUVÂśUHOHYDQW experience. Converters question whether there are enough unemployed Saudi engineers available â&#x20AC;&#x201C; if not there will be a skills shortage in the industry. There is a real danger that foreign skilled workers may voluntarily leave Saudi Arabia faster than Saudis can replace them. Saudi Arabia is at a key junction â&#x20AC;&#x201C; if these changes can be successfully implemented and build on the strong petrochemical industry, it could become very competitive and be structurally more sustainable without a dependence on forHLJQVNLOOV%XWLILWFDQQRWEXLOGVXIÂżFLHQW Saudi skills as fast as foreign skills are excluded, the polymer converting industry could collapse, or relocate to a neighbouring country. Or the success of Saudization might just have to rely on Sophie.


PEOPLE

Stellenbosch polymer science postgrad

shines on international stage NONKULULEKO Radebe, an MSc student in polymer science at Stellenbosch University (SU), was awarded the prestigious Borealis Poster Award at an international conference on polymer analysis and characterization (ISPAC 2017) in Linz, Austria, recently. Prof Peter Mallon, head of the Department of Chemistry and Polymer Science at SU, says this is an outstanding achievement and shows that the departmentâ&#x20AC;&#x2122;s postgraduate students can compete with the best in the world. The International Symposium on Polymer Analysis and Characterisation (ISPAC) is an international forum for the presentation of cutting-edge WHFKQRORJLHVLQWKHÂżHOGRISRO\PHU analysis and characterization. For her MSc project, Radebe combined two highly specialized WHFKQLTXHVQDPHO\WKHUPDOÂżHOGĂ&#x20AC;RZ fractionation (ThFFF) and Fourier Transform infrared spectroscopy (FTIR), to determine the structural properties of complex polymers in terms of their molecular weight distribution and chemical composition distribution. She explains: â&#x20AC;&#x153;Polymeric materials are used in many industries and understanding the structural properties of these materials is imperative to the development and production of products. Furthermore, the data can be used for quality control purposes, comparison of supplier materials and design of production lines. The abovementioned techniques are also used to characterize unknown materials and

Nonkululeko Radebe received the award at the event in Austria recently

polymer mixtures.â&#x20AC;? The title of her poster was â&#x20AC;&#x2DC;Multidimensional analysis of polymers XVLQJWKHUPDOÂżHOGĂ&#x20AC;RZIUDFWLRQDWLRQDQG Fourier Transform infrared spectroscopyâ&#x20AC;&#x2122;. After matriculating in 2011, Radebe applied at several universities for programmes ranging from law to accounting and engineering. When she was accepted for a BSc in Chemistry and Polymer Science at SU, she had no idea what polymer science was, â&#x20AC;&#x153;but it sounded like something cool to say I was studying!â&#x20AC;? By her third year of study, she developed an interest in polymer science. In her honours year, she approached her

current study leader, Prof Harald Pasch, about the possibility of doing an MSc in his research group. â&#x20AC;&#x153;Fortunately, he had a project for me and I did not hesitate in taking the opportunity,â&#x20AC;? she continues. She plans to complete her MSc thesis by the end of the year and then to pursue D3K'LQWKHVDPHÂżHOG But she also wants to inspire young people to use science to explore the challenges facing society today: â&#x20AC;&#x153;One day I want to be in a position where I can put more effort into investing in women WRVWXG\VFLHQFHDQGLQĂ&#x20AC;XHQFHGHOLEHUDWH systematic changes that will allow racial and gender diversity in science.â&#x20AC;?

New vinyls supplier Vynco ZA starts VICTOR Boehmer has started Vynco ZA, a supplier of various vinyl materials and chemicals, in Pretoria. Vynco is the Sub-Saharan Africa agent for Inovyn, a European manufacturer of general purpose vinyls (reputed to be the leader in Europe); specialty vinyls (second in Europe); and chlorine; caustic soda; caustic potash; chloromethanes; epichlorohydrin, allyl chloride among other chemicals. Most of these materials The team at yVnco in Pretoria includes iVctor Boehmer and Rensche de iVlliers 70 DEC 2017 / JAN 2018

are destined for the wider chemicals sector. Victor previously headed up Solvay in South Africa, for 10 years, where he was involved in the sale of the European manufacturerâ&#x20AC;&#x2122;s PVC materials as well as the specialty polymer range. $OVRDWWKHQHZ9\QFRRIÂżFHLQ3UHWRULD is Rensche de Villiers, who has about 21 yearsâ&#x20AC;&#x2122; experience in material supply management and logistics. www.vyn.co.za


Book early before as m Christown! shutd


Prestigious award for SU polymer scientist 352)(6625+DUDOG3DVFKGLVWLQJXLVKHG professor and holder of the Sasol Research Chair in Analytical Polymer Science at Stellenbosch University (SU), has been awarded the 2017 Gold Medal of the South African Chemical Institute (SACI). The SACI Gold Medal is regarded as the highest recognition for outstanding contribution to research afforded by the South African chemical fraternity. 7KLVLVWKHWKLUGWLPHLQ¿YH\HDUVWKDW this prestigious award was awarded to a researcher from SUâ&#x20AC;&#x2122;s Department of Chemistry and Polymer Science. Previous ZLQQHUVZHUH3URI/HQ%DUERXU6$5&K, chair in Supramolecular Chemistry in DQG3URI%HUW.OXPSHUPDQ6$5&K, chair in Advanced Macromolecular Architectures, in 2013. Prof Pasch joined SU as the Sasol Research Chair in Analytical Polymer Science and head of the polymer science division in 2008. Since then his research group (which focus on advanced polymer

3URI+DUDOG3DVFKIURP Stellenbosch University has been awarded the 2017 Gold Medal RIWKH6RXWK$IULFDQ&KHPLFDO ,QVWLWXWH 6$&,

analysis) has developed into one of the leading international groups to do research in polymer fractionation and characterization. +LVSUHVHQWUHVHDUFKIRFXVHVRQ multi-dimensional liquid chromatography, advanced spectroscopy, development of analytical methods for nanomaterials and high-throughput experimentation. Liquid chromatography is a separation technique that is commonly used for the analysis of polymers according to their molecular size, chemical composition and molecular architecture. All physical properties of polymers, as well as the range of application of polymers (automotive, aerospace, medicine, microelectronics etc.) depend on these molecular parameters. )RUWKHFRUUHODWLRQRIPROHFXODUVWUXFWXUH and physical properties such separation techniques is indispensable. In the Pasch group different liquid chromatographic techniques are coupled to each other in multidimensional separation setups, thus, developing new analytical

BASF South Africa Top Employer for sixth consecutive year AT a gala ceremony held at the Sandton Convention Centre on 12 October, the Top Employers Institute has for the sixth FRQVHFXWLYH\HDUFHUWL¿HG%$6)6RXWK$IULFDDVRQHRIWKHWRS employers in the South Africa. The company was also placed ¿UVWLQWKH&KHPLFDOVVHFWRU$WWKHVDPHHYHQW%$6):HVW $IULFDUHFHLYHGLWVWKLUGFHUWL¿FDWLRQDV7RS(PSOR\HU1LJHULDIRU its outstanding employee offerings within the African category. The annual international research undertaken by the Top (PSOR\HUV,QVWLWXWHJOREDOO\FHUWL¿HVH[FHOOHQFHLQWKHFRQGLWLRQV that employers create for their people. Central to the Top Employers programme is that participating companies must complete a stringent research process and meet the required KLJKVWDQGDUGLQRUGHUWRDFKLHYHWKHFHUWL¿FDWLRQ %LOO\(OOLRWW (Top (PSOR\HU Country Manager: 6RXWK$IULFD  pictured with Benoit Fricard (BASF Managing 'LUHFWRU 6RXWK$IULFD  receiving the 2018 Top (PSOR\HU trophy

technologies for complex polymers. Prof Pasch also co-authored two of the most important and up-to-date textbooks in this ¿HOGQDPHO\µ0XOWLGLPHQVLRQDO +3/&RI3RO\PHUV¶ 6SULQJHU ZLWK 'U%HUQG7UDWKQLJJIURPWKH8QLYHUVLW\RI *UD]LQ$XVWULDDQGµ$GYDQFHG6HSDUDWLRQ 7HFKQLTXHVIRU3RO\ROH¿QV¶ 6SULQJHU 2014), co-authored with Prof Muhammad ,PUDN0DOLNIURPWKH8QLYHUVLW\RI.DUDFKL in Pakistan. Prof Paschâ&#x20AC;&#x2122;s total number of peerreviewed publications exceeds 300. Of these, 81 were produced between 2012 DQG+HLVIUHTXHQWO\LQYLWHGDV plenary and guest speaker to national DQGLQWHUQDWLRQDOFRQIHUHQFHV+HKDV supervised more than 50 postgraduate students both in Germany and South Africa and many of these graduates now occupy leading positions in major companies.

