Page 1


S A N TA N A ROW P RESE N TS

38==4A>=C74A>F

& A SHOW Cf^2^dabT3X]]TaU^a!#($ 5A44CWTPcaTCXRZTcb Bd]SPh¸FTS]TbSPhÂ&#x201C;<PaRW! 0_aX[ ( Purchase 2 specials and receive 2 FREE tickets to Ainâ&#x20AC;&#x2122;t Misbehavinâ&#x20AC;&#x2122; performing at the San Jose Repertory Theatre.

Present your itemized receipts to the Santana Row Concierge. Hurry, tickets are while supplies last.

0\QTa8]SXP2^]bdT[^<TgXRP]1Xbca^CWT2^d]cTaCWTP<TSXcTaaP]TP]2dXbX]TA^dg;^dXbXP]P:XcRWT]BX]^ EX[[PVT2P[XU^a]XP1Xbca^;1BcTPZA^bXT<R2P]]½b8aXbW?dQATbcPdaP]cHP]ZTT?XTa;TUc1P]Z1aPbbTaXT

4BOUBOB3PXDPNtt4UFWFOT$SFFLBOE8JODIFTUFSJO4BO+PTF


4

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


CONTENTS:

24 UPFRONT: 06 HIT LIST { editors’ picks } 08 50 WAYS TO LEAVE YOUR SOFA { top events } DEPARTMENTS: 16 HEALTH & BEAUTY Featuring: Cal-culator, make your own personal care products, home gym on the cheap and holistic dentistry. 24 DINING Featuring: Cook like a pro, Half Moon Bay Vintner Series, La Vic’s Orange Sauce, outdoor dining and chocolate shopping. 52 NIGHTLIFE Featuring: Black Eyed Peas, San Francisco WonderCon and top bands playing around the Bay. 54 ARTS Featuring: Brasil Guitar Duo, To Kill A Mockingbird, learn to throw clay and local event listings. 58 FAMILY & COMMUNITY Featuring: Modern Bridal Faire, Vasona Lake Park, Eggstraordinary EggHunt and local community listings. 62 SPORTS & ADVENTURE Featuring: Speed skating and horseback riding. 64 HOME & DESIGN Featuring: Central Coast Home & Garden Show and Common Ground Gardening Supply & Education Center.

52

56

12

16

58

SV GUIDES 52 63

WINE TASTING SPORTS & ADVENTURE

SPECIAL ADVERTISING SECTIONS: MARKETPLACE: 66 CAREER TRAINING 66 HOME IMPROVEMENT 67 TRAVEL & GETAWAYS 67 WEDDING PLANNING

60 THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

5


HitList

» FEATURE

ARMY OF TWO: THE 40TH DAY

W

HIT L IST

hen it comes to enjoying an amazing and entertaining cooperative gaming experience, no game does it better than Army of Two: The 40th Day. You and a buddy will have a blast running and gunning through Shanghai, China and trying to survive as the city comes crumbling down during a terrorist attack. And the best part? This sequel lets you grab weapons from killed enemies, letting you have FOUR weapons (up from three in the original Army of Two). Armed with a charming sense of humor and a control scheme that makes it easy for anyone to pick up, Army of Two: The 40th Day for Xbox 360, PlayStation 3 and PlayStation Portable is definitely a good time to be had. www.armyoftwo.com

STUFF WE LIKE

BE SMART WITH YOUR MONEY

M

oney management is one of the most difficult tasks of being a grownup, and our current economy is testament to that. With credit cards and multiple bank accounts ruling our lives, it’s easy to stop keeping track of receipts and pesky check book balances. So allow us to introduce you to Mint.com, a free online money management tool that offers a safe and secure solution to budget every dollar and cent. In just five minutes, you can add all your accounts to this site, including checking, credit card, loan and investment accounts. And then, like magic, Mint will give you a complete picture of your finances in real time, as well as tools to help you budget. During these times of economic decline, you really can’t afford to NOT use Mint.com. Oh, and yes - they have an app for all of that. www.mint.com.

HEAVY RAIN

T

his interactive drama video game lives up to its wicked name. Heavy Rain places you in control of four protagonists in an epic murder-mystery involving a mysterious Origami Killer who drowns victims with extended periods of rainfall. Being able to control the characters’ decisions by performing actions highlighted on the screen via certain button combinations makes Heavy Rain seem more like a choose-your-ownadventure book than a mere video game, as your actions affect the narrative and lead to 6

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

different scenes and endings based on your choices. Made exclusively for the PlayStation 3, this soap opera for techies is awesome for anyone looking to create his own destiny.

THOU SHALT BE SAVED!

I

f you’re the type of person who just needs to know if pornographic material is being smuggled into the family computer (or any computer, for that matter), you’re going to LOVE Paraben’s Porn Detection Stick. That’s right, this dirtily-named device will search your computer in about a ba-zillion different invasive ways to clean it out. Skin Detection, Body Part Separation, Negative Curvature Rejection and Body Part Layout Decision are just a few of the imaging methods the stick uses to scope out anything naughty. Place the Porn Detection Stick into your computer and, just like that, 99% of the inappropriate content will be unveiled. www.paraben-sticks.com/pornremover.html TW


HIT LIST: STUFF WE LIKE

Silicon Valley’s Finest Entertainment & Lifestyle Magazine VOLUME 10, ISSUE 05: March 24 - April 6, 2010

THE WAVE MEDIA Publisher: Bill Hargreaves

Marketplace Ads: marketplace@thewavemag.com

Associate Publisher: Chris Rhoads

Editorial: writeus@thewavemag.com Events: 2010events@thewavemag.com

EDITORIAL

Design: design@thewavemag.com

Executive Editor: Johnny Brafford, Jr.

Employment: jobs@thewavemag.com

Senior Editor: Jenn Katz

Distribution: distribution@thewavemag.com

Contributing Writers: Rebekah Hollister, Devin Di Nardo

ADVERTISING INFORMATION:

ART / PRODUCTION:

Bill Hargreaves (408) 912-5066 advertising@thewavemag.com

Design Director & Photographer: Chris Schmauch

PUBLICATION INFORMATION

Graphic Designers: Marina Popova, Ezra Gordon

SALES / ADVERTISING: Vice President, Sales: Bill Hargreaves Online Sales / Marketing: Chris Rhoads

The Wave Media publishes The Wave Magazine. All content of this issue is copyright ©2010 by The Wave Media, Inc., and may not be reprinted in whole or in part without the express written consent of the publisher. The Wave is available throughout the Silicon Valley; one copy of each edition of The Wave is available for free. Anyone removing magazines in bulk will be prosecuted.

Marketing / Traffic Coordinator: Rebekah Hollister

SUBSCRIPTION INFORMATION

District Sales Managers: Ray Klopp, Carol Zimring, Julie Lynn

4595 Cherry Ave., San Jose, CA 95118

CLIENT SERVICES: Rebekah Hollister, Jordan Ferguson

ONLINE: IT Support: Jenny Phan Design / Code: Chris Schmauch

EMAILS: Display Ads: advertising@thewavemag.com

Back issues of The Wave Magazine are available for $5. Please submit your request for a back issue to: Subscriptions to The Wave Magazine run $9.95 for 27 issues (one year). For more information, call (408) 912-5060 or visit http://subscribe. thewavemag.com

EDITORIAL CONTRIBUTIONS Unsolicited manuscripts and story ideas must be accompanied by a stamped return envelope. The publisher assumes no responsibility for lost artwork, photographs or manuscripts. Submit all manuscripts, artwork and photographs to: The Wave Magazine, 4595 Cherry Ave., San Jose, CA 95118 Tel: (408) 912-5060 Fax: (408) 978-7793

HIT L IST

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

7


50 Ways

» FEATURE

TO LEAVE YOUR SOFA www.santaclaravalleyorchidsociety.org

March 26–28: Hundreds upon hundreds of beautiful orchids will be on display and for sale. Experts will also be on hand to answer all orchid questions. CALIFORNIA 14NORTHERN SCREENWRITERS EXPO

Silverado Resort, 1600 Atlas Peak Rd., Napa www.norcalscreenwriters.com

March 26–28: Take part in this year's Northern California Screenwriters Expo, where you can take part in workshops to hone your craft. Come prepared, because you’ll get a chance to pitch your script to some Hollywood big shots.

15PLANT AND BOOK SALE

The County Fair Building – Golden Gate Park, Ninth at Lincoln Way, San Francisco (415) 626-7500 www.friendssfpl.org

March 26–28: The sale will feature zillions upon zillions of new and used books in all categories (with an emphasis on science, gardening and nature) AND a wide assortment of unusual and beautiful plants propagated from the Botanical Garden's own collections . All proceeds will fund the San Francisco Public Library’s literacy programs and the San Francisco Botanical Gardens. SANTA CRUZ 1624KAYAKANNUAL SURF FESTIVAL TH

Steamers Lane, Lighthouse Point, Santa Cruz www.asudoit.com

March 26–28: Three days of competitive kayak surfing for novices and experts with live entertainment, food and free kayak demos.

3/27

18

SATURDAY

50 Hand-Picked Events Just For You

3/24

WEDNESDAY

01JAYZ

HP Pavilion, 525 W. Santa Clara St., San Jose www.hppsj.com

50 WAYS

March 24: Don’t miss your chance to experience the KING of hip-hop, Jay-Z, when he rolls into HP Pavilion: 5:30pm FRANCISCO FLOWER & GARDEN SHOW 02SAN

experience the stresses, triumphs, desperate lows and comic highs.

05

California Academy of Sciences, 55 Music Concourse Dr., Golden Gate Park (415) 379-8000 www.calacademy.org

Daily: We here at The Wave simply adore penguins. Most of all, we enjoy how happy they get during feeding time. So, we invite you to join us for some good old fashioned penguin feeding fun everyday at 10:30am & 3:30pm

3/25

San Mateo County Event Center, 1346 Saratoga Dr., San Mateo www.sfgardenshow.com

March 24–28: If you're a lover of gardening or are just interested in learning how to turn your garden into a personal paradise, you’ll want to visit this five-day expo dedicated to everything garden related, with zillions of flowers on display and experts to answer all your questions.

03

FRANK LANGELLA’S CYRANO

City Lights Theatre Company, 529 S. Second St., San Jose (408) 295-4200 www.cltc.org

Thru April 18: Roxanne Kowalski – “When you’re getting love letters, you don’t go around trying to compare the signature to handwriting.” C.D. – “You wanna know why? 'Cause you wanted to believe it. You wanted it all. All the romance and emotion, all wrapped up in a cute little nose and a cute little ass!”

04BABY, A MUSICAL

Off-Market Theatre, 965 Mission St., San Francisco (800) 838-3006 www.roltheatre.com

Thru April 18: The delightfully hilarious and touching story of three expectant couples as they 8

PENGUIN FEEDINGS

THURSDAY ANNUAL SAN 06SECOND FRANCISCO SALSA FESTIVAL The Westin San Francisco, 50 Third St., San Francisco salsarealm.com

March 25–27: Three days of non-stop salsa with workshops for all skill levels and allll night dancing.

07

VITA NUOVA

Anno Domini, 366 S. First St., San Jose www.supportnetwork.org

March 25: A fundraiser honoring the Support Network for battered women, with live DJs, a silent auction and a raffle where you have a chance to win art, Sharks tickets, gift certificates and more: 7–10pm

08

SAN JOSE SHARKS vs. DALLAS STARS

Shark Tank, 525 W. Santa Clara St., San Jose www.sjsharks.com

March 25: Tuuuurdooooo!Tuuuurdooooo! Tuuuurdooooo!: 7:30pm

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

3/26 FRIDAY

FINE ARTS 09SIDEWALK FESTIVAL

ANNUAL BONSAI 1740EXHIBITION TH

San Jose Buddhist Church Betsuin, 640 N. Fifth St., San Jose www.gsbf-bonsai.org/sjbonsai/

March 27–28: This exhibition will feature beautiful bonsai trees on display and for sale, along with demonstrations with Bonsai master Harry Hirao on caring for your bonsai tree. GOODGUYS 28 ALL 18AMERICAN GETTOGETHER TH

Alameda County Fairgrounds, 4501 Pleasanton Ave., Pleasanton www.allamericangettogether.com

March 26:More than 25 artists will show original and unique pieces, including paintings, photography, ceramics, fine jewelry and more!: 10am–5pm

March 27–28: Attention gear-heads and car enthusiasts: It’s that time of the year. Yep, car show time! The GoodGuys will feature more than 3,000 of the baddest hot rods and customs, along with exhibitors, vendors, a swap meet and activities for the little ones.

10JERRY SEINFELD

ANNUAL MONOTYPE 19THE MARATHON

March 26: A full evening of quirky humor from funny man Jerry Seinfeld. What a nut he is: 7pm

March 27: This print exhibition/fundraising event features more than 100 original works on paper by some of the Bay Area’s most talented printmakers. The best part? All pieces will be up for grabs to the highest bidder!: 5:30–7:30pm

Carlmont Village Shopping Center, Ralston Ave. & Alameda de las Pulgas, Belmont

Flint Center for the Performing Arts, 21250 Stevens Creek Blvd., Cupertino www.flintcenter.com

ANNUAL INDIAN 11FOURTH HEALTH CENTER COMEDY JAM Marriott Santa Clara, 2700 Mission College Blvd., Santa Clara (408) 445-3400 x208

March 26: Come on out for some hilarity with comedians Marc Yaffe, Jim Ruel, Vaughn Eaglebear and JR Redwater to help raise needed funds for the health center.

12JOHN MAYER

HP Pavilion, 525 W. Santa Clara St., San Jose www.hppsj.com

March 26: Please welcome John Mayer with special guests Michael Franti & Spearhead to the HP Pavilion: 7:30pm 59 ANNUAL SANTA CLARA VALLEY ORCHID 13 SOCIETY SHOW & SALE

San Jose Institute of Contemporary Art, 560 S. First St., San Jose www.sjica.org

20FREE HEALTHY KIDS DAY

Hoover Elementary, Palo Alto (650) 842-2753 www.paloaltofamilyymca.org

March 27: Is little Bobby becoming a little fatty sitting on the couch? If so, it’s time for a life change for Bobby AND mom and dad. Join The Palo Alto Family YMCA for their free Healthy Kids Day event for adults and children. The event is part of a nationwide effort to help lower the increase of childhood obesity by raising the awareness level of families and encouraging parents to adopt healthy lifestyles.

TH

Westgate Mall, 1600 Saratoga Ave., San Jose (408) 229-2747

10


50 WAYS TO LEAVE YOUR SOFA: TOP EVENTS

50 WAYS

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

9


50 WAYS TO LEAVE YOUR SOFA: TOP EVENTS

50 WAYS EVENT

LISTINGS

[ C O N T. ]

8

29

21KID KOALA

Yoshi’s, 1330 Fillmore St., San Francisco (415) 655-5600 www.yoshis.com

DOWNTOWN SAN JOSE 50 blocks of exciting restaurants, 50 WAYS

galleries, museums, theaters, shops and nightlife. sjdowntown.com/dine

March 27: Two supremely wicked sets from one of the most talented wax spinners you’ll EVER have the pleasure to see and hear.

22

THE HERITAGE BUTTON SHOW & SALE

10

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

SUNDAY

26MODERN BRIDAL FAIRE

San Jose McEnery Convention Center, 150 W. San Carlos St., San Jose www.modernbridal.com

March 27: If you’re into the button scene, you won’t want to miss Santa Clara Valley Button Club's very first button show.

March 28: Gettin’ hitched, eh? Well, don’t miss the Modern Bridal Faire. They have all the bases covered, from florists, photographers and bridal gowns to live music, invitations, caterers, limousines and reception sites.

LAS VEGAS DANCE 23VIVA SHOW

FOLKLORICO DE 27BALLET MEXICO

March 27: Ariel Dance Productions brings showgirls to the city of Sunnyvale with a Vegasinspired show, featuring a hip-hop version of the Treasure Island Sirens, Cirque du Soleil-inspired jazz and contemporary performances.

March 28: The celebrated Ballet Folklórico de México of Amalia Hernández from the Palace of Fine Arts in Mexico City will appear in a special production honoring the Bicentennial Anniversary of Mexico’s Independence and the Centennial of the Mexican Revolution.

GUNG DAOIST 24CHI LONGEVITY WORKSHOP

Voodoo Lounge, 14 S. Second St., San Jose www.voodooloungesj.com

Heritage Button Show, 100 S. Murphy Ave., Sunnyvale www.cabutton.org

King’s Academy Theatre, 562 N. Britton Ave., Sunnyvale (408) 621-2790 www.arieldanceproductions.com

Gyalwa Gyatso Buddhist Center, 1070 Buckman Ave., Campbell www.gyalwagyatso.org

March 27: Join Larry Wong as he guides you through the movements to promote health and longevity, including self-massaging, stretches, patting, tapping and repetitive movements. Suitable for all ages and experience levels: 2–4pm

PARK YOURSELF HERE. Shop or dine at businesses displaying this sign and receive up to 2 hours of validated parking at participating parking lots and garages. sjdowntownparking.com

3/28

SEVENTH ANNUAL 25 MODEL TRAINS AND PLANES

Hiller Aviation Museum, 601 Skyway Rd., San Carlos www.hiller.org

March 27–April 11: Model train lovers won’t want to miss this. You’ll have a chance to view exquisitely crafted H-O model trains as they putt around miniature landscapes, scenery and villages of Germany, Austria, France and Switzerland, amongst other European countries: 10am–5pm

San Jose Center for the Performing Arts, 255 Almaden Blvd., San Jose

28HANK WILLIAMS III

March 28: You never know what you’ll get from Hank III – country, rock, punk...? It’s a coin toss, really. Just order another round of Jim Beam and enjoy the show.

29BRASIL GUITAR DUO

Montalvo Arts Center, 15400 Montalvo Rd., Saratoga (408) 961-5800 montalvoarts.org

March 28: The Brasil Guitar Duo have been wowing the masses for the last 10 years with their innovative and seamless blend of traditional and Brazilian works, so it’s no wonder they won the 2006 Artist Guild International Competition: 3pm

30BUNNY 101

For Other Living Things, 1261 S. Mary Ave., Sunnyvale 12


50 WAYS TO LEAVE YOUR SOFA: TOP EVENTS

50 WAYS

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

11


50 WAYS TO LEAVE YOUR SOFA: TOP EVENTS

50 WAYS EVENT

LISTINGS

[ C O N T. ]

10

PROMOTION

Optometrist and Ophthalmologist Revolutionize Migraine Prevention and Therapy

50 WAYS

www.forotherlivingthings.com

St., San Jose www.chavezfamilyvision.com

March 28: If you’re heavily into the bunny rabbit scene, you’ll want to attend this seminar, which will cover all topics to keep your bunny happily hoppin': Noon–4pm

March 31: Come and celebrate the legacy of Cesar Chavez through a wonderful breakfast with City Council members, civic leaders, public servants and YOU! See you there: 8am

12 ANNUAL 31 VIETNAMESE SPRING FESTIVAL & PARADE TH

Downtown San Jose on Market St. www.vsfparade.com

March 28: Fun for the entire family will be had at this year’s Vietnamese Spring Festival, which features arts & crafts, great food, live music, cultural performances, children’s games and more: 11am

I

n the United States, 28 million people suffer from migraines. Approximately 900,000 people per day will have an attack. Two compassionate San Jose doctors have gone out of their usual ways spending nearly two decades on causes and prevention of Migraines. They are on the front line of this serious and debilitating disorder, revolutionizing the way we think and treat migraines in the world. Dr. Hamid Sajjadi, a top cornea and Lasik surgeon and Dr. David Chang, a highly skilled optometrist with over 18 years of experience have identified that much of the problem stems in the eye and have joined forces to revolutionize migraine prevention. Prevention is more important than treating migraines. Before the Migraine attacks, the brain suffers hypoxia. This may cause permanent damage.

21

approximately 95% effective in preventing migraines with fewer side effects than the oral medications that are traditionally prescribed today. The doctors say occasionally both methods are needed to achieve near total control. The Doctors are also seeing that one becomes more susceptible to secondary triggers when the anomalous eye conditions alters and weakens the brains normal state.

The Doctors have identified four hereditary eye conditions that can trigger migraines and these conditions also appears to be the most common causes of chronic migraines. Through what Dr. Chang describes, when using a combination of lenses and mild prisms the rate of prevention is about 95%. He explains, “our two eyes have 12 external muscles and 4 internal muscles rotating on 6 axes. If the two eyes do not send a perfectly matched image it may trigger a migraine attack.”

The benefits of these findings are unparalleled. The doctors will be introducing the therapy to the American Board of Optometry and Ophthalmology later this year. Their practice specializes in first, preventing and treating eye related headaches and migraines with precisely measured glasses prescriptions. Secondly, very accurate and reproducible Lasik surgery and thirdly, it targets patients ages 3 and up with difficult eye and overall health problems; such as those diagnosed with learning disabilities, ADHD, autism, seizures, brain tumors, and Alzheimer’s. The doctors see these illnesses as relatable to the migraine treatment. Through their dedication and further grant funding and research, the possibilities for better rehabilitation are endless.

Dr. Sajjadi also discovered a new migraine medication, 8 years ago, which is a precise mixture of 3 already approved drops that are instilled in the eye. This has also been

The San Jose Eye & Laser Medical Center is located at 1848 Saratoga Ave. #5A, Saratoga, CA 95070. You can reach them by calling (408)871-6800. www.sanjosevision.com

32

WEST COAST BLUES HALL OF FAME & AWARD SHOW

Hilton Oakland Airport, One Hegenberger Rd., Oakland www.bayareabluessociety.net

March 28: This show honors blues, jazz and gospel artists for their contributions to the “blues.”

3/30 TUESDAY

33

SOUTH BAY CIVIL WAR ROUND TABLE

Holder’s Country Inn, 998 S. De Anza Blvd., San Jose (510) 651-4484 www.sbcwrt.org

March 30: Nothing beats a good war discussion, especially a Civil War discussion, so if that’s your gig, join the South Bay Civil War Round Table and hang with fellow Civil War buffs. Meetings happen every last Tuesday of the month: 6:45pm

34SAN JOSE CAREER FAIR

Holiday Inn San Jose, 1740 N. First St., San Jose (877) 561-5627 www.bayareahires.com

March 30: Tired of your humdrum job? Tired of not having a job? Then spruce up your resume and head over to the Bay Area Hires Job Fair to meet face-to-face with employers who want to hire you.

3/31

WEDNESDAY CESAR CHAVEZ 35 COMMEMORATIVE BREAKFAST

Center for Employment Training, 701 Vine

12

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

4/1

THURSDAY

36THE GOOD DANCE

Novellus Theatre, 700 Howard St., San Francisco (415) 978-2787 www.ybca.org

April 1: Brooklyn-based choreographer Reggie Wilson returns to YBCA after a multi-year collaboration and cultural exchange with Congolese contemporary choreographer Andréya Ouamba and his Dakar, Senegal-based dance company. The program features movement, text and live vocal work, melding the rich art, culture and history of each man’s ancestral past, while incorporating African, Caribbean and AfricanAmerican rhythms.

4/2

FRIDAY

37THE BLACK EYED PEAS

HP Pavilion, 525 W. Santa Clara St., San Jose www.hppsj.com

April 2: It’s double the fun and double the dance, as Ludacris and the Black Eyed Peas turn the HP Pavilion into the world’s largest rumpshake-a-thon.

4/3

SATURDAY

38EGGSTRAORDINARY EGG HUNT

Roaring Camp Railroad, Graham Hill Rd., Felton (831) 335-4484 www.roaringcamp.com

April 3–4: Hop aboard the “Eggspress” train, where you’ll take a trip to the redwoods for a super-sized egg hunt, featuring thousands upon thousands of chocolate candy eggs and hidden prizes!

14


50 WAYS TO LEAVE YOUR SOFA: TOP EVENTS

COME CELEBRATE THIS EASTER WITH FAMILY AND FRIENDS AT THE SAN FRANCISCO AIRPORT MARRIOTT. Enjoy Easter festivities with your family at Hangar Steak, located in the San Francisco Airport Marriott. Indulge in fresh seafood selections, patio BBQ, salads, omelettes, pastas, and desserts and capture the moment with complimentary photos of your family with the Easter Bunny.

