Page 1

Serving Great Neck, G.N. Plaza, G.N. Estates, Kensington, Kings Point, Lake Success, Russell Gardens, Saddle Rock and Thomaston

$1

Friday, July 12, 2019

Vol. 94, No. 28

LIVING 50 PLUS

L. SUCCESS WEIGHS RENTAL RULES

STATE SEEKS FIRST CAP ON DIOXANE

PAGES 29-44

PAGE 2

PAGE 9

Leaders bracing for ‘everybody’s worst fear’

MAN WITH A PLAN

Community responds to Manhasset Square plan for Macy’s property BY T E R I W EST Richard Bentley, who leads the conglomerate of all of Manhasset’s civic groups, described it as “everybody’s worst fear.” A development with three rental unit apartment buildings, an office building and hotel along Manhasset’s Northern Boulevard and Community Drive proposed by Macy’s and Brookfield Properties is simply far too big, he said. After Brookfield and Macy’s debuted the plan for the Manhasset Square project to the Council of Greater Manhasset Civics Associations in May, discussion in Manhasset neighborhoods has manifested in early opposition. A digital petition against rezoning the property from commercial to residential has 1,145 signatures despite a formal application not yet reaching the Town Board. “I don’t think anybody around the table has gotten any feedback from any resident that said, ‘Oh

this is beautiful,’” Bentley said at the June meeting of the Council of Greater Manhasset Civics Associations. “The scope was far too large.” Since meeting with the civic leaders, Brookfield Properties has continued to meet with groups including the Manhasset school district administration and town council members. “Through early interactions with town officials, our team heard the concerns raised about the project and we have tailored the program and modified the scope in response,” said Aanen Olsen, vice president of mixed use for Brookfield Properties. He did not specify any changes. Brookfield is also planning a website that would allow for question or feedback submissions and project updates, he said. Residents’ concerns include adding students to the Manhasset school district, which already struggles to fit students in Munsey Continued on Page 69

PHOTO BY JANELLE CLAUSEN

Albert Shirian, who is seeking to develop the First Playhouse for owner Jan Soleimani, speaks with Great Neck Estates trustees about insurance requirements and getting an extension for acquisition of a demolition permit. See story on page 2.

Lake Success cell node fight may continue in court BY JA N E LL E CL AUSEN ExteNet Systems is suing the Village of Lake Success, according to court papers filed last month, suggesting local officials acted beyond their legal

authority in blocking the company from installing cellular nodes throughout the area. The lawsuit, filed on June 12 in U.S. District Court and awaiting a response from Lake Success, calls for an expedited review and judgment that

would pre-empt the village’s “regulatory scheme,” overturn the board’s denial of the proposed small cells, and compel the village to issue all necessary permits and consents. “ExteNet has suffered and Continued on Page 58

For the latest news visit us at www.theislandnow.com D on’t forget to follow us on Twitter @Theislandnow and Facebook at facebook.com/theislandnow


2

The Great Neck News, Friday, July 12, 2019

GN

Playhouse developers Fine tuning bill on get a little more time short-term rentals Amended plans will be reviewed by trustees

Lake Success holds on passing law BY B I L LY F I T Z PAT R I C K

PHOTO BY JANELLE CLAUSEN

Jan Soleimani, the owner of the First Playhouse building at the corner of Middle Neck Road and Maple Drive, said developers are committed to the project. BY JA N E LL E C L AUS E N Great Neck Estates trustees granted the developers for the First Playhouse project extra time to secure a demolition permit and building permit on Monday night after the group submitted amended plans for the building. The First Playhouse of Great Neck Corp. has planned to redevelop the historic theater, which straddles Great Neck Estates and Great Neck Plaza and is located at the corner of Middle Neck Road and Maple Drive, into a 20-unit, 35-bedroom apartment building with retail space for well over a decade. The developers recently offered amended plans, which included changing the entrance location, adding windows to the west side facing Maple Drive, and moving the fitness center upstairs. A. Thomas Levin, the village attorney, had raised some concerns at the meeting, such as how the village will be protected and what would happen if the developers demolished the building but left “a hole in the ground.” He also asked how the village could grant an extension if it was uncertain how long the process would be, as the village “can’t give an extension of the deadline forever.” Albert Shirian, who is developing the project for First Playhouse of Great Neck Corp., said the

company had found some problems and come up with a better plan. He also said he hopes to add a more modern façade to the building, which would not change its fundamental structure. A lack of clear guidelines and extensive insurance requirements have been issues, Shirian said, but the developers plan to push forward with the project. “I like to start, I like to finish, I like to get out,” Shirian said, adding that he plans to make the building as “beautiful as possible.” Jan Soleimani, the owner of the building, also said he wants to get the project done as quickly as possible. Mayor William Warner said Great Neck Estates is not trying to hold up the project and there is a “formula for what we have and what’s in the code,” which building inspector Barbara Dziorney must stick to. “We’re trying to move this along,” Warner said. The developers now have up to six months to get a demolition permit from the village and then six months after that to once more be approved for a building permit. Trustees also voted to move a public hearing on the First Playhouse’s amended plans to October. Great Neck Plaza Mayor Jean Celender did not speak during the public hearing but commented afterward, “We’d like to see it built too.”