PlastiColors wins Astrapak award PlastiColors were proud WRUHFHLYHDFHUWL¿FDWHRI acknowledgment at the RPC Astrapak Quality Awards event held in October 2017. PlastiColors were nominated amongst eight other suppliers LQWKHLQGXVWU\IRUWKHLU innovative collaboration as well as their excellent quality, service and technical development across the RPC Astrapak Group. PlastiColors acknowledged Millikenâ&#x20AC;&#x2122;s nucleation technology and, together with Milliken, brought this technology to RPC Astrapak Group with very valuable results. Pictured with the award are Nawaaz Kalick (RPC Astrapak); Michelle Fleming (PlastiColors); Bobby Pillay (PlastiColors) and Robin Moore (RPC Astrapak)

New at Somochem 3DP0DJLOOKDVMRLQHG6RPRFKHPSDUWRIWKH 0RKLQDQLJURXSRI,QGLD3DPZKRZDVSUHYLRXVO\ ZLWK6DVROKDVÃ&#x20AC;LWWHGEHWZHHQSHULRGVRIUHWLUHPHQW RYHUWKH\HDUVEXWWKHOXUHRIWKHSRO\PHUZRUOGKDV DWWUDFWHGKHUEDFNRQDQXPEHURIRFFDVLRQV6KH joined Sasol in 1989 in Johannesburg and had a IHZ\HDUVEURNHQVHUYLFH6KHZDVVDOHVPDQDJHU IRU33LQ*DXWHQJZKHQVKHOHIWLQWKHQ re-joined Sasol in Cape Town as account manager IRUWKH&DSHUHJLRQ6KHµUHWLUHG¶LQHDUO\EXW DPD]LQJO\UHWXUQHGMRLQLQJ6RPRFKHPLQPLGµ6RPRFKHPKDVEHHQ VXSSO\LQJSRO\PHUVLQ$IULFDIRU\HDUVDQGLVQRZVXSSO\LQJLQWR6RXWK $IULFDLQFOXGLQJ+'/'OLQHDU3(73639&DQGFKHPLFDOV DEC 2017 / JAN 2018 71


People on the move Mark Smith (right) has joined Skye Plastics in Spartan, teaming up with Fred Morawitz Craig Arnold, new president for SubSaharan Africa for Dow

Mark Smith has joined Skye Plastics in Johannesburg, a short distance from his previous employer, Bowler Plastics, in Spartan where he has been appointed sales executive. Originally one of the owners of Lapack in Elandsfontein, Mark joined Bowler in 2015, where he was also sales executive. The decision to leave Bowler Plastics, one of the most successful FMCG container/solution manufacturers in Southern Africa, must have been a big one, but Mark said he completed a successful two year tenure at Bowler Plastics and had taken the decision to join Cyril and Fred at Skye Plastics with a view to â&#x20AC;&#x153;long term sustainable growthâ&#x20AC;?

72 DEC 2017 / JAN 2018

Alan Booth was earlier this year appointed as general manager at CTP )OH[LEOHVWKHSODVWLFÂżOPDQGSDSHU printing and bag-making operation in Cape Town. Alan brings extensive management expertise in the plastics manufacturing area to the Caxton group company based in Ndabeni. He has had considerable experience in various packaging companies within the former Astrapak group and well as Zibo containers. Carolyn Kellock has been appointed technical manager at PlastiColors in Johannesburg. Carolyn, who has a Bachelor of Science Chemistry Honours degree as well as a National Polymer Technology Diploma, has a wide experience across the plastics industry, IURP37)(7HĂ&#x20AC;RQWRHQJLQHHULQJSRO\PHUV DQGSRO\ROHÂżQV6KHKDVEHHQLQYROYHG in production, sales and business development and has had exposure to several processing technologies, and is excited now to be entering the masterbatch industry. The Dow Chemical Company has appointed Craig Arnold as president of Dow Sub-Saharan Africa. Prior to this role, Arnold was commercial vicepresident for Europe, Middle East, Africa

Donald Hicks has started Advanced Quality Performance Measurement

Alan Booth (right) has been appointed GM of CTP Flexibles, reporting to Leon Witbooi, MD of the Cape packaging group

Carolyn Kellock, new technical manager at PlastiColors in Johannesburg

Myles Ryan has joined West African Group

Alan Shone, new operations manager at S&N Rubber

and India for Dow Industrial Solutions, based in Switzerland. Arnold succeeds Ross McLean who has retired from the company. Arnoldâ&#x20AC;&#x2122;s career has been on an exceptional growth trajectory, which saw him being promoted to senior executive UROHVÂżUVWLQ(XURSHDQGWKHQJOREDOO\ which resulted in relocations to global and regional headquarters in the US, Middle East, Australia/New Zealand and recently Europe. Arnold has been instrumental in successfully unlocking new opportunities in emerging geographies for both new and existing customers across Dowâ&#x20AC;&#x2122;s key strategic businesses â&#x20AC;&#x201C; and value chains â&#x20AC;&#x201C; like Oil & Gas, Specialty Plastics & Elastomers and Synthetic Rubber & Elastomers. Arnold is a strong proponent of diversity and inclusion in the workforce. He is a sponsor of Dowâ&#x20AC;&#x2122;s Global Womenâ&#x20AC;&#x2122;s Innovation Network and Dowâ&#x20AC;&#x2122;s Global Disability Network. He is based in Johannesburg.

at Nampak Liquid Packaging in Circuit Road in Westmead, Durban.

Donald Hicks has retired from Nampak Liquid Packaging in Westmead â&#x20AC;Ś and started a new venture, Advanced Quality Performance Measurement. Donald spent over three decades with the Nampak group, the last few at Nampak Liquid Packaging in Westmead, servicing mainly dairy manufacturers. He developed the performance management system, named it AQPM, and has now started a business with the same name. AQPMâ&#x20AC;&#x2122;s visual management systems communicate in real time with machines and display feedback which enables operators to respond immediately, and hence maintain per shift targets. According to Donald, â&#x20AC;&#x153;Keeping score is at the heart of being in control, and productivity is driven by information.â&#x20AC;? AQPM supplies the monitoring devices and systems as well as the LED screens used for the analysis. Deon Beyers has succeeded Donald

Alan Shone has been joined S&N Rubber in Port Elizabeth where he has EHHQDSSRLQWHGSODQWRSHUDWLRQVRIÂżFHU Alan will assist Stuart Browning, owner and MD of the company, with the many facets of senior plant management. S&N Rubber, being in existence for 26 years, is a reliable supplier of custom compounds and components both for the OE and aftermarket automotive industries as well as general components for the engineering and building industries. Alan has 30 yearsâ&#x20AC;&#x2122; experience starting with tyre and then carbon black industries, the latter of which involved more than 10 years in senior management positions. Alan says heâ&#x20AC;&#x2122;s delighted to join the â&#x20AC;&#x153;dynamic S&N Rubber team and extremely excited to have the opportunity to further entrench and enhance S&N Rubberâ&#x20AC;&#x2122;s offerings to the market placeâ&#x20AC;?.

Myles Ryan has joined West African Group as manager for the companyâ&#x20AC;&#x2122;s PP/BOPP Films and Performance Polyethylene (Vistamaxx) businesses. The polypropylene business is part of a suppliersâ&#x20AC;&#x2122; agreement WAG has with Safripol, which is a change that resulted after Safripolâ&#x20AC;&#x2122;s purchase earlier this year by KAP group. The BOPP ÂżOPVDUHIURP7DJOHHIRI'XEDLZKLFK WAG has represented for a number of years, and the Vistamaxx materials are from ExxonMobil, which WAG already distributes for. Myles will look after these units nationally and will be based in Gauteng. The appointment marks a return to the industry for Myles, who was previously at Safripol, from 2007-2013; for the past four years heâ&#x20AC;&#x2122;s been with Hilti, a multi-national group that manufactures power tools and accessories for the construction industry.


People on the move Kim Arendse â&#x20AC;&#x201C; new training administrator for Eastern/ Western Cape for Plastics|SA

74 DEC 2017 / JAN 2018

Plastics|SA is proud to welcome Kim Arendse as new regional training administrator for the Western and Eastern Cape regions. Kim holds a national diploma in Human Resource Management and will be based full-time DWWKH36$RI¿FHVLQ0DLWODQG&DSH Town. 3ULRUWRMRLQLQJWKHSODVWLFVLQGXVWU\ Kim worked at Dyna Training and NQ 3OXV1HWZRUNVDWUDLQLQJSURYLGHUWKDW specialises in management training and assessments. She grew up in the Mother Cityâ&#x20AC;&#x2122;s northern suburbs. ³,¶PYHU\H[FLWHGDERXWP\QHZ FDUHHU´VD\V.LP³7KHSODVWLFVLQGXVWU\ LVTXLWHQHZIRUPHEXW,ORRNIRUZDUGWR OHDUQLQJHYHU\WKLQJ,FDQDQGDGDSWLQJWR WKHQHZFKDOOHQJHVWKDWDZDLW´ Regional training manager Isabelle Brettenny says Kim has hit the ground running since she started at PlasticsSA DQGKDVDOUHDG\SURYHQKHUVHOIWREHYHU\ helpful and a hard worker. â&#x20AC;&#x153;It will be Kimâ&#x20AC;&#x2122;s responsibility to ensure WKHVPRRWKUXQQLQJRIRXURI¿FHE\ liaising with clients who want to set WUDLQLQJGDWHVIRUWKHLUZRUNIRUFHHQVXUH the necessary paperwork is completed correctly and assist us in promoting the YDULRXVFRXUVHVWRRXUFOLHQWV´

Afsana Nundeekasen, new role at Protea

Desmond Paul and Precious Makwe have joined the 3RO\Ã&#x20AC;RU6$ team

Afsana Nundeekasen has been DSSRLQWHGLQGXVWU\PDQDJHUIRUFRDWLQJV polymers and elastomer for Protea Chemicals. Afsana has been with Protea for 11 years has recently relocated from Durban to take up the new role in Johannesburg. She looks forward to building new relationships and gaining QHZH[SHULHQFHLQWKHSODVWLFVDQGUXEEHU sector. Afsana holds a BTech Chemical Engineering degree and has recently TXDOL¿HGZLWKKHU0DVWHUVRI%XVLQHVV Administration (MBA) degree through 8QLYHUVLW\RI6WHOOHQERVFK%XVLQHVV School (USB). 3RO\Ã&#x20AC;RU6$KDVZHOFRPHGWZRQHZ sales consultants, Desmond Paul and Precious Makwe as sales consultants at LWV+HDG2I¿FHLQ(GHQYDOH(NXUKXOHQL Precious Makwe worked for Plascon SULRUWRMRLQLQJWKH3RO\Ã&#x20AC;RU6$WHDP%RUQ DQGEUHGLQ0DERSDQH3UHWRULDVKHZLOO EHIRFXVLQJKHUDWWHQWLRQRQVHUYLFLQJ the Johannesburg area. Desmond Paul LVQRVWUDQJHUWRWKHÃ&#x20AC;RRULQJLQGXVWU\ KDYLQJZRUNHGIRU%HOJRWH[)ORRULQJSULRU WRMRLQLQJWKH3RO\Ã&#x20AC;RUWHDP+HZLOOEH UHVSRQVLEOHIRUVHUYLFLQJ3RO\Ã&#x20AC;RU¶VFOLHQWV in the Pretoria area.

