Page 1

Live, Work & Travel

July 4-10 2011 Issue 1453




£1 where sold

David Schwimmer’s dark direction

BARBADOS ADVENTURES Shake your booty at Crop Over

JOIN THE PARTY Light up your summer at London’s best festivals


ANGLO PACIFIC SHIPPING & TAX 30th Anniversary OVER 500,000 SATISFIED CUSTOMERS HAVE ALREADY TRUSTED THEIR POSSESSIONS TO ANGLO PACIFIC, LONDON’S LEADING SHIPPERS EXCESS BAGGAGE > Free supply of tea cartons and bubble > Free delivery/collection within M25 > By sea/air/road worldwide > Money Back Guarantee HOUSEHOLD REMOVALS > Free home survey, no obligation > Packed by skilled professionals > Shared or exclusive containers > Motor car/bike specialist shippers TAX REBATES > Average refund £963 secured last year > Online Tax Pack, only 10% commission MONEY TRANSFERS > Competitive exchange rates FINANCIAL PROTECTION > Bonded by the British Association of Removers > Bonded by the Association of Tax Agents > FIDI Accredited International Mover SO BEFORE YOU CHECK OUT OF EUROPE CHECK OUT ANGLO PACIFIC

FREEPHONE 0800 085 0355 Anglo Pacific International Plc, 5/9 Willen Field Road, Park Royal, London, NW10 7BQ Email: Hours: Mon-Fri 8.30am - 6.00pm Sat 9am-1pm

this week July 4-10 / Issue 1453 Free every Monday

Front Cover: Barry Lewis

EDITOR’S LETTER Technology: it can be our best friend but also our worst enemy. This week, on p36, we explore how facial recognition techology could infiltrate your life to the point where it’s almost making shopping choices for you. Then, on page 44, Tom Sturrock explores the link between rocket science and cricket. If it’s all a bit mind-boggling, there are plenty of great festivals to unwind at. We profile our pick of London’s best on page 10. Enjoy!

72 Bump and grind: get your groove on at Crop Over, Barbados


26 A new direction: David Schwimmer’s new movie

53 Global Vision 54 OUTSIDE THE FESTIVAL: Explore Edinburgh’s many attractions 58 Late Deals 61 TNTT Weekender: San Sebastián 62 Hotshots 64 BEANEATH THE SURFACE: Take a dive off the beaches of Malta 66 Travel Tips 67 Travel News 68 On The Road 69 Top Five 70 PARTY TIME: Shake your booty at Crop Over in Barbados



34 World News 36 FACE-OFF: How facial recognition is infiltrating marketing 39 Our view: Mullahs and mullets 40 Sport: Best Of The Week 43 Sport view: Who needs Hawk-Eye? 44 A SCIENTIFIC VIEW: Combining cricket with rocket science

101 Freight 107 Classifieds 113 Accomodation


8 LONDON 8 London Life 10 FESTIVAL FUN: The best summer entertainment in London 12 Food & Drink 10 GEEKY HOBBIES: Don’t sneer – these pursuits are now cool 16 Spotted 18 Silly Buggers

21 ENTERTAINMENT 21 22 23 24 25 26

Celebrity News TNT Life Look Who’s Talking: King Kapisi Cinema Culture TRUST ISSUES: David Schwimmer on his dark new movie

28 MUSIC & CLUBS 28 29 30 32 33

Album Of The Week Gig Of The Week Music Listings Clubbing Listings Clubbing

36 Facing facts: how advertising can pick you out of the crowd

46 CAREERS & MONEY 46 Job Of The Week 47 Careers 48 CITY OF SAILS: Make the move to Auckland, New Zealand 52 Money

REGULARS 4 6 22 114 23 Non-believer: rapper King Kapisi isn’t down with God

Letters Wins Wins Desperately Seeking 10 Cut loose this summer: London’s best festivals

Tell us what you think at tntmag or tweet @tntmagazine

YOUR SAY... EDITORIAL Editor Carol Driver Content editors: Sub editor Jahn Vannisselroy Travel Janine Kelso Entertainment Alison Grinter News & sport Tom Sturrock Web Frankie Mullin Staff writer/editorial assistant Rebecca Kent

It’s still important to have Pride

Thank you for your article on Gay Pride (TNT 1452). The past weekend’s London Gay Pride celebrations and others being held in cities around the world are still as relevant today as they were when they started in the early Seventies. There is still lots of prejudice against gay people and not only in Eastern Bloc countries such as Russia and Poland, but also in our very own backyard. One man was beaten up and killed in Trafalgar Square a couple years ago, solely for being gay. And a few months ago I was assaulted by a youth as I was leaving a gay bar in Camden Town. It is really hard to believe that this is still happening. Tim Baros, via email

DESIGN AND PRODUCTION Head of design and production Jon Cooke Graphic design manager Astrid Breacker Design and production executives Justine Mackay | Laura Doyle Picture researcher Laila Pacheco DIGITAL & IT Head of digital marketing and development Syed Ahmad IT manager Stephen Dann SALES Commercial director David Alstin Sales manager Jaqui Ward Classified sales manager Matt Syder Sales executives Tyler Harrison Eddie Clinton | Stuart Shirra Michael Darrington | Donovan Smith Sales administrator Abby Nightingale MARKETING & EVENTS Marketing and events executive Domenica Ribaudo Marketing and events assistant Phoebe Cherrill Social media co-ordinator Daniel Cape ACCOUNTS Finance director Nick Crampton Accounts Margaret Roberts | Ewa Marks TNT PUBLISHING CEO Kevin Ellis Chairman Ken Hurst TNT Publishing Ltd Emblem Direct Ltd PRINTED BY Wyndeham Peterborough Limited NEWS AAP SAPA NZPA PICTURES AAP AP Alamy Getty Images NZPA PA Photos Pictures Colour Library Reuters Rex Features Robert Harding SAPA TNT Images PUBLISHER


TNT Magazine, 10 Greycoat Place, London, SW1P 1SB General enquiries Phone 020 7960 6008 Fax 020 7960 6977 Email SALES ENQUIRIES

020 7989 0567



COVER PRICE: £1 where sold SEE for pickup points or to read TNT online SUBSCRIPTIONS Call 020 7960 6411 DISTRIBUTION Call 020 7960 6411 All thieves of TNT bins will be prosecuted.

Pride: very relevant in 2011

NEW You can now text us your thoughts: Text TNT and your message to 81707* RACIST, RACIST, RACIST – OI,OI,OI I recently read on the forums a reader (Jim Bowen) writing that Australia is not a racist country. Now, I am a proud Australian. However, one thing I am not proud of is Australia’s record in terms of race relations. A 17-year gap in life expectancy between indigenous and non-indigenous Aussies is one example. Aboriginals are literally living in third-world conditions despite Australia being a first-world nation. The fact that the Human Rights Commissioner for the United Nations has recently labelled Australia’s policies towards asylum seekers as inhumane, racist and one of the most primitive systems in the world.


This is embarrassing and a disgrace. It is a result of a lack of understanding and a lack of knowledge on the part of both citizens and leaders. Ignorance breeds racism. To say Australia is not racist is turning a blind eye to the issues which need to be addressed in order for us to become a greater nation. Meredith, via

TIDY YOURSELF UP Shane Warne’s (alleged) make-up wearing, face-lifting, eyebrow-tweezing activities go to show it’s not just us Poms who have our fair share of insecure preeners. There goes the legend of Warnie the macho man. Karl Chads, via email

YOU’D BE SILLY NOT TO I’d just like to say that I enjoy your Silly Buggers Page.

Perhaps now that the monarchy is entering a new age maybe you could feature Kate Middleton around the world? In the meantime, um, any chance of a date with Ruby? Graeme V. Peters, via email

Your tweets to @tntmagazine @Noodles_GHostel: Girls and Boys, is the site of grown men throwing tomatoes over each other erotic? It dawned on me reading @ tntmagazine its a possibility?!

WIN! Letter of the week wins a three-day tour of Ireland from Shamrocker (, valued at £119. Letters may be edited. Prize is not transferable. Your Say is a reader forum and does not represent the opinions of TNT or its staff.



Understanding art

The adventures of Tintin

* Messages cost 25p each + standard network rate. 18+ bill payers only. Send STOP to end. Number may show on bill. A2B 08700460138

Getty Images, TNT Images

TNT Magazine is printed on paper from sustainable forests. There is no business connection between the proprietors of this magazine and TNT Ltd, the worldwide transportation group. Copyright here and abroad of all original materials is held by TNT Magazine. Reproduction in whole or part is forbidden, except with permission of the publishers. Registered as a newspaper at the Post Office.



TNT’S STREET LIFE Snapped: A Witold Krassowski photo four hours after the London bombings, 2005


© Witold Krassowski, Getty Images

Wherever you are, the streets are where you’ll find colour and the expression of the people; the heartbeat of the city. These exhibitions capture people going about their business in a variety of cities. You’ll find the first UK showing of the archives of mysterious Chicago street photographer Vivian Maier at the German Gymnasium, as well as a newly discovered body of work by previously unknown British photographer Walter Joseph, who produced

Big Trip

a gritty portrait of post-war London at the British Library. Photofusion will present rare perspectives by leading female street photographers, while the voyeuristic Seen/ Unseen has new work by George Georgiou and Mimi Mollica, using the London bus as a vehicle to surveil an unknowing public. The festival will also present the first International Street Photography Award to the best work from thousands of worldwide submissions.

» Various venues across London. Until July 31. (london

Short break




HOW TO ENTER Go to See webpage for terms and conditions. Winners will be selected at random

WIN A FANTASTIC TRIP TO MORZINE TNT and h.o.f.n.a.r have teamed up to give one lucky reader (and a friend) a fantastic trip to Morzine in the French Alps – worth more than £650! If you have never been to the mountains during the summer, then you are in for a treat. We stay in an awesome chalet with a sauna, pool table and there’s even a jacuzzi in the garden. We run really laidback trips for 20- and- 30-somethings and the plan is to get active: mountain biking, climbing, white-water rafting, picnicking, paragliding, swimming in mountain lakes, hiking, canyoning … the list is endless. Do as much or as little as you wish – it’s your holiday! Enter at competitions.


WIN MORE 4 16 24 33 62

Ireland tour Guidebooks Drive Angry DVD Clubbing tickets A three-day tour of Scotland 62 Photography course 68 Cash and guidebooks 70 A trip to Bath and Stonehenge PREVIOUS WINNERS TNT 1449: A Busabout trip round Spain and Portugal: Suzanne Jackson

NEW You can now text us your Entry: Text TNT and your message to 81707* * Messages cost 25p each + standard network rate. 18+ bill payers only. Send STOP to end. Number may show on bill. A2B 08700460138




FAST FRINGE AT LEICESTER SQUARE THEATRE £12.50 WHAT: A selection of acts confirmed for the Edinburgh Fringe give their material a dry run in punchy, three-minute bites. Just enough to induce a couple of belly-laughs and leave their audience wanting more. WHEN: July 5 DO IT BECAUSE: It’s some serious value for money. You’ll get to see 28 comics, from stand-ups to sketch to character acts. If you’re not planning on getting up to Edinburgh for the festival, then this really is the next best thing.


» Leicester Square Theatre, 6 Leicester Place, WC2H 7BX Leicester Square (

FREE RUN FROM £15 Dray Walk: great for a Sunday session

Capital idea: Dray Walk Dray Walk bears the dubious distinction of few people actually knowing its name. It is better known to most as, ‘that little alleyway that runs off Brick Lane just before the bridge’. However identified, though, Dray Walk attracts a bumper crowd most weekends, its wooden benches and stone shelves an ideal spot to wolf down a burger and a beer before plunging back into the thronging markets. Dray Walk is also home to Rough Trade, one of the East

End’s most eclectic, but still accessible, record stores – which also makes excellent coffee. In Dray Walk, bars and cafes rub shoulders with independent clothing stores and gallery space, just around the corner from a restaurant housed in a gutted doubledecker bus. Definitely worth a look for a rowdy Sunday session. TS

Udderbelly’s big-ticket show is a spectacular combination of parkour, acrobatics and martial arts. Probably a good idea not to recreate this on your way home from the pub.

SOMERSET HOUSE SUMMER FROM £22 The stunning grounds of Somerset House, with its elegant, sprawling courtyard, host some of London’s best outdoor summer concerts.

» Udderbelly, Southbank, SE1

» Somerset House Trust, The

8XX Waterloo (underbelly. Until Jul 17

Strand, WC2R 1LA Temple ( Jul 7-17

» Off Brick Lane, E1 6QL High-flyers: the stars of Free Run

Liverpool Street



Separate journeys made by car each day Source:

LONDON’S TRAMS network was implemented. By the turn of the century, the trams went electric, with London’s various providers coming together to create

Europe’s largest tram network. In their heyday, London’s trams covered much of the inner city and branched into the suburbs in all directions. After the Second World War, though, money and materials for maintenance were in short supply, and the trams were steadily replaced by buses. In the past decade, though, light rail systems have come back into vogue, particularly in London’s outer reaches. TS

Getty Images

Once upon a time, trams were a common sight in London, running in various forms for nearly a century before they were shut down this week in 1952. In 1860, horse-drawn trams operated along Victoria St and were soon incorporated in Blackheath, Brixton, Whitechapel and Kensington. By the end of the 19th century, Londoners had become so keen on travel by tram that Europe’s first cable

Sneak peak: Arthur Smith will host Fast Fringe



It’s the biggest week of the year for green-thumbs, with all kinds of horticultural obsessions getting a run. Maybe your prized petunias will finally receive the accolades they deserve.

East London will become home to a whole bunch of nifty innovations between now and the Olympics but cruising along the waterways on a floating cinema could be top of the pile.

» Hampton Court Palace,

» Tottenham Hale’s waterways

KT8 9AU Hampton Court ( Jul 5-10

Tottenham Hale (floating Until Sep 18

Carve it up: go surfing (sort of) in London



It’s not exactly Bondi Beach but this inner-city surf simulator recreates the effect of the ocean’s wave, powering surfers along at about 40 kmh. It’s as close to the beach as you’ll get without leaving London behind.

Submissions for one of the UK’s biggest art prizes veer between the conventional to the truly surprising. The National Portrait Gallery is one of the most interesting smaller galleries as well, so don’t miss it.

» Broadgate Circle, EC2M

» National Portrait Gallery,

2BL Liverpool Street ( Jul 4-8

WC2H 0HE Charing Cross ( Until Sep 17

A great way to end summer: The Mayor’s Thames Festival

If you’re not entertained in London this summer, you’re not trying hard enough WORDS ALISON GRINTER


ondon’s seemingly endless calendar of cultural event means there’s a festival to suit every sensibility this summer. We’ve lined up some of the best and identified their unique selling points to help you choose.

Killing Swine at the Camden Fringe Festival

■ INTELLIGENT MOVEMENT: HIP HOP FESTIVAL AT SOUTHBANK What: A dynamic programme of concerts, debates, workshops and parties spanning the four pillars of hip-hop – b-boying, MCing, DJing and graffiti. USP: Where else can you sign up for a popping masterclass with Popin’ Pete, of the Electric Boogaloos?

» Southbank Centre, SE1 8XX. Jul 14-17. ( Prices vary – some events free. Waterloo

» Clapham Common, SW4Common. Aug 27-28 ( Day tickets £45, w/e £90. Clapham ■ NOTTING HILL CARNIVAL What: It began as a local festival set up by the West Indian community in the 60s but has since ballooned into Europe’s biggest street festival, attracting one million revellers. USP: Eye-popping floats, the sounds of traditional steel drum bands, massive sound systems and tasty Carribbean food.

» Notting Hill, Aug 28-29 (thenotting Free.

Notting Hill.

■ CAMDEN FRINGE FESTIVAL What: From it’s humble one-venue beginnings five years ago the Camden Fringe Festival now encompasses the whole borough – from Highgate to

Barry Lewis, Getty Images

One great party: the Notting Hill Festival

■ SW4 WEEKENDER What: An eclectic two-day electro-dance festival featuring such luminaries as Underworld, John Digweed, Magnetic Man and Annie Mac.

USP: Drum’n’bass exponents Pendulum will make their only London live appearance for 2011 on the Sunday.

Saxy times: Denys Baptiste will play the Ealing Blues festival

Fun in the sun: hit SW4 for a great weekend

LONDON 11 Heads-up: Shoreditch Festival will keep you entertained

Bloomsbury – offering a heady mix of cutting edge theatre, opera, dance and stand-up comedy. USP: With 200 shows across eight venues over four weeks, it’s a credible alternative to the Edinburgh Fringe Festival.

» Camden ( Aug 1-28. From £5.

Chalk Farm

■ ANTHROPOMORPHIC SUMMER FESTIVAL What: Wilton Hall, one of the world’s oldest surviving grand music halls, hosts events ranging from ping-pong championships to classical concerts and films, comedy nights, magic shows and dance puppet theatre. USP: Franz Ferdinand’s Nick McCarthy provides a live musical score for a one-man puppet show of Shakespeare’s The Tempest. That’s not something you’ll see every day.

» Wilton’s Music Hall, 1 Graces Alley, E1 8JB. Jul 5-Sep 9. ( Prices vary. Algate East

Andrew Benge & Caitlin Mogridge, Dave Hogan

■ LIVE FEST What: London’s largest indoor festival is spread over numerous venues in the O2. USP: See some of some of the UKs finest urban acts including N-DUBZ, Tinchy Stryder, Roll Deep and Tempa T. Middleof-the-road popsters The Hoosiers are also on the bill and post-hardcore rockers Funeral For a Friend will provide a DJ set.

» The O2, Peninsular Sq, SE10 0DX. Sat Jul 23. ( From £40 North Greenwich. ■ SHOREDITCH FESTIVAL What: Traversing 3km of Regent’s Canal, Shoreditch Festival will showcase live music, film screenings, boat trips, theatre, a floating forest, food markets, health hubs and much more.

USP: It’s a partially set on water and features floating attractions such as The Floating Cinema at Shoreditch Trust’s Waterhouse Restaurant (N1 5QJ).

» Regents Canal. Jul 16-24. (shoreditch Free. High Street.


■ LOVEBOX What: Lovebox has blossomed into one of London’s biggest clubbing events of the summer. Headliners this year include Scissor Sisters, The Wombats, Example, Beardyman, Ed Banger. USP: Snoop Dogg will perform his classic Doggystyle album in full, with help from Warren G. Expect to hear Gin and Juice, What’s My Name and the x-rated Ain’t No Fun (If The Homies Can’t Have None).

» Victoria Park, Jul 16-18 (lovebox. net) From £28.50. Bethnal Green.

■ EALING BLUES AND COMEDY FESTIVAL What: Back-to-back festivals in Ealing’s vast Walpole park. Ealing’s Comedy Festival features 25 acts (including Omid Djalili, and Stephen K Amos) over five days, followed by Ealing’s legendary Blues Festival celebrating its 25th year with roots singer Sandi Thom topping the bill. USP: Two very good excuses to get out into the leafy suburbs.

» Walpole Park, W5. Comedy: Jul 1522. £17.50. Blues: Sat, Jul 23. £4. ( Ealing Broadway

■ MAYOR’S THAMES FESTIVAL What: A mixture of music, street arts, river races, art installations culminating in the magical, illuminated Night Carnival. USP: It’s the perfect way to have one final big weekend before summer ends. And it won’t cost a bean.

» Various venues, Ready to bring it: Tinchy Stryder plays Live Fest

Sep 10-11. (thames Free.




6 Wandsworth High Street, SW18 4LB ( Wandsworth Town

THE SCENE As it’s far enough away from any major public transport routes, locals need not share the Grand Union’s quaint surrounds with outsiders. Inside, vintage


decor and flea-market embellishments clamour for space amid a backdrop of chintzy wallpaper and the result is decadent. The draw, though, is a huge, dreamy oasis of a beer garden, adorned with hammocks and huts. THE GRUB Can’t go past the burgers and handmade pizzas. BEHIND THE BAR There’s an extensive range of beers and

ales on tap, plus the bottled favourites. But cockatils are the speciality and if you’re going to swing on a hammock, do it properly – with a Cacao Nut in hand. BILL PLEASE Cocktails, burgers and pizzas from £7.50. VERDICT This place has got soul –and it’s not just coming out of the speakers. REBECCA KENT

Restaurant Review The Scene ★★★★★

459 Kings Rd, SW10 0LR 020 3362 3362 Fulham Broadway (

THE SCENE At the Fulham end of the posh Kings Rd, The Scene mimics the trappings of a Hollywood diner, decked out in silver screen memorabilia. Matinee idols of the golden age stare down from photos on the walls and classic films play above the bar. It’s an attractive theme, albeit a familiar one, but the furnishings and the lay-out do little for the atmosphere. THE GRUB In keeping with the American-diner theme, you find plenty of red meat, spiciness and cheese. The beef chilli makes a perfect starter, although the decision to serve it with corn chips doesn’t quite do it justice. Foodwise, though, it’s all about the burgers – they’re enormous

FINE-DINING INDIAN PLACES Trishna Trade in chicken tikka for the coastal cuisine of southwest India – delicious seafood served up in stylish sharing platters – at this sleek Marylebone restaurant.


Hollywood style: be seen at The Scene

and packed with fillings. BEHIND THE BAR Pretty standard. It’s about £4 for a beer but the boozey milkshakes add a twist worth trying. BILL PLEASE Two courses and

a couple of drinks for £25. VERDICT A comfortable experience but the straightforward, diner-style food doesn’t quite justify the red-carpet prices. TOM STURROCK


The Red Fort



A traditional grill takes pride of place in the open-plan kitchen of this Soho stand-out where lobster dominates the menu.

Grand Union


This west London institution has been going strong for 34 years and draws a crowd every night of the week. Airy and atmospheric, Khans’ tandoori is top-notch.



Claim your Tax Refund now!

1 in 3 people are due an average Tax Refund of £850* > No refund – no fee! > FREE no obligation quote

> Over 200 000 successful claims > Member of the Association of Tax Agents

Log onto our website to receive a Tax Pack and unbeatable discounts.

0808 141 1600 43301_2

*£850 is roughly the average amount owed to a Tax Refund client. Your personal claim will depend on your individual circumstances. ** Terms and Conditions apply.

Have a yarn: get knitting

Tá Na: don’t get too excited, they’re just improvising …

Geek to chic Pursuits that were once the preserve of social misfits have gone mainstream WORDS REBECCA KENT

... and so are they

Ding dong: Boris made ping pong cool

xx xxx xxxx ,xxx ,xxxx xxx

Now rook here: chess is becoming popular

Ball sports: Pentanque is now hip



here was time cool cats wouldn’t be caught dead clicking a pair of knitting needles, or bellowing numbers in a bingo hall. But a core group of revivalists have made pastimes once deemed geeky bang on-trend again. Here are our favourite activities gone groovy.

STITCH, BITCH Stitch London is a prosaic rename for Stitch and Bitch but that hasn’t diminished the popularity of this group – a selfdescribed “radioactive woolly Godzilla with sticks and string”. This bunch of fiesty woolweavers meets once a week to click their needles over tea, cake or beer in pubs, parks and cafes.

» Stitch London, various times and locations. Free. (

SMASH IT At the end of the Beijing Olympics, Boris Johnson strode onto the stage and told the watching world in no uncertain terms: “Ping pong is coming home”. Cue one of the strangest public sporting phenomena to hit London. Get yourself down to King Pong at The Book Club for its weekly tournament. Alcohol is encouraged and random urine samples are not requested.

» King Pong, The Book Club, 100-106 Leonard Street, EC2A 4XS Shoreditch High Street £3 (

SING, SING, SING Besides group therapy, choirs are one of the only places where people can come together and express emotion for the greater good. American Pie’s Oz joined one and scored the girl who stuck a flute up her pussy. Though the pair didn’t do much for its image, the American TV hit Glee did. DD Glee, run by David Dellaire, a London-based voice teacher, recreates the Glee format in a south London studio.

» DD Glee, Arch 468, unit 4, 209a

Tom Chambers, TNT Images, Getty Images

Coldharbour Lane, SW9 8RU Loughborough Junction. £6 for a drop-in session (email

15 LEGS ELEVEN The grey-rinse brigade has left the building and the nutters of The Underground Rebel Bingo Club have moved in. This regular event stages bingo with a serious twist – a twist of lime in your alcoholic beverage, that is, which you’ll drink to very loud music. “It’s an attack on the senses,” say the organisers. Definitely not how Granny used to play, but times are a-changing.

» The Underground Rebel Bingo Club, location revealed upon purchase of ticket. Next meet is on July 30, 9pm-1am Tickets from £4. (

SO YOU THINK YOU CAN ACT Tá Na Deptford have made small performance crazy-fun. Meeting in a pub one night a week, attendees dive into a costume box, snatch a few zany props and improvise to DJ tunes – it’s an happy alternative to the usually ego-filled, uncool world of am-dram. The concept originated in Brazil, where it is a form of street theatre known as Tá Na Rua, but here its mission is to reflect London.

» Parliament Hill Fields Bowling Green, Hamstead Heath, NW5 1QR Gospel Oak. Daily from 1pm. Book at the adjacent tennis courts. £3.50 pp/ph. Equipment can be hired ( club/1704/)

TOSS IT UP Move over French cloth-capped pensioners – the English have just about made petanque, or French boules, their own. It might have something to do with the fact that it’s the most perfect outdoorimbibing sport.

» Balls Brothers Hay’s Galleria, Tooley Street, London, SE1 2HD London Bridge. Book the pitch for free. (

» Tá Na Deptford, Amersham Arms pub, New 388 New Cross Road, SE14 6TY Cross. Every Wednesday, 7pm-10pm. Free. (

CHECKMATE Garry Kasparov, the Russian high priest of chess once called the strategy game “mental torture”. At the Wargrave Arms each Tuesday night there’s none of that. Get along, have a beer and pin down an opponent who won’t make you look like a flop. If you do flop, no one will care anyway.

THE GREAT TILE REVIVAL We all played dominoes as kids – until we discovered video games. However, West Indians across the capital, and anyone who dares take them on, are getting psyched about their ivory tiles and foldaway tables. Bar Sequence, a cocktail establishment in the heart of Islington is also trying to keep this deceptively complicated game of dots alive.

» Wargrave Arms, 40-42 Brendon Street,

» Bar Sequence, 43 Essex Road, N1 2S


Angel. Thursday nights. (

Edgeware Road. 7.30pm. Free.

A CURVE BALL No longer the preserve of the geeky and superannuated, lawn bowls has been embraced in the capital. It’s how Londoners roll on laidback summer days, even if many of us use needless velocity and dispatch the bowls into the fences surrounding the green.

