{' '} {' '}
Limited time offer
SAVE % on your upgrade.

Page 1

HOWICK, BOTANY, PAKURANGA AND SURROUNDS

www.eastlife.co.nz

December 2013

Set for

Christmas

Santas on the job

Garden with

HART

OUT & ABOUT | FASHION | HEALTH & BEAUTY | FOOD | ART | HOME | MOTORING | EVENTS | TRAVEL www.eastlife.co.nz

eastlife | december 2013 |

1


 eastlife | out & about



Issue

Nine



  

        

       

>>>                  

                





 



  

 

quote >>>

• •  •  •  •  • 

 

    

Check out our blackboard at the office for more inspirational quotes or drop by and tell us your favourite. 

• •  • 







  

 

 

 

 

 

 

 

 

 

  2   | eastlife | december 2013

www.eastlife.co.nz


 out & about | eastlife



           

 







  

• • •



  

   

www.eastlife.co.nz









where people matter eastlife  | december 2013 |

3

 E510001-v9


eastlife | contents

Merry Christmas... As EastLife hits the streets this month, I am sure most readers will be well into their Christmas preparations – we all know how fast December flies by! As for me, my pressie shopping is done, I have my New World Christmas Club card at the ready to assist with last minute groceries and I’ve nearly decorated the house. I just love Christmas and not a year goes by when I don’t add to my pool of Christmas novelties. This year, I again popped to Everlasting Daisies at Bishopgate and came away with some wonderful goodies including a large, red-hatted, greybearded Christmas gnome, glittering poinsettia for a festive centrepiece, a table size Christmas tree with fairy and a gorgeous ear-twitching, bottom-wriggling, singing dog. And I can’t wait for Christmas Day. For me it’s all about family, friends, the tree surrounded by gifts, Christmas cake and sherry at breakfast, festive music – Joy to the World AND

Snoopy’s Christmas – booby presents with cryptic messages, the aroma of roasting meats, fresh beans, mouthwatering gateaux, a new Christmas Day outfit, an afternoon nap and revelling in the sense of goodwill towards all men. The latter seems to be everywhere even on the roads where traffic is wonderfully minimal and everyone goes all out to be ultracourteous. And this year, NO stress! That’s because it is one of just a handful in my married life that I haven’t done Christmas lunch for a crowd. I am so looking forward to relaxing at daughter’s home – having a fun with my little grandsons is high on my list of priorities! At Christmas I’m also inclined to reflect on my Finnish roots and while I acknowledge that the real reason for the season is the birth of Christ, it is a day in which my family expresses our love for one another; when we feel a special bond with friends close

to us; and when we can enjoy what seems to be the only day of genuine goodwill and peace everywhere. Although an avid shopper, I especially appreciate that shops are closed and believe there should be more days when this phenomenon occurs. It seems sad that so many people want only to flock to malls during the break when there is ample opportunity to do so at other times. Undoubtedly, readers will have their own special traditions and, for most, the day will be one of pleasure and sharing. However, there will be some whose Christmas Day is a lonely or sad affair. Hopefully, EastLifers who know of someone in need of company, will welcome them into their home ensuring goodwill abounds. Now, as the year draws to a close, the team here is thrilled and grateful at the way in which readers have embraced EastLife since its launch

last April. We have loved bringing to you local stories, competitions and insights into the latest food, fashion, beauty, home decor, motoring and travel trends. A big thank-you also to our columnists for their sage advice and to all contributors and advertisers who have helped make our magazine blossom. Finally, my Christmas wish to you all is that love influences all you do throughout the season, that each and every one of you is blessed with a sense of peace and joy and that the New Year will bring health, prosperity and happiness. See you in February 2014

Helen Perry Editor

this month... Ph 09 271 8020 www.eastlife.co.nz Editor: Helen Perry 09 271 8036, editor@eastlife.co.nz

7-9

out & about

24-34 Lifestyle

42-50 food

 astLife photographers E around the town

• Easy riding around the country • Focus on Whitford • Christmas essentials

• Gluten free makes business • Wild about wheat • EastLife dining guide

35-41 health, beauty and fashion

51-61 home

14-15 profile

Sales: Rachel Watts 09 271 8019, rachel@eastlife.co.nz

Former local in the thick of Royal NZ Ballet jubilee

Sales: Caroline Boe 09 271 8091, caroline@eastlife.co.nz

16

interview

Powering way to champs

19

obituary

Dave Slater

Design: Clare McGillivray 09 271 8067, clare@eastlife.co.nz Photography: Wayne Martin

• Festive fashion • If the shoe fits • Nancy in the swim • Diet to ease asthma attacks

• Chair to go anywhere • Outdoor theme for Christmas table

62-63 drive • New path for Nissan

Manager: Karla Wairau 09 271 8083, karla@eastlife.co.nz Managing Director: Reay Neben 09 271 8012, reayn@eastlife.co.nz Publisher: Times Newspapers Ltd 50 Stonedon Drive, East Tamaki, Auckland. PO Box 259-243, Botany, Auckland 2163 Like us on facebook: www.facebook.com/ eastlifemagazine DISCLAIMER: Articles published in EastLife do not necessarily reflect the views of the publishers or editor. All material is provided as a general information service only. Times Newspapers Ltd does not assume or accept any responsibility for, and shall not be liable for, the accuracy or appropriate application of any information in this newspaper. All the material in this newspaper has the protection of international copyright. All rights reserved. No content may be reproduced without the prior written consent of Times Newspapers Ltd.

4 | eastlife | december 2013

on the cover

The Advent wreath, long used to prepare for the Advent season or the “coming of Christ” is traditionally made of evergreens to represent the everlasting life brought through Jesus while the circular shape also epitomises a God of no beginning and no end. In many countries, flowers, leaves, fruits and twigs are used to form the garlands which are hung on front doors. Modern day wreaths date back to the Lutherans in Germany in the 16th century. Then, in 1839, Johann Wichern used a wreath

made from a cart wheel to teach children about Christmas. For every Sunday of Advent’s four weeks he placed a white candle in the wreath and for days in between he used a red candle. The EastLife team think this wreath, assembled by Di Bowbyes from Everlasting Daisies at Botany South, also symbolises the circle of friendship amongst our supporters. We hope it represents a harmonious and bountiful Christmas for all. Cover photo Wayne Martin

www.eastlife.co.nz


McMillan out &Team about | eastlife BMW

Newmarket

THE NEW BENCHMARK. THE ALL- NEW BMW X5 HAS ARRIVED. The first generation BMW X5 invented the Sports Activity Vehicle class. It was the first of its kind, combining all-wheel-drive capabilities with the kind of luxury, performance and driving dynamics you could only find in a BMW. The second generation BMW X5 continued this winning formula delivering class-leading dominance, making it New Zealand’s best selling premium SUV. But now a new benchmark is about to be set. The much anticipated third generation BMW X5 has finally arrived in New Zealand, bringing with it entirely new levels of performance and innovation. • CONNECTED DRIVE FEATURES INCLUDING: - BMW HEAD-UP DISPLAY

Drive away from*

129,000

$

- PARK DISTANCE CONTROL WITH 360 DEGREE SURROUND VIEW - ADAPTIVE BI-XENON HEADLIGHTS WITH HIGH BEAM ASSIST - DRIVING ASSISTANT SAFETY SUITE

or

441

$

per weekˆ

iDRIVE TOUCHPAD CONTROLLER

NAVIGATION SYSTEM PROFESSIONAL

FULLY-AUTOMATIC TAILGATE OPERATION

THIRD ROW SEVEN SEAT OPTION

*Offer based on Drive Away Price. Finance offer based on Loan agreement consisting of a 36 month contract, 10.99% interest rate with a 20% deposit and a fi nal payment of $64,000 for the X5 30d. Drive Away Price is the BMW recommended retail price for the purchase of a new unregistered BMW. It includes GST, fi rst full tank of fuel, 12-month registration, and all other costs required for fi nal delivery of the vehicle. Offer expires 31/12/2013 and is subject to BMW Financial Services lending criteria.

BMW2511

Team McMillan BMW 7-15 Great South Road, Newmarket. 09 524 3300 www.teambmw.com

E510002-v7

Visit Team McMillan BMW today to test drive the all-new BMW X5 and find out why BMW is the number one selling premium vehicle in New Zealand and around the world.


eastlife | interview

10 TEN

Ten questions in ten minutes with

Ken Ring

When locals ‘ring’ in the New Year, some will be left unsure as to whether the weather will deliver favourable conditions. However, others, armed with a copy of Ken Ring’s 2014 New Zealand Weather Almanac, may know exactly how their gardens will grow, when the fish will be biting, or when to bow forward toward smooth sailing. To discover how the former maths teacher can regularly predict weather patterns long before they occur, EastLife posed a few questions to Ken.

In less than 30 words, what’s the weather looking like in 2014? Actually, it’ll be another great year for farmers and gardeners. It should be another warm summer, with enough regular rain to stay off drought. A slightly wetter than average year overall, with average sunshine hours and mostly mild temperatures. How is it that you’re able to predict weather so far in advance? I liken it to tide tables; the weather has a daily tide, with monthly peaks and troughs and the moon in control as for the seatide. As all this is subject to repeating cycles, the trends are able to be calculated in advance. Why is it so important for Aucklanders in particular to be able to predict the weather? Auckland can get unsettled weather from the northeast that can damage boats and cause flash flooding during kingtides, so we need to know when a round of northeasterlies may be expected. Most Aucklanders spend a lot of their lives outside, so if there is information available in almanacs it means they can make more informed decisions, eg, best dates to run school camps. How did your background lead to predicting the weather? My interest in patterns came in useful when my family and I lived an outdoor life in the 1970s and I regarded myself as a serious fisherman. I realised the tides and weather correlated so well that studying tide cycles could give me a heads up. It kept on working so I spent about four years studying why, and came up with a workable system. Generally speaking, how accurate are your predictions? Many farmers give me about 80-85% success rate. That means, overall, a

6 | eastlife | december 2013

month or two per year may be a bit out because it’s not an exact science. The trends are the main message and one shouldn’t expect it to be too precise because there are many local factors also going on in weather. But my aim is that it will always be more useful than having nothing. What’s the worst miscalculation you’ve made? Tweeting for six months that a destructive earthquake was coming to Christchurch around February 20, 2011. The media and politicians didn’t realise that I was only trying to warn, and made me out to be some kind of prophet of doom even though the job of a long-range forecaster is to warn. And I should not have given in to the pleading of TV3 to appear on Campbell Live on February 28. [It wasn’t Ken’s prediction that was the miscalculation, but rather failing to anticpate how media would deal with the forecast.] Do you personally engage in activities such as gardening, sports, boating, fishing etc for which you would need to consult your own predictions? Yes, all of the above! My son has a boat and I live less than 5 minutes walk from a beach. Plus friends and relatives are always going up to the islands or down to the slopes, so I get a lot of calls. Weather aside, what special hobbies or interests do you have? In past careers I have been a teacher, magician and musician, and retain an active interest in all those areas. I have grandchildren, one an artist, another a musician and the third wants to be an All Black! It’s a blessing and privilege to watch them grow and achieve. Sitting around a campfire with family or friends, playing music or recalling memories – I think that’s what life’s about.

WIN! 2014 NEW ZEALAND WEATHER ALMANAC – Thanks to Random House, EastLife has a copy of Ken Ring’s 2014 New Zealand Weather Almanac valued at $39.99 to give away to one lucky reader. An ideal handbook for all who rely on foreknowledge to be forearmed, Ken’s almanacs are useful tools for anyone from skiers and fishermen to event planners who need to stay one step ahead of the weather. To enter the draw visit www.eastlife.co.nz. Click on the competition link and complete the form. One entry per email address/ person; entries close January 31, 2014. Winner notified by phone or email.

What would be the first thing you would do if you became Prime Minister? Because new eco regulations are hurting the agricultural sector I would stop all funding for global warming/ climate change research until scientists could provide real evidence that a problem exists, rather than projections from computer models. If you could invite any three people – living or dead – to dinner, who would you ask?

Some people may remember a mate of mine, the late Harry Alcock from the Waikato. Harry and I pooled our knowledge in the late 1990s and I would love to discuss some subsequent discoveries with him. Secondly I’d pick my loving, late father who, in his way, was something of a maverick. Thirdly either Copernicus or Sir Isaac Newton (whoever is available!) because both would have known exactly what I am trying to achieve.

www.eastlife.co.nz


out & about | eastlife

new look village jeweller shines Out with the old in with the new – the grand opening of Village Jeweller (formerly Howick Village Jeweller) and Schweder Bespoke Jewellery heralded a new era for owner Chris Schweder. The sparkling grey and gold decor and stylish renovations were praised by guests who also welcomed the launch of Schweder Bespoke Jewellery, a new line exuding all the elegance and creativity associated with this award-winning jeweller. CARMEN BIRD attended the event. 1. Janet Grey, Michele TheronJansen 2. Kathy and Ryan Thorpe 3. Jo van de Paverd, Lee Bevan 4. Angela and Barry O’Shaughnessy 5. Isabell Dempsey, Charm Schweder, Tracy Taylor, Janet Gray, Michele Theron-Jansen

4

6. Kathy Thorpe and Jo Webster 7. Vicki Bennie, Chris Schweder, Chris Bull 8. Gordon Gray, Janet Gray, Les Green 9. Fiona Keith-Kirk, Kristine Jensen, Robyn Greer

1

1

2

3

6

5

74

8

9

E512064-v4

n Photography by Carmen Bird | For orders email carmen-marie@xtra.co.nz | www.carmenbirdphotography.co.nz

www.eastlife.co.nz

eastlife | december 2013 |

7


eastlife | out & about

When you wish upon a star! Plenty of Christmas wishes look to be coming true this year after the Kmart Wishing Tree Appeal got off to a grand start locally with a family day at the Botany store last month. Now in its 19th year, the appeal aims to collect more than 40,000 gifts nationwide to be distributed by Santa’s unsung helpers, The Salvation Army. And already the Botany

store is leading the tally with more than 283 gifts donated in just the first week. Botany Downs residents donated nearly 1000 gifts last year and again shoppers are being asked to purchase a gift of choice (from any retailer), collect a gift tag from any Kmart store to jot down the intended gender and age of the ideal recipient of that gift, then place it under the tree.

Local businesses and other organisations have also shown support with 12 parcels being donated by Botany Bluelight Police on day one. Paradice ice skating has donated skating passes and Harvey Norman Botany has added a hairdryer/ hair straightener to the list. The appeal runs until December 24 with the Salvation Army ensuring gifts will be delivered for Christmas Day.

car for christmas A completely overwhelmed Deanna Rose wept tears of joy when her name was drawn, in front of a huge crowd, as the winner of an Alfa Romeo Mito in Pakuranga Plaza’s Spend A Little And Win Big shopping promotion. But the irony of the win is that Deanne doesn’t drive! All set to learn now that a brand new car will be parked in her garage, Deanna says her husband Greg will be the lucky first to wheel out the new vehicle

and take it for a spin. A Pakuranga resident, Deanna is a regular shopper at the Plaza and entered her shopping receipts in the draw every week for two months. Despite being hopeful she says she never really thought for a moment that she would win. “We’re just ecstatic. I guess our older model Toyota Caldina won’t be getting much use now!”

Plaza owner Dallas Pendergrast, right, congratulates Deanne Rose and husband Greg on their car win.  Photo supplied

FREE GIF WRA PPINT DATE G S AS M

ARKE D

8 | eastlife | december 2013

www.eastlife.co.nz E510117-v2


out & about | eastlife

midnight madness in howick

The atmosphere was definitely one of “I’m mad about you, you’re mad about me babe” as people thronged the streets of Howick Village for the annual Midnight Madness event last month. There were smiles, laughter and a warm feeling of community as couples, families, mates and friends turned out to enjoy the festivities. Photographer CARMEN BIRD was there. 1. Sophia Pervolianakis, Rebecca Noh, Kate Harris 2. Colin and Karen Christie 3. Tiana Irwin, Ashleigh Meyer 4. Richie Barnett, Kerry Holland, Colin Gribble, Peter de Jong 5. Dawn Fulgoni, Amanda Thompson

2

3

5

6

8

9

6. Vanessa Brooke, Isabella Bird 7. Jeremy Thompson, Sue Lodge, Bruce Simmonds 8. Michelle Edwin, William Chiyesu 9. Gill Ewen, Sarah Wright 10. Jennifer and Leo the Lion puppy 11. Erin Holland, Carrie Barnett, Kim de Jong

1

4

7

10

11

n Photography by Carmen Bird | For orders email carmen-marie@xtra.co.nz | www.carmenbirdphotography.co.nz

Thank you for a fantastic day! Howick Santa Parade

www.eastlife.co.nz

The Howick Children’s Charitable Trust would like to say a MASSIVE thank you to the Howick community, volunteers, sponsors and supporters who helped make the 2013 Howick Santa Parade a huge success. PROUDLY SUPPORTED BY:

eastlife | december 2013 |

9


eastlife | events

december 2013 ➤ CHRISTMAS Christmas@Sunkist December 7, 10am-8pm, Beachlands Log Cabin, FREE Give the sleigh bells a little jingle and swoop down to the Wakelin Reserve in Beachlands for a glimpse of Santa for the first time at this local art and craft market. Ring in the festive mood with an array of activities for the whole family such as dog shows, pony rides, food stalls, stage performances and a fabulous new Santa Parade. Finally, revel in a glorious Christmas Carol Concert (6pm) at this breathtaking location. Staff Christmas Party Fawlty Extravaganza December 5, 12 & 19, 6.30pm9.15pm, La Casserole, Highland Park Chuckle the night away with the manic, misanthrope, Basil Fawlty, and his languid little nest of vipers, Sybil and team from Fawlty Towers. Sit down to a dinner show orchestrated by an outrageous ensemble of actors and delight in a sumptuous three-course meal prepared by the expert chefs of La Casserole. Tickets are $75 per person and include dining and entertainment. All drinks are BYO. For more information, visit corporateentertainment.co.nz

The Royal Christmas Variety Show December 18, 11am-1pm, Picton Centre Have a romping rambunctious time at the Right Royal Christmas Variety Show featuring the Queen – on her bestest behaviour, of course. Laugh, cry, sing, cheer and clap from the very first song and celebrate in true Christmas spirit with a regal cast backed by Santa and his Christmas Elves. Be entertained like never before with a broad selection of musicals, fun duets, love songs and finally, a rousing Christmas Cheer. Tickets are $30 per person and information is available from daytimeconcerts.co.nz Panmure’s Christmas Parade & Festival December 7, 11am-2pm, Queens Rd, FREE If you missed out on Howick’s Santa Parade, don’t get those Christmas stockings in a knot; instead, skip over to Panmure for a float-astic day pumped up with fun for all. A Panmure institution since the ‘50s, the event will kick off with a parade beginning and ending in the Pleasant View Rd car park, and will finish with activities taking place in the Community Hall car park on Pilkington Rd. Unwrapping Christmas December 9-21, Aotea Square, FREE The city is coming to life showering everyone with gifts galore as the countdown to Christmas begins. With an energetic schedule packed to the brim with dance sessions, live music, theatre and circus performances as well as arts and crafts markets, witness this vibrant line up in all its glory. Dance takes a strong focus this year with a variety of dances

from salsa, swing and ballroom to Celtic, and demos by the renowned Candy Lane Dancing with the Stars dancers and Viva Latino as well as appearances by the Twisty Willow Celtic Band, so break out those jiving shoes and dance up a storm. See theedge.co.nz/unwrappingchristmas Scrooge: Christmas Musical Production December 15, 10am, 3pm & 6pm, Vodafone Events Centre, Manukau A feel-good time is in store for the whole family with a colourful stage production of Charles Dickens’, A Christmas Carol. Performed by the Equippers, this well-loved story will come to life in true Christmas spirit. All proceeds from the musical will go to Kids Can and the Child Cancer Foundation. Tickets are $5 per person and free for children under 5.

Heroic Gardens 2014 February 22-23 Mercy me, Auckland’s heroes are back in business! For 18 years, the Heroic Gardens tour has brought some of Auckland’s finest gardens into the limelight, raising funds for worthy causes in the

➤ music Sunday Afternoon Sounds in the Courtyard December 8, 15, 22 & 29, GBS Restaurant, Picton Street The sun’s shining, the beer is cold and the food is to die for. So pop a chill pill and take a spot in the GBS courtyard to enjoy an eclectic range of live music for the month of December. The Feelers Summer Tour December 19, 6pm-11.30pm, Howick Club, Botany Rd Ever popular foursome The Feelers is back with a refreshed outlook and ready to bring down the Club. Playing the cream of the track crop from its award-winning 6x Platinum bestselling album Supersystem as well as other hits such as Communicate, Playground

process. The 2014 incarnation is expected to be no exception. With 22 gardens on show, from Titirangi to Whitford, the festival – benefitting Mercy Hospice – will again include many open to the public for the first time. Visit heroicgarden. org.nz for more information.

E510003

10 | eastlife | december 2013

www.eastlife.co.nz


events | eastlife Battle, and One World, The Feelers is one summer sensation not to be missed. Book now on 0800 BUY TIX and anticipate two hours of sweet harmony from this national treasure. Groove in the Grapes January 18, 3pm-9pm, Turanga Creek, Whitford As the grapes soak up some sun, music lovers can also kick back and relax in a vineyard setting enhanced by smooth notes from accomplished musicians. Listen to cover hits, classics and jazz and celebrate the best of summer with a glass of wine. Big Day Out January 17, 11am, Western Springs Stadium No Blur? No fear; there’s still an incredibly strong line up of musicians all hyped for the return of 2014’s Big Day Out. Now in a new home and sporting new vibes, the festival will feature music heavyweights such as Pearl Jam, Arcade Fire, The Naked and Famous, The Phoenix Foundation, Tame Impala and more. Tickets $185 per person; go to bigdayout.com Leonard Cohen December 21, 8pm, Vector Arena Catch this once-in-a-lifetime opportunity to listen and watch award-winning musical legend Leonard Cohen live on stage. With a recording career spanning decades, the singer-songwriter has earned the respect of critics worldwide for his poetic blend of folk and rock music. The ingenious arrangement of 1984’s Hallelujah has sparked numerous covers, and remains one of Cohen’s best known legacies. Visit ticketmaster.co.nz for tickets.

➤ comedy 7 Days Live December 21, 7.30pm, Vodafone Events Centre, Manukau Without the restrictions of TV cameras and the censors, the 7 Days

team irreverently reviews the news, the newsmakers and each other – right in front of your eyes. Be there to see what happens when the cameras aren’t rolling. See Jeremy Corbett, Paul Ego, Dai Henwood and the rest start with quick-fire, stand-up comedy and then tear into a no-holds-barred, interactive game of 7 Days.Tickets from Ticket Direct, $49.50 adult, $44.50 student/senior or $44.50 for a group of 10 or more. Students, senior and concession tickets available from the box office only, phone 976 7777.

➤ holiday programmes Mcleay Claymation & Cartooning Workshops January 13, 9am-1pm, 1pm-5pm, Highland Park Community House This school holidays, busy hands will be having a field day with two workshops focused on claymation and cartooning techniques. Based on the teachings of experienced animator and illustrator, Rob Mcleay, the workshops will focus on content from his latest book, The Project Book Volume 3. The workshops will be held separately with the Cartooning Workshop taking place in the morning, and the Claymation Workshop in the afternoon. Suitable for those aged 7 and above; tickets $70 per person. Check out www. mcleayworkshops.com for more info. Lego Engineering & Robotics Holiday Course January 13-15, 9am-5pm, Auckland Grammar School Have a Lego-obssessed child? Then check out this course that has all the building bricks to guide wandering minds to explore bigger possibilities. Take part in extreme Lego challenges using Bricks, Software, Mindstorm robots and 3D Lego construction software. Explore a range of construction, robotics, architectural and engineering challenges and take problem solving skills to new heights whilst learning how to

programme robots. Bring a camera to capture the magic! For more info, see bubbledome.com

➤ festivals Chinese New Year Festival & Market Day January 18, 9.30am-4pm, ASB Showgrounds, FREE Be there as the Year of the Horse gallops into town, with an annual celebration of epic proportions. One of the most popular cultural events in the calendar, this festival will showcase numerous sights and sounds, a variety of stalls and plenty of fun and entertainment in store for the whole family. See aucklandchinese.org.nz for more information or to apply for a stall. Auckland International Buskers Festival January 24-27, 12pm-10pm, Viaduct Harbour, FREE See the wildest, wackiest and most wonderful antics of some of the world’s most talented street performers at this annual favourite. Put on your best clapping gloves, slip on those stomping boots and dive down the back of the couch for a handful of loose change, then make your way to the city for a variety of comedy, mind-blowing magic, outrageous acrobatics, mime, contortion, death-defying stunts and dance acts. See aucklandbuskersfestival.co.nz for the schedule and for more details.

➤ wheeled

cars, bikes and many more, the event will also feature extreme sports – fmx, bmx, and skate –as well as huge trade stalls and drag racing. This display will dazzle even the hardiest of thrill seekers. Tickets, $25 per person and free for children under 10; see 4androtary.co.nz for more details.

➤ Markets Howick Village Market Every Saturday, 8.30am-12.30pm, Picton St, Howick Classy Crafts Every Saturday, 9am-1pm, All Saints Community Centre, Cook St, Howick Aotearoa Crafts Every Saturday, 9am-4pm, Sunset Tce, Botany Town Centre, Botany Pine Harbour Fresh Market Every Saturday, 8am-12pm, Pine Harbour Marina, Jack Lachlan Dr, Beachlands Clevedon Village Farmers’ Market Every Sunday, 8.30am-12pm, Clevedon Showgrounds, Monument Rd, Clevedon Clevedon Village Market Every Sunday, 9am-2pm, Clevedon Community Centre, 1 PapakuraClevedon Rd, Clevedon Pakuranga Night Market Every Saturday night, 6pm12midnight, under The Warehouse, Pakuranga Plaza

V4 and Rotary Nationals 2014 – Show and Shine Day January 25, 9am-6pm, ASB Showgrounds, Greenlane Petrolheads can satisfy their need for speed at this annual automotive festival promising the best of youth culture and entertainment. Featuring show cars, drag cars, drift cars, mini trucks, V8s, classic cars, old school

Enjoy summer on the Hauraki Gulf For information about magnificent destinations, timetables and tours visit fullers.co.nz E510199

www.eastlife.co.nz

eastlife | december 2013 |

11


E510101

www.beautybible.co.nz

Your favourite brands online including

QR code generated on http://qrcode.littleidiot.be

Do you need your Investment Property managed? ALANA NATHAN

▲ 15 years experience in the residential property management industry ▲ Extensive knowledge of the Residential Tenancies Act 2010 ▲ Great communication is the key ▲ It’s building relationships that counts

Alana Nathan looks forward to meeting you Licenced Agent REAA 2008 DDI 538 0108 | Mob 021 228 9902 | email: alana@fnhowick.co.nz 09 538 0105 www.fnhowick.co.nz E512052-v2

12 | eastlife | december 2013

www.eastlife.co.nz


profile | eastlife

A moving experience

In search of a rural lifestyle, Jo Plummer moved from Bucklands Beach to Karaka and, despite establishing roots on a five-acre lifestyle block, she’s been on the move ever since, as JON RAWLINSON discovered. Working as a Pilates instructor while juggling an active family and a lifestyle block can make for a busy life. However, former Howick local, Jo Plummer, says her commitment to fitness has helped her take life’s challenges in her stride. “Fitness and exercise are crucial for wellbeing and I’ve always believed in being a positive role model for my kids; besides that, I need to keep fit to keep up with them all! Exercise has been a huge part of my life, it was instilled in me as a child and, as a parent of four, it’s crucial.” While Jo says country air is good for the body and soul, life on the family farm is not always plain sailing. With her husband, Mark – head physiotherapist for the Blues and Auckland rugby teams – regularly away on business, she relies on the support of family and friends. “With Mark away so much I need to keep the place ticking over. Having a fit body helps me keep on top of everything and I have an amazing support network,” she says. “Mark worked for the Black Caps when we met, so our relationship was always long distance. The mantra, ‘distance makes the heart grow fonder’ is true, but after 19 years of marriage, I think it’s moved beyond that!” While Jo chose the sporting (and ultimately) lifestyle farming track, her life could have taken a different turn – less leotards and gumboots, more tiaras and ball gowns – when she entered Miss Howick in her sixth form year in 1988. “It was totally out of my comfort zone, but I knew Val Lott through her kids and swimming club, so I was put at ease,” she says. Jo won Miss Personality and Miss Potential Model, which included a modelling contract through renowed modelling agency, Maysie Bestall Cohen. However, her commitment to www.eastlife.co.nz

sport ultimately drowned out catwalk ambitions. “I was told my shoulders were too wide from swimming! But sport was always more important to me and I did lack a passion for modelling, so that settled it. On the other hand, I did take away great self-confidence from the experience.” A love of sport runs in the Plummer family, with the couple’s children – Josh (17), Harry (15), Ben (12) and Piper (7) – all involved. “Mark and I have always been big on our children staying active. They have probably seen Mark play more sport than me. I played water polo for New Zealand for 10 years, but had finished by the time the kids came along,” says Jo. “There’s a saying: ‘kids in sport are kept out of court,’ which I suppose has some truth to it. My theory is, regardless of whether parents represent at a top level or not, children will find a niche through exposure and seeing parents being active and enjoying themselves.”