Bob Williamson, Executive Chairman of the South African National Tooling Initiative, was elected as new President of ISTMA World for a three-year term

Bob Williamson([HFXWLYH&KDLUPDQ of the South African National Tooling ,QLWLDWLYHZDVHOHFWHGDVQHZ3UHVLGHQW of International Special Tooling and Machining Association (ISTMA) World for a three-year term. ISTMA represents associations from 20 countries and VHUYHVDVWKHFHQWUHRIH[SHUWLVHIRUWKH worldwide special tooling and precision machining industry. Williamson was instrumental in the establishment of WKH,QWVLPEL1DWLRQDO7RROLQJ,QLWLDWLYH (NTI) in South Africa. The Intsimbi NTI DPXOWLVWDNHKROGHULQLWLDWLYHLQWURGXFHG by the Toolmaking Association of SA (TASA) and the Department of Trade and Industry (the dti) sought to not only halt the decline of the tooling sector but to embark on a robust rehabilitation programme. The NTI Pilot Programme â&#x20AC;&#x201C; 2010 to 2022 was therefore introduced to SLORWWKHDGYDQFHGPDQXIDFWXULQJVHFWRU VROXWLRQVUHTXLUHGIRUVNLOOVHQWHUSULVH GHYHORSPHQWDQGWUDQVIRUPDWLRQRIWKH local direct tooling industry. Direct tooling in South Africa represents a R15 billion market.

Farewell to Jimmy Warne of Jannock 1950-2017

Farewell to Barry Hunt 1941-2017

-,00<:DUQHRI-DQQRFN7RRO 'LHRI6LOYHU¿HOGV:HVW 5DQGSDVVHGDZD\LQ-XO\XQWLPHO\DWWKHDJHRI -LPP\ZDVERUQLQ0LGGOHVEURXJK<RUNVKLUHLQ DQGLPPLJUDWHGWR6RXWK$IULFDLQEHJLQQLQJ his career in the country as toolroom foreman at Solid +DUGZDUHJUDGXDOO\HDUQLQJWKHUHSXWDWLRQDVDQ H[FHSWLRQDOWRROPDNHU+HVWDUWHG-DQQRFN7RRO 'LHLQ PDQXIDFWXULQJSUHVVSODVWLFDQGUXEEHUWRROLQJ+LVVRQ-DPHVMRLQHG WKHFRPSDQ\DQGWRJHWKHURYHUWKH\HDUV-DQQRFN7RRO 'LHDQGWKHQ WKHVXEVLGLDU\-DQQRFN3ODVWLFVHYROYHG7KHIDFWWKDWWKHFRPSDQLHVVWDQG strong today is a tribute to a Jimmyâ&#x20AC;&#x2122;s leadership abilities. ³-LPP\ZDVDGHYRWHGGHWHUPLQHGPDQWRDOOLQEXVLQHVVIDPLO\DQG IULHQGVDQGWKLVLVVRPHWKLQJZHFDQDOODVSLUHWR2XUPHPRULHVRI-LPP\ build a strong special bridge of dedication and passion for perfection in all WKDWZHGRDQGZLOOUHPDLQSDUWRIXVDOO+HZLOOEHGHHSO\PLVVHG´VDLG James. (Jannock is a name for â&#x20AC;&#x2DC;honest manâ&#x20AC;&#x2122; in Yorkshire.)

BARRY +XQWIRXQGHURI0DWW5XEEHU 0RXOGLQJVSDVVHGDZD\RQ-XO\ after suffering an aortic aneurysm. +LVGDXJKWHU'HEELHKDVWDNHQRYHU the business. Born on 18 September LQ+LQFNOH\/HLFV(QJODQG %DUU\DUULYHGLQ6RXWK$IULFDLQ +HUDQ0DWW5XEEHU0RXOGLQJVIRU\HDUV He was married to Margeret for 52 years and had WZRFKLOGUHQ$QWKRQ\DQG'HEELHZKRVD\VKHUIDWKHU ZDVYHU\GHGLFDWHGWRKLVIDPLO\DQGZDVDOZD\V LQYROYHGLQDOOWKHLUDFWLYLWLHV³+HZDVVXFKDVSHFLDO SHUVRQZKRZDVORYHGE\DOO+HDOZD\VWKRXJKWRI other people before himself. He also had a great ORYHRIDQLPDOVDQGDVSHFLDOSDVVLRQIRUKLVEHORYHG KRUVHV´


Books M arDkUeNtHS 0 W tu E[xSpDaQn 6WdXyG:\ ( Gd olRyOs\tVyr DaEbOlHe P 3 W\eUn He QH (3

New report on EPS foam )2//2:,1*WKHWUDJLF¿UHRIWKH*UHQIHOO7RZHULQ /RQGRQWKHGLVFXVVLRQFRQFHUQLQJWKHVDIHW\RIIDFDGHV DQGLQVXODWLRQPDWHULDOLVLQFUHDVLQJO\PRUHLPSRUWDQW HVSHFLDOO\IRUPDQXIDFWXUHUVRI(36VD\V2OLYHU.XWVFK &(2RIWKHPDUNHWUHVHDUFKFRPSDQ\&HUHVDQD ([SDQGDEOHSRO\VW\UHQHLVPDLQO\XVHGE\WKH FRQVWUXFWLRQLQGXVWU\IRUWKHUPDORUVRXQGLQVXODWLRQ &HUHVDQDKDVUHOHDVHGLWVWKLUGVWXG\DQDO\VLQJWKHJOREDO PDUNHWIRUH[SDQGDEOHSRO\VW\UHQH:RUOGZLGHDERXW PLOOLRQWRQVRI(36ZHUHFRQVXPHGLQ 7KHVWXG\SURYLGHVDWKRURXJKSUHVHQWDWLRQDQGDQDO\VLV RIWKHJOREDOPDUNHWIRU(36±LQFOXGLQJIRUHFDVWVXSWR 'HYHORSPHQWRIGHPDQGUHYHQXHVDQGSURGXFWLRQ LVDQDO\]HGIRUHDFKLQGLYLGXDOUHJLRQ,WDOVRH[DPLQHV WKHPRVWLPSRUWDQWQDWLRQDO(36PDUNHWVLQGLYLGXDOO\ %HVLGHV(8VWDWHVWKH86$&KLQDDQG-DSDQWKHVH

DOVRLQFOXGH5XVVLD 0DOD\VLD7DLZDQDQG 6RXWK$IULFD 7KHVWXG\DQDO\VHV WKHDSSOLFDWLRQDUHDV± SDFNDJLQJFRQVWUXFWLRQ OHLVXUHPHGLFDOVSRUWV SURGXFWVDQGVSHFLDO DSSOLFDWLRQV,WDOVR SURYLGHVXVHIXO FRPSDQ\SUR¿OHVRI WKHODUJHVWSURGXFHUV RI(36±FOHDUO\DUUDQJHG DFFRUGLQJWRFRQWDFWGHWDLOVWXUQRYHUSUR¿W SURGXFWUDQJHSURGXFWLRQVLWHVFDSDFLWLHVDQGSUR¿OH VXPPDU\

www.ceresana.com/en/market-studies/plastics/expandable-polystyrene/

PVC â&#x20AC;&#x201C; a best seller! '(63,7(TXHVWLRQDEOHSODVWLFL]HUVSRO\YLQ\OFKORULGH 39& LVRQHRIWKHEHVWVHOOLQJW\SHVRISODVWLF3URGXFWLRQ FRQWLQXHVWRULVH,QRYHUPLOOLRQWRQVRI39&ZHUH FRQVXPHGFRUUHVSRQGLQJWRRYHURIWRWDOSODVWLFV GHPDQG 7KHPDUNHWUHVHDUFKLQVWLWXWH&HUHVDQDKDVSXEOLVKHG WKHIRXUWKVWXG\RQWKHZRUOGPDUNHWIRU39&7KHODWHVW UHSRUWH[SHFWVJOREDO39&GHPDQGWRULVHE\RQDYHUDJH SHU\HDUXQWLO:LWKDPDUNHWVKDUHRIWKH $VLD3DFL¿FUHJLRQLVWKHPRVWLPSRUWDQWVDOHVPDUNHW 7KHVWXG\SURYLGHVDWKRURXJKSUHVHQWDWLRQDQGDQDO\VLV RIWKHPDUNHWIRU39&±LQFOXGLQJIRUHFDVWV XSWR'HPDQGGHYHORSPHQWDVZHOO y: d u t S DVUHYHQXHVDQGSURGXFWLRQYROXPHVDUH t arke l M DQDO\]HGIRUHDFKLQGLYLGXDOUHJLRQ y n Plyvi e (4 thWKHedG.)

o ,WDOVRH[DPLQHVWKHODUJHVW d Chlori FRXQWULHVRIWKHPDUNHWLQPRUHGHWDLO 'DWDRQGHPDQGUHYHQXHVWUDGH SURGXFWLRQDQGFDSDFLW\DUHSURYLGHG IRUHDFKFRXQWU\7KHGHPDQGIRUHDFK DSSOLFDWLRQSURGXFWW\SH Ã&#x20AC;H[LEOH ULJLG39& DQGVHJPHQW SDFNDJLQJ FRQVWUXFWLRQWUDQVSRUWDWLRQHOHFWULFV HOHFWURQLFVLQGXVWU\DQGRWKHUV LV DQDO\VHGDVZHOODVWKHDSSOLFDWLRQ DUHDVRI39&