Gleek: sing your heart out



Email us at marketing@ with ‘Spotted’ in the subject line, email must include a photo of yourself! You’ve won a Lonely Planet (lonelyplanet. com) guide of your choice.


JUNEFEST 2011 Fest Pub, Fulham, Sun, June 26 Photos by: Nicola Bellinfantie/TNT Images

TNT online To find out whether you’ve been spotted log on to




I’ve just split up with a long-term girlfriend and although I resolved to keep it together, I’m finding it really hard. How can I get over her?



How we deal with adversity is the true measure of our character. Sure, you could sit back, slowly working through your feelings and eventually coming to terms with the fact you’ve gone separate ways while developing a real appreciation of the time you spent together. But that would make you a pussy, the kind of guy who allows his world to be shaped

TOOL OF THE WEEK Quit milking it

even though it’s hard. By now, Roxette’s Listen To Your Heart is the soundtrack, like at the end of Pretty Woman, before Richard’s Gere rich businessman decided that, actually, he loved that whore and was going to make it work. Let’s be honest, I think we’ve all had our own ‘I love that beautiful sex worker’ moments over the journey. But, yeah, anyway. Your lady has gone. She’s probably sleeping with another guy by now. Get over it.

» Got a sex or relationship dilemma? Email dearreuben@


Getty Images; ThinkStock Images

Police officers encounter all kinds of weird behaviour in the line of duty, but basic training can’t prepare you for getting sprayed with breast milk. Officers in Delaware wanted to speak to Stephanie Robinette, 30, about a domestic dispute but when police approached her car she refused to get out. “She proceeded to remove her right breast from her dress and began spraying deputies and the vehicle with her breast milk,” sheriff Walter Davis said. Still, it’s better than a shot of pepper spray.


The end of a relationship by other people and events can be brutal. You’ll outside his control. likely find yourself sitting in I’ve actally written a series your apartment staring out the of self-help books that I think window at the rain, wondering could be helpful – they take if it’s raining where she is, Neitzsche’s idea of the will while U2’s Without Or Without to power and apply it to our You plays in the background. everyday lives. I suggest you A montage of all the happy start with my first title, Cast Off times you Your Slave shared plays Mentality and on a loop in Embrace Your your mind, Inner Amoral maybe cutting Superman. away to her It was very at opportune popular among times, survivalists, showing her gun ownership getting on activists and t When it’s raining – in your hear with her life, Chelsea fans.

# 434


Silly Buggers™


Tour Search by

Think Skyscanner. But for Tours.



trips for 18 to 30 somethings L8291 / Y2992

Subject to availability. Flights not included. Price quoted is for specific departures only and price includes local payment based on €1 = £0.89, which must be paid locally in Euros. Exchange rates correct at time of printing, and subject to currency fluctuations, depending when payment is made.

Download Tour De als iPhone App now !



Need to send money between UK and home?

asons e r d o o G tforex: n t e s u to tes

» Great ra fees n bank e d d i h » No ons ansacti r t r e t s ems » Fa ne syst i l n o e s u pliant » Easy to lly com u f d n a ure vice » Safe, sec mer ser o t s u c d » Unrivalle

r e p a e h C e than th banks*

The easy way to move your money

0870-898 8996 *Source: 1st Contact survey of UK high street bank charges, April 2008.



Rebecca Kent WITH THE LATEST FROM THE WORLD OF SHOWBIZ Dangerous: don’t mess with Monk


There’s life after X Factor, Danni Minogue has been relieved to learn, having apparently been bombarded with offers of work, including a prime-time role on UK morning TV. Boom, lady!


Someone took offence to Robert Patterson’s good looks and splattered a custard cake in his face on the set of Cosmopolis. Sadly, the cream rubbed off quicker than we could get there to lick it.

TNT Images; Getty Images

AUSTRALIAN IDOL JUDGE DEAD Celebrity life reportedly became too much for Australian Idol judge, Jay Dee Springbett, 36, who was found dead in his Sydney home. Friends say the Sony music executive, a separated fatherof-two, had slumped into a deep depression. “Trouble followed Jay Dee wherever he went, but he was a very talented man,” Sunday Telegraph reporter, Jonathon Moran said. The cause of his death has not been confirmed.

NEW ZEALAND Woman’s Weekly: Bronagh Key, the wife of prime minister John Key likes to keep private, so she agreed to an interview with one of NZ’s highest-selling womens’ magazines and vows that she won’t absorb the pressures of John’s job, if she can help it. And then she said was something about raising kids. Yawn.


MONK: 1, PERVE: 0 Aussie bombshell Sophie Monk caught a stalker with his pants down after she confronted him on Skype.

Monk took her latest obsessed fan head on when he buzzed through. “He was ringing me all through the night to the point I had to turn my computer off … and all of a sudden this message comes up, ‘Can I please pleasure myself for you?’,’’ Monk told Fox FM. “I was like, ‘Hey’ and he was like, ‘Oh my God, it’s

really you!’ and I was like, ‘Yep! No, that’s the answer’ and he was like, ‘I’m so, so sorry, I didn’t know what I was doing, I’ll erase you right now’.” Before you get any copycat ideas, she has now erased herself from Skype. Monk also revealed she had a stalker on Facebook but didn’t erase him because “he might come murder me.” “I’d rather know what’s going on, keep your enemies close …” she said.


” I don’t find her to be an intelligent, together or strong woman” Shock jock Kyle Sandilands takes a broadside at Megan Gale

Woman’s Day: At the risk of a stampede, Dancing With The Stars heartthrob Manu Feildel is, wait for it ladies ...”open to love again”. Meanwhile, would-be suitors to Home & Away actress Jodi Gordon can expect to be blanked. She tells the mag she’s getting hitched to NRL player Braith Anasta.

SOUTH AFRICA Heat: Victoria Beckham is about to pop out her fourth child, and you think she’d smile about it. But no. She’s got the baby blues and, as usual, she looks like she swallowed a raw egg. The half-naked picture of Daniel Wessels, ‘officially’ SA’s hottest man, on the cover might put a smile on her face. It worked for us.




TNT LIFE Rousing: Bilbao BBKxxx Live xxx is a world-class event


Teach English abroad


Teaching English as a foreign language is a great way to earn a bit of cash while you travel. Invest in an 18-hour TEFL course and you will be qualified to teach children, teenagers or adults throughout the world.

WHAT Learn how to speak French or Spanish with TNT’s Learn the Lingo classes.

WHEN July 12 and 13, for five weeks

WHERE St Paul’s YHA, Carter Lane, EC4V 5AB St Paul’s. See

» TNT’s Learn the Lingo. YHA Holland Park, Sat, Jun 11. £150. High Street Kensington. See

Teach kids English

TNT online

ROCK OUT AT BBK Coldplay will headline Bilbao BBK Live this week, recreating the explosive set that thrilled audiences at Glastonbury. The Black Crowes, Crystal Castles, Chemical Brothers, Jack Johnson, Kaiser Chiefs and Blondie will also entertain festival-goers. The event is on a stunning hilltop on the outskirts of Bilbao – and the beach only a stone’s throw away. Don’t miss it.

» Bilbao BBK Live, July 7-9. Fly to Bilbao or Santander. A 3-day pass incl. camping costs £96. See


Ooh la la

SPOTLIGHT ON TNT LITTLE BLACK BOOK Like free stuff? Get yourself a copy of TNT’s Little Black Black Book – packed with deals on food, clubbing, theatre, beauty, gyms and much more.

» £6. See

HOW TO ENTER Go to See webpage for terms and conditions. Winners will be selected at random

WIN TICKETS TO LIVE FEST 2011 TNTT and Live Fest have teamed up to give SIX lucky readers the chance to win a pair of tickets (worth £80) to Live Fest 2011, London’s biggest indoor music festival, at the O2 on July 23. The line-up includes N-Dubz, Tinchy Stryder, The Hoosiers, Roll Deep, dan le sac Vs Scroobius Pip, Tempa T and many more. Enter at

» Tickets can also be bought from

TNT Images

For a full list of London entertainment log on to



King Kapisi The veteran New Zealand rapper on why he doesn’t believe in God and the unrealistic expectations of the next generation INTERVIEW ALISON GRINTER You were born and bred in Wellington to Samoan parents. That must give you a unique insight on things …

I was born in Wellington but went to Samoa at the age of seven and I was amazed that there was a whole bunch of people like me, talking my language. Until then, I thought I was a Maori. It was a real eye-opener. Samoans are very religious people. I had to go to church when I was younger. We went to a Methodist church but one day my mum gave me the option of going or staying home. She said: “You wanna stay home and watch Star Trek or go to church? My cousins never got that option. I’m part of probably .01 per cent of the Samoan population around the world that doesn’t believe in God. What’s your beef with religion?

God has not done anything for me. Our people are so religious that they throw money at the church and at the pastor, who lives in a flash house. The amount of money Samoan families feel they have to give to the church to keep face is silly. I thought, “If God was a real god, he wouldn’t be asking for money.” You often talk about the importance of “keeping it real”. What does that mean to you?

I’m just always on the buzz that if you respect others like you want to be respected, well that’s the overall thing. Polynesian hip hop has become a force to be reckoned with but is there a lot of pressure to ape the Americans?

The origins of hip hop are in New York but then you can mold

If God was “ real he wouldn’t ask for money

them into something you can call your own. When I was younger I sounded American, because everyone starts out doing that. I’ve since developed my own style and now I rap like me. After performing in the South Bronx at a place called Crotona Park [in 2003], honestly I could have retired – I met DJ Kool Herc, the godfather of hip hop, and the Furious Five. Just going back to the home of hip hop, I became aware that although the art form has grown, it’s still the voice of the youth, it’s just people telling their stories – and the stories I tell tend to be from a Polynesian point of view. You’re not a youth though ...

But I still think I’m 23. I’m older but I’m still living the same dream I was when I was 19. And you have to go out and

learn new things. I now do my screenprinting and editing, produce my own music videos and have my own clothing line … and I manage myself. You’re like the Jay-Z of the Antipodes.

I wish I had his money. My wife and I have our own record label Quabax Wax. We’ve been looking into developing other acts but I would hate to take hold of another person’s career and then mess it up, because it’s happened to me before. I’ve seen a lot of artists pulled into record deals and the labels don’t know what to do with the artists. What advice do you have for young rappers?

So many are just waiting for someone to hand success to them on a plate. They haven’t got that drive or motivation. They tell me, “I’m an incredible rapper” and I say, “Cool, so am I, what else have you got?” Instead of writing one rhyme or one song, you’ve got to have 25 ready to go. Then you’ve got to shoot three videos and get the album out to the local and commercial radio stations. You’ve got to have all these things ready to go. Where does the name King Kapisi come from?

I just liked the way it sounded. I could have just as easily have been called Bran Muffin, one of my favourite foods, or I could have been MC KFC.

» At Origins Festival of First Nations at Rich Mix, 35-47 Bethnal Green Rd E1 6LA Bethnal Green ( uk). Tue, Jul 5. £9. New album Hip Hop Lives Here out soon.



Emotional: Liana Liberato in Trust


STARRING: Clive Owen, Catherine


Keener, Liana Liberato CERT: 15 RT: 106 MINS


You have to hand it to David Schwimmer – the man isn’t afraid to try new things. After cutting his directorial teeth on comedy Run Fatboy Run, the former Friends star delves into the murky world of internet sexual predators for this shocking drama. Newcomer Liana Liberato is superb as Annie, a 14-yearold who strikes up an online friendship with Charlie, who she thinks is a teenage boy. She finally meets him face-toface, only to discover he’s a middle-aged predator who’s been grooming her. When her father Will (Owen) finds out his daughter has been raped, it rips him apart – his anger and frustration made worse by Annie’s inability to see anything wrong with what Charlie has done. Exploring topical themes

1 From which town does Clive Owen hail? 2 In which film did Owen make his debut? 3 In a 2005 poll, Owen was voted the top choice to play which character? 4 Apart from Owen, which actors complete the love triangle in Closer? 5 In an upcoming film Owen is to play in an American writer. Name him.

like parenting in the technological age and the sexualisation of children in advertising with subtlety and restraint, Schwimmer does a fine job behind the camera. He’s helped by powerhouse performances, with Owen again underlining his class and Catherine Keener equally

impressive as Annie’s mother. Trust is not a flawless film but there is enough here to suggest Schwimmer has a bright future as a filmmaker. GOOD FOR: Redefining “Ross”. PIERRE DE VILLIERS

» Read our interview with David Schwimmer on page 2 .

She may be one of the world’s highest grossing actress, according to Forbes. com, but Aussie superstar-inthe-making Mia Wasikowska is yet to fly the family nest. “I don’t have a place of my own yet,” the star told Sydney Confidential at the premiree of her new film, Jane Eyre. “When I’m not working I still go back to Canberra where I live with my family. It’s nice to be able to decompress.” Not that Wasikowska has time to be a homebody – she’s due to shoot three films, Stoker; A View From The Bridge; and a Jim Jarmusch project, in quick succession.

LAST WEEK’S ANSWERS 1 Big 2 Heart And Soul, Chopsticks 3 Saving Private Ryan 4 Antonio Banderas 5 Rita Wilson WINNER Terence Choi


Brad Pitt and Cole Cockburn


Terrence Malick explores family life and the universe in a riveting drama that has Sean Penn’s troubled architect look back at, among other things, the relationship with his strict father (Brad Pitt). Complex and profound, Malick’s masterpiece is heaven sent for those who want to be challenged when they go to the cinema. GOOD FOR: A break from vacuous blockbusters. PDV



The Autobots and Decepticons tear chunks out of each other as Shia Labouef’s Sam is again caught in the middle. Rosie Huntington-Whiteley turns in the worst acting debut you’ll ever see and the storyline’s overly complicated, but the climactic showdown is sensational – especially in 3D. GOOD FOR: Switching your brain off. PDV

Shia LaBeouf and Rosie Huntington-Whiteley

Getty Images, Robert Zuckerman

To win a copy of Drive Angry out now on DVD and Double Play Blu-ray, through Lionsgate Home Entertainment email answers to grabs@ tntmagazine. com with “Drive” in the subject line.


THE REEL DEAL Carey Mulligan (below) must have a little thing for Australia. The Oscar-nominated actress was already heading to Australia to play the lead role in Baz Lurhman’s 3D version of The Great Gatsby, and has now signed up for another Oz-based cinematic production. According to Hollywood trade mag Variety, the British actress will star in a sci-fi action flick called Outback. The film will be directed by Hollywood stalwart Gary Ross – who penned films Big, Seabiscuit and Pleasantville. Mulligan’s Gatsby co-star Tobey Maguire is slated by Variety as one of the producers of Outback.


CULTURE EMPEROR AND GALILEAN Ibsen thought this his most important play, but with a potential running time of eight hours, you’re unlikely to get the chance to see it again. So all credit to the NT for putting on Jonathan Kent’s mixed dress production (a British premiere) of this 1873 epic, cut to three-anda half hours hours in Ben Power’s lucid version. The magnificent staging makes full use of the revolve and 50-strong cast. Andrew Scott is magnetic as the fanatical Julian (AD331-363) who was raised a Christian but (encouraged by Ian


SEE THIS: Theatre McDiarmid’s Maximus) embraced pagan beliefs well before his brief, tyrannical reign as Emperor of Rome. But it’s still a long haul as Julian searches for truth from Constantinople to Gaul to the Persian desert – and one with only limited appeal. LOUISE KINGSLEY


» Olivier at the National, South Bank, SE1 9PX Waterloo (national In rep until Aug 10. £12-£30

TNT online For more reviews see

Andrew Scott as Julian and Genevieve O’Reilly as Helena

WORTH A LOOK As I Like It is a play about a woman who has everything but love » Chelsea Theatre, World’s End Place, Kings Road, SW10 0DR

of Music and Dramatic Art take up residency •The London Academy Hammersmith ( Jul 4-12. Free

Sloane Square ( Jul 4-14. £15

at the Lyric with A Gloriously Mucky Business » Lyric Hammersmith, 2 King Street, W6 0QA






Kamin Mohammadi

Alastair Campbell

(Bloomsbury) JULY 4

(Hutchinson) JULY 7

Kamin Mohammadi was nine years old when her family fled Iran during the 1979 Revolution. In this memoir she recalls trying to fit in with British attitudes to family, food and freedom.

The third volume of spin doctor Alastair Campbell’s unique daily account of life at the centre of the Blair government. It begins amid conflict in Kosovo, and ends on the world-changing day of September 11, 2001.

A TASTE OF HOME: Angela Hartnett


(Vintage) OUT NOW

Lisa Maxwell

Two hundred quick and easy recipes from the Michelinstarred chef who draws inspiration from her childhood experiences of accessible home cooking with her Italian grandmother.

(Harper Collins) JUL 7

You wont see any dirty papparazzi upskirts here. Glamour of the Gods celebrates Hollywood portraiture from the industry’s ‘Golden Age’, (1920-1960) when studios tightly controlled the images of their stars.

With more than 70 glorious images of luminaries like Liz Taylor and James Dean, the exhibition demonstrates photography’s role in creating Hollywood’s mystique.

» National Portrait Gallery, St Martin’s Place, WC2H 0HE ( Leicester Square. Jul 7-Oct 23. £6

Catherine Ashmore; George Hurrell © John Kobal Foundation, 2011

Clarke Gable and Joan Crawford for Dancing Lady, 1933

Lisa Maxwell, the newest addition to the quick-witted Loose Women, tells how being her family’s “dirty secret” as an illegitimate child weighed down on her from a young age.

MORE EXHIBITIONS US assemblage artist presents a selected collection of her ‘box art’ pieces Dwora Fried: Boxed In

» Woolfson & Tay, SE1 3UN Printmakers

London Bridge (

Jul 5-Aug 31. Free

Screenprints by Maureen Sweeney » Greenwich

Greenwich ( Jul 5-17. Free


avid Schwimmer has some depressing news for Friends fans still hoping the cast of the hit comedy show will one day reunite for a movie. Ask the man best known for playing goofy paleontologist Ross Geller if there’s any chance of the coffee-house six appearing on the big screen and he replies with a firm “No”. “The six of us haven’t even been in the same room in seven years,” Schwimmer points out. “After the show ended we immediately went our separate ways. The whole cast has such different careers, families and stuff going on. The person I speak most often to is Matt LeBlanc but it’s hard because I live in New York and got my life going on and he’s in LA with his own life. To be honest, unless it is brought up in an interview or a fan approaches me, I don’t think about Friends anymore.”

I am critical “ of using young

models in a sexualised way

TRUST ISSUES David Schwimmer made his name in Friends but, as the director of a hard-hitting new drama about rape, has he finally left goofy Ross behind for good? WORDS PIERRE DE VILLIERS

Just how much Schwimmer has moved on since the days of Central Perk is clear when you look at his latest film. Trust, which the 44-year-old directs, is a hardhitting drama about a 14-year-old girl (played by Liana Liberato) who unwittingly befriends a sexual predator online. When her father (Clive Owen) discovers his daughter has been raped by the man, guilt and rage tears his life apart. Schwimmer decided to make it after hearing a heart-breaking speech at an event for the Rape Foundation in California, of which he is a board member. “About seven years ago we had a father speak at one of our annual fundraisers about his experience when his daughter had been brutally raped,” Schwimmer recalls. “I was in the audience listening to this man and seeing him shaking at the podium, powerfully describing what he went through – the feelings of rage, guilt, helplessness and responsibility. His marriage and work almost fell apart and his life was almost destroyed by it. It was so moving that I thought I really want to tell that story.” Trust also explores the sexualisation of


Getty Images

Guidance: Schwimmer directs Liana Liberato in Trust

children in advertising, a hot button topic in England at the moment. Schwimmer isn’t afraid to weigh in on the debate. “I am openly critical about using younger and younger models in advertising in a very sexualised way,” he says. “I think it is really irresponsible and I think there should be more of a public outcry about these images that our kids are being inundated with. I think we have fewer and fewer role models for young adults, especially young women, with pop stars having to use their sexuality in a way that you have to wonder what the message is that we are sending our girls.” While the well-crafted Trust shows Schwimmer has a real future behind the camera, the star is keen to keep acting and is even be up for doing another TV show. “If I do decide to do another show it will most likely be on a cable network like HBO because of the time commitment,” he explains. “On cable shows they only do nine to 12 episodes a year, rather than 22 or 24, so it would enable me to still do a play, direct or do a movie.” Good time management is of particular importance to Schwimmer since becoming a father for the first time. His British wife Zoe Buckman – whom he met while making directorial debut Run Fatboy Run

Parenthood: Schwimmer with wife Zoe Buckman

Forget it: Friends ain’t going to make a comeback

in London in 2007 – gave birth to baby girl Cleo in May. “Being a father is amazing,” Schwimmer says. “It is really strange because now is my first time away from the baby and my wife since we had her seven weeks ago so it’s weird. I’m a little uneasy being away from her. I miss her so much.” Schwimmer is already looking forward to spending quality time with his daughter when she’s a teenager, with the prospect of introducing her to six friends who like hanging out in a New York coffee shop causing the star smile broadly. “I haven’t seen Friends in eight or nine years but I thought about watching it again recently because of my daughter,” he says. “When a friend of mine saw Cleo for the first time he said, ‘How great is it going to be when she’s like 14 and gets to see you do that show’. And I thought, ‘Wow, that’s going to be really interesting to introduce her to that character and my work’. That would be really fun for her and maybe fun for me. It will be a bit like watching a home movie and seeing how young I used to be. I probably won’t watch the show again until I watch it with her.”

» Trust is on general release from Fri, Jul 8. See page 24 for our review.




FAST FORWARD Anna Calvi Shepherd’s Bush Empire, Nov 1 (0844 477 2000). £12.50. The Cat Empire Shepherd’s Bush Empire, Oct 20 & Brixton Academy Oct 21 (0844 477 2000) £22.

BLONDIE Panic Of Girls (EMI)


Looks good, sounds good Deborah Harry

CSS XOYO, Aug 23 ( £15.


A few decent singles and a hectic touring schedule have kept Blondie on the radar since their 1997 reunion, but let’s not kid ourselves: they haven’t been a force to be reckoned with since their 1980 album Autoamerican. And, unfortunately, Panic Of The Girls is no back-to-form effort in the vein of Paul Simon’s So Beautiful Or So What.

Death From Above 1979 Brixton Academy, Oct 7 (08444 77 2000). £21.50.

Though redolent of Blondie’s best works, with lashings of languid reggae and spiky new wave, nothing here is close to the pop perfection the New York City band were famed for.

Deborah Harry’s voice, a contradiction of sweet girlishness and womanly strength, is the album’s best feature. Sadly, it’s not enough. ALISON GRINTER




Fly From Here (Frontier) The archetypal English prog-rock band, formed in the late 60s, put out their twentieth studio LP.

Soul UK (Hurricane) The British soul singer, who channels Aretha Franklin, releases her seventh studio album.

When The Sun Goes Down (Polydor)

Justin Bieber’s squeeze Selena Gomez releases her third album in two years.

MUSIC NEWS Angus & Julia Stone

Angus and Julia Stone took the top gong at this year’s Australasian Performing Rights Association (APRA) awards. The brother and sister duo beat fierce competition from The John Butler Trio, Sia, Birds of Tokyo and Kasey Chambers to win the songwriter of the year and song of the year award for


their single, Big Jet Plane – from their latest album Down The Way. Other winners included Megan Washington, who took home the breakthrough songwriter of the year award for her debut album I Believe You Liar; The John Butler Trio, who garnered the blues and roots work of the year for their single Close To You; and AC/ DC, who took out the award for most-played Australian work overseas for their 1979 single Highway to Hell.

and/or rare tracks when they reissue their entire back catalogue next month. Previously unheard tracks include covers of The Doors’ Light My Fire, and Randy Newman’s Guilty plus a raft of demo tracks. The band’s six albums will be reissued, also in digittal form, on July 22.

Aussie pub rock icons Cold Chisel will release 56 new

Cold Chisel




No 1 single Someone Like You, Adele No 1 album 21, Adele

No 1 single Someone Like You, Adele No 1 album 21, Adele

No 1 single The Lazy Song, Bruno Mars No 1 album Wees Lig, Juanita du Plessis

No 1 single Don’t Want To Go Home, Jason DeRulo No 1 album Born This Way, Lady Gaga

Josh Groban Hammersmith Apollo, Oct 11 (0844 844 4748). £40. G Love Union Chapel, Sep 15 (0870 264 3333). £15. Gurrumul Barbican, Oct 6 (020 7638 8891). £12.50£22.50. (On sale July 6) Paul Kelly Bush Hall, Aug 30-Sep 2 (0870 264 3333). £15 or £42 for four nights. Ke$ha Hammersmith Apollo, Jul 13 (0844 844 4748). £25. Metronomy Royal Albert Hall, Oct 3 (020 7589 8212). £25. The Specials Brixton Academy, Oct 31 (08444 77 2000). £35. Public Enemy Forum, Sep 8 (0844 844 0444). £25. Suicidal Tendencies Electric Ballroom, Aug 15 (0870 264 3333). £17.50. Yann Tiersen Roundhouse, Oct 20 (0870 264 3333). £17. The Vaccines Brixton Academy, Dec 8 (0844 477 2000). £17.50. Wilco Roundhouse, Oct 28-29. (0844 482 8008). £32. Wild Beasts Shepherd’s Bush Empire, Nov 23 (08444 77 2000). £17. Dweezil Zappa plays Zappa Barbican, Nov 29. (020 7638 8891). £29.50.

Getty Images


Liam Finn XOYO, July 20 ( £15.75.




GIG OF THE WEEK TAKE THAT Take That have garnered just as many column inches for the state of their fans as they have for their actual comeback tour. The band has reunited with Robbie Williams for the first time since 1995 and, according to some reports, women of a certain age have been getting so shitfaced at recent concerts that there has been a spike in hospital admissions. More power to the middle-aged boy band for still having that effect on their fans. Expect more mass hysteria as their Progress tour continues.

» Wembley Stadium, Olympic Way, HA9 0WS



Park (0844 980 8001). Until Jul 9. £50 All smiles: Take That are back



Lou Reed has a reputation for being such a grumblebum that even feisty journalist Caitlin Moran admitted to being scared at the prospect of interviewing him. But as he’s the onetime The Velvet Underground frontman – and writer of classic tunes like Walk On The Wild Side – the sexagenarian can be forgiven for his moods.

John Butler has more of a spring in his step since he jettisoned his band’s previous line-up and introduced Nicky Bomba on percussion and Byron Luiters on bass. His subsequent album, April Uprising, showcases the Freemantle roots muso – and part-time eco-warrior – at his most deft and experimental yet.