There’s a saying: ‘kids in sport are kept out of court,’ which I suppose has some truth to it. My theory is, regardless of whether parents represent at a top level or not, children will find a niche through exposure and seeing parents being active and enjoying themselves.”

While her sons enjoy rugby, Jo says both she and Mark are well aware of the risks associated with contact sport.

Before fostering a love of sport in her children, Jo taught physical education at Macleans College from 1994-1997.

“I never wanted the boys to play rugby. Mark broke his neck in seventh form at First XV rugby training, so I was paranoid one of the boys would too. I stress during every game and probably always will.

“PE was always the passion and my drive was to be a role model for teenage girls to continue exercising through puberty and beyond, helping set them up for adulthood. I absolutely loved the experience and the school; it was hard deciding whether or not to go back.”

“It’s too early to say where our youngest’s passion will lead but, with three older brothers, Piper has developed a killer instinct! She was awesome this year, her first year of netball, and she’s opening the boys eyes to hip hop as well!”

Jo left teaching in 1997 when she and Mark found their own little bit of country. While neither had a great deal of experience with land, Jo had already developed a taste for the country while living with her parents on their 2.5 acre Flatbush property.

“Mum and dad still live there, but the area looks nothing like it did when I was growing up. When Mark and I made the move to Karaka, we had a one-year-old and I was 20 weeks pregnant. Not long afterwards Mark went on a cricket tour, so I had a few months on my own. I wondered what the heck we had done! “These days, with the boys attending school in the city, there are challenges, but we just love the lifestyle; we can offer the kids the best of both worlds – the town and country experience,” she says. “We also love the peace and quiet. I have a Pilates studio at home and the ambience is divine. Walking into my studio each day, looking out at the gardens with the sun streaming in; it really is a wonderful way to live!” eastlife | december 2013 |

13


eastlife | profile

Ballet history a merry dance The Royal New Zealand Ballet is pirouetting through its diamond jubilee year in traditional touring manner. HELEN PERRY asked the company’s corporate development manager about the celebrations and her dance history which began in Howick with the Val Murray’s Ballet School and later the Julie Cotter Dancers. There is still a great deal of the ballerina in Diane Field even though it is decades since she donned leotard and ballet shoes to stand at the barre. From the velvet band holding back shoulder-length hair to her slim frame and dancer’s carriage – straight back and quietly confident manner – she exudes the kind of poise that stems from years of training, teaching and being surrounded by ballet dancers. And, it seems, that very same training has provided her with the concentration and discipline needed to work extensively with companies in order to secure the kind of corporate sponsorship needed to support a national ballet company. “It can take several years to court a major sponsor,” Diane explains. “The relationship has to be a fit between brands with commercial outcomes

identified and delivered. There’s a lot of preparation involved; it’s not just a matter of fronting up and asking for some funds. Strategic objectives all need to be taken into account and that requires research and negotiation.” This year being the RNZB’s 60th anniversary has included three national tours and a tour to China although Tower Tutus on Tour is by far the biggest undertaking with two groups touring consecutively from one end of the country to the other. The tour ends December 4 on Stewart Island. Diane says from its inception the RNZB has had a strong tradition of touring. “And much of its success has been due to a tradition of visiting provincial and regional towns where we experience such a huge turnout and warm welcome. Centres, which

have more limited access to quality entertainment, really appreciate it when the ballet comes to town and they show it.” As Tower Tutus on Tour winds up, Diane says its visit to 47 centres, with some performances specifically for school groups, has, again, been wonderfully received. “It’s been marvellous to see young and old turn out and, in some remote places, even hardened workers not usually thought of as ballet enthusiasts.” However, Diane says a common thread among many people has been their memories of attending similar performances by the company many years ago. “So many remember going to the ballet with their grandmothers and now they are taking their own grandchildren.” For Diane it has been a similar story.

diane field Her mother, Joyce, was active in the former Howick Operatic Society (now Harlequin Theatre) making costumes, singing and helping backstage. “From a young girl, show business was a part of my life and later, I danced in and choreographed musicals such as The King and I and Evita.”

Ormiston Hospital

Surgery Closer to Home Botany Junction

Open Day – Saturday, February 22, 2014 – 10am to 3pm Ormiston Hospital A private surgical hospital accommodating your ACC, Private Health Insurance or Privately Funded Surgical Needs 125 Ormiston Road, Flat Bush, Ph 09 250 1157 Email enquiries@ormistonhospital.co.nz Website www.ormistonhospital.co.nz We are opening our doors to our community and we invite you to take a tour through our beautifully appointed hospital. You will be taken into an Operating Theatre and shown state of the art equipment and have the opportunity to view the warm surroundings of our Ward. Our staff will be on hand to answer questions and you will experience first-hand the friendly, helpful and caring environment that we foster at Ormiston Hospital. Our Vision “To be the preferred private surgical hospital in our region through clinical excellence and superior service” E510106-v5

14 | eastlife | december 2013

www.eastlife.co.nz


Early days on tour with the New Zealand Ballet Company (now Royal New Zealand Ballet).

But first Diane learnt to dance – specifically ballet. She was just eight when she join the Val Murray Ballet School, operating out of the hall next to the former Howick Library. “I carried on learning under the late Bev Bowen in Pakuranga then returned to Val Murray for my majors. Then, at 17 I enrolled with the Julie Cotter Dancers to learn jazz which was all the rage.” Other well known locals who danced with the school were the Kendall sisters, Barbara and Wendy, (who Diane also knew through the Bucklands Beach Yacht Club); former Miss Universe, Lorraine Downes; international model, Angela Dunne; and Suzy Aiken (now Clarkson) television presenter and former face of aerobics in New Zealand.

“I had trained as a laboratory technician and initially worked at Greenlane Hospital but on my return from the UK I managed the Julie Cotter Dancers for 12 months as Julie had headed to Australia.” It wasn’t until 2007, after working with TVNZ Enterprises, where she did a Direct Marketing Diploma, and at Opera NZ where she completed a post graduate Diploma of Management/Arts that Diane returned to her love of ballet by joining the RNZB in her present role.

“And I love it. I have an office in Auckland but because the company is in Wellington, I commute a lot. “This being the company’s jubilee year has been particularly memorable especially the official party in Wellington on July 21. It was an earth-shaking event – literally. That was the day of the big Wellington earthquake and ground really shook but it didn’t hamper a wonderful night of festivity.”

“Jonty is now 73 and will perform the role of Dr Coppelius so that’s quite an achievement; in keeping with the ballet’s 60 year history,” Diane says. “Furthermore, with Coppélia opening the New Zealand programme, after a three-week tour to the USA, it shows the company is in good heart and set to offer new opportunities to dancers of the future.”

Experienced & Teachers PACK & SEND Parents PAKURANGA

URGENTLY NEEDED

JFS

"OU JRV FT 1" $, "( */

Centres, which have more limited access to quality entertainment, really appreciate it when the ballet comes to town and they show it.”

And the celebrations don’t quite stop when 2013 draws to a close. Next year when the RNZB brings Coppélia to the stage in April, it will mark the 50th anniversary of renowned New Zealand dancer, Jon Trimmer’s first performance in this ballet.

(

“Later, I also taught at the school and only left when I headed to London on the big O.E. and did all the amazing things that young people do such as working on an Israeli kibbutz.

S $PV

ALL YOUR FREIGHT SOLUTIONS PACKAGED IN ONE LOCATION

BDF 5S L D B 5S

in Dannemora and Howick!

We pick up, pack and send anything anywhere!

Do you love working with very young children?

0/"4"'&*/5&3/"5* "S UX PSL

Even if its fragile, large, awkward or valuable, If you oneare: item or 1000, we will professionally • Keen to work pack,from insure and deliver it. your own, safe Nohome account needed!

• Passionate about

small group childcare Unit C, 335 Ti Rakau Drive East Tamaki 2013 (opposite Bunnings Warehouse) (09) 9131950 • Experienced with prewww.packsend.co.nz pakuranga@packsend.co.nz school children • Wanting to complete ECE training for FREE

PACK & SEND PAKURANGA ALL YOUR YOUR FREIGHT FREIGHT SOLUTIONS SOLUTIONS PACKAGED PACKAGED ALL IN ONE ONE LOCATION LOCATION IN

We would like to meet you to discuss how the Stems family could be the right match for you and your family! Please contact Emma on 536 7103 or emma@stemsfromhome.co.nz We’d love to chat to you today!

We pick up, pack and send anything anywhere! We pick pick up, up, pack pack and and send send anything anything anywhere! anywhere! We Even if it’s fragile, large, awkward or valuable, Even ifif its its fragile, fragile, large, large, awkward awkward or or valuable, valuable, Even one item oror1000, we will professionally one item 1000, we will professionally one item or 1000, we will professionally pack, pack,insure insureand anddeliver deliverit.it. it. pack, insure and deliver No account needed! No account needed! No account needed!

www.eastlife.co.nz

E510094-v3

Tamaki 2013 Tamaki 2013 (09) 9131950 (09) 9131950 a@packsend.co.nz a@packsend.co.nz Unit C, 335 Ti Rakau Dr, East Tamaki (opposite Bunnings Warehouse) Ph (09) 913 1950 www.packsend.co.nz pakuranga@packsend.co.nz

E512060-v2

F

profile | eastlife

www.stemsfromhome.co.nz eastlife | december 2013 |

15


eastlife | profile

Pakuranga has the Power! When the going gets tough, the tough ‘weight’ around, as local Powerlifting prodigy, Daniel Holliday, explained to JON RAWLINSON.

There will be no holiday for Daniel on Sunday, December 8 when he steps up to take on some of the best powerlifters in the world – including 550 athletes from 20 countries – at the Telstra Pacific Events Centre. The South African-born local will be representing New Zealand, a country he’s called home since the age of 13. But is he nervous? Not a bit. The competition follows a meteoric rise which has seen Daniel Holliday reach elite level only a little over a year since first competing. He says his family has provided the “driving force” behind his efforts. “I guess I have the right genetics and determination. But something that always pushes me is when kids talk and say, ‘my dad’s stronger than your dad.’ In the case of my two boys, it’s true! I want to make them proud of their dad.” And Jacob (aged 3) and Alexander (5) will have every reason to puff out their chests and lift their heads high should dad reach his goal in the 120+ weight category at the upcoming Commonwealth and Oceania Powerlifting/Benchpress Championships this month. “I’ve reached an Elite Total, which not many people in New Zealand have. I hold two Auckland records for my deadlift and benchpress, and I’m planning on achieving the biggest RAW total [combined total of deadlift, benchpress and squat weights] New Zealand’s seen at Commonwealths, lifting 840-850kg,” says Daniel. During the event, athletes will compete once, but scores will count towards both Oceania and Commonwealth titles. Daniel will compete on Sunday, December 8. Despite being ranked third in Oceania, he says at least a personal best effort – 310kg squat, 225kg benchpress and 330kg deadlift – will be required to win. “I’m very confident that I’ll place in the top three of both. There will be some top competition though.

16 | eastlife | december 2013

To win Oceania, I’d have to be very close to my personal best, and for Commonwealths I’d have to hit some amazing lifts,” he says. Daniel’s rise to the top of his sport began in November last year. Undergoing physio for an injured leg, he realised he had potential. Since then, he has secured five medals, including three golds, across a range of competitions, culminating in Auckland and national titles earlier this year. “I won the gold [in Auckland] for my weight category and qualified for the nationals in Christchurch where I picked up silver and qualified for the Commonwealth/Oceania champs. It felt great! All the hard work had paid off.” However, a back injury almost stopped his run. “As I was warming up in Christchurch, I tore a muscle. It made things more difficult, but it made me more determined too. I wasn’t going to let my hard work be ruined before the day had even started!” The speed of Daniel’s ascent to the top of his sport has, however, led

I’m accused of being on drugs all the time, but I’m not… people don’t normally see someone benching more than 200kg and picking up over 300!”

peoples’ roofs! They’ve been a huge support and allowed me to go off and compete.” Despite gracing the field at Pakuranga United Rugby Club in his younger years, the 25-year-old says, faced with a bright future in his new sport, a return to rugby is off the cards.

some to question his methods. “I’m accused of being on drugs all the time, but I’m not. I guess it’s because people don’t normally see someone benching more than 200kg and picking up over 300! I have been pressured to use drugs, but I’ve never touched the stuff. “If others are on drugs they have an advantage. It is difficult, but with hard work and the right coaching it’s certainly possible to win clean. Drugs could be a problem, but we get tested and if people are using during competition time, I’m pretty sure they’ll be caught.” Daniel says the support of sponsors has been invaluable over the last year, particularly Reel Roofing from East Tamaki where he works full time. “I’m a site supervisor; I’m a bit too big to go walking around on

“I played First Fifteen rugby at Pakuranga College from the get-go because I was too big to play for other teams. I also played for Pakuranga United, under-17s to under-21s. I was a prop, as if you couldn’t have guessed! “But these days powerlifting is my focus, I have a much bigger passion for it than I did for rugby.” And beyond the Commonwealth and Oceania Powerlifting/Benchpress Championships, Daniel says he will continue to lift his game on the world stage. “I have the World RAW champs in Johannesburg next year [IPF RAW Classics Powerlifting Championships]. I’d love to place top three and, in my benchpress especially, I’d be going for gold. It’ll take a lot of hard work, but I’m up for the challenge.” www.eastlife.co.nz


YOU’LL NEED A BIGGER STOCKING.

MINI RAY $29,200 DRIVE AWAY.

At only $29,200 drive away or $92 a week*, MINI RAY deserves a place on your Christmas wish list. Experience MINI’s legendary go-kart handling, iconic styling, customisable design options and smart safety features. Plus a new MINI RAY includes MINI’s 3 Year Scheduled Servicing, Warranty Plan and Roadside Assistance. So all you’ll need is a gift tag to go with the tiny price tag on a MINI RAY. Visit the Team McMillan MINI Garage for a test drive or go to MINI.CO.NZ for more information.

0,1

E510195

Team McMillan MINI Garage, 430 Broadway, Newmarket, 0800 548 352. *Offer based on Drive Away Price. Finance offer based on Loan agreement consisting of a 36 month contract, LQWHUHVWUDWHZLWKDGHSRVLWDQGD´QDOSD\PHQWRI$GRFXPHQWDWLRQIHHRIDSSOLHV Offer expires 31/12/2013 and is subject to BMW Financial Services lending criteria. www.eastlife.co.nz

eastlife | december 2013 |

17


THE NATURAL HEALTH CO. ORGANIC STORE EXCITING NEW PRODUCTS IN-STORE Come in and see our new range of Co-Yo, the delicious coconut yoghurt. This heavenly yoghurt is dairy, gluten and lactose free. Suitable for vegans. Try the yummy avours – such as berry, pineapple, mango. Winner of 2012 Food Magazine Awards. Check out our: • organic fresh kale • salad mix • baby spinach

Other popular brands include: • Loving Earth – organic raw chocolate • Clean Paleo – egg white protein • Alexander’s Woodhaugh Honey – raw, unheated honey • Make it Raw range of crackers and grawnola

Bring this advert into store, spend over $50 and you will receive a

FREE

Pop in and take advantage of our great deals on our popular products while stocks last!

Kokonati Organic Virgin Coconut Oil 200ml

Shop 27, Highland Park Shopping Centre, Pakuranga Highway, Highland Park. Ph 534 0445.

Valid until December 24, 2013

G G

G

G

G

G

www.

G

G

AUTHENTIC JAPANESE CUISINE

Grand Opening

G

New owners, new menu, new decor, great food and great prices Highland Park Shopping Centre, Pakuranga Highway, Highland Park. Ph 537 2829

G

G

G

G

G

G

G

  Ĺľ   

 "  G Solid sterling silver and Swarovski crystal G hearts in enchanting www.

G

.com.au

from Holland... with love

Highland Park Shopping Centre, Pakuranga Highway, Highland Park. Ph 537 5656. www.highlandparkjewellers.co.nz

G

G

G

G

G

  Ĺľ   

Solid sterling silver and Swarovski crystal hearts in enchanting rose pink, available from: Highland Park Jewellers Shop 1, 505 Pakuranga Hwy Auckland ph 09 5375656

 "  CORNER AVIEMORE DR & PAKURANGA ROAD www.highlandparkshoppingcentre.co.nz

18 | eastlife | december 2013

Solid sterling crystal hearts pink, available Highland Par Shop 1, 505 P Auckland ph 0

G

rose pink, available from:

G

from Holla

www.eastlife.co.nz


obituary | eastlife

Chequered flag lowered for last time The death of NZ Motorsport administrator, David Slater has rocked the world of motor racing. However, with a Midas touch, that turned many events to gold, his passing has also been felt by sailors, anglers, campervanners and golfers as well as drivers from many classes of motorsport. To HELEN PERRY he was a friend with a zest for life. The sudden death of motor racing stalwart and former Howick resident David Slater, who collapsed on his way home from Auckland to Taupo early in November, has impacted hugely on Motorsport New Zealand and NZV8s. Circuit safety inspector for MSNZ and the FIA, Dave had a long association with Pukekohe Raceway, which made the presence of wife Ziggy and son Ricky at Round 1 of the NZ V8 Touring Cars championships just days after the funeral, a poignant affair. Retired Aussie supercar driver Jason Bargwanna even dedicated his round win to Dave and made sure Ziggy received her share of the champagne. “We just had to go,” said Ricky. “Mum was always at the track with Dad and was also involved with admin.” Of course, many local readers will remember Dave as the hands-on owner of the former Shell Service Station in Cascades Rd, Pakuranga, which he operated for many years. Throughout much of his life David was both a motor racing competitor and an administrator. His untimely death on November 10 sparked a flurry of Facebook tributes and the large turnout at his Taupo funeral was a mark of the highest respect for a “real gentleman”. Impossible to cover all facets of

Dave’s extraordinary and active life, some can’t be ignored. For example, he won numerous New Zealand motor racing championships in various classes and raced in Japan, Australia, the USA and England.

I love the challenge of building a car then being able to get the ultimate out of it to win!”

He was also responsible for guiding former Prime Minister, the late David Lange’s successful motor racing career and stayed at Vogel House, Wellington as Mr Lange’s guest. Ricky recalls the pair’s warm friendship – “Dad was always thrilled and proud to have played a part in Mr Lange’s passion for the sport.” Dave [Slater] was also a foundation driver and huge supporter of Holden HQ racing when it launched in the late 1980’s. He was highly successful with many class wins and even raced at Bathhurst appearing in an HQ support race before the main event.

is a reminder that Dave, fast and able on the track, was also an advocate of safety and rules.

After many years in car sales at MacMillan Ford and as sales manager at Lyon Ford, he said he loved the camaraderie between drivers and the competitiveness of HQs as a single design make.

In particular, he worked with friend Bob Cullinane for a number of years operating Pukekohe Park Raceway Driving School where he loved to pass on his racing skills in a safe environment.

His own words: “I love the challenge of building a car then being able to get the ultimate out of it to win!” And he won many times over.

He also competed in other quarters. He was an avid trout fisherman, competitive golfer and sailor. In fact, back in the 80’s, he competed in the Auckland to Fiji yacht race and came third in his class. More recently he and Ziggy bought a motorhome, becoming members of the Taupo Motorhome Club.

Dave rounded off his race career with club meets and also took part in endurance races at Pukekohe Raceway but his final role for MSNZ

A time served mechanic, his career always revolved around cars but his home life was anchored by Ziggy and Ricky. Both were as much at home trackside as Dave. He and Ziggy moved from Golflands to Taupo 12 years ago. It proved the perfect base for travelling to race tracks around the country where Dave became known to many as “the man with the blue clipboard!” Ultimately, David lived largely in the fast lane of life, but he always had his hand firmly on the wheel and negotiated the chicanes with skill and dexterity. New Zealand motor sport has lost a wonderful supporter and friend.

+ Business and Commercial + Property + Litigation, Mediation & Intellectual Property + Trusts and Asset Management + Family and Matrimonial + Employment + Immigration + Wills and Estates Wynyard Wood, Level 1, The Crossing, Cnr Highbrook Drive and Business Parade South, Highbrook Business Park P: 09 969 0126 E: manager@wynyardwood.co.nz

www.wynyardwood.co.nz HIGHBROOK | AUCKLAND | WARKWORTH E510138-v2

www.eastlife.co.nz

eastlife | december 2013 |

19


eastlife | interview

In good Nick for Christmas Forget James Brown, arguably Santa Claus is the hardest working man in show business, as JON RAWLINSON discovered. Undertaking multiple appearances during the festive season – many at the same time! – it’s tough being Nick at Christmas. However, come December, East Auckland local, Sian Baker gets down to the business of ensuring Mr Cringle really does jingle all the way! The recruitment agent from East Tamaki company, Lowie Recruitment, says while sourcing Santas for shopping centres and corporate functions may be a jolly job, professionalism is crucial.

make such a difference. They have to be jovial with a larger than life personality and love kids, but they also need to be professional in look and the way they act.” In addition, Sian’s Santas must be prepared to deal with tricky situations.

“Our clients want to have the best experience for children, because a good Santa makes a huge difference to a shopping mall,” she says.

“We’ve had some heart-wrenching stories from children, including ‘can I have a new baby brother; my other one died,’ or ‘I don’t want anything, just for mummy to get better,’ or ‘can you bring Nana back from heaven?’ Often our Santas will speak to the parents afterwards, if possible, so they can then deal with it as well,” she says.

“It’s a lovely role and they can

“But there are a lot of fun questions

too. A child once asked my son, Nick – a great name for a Santa – where his reindeer were. Nick said they were on the roof in a magic container eating pizza for lunch; the child was delighted! Children want to believe, so it’s important our Santas improvise and make the role their own.”

Festive functions for corporates also present challenges when ‘children at heart’ indulge too heavily in the Christmas spirit(s). “It doesn’t happen often that people have had too much to drink, but it does happen. So, we choose our guys very carefully. I tend to pick the

BUSY WITH BUSINESS? WE’LL COME TO YOU Telecom Business Hub Tamaki offers products and services which can be tailored to your business needs. Simply call 0800 588 494 to arrange your 30-minute business tech check.

We’ll come to you Call 0800 588 494 telecom.co.nz/businesshub

E510186

20 | eastlife | december 2013 Bus Hub East Life Mag.indd 1

www.eastlife.co.nz 25/10/13 11:46 AM


interview | eastlife Santa Santa lady lady –– Sian Sian Baker Baker checks checks in in with with aa local local santa. santa.

Childcare on your terms

Sian Sian Baker Baker from from Lowie Lowie Recruitment Recruitment says, says, while while most most clients clients favour favour the the conventional conventional Claus Claus for for Christmas Christmas appearances, appearances, when when it it comes comes to to the the red red suit, suit, one one size size doesn’t doesn’t need need to to fit fit all. all.

people people who who II know know can can deal deal with with high high jinx. jinx. They They need need aa sense sense of of maturity maturity and and know know what what to to expect, expect, engaging engaging in in aa bit bit of of banter, banter, but but knowing knowing where where to to draw draw the the line. line. They They need need to to maintain maintain professionalism professionalism and and have have fun fun too.� too.� Whether Whether dealing dealing with with inquisitive inquisitive children children or or unruly unruly adults, adults, all all Nicks Nicks are are provided provided with with training training and and bad bad Santas Santas are are soon soon give give the the ‘sack’! ‘sack’! “Training “Training sessions sessions usually usually take take aa couple couple of of hours. hours. We We give give them them the the basis basis of of what what the the role role entails entails and and how how they they should should act act in in certain certain situations, situations, but but it’s it’s their their role role and and they they can can have have fun fun with with it,� it,� Sian Sian says. says. “However, “However, ifif anyone anyone misbehaves misbehaves or or we we get get aa complaint, complaint, II nip nip it it in in the the bud. bud. But But most most Santas Santas have have been been doing doing this this for for years years and and are are most most professional. professional. “I “I have have aa good good gut gut feeling feeling and and we we also also carry carry out out police police and and reference reference checks; checks; it’s it’s really really important important that that they they do do us us and and our our clients clients proud.� proud.�

“If “If he’s he’s got got the the stomach, stomach, that’s that’s great, great, but but we we provide provide padding padding too. too. Some Some find find the the padding padding incredibly incredibly hot hot so, so, ifif the the client’s client’s okay okay with with it, it, such such Santas Santas won’t won’t wear wear it. it. IfIf asked asked he’ll he’ll say say ‘Mrs ‘Mrs Claus Claus has has me me on on aa diet’ diet’ or or ‘I’ve ‘I’ve been been working working out.’ out.’

09 215 8335 / 021 338 639

Stephanie@bluebells.co.nz Stephanie@bluebells.co.nz // www.bluebells.co.nz www.bluebells.co.nz

E510112 E510112

Would the real Chris Cringle please stand up?

Bluebells provides quality In Home Education and care in safe and nurturing environments. We offer 20 years of teaching experience to build your childs individual learning programme

EARLY CHILDHOOD EDUCATION & CARE ...IN THE HOME!

“Our “Our clients clients generally generally want want the the traditional traditional look; look; however, however, we’ve we’ve had had Pacific Pacific Island, Island, Maori Maori and and even even Chinese Chinese Santas Santas requested. requested. “We “We don’t don’t use use female female Santas, Santas, but but only only because because it’s it’s not not something something we’ve we’ve been been asked asked for.� for.� And And age age is is no no barrier barrier to to ho, ho, ho, ho, ho’s. ho’s. “We “We get get aa few few youngsters youngsters around around the the 20 20 year year mark, mark, and and 88 88 is is our our eldest. eldest. Kids Kids don’t don’t tend tend to to see see young young Santas Santas as as not not being being the the real real McCoy. McCoy. Parents Parents may may make make critical critical remarks remarks about about the the lack lack of of crinkles crinkles and and wrinkles, wrinkles, but but not not the the kiddies. kiddies. “Most “Most of of our our Santas Santas are are retired retired –– they they have have life life experience experience and and grandchildren grandchildren –– and and some some are are from from theatre theatre groups; groups; actors actors generally generally make make good good Santas. Santas. However, However, they they really really do do come come from from all all walks walks of of life.� life.�

Quality Quality home home based based childcare childcare & & education education for for children children from from birth birth to to starting starting their their school school journey journey A A friendly friendly network network of of experienced experienced & & dedicated dedicated Educators Educators Free Free professional professional development development opportunities opportunities for for Educators Educators Access Access to to stimulating stimulating & & educational educational learning learning resources resources

Administration Administration support support & & contractor contractor payroll payroll service service Personalised Personalised learning learning journals journals & & individual individual plans plans for for each each child child Local Local regular regular weekly weekly events events and and outings outings Contact Contact us us for for FURTHER FURTHER INFORMATION INFORMATION about about becoming becoming an an In In Home Home Educator, Educator, or or meeting meeting your your childcare childcare needs! needs!

533 3512

admin@connectionsinthehome.co.nz admin@connectionsinthehome.co.nz www.connectionsinthehome.co.nz www.connectionsinthehome.co.nz

‘CONNECTING CHILDREN, HOMES AND OUR COMMUNITY THROUGH EARLY CHILDHOOD EDUCATION’ E510184 E510184

6=E7190=B/<G>/9C@/<5//<2AC@@=C<2A

BSZZca eVObWaVO^^S\W\U G=C@;=<B6:G:743ABG:3;/5/H7<3

ESeO\bb]Y\]e eVObg]cbVW\YeVObg]cZWYS eVObg]ceO\bb]aSSW\3Oab:WTS

0SW\]c`4SP`cO`gWaacS 1]^gRSORZW\S8O\cO`g  "2Wab`WPcbSRÂż`abeSSY]T4SP`cO`g

1]\bOQbca >V %& Â&#x2019;W\T].SOabZWTSQ]\hÂ&#x2019;eeeSOabZWTSQ]\h www.eastlife.co.nz www.eastlife.co.nz

eastlife eastlife || december december 2013 2013 || 21


Win!

eastlife | competitions

To enter the draw for any of these competitions visit www.eastlife.co.nz click on the competitions link and fill in the form. One entry per email address / person; entries close January 31, 2014. Winners notified by phone or email.