6WXG\ 0DUNHW \O 3RO\YLQ H &KORULG

www.ceresana.com/en/market-studies/ plastics/polyvinyl-chloride

JEC publishes composites market overview 32/<(7+</(1(DQGSRO\SURS\OHQHFRQWLQXHWR EHWKHZRUOG¶VOHDGLQJWKHUPRSODVWLFSRO\ROH¿QVLQ WHUPVRIPDUNHWVL]H'HVSLWHRQJRLQJYRODWLOLW\DQG www.dpiplastics.co.za XQFHUWDLQW\ZRUOGZLGHWKHUHLVFOHDUO\QRGHEDWH RYHUZKHWKHULWSD\VWRLQYHVWLQSRO\ROH¿QV ,QDZKLWHSDSHU)DEUL]LR*DOLq,&,6VHQLRU FRQVXOWDQWDQGJOREDOOHDGIRUSRO\PHUVLQVLJKW SURYLGHVWKHFULWLFDOIDFWRUVWRFRQVLGHUIRU\RXU SODQQLQJ 5HIHUHQFLQJGDWDIURPWKH,&,66XSSO\DQG 'HPDQG'DWDEDVHWKHZKLWHSDSHUFRYHUV UHJLRQDOKLJKOLJKWVDQRYHUYLHZRIUHFHQWWUHQGV LQSRO\ROH¿QV 33DQG3( VXSSO\DQGGHPDQG RXWORRNHPHUJLQJFKDOOHQJHVDQGLQYHVWPHQWV DIIHFWLQJWKHPDUNHWV 7KHSDSHUHQDEOHVVXEVFULEHUVWRJDLQDORQJ WHUPYLHZRIWKHUDSLGO\FKDQJLQJSHWURFKHPLFDOV PDUNHWVRIIHULQJTXLFNDFFHVVWRGDWDRQLPSRUW DQGH[SRUWYROXPHVSODQWFDSDFLWLHVSURGXFWLRQ DQGSURGXFWWUDGHÃ&#x20AC;RZV 7KHERRNFDQEHSXUFKDVHGRQOLQHDW www.jeccomposites.com/e-store/ overview-global-composites-market

Environment: A journey on plastic seas 7KLVLVWKHVWRU\RIDYR\DJHEHDULQJ ZLWQHVVWRSODVWLFSROOXWLRQLQWKH RFHDQV-XQN5DIWLVDVWLPXODWLQJ WKRXJKWSURYRNLQJDQGIDFWXDOO\ JURXQGHGUHDG6FLHQFHHGXFDWRU DQGUHVHDUFKHU0DUFXV(ULNVHQ¶V QDYLJDWLRQDOIHDWLVJULSSLQJ± GD\VFURVVLQJVRPH 78 / JAN2017 2018 2017 76 DECâ&#x20AC;&#x2122;17 AUG / SEPT

NLORPHWUHVRIRSHQRFHDQEHWZHHQ &DOLIRUQLDDQG+DZDLLLQRQ DUDIWFUDIWHGIURPSODVWLF ERWWOHVZUDSSHGLQ¿VKLQJQHWV %XWLWLVPRUH:RYHQWKURXJKWKH FKURQLFOHDUHWZRHTXDOO\IDVFLQDWLQJ VWRU\OLQHV(ULNVHQ¶VHYROXWLRQIURP VROGLHUWRUHVHDUFKGLUHFWRURIWKH

HQYLURQPHQWDOQRQSUR¿W*\UHV ,QVWLWXWHLQ/RV$QJHOHV&DOLIRUQLD DQGWKHMRXUQH\ZHDOOQHHGWRWDNH WRZDUGVDPRUHVXVWDLQDEOHXVHRI SODVWLFV Marcus Eriksen Beacon: 2017 ISBN: 9780807056400

UGrd

HeGd .)


World News

AROUND THE WORLD

Sadara commissions last of its 26 plants SADARA Chemical Company, a joint venture between Saudi Aramco and Dow, celebrated the commissioning of the last of its 26 plants, an isocyanates section currently producing crude quantities of toluene diisocyanate (TDI) and other speciality chemicals, on 14 August. Sadara in Jubail Industrial City II, Saudi Arabia, is said to be the largest integrated chemical complex ever built in a single phase. The TDI section is mainly used in the SURGXFWLRQRIÃ&#x20AC;H[LEOH38IRDPIRU furniture, mattresses, cushioning and car seats. It consists of three integrated units producing dinitro toluene (DNT), toluene diamine (TDA), and TDI. The DNT and TDA units started operations in April and the TDI unit began crude production in August. Sadara also includes an integrated facility for polymeric methylene diphenyl diisocyanate 30', ZKLFKEHJDQSURGXFLQJ commercial quantities in June. In addition, the chemicals complex comprises a polyether polyols plant, which came on-stream in July. In total, Sadara will produce more than three million tons of plastics and speciality chemical products annually. The speciality chemicals portfolio includes facilities that manufacture propylene oxide, propylene glycol, ethylene oxide, glycol ethers, amines, isocyanates, and polyether polyols. www.dow.com www.sadara.com www.saudiaramco.com

Assocomaplast renamed in Amaplast $662&20$3/$67WKH,WDOLDQ trade association of manufacturers of plastics and rubber processing machinery and moulds, has changed its name to Amaplast. According to the association, the new name is shorter and easier to pronounce (especially for nonItalians); the name is an acronym IRU$VVRFLD]LRQH0DFFKLQH3ODVWLFD 3ODVWLFV0DFKLQHU\$VVRFLDWLRQ  The association was founded in 1960 and today represents over 160 major Italian machinery manufacturers. www.amaplast.org

80 DEC 2017 / JAN 2018

The lightweight electric car is made of resin from sugar beets and VKHHWVRIÃ&#x20AC;D[,WKDVDVLPLODUVWUHQJWK ZHLJKWUDWLRWRWKDWRI¿EUHJODVVDQG weighs only 310kg

P&G launches

bottle made from ocean plastic AT THE Our Ocean Conference 2017 in 0DOWD3URFWHU *DPEOH&RODXQFKHG WKH)DLU\2FHDQ3ODVWLFERWWOHPDGH completely from post-consumer recycled plastic and ocean plastic. The launch aims to raise awareness of the issue of ocean plastic and what can be done to prevent plastic waste from reaching the ocean. 7KH¿UVWHYHU)DLU\2FHDQ3ODVWLF%RWWOH has been created in partnership with recycling expert TerraCycle and will reach %ULWLVKFRQVXPHUVLQ7KH8.ODXQFK will include 320,000 bottles, the largest production run of recyclable dish soap bottles in the world made using ocean plastic. The innovative bottle will be made from 10% ocean plastic, collected from the ocean and beaches around the world, and

P&G Fairy bottle made of 100 percent recycled and ocean plastic

90% post-consumer plastic. $FFRUGLQJWRWKH(OOHQ0DF$UWKXU )RXQGDWLRQ (0) RIWKHYDOXHRI SODVWLFSDFNDJLQJPDWHULDOZRUWK billion to $120 billion annually, is lost to the economy and on the current track, WKHUHFRXOGEHPRUHSODVWLFWKDQ¿VKLQWKH RFHDQ E\ZHLJKW E\ 7RGLYHUWSODVWLFZDVWHIURPODQG¿OODQG WKHRFHDQ3 *EUDQGVLQFOXGLQJ)DLU\ Dawn, Yes, Dreft and Joy will continue to GLYHUWPHWULFWRQQHVRISODVWLFIURP ODQG¿OOIRUXVHLQWUDQVSDUHQWSODVWLFERWWOHV using an average of 40% percent postconsumer recycled plastic content across PLOOLRQWUDQVSDUHQWGLVKFDUHERWWOHV globally. If stacked, these bottles would be WLPHVWKHKHLJKWRI0RXQW(YHUHVW

ZZZEDVIFRP


World News

Biodegradable car! Next step in environmentally-friendly motoring WHATâ&#x20AC;&#x2122;S made of sugar, can carry four people and travel at 80 km per hour? A biodegradable car, whose inventors say, could be the next step in environmentally friendly motoring. The lightweight electric car, created by students in the Netherlands, is made of a resin derived from sugar beets and FRYHUHGZLWKVKHHWVRI'XWFKJURZQĂ&#x20AC;D[ â&#x20AC;&#x153;Only the wheels and suspension systems are not yet of bio-based materials,â&#x20AC;? said Yanic van Riel, one of the developers from the TU/Ecomotive team

at the Eindhoven University of Technology. 7KHFDULVVDLGWREHWKHZRUOGÂśVÂżUVW vehicle to be built from bio-composites, with the chassis, body, and interior made from such materials. According to the TU/Ecomotive team, the car combines bio-based composites PDGHIURPĂ&#x20AC;D[ZLWKELREDVHGSODVWLFV made from sugar beets. This plastic is crafted into a honeycomb-shaped core, DQGSODFHGEHWZHHQWZRĂ&#x20AC;D[FRPSRVLWH sheets. The lightweight car is powered by lithium ion batteries, with a power output

of 8kW using 2 DC-motors. The structure of the car they have called Lina, has a similar strength-weight UDWLRWRWKDWRIÂżEUHJODVVDQGZHLJKVRQO\ 310kg. But the prototype has not yet passed crash tests, because the material â&#x20AC;&#x153;will not bend like metal, but breakâ&#x20AC;?, said the teamâ&#x20AC;&#x2122;s leader Noud van de Gevel. The TU/Ecomotive team plans to test drive Lina later this year, once given the green light by the Netherlands Vehicle Authority.