50 WAYS

HANGAR STEAK EASTER BUFFET Sunday, April 4th, 10:30am โ€“ 3:30pm ย™6Yjaih"),#.* ย™8]^aYgZc&&jcYZgยบ''#.* 8]^aYgZcjcYZg)ZVi[gZZl^i]ZVX]eVn^c\VYjai# To make your reservation, call +*%#**'#(*%* or visit lll#]Vc\VghiZV`h[d#Xdb today.

SAN FRANCISCO AIRPORT MARRIOTT &-%%DaY7Vnh]dgZ=^\]lVn!7jga^c\VbZ!86.)%&% E]dcZ+*%#+.'#.&%%!lll#hVc[gVcX^hXdV^gedgibVgg^dii#Xdb

THEWAVEMAG.COM MARCH 24 ๏šบ APRIL 6, 2010

13


50 WAYS TO LEAVE YOUR SOFA: TOP EVENTS

50 WAYS EVENT

LISTINGS

[ C O N T. ]

12

36

4/4

SUNDAY

39HAPPY EASTER!

45MOHSEN NAMJOO

Cubberley Auditorium, Stanford University www.stanfordtickets.org

4/5

MONDAY

40HORSE RIDING CAMP

Care Equestrian (650) 703-7562 www.careequestrian.com

April 5–16: The camp will focus on increasing riding skills, building confidence, giving safety tips and barn etiquette and helping the rider gain a better understanding of the connection between him and his horse.

STYLISH

* AFFORDABLE * NEW

New Homes for First Time Home Buyers in Gilroy and Morgan Hill

OAKLAND A’S 41MARINERS

VS.

SEATTLE

Oakland-Alameda County Coliseum, 7000 Coliseum Way, Oakland

April 5–8: Bring the whole family out for the A’s home opener and watch them give the Mariners a good working over – a three night working over!

4/8

THURSDAY REPERTORY 42SPRING PROGRAM

50 WAYS

San Jose Center for the Performing Arts, 255 Almaden Blvd., San Jose www.balletsj.org

Up to $150,000 of Down Payment Assistance Available!* 1, 2 & 3 Bedroom Town Homes available! Prices starting from the High $200’s!

Upcoming Class on ble! a il a Homeownership v a ’s move in ax Credit Wed, March 24th, 2010 @ 6:00pm T 30 day l a Feder 651 West Sixth Street Get the s out! ime run Gilroy, Ca 95020 t e r Befo RSVP 408-843-9271

Broker DRE # 00899770 Prices, Terms and Conditions Subject to change. Down Payment Assistance for qualfied first time home buyers. Tax credits are for Qualified individuals. See SCH for details.

14

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

4/10

SATURDAY

April 8: Ballet San Jose invites one and all to their spring performance, featuring three dances (Square Dance, Moments and Salu d’ Amour). FEMALE BRAIN & THE MALE BRAIN 43THE Historic Hoover Theatre 1635 Park Ave., San Jose www.commonwealthclub.org/sv

April 8: Super brainiac, neurobiologist and author Dr. Louann Brizendine will discuss the differences between the female brain and the male brain. That shouldn’t take too long… Riiiiight.

4/9

FRIDAY SAN FRANCISCO GIANTS 44vs. ATLANTA BRAVES AT&T Park, 24 Willie Mays Plaza, San Francisco www.sfgiants.com

April 9–11: It's that time of year! It's time to dig out your Giants ball cap and glove and head to San Francisco for the Giants' home opener.

April 10: Don’t miss your chance to see Mohsen Namjoo, the Iranian artist, songwriter, singer and music scholar who is considered to be the “Bob Dylan” of Iran: 7pm UGANDAN ORPHANS 46THE CHOIR Westminster Presbyterian Church, 1100 Shasta Ave., San Jose (408) 294-7447

April 10: You’ll enjoy dramatic drumming, amazing athletic dancing and beautiful harmonies as the choir performs traditional African folk songs. EXHIBITION 47ROBO PREVIEW

Hillsdale Shopping Center, 60 31st Ave., San Mateo (650) 345-8222 www.hillsdale.com

April 10: Hillsdale Shopping Center will host a robot demonstration and exhibition event showcasing combat robots, walking humanoids, soccer bots, sumo bots, kung fu droids and more. SAN JOSE FLEA MARKET 48 50 ANNIVERSARY CELEBRATION TH

San Jose Flea Market, 1590 Berryessa Rd., San Jose (408) 453-1110 www.sjfm.com

April 10–11: Can you believe the San Jose Flea Market is 50?! Come celebrate in grand fashion with live music, a car show, fine wine, food and, of course, the flea market itself.

49YURI’S NIGHT

NASA Ames Research Center, Moffett Field, Mountain View www.ynba.org

April 9–10: Celebrate Russian Cosmonaut Yuri Gagarin’s first flight into space with two days of exhibits,including speakers, tours, demonstrations and live music on two stages from N.E.R.D, Les Claypool, Common, The Black Keys, Glitch Mob, Hamsa Lila and DJ Qbert.

4/11 SUNDAY

MILLER, GOODMAN, 50 DORSEY & FRIENDS BIG BAND SHOW Venture Christian Church, 16845 Hicks Rd., Los Gatos (650) 856-8432 www.californiapops.com

April 11: California Pops' big 60-piece Orchestra presents its big band show featuring the unforgettable music of Goodman, Glenn Miller plus Grammy winner Quincy Jones and more: 5pm TW


50 WAYS TO LEAVE YOUR SOFA: TOP EVENTS

50 WAYS

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

15


Health&Beauty

» FEATURE

Carls Jr.

CAL-CULATOR Check out these numbers for an average 150 lb. person: Running 5 mph burns 7.87 calories per minute Walking 3 mph burns 3.12 calories per minute Cycling 16 mph burns 3.82 calories per minute Cycling 23 mph burns 13.35 calories per minute Swimming 2.56 mph burns 12.95 calories per minute

iStockPhoto

POTASSIUM:

osteoarthritis in the knee.

Regulates heartbeat, helps dispose of body wastes, reduces pain of arthritis, helps lower blood pressure.

NATURAL SOURCES: Sunlight, fortified milk, tuna, shrimp, salmon, herring.

Okay, now let’s put this into numbers you can relate to:

NATURAL SOURCES: Potatoes, celery, carrots, fish, milk, watermelon, bananas.

Carl’s Jr. Guacamole Bacon Six Dollar Burger = 1040 calories. That means you’d need to walk for almost six hours straight to burn it off.

VITAMIN A:

Starbucks Venti Caffe Mocha = 340 calories. You’d need to run for about 45 minutes to burn it off. Snickers candy bar = 266 calories. You’d need to be on your bike cycling for over an hour at 16mph to shed it.

Promotes wellness in bones, eyes, hair, nails and teeth; antioxidant properties may be helpful for Alzheimers and chronic fatigue syndrome.

VITAMIN B-12: Increases energy, reduces depression and irritability, improves ability to fight off disease; may improve symptoms of rosacea.

NATURAL SOURCES: Liver, trout, tuna, cottage cheese, oysters, beef, milk.

NATURAL SOURCES: Dark leafy vegetables, red fruits, sweet potatoes, broccoli, squash, mangos.

HE A LTH & BE AUT Y

VITAMIN C:

WHAT VITAMINS CAN DO

W

e all grew up knowing we’re supposed to eat balanced meals and take vitamins regularly. But what do these vitamins and minerals do, exactly? What’s the difference between Vitamins E, A and B? Check out this small index of vitamins and minerals to find out how you can get them and what they can do for you:

BIOTIN: Eases muscle pains, alleviates eczema and dermatitis, promotes healthy skin, nails and hair.

NATURAL SOURCES: Eggs, milk, rice, soy products, oatmeal, legumes, cauliflower, peanut butter.

16

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

Strengthens immunity, promotes healthy gums, assists in lowering blood cholesterol, aids in protecting against cancer and heart disease.

NATURAL SOURCES: Kiwi, orange, cantaloupe, grapefruit, watermelon, brussel sprouts, red peppers. iStockPhoto

VITAMIN E: Aids in preventing cancer, heart disease and stroke, assists in healing skin, decreases bad cholesterol, aids in preventing cataracts.

NATURAL SOURCES: Vegetable oil, sunflower seeds, almonds, sweet potatoes, collard greens, eggs, soybeans.

VITAMIN D: Helps prevent osteoporosis, promotes healthy bones and teeth, may help prevent colon, breast and prostrate cancer; slows progress of

MAKE YOUR OWN PERSONAL CARE PRODUCTS

G

als and guys alike love pampering themselves with fancy soaps, lotions, balms, scrubs and other personal care products, but are they “personal” enough? These products make you feel, look and smell better, but we all have to admit that it’s a guilty plea- 18


HEALTH & BEAUT Y: FEATURES

HE A LTH & BE AUT Y

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

17


HEALTH & BEAUT Y: FEATURES

HEALTH & BEAUTY F E AT U R I N G

[ C O N T. ]

sure these days to splurge on something like expensive soap. And really, what’s in this stuff? Can you make it yourself? Why, yes you can! Opal’z in Palo Alto offers a number of classes covering topics including how to make soap, lotion, fluffy salt scrubs, lip balms and candles. What’s even better is they use a 100% pure soap base with natural vegetable oils and botanicals with no animal testing, detergents or additives to leave your skin silky smooth and healthy. Personalize your personal products with a capital “P” (for “personal,” of course) and have fun while you’re at it.

16

Opal’z, 719 Colorado Ave., Palo Alto (650) 322-6500 www.opalzoap.com

Palo Adult School, 50 Embarcadero, Palo Alto www.paadultschool.org Also visit homemadebathproducts.blogspot.com for additional classes and recipes for making bath products.

iStockPhoto

HOME GYM ON THE CHEAP

S

HE A LTH & BE AUT Y

o you’re one of the hundreds of thousands of people who pay for a gym membership but just can never seem to make it there, eh? Your excuses consist of needing to cart kids around, being busy with work, being lazy, etc., etc., right? And despite the pile of excuses, you’re a little bummed out that your bod may not be so hot come summertime. Stop moping and fix it. See below for some inexpensive, no-excuse items and activities you can peruse at home or even at the office to help you stay in shape between gym visits, and pay special attention to numbers 1-4 for exercises you can do in front of the tube.

1. Jump rope to burn 11-20 calories a minute. $20 for the jumprope. 2. Get a set of dumbbells to keep those arms toned. Use them with lunges for your legs and butt. $25 for 20lbs.

3. Stability balls are great for core and resistant exercises, especially when paired with dumbells (they’re also fun to bounce on). $20

4. Resistance tubes can give you a full body work out and can be stored in an office drawer. $25 5. Ride your bike to work to burn calories and lower stress. FREE 6. Go for a run in your neighborhood before or after work or during lunch time to clear your

head and get a great workout. FREE.

20

18

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


HEALTH & BEAUT Y: FEATURES

HE A LTH & BE AUT Y

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

19


HEALTH & BEAUT Y: FEATURES

HEALTH & BEAUTY F E AT U R I N G

[ C O N T. ]

18

iStockPhoto

HOLISTIC DENTISTRY

Â&#x2014;Â&#x2018;Â&#x160;Â&#x2014;Â&#x152;Â&#x17D;ČąÂ?Â&#x2018;Â&#x17D;ČąÂ&#x160;¢ȹÂ&#x2DC;Â&#x17E;ČąÂ&#x2DC;Â&#x2DC;Â&#x201D;ǡ Have you been thinking about a cosmetic service as something you'd like to do for yourself? When you're ready to make subtle, yet striking improvements, we're here to help.

T

rips to the dentist are never fun, which makes the thought of a checkup sans drills, shots and numbness actually seem pleasant. Herbal treatments, non-surgical gum treatments, metal-free orthodontics and x-rays with a 90% radiation reduction seem nice, too. However, these minimally-invasive procedures found at local holistic dentist offices are still new and arenâ&#x20AC;&#x2122;t for everyone, so make a consultation appointment to find out exactly what differs between these alternative procedures and the traditional ones. Keep an open mind and check it out for yourself before making a decision. Here are a couple of contacts to get you started:

Healthy Smiles Dental Care, 5595 Winfield Blvd., Ste. 108, San Jose (408) 226-6683 www.ihealthysmiles.com

Dr. Inna Davydova Dentistry, 1237 S. Mary Ave., Sunnyvale www.asunnyvaledentist.com

HE A LTH & BE AUT Y

Photo(s) of Model(s) shown, not Actual Patient(s)

Ĺ&#x2014;Ĺ&#x203A;Ć&#x2013;ČąÄ&#x203A;ČąÂ&#x160;Â&#x153;Â&#x17D;Â&#x203A;Čą

Â&#x160;Â&#x2019;Â&#x203A;ČąÂ&#x17D;Â&#x2013;Â&#x2DC;Â&#x;Â&#x160;Â&#x2022;ČąÂ&#x203A;Â&#x17D;Â&#x160;Â?Â&#x2013;Â&#x17D;Â&#x2014;Â? Ä&#x203A;Â&#x17D;Â&#x203A;ČąÂ&#x160;Â&#x2022;Â&#x2019;Â?ČąÂ&#x160;Â&#x203A;Â&#x152;Â&#x2018;ČąĹ&#x2014;Â&#x153;Â?Ç°ČąĹ&#x2DC;Ĺ&#x2013;Ĺ&#x2014;Ĺ&#x2013;ČŽÂ&#x160;Â&#x203A;Â&#x152;Â&#x2018;ČąĹ&#x2122;Ĺ&#x2014;Â&#x153;Â?Ç°ČąĹ&#x2DC;Ĺ&#x2013;Ĺ&#x2014;Ĺ&#x2013; ÇťÂ&#x2013;Â&#x17E;Â&#x2022;Â?Â&#x2019;Â&#x2122;Â&#x2022;Â&#x17D;ČąÂ?Â&#x203A;Â&#x17D;Â&#x160;Â?Â&#x2013;Â&#x17D;Â&#x2014;Â?Â&#x153;ČąÂ&#x160;Â&#x203A;Â&#x17D;ČąÂ&#x203A;Â&#x17D;Â&#x152;Â&#x2DC;Â&#x2013;Â&#x2013;Â&#x17D;Â&#x2014;Â?Â&#x17D;Â?ČąÂ?Â&#x2DC;Â&#x203A;ČąÂ&#x2039;Â&#x17D;Â&#x153;Â?ČąÂ&#x203A;Â&#x17D;Â&#x153;Â&#x17E;Â&#x2022;Â?Â&#x153;Çź

Â&#x160;Â&#x2022;Â&#x2022;ČąÂ&#x2DC;Â?Â&#x160;¢ǡȹĹ&#x161;Ĺ&#x2013;Ĺ&#x17E;ČŹĹ&#x17E;Ĺ&#x203A;Ĺ&#x2014;ČŹĹ&#x17E;Ĺ&#x2DC;Ĺ&#x2013;Ĺ&#x2013; iStockPhoto

Kaiser Permanente Cosmetic Services 2440 Samaritan Drive, Suite 2 San Jose, CA 95124 (408) 851-8200 Services described here are provided on a fee-for-service basis. These services are separate from your Health Plan beneďŹ ts and are not provided or covered by Kaiser Foundation Health Plan, Inc. Clinical services are provided by providers or contractors of the Permanente Medical Groups. Results of services vary among patients and cannot be guaranteed. The Permanente Medical Groups, Kaiser Foundation Health Plan, Inc., and Kaiser Foundation Hospitals have a ďŹ nancial interest in the provision of these services. For speciďŹ c information about your Health Plan beneďŹ ts, please see your Evidence of Coverage.

20

THEWAVEMAG.COM MARCH 24 ď&#x161;ş APRIL 6, 2010

ICE ICE BABY

S

o you took our advice and went out for a run (or maybe you just played five sets of tennis or just finished playing soccer or hockey). But now your knee is throbbing and it really feels like youâ&#x20AC;&#x2122;re going to be in a world of hurt tomorrow. The last thing you want to do is nothing. Taking immediate action can reduce and even 22


HEALTH & BEAUT Y: FEATURES

HE A LTH & BE AUT Y

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

21


HEALTH & BEAUT Y: FEATURES

HEALTH & BEAUTY F E AT U R I N G

[ C O N T. ]

eliminate that soreness. So what do you do? Ice it! Wrap an ice pack around the hurt area as soon as you get home. The sooner you ice it, the sooner the swelling and inflammation will decrease. Don’t worry about having a real ice pack or wrap if you don’t have them handy – filling a Ziplock baggie with ice, or grabbing a bag of frozen veggies from the freezer will work just fine. You’ve got to keep the area iced for at least 15-20 minutes for it to be effective, and for maximum benefits, ice the area five times a day with 45 minutes between applications. And, of course, if you still hurt after a day of ice, call the doc.

20

NATURAL SOURCES THAT CAN HELP FIGHT MUSCLE SORENESS AND INFLAMMATION:

HE A LTH & BE AUT Y

Berries. You can pretty much choose any kind (strawberries, blueberries, acai, etc.) Vegetables such as cabbage, broccoli, brussel sprouts and cauliflower.

iStockPhoto

KEEP YOUR FACE HAPPY

A

re you one of the unfortunate souls cursed with ultra-sensitive, red, dry skin? And no matter what you try, including dunking your head into a drum of vegetable oil (we’re kidding; no one does that), you just can’t get that healthy, glowing, moisturized look? Allow us to introduce you to Dr. Andrew Weil who has collaborated with Origins Skin Products to create a collection of treatments to help people just like you. Dr. Weil uses health-promoting plants and herbs in his products that will calm your skin and increase vibrance when used daily. We’re especially fond of his Plantidote™ MegaMushroom line, with moisturizing and soothing properties to create happy faces. TW

Dr. Andrew Weil for Origins www.origins.com 22

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


HEALTH & BEAUT Y: FEATURES

GETAWAY...STAY IN THE BAY! 

/,0,7('7,0(2))(5 0LQXWHV0DVVDJH)5((  9DOLG  )LUVWWLPHYLVLWRURQO\

6LPSO\FDOOXVWRPDNHDQDSSRLQWPHQWDQGPHQWLRQWKHDGV

You don’t have to go far for a getaway. At Cornerstone Spinal Care, we provide the greatest therapeutic massage with the most serene environment that will bring you the exclusive getaway you deserve. Come and experience yourself!

Gift Card Available Cornerstone

Swedish Deep Tissue Hot Stone Shiatsu

Thai Massage Sport Massage Trigger Point Reflexology

995 Montague Expressway Suite 121 • Milpitas • CA 95035 • 408.956.8266

HE A LTH & BE AUT Y

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

23


Dining

» FEATURE

“PB & J” at The Kãama Lounge, by Chris Schmauch

DINING

KÃAMA ONE, KÃAMA ALL

Calvin’s Famous South Philly Cheesesteaks, by Chris Schmauch

L

ocated a stone’s throw from Santana Row, Kãama Lounge and Supper Club is poised to reveal its elegant eastern atmosphere and unique take on culinary comfort to the general public. Matt Mermod, an awardwinning Napa Valley chef, somehow found a way to bring his truly unique vision to the dining table. The Wave can personally attest that Matt’s take on Pot Pie, Mac ‘n’ Cheese, Pork ‘n’ Beans, PB & J (pictured) and more will defy your expectations and delight your senses! Kãama is dedicated to the Goddess of Pleasure - and the comfortable, yet classy ambiance and nostalgic edibles will leave you prostrating to the goddess before the night is over.

Kãama Lounge, 385 S. Winchester Blvd., San Jose (408) 243-4200 www.kaamalounge.com

24

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

if cravings aren’t satisfied, and trying to overcome them just makes it worse, to the point where we feel like inflicting personal harm. So we’ve decided to just give in to cravings, especially if they’re for cheese and steaks, and most notably, for cheesesteaks. There is just no substitute for a melted cheese, tender steak and grilled onions combo served in a warm hoagie (…ooohhhhh merrrrcy). Oh, and it’s got to be a good one, because nothing can make the craving worse than a disappointing cheesesteak. So take our advice and head to one of our favorite establishments:

Amato’s Cheesesteaks, 1162 Saratoga Ave., San Jose (408) 246-4007 www.amatoscheesesteaks.com

CHEESE AND STEAK = CHEESESTEAK

C

ravings are monsters that can’t often be beat. We have no idea why we go mad

Calvin’s Famous South Philly Cheesesteaks, 1411 The

Alameda, San Jose (408) 286-5652 www.calvinscheesesteaks.com

Cheese Steak Shop, Multiple locations www.cheesesteakshop.com

Steven’s Classic Philly Cheesesteaks, 1121 Tasman Dr., Sunnyvale (408) 734-2792

26


SANTANA ROW

|

DINING: FEATURES

BLOWFISH SUSHI

www.blowfishsushi.com 355 Santana Row, Suite 1010, San Jose

Phone: (408) 345-3848 Executive Chef: Ritsuo Tsuchida Cuisine Type: Sushi ; RESERVATIONS RECOMMENDED ; WALKINS OK Lunch: Mon - Fri 11:30am – 2:30pm, Sat and Sun 11:30am-5pm Dinner: Sun - Thu 5 – 10:30pm, Fri and Sat 5pm – 12am Happy Hour: Mon - Fri 5 – 7pm Parking: Parking Lot & Valet

ENTERTAINMENT: Wednesday-Sunday Nights: Live DJs in FUOU SAKE LOUNGE

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE

Contact Name: Nick Momsen (408) 345-3848 nickm@blowfishsushi.com

EXTRAS: t"8"3%8*//*/(3&45"63"/5t BAR SCENE t#64*/&44-6/$)&4t$"46"- ATTIRE t'6--#"3t(*'5$"3%4t */ʰ)064&%+t LATE NIGHT DININGt-*7& &/5&35"*/.&/5t-06/(&"5.041)&3&t -08ʰ$"3#'3*&/%-:t SAKE BAR t 4&"40/"-.&/6t464)*#"3t5",&065 "7"*-"#-&t ZAGAT RATED

SELECTED MENU ITEMS: PYRAMID OF TARTAR............... $10.50 Big Eye Tuna, Atlantic King Salmon, and avocado with a light honey tartar sauce and a sweet ginger soy sauce.

SUSHI COMBINATIONS ........... $9.95

CHILEAN SEABASS ................ $22.00

Itsumono – maguro, hamachi, sake, aburi bincyo, and California Roll

Marinated Chilean Seabass with Rikyu Sesame Sauce

CALAMARI SALAD ................... $8.25

SAKE BY THE BOTTLE

Crispy fried calamari over dressed mixed greens

THE PUNCH............................ $11.00 Sliced filet mignon, steamed spinach in a potato ring with a light garlic soy sauce dusted with cayenne pepper RITSU ROLL .............................. $9.75 A unique offering of two types of tune, avocado, tobiko and nori lightly flash fried served with a citrus ponzu sauce

LUNCH BENTO BOX............................. $9.95

$O$UMI MAKI ................................... $13.50 Shrimp Tempura, spicy tuna & crab mix wrapped in a soy paper and topped with a Sweet and spicy miso aioli

MEIBO “MIDNIGHT MOON” ...... $30 Fruity aromas give way to a light body and smooth texture

MU “NOTHINGNESS” ................ $68

ENTREES ALL ENTREES ACCOMPANIED WITH A TRIPLE MUSHROOM NAPOLEON, WASABI MASHED POTATOES AND ASIAN RATATOUILLE SERVED WITH STEAMED RICE AND INAKA MISO SOUP.

AHI TUNA ............................. $22.00

This amazing Daiginjo holds honeydew flavors and finishes with a comforting spicy warmth

YUKI NO BOSHA “BEAUTY OF AKITA” .....................................