WIN! GOLDAIR FOOD PROCESSOR Christmas is a time for sharing festivities, fun and FOOD! And what better way to whip up some yuletide fare, including a traditional Christmas cake, than with a Goldair food processor? Featuring five speeds, with a pulse function, this 800w machine will blend, chop, mix, and slice for all of your Christmas cooking needs. Available in two colours to choose from, festive red or stylish grey, this multifunctional food processor is a super gift for the budding or experienced home chef. RRP $299.99 from Farmers. Better still you could be a laughing all the way to the oven if you enter our draw.

WIN! Cookbook to make summer complete Evocative images conjure up visions of the quintessential Kiwi summer in Beach Bach Boat Barbecue: The Complete Collection. Penny Oliver’s simple, stylish recipes rely on fresh, quality seasonal ingredients and celebrate summer. Together with Ian Batchelor’s enticing photography, including scenesetting locations, the four recipe sections will stir up a holiday mood. There is something for every taste and circumstance. Plenty of delicious sweet treats too. It’s a winner and one lucky reader will be too! Beach Bach Boat Barbecue: The Complete Collection. Recipes, Penny Oliver; Photography, Ian Batchelor; Published by New Holland. RRP $55.

WIN! Village Barn gourmet hamper Exciting new shopping destination, The Village Barn Whitford, offers a unique blend of quality decorator accessories, original art and local gourmet foods. What’s more, The Village Barn has put up a fabulous hamper, valued at around $145. One lucky reader will receive a six-piece selection of Macadamia nuts including two packs of dukkah from Top Notch Macadamia Orchards; a nutcracker and a 1kg bag of macadamia nuts plus gourmet mustards from MustardMakers NZ including The Mustard Trio of Farmhouse French Mustard, Lemon and Dill Mustard and Manuka-Smoked Mustard plus a jar of Ham Paint (orange and spice) and a jar of Mustard Paint (tangy marinade/glaze).

WIN! A JO MALONE CANDLE To imbue homes with the sweet lingering fragrance and light up the New Year, Jo Malone has gifted a Dark Amber & Ginger Lily candle valued at $155 to give away to one lucky reader. Adorn the home with the intoxicating scent of amber and black orchid illuminated by the clean sensuality of black cardamom, ginger and water lily.

WIN! Delicious Festive Selection chocolates

win! squabbles board game

Nothing says summer like kiwifruit pavlova so, artisan chocolate makers, Devonport Chocolates, have come up with the ultimate festive treat – a tablet of creamy Belgian milk chocolate with real meringue and kiwifruit pieces, adorned with a specially commissioned artwork by artist, Fraser Williamson. What’s more, a delectable kiwi pav-flavoured truffle also stars in the new Festive Selection, alongside other fabulous flavours such as gingerbread, chewy caramel, spiced fruit and nut, raspberry bonbon and Valencia orange. Ideal as a gift or after dinner treat – 80g tablet RRP $11.90; 16-piece Festive Selection RRP $39.90. www.devonportchocolates.co.nz. EastLife has two boxes of the Festive Selection to give away!

Invented by Howickian Julia Banks, Squabbles is a new, fast-paced word game suitable for ages 8 and up and will have boredom biting the dust in no time. Each player builds a crossword using 20 letter tiles and when a crossword using all tiles is completed, ‘Grab’ is called, signalling players to grab another tile and add it to their crossword. To spice things up, a BAD BOY tile is thrown into the pile – cheeky shenanigans ensue and Squabbles arise! Thanks to its creator, here’s a chance to grab a Squabbles set for the family.

For last month’s EastLife winners visit www.eastlife.co.nz/competitions 22 | eastlife | december 2013

www.eastlife.co.nz


lifestyle Baird luck CHRISTINE MILES from the Howick Historical Village gives the low down on the history behind some of our thoroughfares. General Sir David Baird (1757-1829), described by his contemporaries as being “every inch a soldier” and “an outstanding gentleman”, was dogged by misfortunes in his career. Severely wounded during an attack on the State of Mysore, India, in 1780, he was taken prisoner, chained to other captives, and finally released in 1784. On hearing that her son and other prisoners were in fetters, Baird’s mother is said to have ruefully remarked, “God help the chiel chained to our Davie.” Then came a little good fortune – the bullet was extracted from Baird’s wound on his release, which, for all we know, may well have saved him from infection, greater pain and even death.

sent home. A year later, in 1807 he led the Cophenhagen expedition, during which he was wounded for a second time. Soon after Baird’s return to active service, he was sent out to the Peninsular War. There, in command of a considerable force, he was to co-operate with Sir John Moore, to whom he had been appointed second in command simply because he was a few days younger. At the battle of Corunna, Baird succeeded to the supreme command after Moore’s fall, but shortly afterwards his left arm was shattered in fighting and the command passed to Sir John Hope. Bad luck indeed! A few years after the passing of this luckless general, Howick’s Baird Street was named for him. It soon became home to the Howick Court, with Petty Sessions being recorded in March 1848 in James Palmer’s Fencible cottage on the corner of Baird and Moore Streets.

But again, his usual ill luck returned. He was persuaded to lend Commodore Sir Home Popham some troops for an expedition against Buenos Aires which became a series of unfortunate failures and Baird was

In 1854 the Auckland Provincial Council allocated funds for a police station which also served as a Police Court. Later, in 1871, the council again allocated funds, this time to build a Magistrates Court, jail and reading

In 1876 a new lockup was built in Baird Street. Constable Malloy celebrated its completion by drinking with the local men, and becoming inebriated. He was subsequently locked in for the night, gaining the ignominious fame of being the jail’s first inmate. Constable Malloy’s senior officer said Malloy was, ‘beyond all the imbecility ever known in the police

force.’ Therefore, it wasn’t long before the people of Howick came to treat Malloy ‘with perfect contempt as being entirely useless’. And that leaves today’s residents wondering what was worse, to be unlucky like the street’s namesake or useless like its infamous inmate? You might take the stance that there was a bit of bad luck all round. – Researched by Christine Miles from the archives at Howick Historical Village

E510185

In 1806, things were looking up for the then Lieutenant General Baird who commanded an expedition around the Cape of Good Hope with complete success.

room. This court house can now be found at the Howick Historical Village.

www.eastlife.co.nz

eastlife | december 2013 |

23


eastlife | travel

Life is a highway... Many Kiwis have had a love affair with motorbikes at some time in life. Not all have managed to remain ‘easy riders’ but, now, more people are pursuing their yen to see New Zealand from the seat of a motorcycle. Bucklands Beach local ROBERT SCOTT from Two-Wheel Touring extols the virtues of riding South Island roads.

New Zealand’s motorcycling community is growing fast. It encompasses all age groups – people who swear the only way to see the country is footloose and fancy-free on a motorbike. Because the South Island’s population is only about one-third of the North Island, southern roads are relatively uncluttered and extremely picturesque making them favourite touring routes. Boasting majestic mountain ranges, stunning lakes and dense virgin forests there is plenty to see. All highways and ‘main roads’ are bitumen although many are only single carriageway.

holes are Karamea Hotel in Westland, and Cardrona Hotel near Queenstown – hospitality assured.

If riders are comfortable riding around 350-400km per day then there are many superb roads to traverse over a week; in fact one can comfortably circumnavigate the South Island in that time.

Road-rail bridges, where trains and vehicles share single-lane bridges, are a feature of the Westland province and something most northerners are not familiar with. So, be aware of these.

Popular places to stop overnight include Queenstown, the Glacier townships of Franz Josef or Fox Glacier, Kaikoura, renowned for whale-watching, and the alpine resort settlement of Hanmer Springs with its hot thermal springs.

A few ‘must ride’ highways include the 250km SH 73 Great Alpine Highway which traverses the Southern Alps, and the 260km SH 94 (known as the Milford Sound Road).

For sheer Kiwi hospitality, an overnight stop at a Westland country pub should be on every wish list. Two well-known motorcycle watering

For the latter, motorcyclists start in rural sheep country around Gore then take in the lakes of the Te Anau area followed by Homer Tunnel before finishing at Milford Sound with its magnificent beech forests and steep mountain ranges.

The South Island represents the pinnacle of motorcycle touring, big enough to have varying terrain and awe-inspiring scenery and small enough that riders can comfortably travel the bulk of the island within a week.”

E510172-v2

For most motorcyclists touring the South Island for the first time, the starting point is usually Christchurch.

The other viable start point is Picton, the terminal town for the inter-island vehicle ferries.

24 | eastlife | december 2013

www.eastlife.co.nz


E S NG IKE RA B LE! LL MO AB FU DE IL F A O AV

travel | eastlife

Planning on touring this summer?

3L[\ZOLSW`V\ÄUK[OLTV[VYJ`JSL[OH[»ZYPNO[MVYYOU! .P]L\ZHJHSS[VIVVRHKLTVYPKL[VKH`

Another worthwhile route is SH 60 which takes daredevil riders from Nelson to Farewell Spit. It includes the 23km Takaka Hill, which is awash with tight corners and switchbacks, some aptly bearing names such as ‘Devils Elbow’ and ‘Eureka Corner’. Farewell Spit – an 18 kilometre long sand spit – is so named because Captain Cook departed here on one of his voyages.

memorabilia and there’s plenty to be found at Methven and Invercargill.

Because South Island roads are generally less congested than further north, this can create a false sense of security for motorcyclists; it’s not difficult to ‘cook a corner’ and ‘final’ yourself in a ditch or the wrong side of the centreline.

Munro was a Kiwi Bonneville Salt Flats motorcycle speed-king in the 1960’s and many folk will have seen the film, The World’s Fastest Indian, which told the story behind his famous land speed record.

Exceeding 140kmh will see a rider face an instant 28-day loss of licence. During the summer, with campervans out in force, often travelling more slowly than other traffic, it is easy to become impatient. Of course, motorcyclists can be at an advantage when it comes to passing but safety first should always be foremost in mind. Remember too, with the South Island’s variance in temperature, it’s common to ride in 25-30 degrees celsius on a summer’s day and then experience an overnight drop to 5 degrees. Summer nightfall doesn’t arrive until around 9pm so covering big distances during the day is comfortable. And there’s nothing more pleasant than cranking up the barbecue and relaxing with like-minded friends after a day on the road. While open road riding and changing landscapes are all part of the touring experience, most bike enthusiasts love to check out motorcycle www.eastlife.co.nz

In Invercargill, the EV Hayes & Son Hardware Store has an excellent collection of old motorcycles. The store is also a focal point for New Zealand’s premier motorcycling festival – The Burt Munro Festival, held in late November.

Naturally, days on the roads also mean accommodation and food must be considered. A good three-course meal at a reasonable restaurant will set travellers back around $50 although one can pay less or more depending on the venue. A motel of reasonable standard costs around $150 per night, but for those happy to carry a tent and use camping grounds, the charge is about $25 per night for ground plot and use of communal facilities. Holiday parks on a shared room basis can be cost-effective at about $40 per night per person. One thing is certain, it won’t take long for fellow motorcyclists to come over, introduce themselves and have a chat. The South Island represents the pinnacle of motorcycle touring, big enough to have varying terrain and awe-inspiring scenery and small enough that riders can comfortably travel the bulk of the island within a week. And, once that’s done, perhaps several times over, there’s a whole world waiting out there!

Call Botany Honda on (09) 274 2727

;Y\NVVK+YP]L,HZ[;HTHRP͂c͂^^^IV[HU`OVUKHJVUa E510208

UK & Europe

Collect 1,000 Fly Buys bonus points when you book your UK or Europe holiday for 2 with United Travel (including return flights & accommodation, cruise or tour). 1000 Fly Buys bonus points: Valid on fully paid UK/Europe package bookings until 16 Dec 2013. Package must consist of 2 return airfares & a land booking for 2 people (accommodation, tour or cruise). Valid on new bookings purchased in store & is not available online. Points will be allocated approximately 6 weeks after the promotion end date. Points can’t be split between members & will be processed on to one Fly Buys card. Fly Buys standard terms & conditions apply & can be viewed at www.flybuys.co.nz. UT1725

United Travel Manukau 652 Great South Rd (Countdown bldg) 25

E512020-v5

eastlife | december 2013 |


eastlife | travel

Sail away on a cruise holiday Local specialists from Cruiseabout Howick suggest how to make the most of cruising the world.

Cruising is one of the most popular and most relaxing ways to travel – you only have to unpack once and each port comes to you while you sleep overnight. With all onboard accommodation, main meals and entertainment usually included, cruising is the ultimate in affordable luxury, making it very easy when planning for your next holiday. Fly and cruise options are a fantastic way to explore the world’s most picturesque and famous waterways such as the Caribbean, Mediterranean and Europe. It allows passengers to visit multiple destinations without having to spend long durations on a plane and living out of a suitcase.

From elegant superliners to small adventure ships, there is a cruise to suit all Kiwis, whether it is a three day local cruise or a round-the-world trip.”

From the remotely beautiful landscapes of Scandinavia, to the sunny shores of the Mediterranean, a cruise is the perfect way to experience the scenic and historic attractions of Europe.

local cruise or a round-the-world trip, the opportunities are almost endless.

The Mediterranean offers a unique combination of sun, sights and world class dining, combined with amazing beaches and a number of attractions.

To help with your cruise holiday, the team at Cruiseabout Howick have put together their top tips to ensure your holiday is plain sailing.

Discover the famous art and architecture in Barcelona, visit the birthplace of ancient gods in Greece including the perfect mix of history and modern design throughout Athens and experience World Heritage listed monuments in Italy.

What to take?

From elegant superliners to small adventure ships, there is a cruise to suit all Kiwis. Whether it is a three-day

Pack light to ensure you have space for souvenirs. Golden rule: pack what you think you need, then half it! Comfortable walking shoes are at the top of the list because you will literally step off the ship onto historical cobbled streets in the middle of European towns or villages for day excursions.

Your cabin With a range of activities onboard to excite all ages, you won’t be spending much time in your cabin!

urban sidewalks. Follow that up with a buffet breakfast and the day is off to a great start.

Elevator or not?

Check with your Cruiseabout Howick expert as to which cabin you would prefer, and which would be most suitable for your holiday needs.

Be sure to ask your consultant if the ship has elevators between decks as some ships don’t. Some require you to use stairs around the ship.

For a truly indulgent holiday, ask about ships that are built with private balconies and include a completely dedicated butler service!

Budgeting

The perfect way to get your day started

Remember that although cruises include all meals and activities, land stays do not. Be sure to budget a bit extra for the occasional lunch, dinner and shore excursion that isn’t included in the price.

Wake up with the sunrise, get up early and walk or jog around the ship. No matter where you are, the view is always breathtaking and looking at the wide, open sea definitely beats

To book your next cruise holiday, contact New Zealand’s dedicated cruise specialists at Cruiseabout Howick on 0800 224 694 or visit www.cruiseabout.co.nz

Cruiseabout Howick are celebrating! It’s our 1st birthday & the crew at Cruiseabout Howick would like to thank all our clients for their support & referrals over the last year. Receive ���*off any new cruise booking of � nights or more, when you book & deposit in December. Our birthday present, to you!

Cruiseabout Howick 16 Moore Street, Howick, Auckland

0800 224 694

www.cruiseabout.co.nz

E510116-V4

Wishi ng everyone a safe & happy holiday!

* Terms & Conditions: Offer is for $50 only & is only valid for redemption at Cruiseabout Howick. One voucher per person & must only be used once. To redeem this voucher you must book a new cruise with a minimum of 7 nights or more. Discount will be deducted from total cost of booking on full payment. Offer is valid for new bookings made before 31 Dec 13. Voucher must be presented at the time of booking. Discounts are non-transferable & not redeemable for foreign currency, cash or credit. FlightCentre (NZ) Limited trading as Cruiseabout. Full terms & conditions are available at www.cruiseabout.co.nz/termsandconditions in store for full terms & conditions. CAH1127815

26 | eastlife | december 2013

www.eastlife.co.nz


A Canadian summer

travel | eastlife

KIM HOUSTON – product director and tour host, World Journeys Don’t let images of snow-capped peaks fool you into thinking Canada is all about skiing and snowshoes; Canada is the best summer destination I know. Each July my family and I escape the New Zealand winter and head somewhere warm. This July we headed to Canada, and sunshine every day. Having enjoyed tours before, this time we hired a Jeep Cherokee in Vancouver and hit the open road. First stop, the mountain village of Whistler. We got our thrills on the spectacular Peak to Peak Gondola, and then, on the Blackcomb Mountain chairlift watching Mama Bear and her cubs casually strolling beneath us. Given that the wildest thing our daughters had ever experienced back home was a weta, the day was declared a huge success! Across to Vancouver Island by carferry, we headed up to Campbell River, and a boat ride to the stunning Sonora Resort, tucked away in the wilderness of Sonora Island. Wow.

tasted fresh like that! A great day ended with the parents in the spa and the kids in the movie theatre, complete with popcorn machine. The next day’s wildlife count included another black bear, as well as sea lions, bald eagles, and a young deer hanging around our lodge room!

Beautiful rooms, delicious meals, all wines, snacks and amazingly, phone calls to anywhere in the world, are included! Much as the intention was to lounge about in luxury, I couldn’t help partaking in a spot of tennis while my husband and the 12 year old headed out fishing.

As if all that wildlife wasn’t enough, we had a visit from a racoon in the middle of the night at our next stop, the West Coast Wilderness Lodge. Fresh water lake swimming, canoeing, and beautiful food completed the picture.

Spotting an Orca was as much a highlight as the salmon they caught – cooked for us that night in the resort’s restaurant. You’ve never

Stopping briefly for a spot of shoe shopping in Vancouver, it was on to Alberta. Travelling at our own pace, we stopped in at my favourite

mountain town of Banff, stunning Moraine Lake and took a short hike to the teahouse at Lake Louise. The Icefields Parkway is the main road through this region, which offers the chance to get up close to and even walk on the Columbia Icefield.

Lake Guest Ranch, promptly declared ‘the best’ by our horse-mad 12 year old. ‘Glamping’ in beautiful canvas tents, horse riding, hearty meals, outdoor activities and wonderful hospitality make this ranch-stay perfect for families.

More ‘wow’ moments were had at the Fairmont Jasper Park Lodge, set on a beautiful lake where elk roamed freely around the property as if they owned it. And yet more at Siwash

The Okanagan Wine Country offered a taste of the local wines, and then suddenly it was all over – 3000 kilometres, one map, and countless memories.

Breathtaking Canada small group hosted journey, 20 June 2014

Vancouver, Whistler, Rocky Mountaineer & the Calgary Stampede! 24 days from $14,230 pp (twin) including ights Guaranteed to go fully escorted from NZ. Airline taxes additional. Contact your Travel Agent, or World Journeys

Call now (09) 360 7311

T. 0800 117311 E. info@worldjourneys.co.nz www.worldjourneys.co.nz 231 Ponsonby Road, Ponsonby, Auckland E513097-v4

www.eastlife.co.nz

eastlife | december 2013 |

27


eastlife | lifestyle

Homebuyers find it all and more at Orewaâ&#x20AC;&#x2122;s

Kensington Park The Kensington Park neighbourhood is finding favour with homeowners, who are increasingly being attracted to the quality homes, maintenancefree, fully landscaped reserves, leisure facilities and vibrant Kensington community. Superbly finished with a high quality fit out, homes at Kensington Park combine elegantly designed interiors, good sized balconies, internal lifts and lockable basement parking to create a first class, easy-care home and lifestyle within this Orewa neighbourhood. With facilities including a gymnasium, heated pool, sauna, and garden allotments available for use to all neighbourhood residents and with streets and reserves maintained to the highest of standards, residents could be forgiven for

thinking they are living in a resort. Instead, they are homeowners in one of New Zealandâ&#x20AC;&#x2122;s most liveable and award-winning developments offering unbeatable location, facilities and lifestyle. Kensington Parkâ&#x20AC;&#x2122;s project manager, Dan Ogle says Kensington Park is unique within New Zealand, being a great example of higher density living in an immensely desirable environment. â&#x20AC;&#x153;While we pay great attention to complimentary architecture, colours and design, what we are really building and offering is a great community. Much of our design is directed to create great streetscapes, community gathering spaces and establishing events so that neighbours can easily become friends.â&#x20AC;?

Michael Holdsworth, a resident of three years is truly delighted, saying, â&#x20AC;&#x153;moving into Kensington Park was the best decision Iâ&#x20AC;&#x2122;ve ever made. The past three years have been the best three years of my life.â&#x20AC;?

This popular neighbourhood has garnered international recognition, winning International Property Awards, as well as an award for best NZ Urban Land Development 2012 with the NZ Property Council.

Kensington Park features a range of homes to suit everyone, from three and four-bedroom freehold houses with private gardens through to quality one, two and three-bedroom freehold apartments.

For originality, quality and style, this superb development is certainly worth viewing when considering your next move. You too could enjoy a genuine community lifestyle in a friendly neighbourhood, just 35 minutes north of the Auckland CBD.

The homes carry a 10-year structural and leak-proof guarantee and are equipped with the latest fibre-optic cabling, which delivers telephone, television and internet services.

Open to view 10am to 4pm daily with late nights to 7pm on Tuesday and Thursday or call 0800 57 67 392 for an appointment to view.

Spacious 2 Bdm homes from $689,000

More than a home, itâ&#x20AC;&#x2122;s a great lifestyle superbly located in Orewa beach

â&#x20AC;&#x2DC;Where Neighbours become Friendsâ&#x20AC;&#x2122;

6KRZ+RPHV2SHQGDLO\DPWRSP Late nights Tues and Thurs to 7pm 28 | eastlife | december 2013 3DUNVLGH'U.HQVLQJWRQ3DUN25(:$ www.kensingtonpark.co.nz

Garden Point Apartments

These two bedroom freehold apartments come with spacious decks and basement SDUNLQJLQWHUQDOOLIWVDQGTXDOLW\ÂżWWLQJV7KLVLVDJUHDWRSSRUWXQLW\WRSXUFKDVHD EUDQGQHZIUHHKROGKRPHZLWKLQVRXJKWDIWHU.HQVLQJWRQ3DUN2IIHULQJVXSHULRU design, elegantly appointed interiors with privacy, these homes provide the premium HDV\FDUHOLIHVW\OH Come and enjoy a JHQXLQHFRPPXQLW\OLIHVW\OHLQDIULHQGO\QHLJKERXUKRRG .HQVLQJWRQ3DUNLVVXSHUEO\ORFDWHGFORVHWR2UHZDÂśVEHDXWLIXOEHDFKVKRSSLQJ FHQWUHDQGIDEXORXVEXVKZDONV\HWMXVWPLQVQRUWKRIWKH$XFNODQG&%' 116m2 to 137m2 EDVHPHQWFDUSDUNV )UHHKROGWLWOHVJLYHSHDFHRIPLQGDQGLQYHVWPHQWDGYDQWDJH Priced from $689,000 to $790,000

ENQUIRE NOW! Call 0800 57 67 392 or Come to Orewa today

www.eastlife.co.nz E510179-v2

$57,67,035(66,21


leisure | eastlife

Game plan

While it may seem like child’s play, it takes gumption to get ‘on board’ with a new business venture, as JON RAWLINSON discovered. Some say ‘those who can, do; those who can’t, teach.’ However, as Mark Snoad – creator of Gumption, a board game designed to promote financial literacy – explains, the best educators also practice what they teach! “Hands-on, real world examples are so important when it comes to developing minds,” says the Ormiston Senior College business studies teacher. “A while back I read that mobile phone bills were sending teenagers bankrupt. That scared me. If they struggle to pay mobile bills, what does that mean when taking on loans down the track?” He says when playing Gumption students become engaged in a fun activity that makes learning about money meaningful and real. Similar to Monopoly, Gumption players negotiate their way around a board,

succeeding through sound business sense. However, there are some ‘Mark-ed’ distinctions. “For example, players need to be careful with spending; they have to trade their way out of trouble. Also, there’s no mysterious organisation giving handouts every time you pass ‘Go’, people actually have to earn their money!” By developing Gumption, Mark says his teaching has improved and students learn that a good idea only carries so far. “Students often think they’re successful when they come up with an idea, but that’s just the start. Producing is much harder, and the toughest of all is marketing and selling that product. “Bringing Gumption to market has been a long process, but it’s been invaluable to my understanding of business practice and I often draw ADVERTISEMENT ADVERTISEMENT ADVERTISEMENT

WIN! GUMPTION – EastLife has FIVE Gumption board games to give away. To be in to win, simply visit the competitions page at www.eastlife.co.nz and complete the form. One entry per person / email address; entries close January 31, 2014.

lessons for students from the game.” He says younger children can also play and learn the value of a buck. “My intention was for Gumption to be for secondary school students, but I played it with my daughters and my youngest kept beating me.” Launched in 2010, Gumption secured the Game of the Year and Teachers’

Choice Awards from the NZ Games Association last year, and sales have been positive, a notable achievement in an age of computer games. “When people play board games, they interact face to face, which would be lost with an online version,” Mark says. “Lots of people create board games, but 80 percent sell less than 300. However, Gumption’s now on its second production run and has sold more than 2000.” And the game may go global. It made its first foray into the Australian market at Brisbane Girls Grammar. “The students here are amongst my biggest supporters, though. Some are happy to help promote and sell it, and one student, from India, has even said he’s going to help create an Indian version of Gumption!”

ADVERTISEMENT ADVERTISEMENT

WHY WHY MOBILE MOBILE WHY W EE THAT COMES TO YOU! SELF-STORAGE? WHY MOBILE SELFSTORAGE THAT COMES TO YOU! THAT COMES TO YOU! SELF-STORAGE? STORAGE THAT COMES TO YOU! SE 5 smart reasons to send your WHY MOBILE ADVERTISEMENT

ADVERTISEMENT

5 smart reasons to your Spring is the natural time to ORAGE THAT COMES TO YOU! SELF-STORAGE? 5 smart reasonswith to send send your 5 smart5re Spring is the natural time to Spring is the natural time to clutter packing Smartbox sm clutter packing with Smartbox Spring is the natural time to clutter pac give your home a makeover 5 smart reasons to send your clutter packing with Smartbox Spring is the natural time home toSELF-STORAGE? MES YOU! give your a makeoverclutter packing with Smartbox clu giveTO your home a makeover give your home a makeover ,W¶VFRQYHQLHQWăSmartbox ,W¶VFRQYHQLHQWăSmartbox deliver deliver the the storage storage unit unit

,W¶VFRQYHQLHQWăSmartbox unit ,W¶VFRQYHQLHQWăS to to and no to your your door, door, so so no no vehicles vehicles deliver to hire hire the andstorage no double double give your home a makeover to your door,,W¶VFR so no to your door, soyour no vehicles to hiredeliver and no handling. 5 smart reasons to send ,W¶VFRQYHQLHQWăSmartbox thedouble storage unit Summer is the natural time to give handling.

e natural time to ome a makeover

handling.

handling.

yourself, or the Smartbox team can do it for you.

Sm you get team 24 hours pack your unit yourself, or the ,W¶VFRQYHQLHQWăSmartbox deliver the ,W¶VHDV\ă storage unit yourself, or the Smartbox cantodo it for you. ,W¶VHD ,W¶VELJă yourself, each container can the contents of a each container can store store thecan contents ofyou. a or the Smartbox team do it for to your door, so no vehicles to,W¶VELJă hire and no double con yours ,W¶VELJă container can store the contents of a ,W¶VELJă each typical bedroom home. typical 1-2 1-2each bedroom home. each container can store the contents of a handling. typical 1-2 bedroo typical 1-2,W¶VELJă bedroom home. ,W¶VEL ,W¶VVHFXUHă you hold the padlock key and the typical bedroom home. key and the ,W¶VVHFXUHă you1-2 hold the padlock ,W¶VHDV\ă you get 24 hours to,W¶VVHFXUHă pack your unit ,W¶VVHFXUHă typica you h you the key and the storage is under 24padlock hour security. storage facility facility is hold under hour ,W¶VVHFXUHă you24 hold the security. padlock key and the storage facility is u yourself, or the Smartbox teamstorage can dofacility it for isyou. under 24 hour security. storage facility is under 24 hour security. ,W¶VDIIRUGDEOHă storage from just just $4.00 a day day and and ,W¶VVH ,W¶VDIIRUGDEOHă storage from $4.00 a ,W¶VDIIRUGDEOHă ,W¶VDIIRUGDEOHă from just $4.00 a dayaand ,W¶VELJă each container can store the ,W¶VDIIRUGDEOHă contents a storage free access 7 a storas from just $4.00 day and free onsite onsite accessstorage 7ofdays days a week. week. free onsite access access days a7 days week.a week. typical 1-2 bedroom home. free onsite free onsite7access ,W¶VDI ,W¶VVHFXUHă you hold the padlock key and the free o storage facility is under 24 hour security.