Groups unveil $150 million N]VL\WĂ&#x2026;OP\XTI[\QKWKMIV pollution To target plastic marine litter in Southeast Asia THE environmental group, Ocean Conservancy, and the plastics and consumer products industries have unveiled plans or a $150 million investment fund to target plastic marine litter in Southeast Asia, one of the worldâ&#x20AC;&#x2122;s hotspots for such pollution. The Asian fund aims to replicate what the social investment group, Closed Loop Partners, has done in North America, where it raised $100 million from retailers DQGEUDQGRZQHUVWRKHOSÂżQDQFHUHF\FOLQJ operations. Under this new initiative, announced at the Our Ocean 2017 conference in Malta, CLP will set up a similar fund for Southeast Asia. The effort is targeting Southeast Asia because it is reported that half of the estimated 8 million metric tons of plastics ZDVWHWKDWĂ&#x20AC;RZVLQWRWKHRFHDQVHDFK\HDUFRPHVIURP$VLD particularly from Indonesia, the Philippines, Vietnam and Thailand, countries with long coastlines and less-developed waste collection. â&#x20AC;&#x153;Our research has found that by improving waste management in Southeast Asian countries, we can cut the Ă&#x20AC;RZRISODVWLFJRLQJLQWKHRFHDQE\KDOIE\´VDLG6XVDQ

Ruffo, managing director of international initiatives at the Washington-based Ocean Conservancy. Ruffo said itâ&#x20AC;&#x2122;s a long-term project, with the groups hoping WRKDYHWKHLQYHVWPHQWIXQGIXOO\RSHUDWLRQDOLQWKUHHWRÂżYH years. She said she could not make announcements now about where the $150 million would come from. Several large plastics companies and groups, including DowDuPont, Amcor Ltd, Dart Container and ACC, are part of the Ocean Conservancyâ&#x20AC;&#x2122;s Trash Free Seas Alliance. DEC 2017 / JAN 2018

81


World News Lanxess completes acquisition of Chemtura LANXESS has successfully completed the acquisition of US company Chemtura, one of the world’s leading VXSSOLHUVRIÀDPHUHWDUGDQWDQG lubricant additives. With a total enterprise value of €2.4 billion, Chemtura is the largest acquisition in the history of Lanxess. 7KHDFTXLVLWLRQVLJQL¿FDQWO\H[SDQGV the company’s additives portfolio and makes Lanxess one of the world’s OHDGLQJSOD\HUVLQWKLVJURZWK¿HOG In addition to additives, Chemtura’s urethanes and organometallics businesses will be integrated into the Lanxess portfolio. The Colognebased specialty chemicals company will absorb some 2,500 Chemtura employees at 20 sites in 11 countries worldwide. The former Chemtura businesses generate annual sales of approximately €1.5 billion.

AROUND THE WORLD

www.lanxess.com

PET recycling levels falling in US FEWER post-consumer PET containers were recycled in 2016 in the US than the previous year, both in terms of percentage and actual tonnage recovered. New statistics from the National Association for PET Container Resources and the Association of Plastic Recyclers show the recycling rate dropped to 28.4% in 2016 from 30.1% in 2015. And the actual mass of post-consumer PET containers recycled fell by 22 000 tons from 2015 to 2016, and that’s on top of a 7 500 ton drop the year before. Executive director of the APR, Steve Alexander, sees several factors driving down the numbers. “Increased contamination, low oil prices and export market implications really have created a perfect storm,” he said. “But the increased contamination, in my estimation, is the biggest problem we’re facing. And it’s one people can control the quickest.” Add to the mix the changes in SDFNDJLQJWKDWFDQOHDGWRPRUHGLI¿FXOW\ separating different resin types, and Alexander said there must be changes in how America handles this segment of the plastic recycling business. All of this comes at a time when PET packaging is as popular as ever. PET bale yields these days are typically around 60%, Alexander said, with the remaining material considered waste by those who handle the material. 82 DEC 2017 / JAN 2018

Solvay Performance Polyamides’ new Technyl® compounding unit is now serving local and North American customers

Solvay starts Technyl production unit in Mexico A stronger local presence to further develop NAFTA1 market SOLVAY Performance Polyamides, a world leader in polyamide-based performance materials, announces the start of production of engineering plastics in San Luis Potosí, Mexico. This new facility is dedicated to the production of the Technyl® range and was built within a few months in partnership with Chunil Engineering, a global automotive Tier 1 and long-standing customer. “This 10KT unit is fully operational and already serving our regional customers in the automotive and consumer goods markets,” said Marcos Curti, Director of Americas for Solvay’s Performance Polyamides Global Business Unit. “Mexico attracts a growing number of global players, particularly from Europe

and Asia. Many of them are Solvay’s longstanding customers who need a trustworthy local manufacture of products they can fully trust.” Solvay Performance Polyamides supports customers worldwide with a complete array of advanced services designed to reduce product-to-market lead times of their innovations. This offering extends from material characterization to application validation and includes 3D printing of functional prototypes in Sinterline® powders, predictive simulation with MMI® Technyl® Design2 as well as the testing of applications at fully equipped APT® validation centres. www.solvay.com

The brand-new Solvay Performance Polyamides’ unit in Mexico provides customers with a wide range of high performance Technyl® compounds

Solvay Performance Polyamides’ new Technyl® compounding facility located in San Luis Potosí, a leading area for automobile production


PACKAGING THAT PROTECTS Packaging helps to preserve food and protects both consumers and goods. SABIC develops innovative polyethylene and polypropylene solutions with a higher performance and purity. That is how ‘Chemistry that Matters™’ really delivers for all of us.

© 2016 Copyright by SABIC. All rights reserved.


World News

Songwon commissions second production line for thermoplastic urethanes ([WHQGHGUDQJHRI738H[WUXVLRQJUDGHVIRUZLUH FDEOH¿OP VKHHWDSSOLFDWLRQV $6SDUWRILWVJOREDOH[SDQVLRQVWUDWHJ\6RQJZRQKDV commissioned a second thermoplastic urethane (TPU) SURGXFWLRQOLQHWREHFRPHRSHUDWLRQDOLQWKHIRXUWKTXDUWHU RI7KHFRPSDQ\¶VSODQWLQ6XZRQ6RXWK.RUHDZLOO be extended to increase TPU production capacity from WRPHWULFWRQVD\HDU With more than 35 yearsâ&#x20AC;&#x2122; business and manufacturing H[SHULHQFHLQWKH¿HOGRIXUHWKDQHV6RQJZRQLVDPDUNHW OHDGHULQ6RXWK.RUHDVSHFLDOL]LQJLQ738VLQNELQGHUV DQGDGKHVLYHVIRUÃ&#x20AC;H[LEOHSDFNDJLQJODPLQDWHV7KH FRPSDQ\KDVHVWDEOLVKHGVDOHVRUJDQL]DWLRQVLQ$VLD (XURSHDQG1RUWK$PHULFDDQGQRZSODQVWRH[SDQGLWV global business by offering a broad portfolio of technically

DGYDQFHGFXVWRPL]HGXUHWKDQHSURGXFWV7KHQHZ production line will allow the manufacture of an extended range of cutting edge TPU extrusion grades for wire & cable DQG¿OP VKHHWDSSOLFDWLRQV +DYLQJH[KLELWHGLWV738VROXWLRQVDWWKH.6KRZODVW \HDU6RQJZRQKDVEHHQZRUNLQJRQIXUWKHUGHYHORSPHQWV DQGUHFHQWO\LQWURGXFHG6RQJVWRPHUÂ&#x152;3$,D738 UHVLQZLWKH[FHOOHQWDQWLEORFNLQJSURSHUWLHV%ORZQ¿OPV produced using Songstomer P-8185 AI have exceptional VWUHQJWKDVZHOODVH[FHOOHQWUHVLVWDQFHWRDEUDVLRQRLO IXHOVROYHQWVDQGKLJKWHPSHUDWXUHV7KHVHSURSHUWLHV make them suitable for demanding applications such as automotive car seat systems. ZZZVRQJZRQFRP

Starlinger goes Hollywood! Presentation of golden FIBC made from 3(7ERWWOHÃ&#x20AC;DNHV MORE than 100 participants from over 25 countries attended the 34th semi-annual conference of the Flexible Intermediate Bulk Container Association (FIBCA) in Hollywood in October. Starlinger seized this opportunity to present a golden FIBC made IURPU3(7ERWWOHÃ&#x20AC;DNHVGXULQJWKHHYHQWWKH companyâ&#x20AC;&#x2122;s â&#x20AC;&#x2DC;bottle-to-bagâ&#x20AC;&#x2122; technology had already been introduced with great success at Interpack in Europe early in 2017. Building on its vast know-how in the area of PET UHF\FOLQJDQGUH¿QHPHQW6WDUOLQJHUVSHQW\HDUV GHYHORSLQJDQGUH¿QLQJWKHSURFHVVWHFKQRORJ\IRU WKHSURGXFWLRQRIIDEULFIURP3(7Ã&#x20AC;DNHV,QLWLDOWULDOV ZHUHSHUIRUPHGZLWKYLUJLQPDWHULDOWKHQH[WVWHS involved the use of recycled PET (rPET pellets). After VXFFHVVIXOWULDOV6WDUOLQJHUPRYHGRQWRSURGXFH WDSHVDQGFRQVHTXHQWO\IDEULFIURP3(7ERWWOH Ã&#x20AC;DNHV7KHIDEULFXVHGIRUWKHJROGHQ),%& WKH golden colour results from the use of beer bottles) is manufactured on a tape extrusion line type starEX 1600 PF with twinTAPE precision cross winders and circular weaving looms type FX.