An attempt to cut down on Airbnb and other short-term rental properties in the Village of Lake Success will have to wait after the Board of Trustees decided to table a bill that would have required landlords of transient properties to obtain rental permits. A bill was proposed at the board’s meeting Monday, but there was concern that the measure would not do enough to address the issue. “I happen to be personally going through this process with the Town of Southampton,” said Trustee Larry Farkas. “So I’ve been reading the law … and they have certain provisions that are absent from our proposal.” Of the provisions missing from Lake Success’ proposed bill are a procedure to renew a rental permit, how often a rental permit should be applied for and ensuring that landlords keep their properties up to code. In the Town of Southampton, a rental permit can be renewed every two years and the property must be kept up to code upon renewal, but the town does not have to conduct the inspection. “The Town of Southampton has an alternative, where they can hire an architect or engineer who can self-certify, which I also liked,” said Farkas. “That would take away the exposure from the village.” In a follow-up call on Wednesday, village Attorney Andrea Curto said the board is considering the creation of a registration of rental properties and whether it wants to have a permit for rentals. The law in general aims to define what “transient” means, Curto said, and would likely call for a minimal rental period of one year. “The idea is to strike a bal-

ance,” Curto said. The schedule of fines for violations has not been finalized, she said. While the board plans on modeling its proposal after the law in place farther east, not all of its provisions will be exactly the same as Southampton’s. “I actually made some extra changes,” Farkas said at the board meeting. “Like the application shall contain consent from the property owner that the code enforcement officer can enter the property, which helps with the exposure. I don’t think that’s something that’s in the Southampton law.” After tabling the bill at the latest trustees meeting, the board is expected to review the additions being made to the proposal before potentially making its decision at the next meeting. The next Board of Trustees meeting is expected to be held Aug. 13 as part of its usual schedule of meeting on the second Monday of each month.

PHOTO BY BILLY FITZPATRICK

Lake Success trustees are currently working on a proposal to regulate short-term rentals within the village. The matter will be taken up again in August.

TO REACH US MAIL: 25 Red Ground Road Roslyn Heights, NY 11577 FAX: 516-307-1046 SUBSCRIPTIONS: Sue Tabakin 516-307-1045 x206 stabakin@theislandnow.com

DISPLAY ADVERTISING: Steven Blank 516-307-1045 x201 sblank@theislandnow.com CLASSIFIED ADVERTISING: Peter Roberts 516-307-1045 x210 proberts@theislandnow.com

EDITORIAL: Editorial Submissions: news@theislandnow.com / Sports Submission: sports@theislandnow.com Arts Editor: Grace McQuade 516-307-1045 x208 • gmcquade@theislandnow.com Great Neck News: Janelle Clausen 516-307-1045 x203 • jclausen@theislandnow.com New Hyde Park Herald Courier: Tom McCarthy 516-307-1045 x204 • tmccarthy@theislandnow.com Manhasset Times: Teri West 516-307-1045 x215 • twest@theislandnow.com Roslyn Times: Teri West 516-307-1045 x215 • twest@theislandnow.com Williston Times: Tom McCarthy 516-307-1045 x204 • tmccarthy@theislandnow.com Port Washington Times: Jessica Parks 516-307-1045 x214 • jparks@theislandnow.com

GREAT NECK NEWS (USPS#227-400) is published weekly by Blank Slate Media LLC, 25 Red Ground Road, Roslyn Heights, NY, 11577, (516) 307-1045. The entire contents of this publication are copyright 2019. All rights reserved. The newspaper will not be liable for errors appearing in any advertising beyond the cost of the space occupied by the error. Periodicals postage paid at Williston Park, NY. POSTMASTER: Send address changes to the Great Neck News, C/O Blank Slate Media LLC, 25 Red Ground Road, Roslyn Heights, NY, 11577.