$125 An elegant daigingo with upfront notes of white pepper that fade in dried apricot and melon

Seared Ahi Tuna with a Soy Butter Glaze

Served with steamed rice, miso soup, salad, and vegetables THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

25

DINING

APPETIZERS


DINING: FEATURES

DINING F E AT U R I N G

[ C O N T. ]

24

Professional Culinary Institute

COOK LIKE A PRO

S

DINING

ometimes, the whole point of hosting a dinner party is to get the rave reviews from guests on how delicious your meal was. What’s even better than receiving accolades from dinner parties is cooking delicious meals every night and wowing your spouse and lastminute-drop-in guests. It’s never too late to enhance your skills, and The Professional Culinary Institute in Campbell can help turn your culinary dream into a reality. They were founded in 2005 and offer full- and part-time programs in culinary arts, baking, sommelier certifications and hospitality management. In addition to professional programs, The Professional Culinary Institute also offers weekend hobby classes (grilling, sushi, baking, decorating, etc.) and a number of special events to delight your palate.

Professional Culinary Institute, 700 W. Hamilton Ave., Campbell

www.professionalculinaryinstitute.com

HALF MOON BAY VINTNER SERIES

T

he Ritz-Carlton partners with several distinguished California vintners and wineries to offer premium wine to guests visiting Half Moon Bay. The series begins in April, continuing through August, taking place Fridays from 4 to 6pm and Saturdays from 3 to 6pm in the ENO Tasting Room, a custom-built, upscale room at The Ritz-Carlton Half Moon Bay dedicated to wine, chocolate and cheese (oh my!). The events feature a “wine educator” from 30

26

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


www.loftbarandbistro.com 90 S. Second St., San Jose

Phone: (408) 291-0677

DOWNTOWN SAN JOSE

|

DINING: FEATURES

LOFT BAR & BISTRO

Executive Chef: Adrian J. Mullen Cuisine Type: American, Mediterranean

APPETIZERS

; RESERVATIONS RECOMMENDED ; WALK-INS OK ; OPENTABLE.COM

STEAK BITES ..........................$12.95 Grilled and cubed marinated flank steak served with a cabernet dipping sauce MARINATED FIRE ROASTED ARTICHOKE ..................................$9.95 Olive oil, balsamic and herb marinated artichoke served with chipotle aioli

Mon-Wed 11am-10pm, Thu-Sat 11am-1:30am, Sun Noon-10pm, Sunday Brunch Noon-3pm, Happy Hour Mon-Fri 3-7pm (Bar Only)

SALADS

ENTERTAINMENT:

CHINESE CHICKEN SALAD ....$12.95 Fried marinated chicken tenders with crisp iceburg lettuce, rice noodles, cilantro and almonds in a soy-sesame vinaigrette

Thursday Nights: Live Jazz 7-10pm Fri & Sat Nights: DJ Dancing 10:30pm-1:30am

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS:

GRILLED PRAWN SALAD.........$16.95 Tiger prawns marinated in garlic, olive oil, and balsamic vinaigrette grilled over chopped romaine tossed in sherry vinaigrette garnished with hearts of palm, olives and tomatoes

; CATERING SERVICES AVAILABLE ; CUSTOM MENUS ; 3 ROOMS, 200 INDOOR SEATED, 250 INDOOR STANDING ; 60 OUTDOOR SEATED, 70 OUTDOOR STANDING Catering: Adrian J. Mullen (408) 340-0963 capersloft@sbcglobal.net Banquet: Kam Razavi (408) 203-1664 (same email)

ENTREES CHICKEN PENNE .................$16.95 Chicken, zucchini, squash, mushrooms, sun-dried tomato and Penne pasta tossed in a sherry wine cream sauce

EXTRAS: t"8"3%8*//*/(3&45"63"/5t BAR SCENE t#64*/&44-6/$)&4t CASUAL ATTIRE t&95&/4*7&#&&3 -*45t&95&/4*7&8*/&-*45t'".*-:'3*&/%-:t FREE 8*3&-&44*/5&3/&5t'6--#"3t GIFT CARDS t*/ű )064&%+t LIVE ENTERTAINMENT t-*7&+";;tLOUNGE ATMOSPHEREt-08ű$"3#'3*&/%-:tOUTDOOR DININGt1&340/"-8*/&ŷ$03,"(&'&&ŸtPRIVATE DININGt30."/5*$t4.0,*/("3&"t46/%":#36/$)t 5",&065"7"*-"#-&t7&(&5"3*"/'3*&/%-:

BAKED HALIBUT ................... $22.95 Topped with a roasted red pepper sauce served with seasonal vegetables and rice

“The menu features gourmet turns on classic comfort foods, as exemplified by the meatloaf, made with smoked ham and smothered in a wild mushroom sauce that migrates to the garlic mashed potatoes.” ~The Wave Magazine

CAMPBELL

|

CAJUN SPICE AHI TUNA ...... $23.95 A 10oz. portion of pan-seared Cajun Ahi Tuna topped with a soy glaze, served with rice, sautéed spinach and mushrooms

CAPERS EAT & DRINK APPETIZERS TUNA SASHIMI......................$12.95 Black and white sesame seed crusted Ahi tuna, served with an Asian noodle salad

www.caperseatanddrink.com 1710 W. Campbell Ave., Campbell

Phone: (408) 374-5777

SAUTEED PRAWNS ................ $11.95 Ginger prawns sautéed with garlic and lemon, scampi style

Executive Chef: Adrian J. Muller Chef de Cuisine: Alphonso Lopez Cuisine Type: American

WARM GOAT CHEESE SALAD . $9.95 Breaded goat cheese, mixed greens, sherry vinaigrette, cherry tomato and black olives

Mon-Wed 11am-10:30pm, Thu-Sat 11am11:30pm, Sun 9am-10pm, Brunch 9am12:30pm, Thursdays: 2 for 1 Margaritas

GRILLED FLANK STEAK SALAD . $17.95 marinated flank steak on chopped iceberg lettuce with artichoke hearts, tomato and olives tossed in balsamic vinaigrette and crumbled bleu cheese

2 FOR 1 MARTINIS MONDAYS AND TUESDAYS ENTERTAINMENT:

ENTREES

Friday Nights: Live Music 9-11:30pm

MARINATED STIR-FRY ............. $17.95 Choice of beef, or chicken served over basmati rice, celery, onion, carrots, zucchinis, bell peppers in a soy teriyaki sauce

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE ; 1 ROOM, 125 INDOOR

Contact Name: Kam Razavi (408) 203-1664 capersloft@sbcglobal.net

EXTRAS: t"8"3%8*//*/(3&45"63"/5t#64*/&44-6/$)&4t $"46"-"55*3&t FAMILY FRIENDLY t'3&&8*3&-&44 */5&3/&5t'6--#"3t-08ű$"3#'3*&/%-:t065%003 DINING t410354#"3t46/%":#36/$)

“Capers – which could mean either the delicious Mediterranean condiment or a playful escapade – seems a particularly appropriate name for this popular spot. Fire-roasted marinated artichokes, flash-fried calamari with jalapeños, a killer chicken marsala, and a meatloaf entrée with a wholesome reputation are just some of the enticing menu items.” ~The Wave Magazine

PANKO-CRUSTED CHICKEN BREAST ..................$12.95 With a honey mustard sauce, or chicken parmesan style, served with garlic mashed potatoes and seasonal vegetables (also available as Chicken Parmesan) BAKED ORANGE ROUGHY ....$18.95 Fresh fillet baked in white wine lemon-butter, served with rice and seasonal vegetables and topped with a lemon caper sauce

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

27

DINING

SALADS

; WALK-INS OK ; OPENTABLE.COM


MENLO PARK

|

CAFÉ PRIMAVERA www.cafeprimavera.com Cafe Primavera at The Allied Arts Guild 75 Arbor Road, Menlo Park

Phone: (650) 321-8810 mariat@cafeprimavera.com

Executive Chef: Greg Russi ; WALKINS OK

Mon-Sat 10am - 4pm Breakfast: 10:00am-11:30am Lunch: 11:30am-2:30pm Afternoon Tea & Dessert: 2:30-4:00pm 1st & 3rd Saturday Brunch: 10:00am-2:30pm

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: Cafe Primavera is a well-established South Bay staple, which made its way into the Peninsula in September of 2009. Owner, Joanna Biondi, began the café over thirty years ago, expanded into a thriving catering and event planning company with currently two operating restaurants. We are excited to share with you our everchanging seasonal gourmet menu and ability to accommodate both intimate and large parties regularly.

Contact Name: Erika

(408) 721-9276 erika@cafeprimavera.com

EXTRAS: t#64*/&44-6/$)&4t'".*-: '3*&/%-:t'3&&8*3&-&44*/5&3/&5 t(*'5$"3%4t13*7"5&%*/*/(t 4$&/*$7*&8t5",&065"7"*-"#-&t 7&(&5"3*"/'3*&/%-:

DINING

SELECTED MENU ITEMS: S M A L L P L AT E S CHEF’S SEASONAL SOUP ............. $7 CAPRESE SALAD (*SEASONAL).......... $10 Heirloom Tomatoes, Mozzarella Di Bufala, Basil, Evoo & Grilled Ciabatta Bread SMOKED PANCETTA MAC AND CHEESE ..................... $10 Smoked Fiscalini Cheddar, Sharp Cheddar, Gruyere Swiss, Parmesan Toasted Bread Crumbs

SALADS AHI NICOISE SALAD ................... $14

Candied Pecans, Strawberries, Red Grapes, Laura Chenel Goat Cheese & Blush Vinaigrette

SANDWICHES “CUBANO” PULLED PORK AND IMPORTED SERRANO HAM ......... $12 Panini Pressed with Chipotle Aioli, Pepper Jack Cheese, Mustard, and Dill Pickles

EIGHT GRILLED VEGETABLE PANINI SANDWICH ................................ $11 Marinated Eggplant, Zucchini, Yellow Squash, Red Bell Pepper, Yellow Bell Pepper, Portobello Mushroom, Sauteed Onions, Roasted Roma Tomatoes, Goat Cheese and Kalamata Olive Oil

Seared Ahi Tuna, Potatoes, Haricot Vert, Cooked Egg, Olives,Tomatoes & Caper-Dijon Vinaigrette

GRILLED BRIE AND ROASTED TURKEY AND PEAR PANINI ...................... $15

SPINACH SALAD ......................... $10

Apple-Cranberry Chutney, Roasted Turkey, Sliced Pears

28

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

PA S TA S ROASTED VEGETABLE CANNELLONI ............................ $15 Red & Yellow Peppers, Zucchini, Yellow Squash, Shiitake Mushrooms, Goat Cheese, Tomato-Basil Sauce, Parmesan Reggiano & Pinenuts, Olives,Tomatoes & Caper-Dijon Vinaigrette

BRAISED SHORT RIBS, PAPPERADELLE, AND WINTER VEGETABLES .......... $17 Papperadelle Pasta, Parsnip, Rutabaga, Carrots, Mushrooms

DESSERTS CHEF RUSSI’S TIRAMISU ........... $8.00 CAFÉ PRIMAVERA LAVA CAKE... $8.00 Warm Luscious Molten Chocolate Center & Vanilla Bean Gelato


SUNNYVALE

|

SIAM TASTE www.siamtastethai.com 172 S. Murphy Ave., Sunnyvale

Phone: (408) 245-8585 Cuisine Type: Thai Cuisine ; RESERVATIONS RECOMMENDED ; WALKINS OK

Mon - Fri: 11am – 10pm Sat: Noon – 10:30pm, Sun: Noon - 10pm Lunch Menu Available Mon-Fri 11am-3pm Parking: Parking Lot

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE ; WEDDING, PARTY, EVENT, CORPORATE, COMPANY PARTY

Contact Name: Cat or Peter (408) 245-8585 austin2526@yahoo.com, phanudejp@hotmail.com

EXTRAS: t#64*/&44-6/$)&4t GIFT CARDS t065%003%*/*/(t5",&065 AVAILABLE t7&(&5"3*"/'3*&/%-:

SELECTED MENU ITEMS: LUNCH

V E G E TA R I A N

CHICKEN SATAY ...................... $8.95

PANANG CURRY WITH ROCK COD OR PRAWN ............................. $9.95

ROTI ....................................... $ 6.95 Fried wheat flour served with cucumber salad and peanut sauce

Marinated chicken, on skewers; served with peanut sauce and cucumber salad

FISH CAKES ............................ $8.95 Deep fried spicy fish cakes; served with cucumber salad

SOUP/SALADS HOT AND SOUR SOUP (TOM-YUM GOONG) .............. $6.95/BOWL

Includes Soup of the day, Salad, Spring Roll, and Steamed rice

GRILL SALMON WITH SPICY MANGO SALAD ..................... $9.95 Includes Soup of the day, Salad, Spring Roll, and Steamed rice

HOUSE SPECIALS

Fresh lemon grass, kaffir lime leaves, lime juice, chili paste, fish sauce, cilantro

LAMB CHOP .......................... $ 16.95

GREEN PAPAYA SALAD

Grill lamb chop served on top of stir fried fresh green beans, carrot and homemade red chili sauce with steamed rice

(SOM-TUM ) ............................................... $8.95

Shredded green papaya, peanuts, green beans, tomatoes, garlic and chili with lime

TOFU IN CLAY POT ................ $10.95 Soft tofu cooked in clay pot, sautéed with vegetables and house sauce HOUSE SPECIAL FRIED RICE (PINEAPPLE FRIED RICE) ................... $10.95 Fried tofu, pea, carrot, pineapple, onion, cashew nut served in pineapple shell

RICE/NOODLES

PA-NANG SEAFOOD .............. $15.95

PAN FRIED THAI NOODLE WITH SHRIMP ( PAD THAI) .......... $ 10.95

Combination of seafood with Pa-nang curry, basil and coconut milk; served on a hot plate

Fried Thai Noodles with egg, tofu onions and bean sprouts THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

29

DINING

APPETIZERS


DINING: FEATURES

DINING F E AT U R I N G

[ C O N T. ]

26

the participating wineries who will guide and educate guests on new and interesting wines. Prices range from $25 to $35 per person, and the delectable cheeses and chocolates are also available for purchase from the ENO Tasting Room.

April, Bonny Doon Vineyard May, Big Basin Vineyards June, Hall Wines July, Chateau Montelena Winery August, Joseph Phelps Vineyards For more information: (650) 712-7000 www.ritzcarlton.com

LA VIC’S ORANGE SAUCE

I

DINING

f you’ve ever visited La Victoria Taqueria, By Chris Schmauch you’re familiar with their famous “orange sauce.” If you’ve never partaken, then pay attention. Let’s begin by stating that we have no idea what’s in this stuff. All we know is that a squirt of it on anything will make even an old bicycle tire taste euphoric. Yes: EUPHORIC. We’re not suggesting La Vic’s food isn’t fit for consumption or is comparable to a tire; rather, we’re suggesting that this orange sauce was likely created via alien technology. And nothing beats alien technology. After tasting the orange sauce, don’t even think about swiping the bottle, as they’ve got a team of spotters (aliens, likely) who will hunt you down. So here’s what you do: Order anything off the menu and make sure to get a bottle of orange sauce on the side. Make sure the bottle is full, because you’ll want every last drop.

La Victoria Taqueria, 140 E. San Carlos St., San Jose (408) 298-5335, 131 E. Santa Clara St., San Jose (408) 993-8230, 5015 Almaden Expwy., San Jose (408) 978-7666 30

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

35


SAN JOSE

|

DINING: FEATURES

SPENCER’S FOR STEAKS & CHOPS SELECTED MENU ITEMS

www.spencersforsteaksandchops.com 2050 Gateway Place, San Jose

SPENCER’S SALAD Field greens, dried cherries, Petaluma Cowgirl blue, balsamic vinaigrette

Phone: (408) 437-2170 Executive Chef: Nicki Rohadfox Jeannine Bettencourt – General Manager Ryan Hanneman – Assistant Restaurant Manager Patrick Sarte – Wine Manager

CRAB CAKES Grilled artichoke salad, lemon aioli SPENCER’S LOADED HASH BROWNS Applewood smoked bacon, sharp cheddar, sweet onions, chives, sour cream

; RESERVATIONS RECOMMENDED ; WALKINS OK ; OPENTABLE.COM

PRIME SPENCER’S STEAK 14oz boneless rib-eye

Lunch: Mon-Fri, 11:30am–2pm Dinner: Mon-Sun, 5–10pm Parking: Self Parking, Valet, Validation

NATURAL COWBOY-CUT RIB CHOP 18oz bone-in rib-eye SEARED RARE AHI TUNA AU POIVRE Sautéed spinach, cognac cream

WEDDINGS / PRIVATE DINING / CORPORATE FUNCTIONS:

CHOCOLATE “NAUGHTY” CAKE A decadent flourless chocolate cake

We can accommodate parties of all sizes, 2 private dining rooms available. Indoor seating and indoor standing. Contact: Jeannine Bettencourt jeannine.bettencourt@hilton.com

EXTRAS: t"8"3%8*//*/(3&45"63"/5t"8"3%8*//*/( 8*/&-*45t#64*/&44-6/$)&4t&95&/4*7&8*/& -*45t'".*-:'3*&/%-:t'3&&8*3&-&44*/5&3/&5 t'6--#"3t13*7"5&%*/*/(

“This is a steakhouse-away-from-home for grilling fanatics, located in the San Jose DoubleTree Hotel. George Foreman wannabes will appreciate the variety of premium grade cuts on the menu, and envy the

|

state-of-the-art infrared broiler that sears each one to an unholy 1,700 degrees.” ~The Wave Magazine

SANTA CLARA

BIRK’S RESTAURANT FROM THE RAW BAR CHILLED SHELLFISH PLATTER .......$65 A selection of Alaskan king crab legs, oysters, wild American prawns and mussels Vinaigrette with accompaniments (Serves 3-5)

STEAKS, CHOPS AND SEAFOOD SINCE 1989

www.birksrestaurant.com 3955 Freedom Circle, Santa Clara

CLASSICS FROM OUR SPLIT IRON GRILL

Phone: (408) 980-6400

PEPPERED FILET MIGNON ..........$36 Cracked pepper crusted with cognac-green peppercorn sauce

; RESERVATIONS RECOMMENDED ; OPENTABLE.COM

BLUE CHEESE STUFFED FILET MIGNON..........................$35 Roasted beets, homemade lattice potato and rosemary/port reduction

Lunch: Mon-Fri 11:15am-2:30pm Dinner: Mon-Sat 5-9:30pm, Sun 5-9pm “Happier” Hour: 4-6pm

PRIME BONE-IN RIB CHOP .........$37 Blue cheese butter, horseradish mashed potatoes and creamed spinach

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS:

FROM OUR WOOD SMOKER

; 3 Rooms, Accommodate up to 40 Indoor Seating, 50 Indoor Standing

PRIME RIB ........ $29 (12oz), $32 (16oz) Seasoned and slow smoked with creamed horseradish and beef au jus

Contact Name: Rachel Coxen (408) 980-6400 rcoxen@birksrestaurant.com

EXTRAS: t"8"3%8*//*/(8*/&-*45t#64*/&44-6/$)&4t &95&/4*7&#&&3-*45t&95&/4*7&8*/&-*45t'6-- #"3t(*'5$"3%4t065%003%*/*/(t0:45&3#"3t 1&340/"-8*/&ŷ$03,"(&'&&Ÿt13*7"5&%*/*/(t 8*/&41&$5"503"8"3%

“Almond wood and mesquite charcoal fuel the tender flavors emanating from this upscale American grill designed by Pat Kuleto. The open kitchen features superb steaks cut from tender, dry-aged, free-range beef and organic, local produce including the popular creamed spinach side. A business-casual hot spot for locals who like the kitchen energy at the grill and the succulent seafood at the oyster bar. Couples should request the lighter, U-shaped ‘Snoopy room’ (shaped like Snoopy’s nose) for more intimacy.” ~The Wave Magazine

WEEKEND AMERICANA MENU FRI, SAT, SUN Four 3-Course Dinners for under $30 (Not inclusive of Tax & Gratuity)

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

31

DINING

Executive Chef: Maurice Dissels Cuisine Type: Steaks, Chops, Seafood


TANDOORI OVEN APPETIZERS SAMOSAS..............................$4.69 2 home made pastry shells stuffed with potatoes roasted in cumin. Served with a side of seasoned garbanzo beans (cholay)

SALADS www.thetandoorioven.com

TANDOORI PANEER SALAD ....$8.49 Tandoori baked paneer cheese on a bed of romaine lettuce, tossed with cucumbers, tomatoes, onions, walnuts, dried cranberries and our own cabernet vinaigrette dressing, garnished with feta cheese.

CAMPBELL: Pruneyard Shopping Center, 1875 S. Bascom Ave. (408) 559-3885 DOWNTOWN LOS GATOS: 133 N. Santa Cruz Ave. (408) 395-1784 PALO ALTO: 365 California Ave. (650) 324-2111 SAN JOSE: 150 S First St. #107 (408) 292-7222

TA N D O O R I W R A P S

; WALK-INS OK

CHICKEN WRAP......................$7.49 Our favorite, Tender chicken straight from the tandoor, cucumber, tomatoes and mint thayo sauce wrapped in freshly baked naan bread

Cuisine Type: Indian Bistro

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS:

TANDOORI FAVORITES

; CATERING SERVICES AVAILABLE

CHICKEN TIKKA ................... $10.49 5 pieces of marinated tender chicken breast, hot from the tandoor, served on a bed of basmati rice with naan and cucumber salad. For a low carb alternative substitute rice and naan for extra cucumber salad wrapped in freshly baked naan bread

Contact Name: Mani Kadir (415) 747-0942 mani@thetandoorioven.com

EXTRAS: t"8"3%8*//*/(3&45"63"/5t#64*/&44-6/$)&4 t$"46"-"55*3&t FAMILY FRIENDLY t'3&&8*3&-&44 */5&3/&5t065%003%*/*/(t7&(&5"3*"/'3*&/%-:

SAN JOSE

|

CHICKEN BIRIYANI ............... $10.49 Saffron basmati rice dish tossed with grilled chicken or lamb, onions, bell peppers, almonds, raisins, and secret spices. Served with raita. Your choice of meat: grilled Chicken or lamb

IMPROV APPETIZERS

www.improv.com 62 S. Second St., San Jose

Phone: (408) 280-7475 Cuisine Type: American

DINING

; RESERVATIONS RECOMMENDED ; WALK-INS OK

Dinner Available: 1st Show Thursday – Sunday Late Night Menu Available All Shows Parking: Parking Lot

ENTERTAINMENT: Wednesday - Sunday Nights: Live Stand-Up Comedy

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CORPORATE FUNCTIONS, DAY TIME BUSINESS MEETINGS ; PRIVATE PARTIES, HOLIDAY PARTIES, BIRTHDAY PARTIES, FUND RAISING EVENTS ; ACCOMODATES 20-400

Contact Name: Chazlee Rivera (408) 280-7475 chazlee@improv.com

EXTRAS: t$"46"-"55*3&t FULL BAR t(*'5$"3%4t LATE NIGHT DINING t-*7&&/5&35"*/.&/5 32

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

SLIDERS 4 mini-burgers, fresh ground beef patties, garlic mayonnaise, choice of swiss or cheddar cheese, on a grilled bun SPINACH & ARTICHOKE DIP A creamy blend of fresh spinach, artichoke hearts and Jack cheese. Served with multicolored tortilla chips

SANDWICHES/ BURGERS BLUES BURGER Two fresh ground beef patties, bleu cheese, crispy prosciutto, spicy avocado sauce, lettuce and tomatoes on a grilled bun. Served with seasoned fries SAUTEED CHICKEN SANDWICH Sauteed breast of chicken flavored with cumin aioli topped with roasted red peppers, swiss cheese and guacamole spread on a grilled ciabatta roll. Served with seasoned fries.