6WDUOLQJHUSUHVHQWVDJROGHQ),%&PDGHIURP3(7 EHHU ERWWOH Ã&#x20AC;DNHV0LFKHOOH'LD].RWWL $PHULFDQ6WDUOLQJHU6DKP /HZLV $QGHUVRQ ),%&$ 5HLQKDUG/HFKQHU 6WDUOLQJHU

84 DEC 2017 / JAN 2018

$Ã&#x20AC;RRGHGKLJKZD\RXWVLGH+RXVWRQ


“CHECKMATE” – WE REMAIN KING IN THE INDUSTRY OF BLACK, WHITE AND FILLER MASTERBATCH. HEAD OFFICE - GAUTENG Telephone: +27 (0) 11 746 4000

EASTERN CAPE - Port Elizabeth Telephone: +27 (0) 41 451 2571

KWA-ZULU NATAL - New Germany Telephone: +27 (0) 31 713 0631

WESTERN CAPE - CAPE TOWN Telephone: +27 (0) 21 935 1788

www.ferrosa.co.za


Diary

ThingTrax scoop

Interplas Unique approach to streamlining the plastics production chain

The system is designed to make it easier and safer for diabetics to inject themselves

DIABETES AID WINS HORNERS AWARD AT INTERPLAS TickleFLEX, an insulin injection aid developed by TickleTEC Ltd, won this yearâ&#x20AC;&#x2122;s Horners Award for Design and Innovation, presented during the UK plastics trade show Interplas in Birmingham in September. TickleFlex assists insulin-dependent GLDEHWLFVZKRVHOIDGPLQLVWHULQVXOLQ,WÂżWV onto existing needles and is designed to minimise both the pain of injection and the human error that sometimes occurs. Invented by type-1 diabetic Peter Bailey, an engineer by training, the design is intended to minimize the discomfort of hitting a nerve and to improve consistency. The TickleFlex uses specially textured Ă&#x20AC;H[LQJ¾¿QJHUVÂśWRJULSDVPDOODUHDRIVNLQ and control insertion depth, whilst pain is EORFNHGE\ÂľVDWXUDWLQJORFDOVHQVRU\LQSXWVÂś The gripping action distracts the nerves, and masks the pain. The device also hides the needle as it breaks the skin, reducing stress for those who suffer from a fear of needles. Â&#x2021; $VHFRQGÂżQDOLVW3K\WRSRQLFVUHFHLYHGWKH British Plastics Federation (BPF) Award for its hydroponic system to grow food in less hospitable climates at less cost. The plastic K\GURSRQLFVNLWLVWKHÂżUVWRILWVNLQGWRRIIHU Deep Water Culture technology geared at the hectare scale, which should provide SURGXFWLYHEHQHÂżWVWRWKHFRPPHUFLDO grower at a much lower cost than has previously been the case.

AB Systems, a British supplier of materials handling and cooling systems, exhibited at the Interplas show in Birmingham in September. Milton Shelley has recently joined the company, which supplies a wide range of equipment. They received 148 inquiries over the three days of the show www.ab-ltd.co.uk 86 DEC 2017 / JAN 2018

THINGTRAX was unveiled as the winner of the inaugural Interplas Innovation Award after judges recognised the solutionâ&#x20AC;&#x2122;s unique approach to streamlining the plastics production chain. Innovation has become a major feature of Interplas, the UKâ&#x20AC;&#x2122;s largest and leading plastics industry event. Over the years, this triennial plastics showcase has become the place to unveil new

products and ideas â&#x20AC;&#x201C; so much so, the theme of the 2017 edition was â&#x20AC;&#x2DC;Innovation Happens Hereâ&#x20AC;&#x2122;. The Interplas Innovation Award was designed to recognise and reward the most innovative product or service exhibited at the exhibition. The brief was simple; Explain what makes the idea different from anything else in the marketplace and what it will do to advance plastics in terms of commercial

3M has applied for a patent for its technology to 3D print with PTFE

3D printing with PTFE from 3M 3M PRESENTED two trailblazing plastic technologies, with its multitechnology subsidiary Dyneon: how additive manufacturing with Ă&#x20AC;XRURSRO\PHUVE\PRXVHFOLFNZRUNV as well as the production of 3M â&#x20AC;&#x2DC;Glass Bubblesâ&#x20AC;&#x2122; in plastics. 3M has developed and applied for a patent for a new technology: for the ÂżUVWWLPHHYHUIXOO\Ă&#x20AC;XRULQDWHGSRO\PHUV VXFKDVSRO\WHWUDĂ&#x20AC;XRURHWK\OHQH (PTFE) can be processed by means of a 3D printing method. The new process enables the manufacture of

components and the integration of several functions in one moulded part â&#x20AC;&#x201C; at the click of a mouse and entirely without tools. Dyneon is working on the additive PDQXIDFWXUHRIĂ&#x20AC;XRURSRO\PHU components. The new additive process will be used for the creation of prototypes and small series with complex geometries for the aerospace and chemical industries, in medical equipment manufacturing and in semiconductor factories. www.3m.com


Innovation Award EHQH¿WSURFHVVLQJDQGHI¿FLHQF\ $IWHUPXFKGHOLEHUDWLRQIURPWKH HVWHHPHGMXGJLQJSDQHO7KLQJ7UD[ HPHUJHGYLFWRULRXVIURPDQXPEHU RIKLJKTXDOLW\HQWULHV7KHDOOLQRQH WHFKQRORJ\DOORZVFRPSDQLHVWRPRQLWRU

WKHLUPDFKLQHU\SUHGLFWEUHDNGRZQV DQGHPSOR\HHZRUNÃ&#x20AC;RZSDWWHUQVJDWKHU SURGXFWLYLW\GDWDDQGXVHWKHLQIRUPDWLRQ WRPDNHWKHLURSHUDWLRQVDVHI¿FLHQWDV SRVVLEOH 7KHGDWDJDWKHUHGLVVWRUHGLQWKH

6PDUW&ORXGDQGKDVEHHQGHVLJQHG IRUSOXJDQGSOD\DOORZLQJQHZXVHUV WRVWDUWEHQH¿WLQJIURPWKHLU7KLQJ7UD[ DQDO\WLFVLPPHGLDWHO\$OOLWWDNHVLVIRUD WHFKQLFLDQWRLQVWDOOWKH6PDUW0DFKLQH &DSWXUH*DWHZD\RQVLWH www.thingtrax.com

ThingTrax helps to streamline the plastics production chain

Successful balance '(6,*1(56DQGGHYHORSHUVIURPWKHIXUQLWXUHLQGXVWU\DUH LQFUHDVLQJO\FKRRVLQJSODVWLFDVDPDWHULDOIRUWKHLUSURGXFWV 7KLVLVZK\YLVLWRUVWRWKH%$6)VWDQGDW)DNXPDLQ2FWREHU FRXOGVLWGRZQRQWKUHHGLIIHUHQWFKDLUGHVLJQVWKH%HOOHYLOOH IURP9LWUDWKH0HWULNIURP:LONKDKQDQGWKH$&KDLUIURP %UXQQHU$OOWKUHHDUHPDGHIURPWKHSRO\DPLGH8OWUDPLGÂ&#x160;6, 6, 6XUIDFH,PSURYHG IURP%$6) ,QDGGLWLRQWRWKHVWDELOLW\W\SLFDORISRO\DPLGHV8OWUDPLG 6,RIIHUVDSHUVXDVLYHFKRLFHZLWKDSDUWLFXODUO\KLJKTXDOLW\ VXUIDFHDSSHDUDQFH'XULQJWKHGHYHORSPHQWRIWKHFKDLUVWKH 8OWUDVLPVLPXODWLRQWRROZDVXVHGWRH[KDXVWWKHSRWHQWLDORI WKHGHVLJQDQGPDWHULDOLQIXOO7KHUHVXOWLVDVXSHUEEDODQFH EHWZHHQDGHOLFDWHDSSHDUDQFHDQGVWUHQJWK www.basf.com

DEC 2017 / JAN 2018

87

â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU%$6)

RQ738(ODVWROODQ®7KHUPRSODVWLF3RO\XUHWKDQH

â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU(ODVWURQ RQ73(739(ODVWURQ®6(%6DQG(3'033

â&#x20AC;¢ 2I¿FLDO'LVWULEXWRULQ6RXWKHUQ$IULFDIRU &*)6(RQ)6(® )OXRURHODVWRPHUVDQG 3HUÃ&#x20AC;XRURHODVWRPHUV

â&#x20AC;¢ 'LVWULEXWRUIRU:HLIDQJRQ:HLSUHQ &3( â&#x20AC;¢ 6XSSOLHUVRI(369DULRXV*UDGHV â&#x20AC;¢ (QJLQHHULQJ3RO\PHUV â&#x20AC;¢ 3RO\ROH¿QV â&#x20AC;¢ 5HZRUNHGDQG5HSDOHWLVHG0DWHULDOV ®

Diary

inaugural


Diary 7KHKHDGOLJKWUHĂ&#x20AC;HFWRULQWKH+\XQGDLL[PDGHIURP 8OWUDVRQÂŽ(SRO\HWKHUVXOIRQHIURP%$6)LVQRWRQO\ KLJKO\IXQFWLRQDOEXWDOVRHOHJDQWLQGHVLJQ,QDGGLWLRQ LWFDQFRQWLQXRXVO\ZLWKVWDQGKLJKWHPSHUDWXUHV

CUSTOMISED HUMIDITY CONTROL Clariantâ&#x20AC;&#x2122;s Healthcare Packaging business unit featured an expanded line of its Equilibrium-Stabilizer products at the Inno Pack area of the CPhI Worldwide exhibition at the Messe Frankfurt in October. These solutions â&#x20AC;&#x201C; including EQ-PakÂŽ packets, EQ-CanÂŽ canisters, EQ-StopperÂŽ caps and EQ-Bagâ&#x201E;˘ â&#x20AC;&#x201C; deliver customised humidity control in all phases of the drug-product development cycle

COMING UP

PROPAK EAST AFRICA IN FEBRUARY PROPAK East Africa is to run again from 27 February-1 March in Nairobi, Kenya. Kenya. The show was held in March 2017, also over three days, and attracted 3 095 trade visitors, which was a 68% increase on the 2016 edition. The focus for 2018 will be to increase representation from the wider East African market, from countries such as Ethiopia, Rwanda and Tanzania. There were 123 exhibitors in 2017 and more are expected in 2018. www.propakeastafrica.com