» Hammersmith Apollo, Queen Caroline St, W6 9QH

» Shepherd’s Bush Empire, Shepherd’s Bush Green, W11 8QE

Hammersmith (0844 844 4748). Mon, Jul 4. £45


Shepherd’s Bush (08444 77 2000). Wed, Jul 6. £20

FESTIVAL WATCH Coming up Benicassim The Streets, Paolo Nutini, Pendulum, Portishead, The Strokes, Arctic Monkeys, Primal Scream, Elbow. Benicassim, Spain (fiberfib. com) Jul 14-17. W/e £145.

Alice: more purple than gold

Alice Gold

Getty Images

THE BUZZ SO FAR The Surrey-born songsmith arrived on the scene

late last year declaring: “There don’t seem to be enough electric-guitar-wielding girls around at the moment. The world needs more.” She quickly did her bit to redress this imbalance by unleashing her ballsy, electric-blues psychedelica on the unsuspecting yet delighted public. WHAT ELSE? She’s a vocal doppelganger for Sixties rock chick Janis Joplin, who she cites as her chief inspiration. THE PLUG Debut LP Seven Rainbows out Jul 4. At Roundhouse, NW1 8EH Chalk Farm ( Jul 13. Free

Cambridge Folk Festival Laura Marling, Richard Thompson, Rumer, Newton Faulkner, Pentangle. Femi Kuti & The Positive Force, Kate Rusby, Raul Malo. Cherry Hinton Hall,Cambridge, ( Jul 28-31. W/e £114. Lounge On The Farm The Streets, Ellie Goulding, Echo & The Bunnymen, Example, Katy B. Merton Farm, Canterbury ( Jul 8-11. W/e tickets £85

The Garden Festival Art Department, Crazy P, Incarnations, Tensnake. Petrcane, Croatia (the Jul 6-13. W/e £90. Wickerman Echo & The Bunnymen, Feeder, The Damned, Utah Saints, Riva Starr, The Coral Noisettes,The Hoosiers Dumfries & Galloway, ( Jul 22-23. W/e tickets £90. Womad Afrocubism, Gogol Bordello, Rodrigo y Gabriela, Baaba Maal, Aurelio & The Garifuna Soul Band, I Am Kloot, Alabama 3, Jazz Jamaica, CW Stoneking, Dhol Foundation. Charlton Park, Wiltshire ( Jul 29-31. W/e tickets £120.

MUSIC LISTINGS MOR posterboy: Bryan Adams



The Turbans, Arhai, Molotov Jukebox Balkan, Turkish,

and thrash metal by the Los Angeles-based outfit. The

Middle Eastern and Persian music by the band from London.

The urban-pop quartet from Los Angeles performs songs from its repertoire.

Underworld, Camden High St, NW1 0NE (020 7482 1932). £13.50.

Rich Mix, Bethnal Green Rd, E1 6LA (020 7613 7498). £8, adv £6.

Koko, Camden High St, NW1 7JE (0844 847 2258). £17.50.

Zingaros The Argentinian

Paul Hazel Showtunes and

Bishopsgate, EC2N 4AG (020 7496 1610). £12, adv £10.

Far East Movement


Terror, Death By Stereo, Alpha And Omega Hardcore

collective plays Gypsy folk and swing. St Ethelburga’s,

songs from musicals by the vocalist. The Pheasantry, Kings

THePETEBOX Beatboxing from the Nottingham-based musician. Hoxton Square Bar And Kitchen, Hoxton Sq, N1 6NU (020 7613 0709). £8.

Joel Sarakula, Arts And Crafts, Chutes The Australian singer-songwriter and multi-instrumentalist plays acoustic pop with elements of rock and soul. Bull And Gate, Kentish Town Rd, NW5 2TJ (020 8826 5000). £6, w/flyer £5.

James Walbourne And Band, Dreaming Spires, Two Fingers Of Firewater Modern folk-rock from the Londonbased singer-songwriter and group. The Lexington, Pentonville Rd, N1 9JB (020 7837 5371). £6.


Blaze: Penguin Cafe, Beth Jeans Houghton The ensemble

Backbackforwardpunch, Butterflies On Strings, My Friend Eject, Test Tone Generators Electronica

performs an experimental blend of post-jazz, electronica and contemporary classical music.

from the three-piece. Dublin Castle, Parkway, NW1 7AN (020 8806 2668). £7, adv £5.

Lou Reed & Band The

Apollo, Queen Caroline St, W6 9QH (0844 844 4748). £38.50-£45.


BRYAN ADAMS The O2, SE10 0DX North Greenwich (0844 856 0202, Thu, Dec 8. £38.50-£45. Sure he’s become the poster boy for bland MOR adult rock in recent years but let’s not forget the Canadian’s one great rock album, Reckless (1984), which spawned the equally brill Summer of 69.

Blaze: Calle 13, Wara Latin funk by the Puerto Rican combo. Hackney Empire, Mare

Blaze: Sharon Jones & The Dap-Kings Retro soul with a Motown feel from the Brooklynbased singer as she promotes her album I Learned The Hard Way, with her backing band. Barbican Centre, Silk St, EC2Y 8DS (020 7638 8891). £20-£25.

Weezer Singer-songwriter and guitarist Rivers Cuomo leads his Los Angeles-based outfit in playing power-popinfused anthemic rock. O2 Academy Brixton, Stockwell Rd, SW9 9SL (0844 477 2000). £35.


The Border Surrender, Mabel Love, Foreign Office The North London-based four-piece plays pop-infused Americana, blues and folk. Bull And Gate, Kentish Town Rd, NW5 2TJ (020 8826 5000). £6, w/flyer £5.

Warren Haynes Band Bluesrock and Americana from the New York-based singer-guitarist and colleagues. O2 Shepherd’s

John Butler Trio The Australian vocalist and guitarist leads his outfit in playing energised roots and funk-infused rock. O2

the Canadian three-piece.

Shepherd’s Bush Empire, Shepherd’s Bush Green, W12 8TT (020 8354 3300/ cc 0844 477 2000). £20.

The Budos Band, Charles Bradley The Staten Island-

Chicago The American rock band perform some of its greatest hits, including If You Leave Me Now and Hard To Say I’m Sorry. HMV Apollo, Queen Caroline St, W6 9QH (0844 844 4748). £39-£45.

Bush Empire, Shepherd’s Bush Green, W12 8TT (020 8354 3300/ cc 0844 477 2000). £20.

Cloud Control, Monument Valley The Sydney-based

Neon Trees Alt rock from

band plays ecstatic indiepop. The Social, Little Portland St,

the American outfit. The

W1W 7JD (020 7636 4992). £9.

Barfly, Camden, Chalk Farm Rd, NW1 8AN (0844 847 2424). £10.

Filthy Whisky, The Chakras, The Din, The Hamptons

Cargo, Rivington St, EC2A 3AY (020 7739 3440). £8.50.

based outfit plays instrumental soul. O2 Academy Islington, Parkfield St, N1 0PS (020 7288 4400/ cc 0844 477 2000). £18.50.

Death Cab For Cutie Melodic indie-rock from the American four-piece, promoting its album, Codes And Keys. O2 Academy Brixton, Stockwell Rd, SW9 9SL (0844 477 2000). £22.50.

based outfit plays indie-rock.

Southampton-based band plays Americana, countryblues, rockabilly and skiffle.

The Borderline, Orange Yard, Manette St, W1D 4JB (0870 060 3777/ cc 0871 231 0842). £8.50.

The Borderline, Orange Yard, Manette St, W1D 4JB (0870 060 3777/ cc 0871 231 0842). £10.

Rahat Fateh Ali Khan

songs performed by original bassist Bruce Foxton, The Clapham Grand, St John’s Hill, SW11 1TT (020 7223 6523). £20.

Gipsy Kings The outfit plays a vibrant fusion of flamenco-pop and rumba. English Heritage: Kenwood, Hampstead Ln, NW3 7JR (020 8348 1286). £29 & £38, concs £27.50.

the London-based singersongwriter. Cargo, Rivington St, EC2A 3AY (020 7739 3440). £8.50.

The Transmitters, Wild Archive, Bobby Treacle, Rude Mechanicals Indiepunk from the four-piece. The Enterprise, Haverstock Hill, NW3 2BL (020 7485 2659). £6, adv £5.

Unknown Mortal Orchestra

Memory Tapes New Jerseybased indie-pop artist Dayve Hawke promotes his LP Seek Magic. XOYO, Cowper St, EC2A 4AP (020 7729 5959). £11.50.

from the Denver-based husband and wife combo. Cargo, Rivington St, EC2A 3AY (020 7739 3440). £10.50.

Carmen Rodgers Soul from the American singersongwriter. The Jazz Cafe, Parkway, NW1 7PG (020 7485 6834/ cc 0870 060 3777). £17.50.

Summer Series: Stornoway

The Huxleys, Fiona Culley, Jake Lennon

WC2R 1LA (020 7845 4600). £22.50.

Soft rock with a retro feel by the London-based band. The Troubadour, Old Brompton Rd, SW5 9JA (020 7370 1434). £8, free before 10pm.

Imaani The vocalist sings soul

Alt-indie folk quartet from Oxford. Somerset House, The Strand,

Yuri Da Cunha Angolan musician. The Coronet, New Kent Rd, SE1 6TJ (020 7701 1500). £30.


and R‘n’B. 606 Club, Lots Rd,

Bad Religion The American

SW10 0QD (020 7352 5953). £12.

outfit plays punk-rock. HMV Forum, Highgate Rd, NW5 1JY (020 7344 0044). £17.50.

Sarah Nixey, Cinemawave, Faults Indie-pop by the ex-Black Box Recorder vocalist. Archangel,

Old St, EC1V 9NG (020 7638 8891/ cc 0845 120 7591). £8-£22.

Pop Levi, The Hounds, Black

Social Distortion The

State Highway Psychedelic rock from the singer-songwriter.

Anuradha Paudwal With Debashish Das Gupta Bollywood music

Californian outfit plays punk-rock. O2 Shepherd’s

100 Club, Oxford St, W1D 1LL (020 7636 0933). £10, adv £8.

Bush Empire, Shepherd’s Bush Green, W12 8TT (020 8354 3300/ cc 0844 477 2000). £22.50.

Summer Series: Professor Green Hip-hop and rap

Summer Series: Eels, Jesca Hoop Mark Oliver Everett’s

Kensington High St, W8 5NP (020 7938 4137). £8, adv £6.

House, The Strand, WC2R 1LA (020 7845 4600). £22.50.

LA-based indie-rock group. Somerset House, The Strand, WC2R 1LA (020 7845 4600). £27.50.

Leftfield alt rock by the Portland-based combo. The Lexington, Pentonville Rd, N1 9JB (020 7837 5371). £7.

Monto Water Rats, Gray’s Inn Rd, WC1X 8BZ (020 7837 4412). £8.

Parkfield St, N1 0PS (020 7288 4400/ cc 0844 477 2000). £12.50.

artist from Hackney. Somerset

Tennis Lo-fi indie-pop

Lilygun Bleak-sounding rock with a flavour of grunge by the London-based outfit.

Green Note Cafe, Parkway, NW1 7AN (020 7485 9899). £10.

The virtuoso violinist performs world fusion and Indian classical music with the tabla player and the ensemble. LSO St Luke’s,

Water Rats, Gray’s Inn Rd, WC1X 8BZ (020 7837 4412). £8.

three-piece plays garage punk. O2 Academy Islington,

Queen Caroline St, W6 9QH (0844 844 4748). £35-£100.

The Green Note Cafe, Parkway, NW1 7AN (020 7485 9899). £12.

Kala Ramnath, Sanju Sahai And LSO Strings

E1 6RU (020 7770 6006). £7, adv £5.

Lucy Rose Indie-pop by

Guitar Wolf, Bo Ningen, Cool Kleps The Japanese

The singer-musician and a 15-piece group perform his Bollywood hits and spiritual Qawwali music. HMV Apollo,

Paprika Balkan and other Eastern European folk by the London-based combo.

Bluesy-rock from the Londonbased band. 93 Feet East, Brick Ln,

producer and rapper Tyler, The Creator leads his provocative alternative hip-hop crew.

Kristeenyoung Melodramatic pop by the New York-based singer-songwriter. Monto

SE10 0DX (0871 220 0260). £25-£50.

Modeste Hugues The awardwinning London-based singersongwriter and guitarist plays music from his hometown of Betroka, Madagascar, combining traditional sounds and South African dance rhythms. The

NW1 7PG (020 7485 6834/ cc 0870 060 3777). £22.50.

Odd Future Wolf Gang Kill Them All Los Angeles-based

Electric Ballroom, Camden High St, NW1 8QP (020 7485 9006). £15.

the experienced American outfit. IndigO2, Peninsula Sq,

Jackdaws The London-

Bettye Lavette Soul from the veteran American vocalist. The Jazz Cafe, Parkway,

The Emotions, Keni Burke Disco and soul by

Dodge Brothers The

From The Jam Classic Jam


Hackney Empire, Mare St, E8 1EJ (020 8985 2424). £13.50-£20.

St, E8 1EJ (020 8985 2424). £20.

Austra Electronica from


Gilad Atzmon Israeli world-bop reeds man. 606 Club, Lots Rd, SW10 0QD (020 7352 5953). £12.

Rd, SW3 4UT (020 7351 5031). £15.

American rock luminary and former Velvet Underground frontman is joined by a fivepiece backing group to perform material from his solo albums including The Raven, New York, The Blue Mask, Berlin and Transformer. HMV


Submit your free listing at least three weeks prior to the publication by emailing

TNT online For full listings info go to tntmagazine. com/whats_on

from the singers. Cadogan Hall, Sloane Terrace, SW1X 9DQ (020 7730 4500). £10-£30.

Melanie Safka Pop-folk by the experienced singersongwriter from America with her Brand New Key. Notting Hill Arts Club, Notting Hill Gate, W11 3JQ (020 7460 4459). £12.

Summer Series: Aloe Blacc The LA-based musician plays smooth R‘n’B and soul. Somerset House, The Strand, WC2R 1LA (020 7845 4600). £20.


THE SOUTH AFRICAN GOSPEL SINGERS “Note perfect” Jane Cornwell, Evening Standard


The original African super choir, the South African Gospel Singers, directed by Pinise Saul, maintains its position as the greatest gospel choir of them all. Formed in 1979 to fight apartheid, the choir remains its original spirits of creating uplifting music that lifts your soul. The choir continues to draw on Xhosa, Zulu and Suthu vocal traditions while embracing township and traditional harmonies, gospel, jazz and soul to create something that is beautiful and moving in the grand style of the very best South African music. The singers’ close harmonies combined with their skin-tight band, led by guitarist Lucky Ranku create a performance that is both soulful and joyous. The choir’s awesome vocal power and bursting exuberance creates music that lifts your spirit and soothes your soul. Join our mailing list at |

Monday 18 July | 7.30pm Queen Elizabeth Hall



BEST SHOWS with and receive amazing discounts! Last chance - closing in July!

Winner of 3 Olivier Awards

JULY 16 19 20 22 23 27 28



0844 847 2465 0844 499 9990 0871 472 0400 01273 673 311 08432 210 100 0844 477 2000 0844 847 8000




To see what’s on offer, check out:



Get a bit of DnB: Pendulum


Hard Core Salsa DJ Mario

GLOBAL GATHERING Long Marston Airfield, Stratford-Upon-Avon, ( July 29-30. From £62. Dance festivals don’t get much bigger than this (they don’t call it ‘Global’ for nothing) Two days and an endless line-up with Pendulum, Steve Angello, Eric Prydz, Carl Cox and more.

plays mambo and salsa, plus dance lessons. Salsa!, Charing Cross Rd, WC2H 0JG (020 7379 3277). 6pm-2am, last adm 1am. £4, free before 9pm.

I Love Mondays DJ Victor spins commercial dance, disco, pop, garage, R‘n’B and funky house. Moonlighting, Greek St, W1D 4DR (020 7437 5782/cc 020 7287 3727). 10pm-3.30am. £5, NUS £1.

Pride Monday Jonesey,


The Sharp Boys and Jamie Hammond spin progressive house in the main room, with live vocals and percussion from Tonnic and David H, while DJ Harvey Adam plays pop in the Stage bar, plus Terry T-Rex provides hip-hop and R‘n’B in the Star bar. Heaven, Charing Cross Arches, Villiers St, WC2N 6NG (020 7930 2020). 11pm-5.30am. £8.

Rehab DJs Val, Satoko, Zoe Demonettes, Joe, Saral and Hale supply indie, electro and pop.

Scewpulous play techno and house. Eagle, Kennington Ln, SE11 5QY (020 7793 0903). 9pm2am. £3, mems £2 before 10pm.

Latino Sound DJ Kirisis and CLI play R‘n’B, hip-hop and dance. Sound, Leicester Sq, WC2H 7NA (0333 240 1010). 9pm-late. £5-£10.

OMFG! DJs Lady Lloyd, Joshyou Are and Niyi Maximus Crown play pop, disco and electro, with host Queen B Munroe Bergdorf. The Shadow Lounge, Brewer St, W1F 0RF (020 7287 7988). 10pm-3am. £5, free before 11pm.

Panic! Max, Gaz and That Perfect Fumble play indie, electro and post-punk. The Roxy, Rathbone Place, W1T 1HJ (020 7255 1098). 10pm-3am. £5, w/flyer/NUS £3.

Stupid Tuesday Funky and soulful house, disco and pop. Thirst, Greek St, W1D 3DR

Martinez, Ekkohaus, Lovebirds, Tony Lionni, Tred Benedict, DJ Largo, Soy Mustafa, Kelly Sylvia and Sophie Lloydd spin deep house, Italo and Chicago house.

St, WC2B 5PW (020 7242 8600). 8pm-late. £10, free before 9pm.

Egg, York Way, N7 9AX (020 7871 7111). 10pm-6am. £20, adv £13.

Roller Disco Funk and disco for

Global Underground

Party Hard Or Go Home!

a wheeled audience. Renaissance

Darren Emerson, Jerome Isma-Ae, Weekend Heroes, Luke Fair, Pete Gooding, Jesse James, Jim & Dale Chambers, Wez Saunders, Matt Whittet, Terry Oxby, Sumadon and Yousif Do Mania & Mick Foley play dance, techno and house. The

Stevie C spins commercial chart, party anthems and retro hits on the ground floor, while Eddie J Santos spins funky house in the basement and Giovanni spins commercial R‘n’B in the VIP room. Zoo Bar,

(020 7488 1766). 11.30pm-3am. £10.

Diffrent Strokes Manny Norte, Phatcatz, Maintain, CJ I DJ, Lonyo and MOBO Award winner and Kiss FM DJ Manny Norte play neo soul, 1980s pop, US house and R‘n’B. Cherryjam, Porchester

1UQ (020 7582 9890). 11pm-8am. £10, w/flyer £6, £6 after 3am, £3 before 3am, £1 before 12midnight.

Rooms, opposite Arch 8, Arches, Miles St, SW8 1RZ (0844 736 5375). 8pm-midnight. £10, £7.50 skate hire.

The Tassel Clubs Dinner Party Resident DJs play swing, soul, blues and rock ‘n’ roll, plus live burlesque and cabaret. The

Borderline, Orange Yard, Manette St, W1D 4JB (0870 060 3777/ cc 0871 231 0842). 11pm-3am. £5, w/flyer £4, NUS £3, mems £2.

Bathhouse, Bishopsgate Churchyard, EC2M 3TJ (020 7920 9207). 6pm-late. £10, £45 inc meal.

Trannyshack Miss Dusty O,

With Bare Fists Zach Chudley

Tasty Tim and Lady Lloyd spin commercial dance and pop.

plays funk, electro, punk, new wave and indie, plus Trumpets Of Death perform live. Shacklewell

Madame Jojo’s, Brewer St, W1F 0SE (020 7734 3040). 10pm-3am. £6, w/flyer £3, free before midnight.

Voix De Ville DJs spin vintage swing and blues, plus cabaret and burlesque performances from Coco Du Bois, Dominic Pipkin, Elsie Diamond, Jo Foley, Elle Amour, Abi Collins and Betsy Rose. Proud Cabaret, Minster Court, EC3R 7AA (020 7482 3867). 7.30pm-1.30am. £10.

Work! DJ Big John plays

Arms, Shacklewell Ln, E8 2EB (020 7249 0810). 8pm-2am. £4.

YoYo Seb Chew and Leo

Ace 90 Skank Part 2 DJs Papa Face, Gaffa Blue, Supa Selecta C, Russ The Disciple, Oxman and Warrior play reggae. Open The

Moonlighting, Greek St, W1D 4DR (020 7437 5782/cc 020 7287 3727). 10pm-3.30am. £5, w/flyer £3.

Blackmore and Bappa play house, funk and soul. Gigalum,

progressive house and psy trance DJ sets across two rooms, courtesy of Lish, Dejavoo, Matt Lorraine, Andy Leppard, Andy Force, BeatNik, Liquid Ross and DJ Moon, plus Son Kite, Ticon, D-Nox, Beckers and Tron play live. Proud 2 at The O2, Peninsula

Cavendish Parade, Clapham Common South Side, SW4 9DW (020 8772 0303). 6pm-midnight. Free.

Flirt, Raymundo Rodriguez and Matt Jam Lamont play house, techno, electro and pop. Egg,

Fire, South Lambeth Rd, SW8 1UQ (020 7582 9890). 11pm-5am. £6, w/flyer £5.

Boom Ian Charles and Spida spin pop, R‘n’B, commercial dance, house and dubstep.

Ridonkuloose Mikey O, James

Hill Gate, W11 3JQ (020 7460 4459). 7pm-2am. £7, £5 before 11pm.


Gate, Stoke Newington Rd, N16 8BJ (020 7503 6099). 9pm-late. £5.

Big Business R‘n’B and funk from Big Business and Capricorn Sound. The Blagclub, Kensal Town, Kensal Rd, W10 5BN (020 7243 0123). 10pm-3am. £10, gents guestlist £8 before midnight, ladies £5.

Shake Disco and pop from DJ John Osbourne and Paul C in the main room, while DJ Milo plays party anthems in room two. Electric Ballroom, Camden High St, NW1 8QP (020 7485 9006). 10pm-3.15am. £10, NUS/mems £8 before 11.30pm.

Play Nicky Blackmarket, Funky

York Way, N7 9AX (020 7871 7111). 10pm-7am. £15, adv £13.

SATURDAY 9 Brazil Rocks DJ Six-3 spins Brazilian and Latin rhythms, plus Balanco Tropical perform live. Guanabara, Parker St,

Tropicalista Boat Party DJ Cliffy, Russ Jones, Cal Jader and Arias spin Latino, Brazilian, global, ghetto bass and tropical music on the Royal Princess boat. Westminster Pier, Victoria Embankment, SW1A 2JH (020 8306 5333). 8pm-1am. £15.


WC2B 5PW (020 7242 8600). 7pm-late. £10, free before 8pm.

D Ramirez The Toolroom DJ provides house and tech-house. Gigalum,

Daliees Jukebox Presents The Glasto Hangover Party

Cavendish Parade, Clapham Common South Side, SW4 9DW (020 8772 0303). 2pm-11pm. Free.

Comburo Unknown Audio, Chloe

Bez, Arlo, MHD, Rebel Sonix and Jawa play house, indie and reggae. The Book Club, Leonard

Fontaine and DJ Raz play deep house and tech-house. Gigalum,

St, EC2A 4RH (020 7684 8618). 8pm-2am. £7, £5 before 10pm.

Groove Sanctuary AfricanLatin, funk, disco and deep house from DJ Jimbo, Joey Vieira and guests. Madame Jojo’s,

Fabric Craig Richards,

Brewer St, W1F 0SE (020 7734 3040). 9.30pm-3am. £5, £3 before 11pm.

Dixon, Isolee, Terry Francis, Steve Rachmad, Vince Watson, Neil Thornton and Johnny Hiller play house, electro and techno.

SLAGS/Chill-Out Dance and house from Simon Le Vans, Andy Almighty and Sean Sirrs.

St, WC2B 5PW (020 7242 8600). 5pm-late. £5, free before 9pm.

Madame Jojo’s, Brewer St, W1F 0SE (020 7734 3040). 10.30pm-3am. £5, NUS/w/flyer £4.

Deepo Ivaylo, Olanski,

Euphoria Angel Kiss, Oliver

Patrick Turner, Asad Rizvi and Fresh Tee supply house and deep bass. The LightBox, South Lambeth

MARSH, Intro, Marc Phill, MEF and DJ AD play electro, house, dance and R‘n’B. Euphoriom, High

Place, SW8 1SP (020 7434 1113). 10pm-6am. £15, concs £10.

St, W3 6NG (0208 993 2915). 9pmlate. £10, ladies free before 11pm.

Fabric, Charterhouse St, EC1M 6HJ (020 7336 8898). 11pm-8am. £19, adv £18, NUS £10, £9 after 4am, £6 after 5am, adv £23 inc CD.

Cheapskates Old school

Bear St, WC2H 7AQ (020 7839 4188). noon-3.30am. £10 w/guestlist, w/guestlist free before 10pm.

Halcyon Presents The Summer Ball Techno,

Sq, SE10 0DX (020 7482 3867). 10pm-7am. £10-£17.50.

R‘n’B and dancehall.


Ministry Of Sound, Gaunt St, SE1 6DP (0870 060 0010). 10.30pm-6am. £13.

Greenslade spin hip-hop, dubstep and bassline, plus live music from The Bleeding Knees Club and Katie Jayne. Notting Hill Arts Club, Notting

Marcus and Olly play indie, punk, techno and electro.

Moonlighting, Greek St, W1D 4DR (020 7437 5782/ cc 020 7287 3727). 9pm-3am. £6, NUS £5, w/flyer £4.

The O2, Peninsula Sq, SE10 0DX (020 7482 3867). 10pm-7am. £12-£20.

Limao plays Brazilian funk, Latin, house, R‘n’B and hip-hop, plus Samba Soul Transatlantico perform live. Guanabara, Parker

Cavendish Parade, Clapham Common South Side, SW4 9DW (020 8772 0303). 7pm-midnight. Free.

hip-hop, electro and disco courtesy of DJ Downfall.

Kinky Malinki TV Rock, Marco Lys and Bingo Players supply house and electro. Proud 2 at

pop from residents The Oli, Alan K, Oliver M and Jamie Head. Fire, South Lambeth Rd, SW8

Club Popozuda Joao Brazil and Khalil play funk, reggae and hip-hop. Guanabara, Parker


Eastern St, EC2A 3HX (020 7739 5173). 9pm-3.30am. £10, NUS/adv £5.

and DJ Gary Baldi spin dance hits. EC3 Live, Crosswall, EC3N 2JY

White Heat DJs Matty,

(020 7437 1977). 9pm-3am. £3.