ENTREES ASIAGO CRUSTED CHICKEN Asiago cheese crusted chicken breast served with roasted garlic mashed potatoes and grilled asparagus and drizzled with a lemon garlic butter PRIME RIB A meat-lover’s delight! A 10-ounce protion of succulent prime rib. Served with roasted


DINING

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

33


DINING: FEATURES

SAN JOSE

|

BLUE ROCK BBQ SANDWICHES TENNESSEE PULLED PORK Hickory smoked, served on a grilled bun with our homemade barbecue sauce (topped with cole slaw upon request) SIRLOIN Smoked and sliced thin, served on a grilled French roll, with carmelized onions and peppers, topped with provolone cheese upon request

www.bluerockbbq.com 3001 Meridian Ave., San Jose

CUBAN Pressed with ham, pulled pork, Swiss cheese, pickles and mustard, served on a grilled French roll

Phone: (408) 978-BLUE (2583) Cuisine Type: BBQ

P L AT E S

ALL PLATES ARE SERVED WITH A CHOICE OF TWO SIDE DISHES

Hours: Mon - Sat 11am-9pm, Sun Noon-8pm Parking: Parking Lot

BABY BACK RIBS 4 Ribs / Half Rack / Full Rack

DINE-IN / TAKE-OUT / CATERING:

TENNESSEE PULLED PORK

; 2009 BEST BBQ - METRO ; 2009 BEST BBQ SAN JOSE MERCURY NEWS ; BEST NEW RESTAURANT ď&#x161;ŽHONORS) THE WAVE MAGAZINE

HICKORY-SMOKED CHICKEN INDONESIAN BEEF AND PINEAPPLE SKEWER

SALADS MIXED GREEN SALAD Spring Romaine Mix, grape tomatoes, carrots, red onions ADD: Pulled Pork / Pulled Chicken / Smoked Chicken Salad (upon request)

SARATOGA

BELLA SARATOGA APPETIZERS EGGPLANT ROLLATINI BRUSCHETTE

www.bellasaratoga.com

SEAFOOD/FISH

DINING

14503 Big Basin Way, Saratoga

Phone: (408) 741-5115

DAILY FISH SPECIALS

Fax: (408) 868-9774

GRILLED PETRALE SOLE

Cuisine Type: Italian

CIOPPINO

; RESERVATIONS RECOMMENDED ; WALK-INS OK

-VODI 11am-4pm %JOOFS 4pm-Close 4VOEBZ.VTJDBM#SVODI 10am-3pm 1BSLJOH Parking Lot or Street 0QFO%BZT

M E AT S CHICKEN SALTIMBOCCA FILET MIGNON SARATOGA GRILLED PORK CHOPS

HANDMADE PASTA & RISOTTO

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; 2 rooms, accommodate up to 55 Indoor Seating, 80 Outdoor Standing

LINGUINE TUTTOMARE CHICKEN RISOTTO

Contact: (408) 741-5115

HOMEMADE RAVIOLIS

EXTRAS: t"8"3%Ĺą8*//*/(3&45"63"/5t"8"3%Ĺą8*//*/( 8*/&-*45t#64*/&44-6/$)&4t$"46"-"55*3& t&95&/4*7&8*/&-*45t'6--#"3t(*'5$"3%4t -08Ĺą$"3#'3*&/%-:t065%003%*/*/(t5",&065 "7"*-"#-&t7&(&5"3*"/'3*&/%-:t8&&,&/% #36/$)t46/%":#36/$)t'-"5#3&"%1*;;"4Ĺą 0/-:03("/*$*/(3&%*&/54t'3&&3"/(&.&"5t (3&"54&"'00%

34

DESSERTS OLD-FASHIONED BREAD PUDDING â&#x20AC;&#x153;Comfortable family dining is served up daily at this elegant Victorian home turned restaurant in the heart of Saratoga. Bella Saratogaâ&#x20AC;&#x2122;s extensive authentic Italian menu features award winning homemade pasta, fresh baked bread, and a comprehensive wine list to complement any meal.â&#x20AC;? ~The Wave Magazine

THEWAVEMAG.COM MARCH 24 ď&#x161;ş APRIL 6, 2010

CHOCOLATE DECADENCE TIRAMISU

MUSIC ON WEEKENDS!


DINING: FEATURES

DINING F E AT U R I N G

[ C O N T. ]

30

;DJGH:6HDCH=DI:A

Alexander’s Steakhouse, by Chris Schmauch

WHO’S GOT THE BEEF? ALEXANDER’S STEAKHOUSE When it comes to steakhouses, the quality of the meat is paramount. And Alexander’s has upped the ante by being one of two restaurants in Northern California that dry-ages its own meat. Stick with the meat and potatoes classics cooked on a showcase grill at this sophisticated steakhouse, or reward yourself with a tender, juicy slab of imported Kobe beef and a flight of chilled sake. But there’s more to why Alexander’s consistently snags top honors. A modern, minimalist interior with a clean, comfortable Japanese feel makes a serene backdrop for relaxed, long dinners, while succulent seafood dishes such as Lobster Dumplings and Main Lobster keep the taste buds of non-beef lovers equally happy.

;djgHZVhdch=diZaH^a^XdcKVaaZn^heZg[ZXi[dgZkZgn dXXVh^dc#=dhi^bedgiVcibZZi^c\h!eaVcZmigVdgY^cVgn

THE GRILL ON THE ALLEY

ZkZcih!Y^cZViFjViigd!gZaVm^cI]ZHeV!dgZc_dnV

The Grill’s locaThe Grill - Meatloaf, by tion at the base of Chris Schmauch Downtown’s posh Fairmont Hotel, coupled with its proximity to the San Jose Museum of Art, make it a favorite among diners on both cultural and business outings. Inside, a ’40s Art Deco interior puts the emphasis on intimate, comfy booths (with lots of places to hang your coat – always appreciated). The Green Room offers clubby private dining for large groups, and the Wine Room sets forth a long formal table beneath an elegant copper ceiling, flanked by cases of fine vino. Patio seating at the front offers a view of the Carousal at holiday time. The menu, like the décor, focuses on American classics: New York steak, U.S. prime Tomahawk rib chop, pan-fried petrale sole, and chicken pot pie. The steaks will never disappoint, but our all-time favorite is the Meat Loaf. 38

lZZ`ZcY\ZiVlVn#I]ZZe^idbZ d[hinaZVcYXdb[dgi!lZVgZ]ZgZ

DINING

idbZZindjgcZZYh!VhValVnh#

EaZVhZXVaa+*%#),%#(-,. dgk^h^illl#deZciVWaZ#Xdb

;djgHZVhdch=diZaH^a^XdcKVaaZn! '%*%Jc^kZgh^in6kZcjZ!:VhiEVad6aid!86.)(%(

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

35


LOS ALTOS

|

FIESTA VALLARTA APPETIZERS TAQUITOS Deep-fried corn tortillas filled with shredded chicken, lettuce, guacamole, Salsa Fresca & sour cream

"VUIFOUJD.FYJDBO'VTJPO www.fiestavallarta.com

BUFFALO WINGS Ranch dressing, spicy hot sauce

301 State St., Los Altos 94022

Phone: (650) 559-5871

SALADS

Fax: (650) 559-5872

SALMON SALAD Grilled Salmon served with mixed greens, avocado, and tomatoes

Cuisine Type: Mexican ; RESERVATIONS RECOMMENDED ; OPENTABLE.COM ; WALKINS OK

TOSTADA SALAD VEGETARIANA Sautéed vegetables, Rice and Black beans served in a flour tortilla shell Fresh guacamole, sour cream, cheese and salsa fresca and ice berg lettuce

Open Daily: 11:30am - 9pm Happy Hour: 3-5pm Parking: Parking Lot

ENTREES 26. FAJITA (GRILLED BEEF OR CHICKEN) martin veggies, salsa fresca, sour cream and guacamole with a choice of tortillas

ENTERTAINMENT: Live Music PLEASE CHECK OUR WEBSITE FOR SCHEDULE

9. VALLARTA BURRITO Prawns sautéed in garlic butter, refried beans, rice, avocado, topped with cheese and sour cream

EXTRAS: “Head South of the border with Fiesta Vallarta’s sophisticated blend of authentic Mexican cuisine and secret family recipes. Taste the exciting flavors of their homemade salsa, enchiladas, tamales and chimichangas while enjoying the festive music and laughter. Order a couple of margaritas or an imported Mexican beer from their full-service bar to make the occasion a fiesta. ” ~The Wave Magazine

DINING

t'".*-:'3*&/%-:t'6--#"3t(*'5$"3%4t-*7& &/5&35"*/.&/5t-*7&.64*$t5",&065"7"*-"#-&t

36

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

34. CAMARONES A LA DIABLA Prawns sautéed with butter, garlic, onions, tomatoes, in spicy Chile de arbol sauce and herbs 41. CAMARONES CHIPOTLE Prawns sautéed with chipotle Sauce, garlic, onions, tomatoes


DOWNTOWN SAN JOSE

|

PAOLOâ&#x20AC;&#x2122;S ANTIPASTI FRITTO MISTO Fried calamari, rock shrimp and artichokes, lemon-caper mayonnaise

www.paolos.com 333 West San Carlos, San Jose

Phone: (408) 294-2558 Executive Chef: Carolyn Allen Cuisine Type: Modern Italian ; RESERVATIONS RECOMMENDED ; WALK-INS OK

P R I M I P I AT I : Z U P P E E I N S A L AT E INSALATINA DI BARBABIETOLA E BURRATA Roasted beet, burrata and herb salad, grilled house-made focaccia, blood orange citronette, basil oil

Lunch: Mon-Fri 11:30amâ&#x20AC;&#x201C;2:30pm Dinner: Mon-Sat 5:30pm-10pm Happy Hour: Thursday Martini Night Parking: Validation

P R I M I P I AT T I : PASTE

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS:

LINGUINE CON FRUTTA DI MARE Thin, flat noodles, cockles, mussels, scallops, rock shrimp and calamari in spicy tomatosaffron seafood broth

; CATERING SERVICES AVAILABLE CUSTOMIZED MENUS TO SUIT ALL TASTES

Contact Name: Carolyn Allen (408) 294-2558

S E C O N D I P I AT T I

5 rooms, accommodate up to 200 Indoor Seating, 200 Outdoor Seating, 300 Indoor Standing, 350 Outdoor Standing

Contact Name: Kimberly Fujino (408) 294-2558

â&#x20AC;&#x153;This is Italian cuisine with a definite California edge. Niman Ranch guanciale (pork cheeks) and locally

EXTRAS:

foraged mushrooms give house-made butternut squash gnocchi a mellow NorCal attitude, and roasted

t"8"3%8*//*/(3&45"63"/5t"8"3%8*//*/( 8*/&-*45t#64*/&44-6/$)&4t'6--#"3t-08Ĺą $"3#'3*&/%-:t065%003%*/*/(t30."/5*$t 8&%%*/(4"/%41&$*"-&7&/54t13*7"5&%*/*/(t 4$&/*$7*&8t8*/&41&$5"503"8"3%

Culver duck breast is tender but worldly with the addition of Pincholine olives, Medjool dates, a Malvasia

|

reduction, and braised local greens. Consult the sommelier for wine pairings that have earned repeat commendations from Wine Spectator. Paoloâ&#x20AC;&#x2122;s serves bargain â&#x20AC;&#x153;CPA Specialâ&#x20AC;? buffets before and after matinees

ANITRA CON OLIVE E DATTERI Roasted Culver duck breast, Picholine olives, Medjool dates, Malvagia reduction, braised greens BRANZINO SICILIANO Poached farm-raised striped bass, tomato, Picholine olives, capers, oregano, prunes, clams and bruschetta

and early-evening performances at San Joseâ&#x20AC;&#x2122;s Center for the Performing Arts.â&#x20AC;? ~The Wave Magazine

SUNNYVALE

FIREHOUSE GRILL & BREWERY MENU HIGHLIGHTS CALAMARI Lightly Dusted with Seasoned Flour, Quick Fried, Served with Tartar or Cocktail Sauce FIREHOUSE BUFFALO WINGS Served with French Fries, Celery and Ranch Dressing. Traditional or Habanero

www.firehousegrill.com 111 S. Murphy Ave., Sunnyvale 1765 E. Bayshore Rd, East Palo Alto

&YFDVUJWF$IFG Chris Hicks $VJTJOF5ZQF American

BBQ BACON BURGER Bacon, Stout BBQ Sauce, Cheddar

; RESERVATIONS RECOMMENDED ; WALK-INS OK

PHILLY CHEESE STEAK Shaved Prime Rib, Grilled Onions and Peppers FISH TACOS Grilled Flounder, Cabbage, Cayenne Ranch

)PVST Open Daily at 11am )BQQZ)PVS Mon-Sat 2-7pm, Sun 7pm-close 1BSLJOH Parking Lot

PULLED PORK TACOS Topped with Cilantro, Onions, Chipotle Aioli GRILLED WILD SALMON Served with Mashed Potatoes and Sauteed Vegetables

ENTERTAINMENT: 5IVSTEBZ 'SJEBZ 4BUVSEBZ/JHIUT 9pm-12am (Sunnyvale location)

FIREHOUSE CIOPPINO Mussels, Scallops, Shrimp, White Fish, Simmered Tender in a Spicy Tomato Broth

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ;$"5&3*/(4&37*$&4"7"*-"#-& ;300.4 */%0034&"5&% 065%0034&"5&%

$POUBDU/BNF Leticia Jensen

(408) 773-9500 gm@firehousegrill.com

ROTISSERIE CHICKEN Sauteed Vegetables and Mashed Potatoes

EXTRAS: t"8"3%8*//*/(3&45"63"/5t#64*/&44-6/$)&4t$"46"-"55*3&t&95&/4*7&#&&3-*45t-"5&/*()5 %*/*/(t-*7&&/5&35"*/.&/5t065%003%*/*/(t4.0,*/("3&"t410354#"3t5",&065"7"*-"#-&

BREW MASTER BABY BACK RIBS Slow Roasted Ribs, Braised with Pale Ale, French Fries â&#x20AC;&#x201C; Half or Full Rack

THEWAVEMAG.COM MARCH 24 ď&#x161;ş APRIL 6, 2010

37

DINING

WALNUT GORGONZOLA Seasonal Greens, Toasted Walnuts, Gorgonzola, Sundried Cranberries, Fresh Granny Apples, Tossed with Shallot-Thyme Vinaigrette

  Sunnyvale   Palo Alto


DINING: FEATURES

DINING F E AT U R I N G

[ C O N T. ]

35

Sundance the Steakhouse, by Chris Schmauch

SUNDANCE THE STEAKHOUSE Sundance certainly excels as a steakhouse – their signature prime rib is available in four different sizes, and other steaks are cut daily by the in-house butcher. Sundance vanquishes rivals as a destination restaurant; it’s the kind of place you go when you want to celebrate a promotion, mark an anniversary or impress an out-of-towner. The dimly lit, mahogany-paneled interior sets the vibe for quiet enjoyment. Pre-meal martinis and post-dessert ports are practically requirements, and anyone who isn’t crazy about steak can dive into a seafood menu that rivals any seaside bistro. At lunchtime, huge burgers and hearty French dip sandwiches round out an abbreviated menu of high-end comfort food. A wine list with more than 400 selections is constantly updated with global varietals.

FORBES MILL STEAKHOUSE

DINING

Come experience the MIZU wave of excellence.

Follow us on:

APPETIZERS. SALADS. SUSHI. SASHIMI. BBQ. & BAR. LUNCH Fast Lunches. Bento boxes from $8.95 DINNER New Menu! Call ahead to make your RSVP now! HAPPY HOUR 5:00 - 6:30pm SUN - FRI $3/4 Bar Bites, $4/$5 Drinks PARTY PLATTERS Having a Party? We can help you with that!

1035 S. Winchester Blvd., San Jose, CA 95128 (408)260.7200 | WWW.MIZUSJ.COM

38

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

Forbes Mill has a large Forbes Mill, by Chris menu of appetizer, entrée Schmauch and dessert items, but you’ll want to zero in on the section featuring the meat that made this place famous: Beef. At the very least, Forbes proves that the phrase “melts in your mouth” is not a cliché. Anyone who has ever indulged in one of Forbes’ ribeyes, dry-aged New York strips, or filet mignons knows what we’re talking about. They also offer Kobe beef – technically, it’s 100 percent American Wagyu raised in Northern California, but under the same strict guidelines that define this exclusive type of Japanese meat. Each cow has been fed nothing but beer and corn for its entire life (while being hand-massaged in air conditioned pens). The resulting steak has a tender, buttery consistency that you simply won’t find in other cuts. The steaks are so good that many patrons will accidentally overlook the extensive wine list, as well as the large selection of salads and seafood entrees.

Alexander’s Steakhouse, 10330 N. Wolfe Rd. (408) 446-2222 www.alexanderssteakhouse.com Forbes Mill Steakhouse, 206 N. Santa Cruz Ave., Los Gatos (408) 395-6434

www.forbesmillsteakhouse.com

The Grill on the Alley, 172 S. Market St., San Jose (408) 294-2244 www.thegrill.com Sundance the Steakhouse, 1921 El Camino Real, Palo Alto (650) 321-6798

www.sundancethesteakhouse.com

42


SAN JOSE

|

DINING: FEATURES

MOSAIC RESTAURANT & LOUNGE S TA R T E R S BABY BURGERS AND BITES .....$8.00 Beef, Chicken, or Pork

www.mosaicsanjoseca.com 211 South First St., San Jose

MOSAIC CRAB CAKE ............$11.00 Maryland Blue Crab, Citrus Butter Sauce

1IPOF   &YFDVUJWF$IFG Albert Nguyen-Phuoc $VJTJOF5ZQF American, French & Asian Fusion

SANDWICHES

; RESERVATIONS RECOMMENDED ; WALK-INS OK ; OPENTABLE.COM

CHICKEN BLT ......................... $9.00 Gruyere Cheese, Bacon, Tomato, Garlic Aioli MOSAIC CHEESEBURGER ......$11.00 Black Angus Beef, Cheddar, Gruyere, or Bleu Cheese, Crispy Onions, Chipotle Ketchup

#SFBLGBTU Daily 6:30 â&#x20AC;&#x201C; 10am %JOOFS Daily 5 - 10pm )BQQZ)PVS Mon - Fri 5 - 7pm Closed for Lunch 1BSLJOH Validated & Parking Lot

M A I N P L AT E S POACHED ATLANTIC SALMON.............................. $18.00 Marinated grapes, Fennel, Tomatoes, VerjusLemongrass Infusion

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ;$"5&3*/(4&37*$&4"7"*-"#-& ;'6--0/Ĺą4*5&$"5&3*/('0361501&01-& ;300.4 ;*/%0034&"5&% */%00345"/%*/( ;065%0034&"5&% 065%00345"/%*/(

$POUBDU/BNF JR Burgos (408) 282-8817 jr.burgos@fourpointssanjosedowntown.com

PAN ROASTED PORK TENDERLOIN ....................... $16.00 Cabbage, Bacon, Pistachio, Cider Sauce FIRE-ROASTED BLACK ANGUS NEW YORK STEAK ............... $26.00 Asparagus, Mashed Potatoes, Gorgonzola Butter, Mushroom Cream Sauce

EXTRAS: t#"34$&/&t$"46"-"55*3&t&95&/4*7&#&&3-*45t'".*-:'3*&/%-:t'3&&8*3&-&44*/5&3/&5t '6--#"3t(*'5$"3%4t-"5&Ĺą/*()5%*/*/(t-06/(&"5.041)&3&t065%003%*/*/(t

|

1&340/"-8*/&Ĺľ$03,"(&'&&Ĺśt13&'*9&.&/6t13*7"5&%*/*/(t30."/5*$t4.0,*/("3&"t 5",&065"7"*-"#-&t7"-&51"3,*/(t7&(&5"3*"/'3*&/%-:

DOWNTOWN SAN JOSE

THE GRILL APPETIZERS SEAFOOD SAMPLER

www.thegrill.com/sanjose 172 South Market Street, San Jose

TRIO OF HUMMUS

Phone: (408) 294-2244

HOUSE-CURED GRAVLAAKS

Cuisine Type: American General Manager/Wine Director: Phillipe Azoulay

ENTREES

; RESERVATIONS RECOMMENDED ; OPENTABLE.COM

DINING

BONE-IN RIB CHOP BONE-IN FILET MIGNON

Monday-Thursday: 11:30am-10pm Friday: 11:30am-11pm Saturday Dinner: 5pm-11pm Sunday: 5pm-9pm

COLORADO LAMB CHOPS BRAISED SHORT RIBS CHICKEN POT PIE

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS:

DESSERTS CHOCOLATE SOUFFLE

2 rooms, accommodate up to 33 Indoor Seating, 30 Outdoor Seating, 60 Indoor Standing, 50 Outdoor Standing

CREME BRULEE STRAWBERRY SHORTCAKE

Contact Name: John Price (408) 294-2244 thegrillonthealley@yahoo.com

EXTRAS: t"8"3%8*//*/(3&45"63"/5t"8"3%8*//*/( 8*/&-*45t#"34$&/&t#64*/&44-6/$)&4t &95&/4*7&8*/&-*45t'3&&8*3&-&44*/5&3/&5 t'6--#"3t(*'5$"3%4t065%003%*/*/(t 1&340/"-8*/&š$03,"(&'&&Ÿt13*7"5&%*/*/(t 30."/5*$t8*/&41&$5"503"8"3%

â&#x20AC;&#x153;The Grill on the Alley in the Fairmont Hotel is your meat-and-potatoloving heaven on earth, and youâ&#x20AC;&#x2122;ll be hard pressed to find better service in Silicon Valley. Modeled after the classy big-city dinner clubs of the 1940s, The Grill offers up an elegant gourmet treatment of American favorites. Dress up to fit in. Stop by on a Sunday, the only day The Grill serves its prime rib special (5-9pm).â&#x20AC;? ~The Wave Magazine

HAPPY HOUR

Now offered every day of the week from 5-8pm, featuring drink and appetizers specials, discounts on beer and wines.

THEWAVEMAG.COM MARCH 24 ď&#x161;ş APRIL 6, 2010

39


SAN JOSE

|

100% FRESH N AT U R A L A N G U S BEEF RAISED ON A V E G E TA R I A N D I E T WITH NO HORMONES, P R E S E R VAT I V E S , O R ANTIBIOTICS

www.mojoburger.com Foxworthy Location: 1401 Foxworthy Ave, San Jose (408) 448-1992 Willow Glen Location: 1411 Bird Ave., San Jose (408) 924-0595 Santa Teresa Location: 6041 Snell Ave., San Jose (408) 281-1345

100% FRESH N AT U R A L C H I C K E N

; WALK-INS OK

MOJO MEALS

Foxworthy: Sun-Mon 11am-8pm, Tue-Wed 11am-8:30pm, Thu-Sat 11am-9pm Willow Glen: Sun-Mon 11am - 8pm Tues - Sat 11am - 8:30pm Santa Teresa: Sun 11:30am - 8pm Mon 11am 8pm Tues-Sat 11am - 8:30pm

(ALL MEALS INCLUDE REG. FRIES AND MED. SOFT DRINK) MOJO

W/ CHEESE MEAL

DOUBLE MOJO MINIMO

W/ CHEESE MEAL

W/ CHEESE MEAL

CATERING:

DOUBLE MINIMO W/ CHEESE MEAL

; OUTSIDE CATERING WITH A FOOD TRAILER

HOT DOG

Contact Name: Peter Favre mojoburger@sbcglobal.net

MEAL

BBQ CHICKEN

EXTRAS:

MEAL

CHICKEN

t705&%#&45#63(&3:&"3436//*/(t#64*/&44 LUNCHES t'".*-:'3*&/%-:t GIFT CARDS t-08ű$"3# '3*&/%-:t OUTDOOR DINING t5",&065"7"*-"#-&t 7&(&5"3*"/'3*&/%-:

TERIYAKI CHICKEN SANDWICH

SAN JOSE www.tonyromas.us 4233 Moorpark Ave., San Jose

Phone: (408) 253-4900 Cuisine Type: Ribs, Steaks, Seafood ; WALK-INS OK ; RESERVATIONS RECOMMENDED ; OPENTABLE.COM

DINING

MOJO BURGER

Sun-Thu 11am-10pm, Fri-Sat 11am-11pm Happy Hour: Mon-Fri 3-6pm Parking: Parking Lot

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE ; MAIN FLOOR SEATS 65 ; UPPER LEVEL SEATS 65 ; LOWER FLOOR SEATS 55

Catering Contact: (408) 253-4900 reservations@tonyromas.us

EXTRAS: t$"46"-"55*3&t FAMILY FRIENDLY t'6--#"3 t GIFT CARDS t13*7"5&%*/*/(t TAKEOUT AVAILABLE

|

BACON CHICKEN RANCH SANDWICH CHICKEN WRAP (RANCH OR BBQ) CHICKEN NUGGETS (6/12)

TONY ROMA’S APPETIZERS ONION LOAF Giant hand-cut Spanish onions, breaded, deep friend and served with our house BBQ dipping sauce, Half Loaf or Full Loaf KICKIN’ SHRIMP Tempt your taste buds with tender shrimp fried to a crispy golden brown and tossed in a creamy sauce exploding with flavour

LUNCH 7 UNDER $7

Seven Lunch entrees under $7.00

ENTREES THE ORIGINAL BABY BACK RIBS Tender, lean pork loin meat, basted with TR’s Original or your choice of one of our other delicious sauces, Roma Rack or Full Slab BOUNTIFUL BEEF RIBS Hearty ribs with a rich beef flavor. Glazed with TR’s Original or your choice of other sauce, Roma Rack or Full Slab TONY ROMA’S TR’S FISH GRILL – GRILLED MAHI MAHI Choose Your Flavor: Prepared one of three great ways: Grilled, Blackened or Pan-seared with a Sesame Crust FILET MIGNON A melt-in your mouth, lean 8 oz. cut of boneless beef tenderloin.