PLASTIC PIPES â&#x20AC;&#x2DC;SPIN-OFFâ&#x20AC;&#x2122; EVENTS PROVE POPULAR THE Plastic Pipes Conference Association (PPCA) has reported that the attendance of its VSLQRIIFRQIHUHQFHVDUHSOD\LQJDVLJQLÂżFDQW role in promoting the technical and commercial development of this global industry. The PPCAâ&#x20AC;&#x2122;s main event, Plastic Pipes XIX, is to be held in Las Vegas from 24-26 September 2018. In the lead-up to that show, a number of â&#x20AC;&#x2DC;spin-offâ&#x20AC;&#x2122; plastic pipe events organised in association with the PPCA have drawn good attendances, including the 5th China International Plastic Pipe Conference in Hangzhou (26-27 October 2017), which attracted a record number of 420 delegates. Similar success was recorded at Pipes XI, the PPCAâ&#x20AC;&#x2122;s spin-off conference and exhibition in Johannesburg in September, which was attended by over 300. Delegates represented water, gas, sewer and telecom utility companies, pipe manufacturers, raw material suppliers, consulting engineers and technical institutes. A total of 35 papers that reviewed technical as well as business developments were delivered. Zoran Davidovski, technical chair of the PPCA, comments: â&#x20AC;&#x153;The growth in attendance of our spin-off conferences and exhibitions is a UHĂ&#x20AC;HFWLRQRIDJOREDOLQGXVWU\WKDWLVFRQVWDQWO\ enhancing all aspects of its value chain. Such ceaseless technical innovation is driven by human inspiration. Replacement of aged and leaking non-plastic pipes with modern, durable and sustainable plastic pipe systems is advancing public health and wellbeing for millions of people throughout the world. Our conferences facilitate that communication purpose and process.â&#x20AC;? Papers posted Organizers of the main PPCA event that takes place every two years have also announced that conference papers for PLASTIC PIPES XVIII in Berlin have been posted to their website. A total of 130 papers are now freely available for download at: www.plasticpipesconference.com

Lights on and full speed ahead ZZZEDVIFRP

Enhanced dimensional stability BASF showcaseD recent developments with its high-temperature plastics portfolio at Fakuma in October. Headlight systems used in the automotive sector are subject to increasingly stringent and in some FDVHVFRQĂ&#x20AC;LFWLQJUHTXLUHPHQWV,QFUHDVHG road safety, lower fuel consumption and resistance to high temperatures must be integrated thoughtfully into modern designs. Polyethersulfone (PESU) UltrasonÂŽ E from BASF can withstand continuous exposure to temperatures of 180°C and for a brief time, even up to 220°C. The material is lightweight and easily metallized â&#x20AC;&#x201C; ideal for use in headlights.

In addition, this high-temperature thermoplastic offers an interesting combination of advanced properties, which match the needs of this application precisely. These include its resistance to HQYLURQPHQWDOLQĂ&#x20AC;XHQFHVVXFKDVH[SRVXUH to moisture, and vibrational related stresses. 7KHSRO\HWKHUVXOIRQHLVNQRZQVSHFLÂżFDOO\ for its high dimensional heat stability which enables the production of complex and delicate geometries â&#x20AC;&#x201C; crucial for linking together functionality and low-weight design LQDFRVWHIÂżFLHQWPDQQHU7KDQNVWRLWV good demouldability, UltrasonÂŽ E can easily be removed from the injection mould.

Four-cavity IML machines

for coffee capsules Premiere of a single serve capsule IML machine FRESH coffee straight out of a coffee capsule has been one of the most popular ways to make a good cup of coffee for years. With increasing demand in mind, Beck Automation has developed an IML machine for highquality plastic coffee capsules. The new machine premiered at Fakuma 2017. The four-cavity IML machine architecture shows that machines with much larger numbers of cavities are also possible. For example, in 2016 Beck Automation successfully commissioned several solutions for 32+32 stack moulding machines. The company is currently completing a 32-cavity IML Single Serve Capsule machine. Nino Zehnder: â&#x20AC;&#x153;With such small packaging sizes, the challenge lies in label inserting precision, as well as an operator-friendly concept. We are talking about very small labels and ultralightweight components with extremely 88 DEC 2017 / JAN 2018

high production volumes. And, whatâ&#x20AC;&#x2122;s more, it is an application for multicomponent technology.â&#x20AC;? The coffee capsules shown are inserted into a multi-component, fourcavity mould from Fostag Formenbau. Beck Automation states a target cycle time of <5 s. Multi-component technology makes it possible to manufacture coffee capsules with PP in the outer layer and an EVOH inner layer. The barrier layer is responsible for the durability and aromaretention of the content, and thus for the productâ&#x20AC;&#x2122;s functionality. Beck states that the packaging itself is less than 10% of the total weight of the product at a mere 1.35g.

ZZZEHFNDXWRPDWLRQFRP


for hoses &2//,1*PE+LQWURGXFHGLWVQHZEORZQ¿OPOLQHZLWK QXPHURXVLQQRYDWLYHIHDWXUHVLQFOXGLQJDQHZYHUVDWLOHGLH ³0RGXODULW\LQHYHU\VLQJOHOD\HU±RXUSURGXFWSKLORVRSK\LV SHUIHFWO\UHÃ&#x20AC;HFWHGLQRXUQHZGLH7KLVGLHLVXVHGIRUWKHSURGXFWLRQ RIPHGLFDOVWUDQGVDQGFDWKHWHUWXEHV0RUHRYHUWKHGLHLVÃ&#x20AC;H[LEO\ GHVLJQHGDQGFXVWRPHUVFDQXVHLWIRUWKHSURGXFWLRQRIDZLGH YDULHW\RIEORZQ¿OPV³VDLG')ULHGULFK.DVWQHU&(2RI&ROOLQ

Diary

Flexible die New medical die, Collin Lab & Pilot Solutions

³$WWKHPRPHQWWKHLQQRYDWLYHPRGXODUGHVLJQDOORZVXS WROD\HUV6WULSVFDQEHLQWHJUDWHGLQWRDQ\GHVLUHGOD\HU,W LVSRVVLEOHWRLQWHJUDWHWZRIRXURUHLJKWVWULSVZLWKDZLGWKDV UHTXLUHG)XUWKHUPRUHWKHJHRPHWU\RIWKHVWULSVFDQH[DFWO\ EHLQÃ&#x20AC;XHQFHG´ 7KH&ROOLQGLHLVVXLWDEOHIRUDYDULHW\RISRO\PHUVDQGFDQEH XVHGDVWXEHVWUDQGRUEORZQ¿OPGLH www.drcollin.de

Reinforcement of SUV front ends

VLGHLQVHUWVDUHKHDWHGVKDSHGRXWVLGHRI WKHPRXOGUHKHDWHGWRÂ&#x192;&DQGWKHQ SODFHGLQWKHPRXOGIURPWKHVLGH$WWKH VDPHWLPHWKHPLGGOHLQVHUWLVKHDWHG DQGWKHQRYHUPRXOGHGWRJHWKHUZLWKWKH WZRRXWHULQVHUWV www.lanxess.com

89

,QDGGLWLRQWKHUHLQIRUFHGDUHDVFDQHQGXUH PXFKKLJKHUVWUDLQ´H[SODLQHG+DUUL'LWWPDU DQDSSOLFDWLRQVGHYHORSHUIRU7HSH[ 7KHIURQWHQGVRIERWK689VDUHPDGH IURPLQMHFWLRQPRXOGHGSRO\SURS\OHQH,Q WKHDUHDDURXQGWKHKRRGORFNWKH\DUH UHLQIRUFHGZLWKDWKLQPPWKLFNSLHFHRI 7HSH[G\QDOLWH5*7KHPDWUL[ RIWKLVVHPL¿QLVKHGFRPSRVLWHLVPDGH IURPSRO\SURS\OHQHDQGFRQWDLQVE\ YROXPHFRQWLQXRXVJODVV¿EUHURYLQJVDV DIDEULF2QERWKVLGHVRIWKHIURQWHQG WKHµ=VWUXWV¶DUHUHLQIRUFHGZLWKDVKDSHG LQVHUWIURPWKHVDPHFRPSRVLWHPDWHULDO 7KHLQMHFWLRQPRXOGLQJSURFHVVZLWK WKHWKUHHLQVHUWVLVKLJKO\HI¿FLHQW7KH

DEC â&#x20AC;&#x2122;17 / JAN â&#x20AC;&#x2122;18

7+(FRQWLQXRXV¿EUHUHLQIRUFHG WKHUPRSODVWLFFRPSRVLWHV7HSH[IURP /DQ[HVVKDYHPDQ\SRWHQWLDODSSOLFDWLRQV DVLQVHUWVIRUWKHORFDOUHLQIRUFHPHQWRI LQMHFWLRQPRXOGHGFRPSRQHQWV:KLOH PHWDOLQVHUWVRQO\LQWHUORFNZLWKWKH LQMHFWLRQPRXOGHGPDWHULDOWKHFRPSRVLWHV KDYHDPDWHULDOERQGWKDWLQFUHDVHVWKH FRPSRQHQWV¶PHFKDQLFDOVWUHQJWK 7HSH[LVDOVRVLJQL¿FDQWO\OLJKWHU7KLVLV HYLGHQWLQWKHIURQWHQGVRI9RONVZDJHQ¶V $WODVDQG7HUDPRQW689VZKLFKDUH PDQXIDFWXUHGLQWKH8QLWHG6WDWHVDQG&KLQD UHVSHFWLYHO\³%RWKIURQWHQGVXVH7HSH[ LQVHUWVZKLFKDUHDURXQGOLJKWHUWKDQ FRPSDUDEOHLQVHUWVPDGHIURPVWHHOVKHHWV