,W¶VDIIRUGDEOHă storage from just $4.00 a day and free onsite access 7 days a week.

Follow your head, not your heart

Hit the refresh button SPECIAL OFFER our head,Follow your SPECIAL OFFER - - - SPECIAL Time to get the family- on Clutter can quicklyhead, take over SPECIAL OFFER Hit the refresh button Information & Information OFFER -& Bookings: Hit the refresh button the refresh button Information SPECIAL OFFER - get heart Hit Information & Bookings: Bookings: board forHit a-space-enhancing Book NOW to when we get attached to items, the refresh button your heart Hitnot the refresh button Information &800 Bookings: Call 1300 880 or Call 0800 22 55 76 cleanout. You could also Call 1300 880 800 or visit or let things pile up without a Book NoW to get your fourth Call 1300 880 800 or visit visit n we Time to get the family on board for a Book NoW to get your fourth we the your Time get the family for a NoW to get your fourth month Follow head, your fourth nckly wetake over Timewhen to get familyto on board for aon boardBook Call 1300 880 800 or visit Book NoW to get your fourth transform that under-used Clutter can quickly take over when we Time to get the family on board for a proper storage plan of attack. Book NoW to get your fourth www.smartbox2u.com.au www.smartbox2u.com.au nitems, we Time to get the family on board for a e up up or let space-enhancing space-enhancing cleanout. You could could also You could www.smartbox.co.nz things pile up space-enhancing cleanout. also www.smartbox2u.com.au SPECIAL OFFER e cleanout. You also month storage month storage storage month storage get to items, orYou let things pile up space-enhancing cleanout. You could also an office, rumpus Ifattached you have belongings you www.smartbox2u.com.au Hit the refresh button rck. plan ofnot attack. Ifyour transform that under-used roominto into an estorage upIfIf space-enhancing cleanout. could ck. transform that under-used room intoalso anroom heart month storage transform that under-used room into an month storage without proper storage If transform under-used room into an room, home gym,thathobby don’ta use often, but plan wantoftoattack.

FREE! FREE! FREE!

- SPECIAL OFFER -

Book NoW to get your fourth

Book NoW to get your fourth month storage

FREE!

but want to keep and be able to get at, space, or another bedroomwww.smartbox2u.com.au for a fast You could also storage Offer ends Friday 28 February, 2014 Smartboxmonth mobile self-storage is an easy sprouting child or your holiday season room intowww.eastlife.co.nz an eastlife | december 2013 | Quote promo code BW4FREE when making your booking and secure option. guests. me gym, hobby om for a fast Offer ends Friday 28 February, 2014 day season

FREE!

Inf Call www

FREE!

gings use often, office, rumpus room, home ck. If you don’t transform that under-used an gym, hobby often, office, room, gym, hobby often, office, rumpus rumpus room, home homeroom gym,into hobby Clutter can quickly take overuse when we Time tobedroom getroom, the home family gym, on board ep and be able to get at,another space, or another bedroom for or aoffice, fast you have belongings you don’t often, rumpus hobby for a space, another keep and bebedroom able to get at, often, office, rumpus room, home gym, hobby et space, or for a fast Offer ends Friday, February 28, 2014 ete at, at, space, or another bedroom for a fast Offer ends February, 2014 self-storage is get an Smartbox easy sprouting child or things your but want to keep andself-storage be able getpile at, season or another bedroom aFriday fast28 for a fastspace, sprouting child orends Offer Friday February, 2014 mobile attached to items, orseason let up space-enhancing cleanout. You could also et at, space, or another bedroom for ato holiday fast easy sprouting child or your holiday Quote promo code EL4FREE Offer ends Friday 28 28for February, 2014 easy sprouting child or your holiday season Information Quote promo code BW4FREE when making your booking & Bookings: on. guests. Offer ends Friday 28 February, 2014 Offer ends Friday 28 February, 2014 Smartbox mobile self-storage is an easy sprouting child or your holiday season your holiday season guests. is an easy and secure option. when booking Quote promo code BW4FREE when making your booking without a proper storage plan of attack. If transform that under-used room into an easy sprouting guests. child or your holiday season Quote promo code BW4FREE when making your booking guests. Quote promo code BW4FREE and have securebelongings option. guests. Call 1300 880 800 or visitwhen making your booking promo BW4FREEroom, when making booking you don’t use often,Quote office,code rumpus homeyour gym, hobby n board guests. for you a

button

to yo

toyou your door, so no vehicles to hire and no double ,W¶VHDV\ă clutter packing with Smartbox ,W¶VHDV\ă you get get 24 24 hours hours to to pack pack your your unit unit your home a makeover handling. hand ,W¶VHDV\ă you get ,W¶VHDV\ă 24 hours to pack your unityou. yourself, oryou theget Smartbox team can do it for

E512091

29


travel | eastlife

LOOK @ ME

Hair Studio

Country style urban pizzazz Often considered the cream of the crop when it comes to country living, Whitford offers a little bit of rural relaxation just a 10-minute drive from suburban Howick – it is the first stop on the Pacific Coast Highway. Of course, Whitford Village is the hub of this rural district and attracts shoppers not only from the local area but from further afield.

Specialising in fine hair Expert colourist Unisex Discount for gold card

Ph Charlotte 530 8939

730 Wharf Rd, Whitford

Encompassing a range of shops and services including gorgeous gift shop No 5 Design with its many ideas for Christmas pressies, Look at Me Hair for cut, style, colour and all your hair care needs, Whitford Village Barn, a unique blend of decorated accessories, original art and local gourmet products and Prenzel of Whitford specialising in quality liqueurs, spirits and gourmet

condiments, sauces and vinaigrettes. In addition there are restaurants and cafes for various dining styles, a superette, service station, real estate office and more.

Resort and Pine Harbour Marina with a ferry service to the city, regular market day, pubs and restaurant.

Close to many recreational activities, the nearby Whitford Country Club is an established and picturesque golf course with a swimming pool and other family facilities while the Whitford Pony Club is just a few hundred metres from the village – this is serious horse country! The village is on the picturesque Pohutukawa Coast route to Beachlands and Maraetai then on to Clevedon and beyond. It is also the gateway to such attractions as one of New Zealand’s best known private gardens, Ayrlies, open to the public on special occasions; Formosa Golf

Named after Richard Whitford, who operated a flax mill in the area, many people believe Whitford referred to the White Ford, which bridged Turanga Creek at the end of Sandstone Rd. The first European settlers were George and William Trice who started farming in Clifton Rd in 1843. However, most settlers began arriving around the mid 1850s. Over the decades, industries have included ostrich farming, quarrying, a brickworks, timber mill and more. Today the village is a meld of old world charm and contemporary retail – a place serving local residents and visitors alike.

E512094

DESIGN STORE Smart Gifts & Gorgeous Things

Citta - Maytime - French Country C.C. Interiors Saben - Mooi & Hermes Bags - Scarves

The Village Barn Whitford is an exciting new destination point for locals and visitors alike, providing a unique blending of high quality decorator accessories and original art with local gourmet foods. You will fall in love with the variety and the tastes of our al fresco style food selection, at the same time being able to look for that special indulgence for the home or yourself.

WHITFORD VILLAGE Ph 530-9333. OPEN 7 DAYS Late night Tuesday until 7pm

E512074-v2

Jewellery, Clothing, Body Products, Gifts for Him & Baby

Established 2004 and still going strong! ✶ A fun shopping experience ✶ For all your Christmas gift needs ✶ Tastings and treats ✶ NZ made www.theprenzelshop.co.nz Open 7 days 10am-5pm E510188

E512075

30 | eastlife | december 2013

www.eastlife.co.nz


christmas gifts | eastlife

IMPORTERS SHOE SALE

New range of French country furniture and stunning home decorations

Importers of quality footwear from Brazil, Italy & China

OPEN THROUGH XMAS & NEW YEAR

138H Harris Road, East Tamaki Phone 09 215 7587 9.30am-5.30pm Monday-Friday 9.30am-4.30pm Saturday & Sunday

49a Springs Road, East Tamaki • Phone 274 7661 Monday-Friday 8am-5pm, Saturday 9am-2pm

www.homescene.co.nz

E512100

E512085

HR O P EN T

OUGH XMAS & NEW YEA R

Christmas Giſt Guide 77 Broadway | Newmarket E510175-v2

Christmas at your feet! Homeware | Furniture Christmas Trees

E512072

Thurs/Fri 10am-3pm & Thurs/Fri 10am-3pm & Sat 10am-2pm Thurs/Fri 10am-3pm & & Thurs/Fri 10am-3pm Sat by 10am-2pm (or appointment) SatSat 10am-2pm 10am-2pm (or by appointment) (or(or by by appointment) appointment)

Ph: 09 580 0290 Ph: 09Marua 580 0290 185B Road Ph:Ph: 0909 580 0290 580 0290 185B Marua Road Ellerslie 185B Marua Road 185B Marua Road Ellerslie (down drive after Ellerslie Ellerslie (down drive after Alertdrive Locksmiths) (down after (down drive after Alert Locksmiths) Alert Locksmiths) Alert Locksmiths)

www.frenchlabelle.co.nz www.frenchlabelle.co.nz www.frenchlabelle.co.nz www.frenchlabelle.co.nz

E512076-v2

E5102078

www.eastlife.co.nz

eastlife | december 2013 |

31


eastlife | christmas essentials

Essentials

SOPHISTICATED TIMEPIECE Inspired by his father who worked 42 years as a watchmaker Tommy Hilfiger was driven to design his own watch collection. With extraordinary fashion instincts his goal was to offer the precise, reliable performance of a quality timepiece as well as the classic style for which he is so well known. Meticulously designed to complement the Tommy Hilfiger brand the watches combine exceptional value, cool, classic, sophistication with quality craftsmanship. Tommy Hilfiger watches are sold exclusively at NZ Jewellers; Botany Town Centre & Sylvia Park. Ph 277 7746. www.nzjewellers.co.nz.

FISSLER ORIGINAL PRO COLLECTION – THE ULTIMATE COOKWARE! Founded in 1846, German cookware company Fissler are regarded by chefs and foodies alike as the best in the world. The Original Pro Collection has been developed by professionals and proves itself with its uncompromising quality, attractive design, superior and innovative functions, and universal use. For the best selection of dinnerware, glassware, linen, kitchenware & cookware, gifts and NZ’s largest range of quality cutlery (stainless and silver). The Studio of Tableware, 5 Harold St, Mt Eden. Ph 638 8082. www.thestudio.co.nz

STERLING GIFT FOR CHRISTMAS Lindi Kingi’s collections are born of a love for the eclectic, the exotic and the precious. Lindi’s fans have asked time and again for a precious metal version of her designs. In collaboration with New Zealand Mint Jewellery, the first Lindi Kingi Deluxe collection named, The Archetype, was born. Featuring a selection of sterling silver pieces, Lindi Kingi Deluxe is the perfect gift for the fashion-conscious this Christmas. Available locally at Walker and Hall, Botany and Manukau stores or www.nzmintjewellery.com

BEEFEATER BUGG The amazing BUGG picks up where other BBQ’s leave off. It’s compact and portable exterior houses a sizable cooking area. It’s big on technology and engineering with a host of advanced features specially adapted for today’s lifestyle. Cook with the hood up, for crispier grilling and searing, or hood down for roasts. Say hello to the amazing BUGG. It’s the world’s most brilliant BBQ yet. Designed and built by BeefEater, BUGG is the culmination of more than 25 years’ experience in the development of innovative BBQs that truly enhance the way we live. www.beefeater.co.nz

ULTIMATE GESTURE OF ROMANCE Using the time-honoured symbol of eternity – the ring – sculpted from precious metals, delicately etched and set with brilliant custom-selected gemstones, Meadowlark’s RITUAL collection represents the dark beauty of ceremony and celebration. Following ancient forms but crafted with contemporary vision, RITUAL is the ultimate gesture of true romance. Meadowlark Mini Protea Ring, sterling silver $319, 9ct solid gold $719. Available at Walker & Hall Botany, Botany Town Centre. Ph 271 0390. Walker & Hall Manukau, Westfield Manukau, Ph 262 3433. www.walkerandhall.co.nz

32 | eastlife | december 2013

LOVENEST – HANDCRAFTED IN HOWICK! Fancy giving something unique, original and handmade this Christmas? Check out the ‘LOVENEST’ Home & Living Range at www.love-nest.co.nz to view individually handcrafted blackboards, cushions, Christmas decorations and more or visit our Howick showroom. This Rustic Frame made with recycled wood is a gift with a difference, perfect to give these holidays filling your home with an uplifting message. RRP $89. Enter coupon code ‘C6BDA70’ to get 15% off on our website! Lovenest, 68 Rodney St, Howick. Ph 021 02644 252. www.love-nest.co.nz www.eastlife.co.nz


christmas essentials | eastlife

Make Christmas shopping easy on yourself – EastLife’s range of stunning festive Essentials takes the hard yards out of finding those special gifts for people you love. Check out our suggestions and wrap up your gift buying in no time at all!

ROBERTO CAVALLI

all the better to see you with...

A fresh injection of Roberto Cavalli for Mirabello Carrara towels are now available at Corso de’ Fiori. Combining Mirabello’s experience and style with Cavalli’s luxurious creativity, this indulgent collection in must-have prints and graphics will add that wow factor to any bathroom or poolside. $129 each. Corso de’ Fiori, The Foundation, 8 George St, Newmarket. Ph 307 9166. www.corso.co.nz

Protecting one of your most valuable assets and looking fashionable is not as hard as you think. At Howick Village Optometrists our trained staff are here to advise you on the right fit and style to suit you whether you need prescription lenses or not. See in store for our pre xmas specials. Howick Village Optometrists, 94 Picton St, Howick. Ph 534 8716. www.howickoptometrists.co.nz

from paris with love

Stihl grillin’ A steak’s a steak right? Wrong. Cooking on a Weber Q will transform old favourites into mouth-watering masterpieces. You’d be hard pressed to find a steak as juicy and flavoursome as those produced on your own Q. Even first time users will be applauded because, by following the directions, we know you’ll produce perfect results every time. View the full Weber BBQ range at STIHL SHOP™ Botany, East Auckland’s only Weber Specialist retailer. Q100E Specialist model shown RRP $449 from www.stihlshopbotany.co.nz

Get a little piece of Paris in Botany with the Eiffel Tower and postcard pendant from French jewellery brand AGATHA Paris, available right now for Christmas at Walker & Hall. The AGATHA Paris collection stirs up the love and romance that is... PARIS! Created in AGATHA Paris’ original ‘lifelong’ material – stainless steel, in shades of silver and rose gold, perfect to match your style and skin tone. Take the love and romance of Paris everywhere, with AGATHA Paris. $166. Available at Walker & Hall Botany, Botany Town Centre. Ph 271 0390. www.walkerandhall.co.nz

Time is ticking! gaia day spa welcome gift A Gaia Day Spa voucher is the ideal gift for the person who has “everything”… fabulous location by the marina, a balcony with a view to relax on after treatment, unique double treatment room….who said the gift had to be for just one? We are excited about our new menu with treatments for every taste and budget. Give us a call to arrange for a voucher or simply pop in! Gaia Day Spa, Level 1, Compass Complex, Half Moon Bay Marina. Ph 534 3390 www.eastlife.co.nz

Grandfather clocks are more than timepieces – they are a stunning centrepiece designed to give presence and character to a room. This Howard C Miller grandfather clock priced at $6,600 including delivery exudes the company’s reputation for incomparable workmanship and unsurpassed quality – its sleek, urban design making it an easy fit with modern home elegance. At Jeff Honeybun Jewellers we sell and service grandfather clocks, wall clocks, mantle clocks and cuckoo clocks. We currently have eight grandfather clocks in stock, both new and used. We also stock Tissot, Seiko, Daniel Wellington, Olympic, Obaku, Boccia and Astina watches. Available at Jeff Honeybun Jewellers, 5 Moore St, Howick. Ph 534 8773. honeybun@xtra.co.nz

eastlife | december 2013 |

33


, h t l a e H beauty

&FASHION

Tis the season to socialise Summer days, festive nights, Boxing Bay/New Years merriment all shout glad rags of the exceptional kind. For those needing several outfits to take them through summer socialising, FashionNZ editor, PETRINA WILSON, provides a few hints how to make the most of one fabulous dress. It’s racing season. Oh, and, yes, it’s also wedding season and, of course, it’s the festive season too, which means there’s every chance of attending functions to celebrate at least one or, perhaps, all of these special events.

or ensemble (an old-fashioned word but today just think ‘layering’ although it once meant two-piece suit or dress and jacket). This will allow you to dress your look up or down depending on the type of event you are attending.

And what’s that I hear you say? Don’t tell me; you’re throwing up your hands in despair and beseeching the fashion gods with, “what do I wear?”

Add a fascinator for the races or drape a glittering scarf over your shoulders for a church wedding to achieve two completely different looks with one dress. It’s amazing how the right accessories can completely alter an outfit. Belts, brooches or a snazzy pair of tights can take the eye in all directions. Swap an elegant but dainty leather handbag for a glitzy clutch and you’ll turn your day outfit to evening glam.

Well, here are a few tips to help raise the fashion stakes for all those gorgeous summer occasions and, hopefully, save you some time and money in the process. Firstly, colour is your friend so don’t be afraid of it. A dash of colour can help you make a fabulous statement. If you naturally sway toward more muted tones, then introduce colour through your accessories – jewellery shoes and, bags....did I mention shoes? Mmmh, some winning options in that quarter this year. Styling outfits together is not only tricky, but can be expensive. If you can’t afford to buy a new dress for every event then it’s time to get creative! Opt for one elegant frock

Don’t forget hair, makeup and grooming are the other vital pieces of the puzzle. A gorgeous designer dress can be ruined if the wearer has lank hair, unkempt nails or scuffed shoes. And please, not a safety pin in sight! It’s important to book those all important appointments early – hair, nails, wax, eyebrow shape and tint. Wearing hair up or down, can also result in a totally different image, so

give some thought to the final effect for the event in question and be sure to dress for the occasion. The season’s festivities can bring out the

best in you! Last but not least, don’t forget to enjoy yourself. When putting so much effort into an outfit it would be a shame not to!

S173 Pakuranga Plaza 576 3818, Meadowbank Shopping Centre 521 6188 34 | eastlife | december 2013

E510171-v2

GO BRIGHT This Christmas with Kagi www.eastlife.co.nz


fashion | eastlife

Step in to summer

beauty | eastlife Summer 2013

The temperature is rising so itâ&#x20AC;&#x2122;s the perfect time to free those feet, with a pair of this seasonâ&#x20AC;&#x2122;s hottest sandals. Check out our summer lust list...

Diana Ferrari Zelma Orange $139.99 from Farmers

Izona Blue Green Thick Stripe Polo Shirt, Izona Thin Stripe Demin Jeans, Muski Boat Shoes $160

Marigold Sandals $39-99 from Number One Shoes Keagan $210 from Mi-Piaci

Ragdoll $129.90 from Overland

Jelly Sandal $29.95 from Hannahs

Pulp Glitterbug $49.95 from Hannahs

Cover Heel Sandal $89 from Max www.eastlife.co.nz

eastlife | december 2013 |

munns.co.nz

35 E510014-v3


eastlife | fashion

Stunning dresses for Christmas celebrations and family BBQ’s

Style radar

Repertoire’s Style Director, Meghan Maher, tells EastLife about the one piece which women should absolutely have in their wardrobe this winter.

Designer clothing & accessories Gift vouchers available OBI • PAULA RYAN • DAVID POND • SILLS REDHEAD • LOOBIE’S STORY • ARTSTYLE • LOUCHE

Open Mon-Fri 9.30am-5pm, Sat 10am-4pm

114 Main Highway, Ellerslie.

Ph 579 3535 E510144-v3

Covertogs are a new and different brand of two piece tankini swimwear for women who want a bit more cover. Your covertogs will help to keep you active and out there

More cover...More confidence 100% NZ designed, made and delivered Check out our range of designs and styles to fit all by visiting our website

www.covertogs.co.nz

Q:

I have to change my clothes a few times every day. It’s so frustrating and time-consuming. Do you have any suggestions on how to dress for my busy lifestyle?

morning. Don’t forget to include your shoes and accessories

A:

• Arrange your clothing in your wardrobe as complete outfits so you are always clear what goes together

• Plan your outfits the night before and lay them out ready for the

• Invest in very good layering basics. A classic black slim leg layering pant and longer layering top can work as a blank canvas and underpin any outfit. A long necklace and a crop jacket are key items to complete any look. If you are desperate, and have nothing else, this combination is always classic, timeless and appropriate for most situations.

The only way around this is with very good planning. There is no easy quick fix but you will get better with time. There are lots of different techniques; it’s about finding the one that works best for you. Here are some that I have heard of and recommended to some of my clients:

E510168

email: info@covertogs.co.nz | phone: (09) 533 8441

Monaco Dream Sail in to the party season

News – in briefs Ladies have spoken! Real men box clever, according to a recent survey of 1,000 Kiwis commissioned by Stubbies. While 47 percent of men believe fitted briefs are most manly, over half of women surveyed (52%) picked cotton boxers as best. Twenty-eight percent of blokes backed Y-fronts, while just 12 percent were smooth for silk.

In addition, the survey found, while 20 percent of women believed men opening the door for them is characteristic of a real man, blokes viewed that as the least manly, preferring instead to stand up for their mates and spend time in their sheds; no surprises there!

And it seems those men flashin’ the fashion this summer should put their best leg forward as women were also predisposed to those who wear short shorts!

E510058-v2

36 | eastlife | december 2013

Almost half said they would like to see more leg, with 48 percent of 18-24-year-olds and 51 percent of ladies aged 55-64 keeping an eye on the thighs. www.eastlife.co.nz


beauty | eastlife

In the swim with Nancy Chateau:

If looking like a total glamazon is the aim this summer then a chic, new swimwear range from Nancy Ganz is feminine, flattering and slimming too!

With a name like Chateau, this swimsuit is sure to prompt dreams of long days on the French Rivieria! This season’s new ‘must-have’, the Chateau swimsuit features cross-over gathered panels in the front and a powerful base fabric underneath for extra hold and control. Beautifully pleated wide straps and soft foam cups provide both comfort and support. The tummytucker is Nancy’s new best friend! Available in Paradise Rouge, Deep Sea and Black. RRP $169.95; Sizes 10-18

Plunge into the warm weather with a collection of shaping swimsuits to ensure a svelte and stylish look throughout those long, balmy days.

“It is also worth investing in a quality piece that uses chlorine-resistant fabric that won’t fade after only a handful of dips in the pool.”

“Women with smaller busts should try gathered or ruched swimsuits to make the bust appear fuller while darker colours are a great option to minimise the appearance of larger hips and bottoms,” she says.

Chic Control: Ooze total chic on your summer island escape in this Nancy favourite. The No.1 selling Chic Control swimsuit has soft

gathering with powerful base fabric underneath to pull those troublesome areas into line. It offers firm control with maximum comfort and style. Known as the Boobalifterer, the Chic Control will be on Nancy’s high rotation list this summer! Available in Deep Sea, Sparkling Grape, Black and this season’s signature print, St Barths. RRP $169.95; Sizes 10-18

................

.................................... ....... .......... ....... ...... . . . . . . ..... . . . . . ..... . . . . .... .... . .... . . . ...

...

..

Christmas

Every purchase made before Christmas puts you in the draw to win 1 of 300 copies of Dr Libby’s new book: Beauty from the Inside Out

120mins

$159*

Plus spend over $150 and receive a Murad skincare gift*

.................................. . . . . . . . ......... . ....... ....... ..... ...... ... . . ..... . . .... ..... .... .... .. ....

Cocoon Heavenly Body • 30 mins Body Scrub • 60 mins Aromatherapy Massage • 30 mins Facial *Valid until January 31, 2014

www.eastlife.co.nz

Caci

.....

Caci Pakuranga, Shop 446 Warehouse Plaza

0800 458 458 | caci.co.nz *One gift per $150 transaction. Offer excludes programs. While stocks last. E122204-v6

eastlife | december 2013 |

E510013-v6

E510207

535 9554 salon@terraceshair.co.nz

2 CONVENIENT LOCATIONS: 180 Pakuranga Rd, Pakuranga. Ph: 577 2998. 2/166 Chapel Rd, Botany South. Ph: 274 9489. www.thaispa.co.nz

.... .

We wish you a

1/10 The Terraces | 24 Wellington St | Howick

..............................

......................... ...... ....... ........ ........ ...... . . . . . ..... ..... . ..... . . . . . ..... . . . . . .... . .. ... ...

........................................ ......... ....... ....... ...... ...... . . . . . ..... ..... ..... .... .... ... ....

so we have GREAT people & GREAT products

..........

. ........... ........ . .................. ... .. ........... ......... ......

GREAT GREAT

This cleverly designed 2-in-1 is about looking sassy and slim by the pool. A versatile mini dress or coveruperer gathers up at the sides to reveal a chic all in one swimsuit underneath. Alternatively, team it with a sarong or kaftan, or hitch it up and pare it back with some board shorts to give you plenty of options! Available in Black and this season’s new Geometric Print. RRP $199.95; Sizes 10-18

.... ...... .. ....

............. . ...

We want you to have hair that looks & feels

Christmas Special

Monaco Swim Dress:

Chateau

....

Nancy Ganz designer Janine Anggara says the important thing to remember when buying swimwear is to choose the right design for body shape.

Monaco

......... ...... ...

Chic Control

................................ ....

With its sleek, modern shapes and innovative design, Body Nancy Ganz Swimwear incorporates a high chlorine-resistant base fabric and secret shaping techniques to hold and control, making traditionally troublesome body zones a thing of the past!

37


eastlife | health & beauty

Who was Carey Reams

Having a bad skin day?

M

And Why Should You Care?

Come to About Skin and receive a FREE skin consultation to solve all your skin issues

CLIVE PLUCKNETT, Naturopath, P.G.Dip. Anti Aging Medicine, P.G.Dip. Cancer Nutrition, P.G.Dip. Mental Health Nutrition, MBA, BA, P.G.Dip Science

Make your loved one’s Christmas with a voucher from About Skin!

In every field of endeavour, there are a few individuals who stand above the rest. Their failure to accept the status quo and innovative and brilliant minds takes them leaps ahead of their colleagues.

Our services include Ipl/Laser, medical microdermabrasion, peels, medifacials, oxygen therapy, skin tightening, rejuvenation, skin needling, stamping, all injectables and more. Come to your one-stop appearance medicine shop

U U

Instead of celebrating their superior results, they are ridiculed and opposed by convention.

5 Reeves Rd, Pakuranga, East Auckland Phone 576 1550 info@aboutskin.co.nz www.aboutskin.co.nz

Such a man was Carey Reams, in the field of health and disease. Because of his commitment to help those in need, he was imprisoned five times and stripped of all his rights as a US citizen.

J 4 u’re sayin 0 ’t tried Je E122202-v6

carey reams

Reams was a brilliant scientist, biochemist and nutritionist, who was fascinated by the health of all living things. He figured that if he could scientifically establish what good health was, then any deviation would be ill health.

Have your dentures crafted by an award-winning Clinical Dental Technician with over 25 years experience.

As a result of these tests, he would determine the patient’s formulae and compare it with the ideal formulae. From this he would be able to develop a treatment plan to move the patient closer to the ideal wellness, using nutrients.

He reasoned that if the body could be brought back to a biological norm, then it could begin to generate energy to heal itself.

RIOUSLY? After many years and much experimentation, he devised a formula for perfect health. This formula was arrived at by testing saliva, urine, faeces, mucous, earwax, sweat and all bodily discharges.

Using the highest quality materials from Europe and the latest techniques to ensure you have the smile you deserve...

He later found that just urine and saliva gave an accurate overall reading to compare against the formulae.

He was meticulous in his use of nutrients, identifying over 30 different types of calcium and their impact on the body. Reams used his test to not only heal the “unhealable”, but also to help people maintain optimum health.

• Full dentures • Partial dentures • Denture cleaning In his laboratory he would conduct A few loyal students carried on Mobile service (Ak) start making l* • and a ch tests on urine and saliva samples, Reams’ teachings. The Reams • Denture repairs/relines measuring refractory levels, (RBTI) test in its original form is • Implant retained dentures conductivity, pH, salt readings, sugar offered by the bewell clinic. For more • Mouthguards erson per week or $368 metabolism, toxicity, digestion and information, visit our website.

ocal

Êviià Make an appointment ÃiÃȜ˜ to come and see us:

club

absorption of nutrients, and most importantly the relationship between them all.

In the words of Reams “Why guess, UÊÊVViÃÃÊ̜ʜÛi when you can be sure?”