40

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


LOS ALTOS

|

CHEF CHU’S APPETIZERS POT STICKERS [6] – KUO THE..$5.50 Chef Chu’s signature dish! Ground pork & Napa cabbage handfolded in thin pastry steamed & pan-fried on the bottom until crispy brown. Served with hot oil and garlic soy sauce.

www.chefchu.com 1067 N. San Antonio Rd., Los Altos

Phone: (650) 948-2696

SEAFOOD

Executive Chef: Chef Lawrence Chu Cuisine Type: Mandarin

MANILA CLAMS IN BLACK BEAN SAUCE ........................................ $12.95 Traditional dish of Manila Clams stir fried in a savory black bean sauce.

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS:

CANDIED PECANS WITH PRAWNS .....................$13.95 Jumbo prawns, deep-fried, then smother with a light tart-sweet mustard mayonnaise. Garnished with our famous candied pecans!

; FULL SERVICE CATERING FOR WEDDINGS AND COMPANY EVENTS ; PRIVATE BANQUET ROOM ACCOMMODATES 120

EXTRAS:

SIGNATURE DISHES

t"8"3%8*//*/(3&45"63"/5t BUSINESS LUNCHES t$00,*/($-"44&4t FAMILY FRIENDLY t'6--#"3 t PRIVATE DINING t;"("53"5&%t5",&065"7"*-"#-&

BONELESS TEA-SMOKED DUCK ....... WHOLE $25.95, HALF $14.95 Marinated duck, steamed, smoked & deepfried with a light tea-smoke flavor. Served with steamed buns, silvered scallions & duck sauce.

PALO ALTO

|

NEW COOKBOOK AVAILABLE Call (650) 948-2696 for details.

BAUMÉ

PAN-SEARED RACK OF LAMB WITH LEMON GRASS ACCENTS .... $18.00 Rack of Lamb marinated in soy sauce, Chinese barbeque sauce, hoisin, rice wine, lemon grass and garlic, pan-seared to succulent perfection.

Photography by Peter Giles www.petergilesphoto.com

LES APÈRITIFS www.baumerestaurant.com

BAUMÉTINI – SAKE WITH LILIKOI CAVIAR KIR TRÈS ROYAL

Phone: (650) 328-8899

CRÉMENT ROSÉ – BAILLY LAPIERRE

Chef: Bruno Chemel Pastry Chef: Ryan Shelton Cuisine Type: French Moderne

SPARKING WINE – EQUINOX

; RESERVATIONS RECOMMENDED ; OPENTABLE.COM

Lunch: Mon, Thu-Fri 11:30am – 1:30pm Dinner: Thu-Fri 5:30 – 9:30pm, Sat 5 – 9:30pm, Sun 5 - 9pm Closed Tuesdays & Wednesdays Parking: Parking Lot

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; 2 ROOMS ; ACCOMMODATE UP TO 35 INDOOR SEATED

Contact Name: Christie Chemel (650) 328-8899 christie@baumerestaurant.com

EXTRAS:

CHAMPAGNE – LOUIS ROEDERER BRUT PREMIER

L E C AV I A R SELECTION: OSETRA, HACKLEBACK, PADDLEFISH 1 OZ

LE DEGREE FIVE COURSE MENU Also available with Drinks and Wine Pairing

LE BAUMÉ TEN COURSE MENU Also available with Drinks and Wine Pairing

L’ A N T O I N E FIFTEEN COURSE MENU Also available with Drinks and Wine Pairing

t#64*/&44-6/$)&4t PRE FIXE MENU t13*7"5&%*/*/(t ROMANTIC t4&"40/"-.&/6 THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

41

DINING

201 S. California Ave, Palo Alto 94306


DINING: FEATURES

DINING F E AT U R I N G

[ C O N T. ]

GOURMET MEALS IN CRAPPY LITTLE KITCHENS

38

C

hef Jennifer Schaertl has written a book to help us all create wonderful meals in our “crappy little kitchens.” We aren’t all blessed with enormous kitchens decked out with the latest and greatest appliances, but that doesn’t mean we don’t all want to eat delicious homemade dinners. Schaertl, inspired by cooking in a tiny kitchen in her first tiny apartment in Brooklyn, NY, wrote Gourmet Meals in Crappy Little Kitchens to tackle the myths surrounding gourmet cooking and instruct you on how to make fun and delectable meals despite the lack of counter space and expensive appliances and gadgets. The book is full of wonderful, cleverly named recipes ranging from appetizers, salads, desserts and entrees named When the Saints Come Marchin’ In Gumbo, Smokin’ Leftover Turkey Soup and Wassup! Wasabi Chicken Salad. Visit www.crappylittlekitchens. com today to get your copy.

11TH ANNUAL WHISKIES OF THE WORLD EXPO

B DINING

oozers across the Bay are jumping in anticipation for this this year’s Annual Whiskies of the World Expo on March 27 at San Francisco’s Hotel Nikko. Hundreds of scotches, bourbons and single iStockPhoto and vatted malts from the U.S., Scotland, Ireland, Canada and Japan, such as Snake River Stampede, Prichard’s Double Barreled Bourbon, Bushmills, Tomintoul and Glenlivet will be on hand and ready for you to enjoy. Seminars will also be available, including such topics as The Great Whisk(e)y Debate, Moonshine Renaissance and The Glenlivet-The Single Malt That Started It All. Live music from Bushmills Pipe and Drum Band , chocolate and fudge pairings and a full dinner buffet complete the event.

The Hotel Nikko, 222 Mason St., San Francisco www.whiskiesoftheworld.com 46

42

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


|

LOS ALTOS

POMPEII RISTORANTE A N T I PA S T I CALAMARI FRITTI ................. $10.00 Fried calamari ZUPPA DI VONGOLE ............ $10.00 Steam clams with tomatoes, basil, white wine & light marinara

www.pompeiiristorante.com 100 State St., Los Altos

Phone: (650) 949-2400

ENTREES

Executive Chefs: Felipe Gutierrez and Gabriel Guitierrez Cuisine Type: Italian

BISTECA ............................... $19.00 Grilled rib eye with a Barolo wine sauce

; WALK-INS OK

VI TELLO PICATTA...................$17.50 Veal sautéed with a garlic lemon butter & caper sauce

Lunch: Mon - Fri 11am - 3pm Dinner: Mon - Fri 5 – 9:30pm, Sat-Sun Noon-9pm Parking: Parking Lot

COTOLLETTE DI MAIALE .........$17.00 Grilled pork chop with prunes in a Madeira wine sauce

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS:

PA S TA S FETTUCINE FRUTTI DI MARE .. $16.00 A mix of sea food sautéed with garlic, herbs & a spicy cioppino sauce

; CATERING SERVICES AVAILABLE ; FOOD TRAYS AVAILABLE FOR PICK-UP ; 1 ROOM, 40 INDOOR SEATED, 26 OUTDOOR SEATED

Contact Name: Gabriel or Felipe (650) 949-2400

LINGUINE ALLA VONGOLE... $14.00 Fresh clams sautéed with garlic, herbs, spices in a creamy white wine sauce

EXTRAS:

SPAGHETTI CARBONARA ..... $12.50 With pancetta, peas in our carbonara sauce

t#64*/&44-6/$)&4t CASUAL ATTIRE t&95&/4*7& 8*/&-*45t FAMILY FRIENDLY t065%003%*/*/(t TAKEOUT AVAILABLE

SAN JOSE

|

BILLY BERK’S G R E AT F O R T H E TA B L E

www.maxsworld.com 99 South 1st St., San Jose

Executive Chef: Gerardo Garcia Cuisine Type: American Eclectic

PESTO, ROASTED VEGETABLE & MANCHEGO ..............................$9 Red Pepper, Tomatoes, Onions, Portabello Mushrooms, Basic & Manchego Cheese

; RESERVATIONS RECOMMENDED ; WALK-INS OK ; OPENTABLE.COM

CALAMARI, LEMONS & JALAPEÑOS $10 Wasabi Aioli & Thai Chili Vinegar Sauce

Phone: (408) 292-4300 DINING

RUSTIC FLAT BREADS ................. $10 Cambozola, Bacon & Carmelized Onions

Lunch: Mon - Fri 11:30am - 4pm Dinner: Mon - Fri 4pm-close, Sat 5pm – close Happy Hour: Mon - Fri 3-7pm Closed Sundays Parking: Validated

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE ; DELIVERY WITHIN A 2 BLOCK RADIUS ; 1 ROOM, 14 INDOOR SEATED, 50 OUTDOOR SEATED

Contact Name: Brad Goldberg (408) 292-4300 bgoldberg@maxsworld.com

EXTRAS: t"8"3%8*//*/(3&45"63"/5t BAR SCENE t$"46"- "55*3&t EXTENSIVE BEER LIST t&95&/4*7&8*/&-*45 tFAMILY FRIENDLY t'6--#"3t PRIVATE DINING t TAKEOUT AVAILABLE 44

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

WHITE CHEDDAR BURGERS .........$8 Carmelized Onions & White Cheddar SLOW ROASTED BBQ PORK ........$8 BIG HOT BUNS WHITE CHEDDAR BURGER ...........$9 Caramelized Onions CHICKEN, ROASTED PEPPER & AVOCADO $10 Shredded Greens & Chili Remoulade

CHOP & TOSS SALADS CHICKEN COBB ........................ $11 Grilled Chicken Breast, Bleu Cheese, Bacon, Tomatoes, Crispy Onions, Avocado, Egg & Ranch Dressing ASIAN TOSS.............................. $11 Chicken, Chinese Noodles, Peanuts, Mandarin Oranges, Cilantro, Scallions, Hoisin Viniagrette


www.caferosalenasanjose.com

SAN JOSE

|

1077 The Alameda, Rosegarden Neighborhood, San Jose

S I G N AT U R E SANDWICHES

Phone: (408) 287-2400 Cuisine Type: Sandwiches, Gourmet Salad and

CHICKEN ALAMEDA Grilled breast of chicken marinated with sun dried tomato pesto, provolone cheese, mayonnaise, tomato, lettuce & onions on a sourdough roll – simply delicious

San Jose’s Best Breakfast Burritos – The Wave Magazine 2010 Winner! The Rosegarden’s best kept secret. ; WALK-INS OK

ROSE GARDEN EXPRESS Tasty pastrami with Swiss cheese, mayonnaise, mustard, tomato, lettuce & onions on a swirl rye bread

Breakfast:: Mon - Fri 6:30 - 10am, Sat 8-10am, Sun Breakfast Burritos Only Lunch: Mon - Sat 10am – 3:30pm Parking: Parking Lot

SALADS MEXICAN FIESTA SALAD Seasoned grilled chicken, served with warm black beans, corn, parmesan cheese, cilantro, tortilla chip croutons, romaine lettuce & fiesta Caesar dressing

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE ; FULL CATERING DEPARTMENT ; BREAKFAST, LUNCH, DINNER, CORPORATE, WEDDING

WARM CHICKEN ASIAN CAESAR SALAD Crispy romaine leaves, red & green cabbage, shredded carrots, toasted sliced almonds, Asian noodle croutons, Asian marinated grilled chicken with creamy sesame ginger Caesar dressing

Contact Name: Bryan Garrett (408) 334-0315 jbryangarrett@comcast.net

BREAKFAST

EXTRAS:

BACON BREAKFAST BURRITO Bacon, egg, country potatoes & cheese

t$"46"-"55*3&t FAMILY FRIENDLY t(*'5$"3%4 "7"*-"#-&t OUTDOOR DININGt5",&065"7"*-"#-&

www.rosiesnewyorkpizzasanjose.com 1285 The Alameda, Rosegarden Neighborhood, San Jose

Phone: (408) 292-6767 Cuisine Type: Pizza-Pasta-Gourmet Salads The Rosegarden’s best kept secret, San Jose’s Best New York Pizza ; WALK-INS OK

Daily 11am - 10pm Parking: Parking Lot

Two Large Flat Screen TV’s – Wine/Beer Bar Great Place Before San Jose Sharks Games

SAN JOSE

|

BREAKFAST SANDWICH Choice of bacon, sausage, ham or chorizo with cheese & egg served on toast or bagel (croissant add 1.00)

ROSIE’S NEW YORK PIZZA PIZZAS ROSIE’S COMBO Sausage, pepperoni, mushrooms, green peppers, onions & olives EMPIRE STATE BUILDING Sausage, pepperoni, ham & Canadian bacon THE GODFATHER Grilled chicken, artichokes, mushrooms, pesto & garlic

NEW YORK CALZONES & STROMBOLIS

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS:

HOUSE CALZONE Ham, Ricotta cheese and Mozzarella cheese

; DELIVERY ; PIZZA/PASTA/GOURMET SALADS ; RESTAURANT AVAILABLE FOR PRIVATE PARTIES ; 80 INDOOR SEATED, 8 INDOOR STANDING ; 14 OUTDOOR SEATED

GARDEN VEGGIE STROMBOLI Green peppers, mushrooms, black olives, Ricotta cheese & Mozzarella cheese

Contact Name: Bryan Garrett (408) 334-0315

EXTRAS: t"8"3%8*//*/(3&45"63"/5t CASUAL ATTIRE t '".*-:'3*&/%-:t TAKEOUT AVAILABLE t8*/&#"3

HOT SANDWICHES PHILLY Steak, Provolone cheese, grilled bell peppers, grilled mushrooms on our ciabatta bread ITALIAN MEATBALL Large Meatballs on our ciabatta bread roll w/ house marinara & Parmesan cheese

SALADS GOAT CHEESE & ARUGULA SALAD Goat cheese, candied pecans, spring mix w/ arugula, red onion, & apple chips tossed in aged vinaigrette THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

45

DINING

ENTERTAINMENT

CAFE ROSALENA


DINING: FEATURES

DINING F E AT U R I N G

[ C O N T. ]

42

Wine Cellar - Patio Dining, by Chris Schmauch

OUTDOOR DINING

S

pring is finally here, and that means we get to enjoy our wonderful California weather and cuisine all at the same time. Yep, we’re talking about dining “al fresco.” Check out our list of outdoor dining hotspots when you’re in the mood to be outside with anything from a simple glass of wine and a book to a full dinner entree and a date.

California Cafe, 50 University Ave., Los Gatos (408) 354-8118 www.californiacafe.com Calvin’s Famous South Philly Cheesesteaks, 1411 The Alameda, San Jose (408) 286-5652

www.calvinscheesesteaks.com

DINING

Dio Deka, 210 Main St., Los Gatos (408) 354-7700 www.diodeka.com Grill on the Alley, 172 S. Market St., San Jose (408) 294-2244 www.thegrill.com Pizza Antica, 334 Santana Row, San Jose (408) 557-8373 www.pizzaantica.com Poor House Bistro, 91 S. Autumn St., San Jose (408) 292-5837 www.poorhousebistro.com Tapestry, 11 College Ave., Los Gatos (408) 395-2808 www.tapestrybistro.com Sonoma Chicken Coup, Multiple locations www.sonomachicken.com Willow Street Pizza, 1072 Willow St., San Jose (408) 971-7080 www.willowstreet.com Wine Cellar, 50 University Ave., Los Gatos (408) 354-4808 www.winecellarlosgatos.com

CHOCOLATE SHOPPING

A

Snickers is good in a pinch, but nothing beats the delectable taste of handmade gourmet chocolate. Whatever your chocolate vice might be, whether it’s dark, white, milk, cherry-filled, with pecans, coconut, buttercream or liqueur-filled, a visit to your local artisan is always in order when the cravings hit. Check out our chocolate line-up to satisfy your chocolate needs.

Chocolate Dream Box, 710 Blossom Hill Rd., Los Gatos (408) 356-2626 www.chocolatedreambox.com

Dolce Bella Chocolates, 18828 Cox Ave., Saratoga (408) 866-8351 www.dolcebellachocolates.com See’s Candies, 1640 S. Bascom Ave., Campbell (408) 371-5695 www.sees.com Schurra’s Candy Factory, 840 The Alameda, San Jose (408) 289-1562

www.schurrasfineconfections.com

46

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

TW


SAN JOSE

|

DINING: FEATURES

HABANA CUBA APPETIZERS CEVICHE Prawns marinated in our cucumber and mango salsa. Served with Tostones

www.998cuba.com 238 Race St., San Jose / Rose Garden

AGUACATE Y CAMARONES Avocado stuffed with marinated bay shrimp

Phone: (408) 998-CUBA Executive Chef: Jennifer Echeverri

BOCADITO Our traditional Cuban sandwich! Grilled with roasted pork, slices of ham, swiss chees and pickles

; RESERVATIONS RECOMMENDED ; OPENTABLE.COM / WALK-INS OK

Lunch: Tue-Fri 11am-2:30pm Dinner: Tue-Thu 5-9pm, Fri 5-10pm, Sat 4-10pm, Sun 4-9pm Closed Mondays

ENTREES PAELLA A LA VALENCIANA Cuban-style paella with saffron, peas, chicken, prawns and chorizo LECHON A LA CUBANA Slow roasted pork marinated in Cuban herbs and citrus juices

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE -DELIVERY & FULL SERVICE ; 3 ROOMS, ACCOMMODATE UP TO 80 INDOOR SEATING, 20 OUTDOOR SEATING

CHAMPIONES A LA HABANA Crimini mushrooms sauteed in our sofrito sauce

Contact Name: Jennifer Echeverri

DESSERTS

(408) 998-2822 Jennifer@998cuba.com

PASTELITOS, BREAD PUDDING, PLATANOS BORRACHOS, FLAN AND MORE!

EXTRAS: t"8"3%8*//*/(3&45"63"/5t BUSINESS LUNCHES t$"46"-"55*3&t FAMILY FRIENDLY t'3&&8*3&-&44 */5&3/&5t OUTDOOR DINING t1&340/"-8*/& š$03,"(&'&&Ÿt ROMANTIC t5",&065"7"*-"#-&t8*/& TASTING t7&(&5"3*"/Ź'3*&/%-:

â&#x20AC;&#x153;For lunch, a must-order is the Cuban sandwich: baked-fresh daily, pressed Cuban bread stuffed with slow-roasted pork, Swiss cheese, ham, and pickles. The fresh mojitos and sangrias, along with the flavorful tropical seasonings, will instantly transport you to Old Havana.â&#x20AC;? ~The Wave Magazine

$"($'$&-$)&'!+-!4' ,#'()&#('#&( '( ,#&'()&#(#(-&-'$"#-!$-!)'($"&'24*# &$)#'#8@=70"!-$+##$%&(2

''$)&&)!&"#)+-$)#!$$ )%($)&+'(+!'$* (&# #)1 #!&-598#!'6=:2@<

DINING

!%!% 

&-$&5$&97%$%!6:@2@< 

&-$#'5$&97%$%!6:@2@<

!&-5$&8938<%$%!68@2@<

&-$('

%%(.&&-;>2@<



 !%%  

 %!

$&89%$%!89?277

&-$"(5$&9<($'6<7277





$&9<%$%!9;7277 

(&#$&89%$%!87?277

" !%!%!







&*(/'"3%&*(%&('$&!)#/##&2 &$"!&$&%$&((&#'($#("('$! (&#'2 !-!)#/##&'%!'2 $#3&    

2



%!%% "   % !  %



&-$!)('59<!)('6>72@<

" !%!% !  !



&-$!#58939;%$%!6<=2@<  $ 

%'#!'5$&8=%$%!6872@< !!

/30,    %50/,2  &)21,*.4,(43-, #&)21,*40/(,20- (& +$'  &"""' ! '

THEWAVEMAG.COM MARCH 24 ď&#x161;ş APRIL 6, 2010

47


CUPERTINO Britannia Arms 1087 S. De Anza Blvd. (408) 252-7262 britanniaarmscupertino.com

DOWNTOWN SAN JOSE Fahrenheit 99 E. San Fernando St. (408) 998-9998 www.fultralounge.com

Cuisine: British, American

Cuisine: Asian Fusion

Rio Adobe Southwest Cafe $

Mezcal

10525 S. De Anza Blvd. #100 (408) 873-1600 www.rioadobe.com

Cuisine: Mexican Oaxacan

Cuisine: Southwestern & Mexican

Morocco’s 86 N. Market Street, San Jose (408) 998-1509 www.moroccosrestaurant.com

400 Castro St. (650) 940-9500 www.cascalrestaurant.com

SAN JOSE Menara Moroccan

Vaso Azzurro Ristorante 108 Castro St. (650) 940-1717 www.vasoazzurro.com

Cuisine: Fine Italian & Provence

Sunday, April 4

Seating times: 10 am, 11:30 am, 1 pm Adults: $45++ Children ages 5 – 12: $19.95++ Children 4 and under are free Open to the Public

25 W San Fernando (408) 283-9595

MOUNTAIN VIEW Cascal Cuisine: Pan-Latin

Family Easter Brunch Enjoy our traditional family Easter brunch that includes lots of goodies from Chef Michael’s kitchen, an Easter egg hunt and balloons from Balloonatics for kids. Also, don’t miss a special appearance by the Easter Bunny and a special celebratory champagne toast.

Cuisine: Morrocan

41 E. Gish Road (408) 453-1983 www.menara41.com

48-hour cancellation policy applies.

Cuisine: Morrocan

To make your reservations today, please call

408.971.9300. Menu available online at sanjoseclub.com

F O R T H E AT R E T I C K E T S A N D E V E N T I N F O , L O G O N T O W W W. A R T S O P O L I S . C O M

SANTA CLARA

|

50 West San Fernando, Suite 1700 San Jose, CA 95113 © 2010 ClubCorp USA all rights reserved PST1100 0310 BH

THE FISH MARKET SALADS CHOPPED PRAWN SALAD Mango, blue cheese, avocado, bacon

www.thefishmarket.com PALO ALTO: 3150 El Camino Real

SMOKED FISH

(650) 493-8862 (TUNA)

SMOKED FISH SAMPLER Smoked by our own Farallon Fisheries

SANTA CLARA: 3775 El Camino Real

(408) 246-3474 (FISH)

RAW SHELLFISH

SAN JOSE: 1007 Blossom Hill Rd.

(408) 269-3474 (FISH)

APPETIZER SPECIALTIES

SAN MATEO: 1855 South Norfolk St.