The Great Neck News, Friday, July 12, 2019

GN

3

G.N. native hatches The Blue Chicken BY JA N E LL E C L AUS E N Aaron Ratner, 22, discovered his love for the culinary arts at 10 years old when his mother, who was one of nine children, asked for help when the holidays came around. Those gatherings, after all, could have anywhere from 50 to 75 people, he said. “She was teaching me how to cook,” Ratner, a Great Neck Estates native, said, “and before I knew it, I was cooking for everyone.” About 12 years later, that love for cooking has manifested in The Blue Chicken, a business venture that debuted at Smorgasburg, which describes itself as the largest seasonal outdoor food market in the United States. It is located in Brooklyn and home to dozens of vendors. About 300 people competed for about 20 open slots this year, Ratner said. The Blue Chicken name stems from his time at the University of Delaware, whose mascot is the fighting blue hen. He said he thought it could be fun to call a future business venture the blue chicken “as a play on that.” Ratner said that Chef Devin Spear, with whom he attended the Culinary Institute of America after graduating from Delaware, was “immediately hooked” with the idea. Since then they’ve spent countless hours with recipe development. “Before anything goes on the menu, we spend months and months testing every item and making sure it’s really right,” Ratner said. Currently, there are four items on the menu, including two chicken sandwiches, blood orange lemonade and – perhaps most famously – chicken and waffles, where chicken is served in a salted blue corn waffle

PHOTO COURTESY OF AARON RATNER

The Blue Chicken, founded by Great Neck native Aaron Ratner, has seen early success in Smorgasburg. cone. That itself stems from a partnership with the Konery, a producer of gourmet waffle cones that was founded by fellow University of Delaware alum Kristine Tonkonow, Ratner said. He said the two met when he was a sophomore, before the idea of pairing a waffle cone and chicken clicked.

Why You Should Buy Or Sell With Me?

Proudly presenting my new listing of the week. Move Right In This Beautiful, Bright & Spacious 4 Bedrooms, 2.5 Baths Colonial Home With Open Floor Plan. Walk To Town & LIRR. Asking Price

$999,000

“It’s really been great for our business so far,” Ratner said, noting its sales have been double that of their chicken sandwich. Ratner also credited much of his business acumen to help from Great Neck South High School economics teacher Dennis Mooney, who first took him “under his wing” about seven years ago. They built and ran the concession stand at Great Neck Estates Park together, he said, where he learned how to manage issues with inventory and purchasing. The money he made also went toward starting The Blue Chicken. “Since then, the amount I’ve learned that has transferred over to The Blue Chicken is really amazing,” Ratner said. Ratner also noted the opportunity he had to intern in the Westbury Mayfair Hotel’s restaurants in London, where he came to appreciate fine dining, the smiles on people’s faces, and the thrills from the speed of service. “I was sort of addicted the second I was in the kitchen,” Ratner recalled. Vigilant Fire Company “played a big role” in his food development too, Ratner said. He recalled being volunteered to cook for a company dinner by his brother, Josh, as well as the general skills he learned being part of the department. “The amount of leadership skills I’ve learned at the Vigilant Fire Company is unparalleled,” Ratner said. Ratner said that while there have been early talks about someday opening a permanent storefront, there are no immediate plans for The Blue Chicken to leave Smorgasburg – a place where “many big names started.” “It’s been a dream of mine to be in Smorgasburg,” Ratner said.

My Commitment To You: • I am well educated and experienced. • I am honest and ethical. • I work full-time. • I am patient and I am a good listener. • I work with you personally and won't relegate you to an assistant. I take responsibility for every step of the way. • I respond quickly to inquiries and phone calls. • I am able to qualify the prospects quickly so as not to waste your time and mine. • Every transaction is confidential.

The Difficult I Do Immediately The Impossible Takes A Little Longer! Debbie Fahimeh Oheb - Licensed Associate Broker EXIT REALTY UNIVERSAL

10 Bond St., Great Neck NY 11021 Office: 516-487-5432 #107

Direct: 516-906-7329 debbieoheb@yahoo.com www.debbieoheb.com


4

The Great Neck News, Friday, July 12, 2019

GN

Help hired as Port moratorium goes on BY J E S S I C A PA R K S North Hempstead Town Councilwoman Dina De Giorgio announced on Tuesday that the town will hire a consultant and a surveyor for the Port Washington waterfront business district. Residents urged the town to make the move at last month’s town meeting where developers and residents alike shared their issues with proposed zoning changes. Developers raised concerns that the proposed changes would halt development in the district, while residents were worried about the potential for overdevelopment. The board’s proposed zoning code changes include eliminating residential use from the district, eliminating below-ground parking, implementing a 10-yard setback on the front and rear of properties and reducing maximum building height from three stories to two. Hotel and boatel uses were eliminated from singleuse properties and instead can be part of a mixed-use build-

PHOTO BY JESSICA PARKS

North Hempstead Town Councilwoman Dina De Giorgio shared her vision for the future of the Port Washington Waterfront Business District at a meeting in May. ing. A density cap of 35 rooms per acre was introduced for new hotels. A boatel is a waterside hotel equipped to accommodate visitors traveling by boat. De Giorgio said she will head a steering committee of interested stakeholders to guide the consultant through the zoning process after community members asked her to

do so. “I am very flattered that everyone seems to have so much confidence that I can do that,� she said. The councilwoman said that some of the property owners have expressed interest in being part of the process. At last month’s meeting, Port Washington Chamber of