Gareth Wyn, Rich Barnard, Dan Jackson, Faze Action, Night Angles and Living In A Disco play house, disco, electro and techno. East Village, Great

Moon Harbour Presents Five Years Of Cargo Edition

N*A*S*I*N SoniX, Brahim and Punk Gareth play punk, rock, metal and ska. The

Bootcamp Rob C and

House Rules Third Party,

Favela Blockparty DJ

Salsa Cellar Resident


Brixton Rd, SW9 6LH (020 7346 8920/ cc 020 7274 5537). 8pm-midnight. £10.

Gravity House, R‘n’B and

Rd, W2 6ET (020 7727 9950). 9pm-2am. £10, £5 before 11pm.

At The King’s Head, Crouch End Hill, N8 8AA (020 8340 1028). 7pm-late. £7, concs £4.

McGee and Jamie Kelly play indie, rock and electro, plus The Kush, Marmalade Sky, The Standards, Jiggo and Love Theory perform live. Jamm,

Dance Nights Princess Karina

The Roxy, Rathbone Place, W1T 1HJ (020 7255 1098). 10pm-3am. £5, NUS/w/flyer £3, £1 before 10.30pm.

DJs play Latin funk, salsa and reggae. Downstairs

Greasy Lips Club Alan

Royal Vauxhall Tavern, Kennington Ln, SE11 5HY (020 7820 1222). 2pmmidnight. £8, £5 after 7.30pm.

WetYourSelf Jay Shepheard, Everything Taboo DJ Andrew Elmore plays retro electro-pop and acid disco. The Shadow Lounge, Brewer St, W1F 0RF (020 7287 7988). 10pm3am. £5, free before midnight.

Submit your free listing at least three weeks prior to the publication by emailing

Alex Vieira, Cormac, Peter Pixzel and Jacob Husley play house, electro, disco and techno. Fabric, Charterhouse St, EC1M 6HJ (020 7336 8898). 11pm-6am. £10, adv £8, NUS £5.



Entertainer: Shlomo works the crowd



CLUB OF THE WEEK JAMM PRESENTS DJ YODA + SHLOMO He’s classically trained as a drummer, has collaborated with Bjork and is a curator at the Southbank Centre. Yes, human beatboxer Shlomo is a man of many talents and he’s bringing his renowned solo beatbox and looping skills to the mic in Brixton this weekend. “I don’t often accept gigs in clubs but seeing as it’s DJ Yoda, I thought why not,” he says. Which brings us to the next headliner – Q Magazine called DJ Yoda “one of 10 DJs to see before you die”. His tricky fingers mix samples from film, TV and pop culture into his sets.


» Brixton Jamm SW9 6LH

Stockwell (020 7346 8920, Fri, Jul 8, 9pm-6am. £10 adv, £12



South London fave House Rules moves north of the river as the party makes its East London debut. Fresh off the back of supporting Swedish House Mafia at Ally Pally, Essex-based duo Third Party will be ripping up East Village’s basement dancefloor while things go disco with DJ/ Producer brothers Robin and Simon Lee. Faze Action is in the bar.

Kinky Malinki always does house music well and this week they’ve summoned some corkers. Dance duo TV Rock bring a big dose of Aussie house music to London this weekend as they take on the monstrous Proud 2. Sure to cause a thunderstorm on the dancefloor, the Flaunt It boys join headliner Tom Novy plus, Marco Lys and the Bingo Players.

» East Village, EC2A 3HX

» Proud2, The O2, SE10 0DX

Old Street (020 7739 5173, Sat, Jul 9, 9pm-3.30am. £5 adv, £10

North Greenwich (020 8463 3070, Sat, Jul 9, 10pm-7am. £10 adv, £15


We have one pair of VIP tickets to DJ Yoda and Shlomo which includes a pair of AAA backstage passes; two pairs of tickets to Kinky Malinki; and three copies of Cream Ibiza. To enter, email ‘Jamm’, ‘Kinky Malinki’ or ‘Cream Ibiza’ in the subject line by noon, Wed, Jul 6

ANSWER, TEXT, REJECT We ask DJ Laidback Luke, who he’d answer, text back or reject if he got calls from: ■ Charlie Sheen I’d reject the call. I have to choose one option so he’ll get the rejected one. Let me say this, Charlie always talks about the same stuff – winning and Tiger Blood. It’s cool if you just meet him for the first time, but assuming he got my phone number off me, as I don’t hand it out, I might have spoken to him before. ■ Judge Jules I would text Judge Jules back as he always tries to reach me when I’m on the road. I love him and did many interviews for him, but somehow he always tries to sneak in when I’m just stepping in a plane

Laidback Luke

or just need to catch up on that half an hour sleep I got last night. I’ll just text him back for now. ■ Madonna Dude, it’s Madonna. Hell yes, I’m gonna pick this up. I’m a big fan and would love to do something for her. I’d pick the phone up any time.

» Cream Ibiza, mixed by Laidback Luke, is out now.


WORLD VIEW strange tales from around the globe United Kingdom

RECORD FRY-UP A fish and chips shop in Southend-on-Sea has demonstrated its devotion to the national dish by frying up the world’s biggest-ever portion of chips. The Fish and Chip Shop at the Adventure Island fun park cooked up 448 kilos of chips, piled up inside a giant box. Five staff took four hours and 20 minutes to cut the potatoes, deep fry the chips and box them up, battering the Guinness World Record of 368.5 kilos set in 2004. “It was hot work. We did it all from scratch. The previous record was done with frozen chips,” Adventure Island spokeswoman Tracy Jones said. “There was a really good atmosphere. Loads of people turned up. The biggest problem was stopping children putting their hands in and taking the chips before we were finished.”

TWEETS OF THE WEEK follow @tntmagazine @ KristalinaS Today I went on & searched “ninjas”. The computer told me “Ninjas cannot be found”. Well played, ninjas, well played. @jimfenton Angry Birds influence: daughter now uses expression “killing two pigs with one bird” @jpalmiotti if you cant get to transformers 3-d today, have a friend throw a handful of leggo at your face & push you down the stairs

Doggystyle: a close shave



and peppermint gel teeth brushing. In human terms, the Brazilian is a full wax treatment of pubic hair, but La Petterie owner Briony Sykes said this particular version only involved a trim with scissors. “That one gets quite a lot of attention and it has become quite popular,” Sykes said. “It’s particularly good for the collies and the retrievers with big rumps. “We cut the hair right back and thin it out.”

Vatican City

POPE GOES ONLINE The Catholic Church is embracing the social media revolution after

Pope Benedict XVI wrote a message on Twitter last week praising Jesus and announcing the launch of a new Vatican website. “Dear Friends, I just launched www. Praised be our Lord Jesus Christ! With my prayers and blessings, Benedictus XVI,” wrote the Pope, using his formal name in Latin – the Vatican’s official language. The Church has embraced social media in recent months, launching popular Facebook and YouTube pages and courting bloggers as it tries to get the church’s message out to a wider and more youthful audience.

‘@Jesus – we’re still waiting’

Getty Images

The threshold for pampering your pets may have just gone up a notch, after a pet care business in Queenscliff, outside Melbourne, launched a Brazilian treatment for dogs. The $20 treatment, designed for “pooches with hairy bottoms”, is part of the shops’ a la carte menu, which features nail-painting, special applications of doggy cologne

Communism is awesome: The Communist Party of China celebrates its 90th birthday with an all-singing, all-dancing stage spectacular. You wouldn’t want to be the kid who drops their flag. There’s no Disney Channel at re-education camp.


United States



Length, in feet, of boa constrictor that went missing in Suffolk. The snake was described as “unfriendly”


Vultures trained by British police to replace dogs that find corpses. The plan failed when the vultures got hungry

Slow and hard: bound to get laid

up for nicotine replacement therapy. But some hooked prisoners, so desperate for a smoked hit, have attempted to light and smoke their nicotine patches, assistant general manager of prison services Brendan Anstiss said. “That type of behaviour is expected,” he said. “Prisoners have tried to smoke a variety of things, from tea leaves to grass, so I’m not surprised they’d try to get a hit from the patches. I’m pretty sure it doesn’t work.”


P48 Work in Auckland P54 Explore Edinburgh




Rolls of loo paper stolen from his place of work by a Massachusetts man who blamed the increased cost of living


Years before wallets become obsolete, according to the boss of electronic funds transfer giant PayPal


Years that British woman Paula Ross suffered a phobia of bananas, which she has now finally overcome



Smoked out: No more fags in the big house

New Zealand

PRISONERS BUTT OUT Kiwi prisoners have resorted to smoking nicotine patches and tea leaves as packs inside sell for $300 (£155) ahead of a tobacco ban. The country’s prisons will go completely smoke-free on July 1 in a radical, world-first move designed to make prisons safer and healthier. The Department of Corrections stopped the sale of cigarettes, matches and lighters in prisons a month ago in preparation, and thousands of inmates have signed

A Swedish pre-school has banned gendered terms in an attempt to promote equality among their students, with staff avoiding words such as “him” or “her”, referring instead to the 33 students as “friends”. At the Egalia preschool, every detail, from the colour and placement of toys to the choice of books has been carefully planned to make sure the children don’t fall into gender stereotypes. “Society expects girls to be girlie, nice and pretty and boys to be manly, rough and outgoing,” said Jenny Johnsson, a 31-year-old teacher. “Egalia gives them a fantastic opportunity to be whoever they want to be.” To even things out, many preschools have hired “gender pedagogues” to help staff identify language and behaviour that risks reinforcing stereotypes.

Getty Images

And finally... STONER KING JAILED The man behind New Zealand’s first cannabis club, The Daktory, has been jailed for eight months. Dakta Green ran the west Auckland club where

cannabis could be bought and sold freely for more than 30 months, but the doors of The Daktory, which had 2000-plus members were closed last month.

Up in smoke


Passengers waiting for flights at New York’s JFK airport were offered a rather odd excuse for their delay, as staff announced breeding turtles were crossing the runway. One of the runways at the travel hub was closed for a full 15 minutes as the turtles meandered around on their way to laying their eggs on the beach at the other side. In the end, airport staff ended up helping the critters on their dangerous journey, but flights were still held up for half an hour. Some passengers at least managed to see the funny side, posting jokes on Twitter. Ron Marsico, a spokesman for the Port Authority of New York and New Jersey, explained: “We built on the area where they were nesting for generations, so we feel incumbent to help them along the way.”


I’d have “hadIf aI had drink and it would have gone pearshaped. It would’ve been like Dynasty

Liam Gallagher missed out on an invite to his brother’s wedding

Hidden cameras: facial recognition will change the nature of digital hoardings


Facial recognition is taking us into a world where billboards now look at you WORDS REBECCA KENT


n the movie Minority Report, captain John Anderton, played by Tom Cruise, strides into work and is greeted by an automated voice which emanates from a digital wall. The wall not only recognises Anderson, but also his weary expression. “Hey John,” it chimes. ”You look like you could do with a Guinness”. The amusing scene was set in 2054, but its vision of targeted marketing using facial recognition (FR) could be imposed on us far sooner than we think.

MAKING A KINECTION Indeed, the march of FR into Western society revolves around technology employed by the X-Box Kinect being sanctioned for use in public spaces. The gaming console, released in

November, uses FR to sign players in and match them with their avatars and profiles. But Microsoft, identifying a greater commercial platform, now uses those profiles to create NUads – advertising catered specifically to each individual gamer. If the player likes the look of a product, they need only make the command “Xbox more” and information is sent to their inbox, along with coupons to assist a purchase.

DREAMS BECOME REALITY Digital marketers are licking their lips at FR hitting the mainstream. ‘’There are obviously legalities which prevent the Kinect from being used more widely,” Girdwood says. “But once those barriers have been broken, the possibilities are a digital marketer’s dream. He envisions “the ultimate” as an

Pawel Libera, Getty Images

Password please: you can already use facial Recogntion technology to unlock your phone

JAPAN PAVES THE WAY To see the invasive reality that FR already presents, you need only look to Tokyo. The city is decorated with electronic advertising hoardings that can instantly identify whether an onlooker is male or female, altering the product on offer accordingly. The technology is also being used in cigarette vending machines: a dispenser takes a photo of a customer’s face and compares their facial characteristics against a database of more than 100,000 visages to determine if the purchaser is of legal smoking age. Experts say that with the will of the right people, we could see such inventions rolled out in the UK by the end of this year. ‘’Nothing is pie in the sky anymore,’’ Andrew Girdwood, media innovations director of Bigmouth Media, says. “In fact, look at online gaming – it (FR) is happening already.”

Facebook wants to know what you look like

What’s in a face? the key to what you need, apparently


Targeted: advertising gets specific


Open sesame: biometric technology has moved from security to commercial use

application to tie the online and offline worlds together. “For example, someone is searching for new shoes on the internet and enters a site by clicking a sponsored ad on Google. “That person doesn’t buy anything online, but walks into the same shop on the high street and through the technology, a shop assistant could say ‘I recognise that person – they went to our website and didn’t buy any shoes, but I know what they are looking for’.” It’s technology crossing the creepy line, but Girdwood wants to believe that consumers will cast their fears aside and embrace it.

A QUESTIONOF PRIVACY Inevitably, such technology raises question about privacy. But as this development is so new, civil liberties and privacy experts

Say cheese: the technology of Minority Report will soon become real

Users should “ be given as much info as possible ” TNT spoke to were unwilling to provide a critique at such an early stage. Meanwhile, the UK data protection authority is in talks with Facebook about the social-networking site’s recent installation of FR. Facebook can now scan photos uploaded to its site, attempt to match them to Facebook friends and then suggest usernames with which to tag the images. “As with any new technology, we would expect Facebook to be upfront about how people’s personal information is being

used,” a spokesman for the Information Commissioner’s Office (ICO) said. “The privacy issues that this new software might raise are obvious, and users should be given as much information as possible to give them the opportunity to make an informed choice about whether they wish to use it. ”

FOR CONVENIENCE’S SAKE Privacy issues asside, marketing boffins don’t want to get excited alone. You won’t be bombarded with junk mail, and that should excite you. “I’m a fan of targeted offers,’’ Girdwood. says. “When my Tesco club card gives me £5 off a bottle of brandy, as a drinker, I’m happy with that. But give me £5 off petrol and that doesn’t appeal to me at all, because I don’t drive. Facial recognition is able to block unnecessary advertising.” And it’s going to make our lives easier. In Korea, Tesco has posters in the subways that look like shop shelves, complete with barcodes. Scan a barcode with your phone and you’ll have the product delivered to your door. Soon enough, you’ll be able to stare at a poster and it will call up your favourite products. But where will this stop? There will come a day when shops, restaurant and other organisations will instantly know who you are, what you do and what you want, just by reading your face. The big question is, though, do you want to smile for that camera or not?

International Money Transfers

> Great Exchange Rates > Use your debit card online > Every 5th transfer is free.

FREE MONEY TRANSFER Receive your ďŹ rst transfer FREE with the following promo code:


0808 141 1681 41956

OUR VIEW TNT puts the world to rights

on collision course


Rookie error: mullets are banned but unabomber beards are OK

Tom Sturrock

Getty Images


hat happens at schools where boys aren’t allowed to grow their hair beyond collar-length? Inevitably, boys who would otherwise be content with short-back-andsides grow their hair long, almost to the colour, cultivating bad-boy chic, flirting with official sanction. A similar cat-and-mouse game is afoot in Iran, where the mullahs – the clergy who wield the real power – have demanded a crackdown on ‘decadent western fashions’. This prescription extends to jewellery and denim clothing, but also to mullet hairstyles. Someone should have told the mullahs that, in 2011, mullets are about as unfashionable as it gets; paradoxically, by issuing their fatwah, they risk reviving the mullet rather than killing it off. They risk making mullets cool again. In 2009, Iran had its Green Revolution. Maybe the next instalment will see mulleted Iranian freedom fighters, decked out in illicit stone-wash denim, taking to the streets, demanding change. Imagine, where the US and Israel have failed, Iranian bogans pick up the gauntlet, waging war on their oppressors, locking horns with the Revolutionary Guard, wresting back

their freedom one block at a time, the Tehran dusk lit up by ready-todrink bourbon and colas used as Molotov cocktails. Think of the celebrities who would lend their voices in support, in solidarity, with the Iranians’ right to keep their hair spikey at the front, short on the sides, long and whispey at the back. What song might Bono – who had a top-notch mullet in the 1980s, before he started dressing like Mad Max in a fetish club – write for Iran’s brave, noble, fighting mulleteers? The mullahs can avoid this, but they must learn the lesson that escaped so many Year 10 tutors: only by averting your gaze, by not acknowledging the mullet, can one hope to denude its terrible power.

THEY’RE ALL RELATED, REALLY Prince Harry has been seeing Florence Brudenell-Bruce, a lingerie model who used to date Jenson Button. Not bad. One problem: Harry and Florence are related. It turns out they’re distant cousins. That might sound like they’re peeing in the gene pool. It’s certainly provided plenty of grist for tabloid headlines seeking to maximise the prurience of it all: ‘Oooooh, gross – Harry is bonking his cousin.’ But really, once you get to that rarefied tier of society, that properly posh set whence a prince is pre-ordained to

be in “likeYou’d a ferret in a sock drawer ” find a missus, they’re all more or less related. That’s what makes them so posh in the first place – keeping proles out of the family tree. Besides, if your eighth cousin – or whatever she is – was as attractive as Ms Brudenell-Bruce, you’d be in there like a ferret in a sock drawer. So don’t judge.


P14 The best festivals P64 Dive in Malta


Mullahs and mullets


SPORT VIEW bite-sized action and analysis Australian rules

PLAYERS WANT MORE The AFL says players have rejected a $1.1bn (£735m) pay deal over the next five years, holding out for more under a fixed percentage agreement. AFL chief executive Andrew Demetriou revealed the amount had been offered to the players to either take as salary up front or as part-wage, part-retirement plan. But instead the players remain steadfast in their demand for a percentage of between 25 and 27 per cent of total AFL revenue. Although those cash demands in the shortterm are not significantly higher than what the AFL is offering, the players also want a three-year, rather than a five-year, agreement. And the fixed percentage deal would allow their coffers to swell with any increase in total AFL revenue in future years. The $1.1bn is almost equal to the entire cash the league’s recent broadcast rights deal.


P21 Celebrity News P54 Explore Edinburgh



SCORCHERS SIGN GIBBS Perth Scorchers’ South African coach Mickey Arthur has signed countryman Herschelle Gibbs as one of the team’s two internationals for this summer’s revamped Twenty20 competition. The Perth team’s announcement on Friday came a day after the Scorchers lost a bidding war for West Indies’ master blaster Chris Gayle, who opted against returning to Perth. “I have known Herschelle for many years and have seen him destroy some of the best attacks in world cricket,” said Arthur, the former South African national coach.

BIG WEEK FOR .......

“I am looking forward to seeing him take to the KFC Big Bash League in a similar manner and I’m sure the Perth Scorchers’ fans will really warm to him.”

Rugby league

RETURN TO WEMBLEY International rugby league will return to Wembley for the first time this century with Australia to take on England at the famed venue during the end-of-year Four Nations tournament. The Kangaroos will clash with the host nation on November 5 as part of a Wembley double-header. The famous ground last hosted a league international in 1997 when the Australians took on Great Britain and won 38-14. The game will be preceded by a match-up between New Zealand and Wales. “With some of the world’s best players on show at Wembley, we will undoubtedly raise the profile of the sport on the national and international stage,” England’s Rugby Football League chief executive Nigel Wood said.

Rugby union

NONU STAYING PUT All Blacks and former Hurricanes midfielder Ma’a Nonu has signed with the Blues after committing to New Zealand rugby for two more seasons. Nonu, 29, will move north after being axed by the Hurricanes for being a disruptive element, in the view of coach Mark Hammett. The blockbusting second five-eighth will also take a playing ‘sabbatical’ from New Zealand rugby at the end of this year, joining the Ricoh Black Rams in Japan’s Top League for several months before returning for next year’s Super Rugby competition. Off to the big smoke: Ma’a Nonu

Getty Images

■ Mal Meninga will coach Queensland this week hoping that his extraordinary run since taking over the top job continues. Put simply, Queensland have the opportunity to eclipse the Maroons sides that dominated the series in iat its inception. Meninga is already a legend of the sport, but his time as coach may yet come to define him.

Head in the clouds: Melbourne youngster Ricky Petterd climbed high to take one of the marks of the season, but the Bulldogs still prevailed by 63 points at Etihad Stadium, reigniting their hopes of playing in a fourth straight finals series.

Gasnier’s newfound passion for ballet wasn’t much help at Origin time


Bernard Tomic’s father, John, reckons Australian tennis’s rising star has plenty of improvement left in him

It takes one to know one, I suppose. Everybody is entitled to their opinion. But I’ve scored a one-day hundred

Preview … Can the Maroons go six in a row? QUEENSLAND V NSW Wednesday 10.30am, Sky Sport 1 It all comes down to this, to game three at Brisbane’s Suncorp Stadium. The Maroons will be gunning for a remarkable sixth-straight Origin series win, while the Blues will be desperate to stop them, desperate to avoid their own slice of history. There are, of course, plenty of individual stories intertwined with this year’s Origin series but, as ever, the most important story is that of the concept itself. State of Origin is an irregularity in the age of professional sport – a representative match that appears to mean as much, maybe more, to the players as the club they represent and are paid by during the rest of the season. Players are meant to be too professional these days to care about what, in any other

sport, would be a gimmick. In the NBA, players undoubtedly relish the chance to play in an All Star game, but it’s hard to imagine them going above and beyond the way the likes of Wally Lewis, Andrew Johns and Allan Langer did in Origin clashes past. In the build-up to Origin, there’s a fair bit of hokum spun by commentators – lots of gravelly whispering about the ‘Origin legend’ and the ‘field of dreams where legends are born’. It’s cookie-cutter stuff and the seasoned sports fan is entitled to roll their eyes at this nonsense – the spray-on gravitas of a bunch of pampered suits in a commentary box. The problem, though, is that Origin has an elemental intensity that lends credence to the hype. It’s hard to believe this decider, with so much on the line, will fail to live up to its billing.

England’s batsman Alistair Cook dismisses Mike Atheron’s comments about him being too slow for ODIs

It’s still the same old story. NSW are running things and nobody is accountable

Queensland legend Arthur Beetson (below) after Maroons forward David Taylor was banned for the Origin decider

Getty Images

The Chat … ALBERTO CONTADOR What’s happening? The Spaniard is the reigning Tour de France champion and has won cycling biggest race three times overall. But when Contador was presented to the fans last week, ahead of its first stage over the weekend, he was roundly booed. Why? Spandex too tight? Probably, but even more importantly, he’s a suspected drug cheat. Contador tested positive for steroids as well as plastic residue which suggested he had been

involved in blood doping – whereby cyclists draw clean blood leading up to and event and then conduct a transfusion after doping to avoid detection. He was meant to be suspended for a year but appealed and is free to compete in France. Innocent until proven guilty? Cycling forfeited its right to the benefit of the doubt a while ago. And Contador has been implicated on doping charges before. They haven’t stuck but few believe he’s a cleanskin.

TV HIGHLIGHTS AUSTRALIAN RULES West Coast v Geelong Friday 11.30am, ESPN The Eagles could cause a major upset RUGBY UNION Super 15 final Saturday 8am, Sky Sports 3 Who will be crowned champions? CRICKET England v Sri Lanka Saturday 11am, Sky Sports 1 The final ODI in the series


He can improve kilometres in every area: forehand, backhand, speed, mentality




TICKETS Celebrate the return of International Rugby League to Wembley! Buy a ticket for the Wembley double header and pay just £10* for a £25 seat. Don’t miss our best Wembley offer


2011 Gillette Four Nations Adult


tickets from

tickets from

28th October



Leigh Sports Village

29th October



Wembley Stadium

5th November






Australia v New Zealand†

Halliwell Jones Stadium

England v Wales England v Australia Wales v New Zealand England v New Zealand

KC Stadium

12th November




The Racecourse Ground

13th November



Elland Road

19th November



v Australia

2011 Four Nations Final

BOOK NOW: CALL 0844 856 1113

using code 4NWEM17

*subject to availability. Not to be used in conjunction with any other offers. Terms and conditions apply. *£10 seat offer on £25 Wembley tickets only. Maximum 6 tickets per person. †Tickets on sale TBC.

SPORT VIEW TNT puts the world to rights

‘Rock again! There must be a better way to decide who’s going to hold the game to ransom this time.’

Jahn Vannisselroy

Getty Images


went to write a letter the other day but avoided email because I was writing to the Board of Control for Cricket in India (BCCI) and they aren’t big fans of technology. However, as I dipped my quill in the inkpot I realised I hadn’t prepped the BBQ on which I cook my dinner each night. I do have a microwave (and an oven) but I’m highly suspicious of both. While the microwave should make my life easier, when I first got it, I left it on too long and my food exploded. Fool me once, shame on you; fool me twice, shame on me – right? So now I like my meals cooked with the human element only – over a fire I started myself, judged to be ready by my senses only and completely non-reliant on the inventions of modern man. Dinner guests tell me I’m mad, out there even if it’s raining, but I tell them that if they don’t like it, I won’t invite them again. As I do serve up a pretty mean grill, they have no choice but to play by my rules. I know the recipients of my letter would empathise. “Dear BCCI,” I etched onto my paper when I returned from igniting the coals. “Well done on your negative stance towards the Decision Review System. It’s completely right not to use technology so expertly crafted by

Carry on “doing what’s best for you ”

I went on to detail my microwave story. I knew India had been burned by technology before, too – in a 2008 series in Sri Lanka, they made only one successful review some of the world’s leaders in that while the opposition made 11. Satisfied, I sealed the envelope and field. You, and your unlikely ally went to post it. But in the process Sepp Blatter, should stick firm to your belief that the human brain, I became distracted; my food was incapable of producing an accurate burnt to a crisp on the BBQ. It seemed my rejection of technology replay and prone to error and lapses in concentration, should be had cost me – and my guests dined solely relied upon. Don’t listen to with a bad taste in their mouths. Dejected, I composed another the rest of the Test-playing nations – and in Sepp’s case, the rest of the letter. This one was to myself and in email form. After I finished writing, world – what do they know? “Carry on doing the best for you I cc’ed the BCCI in and hit send. “Technology isn’t such a bad – if your team can’t deal with the idea after all,” it read. “No one else Graeme Swann’s deliveries, you definitely don’t want the Hawkeye has a problem with it. It’s obvious you’re the one with the problem. system in place. I do understand Perhaps you should simply learn your acceptance of Hotspot though. My BBQ has a great one.” to use it properly.”