GINGER LIME PRAWNS Served with cilantro sauce

(650) 349-3474 (FISH)

STEAMED SHELLFISH

...FEATURING OUR TOP OF THE MARKET RESTAURANT

DUCKETT’S BUCKETT Steamed shellfish combination

CIOPPINO AND PASTAS

; RESERVATIONS RECOMMENDED ; WALKINS OK

DUNGENESS CRAB CIOPPINO Served with garlic bread

Lunch: Mon-Sun 11am-4pm Dinner: Sun-Thu 4-9:30pm, Fri-Sat 4-10pm Happy Hour: Mon - Fri 3:30-6:30pm

EXTRAS: t"8"3%8*//*/(3&45"63"/5t BUSINESS LUNCHES t$"46"-"55*3&t&95&/4*7&8*/&-*45t'".*-: '3*&/%-:t'3&&8*3&-&44*/5&3/&5t'6--#"3t (*'5$"3%4t0:45&3#"3t464)*#"3ʤ4+0/-:ʥt TAKEOUT AVAILABLE

ENTREES FRESH LINE CAUGHT PACIFIC YELLOWFIN TUNA

“Every Fish Market location (the first opened in 1976) houses a retail market, oyster bar, and restaurant. The menu changes daily, but no matter what day it is, there’s a dish for nearly every hankering: seafood cocktails, raw oysters and clams, baked shellfish, steamed shellfish, smoked fish, sashimi and sushi, oyster bar specialties, and a deep list of mesquite charbroiled entrees. Ask for the cheesy bread with crabmeat. Trust us.” ~The Wave Magazine

FRESH ALASKAN HALIBUT DIJON CRUSTED FRESH SOUTH AMERICAN TILAPIA – PAPAYA SALSA PAN SEARED MEDITERRANEAN STYLE PRAWNS With feta cheese, kalamata olives, fresh basil and fishwife rice

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

49

DINING

CAPE COD ISLAND CREEK OYSTERS


DINING: FEATURES

SANTANA ROW

|

ROSIE MCCANN’S

www.rosiemccanns.com 355 Santana Row, Ste. 1060, San Jose (Across from Maggiano’s Restaurant)

Phone: (408) 247-1706 Fax: (408) 247-1870 ; RESERVATIONS RECOMMENDED ; OPENTABLE.COM

Lunch: Mon - Sun 11:30am Dinner: Daily 4:30pm Brunch: Sat & Sun 10am-2pm

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE ; 3 ROOMS, ACCOMMODATE UP TO 250

EXTRAS:

DINING

“Rosie McCann’s reinvents traditional pub fare. Quaff a pint or two at the elegant curved bar, and you, too, will be singing praises to Rosie’s Irish nachos, a mountain of guacamole, salsa, and all the fixings atop (of course) potatoes.” ~The Wave Magazine

'6--#"3t-*7&&/5&35"*/.&/5 t ROMANTIC SETTING t#64*/&44 -6/$)&47"-&51"3,*/(t PRIVATE / CORPORATE EVENTS UP TO 80 t $"5&3*/(5",&065t WEDDING RECEPTIONS t1"5*0%*/*/(

SELECTED MENU ITEMS: AHI TOWER

BLACKENED CHICKEN

Pepper & sesame crusted seared ahi with cucumbers & romaine atop fried won tons, drizzled with a sesame soy sauce dressing

Grilled blackened chicken breast in a gorgonzola cream sauce. Served with mashed potatoes & broccoli

Irish sausages, garlic mashed potatoes, Guinness gravy, vegetables & spicy mustard

CORNED BEEF & CABBAGE

GRILLED CORIANDER WILD SALMON

BACON WRAPPED PRAWNS Stuffed with parmesan served with spicy aioli & mixed greens

FLAT IRON STEAK Topped with fried onion strings in a cognac demi-glaze with scalloped potatoes & vegetables

WILD MUSHROOM RAVIOLIS Vodka tomato cream sauce, sautéed portabella mushrooms & garlic bread 50

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

BANGERS & MASH

Carrots, new potatoes & horseradish sauce

Baby spinach, garlic mashed potatoes, jalapeño aioli

FISH & CHIPS

CRAB LOUIE

Alaskan cod in Rosie’s light beer batter served with spicy slaw & tartar sauce

Dungeness crab, avocado, tomatoes, red onions, hearts of romaine, Louie dressing

LAMB STEW

GRILLED SKIRT STEAK AND FETTUCINI

Carrots, celery, leeks, onions & spices, garlic mashed potatoes & Guinness gravy

Served with sautéed spinach and gorgonzola cream sauce


SAN JOSE

|

DINING: FEATURES

FAHRENHEIT

www.fultralounge.com 99 E San Fernando St., Downtown San Jose

Phone: (408) 998-9998 Fax: (xxx) xxxx-xxxx ; RESERVATIONS RECOMMENDED ; OPENTABLE.COM

Lunch: Mon - Fri 11:30am - 2pm Dinner: Mon - Sat 5 - 11pm Happy Hour: Mon - Sat 5-7pm Parking: Parking Lot , Validation

ENTERTAINMENT: Mon-Sat: 9pm - 2am

BANQUET / PRIVATE DINING / CORPORATE FUNCTIONS: ; CATERING SERVICES AVAILABLE

2 ROOMS, ACCOMMODATE UP TO 135 INDOOR SEATED, 300 INDOOR STANDING Contact Name: Eric J. Haraga (408) 274-9998 eric@fultralounge.com

EXTRAS: t"8"3%8*//*/(3&45"63"/50 #"34$&/&t#64*/&44-6/$)&4t &95&/4*7&8*/&-*45t'6--#"3t &*/ʰ)064&%+t-"5&/*()5%*/*/( t-*7&&/5&35"*/.&/5t-06/(& "5.041)&3&t;"("53"5&%

SELECTED MENU ITEMS: AHI TUNA TARTARE TOSTADAS .... $11 Fresh diced tuna, white corn, avocado, toasted sesame, and wasabi served with crispy wonton chips

DUNGENESS CRAB CAKES ......... $13 Dungeness crab cakes served with orange sections and pea sprouts topped with spicy aioli and chives ASPARAGUS RIB EYE STEAK ROLLS . $12 Rib eye steak wrapped around fresh asparagus with black pepper sauce and served with roasted garlic mashed potatoes

THAI BASIL BRUSCHETTA .............. $8 Cherry tomatoes, cucumbers, jalapenos, Thai sweet basil, and ground roasted peanuts served with crostini

FAHRENHEIT FRIES ....................... $6 Trio of potato, yam, and taro root fries served with spicy aioli, sour cream & chives, and ketchup GREEN APPLE & ASIAN PEAR SALAD $9 Mixed field greens with Asian pear, green apple, and raspberries tossed in a light vinaigrette topped with crumbled blue cheese and candied walnuts

ENTREES

THAI CHICKEN ........................... $15 Chicken breast and potatoes simmered in a coconut curry sauce with mixed bell peppers, served with Jasmine rice HONEY CHILI CHICKEN .............. $17 Chicken breast glazed in honey chili. Served with Jasmine rice and sautéed mixed vegetables

PAN SEARED SALMON............... $22 Fresh seared salmon with grilled asparagus and organic baby carrots. Topped with a ginger scallion soy glaze

SHOGUN BONE-IN RIB EYE ....... $28 16oz choice rib eye topped with ginger butter, served with almond green beans and roasted garlic mashed potatoes BLACK PEPPER RACK OF LAMB ... $24 Grilled rack of lamb with sesame mint jus, sautéed pickled cabbage, and roasted garlic mashed potatoes THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

51

DINING

APPETIZERS


NIGHTLIFE: FEATURES

NIGHTLIFE NIGH HTLIF F E AT U R I N G

Black Eyed Peas

BLACK EYED PEAS: 4/2

“W

hat you gon’ do with all that junk? All that junk inside your trunk? I’ma get, get, get, get, you drunk, get you love drunk off my hump. My hump, my hump, my hump, my hump, my hump.” Pure genius. Okay, maybe not. But what the Black Eyed Peas might lack in substance is definitely made up for in spectacular fashion. And on April 2, you’re going to witness so much of it that you’ll find yourself shakin’ your hump, your hump, your hump up and down the aisles, regardless of whether or not you expected to. Oh, and before we forget – special guest Ludacris and his hump will open up the show.

HP Pavilion, 525 W. Santa Clara St., San Jose www.hppsj.com

SAN FRANCISCO WONDERCON 4/2-4

» SVGUIDE: WINE TASTING

D

VIEW SLIDESHOWS & PROFILES: WWW.THEWAVEMAG.COM/WINE

NIGHTL IFE

WINERIES

Castillo’s Hillside Shire Winery 2215 Liberata Dr., Morgan Hill (408) 776-8200 www.castilloshillsideshirewinery. com Tucked against the undulating foothills of Morgan Hill, you will find Castillo’s Hillside Shire. A boutique winery, family owned and operated, presenting handcrafted premium wines designed for all palates. Steep sloping vineyards provide the backdrop for rest and rejuvenation while enjoying the pleasures found in our premium handcrafted wines. We invite you to experience our savory blends.

Martin Ranch Winery 6675 Redwood Retreat Rd., Gilroy (408) 842-9197 www.martinranchwinery.com Discover the unique pleasure of tasting fine wine and relaxing in the vineyard — tour the winery building and learn about the art of winemaking from winemakers first-hand. Enjoy award-winning Thérèse Vineyards and J.D. Hurley wines (cabernet sauvignon, syrah, merlot and sauvignon blanc) barrel samples and light appetizers. Open third weekend of every month 12-4pm

Cinnabar Winery Tasting Room 14612 Big Basin Way, Saratoga (408) 8671012 www.cinnabarwine.com We invite you to visit our beautiful tasting room. Located in the quaint, historical village of Saratoga, flanked by the magnificent Santa Cruz Mountains. WINE SHOPS

Tessora’s Barra di Vino The Pruneyard, 1875 S. Bascom Ave., Campbell (408) 626-7711 www.tessoras.com Tessora’s focuses on wines from Northern and Central California. We also have a fine inventory of international wines. Selections from France, Germany, Spain and, of course, Italy! We also offer a wide selection of beer.

The Wine Room 520 Ramona St., Palo Alto (650) 322-1292 www.thepawineroom.com The Wine Room is located in the deLemos art & crafts building in the historic section of beautiful downtown Palo Alto. We serve up an eclectic variety of wines from around the world. Come in and have a glass, or share a bottle and a cheese plate off our light fare menu with friends, family or clients.

ADD YOUR BUSINESS HERE: (408) 912-5060

52

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

o you have an entire room dedicated to comic books and action figures? Do you find yourself drawn to wizardware or parading around the neighborhood wearing a Tick costume? If you answered yes to any of the above, the 2010 WonderCon is a MUST for you. WonderCon will be stocked full of everything comic-related, including special guests from the world of comics and science and fantasy, with Murphy Anderson, Joe Kubert and Frank Cho to name a few. The expo will also feature exhibits, artist galleries, autograph opportunities, speakers, gaming and, of course, a masquerade ball. It’s coming up, so you better get started on your costume!

Moscone Center, 747 Howard St., San Francisco www.comic-con.org

HEADLINERS 3/26: Air, Fox Theatre, Oakland www.thefoxoakland.com 3/26: John Mayer, HP Pavilion, SJ www.hppsj.com 3/27: Hank III, Catalyst Club, SC www.catalystclub.com 3/27: Neal Schon, The Fillmore, SF www.livenation.com 3/28: Hank III, Voodoo Lounge, SJ www.voodooloungesj.com 3/29: Nellie McKay, Great American Music Hall, SF www.gamh.com 4/2–3: Yonder Mountain String Band, The Fillmore, SF www.livenation.com 4/6: The Church, SF, Great American Music Hall, SF www.gamh.com 4/9–10: Citizen Cope, The Fillmore, SF www.livenation.com 4/10: Train, Fox Theatre, Oakland www.thefoxoakland.com 4/11: Taylor Swift, SJ, HP Pavilion, SJ www.hppsj.com TW


NIGHTLIFE: FEATURES

NIGHTL IFE

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

53


Arts

» FEATURE

EVENT LISTINGS To Kill A Mocking Bird, Mountain View Center for the Performing Arts

Almaden Blvd., San Jose (408) 792-4111 www.sjtix.com

Historic Hoover Theatre, 1635 Park Ave., San Jose (510) 792-8355 www.theflamencosociety.org

woodblock print by Japanese artist Kiyoshi Saito: Thru 5/30. Tracing the Past, Drawing the Future Master Ink Painters in 20th-Century China: More than 100 works in calligraphy and paintings from artists known in China as the "Four Great Masters of Ink Painting": Thru 7/4. Papua New Guinea Sculpture Garden: Wood and stone carvings of people, animals and mythical beings: Ongoing. Longing for Sea Change: Witness the dramatic and emotional visual narratives of contemporary artists living and working in Africa through video installations: Ongoing

An informal flamenco performance featuring Adela, David Gutierrez Rubina and Roberto, along with students from Flamenco Society and various other performers: 3/27

180 Woz Way, San Jose (408) 298-5437 www.cdm.org

The celebrated Ballet Folklórico de México of Amalia Hernández, from the Palace of Fine Arts in Mexico City, will appear in a special production honoring the Bicentennial Anniversary of Mexico’s Independence and the Centennial of the Mexican Revolution: 3/28 JUERGA

SLEEPING BEAUTY’S WEDDING

Mountain View Center for the Performing Arts, 500 Castro St., Mountain View (650) 903-6000 www.peninsulaballet.org

IF YOU HAVE AN IDEA FOR A LISTING, OR KNOW OF SOMETHING HAPPENING THAT YOU'RE AFRAID WE'LL OVERLOOK, PLEASE VISIT WWW.THEWAVEMAG.COM AND CLICK THE RED “SUBMIT YOUR EVENT” BUTTON.

THEATRE

ROSENCRANTZ AND GUILDENSTERN ARE DEAD

Theatre on San Pedro Square, 29 N. San Pedro St., San Jose (408) 267-3479 www.shadyshakes.org

AIN’T MISBEHAVIN’

Follow an African-American jazz band through their pain and triumphs during the Harlem Renaissance of the 1920s and ‘30s, when the Cotton Club and the Savoy Ballroom were changing the face of music. You’ll laugh, you’ll cry and you’ll have to restrain yourself from dancing in the aisles to the great music of Fats Waller – Honeysuckle Rose, Ain’t Misbehavin’, Black & Blue, The Joint is Jumpin’ and I've Got a Feeling I'm Falling: Thru 4/18 THE ALTOS, LIKE THE SOPRANOS, ONLY LOWER

Bus Barn Theatre, 97 Hillview Ave., Los Altos www.busbarn.org

An interactive murder mystery has you, the audience, figuring out who put out a contract on Tony. A spoof of the popular HBO series is a mafia mystery/musical/comedy not to be missed!: 4/8–5/1 BURN THIS

Dragon Theatre, 535 Alma St., Palo Alto (800) 838-3006 www.dragonproductions.net

ARTS

This is a love story unlike any other love story. The characters don’t say, “I love you"; they say, "I don't want this." Hmmm… are we sure this is a love story?: Thru 4/4. DIRTY BLONDE

San Jose Stage Theatre, 490 S. First St., San Jose (408) 283-7142 www.sjstage.com

This Tony Award-nominated play chronicles Mae West’s colorful career, from her beginnings in vaudeville to her legendary stature as one of films greatest stars: 4/7–5/2.

DON’T MISS

KISMET

Montgomery Theatre, 291 S. Market St., San Jose (408) 986-1455 www.lyrictheatre.org

Lyric Theatre continues its 37th season with the classic Broadway musical, Kismet. Winner of the 1954 Tony award for Best Musical, Kismet is the story of a beggar poet caught for 24 hectic hours in a complex web of danger, hilarity and love: Thru 3/28 LADY, BE GOOD

Theatre on the Square, 29 N. San Pedro St., San Jose (408) 679-2330 www.tabardtheatre.org

Enjoy a fast-paced, lighthearted musical comedy featuring songs by George and Ira Gershwin. It’s a whirlwind of tale of love, Mexican gangsters, mistaken identities, sacrifices and fortunes all told through song and dance: 3/27

DON’T MISS

San Jose Repertory Theatre, 101 Paseo de San Antonio, San Jose (408) 367-7255 www.sjrep.com

This existentialist play is the fabulously inventive tale of Shakespeare's Hamlet as told through the bizarre experiences of two of its minor characters. Rosencrantz and Guildenstern are friends of Hamlet's from Wittenberg who are called upon by King Claudius to come and keep his step son/ nephew company and essentially spy on him. We all know how the story ends, but these two blokes trudge through life with hope that everything will be alright. Can they actually control their own destiny, or will fate win the day? Is this a tragedy or a comedy? Can life be anything but both? You'll have to judge for yourself: 4/9-24 SHOUT! THE MOD MUSICAL

The Retro Dome, 1694 Saratoga Ave., San Jose (408) 404-7711 www.theretrodome.com

Take a “flashback,” and hopefully a good one, to the ‘60s where you’ll be entertained with dancing, music and, of course, go-go boots: Thru 4/11 SUNSETS AND MARGARITAS

Lucie Stern Theatre, 1305 Middlefield Rd., Palo Alto (650) 903-6000

Papa Candelario’s life is spinning out of control. His one-time restaurant is struggling, his son is seeing visions of the Virgin Mary, his granddaughter has a girlfriend and half the neighborhood has joined an anti-immigration march outside his restaurant. Can it get any worse? We’re not telling: Thru 4/4 SWEET CHARITY

Saratoga Civic Theatre, 13777 Fruitvale Ave., (408) 268-3777 www.wvlo.org

Follow our young naive Charity as she desperately seeks to find love, but of course, is time after time disappointed until… You’re going to have to see it to find out: Thru 4/10 TO KILL A MOCKING BIRD

Mountain View Center for the Performing Arts, 500 Castro St., Mountain View (650) 903-6000

Told through the enquiring eyes of Scout, a young tomboy learning the hard truths of prejudice and privilege in Depression-era Alabama, this endlessly engaging tale of heartache and joy, innocence and integrity, finds the search for family, justice, and common ground the defining test of the American character.: 4/7–5/2

DANCE BALLET FOLKLORICO DE MEXICO DE AMALIA HERNANDEZ

San Jose Center for the Performing Arts, 255

54

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

Join the Lilac Fairy and her court, Puss and Boots, Little Red Riding Hood, Blue Bird and the rest of the joyous kingdom as they celebrate the wedding of Princess Aurora to her prince: 3/27–28 URBAN NIGHTS DANCE FUSION

Dinkelspiel Auditorium – Stanford University, 471 Lagunita Dr., Stanford (650) 575-1110 www.stanford.edu/group/cardinalballet/

Cardinal Ballet Company presents Stanford University's biggest dance event of the year. It features Basmati Raas, Bent Spoon, dV8, Los Salseros de Stanford, Stanford Chinese Dance, Swingtime, tapTH@T, Troposomatic and Urban Styles: 4/3–4

OPERA & CLASSICAL BACH TO ITALY

Montalvo Arts Center, 15400 Montalvo Rd., Saratoga (408) 961-5858 www.pacomusic.org

This year's Bach celebration explores the influential music from Italian style-setters of Bach's day, music which infused all of Europe with its elegance, dance forms and flair. Works by Vivaldi, Marcello, Scarlatti, J.C. and J.S. Bach will be performed: 3/27 MESSIAH: THE SPRING SING

West Valley Presbyterian Church, 6191 Bollinger Rd., Cupertino www.wvpc.org/messiah

Come celebrate the season by singing popular Easter numbers and less familiar selections. Bring your own score, purchase one at the door, or just relax and listen: 3/28–29 CONCERTO FESTIVAL: THE SINFONIETTA ORCHESTRA

Spangenberg Theatre – Gunn High School, 780 Arastradero Rd., Palo Alto (650) 213-7111 www.ecys.org

The Concerto Festival features great works including Overture to Titus (Mozart), Piano Concerto No. 19, Mvt. I with James Poe, soloist (Mozart), Butterfly Lovers Concerto, Mvt. III with Holly Xiao, soloist (Xhanhao Gang), Cello Concerto in C, Mvt. I with Ashley Huh, soloist (Haydn), Violin Concerto No. 2, Mvt. III with Gun Ho Lee, soloist (Wieniawski) and Ballet Parisienne (Offenbach): 4/3

MUSEUMS CANTOR ARTS CENTER

Palm Dr. at Museum Way, Stanford University (650) 723-4177 www.museum.stanford.edu

The Eye of the Beholder: Honoring Ruth and Robert Halperin: This exhibition of 45 works, on view in two galleries, acknowledges the sensibility of a discerning art lover and committed friend of the Cantor Arts Center, the late Ruth L. Halperin. The works reveal common attributes across cultures in the design and creation of pleasing and beautifully made objects, including a photograph by British artist Andy Goldsworthy and a sinuous iron-wrought form from Nigeria, textural wood sculpture by German-born Ursula von Rydingsvard and a carved box by a Kuban artist, a woven baby carrier from Cameroon and a

CHILDREN’S DISCOVERY MUSEUM

Kids and parents alike can learn about science, math and art by tinkering on the museum’s two floors of interactive exhibits: Ongoing ROSICRUCIAN EGYPTIAN MUSEUM

1660 Park Ave., San Jose (408) 947-3636 www.egyptianmuseum.org

History of the Rosicrucian Egyptian Museum: This exhibit showcases the museum’s transformation from a single artifact in an office to a museum with more than 4,000 pieces: Ongoing. Vanishing Pollinators: An educational art exhibit explains the great decline in pollinator populations with 34 beautiful color photographs: Ongoing SAN JOSE MUSEUM OF ART

110 S. Market St., San Jose (408) 271-6840 www.sjmusart.org

New Stories from the Edge of Asia: Plastic Life: This first in new series that features recent work by artists from Pacific Rim countries and cultures who explore new narrative territory using animation, digital techniques, video and film: Thru 9/19. Wayne Thiebaud: Seventy Years of Paintings: This exhibition features 103 paintings and drawings spanning the Sacramentobased artist’s career from his earliest work as a young student to his latest paintings: Thru 7/4. Juicy Paint: Drawn from the Museum’s own holdings, Juicy Paint explores the many ways in which artists have explored and exploited the sheer physicality and dimensional effects of paint since the 1950s. Highlights include works by Elmer Bischoff, Joan Brown, Nathan Oliveira, Manuel Neri, Karl Kasten, Jeffrey Keith, Sam Tchakalian and Phe Ruiz: Thru 6/6 TECH MUSEUM OF INNOVATION

201 S. Market St., San Jose (408) 294-TECH www.thetech.org

IDEA House: An interactive program encourages visitors to formulate and synthesize like never before: Ongoing. Green by Design: Designs with a green approach, aiming to prevent environmental problems and improve lives: Ongoing. Star Trek: The Exhibition: Hardcore Trekkies and newcomers alike will be awestruck by this comprehensive exhibit, which features props, models, recreated sets and paraphernalia galore from the Star Trek television series and movies: Thru 4/4 TRINTON MUSEUM OF ART

1505 Warburton Ave., Santa Clara (408) 247-3754 www.tritonmuseum.org

Bay Area Chicana: Works of Bay Area Chicana artists who explore the intentional use of indigenous elements as a conscious spiritual and aesthetic choice: Thru 7/20

GALLERIES ANNO DOMINI GALLERY

366 S First St., San Jose (408) 271-5155 www.galleryad.com

Indoctrination: Debut solo exhibition from Brazilian artist Dante Horoiwa with works portraying lost spiritually and loneliness: Thru 4/17 SONYA PAZ FINE ART GALLERY

195 E. Campbell Ave., Campbell (408) 378-5000 www.sonyapaz.com

Creative Cats: A colorful and allergy free display of mod and funky feline infused paintings and products: Thru April TW


ARTS: FEATURES

ARTS F E AT U R I N G For your chance to receive an admit-two mobile pass to an advance screening of

in San Jose, text the word BOOK and your ZIP CODE to 43549. Passes are in limited supply and will be distributed on a first come, first served basis. Limit one pass per person. Each pass admits two people. DEADLINE TO RECEIVE ENTRIES IS THURSDAY, MARCH 25 @ 12:00pm (PST).

One lucky winner will receive a copy of THE LAST SONG novel. Beloved storyteller Nicholas Sparks brings us a deeply moving story of a young girl’s first encounter with heartbreak—and love. The stunning #1 New York Times bestseller is now a major motion picture.

Deadline: Monday, March 29. Winners will be notified by text message.