Commerce President Mitch Schwartz suggesting organizing developers to hear how they would like to see the zoning code changed after one property owner reached out to the chamber about the zoning code changes. Mariann Dalimonte, Democratic candidate for De Giorgio’s board seat and executive director of the Greater Port Washington Business Improvement District, spoke out against the idea. “I really feel the chamber should not be hosting these meetings,� she said. “I really feel that it would be a benefit to the Town of North Hempstead to host these meetings.� De Giorgio said at the time that it wasn’t that the town is not interested in hosting the meetings but that sometimes people feel more comfortable “not under the pressure of coming into Town Hall� and thought it would be best that the chamber host at least the initial meeting. She said on Tuesday she is trying to figure out where and when the meetings will take place but is planning for the first meeting to be held the

first week of August. So for now, the board continued the public hearing without a date and scheduled a public hearing for next month’s meeting on a resolution to extend the building moratorium to April 1. Representatives of various civic groups in Port Washington voiced the need for the town to use the recently proposed zoning changes as the foundation for the updates to the code. Mike Benedetti, a member of the Mitchell Farm Home Association and the Port Washington Waterfront Association, said he was echoing his neighbors in suggesting that the proposed code dated June 7 be maintained as a baseline and incorporated into the request for proposal with the selected consultant. The 11.2-acre waterfront business district was organized in June 2009 and runs along the north side of Main Street from Sunset Park to the west side of Main Street after the curve and ends just before Dolphin Green. A building moratorium has been in eect since December 2017.

This is more than great rates This is more savings for wherever you’re going. Platinum Savings Account

2.00

%

   "  $ %&! # ' # '! ()   $  *&+,,, ! !! (  

   $*&+,,, ! %

Guaranteed Fixed-Rate CD

2.10

%

   "  $  -.! #!' # '! ( )   $ *&+,,,&

Enroll in a branch by August 30, 2019. /  ' 0Ask about our business savings rates.      Portfolio by Wells Fargo ! "

         #  3 1.                      !"#!$#%!&'!$#(!#%!&' )*  *    )   +,  -                       /02345676+8     ) 8   9  &+'$:;) 9 <  ) =%>!!!                 =%>!!!    )        ) +?6 @  

       A

    ) B4 C*6++  D  ;  )   * #   <+

)    ;<      %+!!:+) 9  ))        )  &%            + E        &% )          =%>!!!          ) 9      ))   8   9      +  !>#(&#%!&'   8   9       045676   =!+!& !+!>:;!+!>:<F      23   =!+!& ='''''+'' !+!>:;!+!>:<   =&!!!!! !+&!:;!+&!:<+3   G  

            )) +8    )   )   +               +H) )    &% )  )  I

   8   9 )) +J   )     =%>+      =&%))       =(>!!    +4    +8       -     +B4       )          =&  +%+  I  F  )* *     )   +   ;<     ) !"#!$#%!&'!$#(!#%!&'      =%>!!!     B4 +?6 @  

       A

    ) B4 C*6++  D  ;  )  * #   <+  4B          +      )    +8    )  +       02   /4    &% ;(K> <      )       I     ;     <+4    &%        )       I   +)         )      +) 9  ))         02 +    )   02          K             02   -  ) 9  C* L    +&+%+2         )      )* *     )          +B4                   +J   )       =%>!!!          

            )  +8      *     )       )          )          L +,  /M0       )  +M9) )   

  +(+   B4 )  =(!             /=%>!!!      **)  ;*  024280I  89< =>!!!!         **  * ;   B4   550<  ;  &!:         <+8     B4    )                        )           C*A I

 ))           +4             ) +8     B4    )          *B4   0*  B 4  0*       * )   + N%!&'B4 C*6++    +2) )    B4 C*6++J 4280+


The Great Neck News, Friday, July 12, 2019

GN

5

LIRR station for new Belmont Arena Governor’s plan for project draws fire over station location, announcement timing BY TOM M CC A RT HY A Long Island Rail Road station will be built on the Main Line as part of the Belmont Park development, Gov. Andrew Cuomo announced on Monday. It is the first full-time LIRR station to be built in nearly 50 years. The new station will be located between the Queens Village and Bellerose stations just east of the Cross Island Parkway. Cuomo’s plans said that electric shuttle buses, which were already planned to run from parking lots within Belmont Park to a proposed new arena for the Islanders hockey team, will also serve LIRR riders traveling to the grandstand and planned arena, hotel and retail village. “The Belmont project will help drive the region’s economy forward while building the Islanders a state-of-the-art facility at home on Long Island, creating thousands of jobs and hundreds of millions of dollars in economic output along the way,” Cuomo said in a news release. The cost of constructing the new fulltime station on the Main Line and upgrading the existing spur is estimated to be $105 million. Cuomo’s announcement said that the Empire State Development

PHOTO BY JANELLE CLAUSEN

team will cover $97 million, 92 percent of the total, and the state will invest the remaining $8 million. The LIRR station is expected to have service approximately every half hour during peak hours and every hour during off-

peak hours, according to the news release. The announcement came as the Empire State Development board voted at a meeting in Manhattan to publish the arena project’s Final Environmental Impact Statement online.