Leah Taylor

RCDT, PGDipCDenTech (Otago)

2 Edgewater Drive

t: 09 576 6987 e: info@pdpdenturestudio.co.nz www.pdpdenturestudio.co.nz

E512016

ess Botany Junction Pakuranga 277 Te Irirangi Drive Auckland 2010 67

38 | eastlife | december 2013

and

Jetts Fitness 2/2 Fencible D Be Well Clinic215 – Unleash Your Wellness Potential 09 2450 730 Whitford Road, Whitford Village Ph 530 8143, 021 490 801 bewell@clear.net.nz www.bewell.net.nz &

www.eastlife.co.nz

*V at

16 years or older. Not to be used with any other offer. Only red


fitness | eastlife

Power workouts for summer Memberships start from under $10 per person per week or $368 per person per year^ Olly Coffey is the National PT Manager for Jetts Fitness New Zealand. He is a REPS-registered Skills Active Assessor and plays an important role in ensuring our personal trainers are fully equipped to meet the diverse needs of all Jetts members.

UÊÊ"«i˜ÊÓ{ÉÇ UÊÊ œÊV>˜Vi>̈œ˜Êviià UÊÊVViÃÃÊ̜ʜÛiÀÊ{äÊVÕLÃʘ>̈œ˜Üˆ`i UÊÊ œÊœVŽÊˆ˜ÊVœ˜ÌÀ>VÌà UÊÊÀiiʣʅœÕÀÊ*/ÊÃiÃȜ˜ Those hoping to exercise their way into the swimsuit they wore last year, need to take action today, but rather than hitting the streets, take a seat and grab your diary. The road into summer is a hectic one. The old adage, if you fail to plan, you plan to fail is true. Your plan should include five scheduled sessions a week.

In order for this to be realistic, highlight all the Christmas parties, shopping trips, baking marathons and end of year deadlines on top of your normal commitments. This alone will be enough to bring on a sweat.

full house should still be scheduled.

It’s possible to travel to the gym or park, complete an effective exercise session, and have a shower in less than an hour. You’ve heard of power naps and power walks, so think power workouts. Short sharp exercise sessions where you move swiftly between exercises, limit your rest, and maintain a challenging intensity. In an effective ‘power workout’, you need to push yourself to achieve as much as you can in 20 minutes while pacing yourself so that you are still standing by the end of the session.

"«i˜ˆ˜}ÊÇÊ iVi“LiÀ Jetts Fitness Highland Park Jetts Fitness Botany Jetts Fitness Botany Junction Jetts Fitness Howick Jetts Fitness Highbrook 491 Pakuranga Road 309 Botany Road Unit 37B, 277 Te Irirangi Drive 2/2 Fencible Drive 60 Highbrook Drive ng you So you’re saying you 09 213 7469 09 215 9370 09 215 7867 09 215 2450 ghbrook Business Parh etts haven’t yet? tried Jetts Hiyet? 09 213 7257 . ....SERIOUSLY? So how do you fit five exercise sessions into your week as we enter the silliest of seasons? Firstly, a lot can be achieved in 20 minutes, but a

The challenge is to juggle how hard you are working with how long you need to last. You should feel like you are short of breath but could still talk to someone if spoken to; on the verge

of being uncomfortable but still in control of the exercise; challenged close to your limits but still able to continue.

These power workouts are extremely effective and there are a number

of different options from which to choose. Speak to an exercise professional for help to design a short, sharp workout plan so you can exercise your way through the madness as we head into summer and the New Year.

So you’re saying you haven’t tried Jetts yet?

Come Come give on down to your us on local club a down and go. give us a go.

hange Exchange Exchange this voucher in for a 5your day free this trial* and start life voucher making a today! change in yourfor life today! a

0800 JETTS 247 / www.jet s.co.nz

per Memberships Memberships start person from under $10 per person per per start week or year^ $368 per from person per year^ un

& UÊÊ"«i˜ÊÓ{ÉÇ UÊÊ"«i˜ÊÓ{ÉÇ iÀÊ{äÊVÕLÃʘ>̈œ˜Üˆ`i UÊÊVViÃÃÊ̜ʜÛiÀÊ{äÊVÕLÃʘ>̈œ˜Üˆ`i UÊÊ œÊV>˜Vi>̈œ˜Êviià UÊÊ UÊÊUÊÊ œÊœVŽÊˆ˜ÊVœ˜ÌÀ>VÌà œÊœVŽÊˆ˜ÊVœ˜ÌÀ>VÌà UÊÊÀiiʣʅœÕÀÊ*/ÊÃiÃȜ˜ UÊÊ

"«i˜ˆ˜}ÊÇÊ iVi“LiÀ "«i˜ˆ˜}ÊÇÊ iVi“LiÀ Highbrook Jetts FitnessFitne Highbrook Jetts Jetts Fitness HighlandFitness Park Jetts Jetts Highland Park Fitness Botany Jetts JettsFitness Fitness Botany Junction Howick Jetts Fitness Howick 60 60 Highbrook Drive 491 491 Pakuranga Road Pakuranga Road 309 Botany RoadHighbrook 309 Botany Unit 37B, 277 Te Irirangi Drive 2/2 Drive Drive Fencible Drive 09 213 09 7469 213 7469 09 Highbrook 215 9370 09 215 937 09 215 7867 09 215 2450 Business Highbrook Park Business Park 09 213 7257 09 213 7257

Valid for 5 days, Monday to Friday, during staffed hours only. Local residents only. 1 pass per person. Must be 16 years or older. Not to be used with any other offer. Only redeemable JETTS 247 / www.jet t Jet s Fitness Highland Park, Botany, Botany Junction and0800 Howick. 0800 JETTS 247 / www.jetts.co.nz

www.eastlife.co.nz

&

eastlife | december 2013 |

39

deemable *Valid *Valid for 5 days, Monday for to Friday, during 5 days, staffed hours only.Monday Local residents only. 1 pass per to person. Friday, Must be 16 years or older. during Not to be used withstaffed any other offer. Only redeemable hours only. Local re at Jetts at Fitness Jetts Highland Park,Fitness Botany, Botany JunctionHighland and Howick. Park, Botany, Botany Junction and Howick. E510052-V3


eastlife | health and beauty

New diet lowers

risk of asthma attack

GINNY MCARTHUR – Outlook for Life. Ginny is not only a nutritionalist and personal trainer but also a marathon runner and regular on Newstalk ZB.

I was talking to a client the other day about her asthma. She told me how much it had improved since she started exercising and eating clean with Outlook for Life. She said she had been drinking a lot of white wine, eating a lot of takeaways and processed food and not getting enough ‘real’ food. Well, we talked through it and she was quite astounded by her lack of knowledge in this area. For example preservative 220 used in wine and dried fruits can be a real trigger. We changed her to a small amount of preservative-free organic wine. Also MSG in some Asian take away

foods – she was a great fan of Chinese cuisine – wasn’t helping. We soon had her making her own stir fries using some of the following ingredients and it has changed her quality of life profoundly.

Leafy green vegetables are high in magnesium and so very useful in helping to control asthma attacks and also to strengthen the nervous system. Magnesium helps to control muscle spasms and cramp. Think kale, spinach and rocket in salads among others.

Oily fish, such as salmon, sardines and anchovies, are high in omega 3’s which have anti-inflammatory properties. Asthma attacks are common in people with high omega 6 and not enough omega 3’s.”

Brazil nuts are full of vitamin E and selenium which are both strong antioxidants. Blueberries are high on the anti-ageing ORAC list and can protect against exercise-induced asthma.

common in people with high omega 6 and not enough omega 3’s.

Ginger also has a powerful antiinflammatory effect increasing blood flow to the respiratory tract.

Oily fish, such as salmon, sardines and anchovies, are high in omega 3’s which have anti-inflammatory properties. Asthma attacks are

Carrots are high in carotene which is good for the mucous membranes. Broccoli, garlic, onions and leeks are also great for the respiratory tract.

So, take back your power by using your food intake to support your body’s weaknesses and then benefit from the effects.

MARINA PLASTIC SURGERY “High quality surgery” Martin Rees Specialist Plastic and Reconstructive & Hand Surgeon

“SURGERY BY THE SEA” ■ Facial Plastic Surgery for skin cancers, treatment of melanoma, BCC (Basal Cell Carcinoma), SCC (Squamous Cell Carcinoma) and various skin lesions

■ Cosmetic Plastic Surgery Face lifts, neck lifts, eyelid surgery, rhinoplasty, otoplasty, breast augmentation, reduction and reconstruction, abdominoplasty, liposuction and liposculpture, hand surgery, injectable dermal fillers etc

■ Mole Checks

Marina Specialists First Floor, “Compass Building”, Ara Tai Drive, Half Moon Bay Marina Ph 534 4040 • Fax 537 0147 www.plassurg.co.nz • EDI: marinasp

➐ E512000

40 | eastlife | december 2013

www.eastlife.co.nz


FOOD Jamie Oliver’s festive classic Oliver would have been driven around the twist if he couldn’t have more of these delectable treats! Fortunately, EastLife’s favourite Oliver (JAMIE OLIVER, that is) has graciously given us quite the Christmas present, thanks to his recipe for...

PERFECT MINCE PIES Jamie says: “It wouldn’t be Christmas without being offered a mince pie, would it? I decided to do a bit of reinventing on the classic mince pie, so in this recipe I’m using a combination of puff and filo pastry, both of which can be bought ready-made in the shops for extra convenience.”

INGREDIENTS:

METHOD:

• 100g quality mincemeat • 25g dried cranberries or blueberries, chopped • Zest of 2 Clementines (mandarins) • 1 splash of sherry or brandy • Flour, to dust • 250g puff pastry • 1 pack filo pastry • 50g unsalted butter, melted • 1 free-range egg, beaten • 50g flaked almonds • Icing sugar, to dust

Preheat the oven to 200°C. Scoop mincemeat into a mixing bowl and mix in dried berries, Clementine zest and sherry or brandy.

Makes 24

Dust a clean work surface with flour and roll out puff pastry into a big rectangle about 20cm x 40cm and the thickness of a dollar coin. Thinly spread mincemeat over the pastry, leaving a 1cm gap around edges. Tightly roll up pastry, lengthways, like a Swiss roll, place it on a floured tray, and pop in fridge to firm up. Take two cupcake trays (for 12 cupcakes each) and butter each one lightly with melted butter. Place one layer of filo pastry over the tray (you may need more than one sheet to cover each tray depending on the size of the sheets) and ease pastry into each hole. Brush with melted butter, then cover with a second layer of filo pastry. Brush with butter again.

The perfect setting for your next intimate party or business gathering. We welcome you to view at 186 Wellington St, Howick.

Take the puff pastry roll out of the fridge and, with a sharp knife, cut it into 24 slices. Place each slice, flat-side down, into a filo-lined hole. Brush with the egg and sprinkle a few flaked almonds on top of each little pie, then pop both trays in the oven for about 25 minutes, until cooked and golden brown. Leave to cool, then crack the

individual pies out of the trays. Dust with a little icing sugar before serving. CHEF’S NOTE: The cooked, cooled mince pies can be frozen in their trays (just wrap the lot in cling film) or in a plastic container. Reheat them in a hot oven straight from the freezer. © 2007 Jamie Oliver Enterprises Limited. Photography David Loftus.

Unique Venue For Hire

This is the month of candies, cakes, celebrations and Christmas songs. Enjoy every moment with peace and happiness.

Merry Christmas to you all from The Lounge

Ph 535 1397 Fax 535 1497 www.howicklounge.co.nz E510033-v4

www.eastlife.co.nz

eastlife | december 2013 |

41


eastlife | dine

Set course for

The Light Horse

The gleaming glass enclosure on Highbrook Drive home to East Tamaki’s newest bar and eatery may look too good to be true but the truth lies in the pudding. NATALIE BRITTAN pays a visit, returning with ‘tails’ straight from the horse’s mouth. There’s nothing in East Tamaki, declared my regular dining cohorts from the city. Determined to prove them wrong, I waxed lyrical about a fabulous new prospect and begged them to come with me until they caved in out of pity. This prospect was The Light Horse Beer Table & Kitchen at The Crossing, a new development serving the Highbrook Business Park. Bearing the signatures of Kelly-Jo Seupakisi of nearby Fisher House Bar and Restaurant, and her business partner, Andrew Clapham, this was no ordinary venture. Andrew’s reputation precedes him with the likes of Celsius Bar in Botany South, Herne Bay Local, and more recently, Tom Tom Bar & Eatery, the latter causing a stir on the prolific Victoria Park dining scene. But The Light Horse was far grander, bigger and trendier than any city fringe eatery I’d ever seen – begrudging companions mumbled inaudibly along the lines of, “this is nice”. There were plush wingback armchairs, colourful powder-coated metal stools, exposed light bulbs, distressed timber as well as a distinct military theme. Ammunition canisters held old-school Cerebos table salt, cutlery and condiments, and staff were dressed in army shirts – a nod to the name. Light streamed through from floor-to-

ceiling glass windows and the bright, breezy atmosphere was dangerously relaxing. A temptingly beautiful outdoors area beckoned and, had the wind been more merciful, we would have succumbed. We visited on an awkward Monday evening expecting to be sole patrons but, as it turned out, Monday at The Light Horse was the new Thursday – with just the right amount of buzz. Greeted by a delightful waitress with a mega-watt smile, we hunkered down. Of note were the international choice of beers on tap such as Asahi, Kingfisher, Czech and Spanish varieties and craft beers such as Honesty Box and Boundary Road. However, these were no distraction for the girls at the table who were beside themselves with the allure of ‘horse tails’. One elegant execution stood out – the Light Horse Redemption, a snowy white martini glass filled with a clear concoction of vanilla, white chocolate and hazelnut liqueurs. We could

SATURDAYS HALF PRICE STEAK NIGHT FROM 5PM

have drunk pitchers of the stuff and, yes, believe it or not, we’re not big drinkers. Alas, one cannot live on drink alone so we filled our bellies with sharing plates of triple-dipped chicken lollipops with pineapple ginger fondue, The Farmer pizza, and a main of Black Angus steak. The chicken was not as crispy as it could have been, the pineapple ginger fondue was a mere sweet chilli sauce and The Farmer described as “slow braised pulled pork, chargrilled apple, garlic confit, candied walnuts, blue cheese cream and crispy sage” was a little overcooked with pork slivers on the ‘lean’ side. Luckily, sweet redemption prevailed. From “neigh” we went to “yay” when we heard what was on offer: mini strawberry jam and custard doughnuts, whipped cream and chocolate dipping sauce; New York vanilla cheesecake, poached blueberries and Chantilly cream; and a chocolate lava cake, dark chocolate ice cream and smashed Oreo biscuit.

Dessert took longer but every minute was worth it. Impeccably presented and utterly delectable, conversation was lost on me – I was drowning in sweet ecstasy. A chocolate fondant oozing a pool of liquid indulgence, the chocolate lava cake had a ménage à trois with the Oreo biscuits and sensational ice cream. It had clearly been baked from scratch given the time it took, and judging by the state I was in, it had been baked to perfection too. The New York cheesecake took the cake that night. Unbelievably smooth and creamy, it was one of the best cheesecakes I have ever eaten; even the harsh cheesecake critics at the table agreed it was ‘sensational’. And the strawberry jam doughnuts were moreish in all their dipping glory. The verdict? The city folk have dismounted their high horse, and declared sweet surrender. As for me, I’ll be holding the horses on mains, and charging straight into dessert and cocktails.

SUNDAYS

PLAYING NOW

ACOUSTIC GUITARIST

JARRAD LEE

THE LIGHT HORSE

1-3PM

BeEr Table ‘n’ Kitchen

BeEr Table ‘n’ Kitchen

Open 7 days, 11am to late – please check opening hours “Instagram us and youover Christmas holiday period

could win a $100 bar shout!” k.com/thelighthorsebar 60 HighbroOk Drive, East Tamaki. Ph 271 5811. wWw.faceboO E510193-v2

42 | eastlife | december 2013

www.eastlife.co.nz


profile | eastlife

dine | eastlife

Weeding out the wheat It may be the staple of many growing households, but wheat has no place in one Howick residence. Not just a lifestyle choice these days, it seems gluten-free is a fast rising business, as NATALIE BRITTAN discovered. One may be forgiven for walking into the Jury residence and thinking it’s a bakery. On any given day there is at least one baked good sitting on the kitchen bench of Mike and Liz Jury, the husband and wife team behind The Gluten-Free Store.

bread is a surprisingly soft, pliable, seeded quinoa loaf. But it was a challenge. “Initially, some was so bad the birds wouldn’t eat it!” says Liz. “We played around with recipes and eventually got there. Now we think it’s just the best!”

“I bake every day,” says Liz, a mother of four – but there’s no traditional flurry of flour, eggs and butter in the kitchen of this mistress of glutenfree pre-mixes. Instead, the pantry is stocked with a goodly number of ingredients including rice, amaranth, buckwheat, corn, quinoa, sorghum, tapioca and chickpea flours, and xanthan and tara gums.

Given that The Gluten-Free Store supplies to major gluten-free bread manufacturers around the country including Phoenix and Bakeworks, this statement has its merits.

These make up the gluten-free premixes for breads and cakes which Mike and Liz retail online, and supply to manufacturers and retailers. Found in many grains such as wheat, rye and barley, gluten helps bind foods such as bread, cake and pastry together. On the day of our meeting, a glutenfree chocolate cake and a gluten-free golden brown loaf of bread rose to the occasion although Mike says the hardest recipe to perfect was the chocolate cake. Of course, those delicious baked products are the means by which Mike and Liz test their flours and pre-mixes, ensuring they will do the job. Just developed last Christmas, the

The business was born more than two years ago from a number of factors. Three and a half years ago, Liz was diagnosed with coeliac disease, a condition that meant her body repelled gluten, resulting in severe auto-immune reactions such as itching, vomiting, blisters, and damage to the small intestine. The prospect of eating soon grew stale, until she discovered GlutenFree Made Easy baking workshops in Pukekohe, run by Neville and Judy Green, formerly of Pakuranga. “We had bought cookbooks and tried things. I had so many disasters! But Judy and Neville make gluten-free easy like they say.” The Greens remain involved. “We bounce ideas off them,” says Liz. “They’re really neat. Neville endorses our mixes because he’s looked at them and knows they’re good.”

Bin Inn

While the smell of baking wafted through the Jury household, Mike, an accountant by profession, was looking to go into business. Keen to rekindle the success of a lunch bar he had once owned in Papatoetoe, he thought a bakery would be ideal. However, Liz could think of nothing worse. “I said that’d be terrible! We’d be selling poison bread.” They then looked at buying a chickpea flour mill, but when they realised that wheat products were being manufactured on the same premises, it was a definite no-no. Following that realisation, Liz became wary of naturally gluten-free products that were not specifically labelled. Even the smallest of contaminations could cause problems. Hence The Gluten-Free Store. “We’ll import flour, get it tested and sell it knowing it’s safe for coeliacs.” While Mike handles the business side, Liz, a freelance photographer, helps with the creative angles. Flours are imported from all over the world, tested at place of origin, and again in New Zealand to comply with Codex International Food Standards and the Australia/NZ Food Standards Code.

Bin Inn Wholefoods and Specialty Groceries

Your local stockist of gluten free store products

With the new business underway they soon diversified. “People said they couldn’t be bothered buying five packs of flour to make a cake so we decided to do pre-mixes,” says Liz. Now, the range is fast-expanding with five breads, a ginger loaf, a vanilla cake, chocolate cake, and scone and pizza base mixes already on the menu. There are plans to introduce a biscuit mix too. The thriving business also supplies major retailers from the local Bin Inn in Howick’s Moore St, all the way down to a New World in Christchurch. Local response has been overwhelming. “Recently we met a little boy who was a coeliac. He tried our bread and couldn’t believe it was gluten-free. ‘It’s the best bread I’ve ever tasted, he said’!” Mike and Liz say it’s the people who make it happen, namely Fiji-based distribution company, Punjas. “They are good people – they’ve really supported us. You’re only as good as the people who work with you,” says Mike. “It’s nice to know we can make a difference, help people enjoy food and have a good life.”

• GLUTEN FREE • ORGANICS • Cereals • Dried Fruits • Flours & Grains • Home Brewing • Herbs & Spices • Legumes & Nuts • Baking Mixes • Cake Decorations • International Foods • Cleaning Products • Plus much more

Phone 537 1041 • www.bininn.co.nz • Open 7 days 7am-7pm 2/219 Moore St, Howick E510201

www.eastlife.co.nz

eastlife | december 2013 |

43


eastlife | recipe book

Cookbook at home under Christmas tree It’s easy to see why Julie Biuso grew up loving to cook – as a child she had nine siblings ahead of her all sharing skills learnt from their mother. Indeed, it was early learning in the home that led to a culinary career and was, perhaps, where Julie’s latest cookbook, Julie Biuso at Home, took root. With 15 books to her name and a string of honours for her writing, including a special jury prize from the Gourmand World Cookbook Awards, Julie’s latest book features more than 270 fresh meal ideas from across the seasons. It also includes useful cooking tips and a comprehensive 32-page Cook’s Notes section. Against a backdrop of family, friends, chickens and her vegetable garden,

this well-known and respected food personality covers everything from sensational salads through to sweet things that will send readers scurrying to the kitchen for an apron, ingredients and beater.

In fact, in these recipes readers will find inspiration for every aspect of a family’s culinary calendar from a simple mid-week meal or a long lunch with friends to impressive nibbles and showstopper desserts for dinner parties. And there’s plenty of baking to fill the tins too.

Impressively, the Le julie biuso Cordon Bleu LondonPhoto Aaron McLean trained chef, who is an ambassador for Le Cordon Bleu Definitely, a book one would love to Institute in New Zealand and also for find under the Christmas tree, thanks the New Zealand Farmers’ Market to New Holland, EastLife is tempting Association, manages to include readers further by giving them a down to earth dishes, using less chance to win a copy for themselves than sexy veggies such as carrots, although it won’t be drawn before cabbage, potatoes, parsnip and Christmas. swedes, alongside eye-popping, mouth-watering gateaux and • Julie Biuso at Home, published by make the whole lot sound utterly New Holland. Available at all good scrumptious. bookstores. RRP $65.

WIN

WIN A COPY – Thanks to New Holland, EastLife has a copy of Julie Biuso at Home to give away to one lucky reader. To enter the draw visit www.eastlife.co.nz. Click on the competition link and complete the form. One entry per email address/person; entries close January 31, 2014. Winner notified by phone or email.

A stylish restaurant and bar, with great atmosphere featuring delicious Thai cuisine.

with

Book now for Christmas functions Dinner 7 nights from 5.30pm Easy parking nearby Private function room Fully licensed/BYOW 590 Dominion Rd, Balmoral Ph 09 638 9516 www.tusk.co.nz

www.eastlife.co.nz E510187

44 | eastlife | december 2013

www.eastlife.co.nz


profile | eastlife

Reaping a wild harvest

It’s easy for Aucklanders to fawn over celebrity bakers such as Loaf’s Sean Armstrong, but east Auckland has its own star baker. NATALIE BRITTAN follows the breadcrumbs leading to the man behind Wild Wheat, and asks what’s baking in his ovens for Christmas. The first thing to cross Andrew Fearnside’s mind when he wakes up is the weather. “As a baker, it’s really important to pay attention to what the weather’s doing,” says the owner and founder of the award-winning Wild Wheat Specialty Breads. “A good baker can predict how the bread’s going to feel. Typically, bread does better when the weather’s cloudy and cooler – mid-10s to 20°C.” Of course, humidity is a factor too, but thankfully, Andrew has a natural aptitude for baking – a discovery he made as a young chef assigned to the bakery of London’s Le Pont de La Tour some 20 years ago. “I understood the principles of baking very quickly. I had this gut feeling and got it straightaway.” Returning to New Zealand in the ‘90s, and after a stint at Pandoro, Andrew began tossing around the idea of owning his own restaurant but the grains of wheat were firmly sown. “I wanted something long-term. You can be a very good chef but it isn’t enough; people move on as soon as a new restaurant pops up. Bread, however, has long-term value.” So, in 1999, Andrew set up Wild Wheat in Howick and began wholesaling continental loaves to the hospitality sector.

Today, the business encompasses a Pakuranga factory and three retail arms in Mt Eden, Howick’s Picton Street and Belmont. Wild Wheat also supplies numerous restaurants, cafes and gourmet food stores. Incidentally, the Picton Street shop is just a “stone’s throw” from where Andrew was born at the former Howick Maternity Hospital. And while the former Howick College student now lives in Manurewa – with plans to relocate to a four-hectare property in the Hunua ranges – he remains loyal to the area where he grew up. Parents Norma and Larry still live in Howick. Thanks to his mum a love of cooking was ingrained from an early age; credit goes to his Yorkshireman dad for an impeccable work ethic. The ambitious firstborn had his first taste of a chef’s life as a 14-year-old apprentice at Bell House restaurant in Pakuranga. It was horrible, Andrew recalls. “I had the stuffing completely knocked out of me.”   And the path to becoming a chef was one less travelled. “I was the only boy in my Home Economics class!” Things took a turn for the better when Malcolm and Joy Scott from Shamrock Cottage took him under their wing and after completing a City & Guilds qualification in culinary arts at the

Guylian’s original marbled chocolate sea shells are made from the finest West African cocoa beans and filled with a delicious, roasted-hazelnut praline

Auckland Institute of Technology (now AUT), the rest was history. These days, the baking mitts are off as Andrew takes on the more strategic role of production manager and overseer of the 24-7 operation. Simplicity, consistency and the management of Wild Wheat’s 30-odd staff members are crucial, he says. “I used to think that I could do it all. But, really, I can’t do it without my staff.” Of course, the only time Andrew can “totally switch off” is Christmas Day. However, first the biggest hurdle needs to be overcome – the baking of 90,000 fruit mince pies. And these are no ‘traditional’ offerings. “As a child I was a fussy bugger and never ate Christmas pudding or cake! This time, I’m making something I can eat.” In addition to mince pie essentials

such as orange peel and mixed spice, the creative baker has opted also for the delectable combination of cranberries and chocolate with a twist of grappa to “sharpen things up”. Naturally, old favourite, Stollen, remains on the Wild Wheat menu, with its nostalgic blend of rumsoaked fruit and marzipan imbued with a shot of amaretto liqueur. Other Christmas Day essentials are well taken care of thanks to Andrew’s mum, and sister, Sarah, both great cooks. In fact, the unusually trim chef admits he is prone to overindulgence. “I’m one of those fortunate people who never put on weight – my father’s the same.” With Christmas being about family Andrew says: “My family has played a big part in my life – I am extremely lucky to have their support.”

Range of Artisan, European-style breads, pastries & savouries Winner of the Metro Best Bread Shop Auckland 2012 every year since 2004 – 2012 NZ FOOD AWARDS WINNER

Guylian is the world’s favourite Belgian chocolate and the ideal, indulgent gift, for someone special

Order your Christmas goodies now, freshly baked pastries, pies and stolens Open right up until Christmas 114 Picton St, Howick (opp Moore St) Ph 535 9262 • www.wildwheat.co.nz

E512108

www.eastlife.co.nz

‘BEST OF AUCKLAND’ - VOTED BEST BREAD SINCE 2004, BEST BAKERY 2011

OPEN 7 DAYS: Mon to Fri 7am-6pm, Sat & Sun 7am-4pm eastlife | december 2013 |

E510196

Available at your local store...

45


eastlife | celebrations

The naked party with Carlton Party Hire When it comes to creating from scratch, an event or party with the WOW factor, then Carlton Party Hire is a one-stop shop. The Carlton team has the total expertise and range of products to turn your function or party into a truly inspirational and memorable occasion – every time! You won’t have the worry or hassle of having to do anything yourself – you can simply sit back and enjoy the function. All you need is the NAKED VENUE – we will do the rest from arranging the marquee, table settings, chandeliers, lighting, flooring and centrepieces to furniture, catering equipment, refrigeration and linen. It doesn’t matter what size your function is – a small party at home or a large corporate event for Christmas – the ability to use a combination of

our hire products to create the perfect atmosphere is important and we will ensure the outcome looks stunning. Professionalism is the key to our success. After all Carlton Party Hire and Carlton Events is part of the Carlton Hire Group, New Zealand’s largest party and event supply company. With more than 40 years industry experience, we are a New Zealand, privately-owned company growing rapidly due to our ability to meet customer needs. At every corporate function it is important how your brand is represented. We can ensure your vision for your event becomes a reality so that customers have a fantastic time and talk about it for a long time to come. Our product range is second to none in New Zealand. We stock a wide

range of party lights, each with different lighting effects. We also have a huge selection of furniture options on hand including LED bars, benches, stools, coffee tables and ice buckets as well as smoke and bubble machines.

contact one of our friendly Carton Party Hire Pakuranga team members on 577-0331.