This film is rated PG. Theatre is overbooked to ensure a full house. Passes received through this promotion do not guarantee admission and must be surrendered upon demand. Seating is on a first come, first served basis. EXCEPT FOR MEMBERS OF THE REVIEWING PRESS. No one will be admitted without a ticket or after the screening begins. All federal, state and local regulations apply. A recipient of tickets assumes any and all risks related to use of ticket and accepts any restrictions required by ticket provider. Touchstone Pictures, The Wave, Grand Central Publishing, 43KIX, Terry Hines & Associates and their affiliates accept no responsibility or liability in connection with any loss or accident incurred in connection with use of a prize. Tickets cannot be exchanged, transferred or redeemed for cash, in whole or in part. We are not responsible if, for any reason, winner is unable to use his/her ticket in whole or in part. Not responsible for lost, delayed or misdirected entries. All federal and local taxes are the responsibility of the winner. Void where prohibited by law. No purchase necessary. Participating sponsors their employees and family members and their agencies are not eligible. NO PHONE CALLS!

IN THEATRES WEDNESDAY, MARCH 31 TheLastSongMovie.com

BRASIL GUITAR DUO: 3/28

T

he Montalvo Art Center is excited to present two guitar Gods, João Luiz and Douglas Lora, and we're very excited to tell you about it. The Brasil Guitar Duo have been playing together since they were teenagers and have been entertaining the masses for the last 10 years with their innovative and seamless blend of traditional and Brazilian works. Winning the 2006 Artist Guild International Competition is testament to their guitar brilliance. They're so mesmerizing, in fact, that we're wondering if they sold their souls for the mad skills. There's no telling for sure, but they sure play like they have. If you need more convincing, go to www.montalvoarts.org and watch a video. Then, of course, reserve your seats.

15400 Montavlo Rd., Saratoga (408) 961-5858 www.montalvoarts.org

TO KILL A MOCKINGBIRD: 4/7–5/2

I

f you loved reading To Kill a Mockingbird, you just might love watching Harper Lee's Pulitzer Prize-winning classic performed on stage by TheatreWorks. For those who don't know the story, it's a heartwarming tale told through the eyes of Scout, a six-year-old tomboy growing up in Depression-era Alabama with her widowed father Atticus and older brother Jem. Issues of racial inequity arise when Atticus, a lawyer, defends a black client accused of raping a white woman. Though the plot deals with serious issues and questions of understanding, justice, equality, and family are evident, the classic tale is renowned for its warmth and humor.

Mountain View Center for the Performing Arts, 500 Castro St., Mountain View (650) 903-6000 www.theatreworks.org

ARTS

LEARN TO THROW CLAY

I

t's fun playing in the mud. It was fun as a kid, and you've got to admit that it's fun now. Come on, we know you want to get your hands dirty and make little mud people and creatures. And we also know that, as fun as playing with mud is, that you'll be awfully disappointed to see your little mudleans fall apart soon after creation. So why not take this playing to the next level with some pottery lessons where you can get your mud bunnies fired, hardened (don't worry, they'll be fine!) and ready for the mantle. Here's a list to get you started. Good luck!

The Art Beat, 68 E. Campbell Ave., Campbell (408) 370-5002 www.theartbeat.net

Blossom Hill Crafts, 15900 Hill Rd., Los Gatos (408) 356-9035 www.blossomhillcrafts.com

Petroglyph, multiple locations www.petroglyph.com TW 56

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


ARTS: FEATURES

ARTS

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

57


Family&Community

» FEATURE

Eggstraordinary Egg Hunt: 4/3–4, Roaring Camp Railroad

GARDENING SAN FRANCISCO FLOWER & GARDEN SHOW: 3/2428

San Mateo County Event Center, 1346 Saratoga Dr., San Mateo www.sfgardenshow.com

If you’re a lover of gardening or are just interested in learning how to turn your garden into a personal paradise, you’ll want to visit this five-day expo dedicated to everything garden related, with zillions of flowers on display and experts to answer all your questions. 59 ANNUAL SANTA CLARA VALLEY ORCHID SOCIETY SHOW & SALE: 3/2628 TH

Westgate Mall, 1600 Saratoga Ave., San Jose (408) 229-2747 www.santaclaravalleyorchidsociety.org

Hundreds upon hundreds of beautiful orchids will be on display and for sale. Experts will also be on hand to answer all orchid questions. IF YOU HAVE AN IDEA FOR A LISTING, OR KNOW OF SOMETHING HAPPENING THAT YOU'RE AFRAID WE'LL OVERLOOK, PLEASE VISIT WWW.THEWAVEMAG.COM AND CLICK THE RED “SUBMIT YOUR EVENT” BUTTON.

FAMILY ACTIVITIES SEVENTH ANNUAL MODEL TRAINS AND PLANES: 3/274/11

Hiller Aviation Museum, 601 Skyway Rd., San Carlos www.hiller.org

Model train lovers won’t want to miss this. You’ll have a chance to view exquisitely crafted H-O model trains as they putt around miniature landscapes, scenery and villages of Germany, Austria, France and Switzerland, amongst other European countries: 10am–5pm EGGSTRAORDINARY EGG HUNT: 4/34 Roaring Camp Railroad, Graham Hill Rd., Felton (831) 335-4484 www.roaringcamp.com

Hop aboard the “Eggspress” train, where you’ll take a trip to the redwoods for a super-sized egg hunt, featuring thousands upon thousands of chocolate candy eggs and hidden prizes!

Take part in this year’s Northern California Screenwriters Expo, where you can take part in workshops to hone your craft. Come prepared, because you’ll even get a chance to pitch your script to some Hollywood big shots. 24TH ANNUAL SANTA CRUZ KAYAK SURF FESTIVAL: 3/2628 Steamers Lane, Lighthouse Point, Santa Cruz www.asudoit.com

Three days of competitive kayak surfing for novices and experts with live entertainment, food and free kayak demos. 12 ANNUAL VIETNAMESE SPRING FESTIVAL & PARADE: 3/28 TH

Downtown San Jose on Market St. www.vsfparade.com

Fun for the entire family will be had at this year’s Vietnamese Spring Festival, which will feature arts & crafts, great food, live music, cultural performances, children’s games and more: 11am MODERN BRIDAL FAIRE: 3/28

ROBO EXHIBITION PREVIEW: 4/10

San Jose McEnery Convention Center, 150 W. San Carlos St., San Jose www.modernbridal.com

Hillsdale Shopping Center will host a robot demonstration and exhibition event showcasing combat robots, walking humanoids, soccer bots, sumo bots, kung fu droids and more.

Gettin’ hitched, eh? Well, don’t miss the Modern Bridal Faire. They have all the bases covered, from florists, photographers and bridal gowns to live music, invitations, caterers, limousines and reception sites.

Hillsdale Shopping Center, 60 31st Ave., San Mateo (650) 345-8222 www.hillsdale.com

FAMILY & COMMUNIT Y

www.norcalscreenwriters.com

SAN JOSE FLEA MARKET 50TH ANNIVERSARY CELEBRATION: 4/1011

San Jose Flea Market, 1590 Berryessa Rd., San Jose (408) 453-1110 www.sjfm.com

FUNDRAISERS & VOLUNTEER

Can you believe the San Jose Flea Market is 50?! Come celebrate in grand fashion with live music, a car show, fine wine, food and, of course, the flea market itself.

Anno Domini, 366 S. First St., San Jose www.supportnetwork.org

PENGUIN FEEDINGS

California Academy of Sciences, 55 Music Concourse Dr., Golden Gate Park (415) 379-8000 www.calacademy.org

Daily: We here at The Wave simply adore penguins. Most of all, we enjoy how happy they get during feeding time. So, we invite you to join us for some good old fashioned penguin feeding fun everyday at 10:30am & 3:30pm

FESTIVALS & EXPOS

VITA NUOVA: 3/25

A fundraiser honoring the Support Network for battered women, with live DJs, a silent auction and a raffle where you have a chance to win art, Sharks tickets, gift certificates and more: 7–10pm THE ANNUAL MONOTYPE MARATHON: 3/27

San Jose Institute of Contemporary Art, 560 S. First St., San Jose www.sjica.org

This print exhibition/fundraising event features more than 100 original works on paper by some of the Bay Area’s most talented printmakers. The best part? All pieces will be up for grabs to the highest bidder!: 5:30–7:30pm

NORTHERN CALIFORNIA SCREENWRITERS EXPO: 3/2628

Silverado Resort, 1600 Atlas Peak Rd., Napa

58

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

GROUP MEETINGS SOUTH BAY CIVIL WAR ROUND TABLE: LAST TUESDAYS

Holder’s Country Inn, 998 S. De Anza Blvd., San Jose (510) 651-4484 www.sbcwrt.org

Nothing beats a good war discussion, especially a Civil War discussion, so if that’s your gig, join the South Bay Civil War Round Table and hang with fellow Civil War buffs. Meetings happen every last Tuesday of the month: 6:45pm

HEALTH & FITNESS FREE HEALTHY KIDS DAY: 3/27

Hoover Elementary, Palo Alto (650) 8422753 www.paloaltofamilyymca.org

Join The Palo Alto Family YMCA for their free Healthy Kids Day event for adults and children. The event is part of a nationwide effort to help lower the increase of childhood obesity by raising the awareness level of families and encouraging parents to adopt healthy lifestyles. CHI GUNG DAOIST LONGEVITY WORKSHOP: 3/27

Gyalwa Gyatso Buddhist Center, 1070 Buckman Ave., Campbell www.gyalwagyatso.org

Join Larry Wong as he guides you through the movements to promote health and longevity, including self-massaging, stretches, patting, tapping and repetitive movements. Suitable for all ages and experience levels: 2–4pm SPRING WALKING SERIES: THRU 4/24

GRPG Visitor & Education Center, 438 Coleman Ave., San Jose (408) 298-7657 www.grpg.org

It’s time to start thinking about shedding some of those winter pounds you’ve put on. Join Friends of Guadalupe River Park & Gardens for their eightweek spring walking series led by fitness instructors Kristin Strellis and Sheri Suomela.

LECTURES THE FEMALE BRAIN & THE MALE BRAIN: 4/8

Historic Hoover Theatre 1635 Park Ave., San Jose www.commonwealthclub.org/sv

Super brainiac, neurobiologist and author Dr. Louann Brizendine will discuss the differences between the female brain and the male brain.

PETS BUNNY 101: 3/28

For Other Living Things, 1261 S. Mary Ave., Sunnyvale www.forotherlivingthings.com

If you’re heavily into the bunny rabbit scene, you’ll want to attend this seminar, which will cover all topics to keep your bunny happily hoppin’: Noon–4pm DOG SCOUTS OF AMERICA MEETING: FOURTH WEDNESDAYS

Animal Community Center, 901 Ames Ave., Milpitas www.dogscouts.org

Get a better understanding of how your dog thinks and learn what drives his behavior. Most importantly, you can learn how your dog can earn the title of ‘Dog Scout,’ earn patches, participate in events and go to camp: 6:30–7:30pm

WORKSHOPS & CLASSES MOVE TO THE GROOVE OF HIP HOP!: 3/28

Sobrato Center, 600 Valley Way, Milpitas (510) 456-5121 www.artoflivingyouth.org

Get those dancing shoes on, as popular Hip Hop teacher Sharine Sanders will lead the tweens through an energetic session of dance moves. Ages 8–13 years: 3:30pm SNAKES AND WORMS!: 4/2

Guadalupe Visitor & Education Center, 438 Coleman Ave., San Jose (408) 298-7657 www.grpg.org

Join the Friends of Guadalupe River Park & Gardens to learn about our lovable, limbless friends in this class all about snakes and worms. You’ll discover the differences from the inside-out and learn about creatures with and sans backbones: 3:30–5pm MOSAIC PET PORTRAITURE CLASS: 4/317

Fireclay Tile, 495 W. Julian St., San Jose www.fireclaytile.com

In this three-session workshop, students will have the opportunity to create a realistic mosaic portrait based on a photograph of a beloved pet. HORSE RIDING CAMP: 4/516

Care Equestrian (650) 703-7562 www.careequestrian.com

The camp will focus on increasing riding skills, building confidence, giving safety tips and barn etiquette and helping the rider gain a better understanding of the connection between him and his horse. IMPROVING BODY IMAGE WORKSHOP: THRU 4/14

FUN RUN: SUNDAYS & TUESDAYS

Dr. Jamie Lopez Psychotherapy Services, 1101 S. Winchester Blvd., Ste. M258, San Jose (415) 572-6450 www.drjamielopez.com

All skills welcome: Sundays 9am, Tuesdays 6:15pm

Discover/discuss factors and personal experiences that have influenced your body image and learn specific coping skills to increase body image satisfaction through this workshop.

Sports Basement, 177 Kern Ave., Sunnyvale (408) 732-0300 www.sportsbasement.com

FREE WEEKLY YOGA CLASS: SATURDAYS

Sports Basement, 177 Kern Ave., Sunnyvale (408) 732-0300 www.sportsbasement.com

Come enjoy a relaxing yoga class with Veronica Cruz of Downtown Yoga Shala. The class covers a sequence of flowing postures, coordinating breath and movement and developing core strength, stamina and flexibility. This is a mixed-level clas: 10–11:15am

BASIC BIKE MAINTENANCE: FIRST TUESDAYS

Sports Basement, 177 Kern Ave., Sunnyvale (408) 732-0300 www.sportsbasement.com

Flat tire, broken chain, out-of-tune shifting...? Come on in and learn handy quick fixes and skills that you’ll need out on the road: 6:30–7:30pm TW


FAMILY & COMMUNIT Y: EVENT LISTINGS

ACUPUNCTURE

HERBS

F

DIET

MASSAGE

Family

Fun

Featuring 42 Faculty Practitioners

at

■ ■

Sharon Feng L.Ac., M.D. (China) ■

Over 20+ years of TCM experience, specializing in infertility and gynecology

Diabetes & Pre-Diabetes Allergies Internal Medicine Digestive Disorders Chronic Pain

■ ■ ■

Pediatrics Alzheimer’s Emotional & Mental Issues Heart Disease & much more!

EX

www.cdm.org

HI NEW BI TI O N!

Specializing in a Wide Range of Treatment Options Including:

Living in Space Open through May 9, 2010 Immerse yourself in this unique space environment and learn about a day in the life of an International Space Station crew member. It’s out-of-this-world! Living in Space was designed and built by The Children’s Museum of Memphis for the Youth Museum Exhibit Collaborative (YMEC).

BioSITE Open House April 14 to April 18, 2010 from 11 a.m. to 2 p.m. The Museum’s award-winning environmental education program presents student achievements in monitoring the Guadalupe River and keeping our local watershed healthy.

Five BraNches UNIVERSITY 25 Years of Excellence in Education & Healthcare 3031 Tisch Way, San Jose (408) 260-8868 200 7th Avenue, Santa Cruz (831) 476-8211

BioSITE (Students Investigating Their Environment) receives generous support from For Museum hours and directions visit www.cdm.org or call (408) 298-5437

www.fivebranches.edu

180 Woz Way San Jose / CA / 95110

The Ultimate

Summer Sports Camps! Soccer • Baseball • Roller Hockey FAMILY & COMMUNIT Y

Early Bir d Bonus! When ‹ Choose your sport for expert coaching & instruction; head coaches include former NHL player and pro/college coaches & players

‹ State-of-the-art, air-conditioned facility ‹ Full day & half day options ‹ Optional swimming lessons ‹ Tons of FUN! Dodgeball, giant inflatables, park & more ‹ Convenient location with easy access to 101 & 85

you sign u p bonus wo by May 15 rth $100 (see web site for de tails)

www.GoToPlex.com/camps 800 Embedded Way • San Jose 95138 408.225.1843 • Email: info@GoToPlex.com THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

59


FAMILY & COMMUNIT Y: FEATURES

FAMILY&COMMUNITY F E AT U R I N G

MODERN BRIDAL FAIRE: 3/28

S

o you’ve either popped the question or been asked the question. And you probably thought that was the hard part, right? Oh, the fun has just begun! It’s time to start planning, and you’ll need a photographer, music, flowers, invitations, the perfect wedding gown and/or suit, a caterer, a hair and makeup stylist, a seamstress, and about a gazillion GoodEyeBlog.com other things, including a place to perform the ceremony and a person to perform it for you. Oh, we forgot to mention you’ll also need favors, bridesmaids and groomsmen gifts, appetizer options, honeymoon ideas, and rehearsal dinner restaurants. We know it’s overwhelming, and that’s why we suggest you visit the Modern Bridal Faire where professionals will be on-hand to help you create a glorious wedding stress-free. Whew!

San Jose McEnery Convention Center, 150 W. San Carlos St., San Jose www.modernbridal.com

VASONA LAKE COUNTY PARK

N

FAMILY & COMMUNIT Y

o one, and we mean NO ONE enjoys family fun more than the gang here at The Wave. And we choose to have our family fun at Vasona Lake County Park. Vasona Lake has everything you need all in one fabulous and beautiful location. You can stroll or ride your bicycle along the paved trail, rent a paddle or rowboat, go fishing, barbeque, play volleyball, horseshoes, softball, and let the little ones take a ride aboard the Billy Jones Wildcat Railroad or the carousel. During the summer months you can even enjoy live music at multiple stages. Pack a picnic lunch and bring a blankie for a cozy gathering, or think ahead and reserve a site with tables, seats and a gigantic barbeque pit for large gatherings.

Vasona Lake County Park, 333 Blossom Hill Rd., Los Gatos (408) 356-2729 www.parkhere.org

EGGSTRAORDINARY EGG HUNT 4/3-4

H

ere comes Peter Cottontail, hoppin’ down the bunny trail, hippity, hoppin’, Easter’s on its way! You know the song, and you also know its time for Easter egg hunts. And boy howdy, do we have a doozy for you. Roaring Camp Railroad would like you to join them for their annual Eggstraordinary Egg Hunt on April 3 and 4. Kids and families alike will enjoy a steam train ride to Bear Mountain where they’ll have the golden opportunity to search for thousands (thousands!) of chocolate candy eggs hidden about the Redwoods. Along with the egg hunt, children will also have a chance to win prizes, participate in games and create special Easter crafts.

Roaring Camp Railroad, Graham Hill Rd. & Mt. Hermon Rd., Felton www.roaringcamp.com TW 60

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


FAMILY & COMMUNIT Y: FEATURES

Get into High Tech! Experience the science of computer chips and the evolution of their development firsthand. Reserve guided tours by phone or online: 408.765.0503 www.intel.com/museum Open Monday-Friday, 9 a.m.-6 p.m., and Saturday 10 a.m.-5 p.m., excluding holidays. FREE admission and parking. Audio tours are available in seven languages. In Santa Clara, off U.S. Hwy. 101 at the Montague Expressway and Mission College Boulevard. Copyright

©

2006 Intel Corporation. All rights reserved.

Laughter truly is the best medicine! Indian Health Center of Santa Clara Valley Proudly Presents

4th Annual Fundraiser Comedy Jam Friday March 26, 2010 8 pm start time - doors open at 7 pm Comics scheduled to appear are: Recently appeared on a SHOWTIME Comedy Special in January

Tickets

$25

$25

All general admission seating

All general admission seating

18 and over

MARC YAFFEE NAVAJO

JIM RUEL OJIBWE

VAUGHN EAGLEBEAR COLVILLE/SIOUX

JR REDWATER SIOUX

FAMILY & COMMUNIT Y

Tickets

18 and over

Santa Clara Marriott Grand Ballroom 2700 Mission College Boulevard - Santa Clara, CA - 95054 Parking fees from the Santa Clara Marriott will apply SPECIAL RATE FOR CALIFORNIA INDIAN EDUCATION CONFERENCE ATTENDEES

$15 To purchase tickets please contact: Vernon Medicine Cloud (408) 445-3400 (x208) or email at vmcloud@ihcscv.org Jennifer Atchico-Shrestha (408) 445-3400 (x374) or email at jatchicoshrestha@ihcscv.org

THIS IS AN ALCOHOL AND DRUG FREE EVENT

TICKETS ON SALE NOW!!! THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

61


SPORTS & ADVENTURE: FEATURES

SPORTS&ADVENTURE F E AT U R I N G

iStockPhoto

ROCKET BOY

H

ave you ever thought about how it’d feel to break the sound barrier, wearing nothing but spandex and a pair of speed skates? We here at The Wave have thought of nothing else for the last nine years, and we are here to tell you this: It can be done! Not only will we guarantee* that you will break the sound barrier, but we’ll tell you where and how you can do it. Join the Nor Cal Speed Skating Association. With just a few instructional classes, you’ll find yourself well on your way to Olympic Gold*. And not only will you partake in fantastic cardio workouts, but you’ll also turn your legs and buns into solid steel!**

*Results may vary **It’s true. If you’re dedicated enough, your buns will turn to steel Northern California Speed Skating Association www.norcalspeedskating.org

GIDDY UP!

H

SPORTS & ADVENTURE

orseback riding. By Chris Schmauch Doesn’t that sound like an activity from the caveman days? Alright, so cavemen probably didn’t ride horses, but you have to admit: There’s something very archaic about riding an animal around town. We also find it very empowering, relaxing and pleasurable. If you’ve never been privy to the equestrian experience, we think you’ll enjoy finding yourself trotting along California’s beautiful coastline or through the foothills of wine country. All beginners are welcome to take horseback riding classes, though they aren’t always necessary; most ranches have a few docile horses kept on hand for the inexperienced. Think cruise control, only on a horse. All you have to do is sit back and enjoy the ride! Experienced cowboys and girls can head straight to the stables, rent the beasts and gallop away. TW

Garrod Farms Riding Stables, 2600 Mount Eden Rd., Saratoga (408) 867-9527

www.garrodfarms.com

Sea Horse Ranch, 1828 N. Cabrillo Hwy., Half Moon Bay (650) 726-9903 www.horserentals.com/seahorse.html 62

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010


SPORTS & ADVENTURE: FEATURES

VIEW SLIDESHOWS & PROFILES: WWW.THEWAVEMAG.COM/SPORTS

BICYCLING

Alavie Fitness

Calmar Bicycles SPORTS & ADVENTURE

2236 El Camino Real, Santa Clara (408) 249-6907 www.calmarcycles.com Calmar Bicycles carries a full line of bicycles to fit your every need and riding style. Whether you are buying a bike for your child or need to take your racing to the next level, we have the bicycle for you. Each model has been carefully chosen by our certified staff for its quality, value and fit. Stop by our convenient location and see what we have for you. FITNESS CENTERS

Alavie Fitness 120 W. Campbell Ave., Ste. D, Campbell www.alaviefitness.com Cutting-edge outdoor fitness boot camps for all ages and fitness levels. Ten Bay Area locations. 5K/10K training and other fitness events and services. Women’s, coed and corporate programs.

Xtreme Fitness Silicon Valley

www.xtremefitsv.com Top tier cardio, conditioning, agility amd strength classes,

“Zumba” Latin dance fitness classes, personal training, mixed martial arts, Pilates, spinning, wellness center, massage, chiropractic, live music with classes and more! OUTDOOR ADVENTURE

Emerald Empire Adventures 265 E. Clay St., Ukiah (707) 367-3299 www.emeraldempireadventures.com Emerald Empire Adventures believes in direct passenger participation in the river adventure. See website for more details and advanced booking!

ADD YOUR BUSINESS HERE: (408) 912-5060

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

63


HOME & DESIGN: FEATURES

=?8=`eXeZ`e^%9lpn`k_fecp*%,[fne!

HOME&DESIGN F E AT U R I N G iStockPhoto

N8@KEFCFE><I CFFBEF=LIK?<I

CENTRAL COAST HOME & GARDEN SHOW: 3/27â&#x20AC;&#x201C;28

C

anâ&#x20AC;&#x2122;t you just feel spring in the air? The hills are green, the birds are chirping, the days are getting warmer and longer, andâ&#x20AC;Ś your yard and home are in utter disarray. Your garden is a mess, the patio furniture needs to be replaced, and youâ&#x20AC;&#x2122;ve had â&#x20AC;&#x153;convert home to run on solar powerâ&#x20AC;? on your New Yearâ&#x20AC;&#x2122;s Resolutions list for years, but youâ&#x20AC;&#x2122;ve been lacking motivation and resources. Luckily, the Central Coast Home & Garden Expo is just around the corner to help you out and answer your questions. The expo features everything from sustainable and edible gardening and composting to lawn watering alternatives, going solar and even raising chickens in your backyard. And hey, first 200 people will receive a free plant!