Aubrey Phillips, a spokesman for the Belmont Park Community coalition, expressed frustration with the announcement, saying he had been led to believe that Cuomo would hold a news conference on Long Island. “There was no conference; he issued out a press release instead,” Phillips said. Phillips was critical of the announcement and the location of the meeting, saying, “They announced a meeting on a holiday weekend nowhere near where the project is.” In regards to transparency, the Belmont Park Community Coalition sent out an email giving the Empire State Development board an “F.” Larry Penner, a transportation historian who previously worked for 31 years for the U.S. Department of Transportation, wrote an open letter critiquing Cuomo’s announcement. In regard to the project costing $105 million, Penner wrote, “Just how did he come up with this number? A reliable cost estimate takes more than just a press release with station renderings that were probably prepared by Empire State Development Corporation project consultant.” Continued on Page 71

After 22 years, staffer Roslyn mill promises revival calls it a career BY T E R I W EST

PHOTO BY BILLY FITZPATRICK

The Lake Success Board of Trustees honored Janet Carman for 22 years of service to the village. BY B I L LY F I T Z PAT R I C K After 22 years on the job, a member of the Village of Lake Success administrative staff has decided to call it a career. Janet Carman retired earlier this month. She had served as secretary to the village’s golf commission, Planning Board and Building Department. Despite spending more than two decades employed by the village, Carman said she never really felt like she was working. “I found the things I loved doing,” said Carman. “I felt like I got to come in

and got to see all my friends and my family. I got to socialize and I got to be a part of the community of Great Neck.” “I just loved being here and it’s not in my head that I left,” she added, “so you will still be seeing me around.” During the Board of Trustees meeting Monday, Mayor Adam Hoffman dedicated a proclamation to Carman for her 22 years of service to the village. He said she is retiring from a “dedicated, outstanding career” and offered her best wishes on her retirement on behalf of the Board of Trustees and the village.

It looks like the kind of structure kids instinctively draw to depict a house – a rectangle with a triangle slammed on as the roof. An ordinary looking building like that stands out in Roslyn, where many are tall and ornamented. Right now, however, the Roslyn Grist Mill looks sunken. The base of the roof is nearly at street level, and the construction signs on the light brown wood out front could trick one into thinking the building is just another new structure being built. It’s not. The grist mill has known Roslyn since before the United States was independent. It has seen the village evolve over the course of 45 presidencies and the main street rise with development. Soon, as the next step in what is planned to be a three-year restoration project, the grist mill will be raised to be at street level once again. In years to come, it will welcome visitors. “This is one of the jewels,” said Howard Kroplick, president of the Roslyn Landmark Society, which is leading the restoration project. “This is a real treasure here.” Wooden beams traverse the length of the structure, bolstered by diagonal pieces and connected by pegs. The existing timber frames are the original

PHOTO BY TERI WEST

Roslyn Landmark Society President Howard Kroplick inside the Roslyn Grist Mill. ones from when the Grist Mill was built, sometime between 1715 and 1741. “People who love grist mills just go crazy when they see this,” Kroplick, in a hard hat, said as he gestured toward the Dutch frames. “This is like a dinosaur.” The hardest part about the grist mill restoration was starting it, he said. For decades, there was a sign out front promising a coming restoration that never happened, Kroplick said. The Nassau County-owned building required millions of dollars worth of Continued on Page 58


6

Blank Slate Media Newspapers, Friday, July 12, 2019

A L L S A N DA L S D R A S T I C A L LY R E D U C E D !

SUMMER CLEARANCE - SAVE UP TO 60%!

PLEASE VISIT OUR WEBSITE FOR NEW STYLES & DISCOUNTS!

VISIT OUR WEBSITE FOR MORE STYLES - www.ericshoes.com

- WILLISTON PARK

SINCE 1942

SLIM - NARROW - MEDIUM - WIDE - XWIDE 2XWIDE â&#x20AC;¢ 4-18 PERTH 6 colors Avalable

Florsheim Lakeside Moc Toe Slip-on

Beautifeel Maisy

B-D-EEEE â&#x20AC;¢ 4-16 Narrow - Medium Wide - Ex-Wide 4-16 Available

N-M-W-XW 4-12

Lowest Price Guaranteed!