GO ON, MY SON Judy Murray had a brilliant idea to take the heat off her dislikable son at Wimbledon – talk about giving his opponent, Feliciano Lopez, a thoroughly good going over in the sack. It worked. The media latched on and the magnifying glass was lifted slightly off Andy. But imagine that was Sabine Liski’s father, expressing his lust for Maria Sharapova. Massive. Public. Outcry. Still, I suppose we should be happy no one was talking about shagging Andy. He’s got a face only a mother could love – it’s just that old Judy loves Feliciano’s a bit more.


P44 Science in sport P61 San Sebastian



Indian technophobes must move with times


Dark arts: Pakistan’s Wasim Akram devastated England with reverse swing


Although a new book suggests the two actually have much in common WORDS TOM STURROCK


scientists, literally. The lunchroom is the cafeteria at the European Space Agency and the conversations therein form the basis of a new book, The Physics of Cricket by Mark Kidger. “It was about combining two obsessions – I’ve been mad about cricket for as long as I can remember,” Kidger says. “I’m also a scientist, working at the European Space Agency and you know what people are like. You have a chat about cricket at lunchtime and very quickly, someone will produce a pen and a serviette and start calculating. So the book is about combining my passion cricket with my passion for science.”

THE DARK ART OF REVERSE SWING During the English summer of 1992, when Pakistan visited these shores, one

Getty Images, TNT Images

All attempts to understand how England won the Ashes have failed

t’s a familiar scene – two workmates, both cricketing anoraks, locked in an earnest sporting discussion during their lunch-break. Onlookers raise their eyebrows and shake their heads in mock despair, but that does nothing to diminish the fervour of the conversation, as the pair do their best to penetrate and illuminate the mysteries of the game. How does reverse swing work? Do statistics tell the full story? Should technology be used to augment umpiring decisions? How much of an advantage do modern bats confer upon batsmen? To illustrate their point, one starts scribbling a diagram or a set of numbers on a napkin. This is where the discussion takes a turn because, instead of mug punters butting heads over a chicken parmigiana, these blokes are rocket


Space-age stuff: new technology maps the ball’s flightpath


Hawk-Eye, which charts the flight of a bowler’s deliveries, is now a fixture of cricket broadcasts, with commentators relying on it to demonstrate a bowler’s line and length, what kinds of deliveries a batsman scores off and, of course, whether the umpire got it right when adjudicating lbw appeals. In earlier attempts to clarify lbw decisions, British astronomer Bernard Lovell, who developed aircraft radar and radio telescopes, was consulted but even he was stumped. Hawk-Eye, also used in tennis, was eventually developed using six cameras to record the ball’s flight, with computer modelling then used to predict the ball’s further trajectory.


Cricket tragic: Mark Kidger

of cricket’s abiding modern mysteries was born. The tourists’ two tearaway fast bowlers, Wasim Akram and Waqar Younis, bamboozled England’s batsmen by making the ball swing in a way they had not encountered before. Indeed, they were making the ball move in the opposite direction to what the hosts expected. The English press immediately suspected ball-tampering. Today, the phenomena is known as reverse swing and England’s bowlers employed it to devastating effect during the 2005 Ashes. “It’s seen as either magic or devilry when one side can do it and the other can’t,” Kidger says, before explaining the physics. “Reverse swing is all about the way the ball goes through the air and the flow of air against the ball. Instead of the air flowing smoothly against the shinier side of the ball, the air breaks off and tugs the ball in one direction and if the ball is moving fast enough, that movement is not always predictable. “Physics does a backflip, but the bowler has to be very quick and it’s a matter of technique.”

THE MAGNUS EFFECT Ask any Australian cricket fan about Shane Warne’s greatest deliveries and watch that glazed, faraway look come over them. There’s the famous ball to Mike

Gatting. But what about when he bowled Basit Ali between his legs? Or the flipper to Richie Richardson at the MCG? Or the one that turned a mile to skittle Shiv Chanderpaul? Kidger’s book offers an extra layer of explanation of Warne’s genius – the best spinners generate drift, moving the ball through the air and not simply off the pitch. It is known as the Magnus Effect. “The Magnus Effect is what allows spinners to get the ball to float through the air in the opposite direction to the spin. An off-spinner might turn the ball into the batsman, but through the air, it means the ball will drift away from the batsman,” Kidger says. “It’s what made Warne such a handful. If the ball has backspin, it will float in the air, if it has top-spin, then it will dip. His famous ball to Mike Gatting, it didn’t just move from right to left, it moved up and down.”

MAN OF FAITH, MAN OF SCIENCE The advent of new technology has transformed the way cricket is officiated and, though Kidger is a boffin, his endorsement of Hawk-Eye and Hot-Spot is qualified. “I’m old-school,” Kidger says. “I was brought up to accept that if the umpire says you’re out, then you’re out. “But if we’ve got the technology to get it right, especially when a really bad decision has been made, then we should use it.”

Genius: Shane Warne’s drift was as lethal as his turn

The umpires “ aren’t 100 per cent either ” A proper bunfight loomed between England and India over the use of the Decision Referral System during their upcoming Test series, but Kidger insists that, although the technology used to verify decisions is not full-proof, using it is preferable to not using it. “The technology isn’t 100 per cent perfect, but the umpires aren’t 100 per cent either. All you can do is reduce the mistakes as much as possible,” he says. “And there’s nothing worse than watching a game of cricket and seeing a batsman given out, only for the TV replays to reveal that he shouldn’t have been.” Either way, it’ll sure make for interesting discussion during the lunch-break.

» The Physics of Cricket is available for £20 from Nottingham University Press. BEST OF THE WEB PERSONAL PRODUCTS LTD T: 020 8867 0695 Personal Products provide mini travel toiletries and personal care products that include well known international brands and product types.

JOB OF THE WEEK: Sales Administrator Assistant Location: London Salary: Basic plus commission We are seeking an experienced sales assistant whose duties will involve cold calling, closing sales, sales order processing, tendering quotes, database updating, office administration. You must be IT literate and have telephone customer service experience. Rob | 020 867 0695 |

JOB OF THE WEEK: Trainee Female/Male Goods In/ Stock Handler Location: London Salary: Basic £13,000 - £13,500 PA (Salary increase when fully trained) LEON JAEGGI & SONS LTD T: 0845 618 0104 E:

Successful applicant must have a good command of the English language with good administrative skills. Responsible for checking goods in, assemble orders for senior staff and re-stocking of the showroom. Will be trained in all company’s admin regarding short deliveries, breakages etc. Must have a helpful personality. Please send a full up to date C.V to

JOB OF THE WEEK: Showroom Assistants & Sales Consultants Wanted Location: London Salary: Basic £12,000 - £15,000 PA With an added target related bonus As seen on the Apprentice. Join our vibrant sales team in Shaftesbury Avenue. Near Piccadilly Circus. Selling commercial catering equipment to the hotel and restaurant industry. Applicants must be customer aware, have a clear command of the English language, must be confident with face to face dealings, as well as on the telephone. Please send a full up to date C.V to

NEW CHAPTER CONSULTING LTD T: 0845 2000 741 Voted one of the best recruitment companies to work for, New Chapter is a vibrant executive search and selection organisation

VIBE TEACHING T: 020 3178 2000 How can you be sure we’re the best? Why not ask someone. We support the Wildcats, Magpies, Anzac Rugby, Netball and Touch in London! Oh yeah, we also support you!

JOB OF THE WEEK: Recruitment Consultant - FMCG Location: London Salary: Excellent salary and commission You will receive lots of commercial exposure and responsibility therefore we want to hear from articulate individuals with excellent interpersonal skills who can offer enthusiasm, drive and want to work in a fast paced environment. All applications directly to | or contact Fraser Craig on 08452000741

JOB OF THE WEEK: Consultants & teachers Location: Central London Salary: Great rates! We are always looking for great teachers to work in our Central London schools, as well as great teachers to work with the team in the Vibe office. If you want to chat more, give us a call! Luke Callaghan | 020 3178 2000 |

LOOKING FOR YOUR NEXT JOB? NEW JOBS ONLINE EVERY DAY To advertise your job of the week contact Eddie Clinton| 020 3137 5650|


Your monthly guide to moving to Australia and New Zealand One way ticket: the grass is greener in Australia





Career Primary school teacher Age 24 Lives Shoreditch From Perth, Australia How did you get into your line of work?

I went straight to uni after high school to study teaching and haven’t looked back. What do you do day-to-day?

I’m a supply teacher and can go from one school to the next almost daily. You never know what you’ll come up against. What’s the best thing about your job?

Laughing at the funny things children do. I also love watching them learn. They may get wet, dirty, or even hurt a little, but when they make a discovery it’s worth it.


What’s the most challenging?

Getting random directions to a random school and looking at 32 children with no clue who they are or what the day with them will bring.

Kiwis flock across Tasman T

he Kiwi exodus to Australia has hit a 32-year high, as a fresh wave of New Zealanders heads across the Tasman. About 3300 Kiwis left for Australia in May, topping the record of 2900 set in 1979. Analysts have pinned the mass departure on the Christchurch earthquakes and on an economy struggling to shrug off the turmoil caused by the global financial crisis. Evidence shows that career opportunities are a key motivation, but the money and lifestyle on offer in Australia also play a part. An extra 300 people left

Christchurch for Australia during the past year, but the quakes could only be accountable for 80 per cent of them, ASB chief economist Nick Tuffley told “Australia’s bigger, the weather’s better and salaries are certainly higher,” he said. “That’s why there’s so much focus on trying to grow our own incomes faster, so that those people who might be tempted by money will choose to stay here in New Zealand.” Meanwhile, a debate ignited on the Facebook page of Rotorua’s Daily Post over which of the two countries

provided the better lifestyle. One woman said her son had applied for work in Australia as he was “chasing the big money they pay”. Jean Serjeant said “there is nothing left here” and work opportunities were simply better across the pond. Another woman, who did not wish to be named, said her daughter recently moved to Australia. “They all go over there for the money,” she said. Sign up for career advice at

Are you ready to take your career back home? Recruitment Summit


As the world’s most successful African recruitment brand, Careers in Africa has a proven track record of successfully connecting leading employers from across Africa with internationally oriented graduates and professionals seeking challenging and rewarding careers across Africa. We are recruiting for over 200 corporations including:

21-23 October 2011 Apply Now at

Auckland: a beautiful city with two harbours


THE SEA Even after this year’s Rugby World Cup Auckland offers a wellspring of work WORDS REBECCA KENT

Work hard, play hard: score a job in Auckland


ore than half of the immigrants who land in New Zealand make a beeline for Auckland to pounce on job vacancies made by a critical brain drain. The Rugby World Cup is imminent, but curiously, Kiwis are not rushing home to join the party. This leaves the door open to anyone harbouring a desire to work in New Zealand. Look to Auckland, its biggest city, and you’ll wonder why you didn’t do it sooner.

THERE’S MONEY TO BE MADE Hannah Francis of Robert Walters says a move from London to Auckland will deliver the same size paypacket. “There are many opportunities available that pay equivalent salaries – and in some cases more – with the added bonus of the New Zealand lifestyle,” she says. “Furthermore, due to the size of the New Zealand market the opportunities available often offer more scope, broader responsibilities, greater autonomy and variety.” Research on remuneration packages demonstrates Francis’s point. With London’s market rates converted, an IT project manager earns £110,000 in Auckland compared to £83,000 in London and a brand manager earns £70,000 in











Calling all experienced Recruiters who are seeking a return home to Australia!!! We have 100’s of roles across Sydney, Melbourne, Brisbane, Canberra and Perth. Industries that Rec2Rec cover include: • IT • Industrial • Accounting , Finance & • Office Support Insurance • Sales & Marketing • Engineering, Construction, • Pharmaceutical & Property & Mining Medical Apply now to Yasmin Dale, General Manager, to commence the process before you arrive home. E: | P: +61 2 9224 1333

Engineers Wanted in Australia Are you dynamic and innovative? (S]SYLEZIIRKMRIIVMRKERHFYWMRIWW¾EMV# )WXMQEXSVWERH4VSNIGX1EREKIVW[ERXIHJSVHMZIVWM½IH lively and innovative design and construction group with niches in: ˆSMPERHKEWTMTIPMRIW ˆ[EXIVERH[EWXI[EXIVXVIEXQIRX ˆLSVM^SRXEPHMVIGXMSREPHVMPPMRK ˆGSEPWIEQKEWHVMPPMRKERHTVSHYGXMSR ˆGSQQIVGMEPFYMPHMRKERHWTIGMEPMWXGMZMP[SVOW AJ Lucas is one of Australia’s most successful infrastructure specialists with a turnover of QMPPMSRTo be part of this successful company apply today.

Please contact our Recruitment Partner Clive Hutchings at STR on 02392 322 322 or email your cv to

Come and meet Lisa Martin, Senior Consultant from our Sydney office in London on Tuesday 19th July and Glasgow on Tuesday 26th July.


Country living: work on a farm

Auckland compared to £62,000 in London. Similarly, a financial analyst can top up their salary by £18,000 by moving to Auckland. The wages are commensurate with Auckland’s high standard of living.

TNT Images, Getty Images

PLENTY OF WORK The Rugby World Cup has compounded a skills dearth in IT, finance and accounting, sales and marketing, and secretarial and business support. Extra resources will also be required in telecommunications and public transport. Beyond the Word Cup, bar staff are required year round and chefs are in high demand, as are teachers. There is also a shortage of doctors and nurses in the country so if you’re in the health sector you’ll be welcomed with open arms.. “Most companies generally want a diverse and international culture and so are very open to the idea of employing foreign workers,” Francis says. “If a foreign candidate is committed to working and living in New Zealand the best way they can demonstrate this is to set a firm arrival date to work towards and gain the eligibility to work.” Several countries have a working holiday agreement with New Zealand for people between 18-30. Visit visabureau. com to check your eligibility. A ROOF OVER YOUR HEAD Auckland is a small compared to London, so choosing where to live won’t be a chore. If your workplace is in the inner-city city and you enjoy a cosmopolitan lifestyle, consider Ponsonby (from £90 a week in a houseshare situation), with its many cafes and restaurants. Point Chevalier (from £80 a week) is slightly farther away but is a genteel suburb, as are Mt Eden (from £85 a week) and Epsom (from £100 a week). Across the Harbour Bridge, the North Shore (from £85 a week) is generally

A lesson to learn: teachers are in high demand

considered the best city in Auckland, with low crime rates compared to South Auckland and West Auckland.

CHOOSE YOUR LIFESTYLE With 28 quality beaches and endless sunny days Auckland’s lifestyle is a huge drawcard. Known as the City Of Sails, on account of it being built around two harbours, Auckland offers plenty of sailing, windsurfing and outdoor activities. It holds 1.3 million people – a third of the national population – and a high proportion is of working age, which makes the city livelier than anywhere else in the country. As such there’s no shortage of nightlife venues – the adventurous, the sophisticated, the young, and the youngat-heart are all catered for. And in foodobsessed Auckland, good grub is never hard to come by.

DOWN ON THE FARM Surprisingly for a country so reliant on farming, New Zealand is on the lookout for agricultural workers. Apiarists, aborists, beef and cattle herd managers, orchard managers and winemakers are all in high demand. Dip your toes in the water by living in a farmhouse in exchange for doing some grunt work like gardening and feeding animals. There’s plenty of work not far from the city centre, in places like Kumeu, Helensville and Albany. See

» For help finding work in Auckland and other parts of New Zealand, see Also, see the short and long-term skills shortages lists at If your skills match those on the list you may be eligible for residence.

REBUILDING CHRISTCHURCH In the aftermath of the Christchurch earthquke and its equally destabilising aftershocks, the New Zealand government has pledged to pump £7.6bn into the South Island’s largest city. As rebuilding starts, construction jobs will soar. Back in March, before the most recent level-six quake, such was the demand for manual workers that local pen pushers picked up tools.

Some companies, unable to wait for the local economy to rebound, have left for Auckland, leaving a skills dearth in a range of professions. Peter Townsend, head of the Cantebury chamber of commerce warned: “We can’t live off tradies alone. We still need lawyers, we still need accountants, we still need bankers, we still need people in the hospitality sector.”

MONEY Your monthly guide to moving to Australia and New Zealand RETURNING HOME

Sexual healing: mine workers may not be getting enough



Pawel Kolat

No jiggy for fly-miners ustralian miners’ sex lives are being affected by the fly-in/fly-out (FIFO) work agreement, experts warn. Managers are now being forced to pay higher wages to compensate for the disruption to workers’ sexual routines. They are also being urged to provide accommodation and to



flexibility, Michael Rafferty, a senior research analyst at Sydney University, says. “In such an urbanised country it’s difficult to attract people permanently to rural and remote areas.” FIFO workers are also likely to be depressed and have drug and alcohol issues.

I have one account for spending and one for saving and I transfer money into my savings account every month. Making sure I don’t touch that account is where it gets tricky. Any money-saving tips for when you first arrive?

Buy a bicycle to save money on travel. What was your last big blowout?



Melbourne tourist chiefs are rattling their Sydney counterparts by launching a campaign in the harbour city to entice tourists over the border. Victoria’s £9m ‘Play Melbourne’ campaign, launched in enemy territory entices tourists to Melbourne for shopping and cafe culture.

Australians are the most satisfied with their lives out of all 34 countries in the OECD. Australia fulfilled all criteria in the Better Life index, including health, and work-life balance. But Richard Dennis, author of Affluenza, said the country should be achieving more, like reversing climate change.

Getting my skydiving licence in Spain last year – the thrills don’t come cheap but they’re worth it. What non-essential items do you spend money on?

Rock climbing gear and gadgets. I recently bought a Kindle. It’s lighter than a book, so I go faster on my bike.

HAIR, THERE AND EVERYWHERE Keep your tresses looking good, and stop them falling out, with these best-of-the-best products ... » Alterna Ten shampoo contains exotic ingredients including African cacao extract, caviar age-control complex, white truffle oil, Champagne grape seed oil, Bulgarian Evening Primrose and Arabian Frankincense. £37 for an 8.5 oz bottle » Condition with Russian

Amber Imperial Conditioning Crème – a blend of blend of nettle, chamomile, rosemary, sage, burdock and grape seed. A 6 oz tube is £75. » The Viatek HairPro Luxor Laser Hair Brush uses nine lasers and six LEDs to stimulate hair growth via laser hair therapy. £312.

Getty Images, Thinkstock

Take advantage of the battle between credit card providers and you could end up paying no interest at all on your purchases in London. Barclaycard has extended its zero per cent period for both purchases and balance transfers to 14 months on its Platinum Purchase card. You can also benefit from the 15-month zero per cent windows on purchases with the Marks & Spencer Credit Card or the Tesco Clubcard Credit Card. However, there is no zero percent offer on balance transfers with the M&S card and with the Tesco credit card it is just nine months. It makes sense to shop around but, as always, make sure you read the small print.

ensure employees are happier in relationships. An study by Edith Cowan University in WA showed it can be more difficult for partners to fall pregnant or to have sexual relations if their menstrual cycle did not fit in with the roster. But the FIFO system offers

Job Web developer From Belchatow, Poland Lives Islington Age 33 How do you budget?

TRAVEL GLOBAL VISION A man leaps over babies during the festival of El Colacho in Castrillo de Murcia near Burgos, Spain.


The festival, held on the first Sunday after Corpus Christi, represents the devil taking away original sin from the newly born by leaping over them.

Photo by Denis Doyle/ Getty Images




If you’re thinking of heading to Edinburgh for the festival, we show you what else the city has to offer WORDS JO CAIRD

The Royal Mlle: street entertainment

Historic city: the view from Calton Hill

Edinburgh SCOTLAND

M Camera Obscura: vortex fun

ore than half a million visitors, artists and performers arrive in Scotland’s capital each August for the Edinburgh Fringe and the city’s other festivals, and with 1000-plus performances each day, you can understand why. But there’s far more to Edinburgh than just its festivals.

OLD AND NEW Beneath the castle to the south is Edinburgh’s medieval Old Town, a jumble of steep streets and cobbled lanes. To its north is the elegant New Town, built in the 18th century to provide modern housing for Edinburgh’s grander residents. Each half has its own bustling high street. In the Old Town, the Royal Mile connects Edinburgh Castle with Holyrood Palace, the official Scottish residence of the monarch. Busy all year round, at festival

Tony Marsh, Getty Images, TNT Images

KING OF THE CASTLE To get a sense of the city’s rich history, head to Edinburgh Castle, the austere fortress perched atop the crag in the centre of town. The castle has changed hands between the Scottish and the English many times and the free guided tours that take place throughout the day are useful when it comes to understanding this

important relationship. Don’t miss the beautiful St Margaret’s Chapel, the oldest part of the castle, or the gritty and engaging Prisoners of War Exhibition in the dungeons.

in association with

3-5 Dock Place Leith EH6 6LU 0131 554 9612 Open: Mon 5pm-1am; Tue-Sat 12pm-1am; Sun 12:30pm-1am



Happy Motoring!



in more than 2,400 locations in over 60 countries



An Authentic South African Bar, serving traditional drinks in a unique, sophisticated style. Come and enjoy a true taste of Africa...



h s i l g n E h c Tea Com bine travel & work with

Language School

e s r u o C L F E T e iv s n e t In d n e k Wee Perfect for readers looking to: ‹ Combine travel and work ‹ Teach during their gap year ‹ Have a career change ‹ Work part-time with flexible hours

} There are many job opportunities worldwide to teach English to children, teenagers or adults.

} You could be in Eastern Europe, Italy, Spain, Costa Rica or Japan teaching English in a classroom, privately one-to-one, or even online.

DATE 9-10 July, 2011 TIME 9am - 6pm VENUE Holland Park YHA Holland House, Holland Walk Kensington | W8 7QU High St Kensington or Holland Park

* Teaching English as a Foreign Language

For further info or to book your place see:

ONLY Courses conducted by International TEFL Training


(normally £200)


WHERE TO DRINK ■ Thistle Street Bar is a tiny boozer with a top range of whiskeys and an atmosphere to make you feel like a local (39 Thistle Street; +44 (0)131 478 7029).

Brass Monkey: student boozer



■ Generous portions of modern European cuisine and awesome views of the castle at The Outsider (15 George IV Bridge; +44 (0)131 226 3131). ■ Seadogs is known for its seafood and vegetarian options, and is refreshingly inexpensive ( ■ Nile Valley specialises in budget African food. There’s no alcohol licence, but you can bring your own (6 Chapel St; 0131 667 8200).

■ Sip a cocktail as you gaze out over the Firth from the funky bar at Forth Floor at Harvey Nichols ( ■ The Brass Monkey is the pub of choice for Edinburgh’s students (14 Drummond Street; 0131 556 1961).

■ Hotel Missoni only opened 18 months ago but this bright, luxurious hotel is now Edinburgh’s hottest place to stay. ( ■ Aonach Mor is a charming, family-run guesthouse that is only a 10-minute bus journey from the city centre ( ■ Castle Rock Hostel offers cheap and cheerful dormitory accommodation in a super central location (


Pierre DeVilliers / TNT Images, Getty Images

Victoria Street: shop ‘til you drop

time the Mile goes nuts, but there’s still plenty to do if you’re not interested in street performance. The petite Writers’ Museum, dedicated to Robert Burns, Sir Walter Scott and Robert Louis Stevenson, is a good spot for literature buffs; the interactive Camera Obscura, Edinburgh’s oldest tourist attraction, won’t fail to impress; and St Giles’ Cathedral boasts some SCOTLAND stunning stained EDINBURGH glass windows. In the New Town, Princes Glasgow Street is Edinburgh’s top shopping destination, as well as Meadows, a short walk through being home to the Scottish National the Old Town from the Royal Mile. Gallery. And for an artistic treat that’s Edinburgh’s ultimate green space, not even on most locals’ radar, visit the however, is Arthur’s Seat, the long extinct Mansfield Traquair Centre to see its volcano that soars to 251 metres over the series of lovely frescoes by Phoebe Anna city and its estuary, the Firth of Forth. Traquair, the leading artist of the Arts It’s about a 20-minute walk to reach the and Crafts movement in Edinburgh. summit, but the views once you get there PARK LIFE are unparalleled. As you gaze out over The city’s weather is notoriously the city, listening to the roar of the unpredictable, even at the height of crowds from the nearby Meadowbank summer, but if you find yourself with Stadium, it’s hard not to agree with a fine day, there’s nothing nicer than the proud locals that Edinburgh relaxing in one of Edinburgh’s parks, is the world’s most beautiful from Princes Street Gardens, to the Gothic city.

NEED TO KNOW WHEN TO GO The Edinburgh Festival Fringe runs from August 5 to 29 ( GETTING THERE By train, fares start at £16.50 single or £33 return for London King’s Cross to Edinburgh with East Coast Trains ( uk). EasyJet flies from London Gatwick to Edinburgh, from £28.99 one way, inclusive of taxes ( Return flights with British Airways from £77 (

Friendly faces: meet the locals



UNDER £250


A two-night break to Bucharest, Romania, is £205 with Untravelled Paths (0871 662 9521; untravelledpaths. com), including boutique hotel accommodation, airport transports, a guided city tour, visits to the People’s Palace and to either the Village or Peasant Museums. Valid until the end of Sep. Excludes flights. A weekend in Paris is £249 with Anderson Tours (0207 436 9304;, including Eurostar travel, transfers, two nights’ B&B accommodation and a tour of the city. Departs Jul 8. Two nights on the Isle of Wight is £99 with Wightlink (0871 376 0013;, including B&B and return car ferry crossings from Portsmouth or Lymington. Departs Jul 13. A nine-day Egypt Express tour is £164 (was £205), including the Pyramids, Abu Simbel and more. Departs Jul 16, 19 and 23. Excludes flights and entrance fees. Two nights in Amsterdam and Bruges is £209 with Anderson Tours (0207 436 9304;, including coach travel, ferry crossings, B&B, and a trip to a cheese and clog factory. Departs Jul 8.


DAILY TRAVEL DEALS GO TO where new travel deals are updated daily. There are more than 30 deals live at any time. Also sign up for TNT’s weekly travel newsletter, which will be emailed to you every Wednesday with the most up-to-date deals and guides to over 170 destinations. Sign up at

£250 - £500

OVER £500

A 10-day Egypt Unplugged tour is £339 (save £60) with On The Go (020 7371 1113;, including Dahab, the Pyramids, the Valley of the Kings and more. Departs Jul 12. A seven-night multi-activity break to Morzine, in the French Alps, is £279 (was £329) with Hofnar (, including airport transfers and chalet accommodation. Excludes flights and activities. Departs July 16. A seven-day Riviera Secrets tour of Albania is £484 with Juicy Tours ( Visit Tirana, Berat and more. Departs Jul 23. An eight-day Sailing Split tour of Croatia is £375 (save £95) with On The Go (020 7371 1113;, including Dubrovnik, Korcula and other ports of call. Departs Jul 9.