For more information on all our products and services visit the web site www.carltonpartyhire.co.nz or

Like us on Facebook to receive information on all of our great promotions and competitions.

COME & ENJOY THE OCEANZ EXPERIENCE... Oceanz Seafood is New Zealand’s largest specialist seafood retailer. Our goal is to deliver the highest quality range of seafood that is available in New Zealand.

NOW TAKING ORDERS FOR CHRISTMAS Enjoy some tasty & healthy treats for Christmas this year. We are now taking orders and recommend that you order in advance to avoid disappointment. The menu this year includes crayfish, scallops, whitebait, oysters, a range of prawns, seafood platters, fresh fish, salmon, and much, much more.

BE IN TO WIN $200 WORTH OF CRAYFISH Want Crayfish for Christmas? We have $200 worth of yummy quality crayfish to be won this Christmas. Every Christmas order placed goes into the draw.

CHECK OUT OUR WEEKLY SPECIALS THROUGH DECEMBER & JANUARY

Open until 7pm Sun to Thurs and 7.30pm Fri & Sat

THE HUB, 451 TI RAKAU DR, BOTANY. PH 271 4880. WWW.OCEANZ.CO.NZ e51210

46 | eastlife | december 2013

All specials while stocks last and weather & catch permitting. www.eastlife.co.nz


s l e s s u m Green lip with Thai red

food | eastlife

dine | eastlife

curry sauce and steamed jasmine rice Ajay Zalte – executive chef, Novotel Auckland International Airport. Ajay is a Pakuranga resident and has worked in leading hotels and first class restaurants worldwide.

INGREDIENTS • 16 fresh green lip mussels • One sliced white onion medium size • 15 grams chopped garlic • 2 tsp red Thai curry paste • 1/2 cup coconut cream • 10 grams chopped fresh coriander • 100 grams Jasmine rice • 15 grams Galangal chopped • 15 grams ginger chopped • 1 lemongrass stalk • 30 ml canola oil • 1/2 lemon • Salt to taste

METHOD: Remove the thick outer stalk of lemongrass and chop very finely. Add canola oil to a pan. Sauté

onion, garlic, galangal, ginger and lemongrass. Add red curry paste, fry for a minute then add a little water and coconut cream and simmer to a sauce consistency. Clean mussels, wash thoroughly and add to the sauce. Simmer till the mussels open up. Stir in lemon juice, season with salt and simmer further for a minute. Steam jasmine rice in a rice cooker or a steamer with 1 1/2 times water. Garnish the mussels with freshly chopper coriander and serve with steamed rice. Serves two

Chilli-hot win... A Highland Park man is stirring up a heat wave across the Tasman with his fiery home-grown concoction which was awarded first place in a trans-Tasman competition. NATALIE BRITTAN has a taste of his success. Ironically, Paul Smith never thought he had a green thumb. “Anything that I grow other than chillies usually dies – I think it’s because I don’t care about them as much.”

Paul’s passion has paid off just 11 months into business. Last month, he scooped first place at the Mr Chilli Awards 2013 with his Pacific Burn creation – a mango, coconut, habanero and sweet chilli sauce. www.eastlife.co.nz

The 33-year-old says he hopes this win will sow the seeds of more chillies in future. “It was a really good opportunity and I hope it’ll get my brand out there.” Meanwhile, Paul, a refrigeration and air-conditioning engineer by trade, is experimenting with technical ways of growing better, hotter chillies using cutting edge methods such as hydroponics and aquaponics in his back garden and garage.

It was a love of hot food that first sparked his love affair with the pepper, and when fellow chilli lover and friend, Scott Thompson, began growing his own, Paul followed suit. In fact, the former Pakuranga College student has taken it further and developed his two-year-old chilligrowing addiction into a fully-fledged chilli sauce manufacturing business going by the sassy moniker of HOTtt ASs Chillies.

than a supermarket sweet chilli.”

The outcome of these experiments are shared online on NZ Chilli Forum, which Paul also co-founded.

An annual competition, the Mr Chilli Awards received more than 200 entries this year from Australia and New Zealand.

A self-confessed “chilli head”, his collection is made up of more than 100 exotic varieties, and the hottest chilli he has ever grown clocked more than two million Scoville units – approximately 400 times hotter than a jalapeno pepper.

“As you can imagine, I was ecstatic!” says Paul. “It’s one of my milder sauces, but it’s considerably hotter

“I never planned it would be a fulltime job but it’s just something I wanted to do and I love it.”

$12

lunches

Wednesday-Friday

ALL NEW

MENUS

BOOK NOW FOR DINNER Thursday-Saturday LARGE GROUPS OK CNR WHARF RD & HATTAWAY AVE BUCKLANDS BEACH LICENSED OPEN 7 DAYS

| december 2013 | 47  eastlife533 7810 E513030-v6


eastlife | dine

summer dining

Mains $10-$24 = $ Mains $25-$34 = $$ Mains $35+ = $$$

BASALT

THEAPOTHECARY

SZIMPLAGASTROBAR

Basalt has been the heartbeat of Howick for 10 years, and with its new addition of Gazebo makes the perfect place to enjoy great food this summer. With 180 degree views of Howick and beyond, this is a real locals’ bar with a lively atmosphere and creative menu.

The Apothecary goes Italian! A licensed eatery in the heart of Howick, The Apothecary is a lively wine bar and a daytime cafe open 7 days with evening bistro dining on Wednesday to Saturday nights. Button-back leather seats and vintage paraphernalia set the mood. Available for private functions.

There’s nothing Szimpla than dropping in at a popular gastro bar for a taste of great food and atmosphere. Stop and linger before or after a flight, and revel in the magic of Szimpla’s beautiful Balinese courtyard and contemporary decor. Close to accommodation and the airport; forget the hassle, just sit back, relax and enjoy the Szimplicity. Weekend brunches from 10am.

• VIEW THE DAILY SPECIALS ON WWW.BASALT.CO.NZ

•CHECKOUTTHENEWITALIANMENUAFTER CHRISTMAS!

Cnr Picton & Moore Sts, Howick. Ph 533 0081. Open Mon-Fri 11am-late, Sat 10am-late, Sun 9am-late. www.basalt.co.nz

LICENSED

27-29PictonSt,Howick.Ph5359661. Cafeopen7daysforbreakfastandlunch, BistrodiningWednesday-Saturday www.facebook.com/theapothecaryhowick

$$

DUM MAST INDIAN RESTAURANT & BAR Specalising in the Muhglai-Hydrabadi-style of Indian cooking. Our idea to life is to be simple and happy. This is how we cook our food, this is how we like to serve and finally this is how we want our guests to feel before they leave us. Simply happy. • SUMMER SPECIAL – Monday, Tuesday, Wednesday – mains $9.99 (excludes seafood). Dine in and takeaway. 44 Fortunes Rd, Pakuranga. Ph 576 8327. Open 7 days. Lunch Wed-Sun 11.30am-2.30pm Dinner Mon-Sun 5pm to late. Free home delivery (conditions apply) www.dummast.co.nz

BYO • LICENSED

48 | eastlife | december 2013

$

LICENSED

•SUMMERSPECIAL–$12.90 lunches, M0n-Fri 12-3pm, Sat 10am-5pm kids eat FREE – one child per ordering adult 2LeonardIsittDr,AucklandAirport. Ph2151220.Open7days10am-late. www.szimpla.co.nz

$$

LICENSED

$

gooDEbrothErS

NA NA THAI RESTAURANT

Goode Brothers – Goode Gourmet, Great Everyday. Relax over a delicious meal and a drink on the extensive new sunny deck, in the new bar area or in the lively restaurant. Enjoy fresh creations from the open kitchen perfect for the family or get-togethers with friends.

In Thai ‘Na Na’ means variety and that’s what you’ll be offered when you dine with us! A delicious variety of traditional Thai cuisine to suit every taste at the best price. Group banquets available. Winner of the ‘People’s Choice Award’ for best restaurant.

•VIEWthEIrDAILYSPECIALSoN WWW.gooDEbrothErS.Co.NZ

• CHECK OUT OUR NEW SUMMER SPECIALS. Open through Christmas and New Year holiday period.

Shop36,townCentreDr,botanytownCentre. Ph2724516. open7days11am-late www.goodebrothers.co.nz

LICENSED

$$

Unit 4/308 Te Irirangi Dr, Botany South. Ph 274 9990. Dinner 7 nights 5.30pm-late, Lunch Fri-Sun 11.30am-2pm www.nanathai.co.nz

BYO • LICENSED

$ www.eastlife.co.nz


dine | eastlife

summer dining

Mains $10-$24 = $ Mains $25-$34 = $$ Mains $35+ = $$$

THE LIGHT HORSE

BeEr Table ‘n’ Kitchen

THE LIGHT HORSE

“Instagram us and you could win a $100 bar shout!”

See Highbrook in a new light at The Light Horse. Stunning new bar and restaurant. Casual and relaxed atmosphere. Convenient location linked to motorway. Bar snacks, pizzas, delicious cocktails. Corporate parties and evening soirees. Book your annual function today. • SUMMER SPECIALS: Saturdays – half price steak from 5pm, Sunday sessions with acoustic guitarist Jarrad Lee 1pm-3pm. 60 Highbrook Dr, East Tamaki. Ph 271 5811. Open 7 days, 11am-late – please check opening hours over Christmas holiday period www.thelighthorse.co.nz

LICENSED

$

URBANSOULCAFE

CELSIUS

An award-winning café delivering quality coffee, food and service seven days a week. If you’re after a weekend brunch or a week day treat – there is something for everyone. Light and spacious, white on white – it is the perfect place to relax and unwind. Open late on Friday nights, check out the new set dinner menu on the website. Available for evening private functions for those special occasions.

Celsius is a purpose-built bar, restaurant and function facility located at Botany Junction. The perfect place for catching up with friends, Celsius offers great service and an extensive range of food. Celsius is East Tamaki’s hot spot for after-work drinks, casual lunches, or your next business meeting or event.

• Open every day over the Christmas holiday period except public holidays.

125OrmistonRd,BotanyJunction. Ph2714822. Open7days,Mon-Fri11.30am-late, Sat-Sun11am-late www.celsiusbar.co.nz

652GreatSouthRd,Manukau.Ph2622435. OpenMon-Thurs7am-4.30pm,Fri7am-late, Sat-Sun8am-4pm www.urbansoul.co.nz

LICENSED

•VIEWTHEIRDAILYSPECIALSON WWW.CELSIUSBAR.CO.NZ

$

LICENSED

$$

AMPHORA RESTAURANT

wELLINgtoNSrEStauraNt

buCkLaNDSESprESSoLouNgE

Mediterranean/Italian restaurant in Botany Junction. Award winning chef and former NZ Beef & Lamb Ambassador. Indoor and outdoor seating. Open 7 nights for dinner, lunch Monday-Friday.

Wellingtons Restaurant is located within the Waipuna Hotel & Conference Centre and overlooks Auckland’s picturesque Panmure Lagoon.

The award-winning cafe has launched its new Kiwi-inspired summer menu as well as an updated wine and beer list. Sample fresh food made on-site in a bright and breezy outdoor setting. Vegetarian and gluten-free options are available and children are well catered for with the kids’ menu. Taste the best of fresh, local produce today!

• $14.50 LUNCHES – Also check out our special on Sunday-Wednesday nights Shop 20a, 123 Ormiston Rd, Botany Junction. Ph 271 6416. Open Lunch Mon-Fri 11.30am-2.30pm, Dinner 7 nights 5.30-late www.amphorabotany.co.nz

BYO • LICENSED www.eastlife.co.nz

$$

Come and dance the night away in Auckland at our Saturday Dine & Dance, with resident band, Tall Order, bring the girls in for High Tea, or join us on Sunday evenings and bring the kids for a night of fun and surprises with award winning magician, Alan Watson! waipunaHotel&ConferenceCentre, 58waipunard,Mtwellington.Ph5263000. open7days–breakfast,lunch,dinner www.wellingtonsrestaurant.co.nz

LICENSED

$$$

•$12LuNChESwEDNESDaytofrIDay Cnrwharfrd&hattawayave, bucklandsbeach.ph5337810. openforbreakfast&lunch–7days, Dinner–thursday-Saturday

LICENSED

$$ eastlife | december 2013 |

49


Taste eastlife | pantry

Try our latest flavours of the month and experience a range of new products with a real taste difference. EastLife is always on the lookout for new products to tantalise the tastebuds of our readers.

Glasseye Creek Wild Meat Sauce

Maison Therese for the best in preserves

Time out in a remote West Coast corner started Shane Wratt on a life changing and ‘saucy’ journey. It began when he tasted venison, wild pork, buffalo, rabbit and duck at the local pub and felt something was missing – that ‘best mate of meat’, a sauce to complement the unique flavours of wild game. After an exacting quest to create a premium meat sauce, Shane came up with Glasseye Creek Wild Meat Sauce. A premium, all natural, preservative-free, dark sauce, the perfectly balanced flavours are derived from distilled maple smoke, New Zealand orange juice, Japanese soy sauce, Californian raisins, locally-sourced molasses, vinegar and secret herbs and spices. Glasseye Creek Wild Meat Sauce 375mls, RRP $10.99. Available from participating specialty food stores and supermarkets.

Oh my darling! Clementine has arrived in time for Christmas, in orange-inal form with Michelin Star chef, Heston Blumenthal, having a fresh take on the traditional festive pudding. Featuring a delightful surprise – an orange or Clementine [mandarin] at the centre – these puddings are effectively self-saucing, with citrus juices coming to the party when heated. And they’ve moved like clockwork in the UK where, according to The Telegraph, the puds were on eBay for twice face value just days after hitting supermarkets! Available in NZ from Nosh Food Market. Hidden Clementine, 227gm, RRP $14.99, Hidden Orange 1.2kg, $49.99.

What better way to ‘relish’ summer barbecues and picnics than with tangy Maison Therese preserves which include delicious relishes such as Tomato Relish, Balsamic Onion Relish, Beetroot Relish and Piccalilli. All four products are gluten and dairy-free, and contain no artificial flavours, preservatives or colouring. Tomato Relish – combining tomatoes, onions and spices for a mild peppery, slightly sweet taste; Balsamic Onion Relish – onions and spices blending in a sweet tangy sauce; Beetroot Relish – a sweet, chunky relish with colour and flavour; Piccalilli – cauliflower, gherkins and onions blended with a mustard and tumeric sauce. Available from supermarkets and specialty food stores. RRP $6.

A toast to Christmas – Allan Scott Cecilia Brut NV! A glass of Allan Scott Cecilia Brut NV is a deliciously stylish way to relax and ring in the festive season. A sophisticated Methode Traditionelle style wine that expertly blends chardonnay and pinot noir grapes, Cecilia Brut NV is the perfect bubbly for the Christmas table. Filled with the fruity flavours of wild white strawberries and stone fruits, Allan Scott Cecilia is characterised by a pale straw hue and creamy, lingering finish. Allan Scott Cecilia Brut NV available from Glengarry’s and online at www.allanscott.com. RRP $29.

Italians get fresh!

SUMMER MEALS FOR ON-THE-GO KIDS Holidays are almost here but there’s no need to stress about planning extra food for at home kids. Pitango’s new kids’ meals, packed with organic and free-range ingredients, are free of sugar, salt, preservatives and additives. Suitable for children upwards of 12 months, they come in bright 200g packs. Chocker with ‘secret’ vegetables, there are four flavours: Organic Spaghetti Bolognese, Free Range Very Mild Chicken Curry, Salmon Risotto and Macaroni Cheese. Available at selected New World, Countdown and Pak’n Save stores. RRP $3.49 each.

50 | eastlife | december 2013

“Scusi signorina, voresti uscire con me?” asked the impertinent Italian stallion. “Sling yer hook,” interjected the miffed Kiwi bloke. Italian is a loving tongue, but it doesn’t go down well when directed by a precocious Neapolitan in search of a little ‘a-more’ from one’s missus! What does go down well, however, is Cucina, Restaurant Quality Artisan Pasta. With no colourings or preservatives, the range features six amazing flavours, eight cuts and filled pasta including ravioli, gnocchi, and tortellini. Available online – cucinafoods.co.nz. Every order is made fresh and delivered free within 2-3 working days. Minimum order $35. www.eastlife.co.nz


home The anywhere chair Many homeowners dream of redecorating when seasons change. Yet sometimes a fresh look is all about cutting one’s coat according to its cloth. But, if finances are a tad tight, especially with Christmas looming, don’t abandon ideas of a makeover. Here CHRISTINE BULL from Inner Concepts Design Consultants shows how clever forethought, a smidgen of flair and a change of cushions, curtains, and throws, or perhaps the backdrop, can achieve multiple effects with a just a little effort. A grand entrance – Looking sharp with Sante Fe Shutters and timeless velvets from the Capitol colour Zebra collection – opt for classic elegance.

Comfy enough for Santa! – Nestled by the tree, this Hemptech Linen chair is in the perfect place to hand out Christmas gifts. It encapsulates the Christmas mood with its patchwork linen cushion and giant pinecones from Wanaka.

Sweet dreams – An exquisite back drop of Zoffany’s Ivy Leaf wallpaper accompanied by Sparkk printed linen cushions and plush throw from James Dunlop creates a sense of tranquility in the home.

E512005-v4

A medley of colour and comfort – It’s all things family in these bright colours from Sanderson’s Bellflower and Eclipse fabrics plus a cuddly throw from Mokums Fuzzy Logic Drapes in Hemptech’s Ragello colour, pepper.

www.eastlife.co.nz

eastlife | december 2013 |

51


eastlife | entertaining

Setting the If there’s one time of the year when families make an effort to truly dress the dining table it’s Christmas. Out comes the special tablecloth, the festive napkins, Christmas crackers and sprigs of holly.

stunning Christmas decorations is outstanding, means Di can let loose her artistic talents. Yet, she says everything photographed here is simple to assemble.

Pass the paua please!

Even those who reject traditional colours and trimmings, opting instead for an al fresco or barbecue theme, may still go all out for a little pizzazz.

With more and more New Zealanders adopting a local theme, the ocean blue and all its bounty is an obvious choice. Add a little Pacifica glitz and you can have a setting that will wow your guests.

But creating something magical doesn’t always come easy so EastLife asked, Di Bowbyes from Everlasting Daisies, at Bishop’s Gate, to create some yuletide splendour.

While the expectation is always for a beautiful day on December 25, Auckland’s inclement weather means most hosts play it safe but those with a verandah or covered patio can enjoy the best of both worlds – airy

Of course, owning a store specialising in faux flowers like you’ve never seen before, and where the cavalcade of

Soft Close Drawers Sit back and enjoy your holidays stress free! Design | Manufacture | Installation

Superior KITCHENS Qu ality Custom Built Kitchens a nd Ca binets Book your new kitchen with us this year for installation next year and receive studio soft-close drawers from

FREE e e r F Sit back and enjoy your holidays stress free! SOFT CLOSE FINDING BETTER WAYS DRAWERS Soft Close Dra wers

Ave illiam

Road

Road

o

sR

ale

Sm

Baker

ad

gs Ro

by Drive

Lady Ru

Sprin

nA ve

East Tamaki

illiam

Ave

fin Drive

Te Irira

E510132-v4

ngi Driv

Harris

e

d

Ke

rwy

Drive

Ac

n ce

Ac

e

www.eastlife.co.nz

Ruby Drive

Ave

Lady

Drive

Drive

Sir W

nA ve

Baker

Ruby

Corro

rwy

Sir W

Harris

Ke

Lady

lliam

52 | eastlife | december 2013

Sprin gs Roa

6

D

1 9 8

illiam

East Tamaki, Auckland 2y7ears Phone 09 274Mon - Fri 7:30 - 4:30pm 8900 Sat 9:00 - 12:00

Factory & Showroom, Unit J, 4 Lady Ruby Dr, oad sR East Tamaki. Ph 274 8900Smale Mon-Fri Ave East 7.30am-5pm; Tamaki Sat 9am-1pm. Sir W

www.superiorkitchens.co.nz Unit J, 4 Lady Ruby Drive

oad

LISH

ings R

B

E

ESTA

*Conditions apply


entertaining | eastlife

festive table ambience but some shelter should raindrops fall. Taking colour cues from a concrete table, pebbled matting and tiled floor – swirling shades of grey (a little like the sea on an overcast day) – Di has brought in a meld of greens, and blue for an overall paua effect. Hints of seaweed and seashells are cleverly achieved with pearls and tinsel. Deep blue glass plates anchor the theme with rich and water-inspired tones reflected in some of the glassware. The magnificent centrepiece may look complicated but Di gleefully says it is so easy to assemble taking only a few minutes. “Just select four or five appropriately coloured, artificial floral stems and tie together with wire. Then do the same again with matching stems. I’ve used green and white berries with green/ blue hydrangeas. “Bring together stem ends of both

bunches and lay on centre of table so they merge into one fusion of flowers and berries. “Finally, place a paua-coloured poinsettia in the middle where bunches blend and trail a drift of glittering turquoise tinsel for the seaweed effect. Then, hey presto, it’s all done. “After Christmas, remove the poinsettia and tinsel; add another flower to the centre of the stems and the result is a more secular look.” Note that Di has ensured the arrangement is positioned below eye level so as not to hamper conversation yet still achieving an overall effect of relaxed glamour, capturing the essence of the seaside. When it comes to other finishing touches on the table she suggests using pearl or berry strands twisted together to form napkin rings, and perhaps a mix of green, blue and turquoise baubles hung or grouped here and there for added effect.

A sense of tradition At Christmas time, you can’t go past a little tradition, and of course, any classic yuletide setting must include a little red and green, plus some glitz if desired. Above right, a gorgeous traditional tablecloth in a timeless rose pattern features equal amounts of blush pinks, soft reds and green for the background palette. Keeping the centrepiece simple Di has simply grouped together a few faux pine stems, then, picked out the red tones in the cloth by tucking some red faux roses here and there into the pine needles. “Of course, candles add that special

glow but because this centrepiece lies close to the surface of the table I’ve placed groups of three tea-lights with artificial flames (battery operated) at intervals around the base,” says Di, “In this way there is no risk of foliage or napkin catching fire yet there is a sense of romance. “I suggest fastening red roses to serviettes with a little beading to carry the theme further out from the table centre. Red Christmas crackers will ensure the celebration goes off with a bang.” While the flowers might be artificial in both these settings, there’s nothing fake about the effect. And Di says other beautiful table settings are just as easy to create for a Kiwi Christmas celebration or New Year event.

NEW AUCKLAND SHOWROOM OPEN Unit I, 6 Polaris Pl, East Tamaki, Auckland. Phone 272 9165 or 273 8588.

COLLECTIONS: DINING FURNITURE | FABRIC COLLECTION INTERIOR ACCESSORIES | LEATHER COLLECTIONS STUDY FURNITURE | OCCASIONAL FURNITURE BEDROOM FURNITURE | LOUNGE SUITES

Our Aged Leather range is inspired by timeless original designs. The Italian top grain leather is hand aged after being uphlstered. The process retains the natural markings and pigmentation of the leather to ensure each piece is unique. Solid American Oak Country Style Dining Table, Sideboard with Antique Finish will add charm to your lovely dining room.

OWROOM: Unit I, 6 Polaris Place, NEW AUCKLAND SH East Tamaki, Auckland

E510210

U

O

RBAN A INTERIORS

www.urbanointeriors.co.nz

www.eastlife.co.nz

Phone 272 9165, 273 8588, Mobile 021 819 098

(check with us for showroom hours)

Christchurch store: 145 Blenheim Rd, Christchurch Ph +64 3 348 8358 Open 7 days 9am-5pm. We accept: eastlife | december 2013 |

53


Enjoy the good life at Acacia Cove

2010 RVA Manager of the Year Bruce Cullington

For those who appreciate the tranquility of an estuary setting Acacia Cove has it all, as well as its own restaurant, heated indoor pool, library, bowling green and new gym.

If youâ&#x20AC;&#x2122;re aged 55 or over, value your independence but want greater security, come and have a look at the superb properties we have to offer. A right to occupy dwelling at Acacia Cove Village is unsecured.

now *+ *+ call for more information

Wattle Farm Rd, Wattle Downs, Manurewa Ph 268 8522 www.acaciacovevillage.co.nz Email: acacia@kirkdale.co.nz

            Our Howick showroom has just had a makeover. +  ,)"-# *' ./ Come and enjoy the experience of viewing our ../ )" gorgeous collection* of tiles in- a relaxed and stylish  ' + 0 environment. E512095 E512095

Who could ask for more?

tiles 

Acacia Cove is a country-style village situated on the beautiful Wattle Downs Peninsula.

Whether you choose to live in a villa or one of our luxurious apartments, youâ&#x20AC;&#x2122;ll have the security of a 24 hour, fully monitored emergency call system built in.

 ph 0800 002 005

New Zealand Owned & Operated E54237

     HOWICK SHOWROOM 198 Moore Street Howick     ! ALBANY SHOWROOM Tawa Trade Centre,  "#$!%&'!( Shop5, 2 Tawa Drive, Albany)

    www.mobileceramics.co.nz

Deal with a Registered Pool Builder

Flexible living

Building and and Building servicing pools pools servicing in your your area area for for in 36 years years 36

Unlock the the true true protential protential of of your your backyard! backyard! Unlock StudioXtra can can make make dreams dreams of of a a home-based home-based office, office, extra extra StudioXtra bedroom, beauty beauty therapy therapy clinic, clinic, hobby hobby or or music music room room come come true true bedroom, providing you you with with the the additional additional living, living, guest guest accommodation accommodation or or providing so no no building building your own own private private escape. escape. The The studio studio is is under under 10m 10m22,, so your consent is is required required in in most most areas. areas. consent

Builders of of quality quality Builders custom-built custom-built concrete pools pools concrete

But wait, wait, thereâ&#x20AC;&#x2122;s thereâ&#x20AC;&#x2122;s Xtra... Xtra... we we have have 11 & &2 2 bedroom bedroom options options available available too. too. But sâ&#x20AC;˘ Affordable Affordable â&#x20AC;˘s Quality Quality finishing finishing â&#x20AC;˘s Saves Saves time time â&#x20AC;˘s Priced Priced from from $11,980 $11,980

118 Pakuranga Pakuranga H/way, H/way, Pakuranga Pakuranga 118 Ph 576 576 4413 4413 info@executivepools.co.nz info@executivepools.co.nz Ph Hours: Mon-Fri Mon-Fri 8am-5.30pm, 8am-5.30pm, Sat Sat 9am-2pm 9am-2pm Hours: www.executivepools.co.nz www.executivepools.co.nz E510038-v3 E510038-v3

54 || eastlife eastlife || december december 2013 2013 54

Phone Malcolm Malcolm on on 027 027 492 492 8504 8504 to to talk talk about about an an Phone affordable option for you or to arrange a viewing affordable option for you or to arrange a viewing

www.studioxtra.co.nz 53538-v2 53538-v2

www.eastlife.co.nz www.eastlife.co.nz


Kitchen recipe for 2014 As the end of the year draws closer, it’s time to sit back, relax and reflect on things that have been put off – a new kitchen, for example. At JAG KITCHENS a professional and skilled team will be available throughout the holiday period to help clients plan a new kitchen for the year ahead. The annual Auckland exodus may be happening yet again come the festive period, but Jag Kitchens is staying firmly put. The kitchen design company in the Danske Mobler Home Centre in Botany will be leaving its doors open from now until well after the New Year, excepting public holidays. This will come as good news to many who have been contemplating a new kitchen but have not been able to find the time to consider finer details. Of course, the task at hand can seem daunting especially when it comes to the multitude of choices on the market. Thankfully, this summer the entertaining season offers much in the way of inspiration from other kitchens. Discerning visitors and guests at the Jag showroom can take note of emerging trends and innovations in hardware, benchtops, cabinetry, storage solutions, colours and materials. Jag Kitchens’ director, Malcolm McLagan, recommends compiling a scrapbook or virtual board of favourite kitchen designs and ideas and exploring websites too. www.eastlife.co.nz

“But inevitably, the wealth of information may become overwhelming,” he says. “That’s when our designers can really help homeowners sort through their wish list, make comparisons, and discover design features they may never have known existed. “Importantly, we can show them how to make better use of space, improve on existing design or layouts and determine whether added building work needs to be done.” Malcolm says not all materials are created equal and the Jag team will explain differences in materials such as those used for benchtops and cabinetry. Advice on costs will also help clients to make the right choice to suit needs and budget, creating a stress-free experience. Specialising in custom-sized kitchens designed to exactly fit the room without resorting to filler panels, Jag Kitchens has its own manufacturing plant and also uses a sophisticated 3D computer design programme to show clients beforehand exactly how their new kitchen will look. Jag Kitchens designs and builds to all budgets and their advice and design service is FREE OF CHARGE.