100â&#x20AC;&#x2122;S Of Styles

SAS

OTHER COLORS

N-M-W-XW

Large Selection of Wedding Shoes

Womens Duo Red Snake

KELSEY N-M-W-XW 4-13

N-M-W-XW 5-12

426 HILLSIDE AVE. WILLISTON PARK â&#x20AC;¢ 516-877-2002 THIS IS THE ONLY LOCATION ON LONG ISLAND (Few Blocks West of Willis Avenue) Mon.-Sat. 9:30am-7pm â&#x20AC;¢ Sun. 11am-5:30pm WWW.ERICSHOES.COM

$25 OFF

B-D-EEEE

W/this ad only

FREE SHIPPING 1-800-681-SHOE

$

25 Off

EACH PAIR

Any Sandals

WE ACCEPT COMPETITORSâ&#x20AC;&#x2122; COUPONS AND COMPANY ONLINE PRICING

Excludes sale items & certain brands

Eric Comfort Shoes With this coupon only. Cannot be combined with any other offer or sale item. Excludes Samuel Hubbard Ara & certain other brands. Offer expires 8/4/19



.LQJV3RLQW&DSLWDO0DQDJHPHQW//&

LVSOHDVHGWRDQQRXQFHWKDW $QGUHV)HUQDQGH]9LFH3UHVLGHQW,QYHVWPHQW$GYLVRU KDVMRLQHGRXUILUP

3ULRUWRMRLQLQJXV $QGUHVVHUYHGDV9LFH3UHVLGHQW DQG)LQDQFLDO&RQVXOWDQWDWD ODUJHILQDQFLDOLQVWLWXWLRQ $QGUHVZLOOEHZRUNLQJRXWRI  RXU*UHDW1HFNRIILFH DIHUQDQGH]#NLQJVSWFRP

ZZZNLQJVSRLQWFDSFRP *UHDW1HFN5G6XLWH*UHDW1HFN1<Â&#x2021;


Blank Slate Media Newspapers, Friday, July 12, 2019

7


8

Blank Slate Media Newspapers, Friday, July 12, 2019

7UDQVIRUP\RXUKRXVHLQWRWKHKRPH\RXZDQW

5GTXKEGUKPENWFGUKFKPI OCUQPT[CPFFTKXGYC[U MKVEJGPUDCVJTQQOU DCUGOGPVUCPFCP[VJKPI GNUG[QWECPKOCIKPG

YYYNKFGXGNQRGTUEQO

 


Blank Slate Media Newspapers, Friday, July 12, 2019

9

State seeks first cap on 1,4-dioxane Mineola among 14 water systems across the state to receive $30K to treat contaminant BY J E S S I C A PA R K S The state health commissioner recommended a maximum contamination level of 1 part per billion for the drinking water contaminant 1,4-dioxane Monday as the governor cleared millions of dollars to help fund local projects to treat the chemical. The contaminant 1,4-dioxane is a clear liquid that was prevalent in Long Island manufacturing and is used in solvents, paint strippers, greases and wax. The Environmental Protection Agency classifies the chemical as “likely to be carcinogenic to humans” through all routes of exposure. Commissioner Howard Zucker has directed the state Department of Health to begin adopting the standards that were recommended by the state Drinking Water Quality Council in December. The maximum contaminant level set by for 1,4-dioxane is the first contaminant level regulation set on the substance in the nation, according to the governor’s office. Zucker also accepted a maximum contaminant level of 10 parts per trillion for both PFOS and PFOA. PFOA is a chemical used to produce nonstick, stain-resistant and water repellent products. PFOS is a chemical used in the production of firefighting foam. “We’re proposing the most protective levels in the nation for three emerging con-

PHOTO COURTESY OF WIKIMEDIA COMMONS

Gov. Andrew Cuomo approved funds to support local water authorities to conduct infrastructure projects that improve water quality and public health. taminants to ensure we are regularly testing and fixing water systems before they ever rise to a public health risk in any part of the state,” Gov. Andrew Cuomo said. The Port Washington Water District is expected to begin a pilot study to treat

1,4-dioxane at wells in Christopher Morley Park in Roslyn before the close of the summer. One of the three Port water district wells in the park is slightly above the pending maximum contamination level. The governor also announced the

availability of $350 million for municipalities to carry out infrastructure projects that protect public health or improve water quality. Another $27 million has been allocated to help Long Island communities upgrade drinking water treatment systems and address emerging contaminants. State grants will fund up to 60 percent of each project’s cost up to a maximum of $3 million. Both the Manhasset-Lakeville Water District and the Port Washington Water District received $3 million from the state for 1,4-dioxane treatment. The Port Washington district’s funds will also be used for PFOA treatment. The state will provide another $370,000 in grants to fund the planning and development of new local infrastructure projects that address emerging contaminants. Grants of up to $50,000 each have been awarded to 14 public systems across the state. Among those municipalities are the Garden City Park Water District, which was awarded $19,600 for 1,4-dioxane treatment planning; the Village of Mineola, which received $30,000 for 1,4-dioxane removal planning; and the Roslyn Water District, which was granted $30,000 for 1,4-dioxane treatment planning. Continued on Page 60