Diary

Strong adhesion

from the very start New TPE series for 2-component automotive applications with EPDM KRAIBURG TPE presented a new series of thermoplastic elastomers at Fakuma 2017 that were specially developed for excellent adhesion and UV resistance in two-component applications with ethylene propylene diene monomer rubber (EPDM). The new compounds of the ThermolastÂŽ K family are intended primarily for automotive applications such as (3'0ZLQGRZWULPDQGVHDOLQJSURÂżOHVZLWKPRXOGHG73( corner joints and end elements. â&#x20AC;&#x153;The production of diverse sealing frames and window WULPVRI(3'0SURÂżOHVZLWKPRXOGHGFRUQHUDQGHQGHOHPHQWV requires new material solutions,â&#x20AC;? said Michael Pollmann of Kraiburg TPE. â&#x20AC;&#x153;The versatility of our TPE technology has made it possible for us to develop a competitive material that solves the phase separation problems of the systems that are currently used. In addition, we have the market expertise and customer orientation for fast implementation of such innovative two-component applications.â&#x20AC;? The core requirements for corner joints and end elements RIZLQGRZWULPSURÂżOHVLQFOXGHH[FHOOHQWDGKHVLRQDQG weathering resistance, which are ensured by the long-term process stability of the TPE/rubber connection. It is also necessary to minimise the injection temperature of the TPE

Window trim and sealing SURÂżOHVPDGHRI(3'0ZLWK PRXOGHG7+(502/$67ÂŽ K corner joints and end elements

7KHQHZ73(VHULHVFRPELQHVH[FHOOHQWZHDWKHUUHVLVWDQFHDQG DGKHVLRQWRH[WUXGHGDQGIRDPHG(3'0SURÂżOHV

solutions in order to reduce the cooling and cycle times of the 2-component elements. 7KH$'(3'089VHULHVIXOÂżOVDOORIWKHVHUHTXLUHPHQWV by combining optimal adhesion properties with long-term resistance to UV radiation and thermal effects with a hardness of 70 Shore A. Compared to competitive materials, these special TPE products exhibit superior stability. The (3'0SURÂżOHLVQHLWKHUFRPSUHVVHGQRUGHVWUR\HGRU deformed. The compounds feature uniform colour fastness of EPDM and TPE and there is no tendency of stickiness or phase separation. www.kraiburg-tpe.com

90 DEC 2017 / JAN 2018

+130 Exhibitors +3500 Trade Visitors Previous 2 editions SOLD OUT 80% of exhibitors felt their sales will increase as a result of exhibiting

East Africaâ&#x20AC;&#x2122;s

Ç Ç Ç Í&#x2DC;Ć&#x2030;Ć&#x152;Ĺ˝Ć&#x2030;Ä&#x201A;ĹŹÄ&#x17E;Ä&#x201A;Ć?Ć&#x161;Ä&#x201A;ĨĆ&#x152;Ĺ?Ä?Ä&#x201A;Í&#x2DC;Ä?Žž

%,**(67

SDFNDJLQJSURFHVVLQJDQGSODVWLFV


CLASSIFIED ADVERTS Advertisers:â&#x20AC;&#x201C; Dec 2017 / Jan 2018 Adex (Sysmetric) Brenntag SA Buzz Trading Cabletech Marketing Carst & Walker Charles Rust Associates Chemfit DemaPlastech DH Polymers Engen Petroleum ExxonMobil FdB Consulting Ferro Industrial Products GreenTech Machinery Hestico Inkulu Plastic Pipes Ipex Machinery Jenowill Karbochem Masterbatch SA MBT MGMW Trading Mould Base Nissei ASB Orion Engineered Carbons Performance Colour Systems PlasticsSA Plastomark PMS Plastics POLYCO Promoplast Propak East Africa Protea Chemicals Rapid Granulator Rawmac Relloy (Erema) SABIC Safripol SAPY Colours SES Skyland Masterbatch Sun Ace Userve Plastic Machinery Vishva Exim W D Hearn Machine Tools West African Group Your Technical Solutions Zerma Africa

79 IFC 23 29,31 61 09 33 63 87 15 17 66 85 35 19 58 36 03 54 69 22 71 37 59 73 75 77 43,45 21 47 89 90 IBC 67 55 42 ,83 05 OBC 51 53 25 41 30 39 27 01 49

52%86,1'8675,$/

0$7(5,$/)256$/( FIRST GENERATION RECYCLED PE 100 PELLETISED MATERIAL Contact: WAYNE on 084 657 0596

0$/7$ 5(&<&/,1*

High-quality recycled HDPE, LDPE, PP phone Danie WHO   GDQLH#PDOWDUHF\FOLQJFRP

=(50$$)5,&$ ,6+,5,1* Technical salesperson wanted Contact: Jeff on 082 781 0082 or jeff@zerma.co.za

ZERMA. THE HOME OF SIZE REDUCTION

Recycle your plastic with us We buy most forms of clean factory waste

Contact: Desiré Preston for more info Tel: 011 894 3520 | Cell: 083 774 6038 | Email: desire@jcl.co.za www.jcl.co.za

THERMOFORMING, SHEET EXTRUSION, AND MATERIALS THERMOFORMING TECHNOLOGY SAVE 90% of your electricity use with GN! â&#x20AC;¢ GN (Canada): machines for reduced waste and reduced energy â&#x20AC;¢ Thermoforming Moulds for GN and other thermoformers â&#x20AC;¢ ToolVu technology for productivity and NEW quality improvement on thermoforming machines â&#x20AC;¢ Complete lines for EPS foam trays and EPS cup moulding NEW

EXTRUSION TECHNOLOGY FROM AGRIPAK OF ITALY Mono & multi-layer extrusion lines for the production of: â&#x20AC;¢ â&#x20AC;&#x2DC;Cartonplastâ&#x20AC;&#x2122; (twinwall/hollow profile sheet) â&#x20AC;¢ Multilayer sheet for packaging â&#x20AC;¢ Semi-foamed sheet for thermoforming

MATERIALS FOR THERMOFORMED PACKAGING

â&#x20AC;¢ Sealing films for trays and top web for FFS machines â&#x20AC;¢ OPS, PP, PET sheet for general packaging â&#x20AC;¢ PP/EVOH/PP for high barrier containers

BRE INNOVATIONS Contact: Tim Forshaw (083 381 5253) or Phil Hopkinson (083 408 5253) or 021 671 5253 or mail to tim@bre.co.za

PVC 0,;,1* &22/,1* 81,7)256$/( PLAS-MEC PVC mixer linked with horizontal cooling mixer for sale CONTACT: Jaco on 011 822 6470 or recycling@transpaco.co.za

:H%X\DQG6HOO 3ODVWLF3DOOHWV 083 756 6897 ZZZSUHPLHUSDOOHWVFR]D

7RSODFHDFODVVLÃ&#x20AC;HG DGYHUWSOHDVH Fax: 086 519 6089 or Tel: 021 712 1408 or E-mail: saplastics@iafrica.com ZZZVDSODVWLFVFR]D

DEC 2017 / JAN 2018

91


World News

Two-layer tyre system

ofo, a leading China-based multinational bike sharing company, will make journeys safer and more comfortable thanks to a two-layer tyre system made with BASFâ&#x20AC;&#x2122;s Elastopan polyurethane

92 DEC 2017 / JAN 2018

Anti-slip tyres provide excellent surface traction for greater safety BICYCLE-sharing commuters around the world will soon experience a more enjoyable ride: ofo, a leading Chinabased multinational bike sharing company, will make journeys safer and more comfortable thanks to a twolayer tyre system made with BASFâ&#x20AC;&#x2122;s ElastopanÂŽ polyurethane (PU). Enabled by a unique dual density technology, the outer layer of the PU based tyre system is hardy over rough surfaces, while the inner layer provides outstanding shock absorption as a result of the materialâ&#x20AC;&#x2122;s high UHERXQGSHUIRUPDQFH7KHLQĂ&#x20AC;DWLRQ free tyre system also eliminates the annoyance of conventional inner-tube patching and repair. Elastopanâ&#x20AC;&#x2122;s anti-slip properties also provide riders with outstanding surface traction for greater safety. The material enables a unique tyre tread

design, which further improves the anti-skid performance of the tyres. Compared to conventional tyres made of rubber, the innovative bike tyre system made with Elastopan is approximately 30% lighter, making the bike easier to handle. The company has connected more than 10 million bikes in over 180 cities across 13 countries. It recently launched shared bikes in United Kingdom, Austria, Russia, Italy, Czech Republic and Holland. Elastopan is wear-, abrasion-, chemical- and fatigue-resistant. As the outer layer of the tyre system is approximately three times more resistant to abrasion than rubber andt is very durable against rough surfaces. â&#x20AC;&#x153;The use of Elastopanâ&#x20AC;&#x2122;s dual density technology can help reduce the need for repairs, extending the service

life of our bicycles,â&#x20AC;? added Dai Wei. â&#x20AC;&#x153;As the bike tyre system is puncture proof and hard-wearing, this will also reduce the number of bikes that are abandoned due to damage,â&#x20AC;? said 'DL:HL&KLHI([HFXWLYH2IÂżFHUDQG Founder of ofo. With Elastopan dual density PU system, the inner layer of the bike tyre has been optimized to deliver high rebound performance. The dual density tyre structure even improves the damping performance by around 30% ZKLFKVLJQLÂżFDQWO\HQKDQFHVFRPIRUW and the overall riding experience. Elastopan can be produced in any colour required. The two-layer structure enables more possibilities for design, as each layer can be manufactured in different colours, and cost-effectively produced in a onestep process. www.basf.com

)


The Protea Chemicals Team offers innovative solutions to industry with the backing of world class products, suppliers and industry professionals.

JOHANNESBURG 011 821 3300 jhbsales@ proteachemicals.co.za

CAPE TOWN 021 550 8100 capeorders@ proteachemicals.co.za

DURBAN 031 468 5424 orderskzn@ proteachemicals.co.za

www.proteachemicals.co.za

PORT ELIZABETH 041 403 1000 peorders@ proteachemicals.co.za


SA PLASTICS DEC 2017 - JAN 2018  

SA Plastics, Composites & Rubber is published six times a year. The magazine includes news and information about issues, products and techno...

SA PLASTICS DEC 2017 - JAN 2018  

SA Plastics, Composites & Rubber is published six times a year. The magazine includes news and information about issues, products and techno...

Advertisement