Cocoanut Grove, 400 Beach St., Santa Cruz (831) 423-2053 www.cocoanutgrovesantacruz.com/hgexpo

COMMON GROUND GARDENING SUPPLY & EDUCATION CENTER HOME & DESIGN

I

Luxury, priced affordably from the $300â&#x20AC;&#x2122;s On the most desired corner in downtown San Jose, homeowners at Axis are enjoying the luxury and convenience of high-rise living. Just footsteps away from wonderful restaurants, great entertainment venues and amenities only offered by ďŹ ve star hotels, Axis is a step above. Come see why so many are calling Axis home.

.!LMADEN"OULEVARD\\!XIS3AN*OSECOM\/PEN$AILY  *See Sales Center for details. Prices, terms, features, availability subject to change without notice. Exclusively represented by PaciďŹ c Marketing Associates. Lic. #01220373

64

THEWAVEMAG.COM MARCH 24 ď&#x161;ş APRIL 6, 2010

f youâ&#x20AC;&#x2122;re into the gardening scene or have just been intrigued with the idea of digging into Mother Earth and growing from her bounty, youâ&#x20AC;&#x2122;ll want to pay Common Ground Gardening a visit. In addition to being able to By Chris Schmauch offer expert advice, they have a plethora of hands-on classes and events to help you turn your run-of-the-mill yard into a beautiful oasis. Class and event topics include backyard composting, planning, grafting, mini-farming, drip irrigation and lawn alternatives, amongst others. And they donâ&#x20AC;&#x2122;t only offer knowledge. Theyâ&#x20AC;&#x2122;ll also have everything you need to get started, from soil and shovels to friendly garden gnomes.

Common Ground Gardening Supply & Education Center, 559 College Ave., Palo Alto

(650) 493-6072 www.commongroundinpaloalto.org

TW


HOME & DESIGN: FEATURES

j Z_ d h[ Iee n9 i JW f_h[ ;n

F;DJ>EKI;IIJ7HJ?D=?DJ>;C?:,&&"&&&i

J^[l_[m?WbmWoimWdj[Z$$$ WjWfh_Y[?mWdj[ZjefWo Hurry in today to City Heights for some of the lowest new home prices in Downtown San Jose! With only twenty left, we still have a home for you that is â&#x20AC;&#x153;move inâ&#x20AC;? ready. Conveniently located within walking distance to restaurants, night life, shopping and more, City Heights oers incredible new 1- and 2-bedroom homes. Come experience spectacular views, a great location and a value that canâ&#x20AC;&#x2122;t be beat! Priced from the mid $300,000s.

CityHeightsSanJose.com 408.286.2489

Visit our new Sales Center in unit #111 175 W. St. James Street Open 10am-5pm Closed Wednesday & Thursday

Models do not indicate racial preference. Information accurate at the time of printing. Prices, terms & availability subject to change without notice. Exclusively represented by PaciďŹ c Marketing Associates. Lic. #01220373

Actual view from City Heights

In a Shea Home, dogs donâ&#x20AC;&#x2122;t bark. Babies donâ&#x20AC;&#x2122;t cry.

HOME & DESIGN

The truth is itâ&#x20AC;&#x2122;s no coincidence that weâ&#x20AC;&#x2122;ve been named Builder of the Year, 2009 Community of the Year and #1 in Customer Satisfaction. See these unbelievable homes for yourself at SheaHomes.com twitter.com/ SheaHomesNoCal Become a fan of â&#x20AC;&#x153;Shea Homes Northern Californiaâ&#x20AC;?

Coincidence? Hardly. Boulevard in Santa Clara From the $500â&#x20AC;&#x2122;s (408) 260-8508

Mondrian in Mountain View From the $600â&#x20AC;&#x2122;s (650) 965-3812

Montage in Livermore From the $300â&#x20AC;&#x2122;s (925) 373-0374

Antigua, Campania and Esplanade in Mountain House 'SPNUIFTt  

Communities are by Shea Homes Limited Partnership and Shea Homes Marketing Company, independent members of the Shea family of companies. California Department of Real Estate, Shea Homes Marketing Company, Broker, License #01378646. Price effective date of publication and subject to change. All plans and amenities are subject to change at any time. Shea Homes, 655 Brea Canyon Road, Walnut, CA 91789 866-696-7432. Š2010 Shea Homes.

THEWAVEMAG.COM MARCH 24 ď&#x161;ş APRIL 6, 2010

65


Marketplace

» FEATURE

HOME IMPROVEMENT CONSTRUCTION

INDEX HOME IMPROVEMENT ... 66 CAREER TRAINING ......... 66 AUTOMOTIVE REAL ESTATE & RENTALS TRAVEL & GETAWAYS..... 67 WEDDINGS ...................... 67 H A R D WA R E

PLACING AN AD

By Phone: Please call Bill Hargreaves at (408) 912-5066 By Fax: Fax your ad to the Marketplace Department at (408) 912-5061

By Email: marketplace@thewavemag.com. Please include your Visa, MC, Amex number with expiration date for payment.

R E N TA L P R O P E R T I E S

PALO ALTO HARDWARE

AMERICAN BARBER COLLEGE

AMERICAN BARTENDING

1228 S. Bascom Ave., Ste. B, San Jose (408) 293-1330 www.moderntvonline. com We can provide the home theater system you dream about. Whether it’s a dedicated theater with plush seating and a big screen, or a family room with a slim plasma TV and speakers built into the walls, we have the solution for you.

252 Ross St., Fifth Floor, San Jose (408) 532-9222 www.barschool.com The nation’s oldest and largest bartending school specializing in training and job placement of bartenders. Over 38 years in business in the Bay Area. Offering one- and two-week sessions teach from mixology to garnishing in a full cocktail lounge classroom, plus job placement services. Call for class schedule.

HOME SERVICES

(Eight South Bay locations) (800)-ATOOLSHED www.atoolshed.com A Tool Shed Rentals should be your first stop for all your rental needs! We have the tools and equipment rentals to make your weekend or major project easier.

BARBER COLLEGE:

BARTENDING:

MODERN TV

A TOOL SHED

CAREER TRAINING

5707 S. Vermont Ave, San Jose (408) 778-3812 Training topics covered: Shop Management, Hair Cutting and Styling, Anatomy and Physiology of the Body, Bones & Circulation, Hair Color & Designing. Students offer all services to the public at an affordable price.

875 Alma St., Palo Alto (650) 327-7222 www.paloaltohardware.com At Palo Alto Hardware, “living green” is more than just a catchphrase. We work hard to put into place systems and programs that are environmentally friendly as we run our business.

E Q U I P M E N T R E N TA L

combining a do-it-yourself woodshop, a woodworking store, and woodworking classes all under one roo.

B E AU T Y S C H O O L

ROOFING AND GUTTERS

FURNITURE

ALL WORLD FURNITURE

981 Stockton Ave, San Jose (408)2926833 www.allworldfurniture.com All World Furniture Inc. was started over six years ago and now has a one of the largest modern, contemporary furniture showrooms with attached warehouse in the San Francisco Bay Area.

PAT I O F U R N I T U R E

THE COMPLETE BACKYARD

1600 Duane Ave., Santa Clara (408) 748-8100 www.patio101.com Come by and visit our 33,000-square-foot showroom featuring all the top names in the patio business. We have over 250 sets on display from various manufacturers. R E A L E S TAT E

WILLIAM JEFFRIES REAL ESTATE

NEED MONEY? Own a Home? Private Money Available. Geoff Gault (408) 202-2089 Investor flips Welcome. DRE# 01260763

JIMYKO

1919 Monterey Road, Suite #10, San Jose (408) 993-0918 www.jimyko.com Provides fresh and unique ideas that attune to today’s casual and contemporary lifestyles. We invite you to explore our retail studio and experience the elements that define your home.

66

S T O R AG E

A1 SELF STORAGE

(Four San Jose Locations) 1415 Old Oakland Rd.; 2900 Monterey Rd.; 131 Baroni Ave.; 3260 S. Bascom Ave. (800) 210-8979 www.a1storage.com Save money with A-1 Self Storage! Affordable pricing for personal and business needs.

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

C H I R O P R AC T I C C O L L E G E

WEB DESIGN

BAY AREA BUSINESS GROUP

Baybusinessgroup.com (408) 728-6440 Michael@baybusinessgroup.com Bay Area Business Group is a strategic internet marketing company that specializes in raising your visibility on the web. We do this by intelligent web design that is not only SEO (Search Engine Optimization) friendly but we mix it with a unique design that fully expresses your business to your target audience. We provide a wide range of services such as: Web Hosting, Email, Web Site Design and site upgrades. WOODWORKING

THE SAWDUST SHOP

452 Oakmead Pkwy., Sunnyvale (408) 992-1004 www.sawdustshop.com The Sawdust Shop is a unique woodworking center located in the heart of Silicon Valley,

PALMER CHIROPRACTIC WEST

90 E. Tasman, San Jose (408) 994-6000 www.palmer.edu The Palmer Center for Business Development is dedicated to promoting entrepreneurship and innovation through educational programs bridging academic training, clinical skills and business. C U L I N A RY C O L L E G E

EPICUREAN CULINARY ARTS

8500 Melrose Ave., San Jose (408) 659-5990 www.epicureanschool.com Students seeking professional training come to Epicurean after extensively researching cooking schools and choose us for our excellent reputation and experienced staff. Immediate hands on training.


D E N TA L A S S I S TA N T

SCHOOL OF DENTAL ASSN.

1870 Alum Rock, San Jose (408) 2580800 www.americanbci.com Most of the participant’s training is hands-on. This individualized training requires small class sizes and ABCi maintains an instructor-tostudent ratio of 1 instructor to 15 students, and a computer-to-student ratio of 1 computer per student.

natural. What makes GoodEye stand out from the rest? Genuine talent and a passion to perfectly capture your momentous day.

WEDDINGS

PLANNERS

C AT E R I N G

NICOLE LISANNE WEDDING CONSULTING

W E D D I N G C O N S U LT I N G

NICOLETTE COUTURE BRIDAL BOUTIQUE

ACPWC

(408) 227-2792 www.acpwc.com The Association of Certified Professional Wedding Consultants (ACPWC) is a National Organization celebrating 18 years of industry experience. They provide a comprehensive training and certification program for Wedding Consultants. ACPWC offers personalized training courses and extended weekend classes for people who would like to become Wedding Consultants or Church/ Facility Coordinators. San Jose class begins April 2009.

FLORISTS

TRUCK DRIVING

15 El Toro Ave., Morgan Hill (408) 7796146 www.nicolettecouture.com Nicolette Couture Bridal boutique is located in charming downtown Morgan Hill. It is owned by mother and daughter partners Nicole and Sue Castro. We are currently offering four gorgeous designers, one of which is exclusive to our boutique for all of Northern California. Our philosophy is to offer a wide variety of high quality gowns in a no-pressure environment so that every bride may enjoy her personal experience of finding her dream wedding gown.

Interested in hosting an intimate wedding for 75-150 guests or less at one of Nicole Lisanne Wedding Consulting & Design’s exclusive private estates? Call us or e-mail us to learn more! Nicole Lisanne, Owner & CWC&D (Certified Wedding Consultant & Designer) (408) 370-4997 nicole@nicolelisanne.com www.nicolelisanne.com Serving Everywhere! TRANSPORTATION

MASSAGE / THERAPY

H & R BLOCK TAX SCHOOL

PLACE OF BLISS SCHOOL CALENDAR

465 El Camino Real, Sunnyvale (408) 720-8654 www.hrblock.com As part of a family of diverse financial services companies, H&R Block offers career opportunities tax preparers, front office, administration, and customer service. TRUCK DRIVING

GOWNS & TUXEDOS

Be part of Place of Bliss School and working practice clinics | 190 Martha St., San Jose | For bookings, contact: Sufani at (408) 314-2139 placeofbliss711@aol.com www.sufani. webs.com Beginning Meditation-1/3, Transcendental Meditation 2-2/7, Reiki 1-1/10, Reiki 2- 3/28, Reiki 3- 5/16, Seichim & The Sacred Teachings (Egyptian & Mayan Energy Healing)-1/24, Deep Release Point Therapy (shaman energywork, 2x a year)-May & Aug., Wisdom Circle Healing Ceremony - FREE EVENT 1/23, 8-9PM. Release the negative and use the positive energy of the group to help set it free. See website and calendar for details.

TRAVEL & GETAWAYS R E N TA L P R O P E R T I E S

MUSIC & ENTERTAINMENT VO C AT I O N A L C O L L E G E

NORTHERN CALIFORNIA VOCATIONAL COLLEGE

143 E. Virginia St., Ste. C, San Jose (408) 971-6282 www.ncvcollege.com Northern California Vocational College offers training with all programs required state licensed or locally permit required: CNA/HHA (Certified Nurse Assistant/Home Health Aid), Massage Therapy, Chiropractic Assistant, Cosmetology, Esthetician, Manicuring, Construction General B, Electrical C-10, Plumbing C-36, Landscaping C-27. Contact us today!

SAVOIR FAIRE BAND

(408) 910-1117 www.savoirfaireband. com Savoir Faire is a fantastic professional cover band. We have the most economical entertainment packages in San Francisco Bay Area! Stu Cornick serves as the band leader, vocalist and emcee with 5 - 8 fantastic musicians and vocalists. These packages can include male and female vocalists, keyboard, guitars, drums, bass and saxophone. PHOTOGRAPHERS

GOODEYE PHOTOGRAPHY + DESIGN

Serving the Bay Area and Beyond (408) 431-4808 www.goodeyephotography. com Specializing in a candid style, GoodEye will not only leave you with a wedding album that will be the envy of your friends, but make the whole experience effortless and enjoyable. GoodEye’s photojournalistic approach will connect with you and your guests in a way that makes every shot look THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

67


ADVERTISER INDEX

ADVERTISER INDEX S A L E S @ T H E W AV E M A G . C O M A-1 Self Storage . . . . . . . . . . . . . . . . . . . 57 Accent on Aesthetics. . . . . . . . . . . . . . . .21 Alexander’s Steakhouse. . . . . . . . . . . . .33 Alliance Credit Union . . . . . . . . . . . . . . .11 Allied Arts Guild. . . . . . . . . . . . . . . . . . . 56 Aloha Coffee . . . . . . . . . . . . . . . . . . . . . . .21 American Kickboxing Academy. . . . . 62 Australian Tanning Company. . . . . . . 72 Axis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 Baume . . . . . . . . . . . . . . . . . . . . . . . . . . . .41 Bella Saratoga . . . . . . . . . . . . . . . . . . . . 34 Billy Berk’s. . . . . . . . . . . . . . . . . . . . . . . . 44 Birk’s Restaurant . . . . . . . . . . . . . . . . . . .31 Blowfish Sushi . . . . . . . . . . . . . . . . . . . . 25 Blue Rock BBQ . . . . . . . . . . . . . . . . . . . . 34 Body, Mind, Spirit Live Health . . . . . . .61 Branham Lounge. . . . . . . . . . . . . . . . . . 52 Cafe Primavera. . . . . . . . . . . . . . . . . . . . 28 Cafe Rosalena. . . . . . . . . . . . . . . . . . . . . .45 Camera Cinemas . . . . . . . . . . . . . . . . . . . .7 Caper’s Eat & Drink . . . . . . . . . . . . . . . . .27 Capital Club. . . . . . . . . . . . . . . . . . . . . . . .49 Capricious Skin Care . . . . . . . . . . . . . . . .17 Celia’s Restaurant . . . . . . . . . . . . . . . . . .47 Chardonnay II . . . . . . . . . . . . . . . . . . . . . 63 Chef Chu’s . . . . . . . . . . . . . . . . . . . . . . . . .41 Children’s Discovery Museum. . . . . . . .59 Christopher N. Do . . . . . . . . . . . . . . . . . . .4 Cinelux Theatres . . . . . . . . . . . . . . . . . . .15 City Heights. . . . . . . . . . . . . . . . . . . . . . . 65 Cocoa Jeans / Moda Divina . . . . . . . . . .11 Color Me Mine. . . . . . . . . . . . . . . . . . . . . 60 Cornerstone Spinal Care . . . . . . . . . . . 23 Counter, The . . . . . . . . . . . . . . . . . . . . . . .43 Dive Bar . . . . . . . . . . . . . . . . . . . . . . . . . . 53 Dive Chronicles. . . . . . . . . . . . . . . . . . . . .70 Dr. Michael Bouzid . . . . . . . . . . . . . . . . .21 Dr. Robert Ferguson . . . . . . . . . . . . . . . .19

68

THEWAVEMAG.COM MARCH 24  APRIL 6, 2010

Ebby’s - Chamber of Commerce. . . . . 57 Eternal Beauty Medical Clinic. . . . . . . .15 European Wax Center. . . . . . . . . . . . . . .19 eWomen. . . . . . . . . . . . . . . . . . . . . . . . . . 68 Fahrenheit UltraLounge . . . . . . . . . . . .51 Faultline Brewing Company . . . . . . . . .42 Fiesta Vallarta . . . . . . . . . . . . . . . . . . . . 36 Firehouse Grill . . . . . . . . . . . . . . . . . . . . .37 Fish Market . . . . . . . . . . . . . . . . . . . . . . . .49 Five Branches University . . . . . . . . . . . .59 Fred Astaire Dance Studio of San Jose14 Fred’s Frugal Frames. . . . . . . . . . . . . . . . .9 Ginger Cafe . . . . . . . . . . . . . . . . . . . . . . . 36 Gold Star Jewelers. . . . . . . . . . . . . . . . . .11 GoodEye Photography . . . . . . . . . . 63, 68 Goosetown Lounge. . . . . . . . . . . . . . . . 53 Grill on the Alley, The . . . . . . . . . . . . . . .39 Habana Cuba. . . . . . . . . . . . . . . . . . . . . . .47 H. Butlers BBQ . . . . . . . . . . . . . . . . . . . . 26 Henry’s Hi-Life . . . . . . . . . . . . . . . . . . . . 46 Improv . . . . . . . . . . . . . . . . . . . . . . . . . . . .32 Indian Health Center. . . . . . . . . . . . . . . .61 infobayarea. . . . . . . . . . . . . . . . . . . . . . . 68 Intel Museum . . . . . . . . . . . . . . . . . . . . . .61 Jabbertise . . . . . . . . . . . . . . . . . . . . . . . . 48 Jane Aesthetic Medicine & Surgery . . .5 Julie Acosta . . . . . . . . . . . . . . . . . . . . . . . .18 Kaiser Permanente Cosmetic Services . . . . . . . . . . . . . . . . . 20 Kimberly Cockerham, M.D. . . . . . . . . . 23 Law Offices of Linda MacKay . . . . . . . .11 Loft Bar and Bistro . . . . . . . . . . . . . . . . .27 Marriott - San Francisco Airport . . . . .13 Medi-Leaf . . . . . . . . . . . . . . . . . . . . . . . . 69 Miramar Events . . . . . . . . . . . . . . . . . . . 60 Mizu Japanese Restaurant . . . . . . . . . 38 Mojo Burger . . . . . . . . . . . . . . . . . . . . . . 40 Mosaic Restaurant. . . . . . . . . . . . . . . . . .39 Neat Feet . . . . . . . . . . . . . . . . . . . . . . . . . .19

Old Port Lobster Shack. . . . . . . . . . . . . 26 Paolo’s Restaurant . . . . . . . . . . . . . . . . .37 Place of Bliss . . . . . . . . . . . . . . . . . . . . . . .21 Planet Orange. . . . . . . . . . . . . . . . . . . . . . .2 Pleasures from the Heart. . . . . . . . . . . .18 Pompeii . . . . . . . . . . . . . . . . . . . . . . . . . . 44 Quattro Restaurant - Four Seasons. . .35 Richard Diffenderfer. . . . . . . . . . . . . . . .12 Rosie McCann’s. . . . . . . . . . . . . . . . . 38, 50 Rosie’s New York Pizza. . . . . . . . . . . . . .45 Sakoon . . . . . . . . . . . . . . . . . . . . . . . . . . . 46 San Francisco Herb & Natural Foods. 20 San Jose Downtown Association. . . . .10 San Jose Earthquakes. . . . . . . . . . . . . . .13 San Jose Eye and Laser Medical Center . . . . . . . . . . . . . . . . . 12, 22 San Jose Repertory Theatre . . . . . . . . .55 San Jose Wolves. . . . . . . . . . . . . . . . . . . 63 Santana Row. . . . . . . . . . . . . . . . . . . . . . . .3 Shea Homes . . . . . . . . . . . . . . . . . . . . . . 65 Siam Taste . . . . . . . . . . . . . . . . . . . . . . . . 29 Silvercreek Sportsplex . . . . . . . . . . . . . .59 South County Housing . . . . . . . . . . . . . .14 Spa Joli . . . . . . . . . . . . . . . . . . . . . . . . . . . . .7 Spencer’s Steakhouse. . . . . . . . . . . 30, 31 Spinnaker Sailing. . . . . . . . . . . . . . . . . . 62 Strike. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .9 Sundance the Steakhouse. . . . . . . . . . 26 Tandoori Oven . . . . . . . . . . . . . . . . . . . . .32 Thaiphoon Restaurant . . . . . . . . . . . . . .42 The Last Song . . . . . . . . . . . . . . . . . . . . . 56 Tickle Pink Inn . . . . . . . . . . . . . . . . . . . . 71 Tony Roma’s . . . . . . . . . . . . . . . . . . . . . . 40 University of East West . . . . . . . . . . . . 22 Waiters on Wheels . . . . . . . . . . . . . . . . 26 Westpark Dental . . . . . . . . . . . . . . . . . . .17 Whiskies of the World . . . . . . . . . . . . . 53 Wine Room, The. . . . . . . . . . . . . . . . . . . 30


Â&#x2021; 0HHW/RFDO'LYH3URIHVVLRQDOV Â&#x2021; 3UHVHQWDWLRQVRQ8:3KRWR9LGHR Â&#x2021; /HDUQPRUHDERXW6FXED'LYLQJ Â&#x2021; 7UDYHO3UHVHQWDWLRQV Â&#x2021; &DUHHUVLQ6FXED'LYLQJ Â&#x2021; .LGVXQGHU)5(( Â&#x2021; DQGPRUH

IRU(QWUDQFH6SHFLDO %ULQJWKLVFRXSRQLQIRUVSHFLDO SULFLQJ2IIHUYDOLGIRU([KLELW+DOO 2QO\7KLV&RXSRQPXVWEHSUHVHQW 1R&DVK9DOXH 9LVLWZZZED\DUHDGLYHVKRZFRPIRUGHWDLOV 70

THEWAVEMAG.COM MARCH 24 ï&#x161;º APRIL 6, 2010

)ULGD\ 30WLO30([KLELWV 3UHVHQWDWLRQV 30)LOP)HVWLYDO

6DWXUGD\ $030([KLELWV 3UHVHQWDWLRQV 30WLO306KLSV5HHI&DVLQR)XQG5DLVHU


So Romantic

OUR GUESTS SELDOM LEAVE THE ROOM .

For more than 50 years, Tickle Pink Inn has graced this enchanting oceanside setting in Carmel Highlands, drawing travelers from around the world. From the moment you arrive, we give you every excuse to never leave the room, with a complimentary bottle of champagne, a host of amenities, and stunning ocean views from 35 luxuriously appointed rooms or suites. Tickle Pink Inn • 155 Highland Drive • Carmel, CA 93923 Reservations: 866.923.1915 • www.ticklepinkinn.com


The Wave Magazine - Volume 10, Issue 05: March 24 - April 6, 2010  

Cal-culator, make your own personal care products, home gym on the cheap and holistic dentistry. Cook like a pro, Half Moon Bay Vintner Seri...

Read more
Read more
Similar to
Popular now
Just for you