10 Blank Slate Media Newspapers, Friday, July 12, 2019

Opioid deaths see decline in Nassau BY JA N E LL E C L AUS E N Annual opioid overdose deaths in Nassau County dropped by nearly a quarter from 2016 to 2018, newly released statistics from the Nassau County medical examiner’s office show, decreasing from 195 in 2016 to 147 in 2018.

The new numbers show a reversal of a trend of consistently rising overdose deaths in Nassau County. There were 82 deaths involving at least one opioid in 2010. By 2015 that number more than doubled to 177, before peaking at 195 in 2016. Continued on Page 68

PHOTO BY AMELIA CAMURATI

Nassau County District Attorney Madeline Singas of Manhasset, center, speaks with Nassau County Executive Laura Curran and Nassau County Police Commissioner Patrick Ryder after a news conference in 2018 about opioid overdoses.

Town dog tethering regulations approved BY JA N E LL E C L AUS E N

Using drones to inspect the energy grid. One of the many ways we’re using smart technology to prevent outages before they happen.

PSEGLINY.com

The Town of North Hempstead added bite to its laws regarding tethered dogs at a Town Board meeting last month, adding a series of protections for dogs and fines for convicted offenders. The change calls for dog owners to provide suitable food, water, shelter and dry ground when a dog is tethered outside. Dogs also cannot be tethered to a stationary object outdoors for more than one continuous hour during a 12-hour period between 6 a.m. and 11 p.m. It also bars choke collars that could hurt a dog or impair its breathing, limits the amount of time a dog can be kept outdoors, and says dogs cannot be tethered outside in temperatures below 32 degrees or above 90 degrees. “We are speaking for those who cannot speak for themselves,” Town Supervisor Judi Bosworth said. “Dogs depend on hu-

mans to care and protect them.” The first violation comes with a fine ranging from $500 to $750, the second violation has a fine ranging from $750 to $1,000, and the third and subsequent violations carry a fine from $1,000 to $1,500. Each violation also carries a risk of imprisonment for up to 15 days. The new law will add considerable length to the subsection of the town code pertaining to “dogs to be restrained,” which did not restrain how an owner could tether a dog. Prior to the amendment, that chapter of the code only said it was illegal for a dog to be on any property without the owner’s consent unless the dog is “effectively restrained in the immediate custody” of its owner or on a chain or leash that was six feet or less. The full law can be found online at https://northhempsteadny.gov/ProposedLocal-Laws. Continued on Page 68


Blank Slate Media Newspapers, Friday, July 12, 2019

Yvette Lingerie Voted Winner BEST LINGERIE SHOP of Queens

The Area’s Only Full Service Corsetier Shop and So Much More! I COME VISIT OUR BEAUTIFUL CLOTHING BOUTIQUE! Featuring Slacks, Tops, Jackets, Dressy Sweaters and Accessories

I FULL SELECTION OF:

I POST SURGERY NEEDS:

Forms, Bras, Bras, Bustiers, Corsets, Bathing Suits, Lymphedema Sleeves, Undergarments, Bridal Wear, Clothing, Wigs, Turbans Plus Sizes. We also carry Wacoal, MarieJo, Primadonna, Chantelle I CERTIFIED FITTERS and Edith Lance. Most Insurances Accepted Alterations Done On Premises On All Our Clothing

Large Selection of Bridal Shower Gifts Serving New York for over 32 years

We’re closer than you think. Located at the Nassau/Queens border.

40-13 Bell Blvd. Bayside, NY (718) 229-5724

11


12 The Great Neck News, Friday, July 12, 2019

GN

“ Words of Wisdom From G.N. Grads”

Ashley Yu shares lessons learned at South

I’ve learned a lot here. Not just academically to the high standards held, but emotionally, and I wanted to share. Great Neck South High School breaks

the majority, if not all, of the clichés of high school. There are no evil principal or teachers, no harsh “labels”; kids are kind and respectful. Everyone is essential to the community we’ve built. There truly isn’t a place like Great Neck South, and it is because of the people here. I’ve learned that nothing will ever truly prepare me for my future. I don’t know what it holds. There’s always going to be a risk or decision to be made. If there’s one thing that’s guaranteed in life, it’s struggle. We’ve all had them and we’re going to continue to have them. But that’s no reason to hold back. I’ve learned that it’s ok to have a little fear and competition as long as it doesn’t consume you. It should motivate you. In