Visit www.jagkitchens.co.nz for more information on a wide range of materials and design options or to see more kitchen examples.

Inside Danske Mobler, Botany Town Centre Open 7 Days, Phone 271 3131 www.jagkitchens.co.nz eastlife | december 2013 |

55


WE COULD HAVE THEM FOR BREAKFAST, BARBECUED WITH PEPPER AND LIME. Get ready for some serious barbecue performance. BeefEater barbecues are built tough. Seriously tough. The integrated Quartz Start® Ignition means they start first time every time. The cooktops won’t rust. And they’re made from heavy gauge steel with all the joints fully welded for rigidity, strength and a long life. The barbecues are fully modular and can be purchased in either mobile or built-in configuration and can be easily converted for use with natural gas. It’s a barbecue you can sink your teeth into.

Signature SL4000 from $8999

Signature S3000 from $3499

1100S Series from $2999

1100E Series from $1699

BUGG from $899 on stand

To view the full BeefEater range please visit beefeater.co.nz

56 | eastlife | december 2013

*Our quality commercial grade stainless steel construction and components come with a lifetime warranty across the Signature® series.

www.eastlife.co.nz E512109-V2


garden | eastlife

Small space secrets Tucked away in a sunny corner of Northpark there is a garden with heart – Ngaire Hart that is. This clever gardener has pumped energy and creativity into a small urban patch turning a once bare section into a fusion of pretty colours, varied textures and a palette of greens that range from soft sage to vibrant lime – a secret hideaway that begs to be shared. “My husband Kelvin and I bought the property in 1990 when it was just a house and land,” Ngaire says. “I started working from a top corner and gradually the outdoors took shape with arches, trellis and garden sculptures adding character.” Eight years later Ngaire’s cottage garden was a picture and had featured in an Uxbridge Garden Safari. “We were very content and then a real estate friend insisted we look at the original homestead in Santa Cruz Drive. My husband, being a builder, could see renovation potential. I didn’t particularly care for the house but I could see prospects in the garden!” The couple duly moved leaving the Northpark home tenanted. Over the next several years, Ngaire and Kelvin, whom some will remember as the marketing face of local subdivisions such as Dannemora and Cumbria Downs, worked on redeveloping house and garden. The latter was so admired that once

again Ngaire’s handiwork featured in another garden safari. Then, unexpectedly, tragedy struck. Kelvin was diagnosed with a terminal illness which quickly took its toll. “After Kelvin passed from this life I stayed at the Santa Cruz property for a couple of years then decided it was just too much to manage.” Fortuitously, Ngaire’s tenants announced they were on the move so instead of purchasing another home, she moved back to the Northpark house. “I completely renovated inside and then started on the garden which still had shape but was neglected and overgrown. There were modifications to be made and, in time, new landscaping ideas to try.” One idea that Ngaire reluctantly adopted has become a favourite part of her garden and it’s easy to see why. “Everyone was going subtropical so I thought I should try to keep up with the trend.” Subsequently, bromeliads, succulents, a gorgeous sago palm, pongas and more took root in a shady corner where Spanish moss hangs like a lace curtain and a demarcation line of Vireya rhododendron and camellias pout seasonal orange and crimson. “The area has really grown on me and now I just love the variegated leaves and the splashes of purple and red the bromeliads throw in.”

ngaire hart And at every turn of the year there is plenty of colour on show. While irises, freesias and tulips are now over, Ngaire’s flower beds have been filled with pansies, antirrhinums, foxgloves, lavender, sweet alyssum, begonias clivia, hosta and more. Hydrangea bushes are starting to bloom blue and pink, the snowball tree is going from green to white and soon, dahlias will bloom in a multitude of colours. Ngaire’s love for planting new finds, her eye for placement, plus gardening skills gleaned from years of home-

grown experience, have resulted in a tranquil and gladsome retreat. But she doesn’t under-estimate the beneficial effects of blood and bone, compost, horse manure and some excellent commercial plant foods. They all ensure her garden is coming up roses – literally. Indeed, there are roses everywhere – flower carpet roses, climbing roses, bush roses and standards – providing colour and fragrance. “I’ve always loved roses. Arches were put in so they could be covered in roses; they really do bring joy to a garden.”

FABULOUS NEW SHOWHOME NOW OPEN

NEW DESIGN – NEW INNOVATION

(09) 238 7777

www.platinumhomes.co.nz www.eastlife.co.nz

eastlife | december 2013 |

53843-V2

WHERE 67 Ina Ville Drive, Pukekohe (off Valley Road) WHEN 10am-4pm Monday-Friday 11am-4pm Saturday-Sunday

57


eastlife | christmas decorations

Pa rum pum pom-pom! By now, some families will be gaily singing, ‘deck the halls with boughs of holly’ while in others, the pre-Christmas mood might be a bit tense as festive pressures put a strain on time and finances. However, the resourceful people at community endeavour, The Log Cabin, Beachlands, have made it easy to create simple, cost-effective Christmas decorations to keep all ages busy as holidays begin.

1. Cut a piece of yarn about 15cm long and place lengthwise over first two fingers in readiness to tie wool once wrapped. Then wind yarn around fingers about 100 times. 2. Tie loosely with short length and slip off fingers. 3. Now tie more tightly with a couple of knots. 4. Cut through all the loops. 5. Trim to a ball shape (you will create a lot of waste).

Here Johannah Tremlett provides step-by-step instructions for making mini pom-poms, ideal for creating a variety of attractive decorations.

➊➋

6. Attach to a stick using a hot glue gun to create Christmas flowers or other decorative items.

Crafting a place in the community Goodwill and community spirit are alive and well at The Log Cabin, Beachlands where various groups and volunteers have pooled their resources to provide a wide-reaching programme of activities.

offering day time, after school and evening classes for all ages as well as school holiday programmes.

Manager, Jenny Carter, launched the volunteer-run initiative early this year

“We are keen to put our local arts and crafts culture on the map, to encourage local cottage industry and to foster that feeling of community here in Beachlands,”

says Jenny. “So far The Log Cabin has been the catalyst for art exhibitions, theatre performances, science workshops and a Bloke’s Shed Expo among other enterprises. “And this month we have organised Beachlands’ first Santa parade for Saturday, December 7. It will be part

of day-long festivities featuring crafts and food stalls, carol singing in the early evening and all sorts of fun.” And Log Cabin activities don’t stop with Christmas. During January, Monday to Thursday, they will include pre-school and kids art classes, board games, art/craft meets, a community morning tea, adult and children’s Spanish classes, an adult art class and a theatre group gathering.

S PRE SALE CHRISTMAS SALE UP TO FF OFF

%

50

%

Bob’s Promise: “Our Beds are made in NZ with Dreamfoam, kinder on you thanks to the elimination of many harmful toxins found in conventional foam.”

Bob’s Promise: “Our Beds are made in NZ with Dreamfoam, kinder on you thanks to the elimination of many harmful toxins found in conventional foam.”

n store except everday low Everything price in store except everday low price

Uno AY

Single Mattress W and Base

S

Now $399

Epic pop up Serenity Milford Queen Essence Slat Frame EVERYDAY + Uno Mattress Minimal partner

LOW

Perfect for the spare room

disturbance & Made with NZ Pine PRICES exceptional value

Serenity Essence

EVERYDAY % 50 LOW

OFF PRICES

Minimal partner disturbance & exceptional value

50% OFF

Double

Everyday $499 Queen Set RRP RRP $999 $4199 Queen Set Queen

Everyday $549 Now

$2099 Now $699

King Single

Now $999

Queen Set RRP $4199

Now $2099

We deliver, set up and take your old bed away. OPEN 7 DAYS.

BRUS-003308 DECEMBER 2013

BOTANY,

NEWMARKET

In Hunter Furniture store in 27 Crowhurst Street the “Botany Town Centre” Ph: 09 523 4101 behind 58 Pak|neastlife Save, | december FREE PARKING 2013  Ph: 09 271 6387

ALBANY

The Gateway, Corban Ave, 260 Oteha Valley Rd Ph: 09 447 3983 FREE PARKING

WAIRAU PARK 8d Link Drive (next to ASB Bank) Ph: 09 443 3922 FREE PARKING

www.eastlife.co.nz

www.bobsbeds.co.nz www.bobsbeds.co.nz Bob Flanagan-Owner www.bobsbeds.co.nz

www.bobsbeds.co.nz

E512105


The special people ‘ Nick Neben is a director of specialist renovation company Smith & Sons Howick and a time-served builder of more than 30 years experience.

Christmas has always been a very poignant time of the year for me, not in a sad way; more in a happy, touching way. So, as it approaches I am again going to digress from the topic of building and talk about someone who has brought joy and tolerance into my life. Growing up as the junior member in a trio of male siblings, I have always been in awe of my oldest brother Michael (or Mikey as we call him). Born with a chromosome abnormality, Mikey has given me a great appreciation of many aspects of my life. At 52, he continues to astound me with his excitement and enthusiasm when it comes to all things Christmas. Downs Syndrome affects about one

in every thousand children born in New Zealand. Once a taboo subject, people, today, are more educated and accepting of Downs kids who now have the opportunity to attend mainstream schools and to lead fairly normal adult lives. As a young mother with three boys under the age of five, and knowing very little about raising a Downs Syndrome child, my mum coped amazingly well . . . considering the strife we all put her through! I don’t think it helped that Mikey had two great allies in his younger brothers who could see no wrong in anything he did. I remember following him, from letterbox to letterbox, in the small cul-de-sac where we lived, peeling the silver tinfoil tops off freshly

Having a special brother in Mikey has taught me to be understanding, compassionate and very proud. I consider these attributes to be a by-product of having such an amazing brother and family.”

delivered milk bottles and downing the top portion of cream! Mikey was a legend to my brother Alan and I – our neighbours weren’t quite so appreciative. Having a special brother in Mikey has taught me to be understanding, compassionate and very proud. I consider these attributes to be a by-product of having such an amazing brother and family.

comment | eastlife

Whether it be Santa Claus, Easter Bunny, a birthday party or just a barbecue with family and friends, Mikey embraces the occasion and will always put a smile on your face. Once again, I have a lot to look forward to this Christmas. Now, having digressed yet again from the topic of building, I must say I’ve had some flak from my younger sister regarding my EastLife column – “love your column” she said “but where are the building tips?” So, from next year I will try to mix it up a bit with a few building tips, some stories and maybe the odd joke or two. But before I go, here’s one tip for readers – if you don’t know what you are doing, call in the experts! It usually costs two to three times more to fix a botched DIY building job. Thanks to the team at EastLife and to all readers, have a happy and safe Christmas.

E513056

www.eastlife.co.nz

eastlife | december 2013 |

59


eastlife | comment

Is your trust doing its job? Fencible Law Director, Lawyer & Entrepreneur, RICHARD GALBRAITH, with his take on current legal & business issues affecting our community. The family trust has increased in popularity tenfold in New Zealand over the past two decades. With an estimated 300,000 and 500,000 trusts of various sorts in New Zealand we have one of the highest family trust ratios per family in the world. Family trusts are established for many reasons but mainly for the protection of family assets from creditors, relationship break-ups and residential

care costs. Inevitably, the residential care aspect will put significant pressure on the Government if every family has a family trust and, on needing to go into care, says, “I don’t have any assets they’re all in a family trust so can you pay for my care Mr Key at $1000 per week?” The Government has commissioned the Law Commission to look into the entire area of trusts and it

recommended in a report, released on September 11, 2013, that a new Trust Act be passed to completely modernise the law of trusts. I believe it is inevitable the Trusts Act will pass. Therefore it is essential that Family Trust’s are reviewed as these changes take place. You will only benefit from your trust if it is correctly administered and maintained. My recommendations are as follows: • You should have a professional and paid independent trustee.I do not recommend taking on the role of trustee as a “friend” of the settlors who set up the trust. The obligations

of trustees are increasing and will get more onerous under the new regime. • Trustees should meet at least once a year even if gifting has been completed to record any trust business. If no business has been completed in that year, a minute should still record the meeting. • Trusts cost money to maintain but in the long run you will give yourself the best chance of benefiting from the trust if this investment has and continues to be made. Finally, best wishes to the Howick and Pakuranga community for the festive period and New Year.

How to handle Laterism, Soonerism and Nowism Bill Potter – the Business Maverick. Bill is a Speaker, FriendCoach*, blogger, author and... The 3Guy*. www.speakers.co.nz/billpotter.html www.btob.co.nz/the-business-maverick

Part two This is the second part of my sojourn into decision-making. The first appeared in the November issue of EastLife. You read it, right? Of course you did. Phew. People ‘do stuff’ soon, later or now. One EastLife reader suggested that there is a fourth option... Never.

We never say never! So, here are my five suggested antidotes to deal with ‘Soonerism’ and ‘Laterism’ because ‘Nowism’ is covered by us, already doing it. Start every task analysis with the positive version of... ‘What if?’ Keep it balanced by asking both, ‘what if I do’, and ‘what if I don’t, do this?’ Now grade the task 1-5, with 1 being ‘vital’.

us choose ‘urgent’ first.

always more talented than you think you are. You are!

Thirdly, do not be seduced by ‘shortterm gains’ often wrapped up in promos that promise the world, but eventually only deliver Easter Island. Fourthly, know that we are first driven by our ‘wants’, then our ‘fears’ and finally, our ‘needs’. The correct order is, of course, ‘needs’, ‘fears’ and only then, ‘wants’. Finally, our three biggest obstacles to doing anything are... You’re scared. You’re disorganised.

We teach StratPlan©, in our ‘Online 3Percenter Course (O3C)©’. Enrolments, to start in January 2014, are open... NOW. Intake #1 is limited to 20 enrolments worldwide, for the Go-getters whom I coach personally. It is the world’s only ‘maverick’ personal transformation course. Scary! Just remember that you are not alone. If the task is important, grab others, and do it together. • ORTS LAW

You don’t believe in yourself. For #1, I sent him to the bathroom to wash ask yourself, ‘what is the worst that IES • LENDING • SP • KYLIE CIET DING S & SO • BUILOK? ES his mouth out with detergent (well, Then, base your ‘action’ decisionsD onGALB canRA happen?’. ForUB #2 create planning live a half-life. Ta.DE Cheers. ITH • CL OMIS PRDon’t R RY TA EL • EN AR AJ AM CH TEST S • RI Too many of TE soap was too kindly...). over ‘urgent’. tools. For N #3,•understand that you are  NYA DU–NR duitdammit@xtra.co.nz FA JA • LAVA LS • ESTA IL‘important’ IBLE LAW ON • SA • INCAPACITY OPERTY • W ATS • FENC Y PROTECTI

T • CAVE CING • PR TRUCTION Y • FAMIL IT TITLES • CONVEYAN ITH • CONS EMPLOYMEN W • CUSTOD ULLOUGH • KIM GALBRA NDOR NANCIES • UN • • FAMILY LA CC TE G D M L IN EL Y IA FI LL NC NT NI FE KE DE • SS LAW • VE • TO SI S NE NS IP RE SI IO • SH IS BU ES • IV ON E AG TI BD CIETI NC LA TG SU SO • GE RE OR & E LI T M DI • S RN UL E ES UB AD DU CL NC OSBO H• CT COURT • SAFA JAN • ASES • LICE • RI D GALBRAIT LE S ST • AR RY TE DI TA CH TS • TA RI EN EN • ER ES • AM SF LAW • EASEM TION • TEST ERTY • WILLS • LAND TRAN ASE TITLES ISTRATION A DUNRAJ • MILY PROTEC CING • PROP • CROSS LE S OF ADMIN STODY • FA TY • LAVANY • CONVEYAN CI ER CU W • TT PA LA W LE CA • LA LE IN E Y • IB S LEASE IL NC M ON OS TI FE FA • CR • PROBAT UC • D D W TR EL EL LA FI NS NI FI LE S • TONI LBRAITH • CO T • CAVEATS • FENCIB TENANCIES TS LAW • TO L GA IA OR M WARRANTIE NT SP KI • • DE G G SI MEN NCIN S • LENDIN TGAGES • RE • BUSINESS H • EMPLOY OR ISIONS • FE E M IV UG • NC BD LO & SOCIETIE GE ES SU LI UL • CC E DI CENC • BUILDING S • KELLY M COURT • DU RICHARD DUNRAJ • LI IP • A CT S SH NY RI TE ON VA ST PROMISES TA TI DI LA • LA • • ES TRANSFER • ADULT RE TY • WILLS TS • LEASES ECTION ER ND EN OT LA M OP • PR SE PR N • Y EA IO ELDER LAW IL • AT M E CING ADMINISTR STODY • FA LIE OSBORN CONVEYAN • CU OF • • S ON W W TI ER LA LA TT UC Y LE LE IL TR TITLES • KY • M NS NCIB • PROBATE • NI FIELD • FA NCING • CO Y COURT • FE ISIONS • FE NCIBLE LAW • UNIT TITLES TS LAW • TO IV IES • FAMIL FE OR • NT BD S SP RA SU • AT • AR G E VE W IN RN OBATE OR OYMENT • CA ETIES • LEND KYLIE OSBO TITLES • PR LAW • VEND PL • CI IT EM SO NG UN • & • DI H S S IL IE UG ILLS • CLUB ULLO NANC ISES • BU VENDOR • W GALBRAITH KELLY MCC DENTIAL TE TARY PROM ONSHIPS • NESS LAW • AGES • RESI • TESTAMEN RAITH • ULT RELATI NCE • BUSI ES • MORTG LB AD GE • SAFA JAN • NC GA LI W DI CE M LA E LI KI • • R T • DU TES • ELDE LEASES • FAMILY RICT COUR ILLS • ESTA INCAPACITY SEMENTS • • CUSTODY SFER • DIST OPERTY • W E TITLES • EA FAMILY LAW • LAND TRAN ANCING • PR • G • KIM N EY D IN IO NV EL CROSS LEAS NC AT FI CO FE TR • NI • H NS • TO LAW ADMINIS SUBDIVISIO ORTS LAW • FENCIBLE MCCULLOUG • T Y SP E • LL UR RN G • LETTERS OF KE IN CO BO • Y S ND OS IES • FAMIL NG • KYLIE LATIONSHIP ES • CIETIES • LE DI RE AG SO IL T & TG BU UL S • OR • WARRANT AD UB M ES • • IS ES LAW LBRAITH • CL TARY PROM ES • LICENC AJ • ELDER COURT • DU RICHARD GA • TESTAMEN ENTS • LEAS • DISTRICT VANYA DUNR • SAFA JAN TRANSFER ES • EASEM PACITY • LA TL TY • WILLS ND CA TI ER LA E IN • • OP AS N PR LE ON PROTECTION IO • TI S AT LAW • CROS ADMINISTR • CONSTRUC NVEYANCING H LE OF STODY • CO IT IB S • CU RA W NC • ER LB LA TT W FE • GA LA • LE T • FENCIBLE D • FAMILY T • CAVEATS • PROBATE EL UR EN FI ING • KIM ES M CO NI TL Y NC OY TI IL TO FE PL M • IT • W • EM NS • FA • UN SUBDIVISIO • SPORTS LA ARRANTIES TENANCIES • W G L E ULLOUG IN IA OR RN NT CC ND ND BO M LE DE Y VE • • S E OS RESI SHIPS • KELL & SOCIETIE SINESS LAW DING • KYLI S IL ON BU • TI UB • BU • LA E ES CL • RE NC AG ES H T IS DILIGE PROM • MORTG GALBRAIT R LAW • ADUL AMENTARY • LICENCES • RICHARD Kylie Osborne ESField AJ • ELDE N • TEST CT COURT • LEASToni DUNR RI • JA A KimSGalbraith Kelly McCullough Richard Galbraith Lavanya Dunraj Safa Jan • ESTATE ST TS FA NY DI SA EN • VA • M ER LA SE TY CITY • TRANSF ND PROTECTION LegalTI E TITLES • EA Lawyer • LA ON • INCAPA Lawyer NG • PROPER FAMILYAccountant Executive Director Legal Executive Legal CIAssistant ISTRATION EYAN CROSS LEAS • CONSTRUC IBLE LAW • S OF ADMIN LAW • CONV Y LAW • ER NC IL LE M TT FE IB • GALBRAITH FA LE NC S • • E FE D AT • T FIEL ENT • CAVE ES • PROBAT MILY COUR LAW • TONI IVISIONS • EMPLOYM S • UNIT TITL RANTIES • FA G • SPORTS RNE • SUBD L TENANCIE VENDOR WAR KYLIE OSBO IES • LENDIN SHIPS • • • ET W ON CI NG TI LA DI SO LA RESIDENTIA IL SS & S NE • BU ULT RE www.fenciblelaw.co.nz phone 533 3539 NCE • BUSI RAITH • CLUB AMENTARY PROMISES R LAW • AD • LICENCE LB DE ES GA EL • AS D DUE DILIGE LE AR AJ ST TS • VANYA DUNR TATES • RICH FA JAN • TE • EASEMEN LA • SA ES • TY TL CI ON TI TI E PA • WILLS • ES CA LEAS PR 60 | eastlife | december 2013  OTECH • CONSTRUCTION • IN www.eastlife.co.nz FAMILY W • CROSS CUSTODY • FENCIBLE LA M GALBRAIT CAVEATS • KI • • T G EN IN M NC OY PL • FE EM • H UG ULLO KELLY MCC

0800 fencible

E513062-v4

“Make it happen! ”


real estate | eastlife

Auctions

It’s that time of year again – Sell Now!

favoured sale method

There’s no point going on a diet or rearranging the furniture because it will soon be Christmas and there’ll be too much food and too much family to slim or tidy.

Total Focus Principal, Greg Roy areinz, gives an update on the local real estate market happenings. October’s sales figures are out and the greater Howick area has again seen another small drop in the median house price to $727,550 – down from $730,500 for September and the all time high of $740,000 struck in August. Looking at figures for October, released by the REINZ, our area is going against the trend slightly compared to the nation overall. The national median house price rose by $7,525 (+1.9%), up from $400,000 in September, to reach a new high of $407,525 for October. Compared to October 2012, the national median house price increased by $27,525 (+7.2%). Three regions also recorded new median highs in October. They were Auckland(the region overall), Canterbury/Westland and Waikato/ Bay of Plenty, with Auckland reaching $582,000. This represents a 12.6% increase from October 2012 for Auckland. REINZ has also been looking to see if sales volumes over the regions and across the nation have been affected by the new LVR rules imposed by the reserve bank. Data shows there

SOLD

were 6,778 unconditional residential sales in October, a 2.1% increase on October 2012, and an increase of 0.9% compared to September 2013. On a seasonally adjusted basis the volume of residential sales fell 4.1%, indicating that sales in October were not as high as would be normally expected at this time of year. REINZ concluded that: “The full effect on prices of the new LVR restrictions may not show up in the national or regional medians for a few months as buyers with pre-approvals make their purchases and the market adjusts to these new conditions.” Auctions still appear to be a very favoured method of sale with 43.0% of all dwelling sales in Auckland (region overall) being sold by auction in October; up from the 38.0% in October 2012 but very slightly down from the record 43.8% recorded in September 2013. Traditionally, the market slows over Christmas and we can only wait and watch with interest how it starts and progresses in the New Year. Wishing everyone a safe and Merry Christmas.

SOLD

SOLD

SOLD

And, if you’re planning to sell, there’s all those people telling you that the real estate agents will be shutting down in a couple of weeks and won’t be back on the job until the end of January, 2014. So you may as well have a great Christmas, get fat on the ham, turkey, trifle and Christmas cake and think about selling when the rellies have left in January! Or should you? Although a few locals leave Auckland over the school holidays, the overseas visitors come in and guess what? They’re often the neighbour’s rellies. What’s more, they could be your new best friends especially if they see a sign on your property advertising it FOR SALE and they buy it – (not all the agents close their doors!) Don’t forget the weather’s sure to be great when those out of towners visit the neighbours or other families in your street. And they’ll be walking right past your place. So, what better time for them to be looking at moving into your neighbourhood than over Christmas when they are enjoying being close

SOLD

to family and, miraculously, your house is available to buy. Get them while they’re feeling warm and fuzzy and they could be giving you what you want for the place before you know it! Secondly, did you know that the festive season spawns the greatest amount of work for matrimonial lawyers in the New Year. Apparently, spending all that time over the holidays with the one you adore is known to aggravate and multiply disharmony between partners, especially those that have been together for longer than the relationship’s use by date. Let’s hope this isn’t the reason for thoughts of selling. But if it is, do it before the proverbial hits the fan. Better still, if you want to beat the rush, list your property now... put it on the market this side of Christmas! It will also help keep the kids on their best behaviour if they know that the house has to be in tip top presentation ready to sell at all times. You never know, you might just get through Christmas unscathed and with a lot more money in your pocket than you’ve spent on presents, all ready to throw at those New Year’s resolutions such as... buying a new home! – Eric Chase

SOLD

MERRY CHRISTMAS

to all my clients and thank you for your support over 2013. Thinking of a fresh start for 2014? Let my expertise help you to achieve your dreams. At Barfoot & Thompson, we work as a team with no boundaries or restrictions, so any one of our 1,400 plus salespeople can sell your property. That’s just one of the reasons we’re Auckland’s market leader.

Contact me today, and get the whole Barfoot & Thompson team working to deliver a premium price for your property.

Eric Koh AREINZ, B.Sc. (Hons) M: 021 388 383 | AH: 09 929 4433 E: e.koh@barfoot.co.nz O: 09 271 6199 | www.barfoot.co.nz www.eastlife.co.nz

eastlife | december 2013 |

61 E510126-v3


DRIVE Available in both two- and fourwheel drive, the latter with Nissan’s ALL-MODE 4x4-i system, Pathfinder retains the ability to go off road but with improved comfort and more technology.

The old model’s diesel is gone; all new Pathfinder models have a 3.5 litre V6 petrol engine mated to an X-Tronic CVT transmission.

The entry level $54,990 Pathfinder ST comes with 2WD. The mid range ST at $59,990 and the flagship Pathfinder Ti for $65,990 have 4WD.

With 193kWs of power and 325Nm of torque, Pathfinder returns class

All three models sit on 18 inch

9G>K

B6CJ@6JC>HH6C B6CJ@6JC>HH6C .8VkZcY^h]9g^kZ .8VkZcY^h]9g^kZ E%.'+&)%%% E%.'+&)%%% lll#bVcj`Vjc^hhVc#Xd#co lll#bVcj`Vjc^hhVc#Xd#co

DJCI9G>K: <G::CB

:GE A68:

DJCI9G>K: <G::CB

GDC

E%.'+&)%%% lll#bVcj`Vjc^hhVc#Xd#co

DJCI9G>K: <G::CB

:GE

GDC

9G>K :GE

69

69

J:

9G>K

9

A68:

J:

B6CJ@6JC>HH6C .8VkZcY^h]9g^kZ =6GG >HGD

>C66 K:C

6K: C

A68:

9>C6

=6GG >HGD 6

69 GD

69 GD

J J@6 B6C H6C C>H

Beaurepaires

E%.'+&)%%% lll#bVcj`Vjc^hhVc#Xd#co

: G>K >K:=9 9 CG9>H = H 6K 8C>6 C:9>C C9 66K 86K: :CJ :

C6C

>HGD

69 GD

J J@6 B6C H6C C>H

 I= DJ

 I= DJ

B6CJ@6JC>HH6C

trading as .8VkZcY^h]9g^kZ

>K: 7>:9G A6B

69 GD

: G>K =9 C9>H 86K:

>K: 7>:9G A6B

 I= DJ 6C

G>G

I:>

:

G>K

9 <>

I:>

>K: 7>:9G A6B

IH :6 <G

IH :6 <G

J J@6 B6C H6C C>H

'=6C9NH:GK>8:AD86I>DCH

: G>K =9 C9>H C6C 86K: 9

:

G>K

9 >K: <> 9G 6C <> >G 6C :>G G>G I

G>G

I:>

=6GG

 I= DJ

>K:

9G

<>

6C

'=6C9NH:GK>8:AD86I>DCH '=6C9NH:GK>8:AD86I>DCH

J J@6 B6C H6C C>H

HOWICK TYRES & ALIGNMENT

leading fuel consumption figures.

'=6C9NH:GK>8:

>K: 7>:9G A6B

Extending a warm invitation to buyers to call in, browse and have a chat with the team, Jeremy says: “We have fantastic opening specials on all vehicles. Come and check them out.”

Manufactured at Nissan’s Smyrna Plant in Tennessee, United States, the three model range has unibody construction instead of the previous model’s separate body and ladder chassis.

IH :6 <G

Having risen through the ranks of the automotive industry to earn an established reputation, Jeremy is keen to step up his game with a newly appointed team consisting of dedicated Nissan specialists. “Our team of experts offer service and advice that are second to none and have experiences to match.”