A 15-day tour of Cuba is £1525 (save £100) with Explore (0844 499 0901;, including accommodation, meals and flights. Valid for any departure in 2011. Book before Jul 31. Four nights in colourful San Francisco is £699 with Thomson Tailormade (0871 664 0273;, including flights and accommodation. Departs Aug 28. Three nights in New York is £599 with Hayes & Jarvis (0844 415 1918;, including accommodation and flights. Departs Aug 28. A 14-day Essence of Peru tour is £1256 (was £1569) with Gap Adventures (0844 272 2040;, including the Amazon jungle, Cuzco, Machu Picchu and Lake Titicaca. Departs Aug 26.

*All fares are ex-London, unless otherwise stated.

Need to send money between Australia, New Zealand and the UK? You don’t need a bank to do it. We also do money transfers to South Africa

Transfer fees from £1

Money transfers For live transfer rates, see

or call 0870 898 8996 Exchange rates* Australian dollar New Zealand dollar South African rand Polish złoty Euro US dollar Canadian dollar Hong Kong dollar Swedish krona Swiss franc Singapore dollar

1.52 1.98 10.96 4.47 1.11 1.60 1.57 12.46 10.31 1.33 1.98

Why use tntforex? ■ Great rates ■ No hidden bank fees ■ Faster transactions ■ Easy-to-use online systems ■ Safe, secure and fully compliant

Unrivalled customer

service *Transfer rates are as of June 28, 2011. Please note that these are mid market rates in relation to GBP


Three nights in Lille is £170 (save £44) with Great Escapes (0845 330 2089; greatescapes., incuding Eurostar and B&B. Valid from Jul 15 to Aug 28.

See Lake Titicaca on a 14-day Peru tour with Gap Adventures for £1256


7 DAY FROM > > > > > >




















GATHER UP YOUR FRIENDS FOR 2011 Sail Croatia is the ‘number 1 travel experience in Europe’ as voted by our customers. Giving you old skool Med combined with all the things we love about being on holiday with a great bunch of mates. • The water at your doorstep and cool drinks on tap.

Freestyle through Eastern Europe with local guides on flexible itineraries giving you the best travel experience with like-minded travellers.

• No bags to carry. No hotels to check in and out of.

• Small buses and small groups - getting you off the beaten track.

Cruise around small islands. Swim everyday in another bay. Explore small ports, cafes and tavernas. Experience amazing clubs and bars ‘til the early hours.

• Only local guides - giving you that local travel experience. • Flexible Itineraries - to fit in with your plans. • Hook up with other road trips or link it to Sail Croatia.



£ 59



• Spectacular views that change by the hour. • Local culture or learn the lingo with our crews.


Exclusive to Sail Croatia Modern, huge decks, spacious cabins, air-con 2 are brand new flagships one with Jacuzzi on the deck! Operating on our Navigator Cruises for 21-35s.

SSION FOR TRAVEL RELAX AND INDULGE YOUR PA See our website for details: See our website for details: FIND US ON





The AA Appointments Group is the UK & Australia’s longest established and by far the largest, UK Specialist Travel Recruitment Consultancy. We are urgently looking for experienced travel personnel with GDS to fill numerous, extremely well-paid temporary assignments within the UK’s most prestigious Travel Organisations’ and Airlines. Our temps enjoy a choice of the largest selection of travel temporary assignments throughout the UK and Australia. A small selection of our current UK immediate opportunities include:Snr Business Travel Consultants x 25 Ticketer x4 Australia/Far East Specialists x3 Events Consultants x3 Long Haul Res consultants x10 Sales Support x3 Corporate Travel Consultants x15 Retail Travel Agents x4 Air Operations Executives x2 Cruise Consultants x6 Marine Travel Consultants x2 Roadshow Consultants x5 Luxury Travel Consultants x8 Fares Helpdesk Agents x2 We offer:•Excellent rates of pay – paid weekly into your bank account. •Immediate short/long term assignments, set contracts and temp to perm placements. •Tax efficient salary solutions including (for overseas temps with the “right to work” coming to the UK) the ability to reclaim the cost of your return air fares and accommodation in the UK against your tax. •Special loyalty benefits, “Refer a Friend” bonuses and temps parties! •General assistance and advice in finding accommodation and like minded friends etc •Regular promotions to win free luxury accomodation for yourself, friends/family in Monaco and Cyprus. •Membership of TATC offering excellent deals on flights, cruises, hotels, holiday packages etc.

For further information or immediate work please email your CV and covering letter to or call 44 (0) 207 977 5530

c/ San Jeronimo 23/2º Floor 20003 San Sebastian Guipuzcoa Tel: + 34 943 422874

HOSPEDAJE BASQUE c/ Elgoibar No. 10 20014 San Sebastian Guipuzcoa Tel: + 34 943 446759

Located in a privileged site, in the slopes of the Monte Igeldo, a few metres from the residential area Ondarreta and its beach. The hotel has 47 fully-equiped rooms, a conference and meeting room, an outdoor swimming pool and garden and free parking. ● ●

Tel. (+34) 943 212 022

TNT Language School sponsored by



Urbansurf is the result of the

Learn The Lingo courses, part of TNT’s Language School, are ideal for beginners or those who’d like to brush up on the basics

French / Spanish Ë TUESDAY 12 JULY Spanish @ 6:30pm

Ë WEDNESDAY 13 JULY French @ 6:30pm

VENUE: YHA London St Pauls 36 Carter Lane, London EC4V 5AB COST: £75 COURSES INCLUDE: u u u

Five weeks of intensive sessions Language Machine tutor Language pack and reading materials

FOR INFO AND TO BOOK YOUR PLACE SEE Places are limited, only 15 per course. Book early to avoid disappointment!



engagement between two great experts in leisure and entertainment: Pukas and Urbanhouse. Pukas contributes surf. Urbanhouse puts the lodging and all the rest. QUESTIONS AND BOOKINGS: Telephone: +34 943 43 15 78 nd Weeke om s fr price


pp urf ding s inclu sons! les for bsite see we details more

URBAN HOUSE Excellent atmosphere in a central location in the oldest and most traditional part of San Sebastian, located between the 2 beaches La Concha and Zurriola (within a 5 min walk) QUESTIONS AND BOOKINGS: Telephone: +34 943 42 81 54


TNT Weekender San Sebastian Classy San Sebastian spills over with body-beautiful surf beaches, hip bars and pretty buildings. It’s also Spain’s undisputed culinary capital as it has more Michelinstarred eateries per inhabitant than anywhere else in the world – 16 to be precise. Smack bang in the middle of the Basque country, the town is fiercely proud and regional.

king prawns, spring onions and cream smothered with grated cheese, which you can eat at Bergara Bar ( Expect to pay about £1.80 for every pincho. See for a list of suggested pintxos bar routes. Bars get going about midnight and stay open until the early hours. When you’re ready for a proper feed, the town boasts a slew of attractive fish restaurants serving fresh catch.



La Concha and Ondarrea are great for swimming, while Zurriola is popular with surfers.

Hike up Monte Urgull to the statue of Christ. This vantage point offers dazzling views across Concha Bay and the city.


Getty Images, TNT Images

CHOW DOWN Munch your way around the OUT OF TOWN Hire a car and cruise along Old Town (Parte Vieja) with the gorgeous coast to Bilbao. a pintxos crawl. Go Along the way, stop at from bar to bar, surfer’s favourite sipping a small Sopelana beach beer or a glass and nudist of wine, while beach chomping on Barinatxe. pintxos, Tasty: pintxos In Bilbao, the Basque you’ll find the equivalent of tapas. acclaimed Guggenheim Forget chorizo; pinxos are Museum of Modern Art, an art form. Must-scoff dishes and a picturesque Old Town include prawns brochette, and bursting with atmospheric bars. txalupa: a mix of mushrooms,

FESTIVAL FEVER The International Jazz Festival will take place from July 21-25 at the San Telmo Museum, with headliners including Cyndi Lauper, B.B. King and Chick Corea. The glitterati roll into San Sebastian in their droves from September 16-24 for the Film Festival, which showcases the best of world cinema. See The Tinker Day drum parades are held in early February with street parties to remember the arrival of Hungarian gypsies. Locals get togged up in gypsy outfits.

AND A RANDOM FACT San Sebastian was a small fishing port until the 19th century, when Spanish royalty (led by King Alfonso XII of Spain’s widow Maria Cristina) decided to start spending summer here, transforming it into a glitzy holiday town.


TNT online For a full travel guide on San Sebastian go to

NEED TO KNOW WHEN TO GO San Sebastian’s climate is mild all year round, with temperatures peaking from June to August. Nights can be cool, even in summer. GETTING THERE Fly to Barcelona, Madrid, Bilbao or Biarritz and catch a train or bus to San Sebastian. Flights to Biarritz cost from £130 return with EasyJet ( VISAS South Africans need a Schengen visa. CURRENCY Euro. 1 GBP = 1.12 EUR. LANGUAGE Spanish and Basque. GETTING AROUND It’s easy to explore on foot. GOING OUT A beer costs about £2.50. ACCOMMODATION Hostels start from £22 per night.

San Sebastian




WINNER SIMPLE MORNINGS Bill Lancaster, from Australia

TNT online For details of how to enter go to

This spartan image entrances with its delicate observations. The spindly rods lead you into the frame with their repetition, as does the gentle fuzzy shoreline zig-zagging into the distance. The way the sea blends seamlessly into the sky is particularly dreamy. The low sunlight has highlighted the rough mounds

of golden sands and draws the eye to the tiny figures of the fisherman. HOT TIP: Low sunlight will pick up the slightest texture in any subject. To make the most of it, position the sun to the side of the camera rather than behind or in front. This will accentuate the contrast in the shadows and highlights.

RUNNER-UP BIG SKY, SOUTH AFRICA Julie Schultz, from South Australia Julie’s shot shows just how dramatic backlighting can be. This smattering of clouds has been turned to deep black against a colbalt blue sky with the backlight creating an intense halo effect. The Halloween-style, spikey tree is perfect for a very interesting silhouette and the sun breaking through

» Bill wins a three-day tour of Scotland for two valued at £218 from Haggis Adventures (; 0131 557 9393). Must be taken within three months of receiving prize letter.

the clouds on the horizon adds a touch of gold to Julie’s entire photograph. HOT TIP: Increase the contrast in your shots to get dramatic effects like this by adjusting the levels with your imaging software. This will deepen the blacks and lighten the whites. » Julie wins a photography course voucher from Nigel Wilson Photography (020 7793 8664; photographycourses. valued at £60.




THEME: LIGHT Tulips, England by Lydia Storey, from England Light is the key to the success of any photograph and Lydia’s shot shows how the right light can give a graphic quality to an abstract composition.


WHY THIS WORKS: 1 The composition is made up of a limited colour palette – blue, pink, white and a hint of yellow/green. 2 The lines of the petals keep the eye gently traveliing back and forth across the frame. 3 The base of the flowers sit right on the base of the frame

so they appear to be sitting on the frame rather that existing inside it. 4 The light is from above so we see no shadows, and the only texture is the silky highlights of the petals which has a tactile effect. 5 The flat blue of the sky makes this almost like a studio

shot – it would be perfect for editorial use.

HOT TIPS: 1 Get in close –the closer the better. Use a macro lens or the macro setting on your camera. 2 Limit the amount of colours and textures in the image.

Try to find a theme in line, pattern or shape. 3 Use the frame creatively – have the subject actively relate to the frame. 4 Flat lighting works well to show off colour and shape and eliminate texture. 5 Try and shoot from an unusual angle.

in association with



in more than 2,400 locations in over 60 countries. Happy Motoring!

Underwater world: scuba diving in Malta

Marvel at the rich underwater life

dive in

Explore the wonders of the ocean by taking a scuba diving trip in Malta WORDS CATHY WINSTON

Scuba diving MALTA

Back on dry land: emerging after a dive

Wreck of the week: sea-weed encrusted treasures


and calm clear seas to practise in, it’s a great place for beginners – not to mention the megalithic temples, centuries-old walled cities and fishing villages to explore on dry land between dives. It’s here I prepare for my final training dive to the wreck of Lady Davinia, formerly HMS Greetham, at the end of a four-day trip.

WRECKS AND CAVES When you think of diving, it’s normally destinations like the Red Sea or the Great Barrier Reef which spring to mind. But Malta, just three hours from the UK, has previously been voted the top scuba diving destination in Europe. With wrecks, reefs, caves and lagoons at more than 30 underwater sites around the coast of the Mediterranean island and neighbouring Gozo you’ll understand why. And with English-speaking instructors

UNDERWATER LOVE The fish swimming through the engine room and smashed Royal Navy china on the seabed can hardly be more of a contrast to the underground pool at Waterloo’s Shell Building where I’d done my pre-trip dive training. Malta’s fascinating string of wrecks, some bombed during the Second World War and others deliberately scuttled to create artificial reefs, is one of its biggest diving drawcards. And best of all, unlike many destinations

Getty Images, TNT Images

he local fisherman don’t even try to hide their grins as I struggle into my wetsuit on the quayside in Sliema, one of Malta’s busiest tourist centres. But as I stride into the water, mask and scuba diving equipment firmly in place, the incredible underwater world makes me forget all thoughts of their amused faces and the bustling cafes 15m above me.



Granny’s Inn is a family run hostel which is ideal for guests (minimum 20 years) & families, who wish to have a comfortable stay when visiting Malta for both a short or long period. It is situated only 20minutes away from the airport. Airport transfers and Taxi service is provided!! Tel: 00356 21323762 | E-mail:


l Offer Specia ¤25 per m o fr s te ra er night person p t iscoun T d % 5 1 oting TN when qu bookings ly on week

Splendid Guesthouse is a typical Maltese townhouse converted to cater for the discerning traveller. It is situated at the heart of Mellieha, conveniently close to the main shopping centre, bars, restaurants and a 10 minutes walk to Malta’s largest beach.

The British is the longest established family run Hotel in Valletta. This hotel is located in the Capital city of Malta, Valletta and is located in one of the city’s quaint terraced streets. This affordable two star Malta Hotel is a family-owned-and-run hotel. Tel: +356 2152 1326 +356 2152 3602 Email:

Contact us: Hotel British, 40 Battery street, Valletta, Malta Tel +356 21224730 or +356 21239022/3 Mob +356 99768250 E-mail:

in association with



in more than 2,400 locations in over 60 countries. Happy Motoring!

TNT Language School sponsored by



Learn The Lingo courses, part of TNT’s Language School, are ideal for beginners or those who’d like to brush up on the basics

French / Spanish Ë TUESDAY 12 JULY Spanish @ 6:30pm

Ë WEDNESDAY 13 JULY French @ 6:30pm

VENUE: YHA London St Pauls 36 Carter Lane, London EC4V 5AB


Five weeks of intensive sessions Language Machine tutor Language pack and reading materials

FOR INFO AND TO BOOK YOUR PLACE SEE Places are limited, only 15 per course. Book early to avoid disappointment!




Historic city: Valletta

Getty Images, TNT Images

where wrecks are frustratingly out of reach for novice divers, most here are shallow enough for beginners to investigate. You needn’t even venture too far from the cities to find them, with two lying in the bay opposite the capital Valletta – the HMS Maori, the ship that sunk the Bismarck, and the bombed Lighter X127 barge, also known as the Carolita.

WHAT LIES BENEATH Swapping the view of Valletta’s 16th Century stone palaces for a silent seaweed landscape, I can make out the gaping hole in the barge left by the bomb’s devastating impact, and more surreally, rusted bedsteads and bits of wheelchair from the old quarantine hospital at Fort St Elmo. The island is also one of the best places to see seahorses, as well as elusive barracudas, parrot and dolphin fish, rainbow wrasse and eels – especially in the clear waters around Cirkewwa, in the north of the island, one of Malta’s best sites for both beginners and experienced divers. Although I can’t stray too deep, the seabed, at 36m, looks temptingly close


WHEN TO GO Visit in March-June or September-October, when Malta is sunny but without the high-season crowds in July/August. GETTING THERE Malta is about three hours’ flight from the UK. Return fares cost from about £75 with EasyJet from Gatwick, about £120 with Air Malta from Heathrow and about £53 with Ryanair from Luton. SEE



MALTA as I explore the string of small caves dotted near the reef – including one with a statue of the Madonna – before floating under a perfectly formed natural stone arch nearby. As I spot a flying gurnard, with its stunning iridescent blue markings, an octopus speeds off in an puff of black ink, annoyed at my bubble-blowing approach. The locals may have find me a source of mirth but, after seeing so many beautiful sights on this diving adventure, I know that I’m the one having the last laugh.

The ocean has many amazing sights

The Azure Window

» The BSAC Ocean Diver course with the Maltaqua Dive School ( costs about £320 or about £195 if you have completed the theory and training sessions in the United Kingdom. Contact London’s Hellfins Club ( for details or the British Sub-Aqua Club ( 350 6200) for more information.

EAT, DRINK, SLEEP EAT: ■ Guiseppi’s wine bar, run by local celebrity chef Michael Diacono on the corner of St Helen Street in Mellieha, is worth hunting out for fantastic seafood. ■ Take a tip from Brad Pitt and Madonna and tuck into fish at Peppino’s Restaurant ( in St Julian’s Bay. ■ Tarragon restaurant (tarragonmalta. com) in St Paul’s Bay gives Maltese classics a modern twist.

DRINK: ■ Grab an outdoor table at 222 Bar ( in Valletta, built in a converted grain store in the bastion walls.

■ For a great selection of wines, head to Trabuxu, in Valletta – watch out for the easy-to-miss stone sign on South Street. ■ For somewhere chic, it’s hard to beat cocktails in the Pearl Lounge at the Corinthia Hotel (, St George’s Bay.

SLEEP: ■ Valletta’s luxurious five-star Phoenicia Hotel ( has views out onto the Grand Harbour. From about £100 per night. ■ Boutique 16th century townhouse Indulgence Divine (indulgencedivine. com) in Vittoriosa has its own roof

terrace and a bedroom in the building’s former chapel. From £400 for five nights, sleeps two. ■ For a budget option, stay in the island’s north at the family-run Splendid Guest House ( in Mellieha, near one of Malta’s top beaches. From about £17.50. Madonna: a Peppino’s fan

TIPS Helpful holidays: volunteer for a trip with a difference



Even the most avid TIP OF sightseer can get THE WEEK bored after traipsing around a city, staring at buildings, listening to a guide blether on about the history. And, really, how memorable is it after the first few sights? Instead, get involved. Ride a horse, go quad-biking, go abseiling, take a cooking lesson, go fishing. These local activities will provide better memories and cooler stories than endless walking tours.


Tony, via email


YOU ASKED FOR IT Laura Lindsay FROM LONELY PLANET I want to take my boyfriend on a short holiday somewhere in Europe. I spent seven months last year travelling around Europe and saw most of the main cities. Now I want to do something a bit different from lying on a beach or visiting museums and monuments. Do you have any suggestions? Zoe, via email





So many travellers put all their money on one card and then have no idea what to do when they lose it. The best advice is to use a number of methods and don’t keep them all in the same place. That way if you lose one, you won’t be left completely penniless. You are thinking along the right lines by taking both credit cards and travellers’ cheques. However, travellers’ cheques are not accepted everywhere and do incur commission. You could also look into a prepaid card which can withdraw preloaded money from ATMs. If you are withdrawing from ATMs (using credit cards or prepaid cards) you will incur fees on each transaction so it can be advisable to withdraw larger sums less often. Unless, of course, you know you will spend whatever you withdraw straight away. It is also advisable to note down the telephone numbers you need to call to cancel your cards if they are lost or stolen. The quicker you can inform the bank, the better. Send an email to yourself with the list of phone numbers.

Alex, via email

NEW You can now text us your thoughts: Text TNT and your message to 81707* * Messages cost 25p each + standard network rate. 18+ bill payers only. Send STOP to end. Number may show on bill. A2B 08700460138 Tweet your tips to @ tntmagazine or email traveltips@ Tip of the Week wins a Lonely Planet guide and other published tips win a fiver.


Lonely Planet’s Laura Lindsay will give you the benefit of her infinite wisdom if you email a question to traveltips@ tntmagazine. com. If she answers your question, you’ll win a Lonely Planet guide of your choice.

This is a reader forum — TNT and Lonely Planet accept no responsibility for any loss, injury or inconvenience sustained by anyone using the information provided.


This could be great opportunity for you to try a volunteering holiday. One of the most rewarding types of trip, volunteering offers you the chance to learn about cultures on a more intimate level and to give something valuable back to the region you visit. Fast becoming a popular holiday option, there are now hundreds of operators providing different trips, from saving the environment to teaching English. European volunteering holidays are less widely offered but I have picked out a few options for you. Real Gap Experience has a one-week trip working with orphans in Moldova from £399 ( Meanwhile, GVI ( has a great trip to Greece to work on turtle conservation. Based in the resort of Lakonikos, you would be surveying loggerhead turtle nests and providing education about the endangered species to visitors and locals. You will need to arrange your own flights for both trips.

I’m travelling through Asia on the way to Australia next year. I plan to take credit cards and maybe travellers’ cheques, but what would my options be if I lost my wallet? How would I be able to access funds? Mark, via email

When visiting Glasgow, use the Subway to get around. It’s cheap, safe and nowhere near as crowded as the London underground.

TRAVEL NEWS Pucker up: not everyone goes to festivals for the music


FESTIVAL FANS GET FRISKY Almost one in five randy music fans have had a one-night stand at a festival, while one in six has lost their undies, according to a recent survey. In the wake of Glasto, Generator Hostels quizzed more than 1000 18 to 25-year-olds about their festival experiences. The research found that festival-goers are a absent-minded bunch, with one in three (29 per cent) leaving behind their shades and hats, and one in four scatterbrains forgetting their tent. When asked what items they couldn’t live without at a festival, one in three (28 per cent) identified wellies as a number one item – crucial for last week’s muddy mayhem at Glastonbury. Meanwhile, one in five (19 per cent) said toilet roll was essential. Other must-haves included portable peeing

device “she wee”, with one in 10 women taking them to avoid being caught short and 14 per cent saying they had to have wet wipes to stay clean. Music fans are so desperate to get their hands on festival tickets that 16 per cent confessed that they would sell their own granny to get hold of one, while one in three (28 per cent) would busk to get the cash together. Tickets to festivals like Glastonbury are notoriously tough to get hold of, with this year’s event selling out just four hours after tickets went on sale in October. The survey revealed that the most popular international festivals are Glastonbury; Rock am Ring, in Germany; Benicassim in Spain; Roskilde, in Denmark and the Burning Man in the United States.

Thinkstock, Getty Images

Log on while on holiday More than half of socialnetworking obsessives have admitted to logging on while on holiday, a survey by has revealed. More than two thirds (39 per cent) say they no longer send postcards to family and friends, preferring to update their mates on their holiday shenanigans by using Facebook and Twitter. Although half of travellers who check or update social networks while on holiday reckon it’s a waste of time, two thirds (59 per cent) admit to

Are you with social Xxxx xxxxobsessed xxx networking sites? xxxxx

spending two hours or more doing so. A total of 42 per cent say they feel out of the loop or bored if they aren’t able to log on, while one in 10 (10 per cent) feel anxious or lonely. Facebook is the most popular site for people to use when abroad (83 per cent).



Amateur snappers are invited to submit their travel photos to a competition run by Islington travel agency Real Holidays. The winner will score a five-night stay (excluding flights) at Grenada’s Spice Island Beach Resort, while the two runners-up will receive a large canvas copy of their print. The top three entries will be shown in the agency’s shop window. Enter before Sep 29. See

HostelBookers has launched its summer sale, offering customers the chance to book selected properties at discounted prices. In Portugal’s historic capital, Lisbon Calling is offering 40 per cent off its normal rates, along with Rome’s recently revamped Hotel Dama. Bookings need to be made before July 31 and travel must be completed by August 31. See summer-sale-2011.






Trie-sur-Baïse, France Aug 15 Eat your fill of cooked pig as you check out the pigsquealing championships in which contestants imitate our porcine friends. There’s also a black-pudding-eating contest. Veggies will want to barf.




dressed in ornate silk, embroidery and fairy lights is interspersed with religious participants performing devotional acts. Between the torches and costumes, you’ll see the faithful walking across hot coals, impaling the skin of their backs and fire-eating. On the last night, a sword is drawn through the Mahaweli Ganga River to symbolically divide pure and impure.


TNT online For more upcoming events, see our destination guides at


REGGAE ON THE RIVER Humboldt County, US July 16-17

WHERE: Religious centre, Kandy. WHY: Buddhists believe that

when Buddha was cremated, one of his teeth was saved. Today a replica of the casket in which it was kept is carried by the chief elephant. HOW MUCH: Free to watch.


BAYREUTH FESTIVAL PUKKELPOP Hasselt, Belgium Aug 18-20 An eclectic music festival set in fields and woodland, attracting about 60,000 people. This year, Foo Fighters, Eminem, Offspring, The Ting Tings and Thirty Seconds To Mars play, among others.


Where in the world?

Bayreuth, Germany July 25-Aug 8

BYRON BAY WRITERS’ FESTIVAL Australia, Aug 5-7 byronbaywritersfestival.

CONWY RIVER FESTIVAL Conwy, Wales, Aug 13-21

THE TRAVELLER … Anna-Lena Pancherz, 21, Münster, Germany What’s your favourite country?

Spain. I love the warm, blue ocean and clear beaches in Malaga. Best party you’ve been to?

Karlie Finlay from Brisbane, Australia, at the Guinness factory in Dublin, Ireland.

What do you like about London?

The Tube. It’s so quick and easy to understand.

Getty Images


Been somewhere good lately? Send us a horizontal photo of yourself with a copy of TNT from anywhere around the world and, if we print it, you’ll win a day trip for two to Bath and Stonehenge with Anderson Tours, valued at £104. » Email your pictures to along with your name, where you’re from and where the photo was taken, or see Files must be at least 500Kb.

The Feria de Malaga goes on for a week and is a massive fun-fair with food and drink tents and loads of rides.