Pathfinder is now significantly less utilitarian and more on-road focused than the previous diesel 4WD-only model.

Nissan says that Pathfinder’s unibody ‘delivers a more car-like driving experience and impressive comfort’.Styling is softer to match, and all versions come with seven seats which make it more familyfriendly.

IH :6 <G

Manukau Nissan dealer principal Jeremy Spicer, who hails from Wellington, says it’s great to be back. “It’s been four years since Nissan has had a presence in the south eastern quarter and we are starting afresh with a state-ofthe art establishment – essentially the largest Nissan dealership in Auckland,” he says.

Nissan’s all-new Pathfinder marks a major shift in direction for this popular SUV.

GDC

Located on Cavendish Drive, in the heart of Great South Rd’s motoring precinct, the sparkling new showroom offers the complete Nissan experience, with all the latest models and much more on display.

New path for Nissan

69

Christmas is revving up to be a smooth one thanks to a brand new Nissan dealership in Manukau which returns the marque to this central location after a long hiatus.

=6GG >HGD

NISSAN’S BACK

B6CJ@ -Gdc9

E%.',' lll#bV

HJE:GH:GK>8:HE

B6CJ@6JC>HH6C7DI6CN B6CJ@6JC>HH6C7DI6CN -Gdc9g^kZgEaVXZ -Gdc9g^kZgEaVXZ E%.','&*&% E%.','&*&% lll#bVcj`Vjc^hhVc#Xd#co lll#bVcj`Vjc^hhVc#Xd#co

NISSAN HJE:GH:GK>8:HE:8>6AH HJE:GH:GK>8:HE:8>6AH

B6CJ@6JC>HH6C7DI6CN -Gdc9g^kZgEaVXZ E%.','&*&% lll#bVcj`Vjc^hhVc#Xd#co

PS

PS

P EXP SER

BV`ZVcVeed l]ZcndjWg^c PSan appointment Howick YZh^\cZYhZgk^XZji^a^h^c\i]ZaViZhihZgk^X^c\iZX]c^fj PS Make for a Nissan Express EXPRESS EXPRESS NISSAN \Zcj^cZeVgih!VeegdkZYajWg^XVcihVcYndjÉaa\Zi^iVaa NISSAN SERVICE ServiceSERVICE and when you bring your vehicle EXPRESS PS in,NISSAN you’ll get a specially designed service Locally owned and operated by SERVICE utilising thePS latest PS servicing techniques PS BV`ZVcVeed^cibZci[dgVC^hhVc:megZhhHZgk^XZVcY EXPRESS Mad Mike for more than 25 years NISSAN and Nissan diagnostic equipment, genuine BV`ZVcVeed^cibZci[dgVC^hhVc:megZhhHZgk^XZVcY EXPRESS NISSAN SERVICE SERVICEl]ZcndjWg^c\ndjgkZ]^XaZ^c!ndjÉaa\ZiVheZX^Vaan parts, approved lubricants and you’ll get it l]ZcndjWg^c\ndjgkZ]^XaZ^c!ndjÉaa\ZiVheZX^Vaan YZh^\cZYhZgk^XZji^a^h^c\i]ZaViZhihZgk^X^c\iZX]c^fjZhVcYC^hhVcY^V\cdhi^XZfj^ebZci! PS all in around 90 minutes. YZh^\cZYhZgk^XZji^a^h^c\i]ZaViZhihZgk^X^c\iZX]c^fjZhVcYC^hhVcY^V\cdhi^XZfj^ebZci! EXPRESS \Zcj^cZeVgih!VeegdkZYajWg^XVcihVcYndjÉaa\Zi^iVaa^cVgdjcY.%b^ch# NISSAN SERVICE \Zcj^cZeVgih!VeegdkZYajWg^XVcihVcYndjÉaa\Zi^iVaa^cVgdjcY.%b^ch# EXPRESS NISSAN EXPRESS SERVICE EXPRESS NISSAN NISSAN SERVICE PS PS SERVICE :ciZgd BV`ZVcVeed^cibZci[dgVC^hhVc:megZhhHZgk^XZVcY PSOnly MANUKAU EXPRESS CONDITIONS: NISSAN BOOK IN PSNISSAN SERVICE one voucher per i]ZXd l]ZcndjWg^c\ndjgkZ]^XaZ^c!ndjÉaa\ZiVheZX^Vaan 9 Cavendish Drive invoice. Only one WOF CHECK YZh^\cZYhZgk^XZji^a^h^c\i]ZaViZhihZgk^X^c\iZX]c^fjZhVcYC^hhVcY^V\cdhi^XZfj^ebZci! Ph 261 4000 8]g^hib voucher per visit. 7:H6;:6C9H::8A:6GAN Bookings essential. \Zcj^cZeVgih!VeegdkZYajWg^XVcihVcYndjÉaa\Zi^iVaa^cVgdjcY.%b^ch# • FREE CRC Nuvu l]Zcn MANUKAU NISSAN Offers only available EXPRESS EXPRESS NISSAN NISSAN upon presentation of ™ ;G::8G8Cjkjl^cYhXgZZc d[[Zgh BOTANY windscreen washer SERVICE SERVICE EXPRESS :ciZgdjgheZX^Va8]g^hibVhYgVlidl^c NISSAN voucher to reception EXPRESS PS 8lVh]Zgide"je Ron:ciZgdjgheZX^Va8]g^hibVhYgVlidl^c Driver Pl SERVICE PS ldg`d NISSAN top-up at time of vehicle i]ZXdhid[ndjghZgk^XZ$gZeV^gWVX`eajhV]j\Z SERVICE Ph 272 1510 PS Valid until ;g^YVn i]ZXdhid[ndjghZgk^XZ$gZeV^gWVX`eajhV]j\Z • FREE wiper blade refills drop-off. ™;G::cZll^eZgWaVYZgZÒaah December 31, 2013 8]g^hibVh=VbeZg[jaad[\ddY^Zh[gdbjh! 7:H6;:6C9H::8A:6GAN www.manukaunissan.co.nz 8]g^hibVh=VbeZg[jaad[\ddY^Zh[gdbjh! l]ZcndjXVaa^c[dgVcnd[i]ZhZheZX^Va 7:H6;:6C9H::8A:6GAN E512086 8dbeZi E512097 l]ZcndjXVaa^c[dgVcnd[i]ZhZheZX^Va ™;G::8G8Cjkjl^cYhXgZZc d[[ZghdgVcnHZgk^XZdggZeV^g 8DC9>I>DCH/ EXPRESS '%$&'$ EXPRESS ÕDcandcZkdjX]ZgeZg^ckd^XZbVnWZjhZY NISSAN lVh]Zgide"je ™;G::8G8Cjkjl^cYhXgZZc ldg`dcndjgkZ]^XaZWZ[dgZ d[[ZghdgVcnHZgk^XZdggZeV^g NISSAN SERVICE 62 | eastlife | november 2013 www.eastlife.co.nz SERVICE ÕDcandcZkdjX]ZgeZgk^h^ibVnWZjhZY 8]g^hibV :ciZgdjgheZX^Va8]g^hibVhYgVlidl^c EXPRESS ;g^YVn'%9ZXZbWZg'%&( lVh]Zgide"je ldg`dcndjgkZ]^XaZWZ[dgZ NISSAN Õ7dd`^c\hVgZZhhZci^Va PS ™;G::cZll^eZgWaVYZgZÒaah GZ[jcY SERVICE i]ZXdhid[ndjghZgk^XZ$gZeV^gWVX`eajhV]j\Z ÕD[[ZghdcanVkV^aVWaZjedcegZhZciVi^dcd[ndjgkdjX]Zg ;g^YVn'%9ZXZbWZg'%&( Wn*#%%e ™;G::cZll^eZgWaVYZgZÒaah EXPRESS SERVICE

NISSAN

HJE:GH:GK>8:HE:8>6AH

33 Wellington Street, Howick

$29 7DD@  '. '. 7DD@ >CLD;8=:8@

Proud supporter of the local community



'. 7DD@

>CLD;8=:8@ L>CI=:8DHID;NDJG H:GK>8:768@ 6=J<: MB6H=6BE:GLDGI=(%%

7:H6;:6C9H::8A:6GAN

8]g^hibVh=VbeZg[jaad[\ddY^Zh[gdbjh! 8DC9>I>DCH/ l]ZcndjXVaa^c[dgVcnd[i]ZhZheZX^Va ÕDcandcZkdjX]ZgeZg^ckd^XZbVnWZjhZY



>CLD;8=:8@

✆ 534 4975

'. 7DD@ 

TWO HANDY LOCATIONS

>CLD;8=:8@ L>CI=:8DHID;NDJG L>CI=:8DHID;NDJG

L>C H:G MB6

H:GK>8:768@ 6=J<: H:GK>8:768@ 6=J<: MB6H=6BE:GLDGI=(%% MB6H=6BE:GLDGI=(%%

B6CJ@6

idgZXZei^dcVii^bZd[kZ]^XaZYgde"d[[ 8dbeZi^i^dcXadhZh*#%%eb ÕKVa^Yjci^a(&9ZXZbWZg'%&(

'%$&'$&(L^ccZgcdi^ÒZYY^gZXi# 8dbeZi^i^dcXadhZh*#%%eb


50

$

OFF yOur next service* test rating from ANCAP (Australian New Car Assessment Programme) with front and rear crumple zones, the comprehensive braking and chassis control package and two front, two side, and multiple curtain airbags.

The four wheel disc brakes are backed up by an anti-lock brake system with electronic brake force distribution, vehicle dynamic control and traction control. The 4WD models also come with a hill start assistance system.

All three Pathfinder models have a long list of standard equipment.

Pathfinder sits on a 2900 mm long wheelbase to liberate ample interior room thanks to the 5008 mm overall length and 1960 mm width.

A seven inch colour display provides information on all the vehicle’s major systems, including the reversing camera which is complemented by rear sensors.

Importantly, the all new Pathfinder has already gained a five-star crash

Controls for the audio system, there’s Bluetooth phone capability, and a six-speaker sound system that’s USB, iPod and MP3 compatible.

An EZ Flex seating system has a

60/40 split second row seat and a 50/50 split third row for a myriad of seating and cargo combinations. There are 10 cup holders and six bottle holders spread throughout the cabin plus four power outlets for running or re-charging electrical accessories. The range-topping Ti model adds full leather upholstery, a front sunroof and large panoramic glass roof with shade cover in the rear, and the passenger’s seat gets power adjustment. Both front seats are heated – great on frosty mornings! New Pathfinder now tackles Mazda CX-9 and Ford Territory head on, and gives Nissan a strong contender in the competitive large lifestyle SUV market segment.

All our work includes 12 month or 20,000km warranty on new parts and labour PANMURE

EAST TAMAKI

1-5 Jellicoe Rd, (just off the roundabout)

77 Greenmount Drive, East Tamaki

PH 570 7163

PH 272 7139

GET ONLINE @

aa.co.nz/autoservice *TERMS AND CONDITIONS: • Offer expires January 31, 2014 • The advert (voucher) must be presented to redeem the advertised offer • This voucher cannot be used in conjunction with any other offer or promotion • Only one voucher per customer • Voucher is not redeemable in part or in full for cash • A damaged or defaced voucher will not be accepted • Services start from $149 including GST and excludes Express Service and WoF • Voucher is only valid at Panmure or East Tamaki AA Auto Service & Repair

E513033-V7

alloy wheels with a tyre pressure monitoring system. MacPherson strut front and multi link rear suspension is used. They include speed sensitive electric power steering with an 11.8 metre turning circle.

NOT AN AA MEMBER? NOT A PROBLEM! EVERYONE IS WELCOME

MANUKAU NISSAN

AUCKLAND’S NEWEST NISSAN DEALERSHIP IS NOW OPEN! Gt

TH

th Sou

M

Rd

N ER AY W OR OT

Lambie Dri

ve

M

U SO

AU UK AN r D AN SS I sh N di en v a C

d ui R

in Puh

t Rd

Redoub

SOUTH WESTERN

MOTORWAY

DRIVE TO CAVENDISH VENDISH D DRIVE FOR AUCKLAND’S BEST DEAL ON A NISSAN.

EX-DEMO PULSAR OPENING SPECIAL 0

$7,00 SAVE UP TORR P OFF NEW

NEW NAVARA

OPENING SPECIAL 00

2,0 SAVE UP TO $1 RRP OFF NEW

NEW X-TRAIL

OPENING SPECIAL 0,000 SAVE UP TO $1 RRP OFF NEW

E512080-v2

www.manukaunissan.co.nz www.eastlife.co.nz

09 261 4000 • 17 Cavendish Drive • OPEN 7 DAYS Part of Australasia’s Largest Automotive Group

eastlife | november 2013 |

63


directory Are you running into a brick wall - trying to get your Rands out of South Africa?

LAWYERS

•COMPANIES •SELF EMPLOYED •CONTRACTORS •RENTAL PROPERTIES •GST RETURNS • TAX RETURNS

Reliability, Integrity, Experience

For aLL your LegaL needs

mullerlaw

Part of the Rand Group Retirement Annuities Pension

View more details at

www.patcallinan.co.nz

Rand out

Pay an invoice in SA?

Inheritance

Transfer in 16 currencies!



 

  or email karend@patcallinan.co.nz 0800 726 373 Call today to claim what’s yours!  Level 1, Plaza Tower,  

Pakuranga Plaza Ph 576 7047 22 Picton St, Howick. www.mullerlaw.co.nz  



info@randreunite.com

  

www.randreunite.com

E512056







   Maria Stephens  





Phone 533-8420    



0800 008 018







  maria@mariastephens.co.nz  



KNOW HOW



Responsible business  www.mariastephens.co.nz    with lasting relationships    in the community 

to maximise the value of your property

List your home       with me and take Home Loans,     advantage of  Business Loans,   our low 2.5% fixed   commission rate*. Insurances  *Rate is GST exclusive    www.kiwimortgages.net.nz         Freephone 0508 33 22 11 Haig Robinson Realty  Ph 533 7567, 021  030 8135 

Carolynne Scott Licensee Branch Manager

Ph DDI: 09 538 1208 Mobile: 0274 991 466 Email: carolynne.scott@raywhite.com

 

   info@kiwimortgages.net.nz 

Licensed Real Estate Agent REAA 2008, MREINZ

   

E512063







E125091



Building and servicing pools in your area for 36 years

Ph: 527-6835 Email: K i m kveltman@ihug.co.nz V e l t m a n 49 Pakuranga Road, A r c h i t e c t u r e Pakuranga

www.executivepools.co.nz 118 Pakuranga Highway Phone 576 4413

www.kimveltman.co.nz

EastLife is available FREE from selected advertisers and the following locations: Botany Botany Information Centre, Conservatory, Botany Town Centre Botany Library, Level 1 Sunset Tce, Botany Town Centre Jag Kitchens, inside Danske Mobler, Botany Town Centre Prenzel of Botany, Shop 21 Town Centre Drive, Botany Town Centre Harvey Norman, 500 Ti Rakau Dr

64 | eastlife | november 2013

Munn’s the Man’s Store, 451 Ti Rakau Dr Pakuranga Golf Club, 199 Botany Rd Eves Pantry, 309 Botany Rd Botany south Hot Spring Spas, 1 Bishop Dunn Pl Art and Framing, 1 Bishop Dunn Pl Mitre 10 Mega, Bishop Dunn Pl

Columbus Coffee, Homebase Botany, 16J Bishop Dunn Pl Bucklands Beach Bucklands Espresso Lounge, Cnr Wharf Rd and Hattaway Ave Bucklands Beach Veterinary Hospital, 340 Bucklands Beach Rd Farm Cove Mon Bichon, 190 Fisher Pde

Half Moon Bay Sealink Ferry Terminal, 1 Ara Tai Dr Marina Fitness, Compass Building, Ara Tai Dr A&J Cafe, Promenade Building, Ara Tai Dr Highbrook Fisher House, 117 Kerwyn Ave Highland Park Highland Park Library, 16 Highland Park Dr www.eastlife.co.nz


directory Everlasting Daisies

Consult

“Smarter “SmarterBuilding BuildingSurveying” Surveying”

NZ’s most comprehensive display of artificial flowers www.everlastingdaisies.co.nz

ExpErt AdvicE

For all residential projects

• Pre-purchase inspections • Insurance valuations • Weathertightness

Call David Beeson

www.beesonbuilding.co.nz

WE LOVE THE JOB YOU HATE!

Christmas is in full swing Unit 7G, Bishop’s Gate Business Centre, cnr Te Irirangi Drive & Bishop Dunn Pl, Botany South opp Mitre 10 Mega Ph 265 0472

021 458 375 artpropconsult@gmail.com

Ph 021 980 549

NO MESS, NO FUSS.

E513054-v2

www.artconsult.co.nz

E510130-v3

B ARRY

UDREYS A UNIQUE HOMEWARES

FRAMING GALLERY LTD

Vintage Wares • French Country

McCORMICK

Franchises available 53586-v2

Down-sizing? See me first!

Specialists in unique mirrors and quality, innovative conservation framing. Original art for sale.

E513002-v3

Service & Value

145c Cascades Rd, Pakuranga. Ph 576 2884 www.audreys.co.nz

E512064-v3

info@bmgalleries.co.nz 249 Ti Rakau Dr, East Tamaki. Ph/Fax 09 273 2091

Dawn Sheldon or Tammy Stonehouse

E512013

350 Broadway, Newmarket, Auckland PH: 522 2626 | www.countrytheme.co.nz

E510166

FURNITURE – ART – ORNAMENTS LIGHTING – PLUS MUCH MORE

GUARANTEED

House that breathes is the house that lives. Live a healthy life and keep sicknesses away.

Commerical / Industrial / Residential

Waterblasters

• House soft wash • Roof cleaning • Gutter cleaning • Pre-paint cleaning • Fence and walls • Deck cleaning • Path cleaning Accredited Member (design & horticulture) of Landscape Industries Assoc. of NZ Inc.

WE ALSO OFFER... Pest control

Ph 0508 932 532 (0508 WE CLEAN), mobile 021 366 615 Email: office@bestpropertyservices.co.nz

We use latest ‘state-of-the-art’ mister technology for even spray of pesticides both inside and outside the house.

www.bestpropertyservices.co.nz

14A Larne Ave, Pakuranga. Phone 577 4309 | 0800 73 78 73 Email: info@pestpesters.co.nz

54050

E520002-v3

Highland Park Shopping Centre, Central Pavillion, Cnr Aviemore Dr and Pakuranga Rd Howick Howick Information Centre, 91 Picton St Total Focus Property, 111 Picton St Timeless Images Photography, Howick Village Mall, Central Tce Monterey Cinemas, 4/2 Fencible Dr Smith and Sons, 22 Moore St www.eastlife.co.nz

Mobile Ceramics, 198 Moore St Inner Concepts, 186 Wellington St Westpac Howick, 19 Wellington St Shamrock Cottage, 73 Selwyn Rd Pakuranga Frames Today, 421 Pakuranga Rd Pakuranga Plaza Information Desk Pakuranga Library, 7 Aylesbury St Brownson’s Jewellers, Pakuranga Plaza

Howick Historical Village, Cnr Bells Road and Lady Marie Drive, Lloyd Elsmore Park Howick Little Theatre, Sir Lloyd Dr Placemakers Pakuranga, 481 Pakuranga Rd Pine Harbour The Jolly Roger Pub, 190 Jack Lachlan Dr, Pine Harbour Marina Whitford Prenzel of Whitford, 7 Whitford Wharf Rd, Whitford Village

E512017

ph: 534 1823 mob: 021 123 5650 lynn@fusionlandscapedesign.co.nz www.fusionlandscapedesign.co.nz

Window cleaning Carpet cleaning Furniture and upholstery cleaning

Exterior Chemical Wash removes fungi, moss, etc that attract pests such as flies, cockroaches, mosquitoes etc to breed. It also protects the paint and increases its life considerably.

EastLife is published on the first week of each month excluding January. Copies will go quickly so be quick to collect yours from any of the following outlets. An electronic version is also available at www.eastlife.co.nz.

eastlife | november 2013 |

65


directory FROG PUDDLES Childcare Centre

Spring & Summer

(Limited Spaces) Above regulations ratio

Teeth Whitening special

Set up and tutoring for:

Under twoâ&#x20AC;&#x203A;s â&#x20AC;&#x201C; small group of eight children taken care of by a team of three wonderful, nurturing, qualiďŹ ed teachers Over twoâ&#x20AC;&#x203A;s â&#x20AC;&#x201C; a dedicated and professional teaching team offering interesting and varied learning experiences which support childrenâ&#x20AC;&#x203A;s growth and development

iPads/tablets iPhones/smartphones iPods eReaders

Zoom Whitening

Remove yourself from daily stress â&#x20AC;&#x201C; rejuvenate and find balance to enhance skin and well-being.

FREE dental care between 13-18 years

Gift vouchers available

Warm and friendly homely environment

www.theitgirls.co.nz admin@theitgirls.co.nz 021 899 862

Call us now to arrange a visit Ph 537 5744 www.frogpuddles.co.nz 1 Dianne Louise Dr, Half Moon Bay

E512070

ď&#x20AC; ď&#x20AC;&#x201A;ď&#x20AC;&#x192;ď&#x20AC;&#x201E;ď&#x20AC;&#x2026;ď&#x20AC; ď&#x20AC;&#x2020;ď&#x20AC;&#x2021;ď&#x20AC;&#x2C6;ď&#x20AC;&#x2030;ď&#x20AC;&#x160;ď&#x20AC;&#x2039;ď&#x20AC;&#x152;ď&#x20AC;&#x201A;ď&#x20AC;?ď&#x20AC;&#x17D;ď&#x20AC;?ď&#x20AC;&#x201A;ď&#x20AC;?ď&#x20AC;&#x160;ď&#x20AC;&#x160;ď&#x20AC;&#x160; ď&#x20AC;&#x2018;ď&#x20AC;&#x2019;ď&#x20AC;?ď&#x20AC;&#x2020;ď&#x20AC;&#x192;ď&#x20AC;&#x201C;ď&#x20AC;&#x160;ď&#x20AC;&#x2030;ď&#x20AC;?ď&#x20AC;&#x201D;ď&#x20AC;&#x2026;ď&#x20AC;?ď&#x20AC;&#x160;ď&#x20AC;&#x2022;ď&#x20AC; ď&#x20AC;&#x2019;ď&#x20AC;&#x201E;ď&#x20AC;?ď&#x20AC;?ď&#x20AC;&#x160;ď&#x20AC;&#x2018;ď&#x20AC;&#x152;ď&#x20AC;&#x2019;ď&#x20AC;&#x160;ď&#x20AC;&#x160; ď&#x20AC;&#x2018;ď&#x20AC;&#x152;ď&#x20AC;&#x152;ď&#x20AC;&#x2021;ď&#x20AC;&#x160;ď&#x20AC;?ď&#x20AC;&#x2020;ď&#x20AC;?ď&#x20AC;&#x201C;ď&#x20AC;&#x201A;ď&#x20AC;&#x2030;ď&#x20AC;&#x17D;ď&#x20AC; ď&#x20AC;&#x2030;ď&#x20AC;?ď&#x20AC;&#x2030;ď&#x20AC;&#x160;ď&#x20AC;&#x17D;ď&#x20AC;&#x2020;ď&#x20AC;&#x160;ď&#x20AC; ď&#x20AC;&#x160;ď&#x20AC;&#x160; ď&#x20AC;&#x2030;ď&#x20AC;&#x201A;ď&#x20AC;&#x2013;ď&#x20AC;?ď&#x20AC;&#x2019;ď&#x20AC;&#x2039;ď&#x20AC;&#x160;ď&#x20AC;&#x2014;ď&#x20AC; ď&#x20AC;?ď&#x20AC;?ď&#x20AC;&#x2019;ď&#x20AC;&#x2030;ď&#x20AC;&#x17D;ď&#x20AC;&#x2021;ď&#x20AC;?ď&#x20AC;&#x160;ď&#x20AC;&#x2026;ď&#x20AC;&#x152;ď&#x20AC;&#x192;ď&#x20AC; ď&#x20AC;?ď&#x20AC;&#x17D;ď&#x20AC;&#x152;ď&#x20AC;&#x2020;ď&#x20AC;&#x160;ď&#x20AC;&#x160; ď&#x20AC;

ď&#x20AC; ď&#x20AC;&#x201A;ď&#x20AC; ď&#x20AC;&#x192;ď&#x20AC;&#x201E;ď&#x20AC;&#x2026;ď&#x20AC;&#x2020;ď&#x20AC;&#x2021;ď&#x20AC;&#x2C6;ď&#x20AC;&#x2030;ď&#x20AC;&#x192;ď&#x20AC;&#x160;ď&#x20AC;&#x2021;ď&#x20AC;&#x201E;ď&#x20AC;&#x2026; ď&#x20AC; ď&#x20AC;&#x201A;ď&#x20AC;&#x192;ď&#x20AC;&#x201E;ď&#x20AC;&#x2026;ď&#x20AC;&#x2020;ď&#x20AC;&#x2021;ď&#x20AC;&#x201A;ď&#x20AC;&#x2020;ď&#x20AC;&#x2C6;ď&#x20AC;&#x2030;ď&#x20AC;&#x201E;ď&#x20AC;&#x2026;ď&#x20AC;&#x160; ď&#x20AC; ď&#x20AC;&#x2020;

ď&#x20AC;&#x201A; ď&#x20AC;&#x192; ď&#x20AC;&#x201E; ď&#x20AC;&#x2026; ď&#x20AC;&#x2020; ď&#x20AC;&#x2021; ď&#x20AC;&#x2C6; ď&#x20AC;&#x201E; ď&#x20AC; ď&#x20AC;

ď&#x20AC; ď&#x20AC;&#x201A;ď&#x20AC; ď&#x20AC;&#x192;ď&#x20AC;&#x201E;ď&#x20AC;&#x2026;ď&#x20AC;&#x2020;ď&#x20AC; ď&#x20AC;&#x2021;ď&#x20AC;&#x2C6;ď&#x20AC;&#x2030;ď&#x20AC;&#x160;ď&#x20AC;&#x2039;ď&#x20AC;&#x152;ď&#x20AC;&#x2030;ď&#x20AC; ď&#x20AC;?ď&#x20AC;&#x2C6;ď&#x20AC;&#x2030;ď&#x20AC;&#x201E;ď&#x20AC;&#x2026;ď&#x20AC;&#x2C6;ď&#x20AC; ď&#x20AC;&#x201A;ď&#x20AC; E513094-v2

Now only

299

$

Valid until February 28th 2014 Aylesbury St, Pakuranga Plaza

15 Pakuranga Road, Pakuranga Ph 570 5334 pvskincare.co.nz

E513005

Beaufords

in Totara Park

Weddings â&#x20AC;˘ Conferences â&#x20AC;˘ Private Functions

576 8689 View our website for terms and conditions.

www.brightwhite.co.nz

Boutique accomodation in the heart of Howick. Fully furnished, long or short term rentals.

Book now for our famous Christmas Day Traditional Buffet Lunch For reservations and enquiries P (09) 267-6979 E john@beaufords.co.nz 90 Wairere Rd, The Gardens, Manurewa

www.beaufords.co.nz

E510182

V A L L E Y d e S O L www.valleydesol.co.nz email: info@valleydesol.co.nz Phone: 0274 949961

Team McMillan BMW

www.teambmw.com

GENUINE BMW PARTS. Ńź/;ŃłTMBSHFTU#.8EFBMFS Ńź&YQFSJFODFEQBSUTUFBN ŃźNPOUI'BDUPSZ(VBSBOUFF

CALL ROB: 534 1337

HRF

Xmas advert 2013.pdf

1

11/11/13

E512060

$BSFFSPQQPSUVOJUJFTOPXBWBJMBCMF $POUBDU#MBJS(SPVCFUPFORVJSF

9:50 PM E513096

Team McMillan BMW 7-15 Great South Road, Newmarket, Auckland. 09 524 3300. www.teambmw.com E513076

54341

66 | eastlife | november 2013

www.eastlife.co.nz


motoring | eastlife

2WD/4WD

www.eastlife.co.nz

eastlife | november 2013 |

67 E512107


Nobody in the World Sells More Real Estate than RE/MAX!

All the best for the festive season. From your local RE/MAX Team...

David Hilliam 021 925 996

Rob Hewison 021 284 3629

RE/MAX Zest (Howick) 3/15 Cook Street, Howick ph. 09 538 0020 Zest for Realty Limited. Licensed Under the REAA (2008).

Graeme Kidd 021 0824 0061

RE/MAX Zest (Remuera) 322 Remuera Road, Remuera ph. 09 524 5242

E512053-v2

Matt Clark 0273 811 733

Profile for Times Media

EastLife December 2013  

EastLife December 2013