FIVE WHALE-WATCHING SPOTS JANINE KELSO GIVES A HIGH FIVE TO HAVING A WHALE OF A TIME CANADA WHAT: Canada’s chilly seas are perfect for whale-watching, especially in British Columbia’s west coast; Newfoundland, Quebec, New Brunswick and Nova Scotia on the east coast. Watch the massive marine mammals from small yet speedy boats, larger cruise yachts, kayaks or even by snorkelling alongside the creatures. SEE:



ICELAND WHAT: Reykjavik’s harbour is awash with boats offering whale-watching tours. It’s possible to spot killer whale orcas, humpback whales, pilot whales, minke whales, as well as dolphins and porpoises. The best time to spot whales is in spring and summer. SEE:




WHAT: You don’t have to go too far afield to see whales. Orkney and Shetland Islands, the Moray Firth, the Scottish west coast and Cardigan Bay in Wales are all hotspots to see these majestic giants. SEE:

HAWAII, US WHAT: Humpbacks are drawn to the shallow waters off Maui from December to May. Goggle the whales playing, tail slapping and blowing spouts in the air while on a boat tour. Find a tour by visiting the kiosks lining Lahaina harbour. SEE:


BOSTON, US WHAT: Mid-April to midOctober is the best time to go whale watching in Boston. Expect to see migrating humpbacks, fin and minke whales as well as dolphins. Humpback whales put on the best display, breaching and tail slapping. SEE:

Thinkstock, TNT Images


THE INSIDER KATY FREEMAN, MARKETING EXECUTIVE, BUSABOUT, HAGGIS & SHAMROCKER The best part of my job is getting to help out at the European festivals – I'm off to Oktoberfest this year! My most challenging travel experience was travelling to South America alone and not speaking much Spanish. My favourite place in the

world is too many to mention them all – South America, the Western Isles of Scotland, Milford Sound in New Zealand and Paris are among them. My top travel tip is always pack half as much as you think you will need. My guilty travel pleasure is sampling the local booze. My first ever big trip was travelling solo around Europe on Busabout hop-on/ hop-off in 2003.

Party time: Crop Over Festival

A BIG KADOOME In Barbados, the Crop Over festival is bigger than Christmas … and there’s loads more bodypaint involved WORDS FRANKIE MULLIN



alf-naked, feathered, sequined bodies have acquired a layer of sweat and dust. As the crowd grinds and pulses its way along the road, the odd tassel or headdress is shed and trampled underfoot. The crowd glows with rum and euphoria. I’m allowing myself to be swept through Bridgetown Market on the final day of Crop Over, Barbados’s spectacular annual festival. This is Grand Kadooment, a word as enjoyable as the event it describes. Kadooment means, in Bajan, “a big to-do”. And a big to-do it is, one that has been getting steadily wilder since it kicked off this morning.

PARTY TIME Kadooment is about creating a spectacle and months of preparation have gone into the competitively flamboyant costumes. Anyone can sign up to “jump” with a band, elevating them to the status of carnival participant proper, with dancing space behind a music float and a drinks truck on hand. If you’ve got the stamina and can rock a spangly outfit, then do it. I haven’t signed up with a band so join the less-colourful, but equally enthusiastic, onlookers who line the streets. I’m in no danger of feeling left out; Bajan people are friendly – so friendly that I am swept into the air by a group of buff, body-painted guys who happen to pass by. This, dear reader, is a very good moment for me. We travel with the costumed bands from the National Stadium to Spring Garden Highway, where everyone will finally congregate to collapse. The day starts early and we find a spot on a grass bank near the judges’ tent. Each band parades through to be scored on their costumes and this is the comparatively ordered part of the day. Before the haze of alcohol and elated

NEED TO KNOW WHEN TO GO Crop Over festivities have already started but the main weekend is from July 29-Aug 1. GETTING THERE British Airways and Virgin Atlantic fly direct to Barbados. ACCOMMODATION Hotel rooms start at £60 a night, but may be more during Crop Over. B&B in a family home from £20 per night. Get a list from SEE





Outdoor Barbados ESCAPE THE MADNESS AFTER CROP OVER HARRISON’S CAVE For total peace and quiet, Harrison’s Cave, with its cool, echoing labyrinth of chambers and tunnels, is your ticket. Fairytale-esque stalactites and stalagmites create shapes that look like people and animals, and in one cave, a 12m waterfall cascades into an emerald pool. A tram will take you through the huge subterranean caverns. BARBADOS WILDLIFE RESERVE Get your camera ready in this haven for Barbados’s most colourful and exotic animals, many of which are endangered. If you’re not a fan of seeing animals in cages, don’t fear – most live freely in the stunning mahogany forest. Expect to meet monkeys, parrots, flamingos, iguanas, turtles and snakes. Get there at the green monkeys’ feeding time for guaranteed entertainment. ANDROMEDA BOTANICAL GARDENS There are several botanic gardens in Barbados, but Andromeda is hard to beat. On a hillside overlooking the coastline, the gardens showcase a dazzling array of flowers, plants and trees. Don’t miss the ancient, giant bearded fig tree and a hibiscus garden which attracts tiny hummingbirds. THE SCOTLAND DISTRICT If you like hiking then visit the island’s Scotland District, so-called by homesick settlers as it supposedly reminded them of their homeland. There are hills, but the resemblance stops there – thanks mainly to the palm-covered slopes, sunshine and distant sparkling ocean. If you’ve danced your legs off, there are several riding schools on the island, so you can hop on a nag to explore.

Fun with feathers

exhaustion sets in, the bands are bright and shiny. The biggest have several hundred members dressed in coordinated, themed outfits. One group shimmies past like fish in green, blue and silver bodypaint, dorsal fins and tails shaking; another, in red, yellow and green, represent the spirit of ‘irie’, a Rasta word meaning ‘good vibes’.

Dance moves “ get raunchy as couples grind ” Bikini-clad bodies jump past – by the end of the day their moves seriously raunchy as couples grind and girls bootyshake. The costumes are works of art, some held aloft on poles or gliding on wheels, needing several metres berth to move. The sheer amount of work involved is seriously impressive. Soca, the musical child of soul and calypso, is the soundtrack of Crop Over and, for months, soca exponents have battled it out to be crowned Calypso Monarch, Party Monarch or Sweet Soca Monarch.

FESTIVAL FEVER The Friday before Kadooment, Pic-O-DeCrop launches a four-day party marathon that is the climax of several months’

festivities. Fans pack the Kensington Oval stadium to watch the high-energy, oftenpolitical soca artists compete for the coveted crowns. Pic-o-de-crop finishes at 1am but that’s not a licence to head to bed. Foreday Morning, one of Crop Over’s biggest parties, limbers up and the streets fill with revellers who, by 6am when the party ends, will be covered in mud and paint. It takes energy to get through Crop Over; after Foreday Morning, there’s still Cohobblopot – a stadium display of the costumed bands – before you reach the prize that is Grand Kadooment. But in Barbados, Crop Over is bigger than Christmas, so the island puts work on the back burner and expects a sore head this week. Today, the Spring Garden Highway is lined with stalls selling drinks and food and, as evening falls, the area becomes packed as both costumed bands and onlookers reach Crop Over’s final party. There’s a beach nearby and the sand is soon littered with discarded tassels and empty beer cans while the ocean fills with slightly battered carnival folk. On the streets nearby, soca anthems blare out and, now the bands have dispersed, the fish-folk dance with the iries, and


Frankie Mullin / TNT Images

Harrison’s cave

Feeling irie: the writer gets cosy with the locals


The history TRAVEL

Crop Over began in the 19th Century when slaves celebrated the end of harvest on the sugar plantations. The earliest mention of the festival was by the manager of Newton Plantation, who wrote in 1788 that he was arranging “a dinner and sober dance” for his slaves. Emancipation came but the festival endured. Free from oppression, ‘harvest time’ became ‘Crop Over’ and the sober dance metamorphosed into something far more fun.


onlookers mix with the costumed dancers. Rum in hand, I’m definitely part of Kadooment now. I’ve even acquired some smudges of body-paint to prove it.

» Frankie Mullin flew to Barbados with British Airways ( and stayed at the Southern Palms hotel (southernpalms. net). For more information see NEXT WEEK: NEPAL

Join a new community trek in the Annapurna range

Pump and grind: couples like to move it

What not to miss FIVE THINGS TO DO BEFORE YOU LEAVE BARBADOS ➤ BEACHES Between the Atlantic and Caribbean oceans, Barbados has a markedly different coastline on either side. The southwest, Atlantic side of the island is undeveloped and unspoiled. For postcard-like perfection, hit Crane Beach, a stretch of white sand overlooked by craggy cliffs. You can reach it from the swanky Crane Beach Hotel and it’s worth spoiling yourself with a drink on the ocean-overlooking veranda before taking the cliff-face lift down for a swim. On the west coast of the island, beaches are long and sandy but may be lined with bars, restaurants and resorts. ➤ SWIM WITH TURTLES The island is formed mainly of coral and there are both deep and shallow reefs abundant with bright coral and exotic fi sh. Here you can swim with hawksbill and leatherback turtles in the wild. These graceful creatures were once endangered but, in some monitored areas, have become comfortable enough with humans to make it possible to swim with them. ➤ GEORGE WASHINGTON HOUSE The house where America’s first president, a slave-owner himself, once stayed has been reconstructed to show how the moneyed classes once lived. Wine-cooling rooms and four-poster beds testify to a cushy existence. which makes the collection of manacles, chains and barbed neck collars which were used as a form of restraint on the slaves all the more shocking.

➤ NIGHTLIFE If you’re not partied out after Crop Over, hang with the locals on Baxters Road, Bridgetown, where you can drink until late. Bars are ramshackle, fun and friendly. St Lawrence Gap is a busy but laidback strip of bars, restaurants and clubs on the south coast. You’ll find karaoke, reggae and jazz bars all within a short block. Eat at Pisces restaurant overlooking the sea and watch the reflection of the lights twinkling. ➤ OISTINS FISH FRY On Friday night, Oistins is the place to be. An area of the town comes to life as all kinds of fi sh are fried up at wooden stalls and served with sweet potato, macaroni pie or coleslaw. Eat at an outside table, then either dance the night away or simply nurse your beer and watch others shake it.

Make friends with turtles






ON SALE! Dep. 30 Jul & 13 Aug 2011







EGYPT EXPLORED Dep. 24 Jul & 13 Aug 2011


















20% OFF!







trips for 18 to 30 somethings

L8291 / Y2992 Flights not included. Egypt prices includes local payment based on US$1 = £0.624, which must be made locally in USD. Exchange rates correct at time of printing, and subject to currency fluctuations, depending when payment is made.


EUROHOTEL: Outstanding locations with bags of character

EUROCLUB: Hostels to hotels, bungalows, castles & yachts


Includes Paris, Rome, Venice, Prague, Amsterdam plus more!

Includes Paris, Venice, sailing in Greece, Prague plus more!





Dep. 19 Aug 2011



Dep. 20 Aug 2011




EUROCLUB: Hostels to hotels, bungalows, castles & yachts

EUROHOTEL: Outstanding locations with bags of character



Includes Paris, Barcelona, Greece, Croatia, Berlin, plus more!

Includes Barcelona, Croatia, Vienna, Prague, plus more!






Dep. 6 Aug 2011



Dep. 9 & 16 Aug 2011



CALL US 0845 257 5210 *Prices quoted & discounts are for specific departures only. All trips subject to availability. Discounts are off trip prices only, and do not include food funds, sailing funds and local payments. Flights not included.






Hop-on Hop-off Europe


10% OFF* SAVE up to £78

Free Lonely Planet with all Hop-on * Hop-off passes and on our Italy, Spain and Eastern Europe treks




Brace yourself for one of the biggest street parties you’ll probably ever see at Spain’s most notorious Festival! Add a bit of beach action at ‘San Seb’ and you’ve got yourself the best of both worlds. We have a choice of Camping and Hostel packages as well as departures from London by coach.


Mykonos, Paros, Santorini & Ios IBERIAN ADVENTURE 7 DAYS JUNE – SEPTEMBER FROM £429-£479

Seville, Jerez, Tarifa, Granada, Toledo & Lagos (Incl: accommodation)


10% OFF* SAVE up to £29


ture Italian Adven

* Use promocode ‘Bull’. Book by 17 July


Ibiza, Menora, Mallorca (Incl: accommodation)


08450 267 514

Pompeii, Capri, Sorrento & Amalfi (Incl: accommodation)


Save 10% when you buy two or more qualifying trips

Scotland, Wales, Cornwall & Ireland


ÂŁ50 Â&#x2018; ÂŁ30 Â&#x2018; ÂŁ20




on selected July & August departures. Book by 17 July.

ÂŁ399 now ÂŁ349 (Students ÂŁ379

NOW ÂŁ329) Orkney, Western Isles, Isle of Skye & Loch Ness



ÂŁ279 now ÂŁ229 (Students ÂŁ259

NOW ÂŁ209)

The Western Isles, Isle of Skye & Loch Ness

ÂŁ189 now ÂŁ159 (Students ÂŁ179


NOW ÂŁ149)

Stonehenge, Newquay, Bath & Landâ&#x20AC;&#x2122;s End

3?22 Surfing Lesson on Newquay Beach worth ÂŁ30



ÂŁ189 now ÂŁ159 (Students ÂŁ179


bVQR` [NaR Y\PNY T R` * ]N``aV\YN[Q R[TYN[Q & dNY * `P\cR_ RcR_ PN[PRY * [R _RP\ZZR[QNaV\[ VQR * && RR Y\[RYf ]YN[Ra Tb * S_


NOW ÂŁ149)

Cardiff, Snowdonia, Brecon Beacons & Conwy Castle


ÂŁ179 now ÂŁ149 (Students ÂŁ164

NOW ÂŁ134)

Orkney Islands, Loch Ness & Highlands



ÂŁ179 now ÂŁ149 (Students ÂŁ164

NOW ÂŁ134)

Loch Ness, Isle of Skye & North West Highlands



ÂŁ109 now ÂŁ89 (Students ÂŁ99


Isle of Skye, Loch Ness & Glencoe



Entry to the Big Pit Coal Mine & entry into Conwy Castle

MULTI ACTIVITY ADVENTURE TRIPS Explore Scotlandâ&#x20AC;&#x2122;s wilderness by bike, hike, canoe and Kayak. INCLUDES: All equipment, support vehicle to carry gear, qualiďŹ ed instructors and max group size of 8.

THE GREAT GLEN William, Great Glen, 4 DAYS ÂŁ329 Fort Loch Ness & Inverness WEST HIGHLAND WAY Loch Lomond, 6 DAYS ÂŁ479 Glasgow, Glencoe & Fort William CHECK US OUT ON FACEBOOK

dddSNPRO\\XP\Z 5.44V@.QcR[ab_R` Award Winning 3,5,7 & 10 Day Adventures Â? Mini-Group Discounts Â? 4bN_N[aRRQ 1R]N_ab_R` Â? =_RSR__RQ Of @A. A_NcRY 3YVTUa 0R[a_R  A_NcRY 0BA@


SAVE ÂŁ50 Â&#x2026;ÂŁ30 Â&#x2026;ÂŁ20 ALL IRELAND ROCKER 7 DAYS GIANTâ&#x20AC;&#x2122;S ROCKER 5 DAYS









FREE STUFF: Blarney Castle / Cliffs of Moher / Giantâ&#x20AC;&#x2122;s Causeway / Carrick-a-Rede Rope Bridge

FREE STUFF: Carrick-a-Rede Rope Bridge / Giantâ&#x20AC;&#x2122;s

FREE STUFF: Blarney Castle / Cliffs of Moher

Causeway / Clonmacnoise early Christian monastic site




BELFAST & DERRY FREE STUFF: Carrick-a-Rede Rope Bridge / Giantâ&#x20AC;&#x2122;s Causeway / Battle of the Boyne site

GALWAY & INIS MOR FREE STUFF: Clonmacnoise early


Christian monastic site

Blarney Castle / Cliffs of Moher







Save 10% when you buy two or more trips






Late Deals SAVE 25% UP TO

European Discovery 12 Days \ 8 Countries \ Time Out Hotels

Includes: Amsterdam, Rhine Valley, Venice, Rome, Florence, Swiss Alps, Paris + more

28 July Now £1,071


Quote/enter PPEURODISC04071


18 Aug Now £1,071 Save £268 Quote/enter PPEURODISC04072

Mediterranean Trail 10 Days \ 3 Countries \ Time Out Hotels

Includes: Rome, Sorrento, Corfu, Athens, Vatican City + more

24 Aug Now £796 Save £199 Quote/enter PPMEDTRAIL0407

USA, Canada & Mexico 2012-13 BROCHURE OUT NOW

Contiki knows how young people want to holiday and delivers it in 18 itineraries across Canada, USA and Mexico. You won’t just visit these countries, you’ll experience them! Contiki is famous for hassle free travel with ease, which means you’ll have more time on the Las Vegas strip, hiking the Canadian Rockies, kicking back on the beach in Cancun + more.

Croatia Island Cruising (below deck cabin) 8 Days \ 7 nights twin share \ Time Out

Includes: Split, Hvar, Korcula, Dubrovnik, Trstenik, Makarska + more

30 July Now £751 Quote/enter PPCLMD823

6 Aug Now £751 Save £77

Quote/enter PPCROAT2506



The Big Chill 46 Days \ 22 Countries \ Camping

Includes: France, Spain, Italy, Switzerland, Netherlands, Germany, Austria, Czech Rep, Hungary, Croatia, Greece, Macedonia, Bulgaria, Turkey + more

2 Aug Now £2,306 Save £468 Quote/enter PPCLMD825

Festivals\ Oktoberfest Camping

18 Aug Now £2,263 Save £457 Quote/enter PPBIGCHILL0407

For more info go to:

7 Days \ Munich tour \ Festival Party

Includes: Best campsite in Munich, 2 person tent. Regular shuttles + more, Transfer option to & from London.

15th – 21st Sept from £299 5 Days from £239

(22nd – 26th Sept or 27th Sept - 1st Oct) | 0845 026 8900




That was  ! r ve e /  

dâ&#x20AC;Ť×&#x201D;â&#x20AC;Ź r tour gue   as d   W l We had to A S g n oi G .  ice was was pâ&#x20AC;Ť×&#x201D;â&#x20AC;Źnom up Đž  l e cam n    going d  h  drums W e!  e cr # give s ce â&#x20AC;Ś "  d ra  t g irn k ) ! ps  I ( m  ' & g % ak, L ĐždĐž Cdy M ul tam

EGYPT AND THE RED SEA Pharaohs adventure 6 days King Tutankhamen 9 days Egypt Unplugged 10 days King Ramses 13 days 5-star Jewel of the Nile 10 days


ÂŁ599 ÂŁ549 ÂŁ649 ÂŁ749 ÂŁ779

Siwa to Alexandria 7 days Sandblaster 13 days Dunes & Tombs 17 days Beyond the Pyramids 12 days Nile Valley to Siwa Oasis 15 days






r t Đž rely ll d  Grt grp,  l go n c, rely frny, fu tour gu e was fantas

k y! â&#x20AC;&#x201C; L e r

d knowdge. Th


Marrakech & Beyond 8 days Marrakech Sahara & Surf 11 days Camels, Souks & Kasbahs 15 days Migration of the Berber 11 days

Why travel with ON THE GO t "#5"  "*50  "50- o  ÜOBODJBM protection t8FMMMPDBUFEMPDBMIPUFMTBOESJBET t&YDFMMFOUFOUIVTJBTUJDMPDBM guides t/PDPNQVMTPSZATJOHMFTVQQMFNFOU t/PAMPDBMQBZNFOU t0òFSJOH a fantastic selection of year-round guaranteed departures t5BLJOHZPVPò UIFCFBUFOUSBDL t$IFDLPVUPVS$ISJTUNBT/FX:FBSUPVSTPOTBMFOPX 020 7371 1113 Seasonal supplements may apply, see website for full details. Phone lines are open Monday to Friday 9am to 9pm. On the Go Tours, 68 North End Road, West Kensington, London W14 9EP. ä&#x2DC; 100% On the Go Assurance. 5096

Had a great ()!

d ghly ew re fantasc

t  pr esĐž d nt r $eds. ir way to #et l  â&#x20AC;&#x201C; Paula C&grave

Gorillas in the Mist 6 days Gorilla & Game Trek 15 days Wildlife Express 22 days Big Five Explorer 36 days Kenya to Cape 43 days

ÂŁ430 ÂŁ720 ÂŁ729 ÂŁ1385 ÂŁ1419 020 7371 1113 Prices reflect local payment, see website for full details. Phone lines are open Monday to Friday 9am to 9pm. On the Go Tours, 68 North End Road, West Kensington, London W14 9EP. ä&#x2DC; 100% On the Go Assurance.





Tours start in Athens every Saturday JUL-AUG ✔ Mykonos ✔ Ios ✔ Santorini ✔ Paros ✔ Athens Amazing value! Package price includes: ✔ 8 or 10 Nights accommodation ✔ Breakfast daily ✔ High speed ferries between Athens & all the islands ✔ Experienced Fanatics Greek Islands tour reps ✔ Superb parties ✔ Unbeatable group atmosphere


15-18 AUG 15-24 AUG 15 AUG-1 SEP

■ Hostel Package ■ Palio to Rome All-Italia ■ Palio-Tomatina Odyssey

£149 £549 £979

✔ Florence ✔ Venice ✔ Milan ✔ Pisa ✔ Rome ✔ Siena ✔ Barcelona ✔ Ibiza ✔ La Tomatina ✔ Palio Festival


12-14 AUG £179

✔ Huge line up featuring FATBOY SLIM! ✔ ASP world surfing tour event ✔ Watergate Bay Music Festival ticket ✔ Return coach from London


fr £389

We sail Croatia’s best islands & route! ✔ Split ✔ Markaska ✔ Mljet ✔ Dubrovnik ✔ Trstenik ✔ Korcula ✔ Hvar ✔ Bol ✔ Brac Cat A: JUL £389-£439 AUG £469-£499 Cat A+: JUL £399-£469 AUG £439-£499 SEP £439 ✔ Top quality boats, unbeatable prices ✔ Select your room & boat when you book ✔ Experienced Fanatics rep on board every tour ✔ Package price includes fuel surcharges & port taxes ✔ Get more for your money with Fanatics in Croatia!

OKTOBERFEST MUNICH’S INCREDIBLE BEER FESTIVAL! 17 SEP-3 OCT ■ Weekend Camping £149 ■ Weekend Hostels fr £189 ■ Weekend Hotel £349 ■ Prague & Buda Fest 8 Day Tour £329 ■ London 6 Day Coach Tours fr £259 All weekend packages three nights Friday-Monday. Mid-week camping & hostel options also available!

RUGBY UNION ■ AUS v BARBARIANS Twickenham SAT 26 NOV ✔ Featuring all of this year’s World Cup stars!

The world ’s biggest food fight! 31 AUG ■ Beach Camping Package £139 ■ City Centre Hostels/Hotels £179/£169 ■ Barcelona + La Tom Double £259 ■ La Tom-Ibiza Combo Tours fr £359 ■ Barcelona, Ibiza, La Tom Treble £449


SKIFEST SKIFEST XMAS & PARIS NYE COMBO ■ Risoul & Paris 23 Dec-2 Jan All-inclusive £699

✔ 7 Nights Risoul ✔ 2 Nights Paris ✔ Coach transfers

SKIFEST XMAS COACH TOUR ■ Risoul 23-31 DEC All-inclusive £599

FOOTBALL ENGLISH PREMIER LEAGUE ■ Coach Day Tours - Manchester Utd & Liverpool ■ Premier League - Fulham FC home games

✔ 6 Nights Risoul ✔ Coach transfers

£99 fr£25

SKIFEST XMAS FLIGHT TOUR ■ Risoul 23-30 or 24-31 DEC All-inclusive £739 ✔ 7 Nights Risoul ✔ Flights & airport transfers

SKIFEST NYE COACH TOUR ■ Risoul 30 DEC-7 JAN All-inclusive £529


30 DEC-2 JAN 30 DEC-2 JAN

■ 7 Nights



■ 3 Night Hostel & Hotel ■ 4 Day Coach/Hostel Tour


£199/£239 £269

✔ 6 Nights Risoul ✔ Coach transfers

SKIFEST NYE FLIGHT TOUR ■ Risoul 30 DEC-6 JAN All-inclusive £729

✔ 7 Nights Risoul ✔ Flights & airport transfers

BOOK ONLINE NOW! or call 0207 240 3223 COVENT GARDEN OFFICE 1st

Floor, 15 New Row, Covent Garden, WC2N 4LD Mon - Fri 9am - 6pm


Th+ +  #$ tour I

have dĐže!




Simply St. Peteâ&#x20AC;&#x2122;s 4 days ÂŁ249 ÂŁ429 Vodka Shot 6 days Back in the USSR 7 days ÂŁ629 Russian Revolution 9 days ÂŁ699

Red Express 10 days ÂŁ799 Genghis Khan 13 days ÂŁ999 Express to China 15 days ÂŁ1349 ÂŁ1799 Big Ticket 19 days

Why travel with ON THE GO t "#5"  "*50  "50- o  ÜOBODJBM protection t  TUBS IPUFMT DIPTFO CZ VT t &YDFMMFOU FOUIVTJBTUJD MPDBM guides t /P DPNQVMTPSZATJOHMF TVQQMFNFOU t /PAMPDBM QBZNFOU t  -PUT PG:FBSSPVOEHVBSBOUFFEEFQBSUVSFTUPDIPPTFGSPN t5BLJOHZPVPòUIF CFBUFOUSBDL t9NBTJO3VTTJBBOE/FX:FBSJO3FE4RVBSFPOTBMFOPX 020 7371 1113 Seasonal supplements may apply, see website for full details. Phone lines are open Monday to Friday 9am to 9pm. On the Go Tours, 68 North End Road, West Kensington, London W14 9EP. ä&#x2DC; 100% On the Go Assurance. 5096


mang re eve ryKat ya was fantasc, d eve ryĐže jed  g r smly  $ tour gu%e I have  tour â&#x20AC;&#x201C; "eâ&#x20AC;&#x2122;s  # had. â&#x20AC;&#x201C; M&n '()n

â&#x20AC;&#x2122; factor! Eve ry g had a â&#x20AC;&#x2DC;wow ad S, Pea d g g Wa Rum... a - Reid p nce! â&#x20AC;&#x201C; d

ÂŁ599 ÂŁ779 ÂŁ949 ÂŁ1249 ÂŁ1599

Passage to Petra 6 days Totally Jordan 8 days Road to Jordan 16 days Arabian Highway 11 days Road to Damascus 14 days 020 7371 1113 Seasonal supplements may apply, see website for full details. Phone lines are open Monday to Friday 9am to 9pm. On the Go Tours, 68 North End Road, West Kensington, London W14 9EP. ä&#x2DC; 100% On the Go Assurance.



Pyramids & Beaches

Egyptian Express *UHDWVWDUKRWHOVÈ&#x2019;&DLURÈ&#x2019;1XELDQ'LQQHU


È&#x2019;3\UDPLGV (J\SWLDQ0XVHXPÈ&#x2019;/X[RU







15 DAYS from




9 DAYS from


No silly local payments

Felucca sailing & donkey riding

Best value packed tours

Top quality, well located 3-star hotels

Guaranteed departures

Awesome, realistic prices

Escorted by an Egyptologist tour guide

No single supplements

Perfect mix of sightseeing & free time

Arrival & departure transfers

ABTA, ATOL, AITO bonding

Xmas & New Year tours

P: 020 7471 6400 or visit 20% OFF ENSUITE SAVE UP TO £145

15% OFF STANDARD SAVE UP TO £88 Valid on departures from 27th August to end September. Book by 17 July

Croatia Island Hopper

Croatia One-Way Sail


8 DAYS FROM £467

Departs Split (May â&#x20AC;&#x201C; October)

6th August - standard cabin

ay On e-Wers! e n Departs Split or Dubrovnik (May â&#x20AC;&#x201C; October) Pio

Inclusions: 7 nightsâ&#x20AC;&#x2122; accommodation, 7 breakfasts, 7 lunches, fuel supplement, island orientation walks, orientations of Split and Dubrovnik, English speaking Busabout Guide and expert local crew.

Classic Rhapsody Trek

Bohemian Trek


All trips include accommodation, breakfasts, Eastern Europe T-shirt and Lonely Planet


08450 267 514



Th k y/ for

ama1ng 2p3%nce!

ryĐže,  gues I w re d to eve

d fr%n&y d re ve ry pr es"Đž# *ed. â&#x20AC;&#x201C;Julia W tour was ll org


Aegean Explorer 7 days Turkey Unplugged 10 days Remembrance Day 9 day Turkey Discovered 14 days

Why travel with ON THE GO t "#5"  "*50  "50- o  ĂśOBODJBM protection t  TUBS IPUFMT DIPTFO CZ VT t &YDFMMFOU FOUIVTJBTUJD MPDBM guides t /P DPNQVMTPSZATJOHMF TVQQMFNFOU t /PAMPDBM QBZNFOU t:FBS round guaranteed departures t"MMUPVSTJODMVEFBWJTUUP"/;"$$PWFt-PUT PG"/;"$%BZUPVSTPOTBMFBMSFBEZGPS t9NBTJO5VSLFZOPXPOTBMF 020 7371 1113 Seasonal supplements may apply, see website for full details. Phone lines are open Monday to Friday 9am to 9pm. On the Go Tours, 68 North End Road, West Kensington, London W14 9EP. ä&#x2DC; 100% On the Go Assurance. 5096

Th ks On  Go!

p, Grt aĘŚ, great peo

great fun. at a day! â&#x20AC;&#x201C; Miel B

Sailing Split 8 days Cruise Dubrovnik 8 days On-board Opatija 8 days Dalmatian Discovery 8 days

ÂŁ299 ÂŁ369 ÂŁ369 ÂŁ449

FREE upgrades available from cost saver boat to classic!

JUL/AUG SPECIAL OFFER! 20% off Sailing Split call for details Seasonal supplements may apply, see website for full details. Phone lines are open Monday to Friday 9am to 9pm. On the Go Tours, 68 North End Road, West Kensington, London W14 9EP. ä&#x2DC; 100% On the Go Assurance.






Hilton Overnight - Northern England


Sat 9 July Includes: Return train travel, full bike and helmet hire, free time to explore Brokenhurst or surrounding villages.



£116pp Departs Sat 9 July

Horse Riding in Wales Includes Horse Ride in Brecon Beacon National Park, B&B Hotel Acom in Cardiff, afternoon in


Sun 24 July pp Includes: Return luxury coach, packed lunch including wine & general admission to the Guards Polo Club for the polo event.


Peak District, Bakewell and York From



Fri 5 Aug AND Fri 12 Aug from pp Includes: Tattoo Ticket, return train travel, 2 nights hotel B&B Acom, sightseeing and transfers.


Haye-on-Wye Departs Sat 9 July




¸ Sat 9 July: A Day in Wales. From ¸ Sun 10 July: Leeds Castle and Rochester. From ¸ Fri 15 July: Stonehenge Private Viewing Morning. From ¸ Sat 16 July: York by Rail. From ¸ Sun 17 July: Brighton. From


£45 £36



PLUS Stonehenge & Bath EVERYDAY. From with entrances to Stonehenge & the Roman Baths included! Windsor, Eton & Oxford EVERYDAY. From £45 with entrances to Windsor Castle and Christ Church College included!

PARIS BY EUROSTAR From £226pp Fri 8 - Sun 10 July EDINBURGH WEEKEND BY RAIL From £158pp Fri 8 - Sun 10 July AMSTERDAM AND BRUGGE From


£189pp Fri 8 - Sun 10 July

No more than 15 people with customer specified pick ups in zone 1 From

PARIS BY EUROSTAR From £226pp Fri 22 - Sun 24 July


¸ EVERYDAY - Oxford, Stratford & Cotswolds ¸ EVERYDAY - Stonehenge, Glastonbury, Avebury & Chalice Well ¸ EVERY SATURDAY & SUNDAY - Leeds Castle, Canterbury & White Cliffs of Dover

BOOK ONLINE AT: or call 0207 436 9304 Anderson Tours Travel Shop, 81 Charlotte Street, London W1T 4PP


Anderson Tours is fully bonded by Client Trust Account

A fantastic sailing experience you will never forget Voyages available to suit all tastes

s ail yS Da rom f

See our website for Pelican’s full sailing programme

This Summer expose yourself...

No previous sailing experience necessary!

to Mediterranean beaches at cheap and cheery prices Fun, flexible adventures to intriguing Albania

9 £9

ey omh CW

hisatAlaungutisct a- dcvaellnutsutroe fionfda oluiftem wrdithfoursatn a g o n tim i b l i n oree! a reeso m u t o n c e t v o d For more information or to book an please call us

01305 839476 Adventure Under Sail Ltd is a registered charity number 1124276


& as m X ! r  Y New


 Iâ&#x20AC;&#x2122;ll rem r ! Xmas foreve r away from my

aut g a I was wor ed I have had  t  r  y  family h a â&#x20AC;Ť×&#x201D;â&#x20AC;Źap  d re tu rd w    t n  s!  d great mor  s to ! p s, d w frn or, L ĐždĐž Ni$i Kemp

EGYPT & JORDAN Party with the Pharaohâ&#x20AC;&#x2122;s 6 days Festive King Tutankhamen 9 days Festive King Ramses 13 days Festive Road to Jordan 16 days Xmas in Petra 8 days



ÂŁ399 ÂŁ649 ÂŁ599 ÂŁ549 ÂŁ679

The Snow Ball 6 days The Big Ruskie 9 days New Years Red Square 9 days Christmas in Morocco 8 days Xmas Turkey 12 days





Next Stop? CHEAPEST VACCINATIONS ONLINE VACCINATION SEARCH NO CONSULTATION FEE! Swapping the concrete jungle for the real thing? 1st Contact Travel Clinic can take care of all your travel health needs â&#x20AC;&#x201C; with free advice plus vaccinations, tablets and accessories. Low prices, online vaccination search, same day appointments & free consultation.

0808 141 2324


Castlewood House, 77/91 New Oxford Street, London WC1A 1DG, Tottenham Court Road, direct: 020 7759 5437

1st Contact Travel Clinic is registered by the Care Quality Commission. Registration number: E010000632. 1st Contact Travel Clinic is a registered Yellow Fever Vaccination Centre by the National Travel Health Network and Centre. Registration number: UKYFVC2800.



www. call + 44 208 742 0226 G




41 Swanscombe Road, Chiswick, London W4 2HL






Accra Auckland Bangkok Bogata Bombay/Delhi Cairo Cape Town Caribbean Chicago Dubai Harare Havana Hong Kong Joâ&#x20AC;&#x2122;Burg Kinshasa Lagos Las Vegas Los Angeles Manila Malaysia Miami New York Nairobi Rio Santiago Shanghai Sydney Tokyo

ÂŁ75 ÂŁ394 ÂŁ135 ÂŁ120 ÂŁ95 ÂŁ85 ÂŁ199 ÂŁ230 ÂŁ165 ÂŁ65 ÂŁ289 ÂŁ169 ÂŁ195 ÂŁ95 ÂŁ225 ÂŁ120 ÂŁ139 ÂŁ125 ÂŁ199 ÂŁ145 ÂŁ125 ÂŁ79 ÂŁ99 ÂŁ245 ÂŁ395 ÂŁ175 ÂŁ350 ÂŁ179

Excluding all taxes & subject to availability



We pickup from Ealing every Friday evening at 6:30pm. Our trips are great for groups of mates, singles or couples HORSE RIDING Ride all day over the Brecon Beacons national park, suitable for first timers or experienced. We ride over mountains and ancient Roman bridleways, itâ&#x20AC;&#x2122;s probably the best ride in the UK, with great scenery. The sore ass is on us and guaranteed, but weâ&#x20AC;&#x2122;ll put muscle soak in the hot tub for you. ÂŁ195 HILL WALKING On the Brecon beacons national park ÂŁ135. Or you can just chill FLY FISHING All tackle supplied, you just fish all day .ÂŁ165 ACCOMODATION has 2 double rooms, dorms & open log fire. It also has a large covered hot tub next to a river with music. At night you can party all you like, with big late breakfast on Sunday. Our food is home made and cooked by a pro. Phone 01874 636170 open till 10pm.

Weekday trips also can be arranged, Sunday to Friday, good for teachers

Included in all prices are return transport, 2 nights accommodation, all food and activity. There are absolutely NO hidden extras.

Email: website:

We are fully qualified and all legalities are in place, so no wukking furries

in association with




l el ve av CLASSIC Trra

020 7586 1234

To advertise call Tyler Harrison 020 7989 0493

Looking for a tour?




in more than 2,400 locations in over 60 countries Happy Motoring!




30th Anniversary

EXCESS BAGGAGE > Free supply of tea cartons and bubble > Free delivery/collection within M25 > By sea/air/road worldwide > Money Back Guarantee HOUSEHOLD REMOVALS > Free home survey, no obligation > Packed by skilled professionals > Shared or exclusive containers > Motor car/bike specialist shippers TAX REBATES > Average refund £963 secured last year > Online Tax Pack, only 10% commission MONEY TRANSFERS > Competitive exchange rates FINANCIAL PROTECTION > Bonded by the British Association of Removers > Bonded by the Association of Tax Agents > FIDI Accredited International Mover SO BEFORE YOU CHECK OUT OF EUROPE CHECK OUT ANGLO PACIFIC

FREEPHONE 0800 085 0355 Anglo Pacific International Plc, 5/9 Willen Field Road, Park Royal, London, NW10 7BQ Email: Hours: Mon-Fri 8.30am - 6.00pm Sat 9am-1pm






Trusted Shipping and Removals


Moving home? More stuff than you imagined? Fast, safe and affordable, 1st Contact’s shipping team offers a full international removal service, whether it’s one bag or an entire household. > FREE cartons and packing materials

> Excess Baggage Shipping to Aus/NZ/SA

> FREE collection and delivery in the London area

> International Removals

> FREE household quote with no obligation

> Storage & mini-moves

> Air and sea freight

> Nationwide collection & delivery

Call Today for your free quote

0808 141 5520 42958 *

Conditions apply. An ATN of Anglo Pacific International PLC. 42958_Tax_Shipping_TNT FP.indd


19/01/2011 08:32









â&#x20AC;¢ -\SS`IVUKLK[VNP]L`V\Ã&#x201E;UHUJPHS     WYV[LJ[PVU)(90440 -0+0-(040:6


CALL 0800 524 4813 ·






TAX : S REBATPEACK E sion ONLIN Commis 10%

ts discoun Double tax rebate on your s Baggage & Exces

for moving

Your Goods TNT’s Oldest Freight advertiser – almost 30 years service


BEST RATES 3 CARTONS OR MORE EXCESS BAGGAGE by Sea, Air & Express using Export grade cartons for added safety FREE delivery and collection M25 (small charge for UK wide areas) FREE supply of EXPORT STRENGTH Cartons SHARED CONTAINER/MINI MOVES for larger baggage shipments and smaller household removals. RENT CONTAINER SPACE, YOU ONLY PAY FOR THE SPACE YOU NEED. FULL CONTAINER/HOUSEHOLD REMOVALS FREE HOME SURVEYS

0800 988 3688 PSS is FAIM ACCREDITED – the only QUALITY STANDARD recognised internationally for Overseas Moving


Bonded by The British Association of Removers FINANCIAL GUARANTEE The only genuine bonding scheme





Five large cartons *


£33 EACH

by sea

Four standard FROM cartons** £2E2AC.5H 0 by sea

Destination charges apply – details with quotation Ë *Additional large cartons only £30 each Ë **Additional standard cartons only £15 each Ë Large carton dimensions: 61 x 51 x 41cm. Maximum weight 40kg/88lbs per carton Ë Standard carton dimensions: 51x 41 x 31cm. Maximum weight 40kg/88lbs per carton

FREE cartons, bubble wrap and tape.

FREE delivery and collection of cartons within M25 to your destination address within 30km of a city centre Ë Track the progress of your shipment with our ONLINE TRACKING SERVICE


019 6969 FROM A MOBILE CALL 03303 000006


3 UNBEATABLE OFFERS: Ë Go online FROM One large for a QUOTE carton* £65 in 30 seconds by sea





nannies | care work | bar/catering | office | sales To advertise call now 020 7989 0567 |

To search 1000s more jobs go to or if you’re looking for tax and visa advice see

general jobs | trades + labour | visas | tax | health teaching

care work


The Freedom of an ACTIVE Life

Required for small private school, Tooting S.W.17 area to start August/September 2011.

Please call 0208 672 4673 nannies

Hampstead Nannies Live In/Daily Nannies, Mother's Helps, Housekeepers, Mat Nurses Barkat House 116-118 Finchley Road London NW3 5HT Finchley Road

Tel: 020 7433 2525/26

We specialise in providing nationwide live-in and live-out care to clients with physical disabilities specialising in high level spinal cord injury Choice: a huge choice of clients & flexible working Security: comprehensive insurance protection Support: professional nurse supervision & support Career: opportunities for promotion & development

We Offer ✓ UP TO £507 PER WEEK start rate plus paid holiday ✓ FREE accommodation WHILE TRAINING ✓ FREE food & accommodation when working ✓ Award Winning Training ✓ Health & Social Care Diploma Study Programme

About You ✓ Over 18 (21 & driving license for live-in work) ✓ Flexible ✓ Previous experience not required as full training given ✓ If you have an NVQ in care or other medical qualification you will start work on our enhanced rates of pay

Visit or call our recruitment hotline on 01732 749175 for further information.


JOB HUNTING? Over 7,000 new jobs

Solving your recruitment problems! for 1000s more jobs




care work


LIVE-IN CARERS REQUIRED. Minimum pay £500 p.w. plus full board. Caring people needed for rewarding work. Interviews can be held any time at our Beaconsfield office or in Central London on Monday, 11th July 2011. Please call Susie on 01494 678811 or email us at Chester House, 9 Windsor End, Beaconsfield, Bucks. HP9 2JJ

chefs/bar/catering Professional Chef de Parties required for Event Catering companies within Central London. £9.00-£12.50 p/h. Weekly pay, flexible hours, 7 days p/w. CV, Qual, Passport, Hyg Cert ess. Tel: 0208 946 6342 or 0208 944 1609 Email: (Agy)

photographic services Alessandra Studio offers Glamour/ Fashion/ Family/ Portrait Photography


Our Studio is based just 2 minutes from Knightsbridge tube station. For bookings or any questions please e-mail us at: Or give us a call on: 07828749334

general employment

Butcher required for busy shop in North West London, 5 Days per week. Please call 0208 969 5469 for more information. SOCIABLE PEOPLE NEEDED FOR FUN TIMES!! We are looking for confident, outgoing people to start ASAP for evening and weekend work. High earning potential for the right candidates. Contact us NOW on: 0203 137 2840 or

BORED OF YOUR JOB? BE A PART TIME MODEL No experience necessary - No height restriction - Ages 16 + can apply



We are currently seeking MALE AND FEMALE part time models for fashion and music videos and commercials. Pay ranges between £550 - £1200 a day for modelling assignments. Please email us one picture of yourself (dont have to be professional) EXCLUSIVE OFFERS, COMPETITIONS, NEWS AND MORE!

DAILY, NIGHTLY, WEEKENDS TO SUIT We specialise in caring for the elderly, the disabled and the infirm in their own homes. We have over 33 years experience in placing nurses and carers in homecare 95 Heath St Hampstead, NW3 6SS (on Northern line - tube) We are an equal opportunities company. for 1000s more jobs


ARE YOU JOB HUNTING? Visit for more than 7,000 vacant positions in all industries across the UK, Australia and New Zealand. At youâ&#x20AC;&#x2122;ll find out how to land your perfect job, an A-Z list of employers, job alerts, career news and information, visa advice and details of recruiters.

Solving your recruitment problems! for 1000s more jobs

trades + labour

adult services

Top London Escorts CLASSIFIEDS

0208 577 7713 / 0207 439 2223 Full security service transport to and from work (and interview). First class facilities. Start immediately earn upto £1000 a day. Call us 24hrs 7days a week.


health + wellbeing


HIGHLY SKILLED & EXPERIENCED SITE MANAGERS, CARPENTERS, PAINTERS, LABOURERS & DRYLINERS. Please send your C.V. including copies of CIS card, CSCS card and any Trade Certificates to: or Fax 0208 963 6901 Experienced Tractor and Harvester Drivers, Milkers & Stockpeople - wanted for Farm and Rural work all over UK.


Spiritual Healer, Clairvoyant and Advisor. Specialist for Love and domestic family problems. Success in exams and career and business. Immigration help also given. Quick Positive Results, Pay After Results. (0208) 2797371 / (07949) 152240

APPLY ONLINE: Ph: 01284 747292



adult services for sale/hire CHEAPEST CAR rentals in London. From £66 per week. Phone 020 8681 2885



Private London based agency run by Women Only with well established international clientele. Seek beautiful, intelligent ladies with model looks and a personality to match!

To arrange an interview please call 07000 202 101 or visit us at: for 1000s more jobs

ARE YOU JOB HUNTING? Over 7,000 new jobs

Solving your recruitment problems!

tax, visas & immigration

Are you owed a Tax or NI rebate? Call 0800 071 6766 or download a tax pack now at

AVE REF RAGE £1,4 UND 43* *200





National Insurance Refunds • Irish Tax Refunds • Tax Returns • Online Refunds Calculator Company Accounts • Self-Employed Accounts • CIS Repayments • Payroll • Book-keeping • ATA Bonded Taxback, 167 Earls Court Rd, Earls Court, London SW5 9RF • Open Monday - Friday 9am - 5.30pm

We are the UK’s most successful tax rebate company with over 20 years experience

Need to send money between UK and home?

asons Good re tforex: n to use t tes

» Great ra es bank fe » No hidden ctions sa an tr s » Faster e system use onlin pliant » Easy to lly com re and fu cu se , » Safe service er om d cust » Unrivalle

r Cheapee than th banks*


Tax & NI Refunds

The easy way to move your money

0870-898 8996 *Source: 1st Contact survey of UK high street bank charges, April 2008.


renting | sharing | short lets | crash pads | hostels

accommodation Whatever type of accommodation you’re looking for you can find it here, and loads more at


To advertise your property call 020 7989 0567 Docklands, City 30 Minutes, large double room with Sky world, ESPN, WIFI and calls, plus cleaner, in large, comfortable house, with off street parking and gardens. 5 minute’s walk from transport connections, shops, park and gym with large pool. £129 per week, inc. all bills. Call: 07787 126 273 / Email:

VERY LOW COST ACCOMMODATION £50.00 P.W Willing to help an older or disabled person then this can be for you. Huge savings, Quiet, comfortable environment, swap 10 hrs per week Helping older person. Keep own job/studies. We have several placements around London. Call us for more information Phone Cathy on 020 7485 7416 or email

Why Hostels in London? Private Houses Cheaper than Hostels! Nice, Clean & Safe Rooms in 5-bedroom Houses to Share Single Rooms from £120 | Double from £140 | Triple/Quad Rooms from £165 • Bills included • One months’ deposit + one months’ • Fitted kitchen & free WiFi rent in advance • Safe and secure areas • One weeks’ fee at the end of the • Minimum 2 months’ stay term if less than 6 months’ contract Stratford | Forest Gate 07515 945 861 | 07983 552 505


Got a room or flat to rent? Post it for free at accommodation

To the Wollongong Aussie with the amazing blue eyes:

Thanks for showing an American girl an amazing time in Europe. Lisa John Mal, this is an important message from your dick: I


haven’t seen a moist crevice or an Arabian eye in six months. Six months! Bigfoot gets seen more than me. If I don’t get some action soon, I’m packing up my balls and leaving. So, ladies, if you’re keen for the six feet of thunder, get in touch with John and I here. Shave the pitch before the big day, it’s hairier down here than your grandma’s top lip. John Beachwood. Via Doing the Seine: I have a 24metre barge in Lagny outside of Paris. I am looking for backpackers to help me start the journey up the Seine next week. Check Fidutia out on Facebook. Via Dearest Li’l Spoon: Long distance relationships can be a challenge. It’s hard work being away from someone as gorgeous as you. Was good to finally see you again but as you read this I’m on my way again. I miss you so much I even miss your home-cooked meals. You’ve come a long way since half-cooked pasta, spaghetti on toast and burnt veggeis in a pot (no water). I can’t wait to see you again – summer travels, we’re gonna have a ‘wow’ time. Unfortunately, not long after, you go home (to the secondbest country) and our relationship becomes even more long distance. But my love for you will never lessen.

post your message at or email


You can now text us your thoughts: Text TNT and your message to 81707*

How’s that for PDA? The original Big Spoon. Candy Girl: Sugar, sugar, sugar, sugar. Pour some on me. Sweet thang, you make my mouth sang. One-time for my sugar mama. Sweets for my sweets, sugar for your yummy. Out. Pepper Cat Calling travellers: We are looking for one more passenger to join seven of us in Ginger Nuts, our eight-seater camper from London to Sziget Festival in Budapest. We leave August 5 after work and arrive at the festival site on Tuesday, August 9. Email Cliff Who wants to hike the Appalachian trail?: I want to

embark on this 2000-mile trail through the States, but I don’t want to do it alone. I’m keen for anyone, from any walk of life to join me in March/April 2012. You’ll need to be eligible for a tourist visa and be prepared to go without creature comforts. I definitely recommend reading ‘A Walk In The Woods’ by Bill Bryson, too. Elena, via

love romance friendship...

my phone on June 26 around Oxford Circus, possibly on Regent Street. I was at Strawberry Moons but they have no sign of it. It is a navy blue canon IXUS touch screen and the photos on it are incredibly valuable – they are of my parents’ holiday here. If it is found please hand it to TFL lost property as I have a form filled out there, or email me at Thank you so much. Melita, AKA 8: We’ve had so many fun times together. We’ll miss our fashionable, bright clothes-wearing-trip/events planner-chef extraordinaire (especially thermomix) who invented Jaegerbombs and has a love of hands and circular beds. You’ve introduced us to ‘suits’ in Liverpool Street and showed us how much fun three blondes can have around the world. Morocco next year. We’ll be late and forget our luggage, but you’ll bring the cheese! That’s if we even

Desperately Seeking is a reader forum, and all messages should be within the spirit of the page; TNT cannot take responsibility for offence caused. No phone numbers can be printed. Messages may be edited for publication. See * Messages cost 25p each + standard network rate. 18+ bill payers only. Send STOP to end. Number may show on bill. A2B 08700460138

If you’re looking for

or just Lost phone: I drunkenly lost

survive the year without you! Loz and Sar x Not happy: Captain Caveman and the Blonde Sheep. Really? Who am I going to have to entertain me now? No more random big ones at the Walkie. No more late-night pizza man. And what about the alley incident? The Hulk? The major blonde moments? I will forever remember the ‘I’m in Essex’ text message and the bass player from Little Red – I swear, a little bit of wee EVERY time! Just remember our pact: big lesbian-filled house at 40. Let me know when the number changes! Love you both! P-Dog! Let’s go mental: Hey megastar, thanks for the invite to Ibiza. I’ll do everything in my power to get there so we can have one more knees-up in the sun before you head back Down Under. I can’t believe you’re finally going. (I give it six months before you get bored and come back). Razza Team Shamrocker: My pores are still sweating out cider – Bulmers, not Magners, or was that Magners? Ah, whatever, it tasted good. And so did the minging Irish schoolgirl you pashed at the pub in front of your sister – Snakeskin, eh? And Red Rocket – you little demon of a boot scooter. I’ve never seen an 18-year-old hip-thrust like you. Thanks for the memories, guys. Just as well a search and rescue of five misfit cyclists face down in a pile of gravel in the middle of Inis Mor wasn’t one of them (but it so nearly was!) Love, Tirty-Tree-And-A-Turd-InYour-Pants.

we have thousands of active profiles for you to match up with. Visit: TODAY!









â&#x20AC;¢ -\SS`IVUKLK[VNP]L`V\Ã&#x201E;UHUJPHS     WYV[LJ[PVU)(90440 -0+0-(040:6


CALL 0800 524 4813 ·


Your essential contacts list All the services you need for living and working in London Limited Companies & Accounting Money Transfers Tax Refunds UK Immigration UK Bank Accounts Travel Clinic Aus/NZ Migration Shipping Contractor Payroll Legal Services Financial & Investment Solutions

0808 141 2262 0808 141 2312 0808 141 2332 0808 141 2254 0808 141 2307 0808 141 2266 0808 141 2287 0808 141 5520 0808 141 2273 0808 141 2303 0808 141 2292

Financial, Migration and Tax Experts

Let 1st Contact claim your Tax Refund for you! > Average Refund ÂŁ850* > 1st Contact will get your maximum refund in the shortest time possible > 1 in 3 are due a tax refund > 1st Contact offers a no refund no fee policy > 1st Contact is bonded by the association of tax agents

Claim your tax refund NOW!

0808 141 2333


*ÂŁ850 is roughly the average amount owed to a Tax Refund client. Your personal claim will depend on your individual circumstances.

TNT Magazine / Issue 1453  

TNT Magazine / Issue 1453

TNT Magazine / Issue 1453  

TNT Magazine / Issue 1453