the words of Bill Gates, “Don’t let complexity stop you. Be activists. Take on the big inequities. It will be one of the great experiences of your lives.” No matter how scary the thought of the future is, it’s up to each person to make the best of the opportunities given and to create and define their own versions of success and happiness. The world we’re about to be released into is like the ocean: mysterious, immense, endless. The past 17 or 18 years have been a walk along the shore, with the people around us being guiding lights. But as we depart from what we’ve known and wade in the water, we face the waves; both struggle and opportunity: our future. We can either choose to retreat in fear or

face these waves head on, reaching deeper water and exposing ourselves to our full potential. Choose the latter, because one strong stir can set an entire sea into motion. The opportunities and struggles we’ve had, the relationships formed, the memories made, the kindness already encountered all serve a purpose. I’ve built my character here, become my own person: a bubbly girl with a weird laugh; someone who will talk to anyone, and I’ve learned to be unapologetically me. We can never fully prepare for what the future brings, but we can be ready to face it head on with the experiences we’ve had at Great Neck South High.

Paden Dvoor talks magic, change, the mind

Good afternoon families, friends, teachers, administrators, and of course, my peers in the graduating class of 2019. Today we live in a world of thought. A world of wonder and new ideas—ideas that our grandparents, parents, and maybe even siblings could have never imagined. We have revolutionized the way we communicate with friends—texting and snapchatting instead of knocking on doors. We have revolutionized the way that we learn—expanding the classroom through apps.

We have formed bonds with computer screens, ordered four course meals with the click of a button, and turned family scrapbooks into Facebook albums. You are now able to go online and check the net worth of the guy you went on a date with last night; you can read what people have to say about that new restaurant you’re not so sure you want to try; you get alerts when the President tweets. Oh yeah, and that too, the President tweets! We have broken down the hardships of everyday life and decreased the workload for ourselves. Life has simply become more accessible and more controllable. That being said, we have also unknowingly carved ourselves paths of well, potential insanity. And with that, I get to the real reason why I got up here today. There’s nothing to talk about anymore. I obviously couldn’t stand before all of you and rant about war, politics, climate change, race, religion, or anything in between. But after some thought, I realized there is something I can discuss. It’s magic. Harry Houdini, thought by most as the

greatest magician to this day, once claimed that he could break out of any jail. He said he could be out of any cell in one hour, no problem. And he did it. He broke out of jail cells all over the country. But a few years in, a pretty old jail in the South asked him to come try it out on them, claiming Houdini’s trick would not work this time. People came from all over to watch, wondering what in the world could stop Harry Houdini. Confidently, Houdini walked right into the cell. And the metal doors were shut behind him. Houdini first removed his belt. Because secretly hidden in his belt was a ten inch piece of steel that had helped him open every past jail cell. He began working. In about a half hour, the confident smirk that rested on Houdini’s face began to fade. In about an hour, Houdini was bathed in sweat, just waiting for the click to signal that he had unlocked the door. And in two hours, Houdini, admitting defeat, collapsed against the door. But as he fell against the door, it

opened. It opened because, you see, that door had never been locked. Well, it had never really been locked. But it had been locked, firmly and thoroughly, in Houdini’s mind, which meant it was locked as if the best locksmith in the world had put his lock on it. The mind is powerful. And the mind is dangerous. We have begun to act as computers—coding and programming ourselves for the worst. But we are not computers. We are about to enter the next stage of our lives, crafting careers, paying bills, moving around the state, around the country, and around the world. Problems will arise and pressures will stump success. But we must realize that our minds are the strongest forces that we will ever face. Our minds will tell us lies; our minds will tell us “you can’t do it,” “you’re not meant for that,” and “you’re not good enough.” But we can’t listen. We should look at Houdini and learn. Learn that the only locked doors that exist are in our own minds. The doors in reality are wide open. And all we have to do is walk through.

Stardust and discovery: Kristin Hon speaks

I once heard that we are all made up of stardust. A truly poetic sentiment, especially when you realize that it’s true. How many of you have heard of nucleosynthe-

sis? (None? Some? Same.) Basically, after the Big Bang, tiny particles were released and fused into heavier elements. Those elements—made of stardust—evolved into organisms, one of which being us. This mind-boggling history has made people so excited to learn about Earth. Problem is… almost everything on Earth has already been discovered. That leaves little room for us to discover. However, what has barely been explored by generations past? Space. You see, we don’t know what we haven’t learned. We can assume, and we can postulate. We can presume, and we can calculate. But the truth is, at the end of the day and at the start of tomorrow, nothing is guaranteed. Space is where we are go-

ing, that much is true. And getting there? Well, how else are we going to understand air resistance without science and math, how else can we incorporate the Apollo missions without history, how else can we communicate our experiences without language? Our education will be our rocket fuel, propelling us toward an uncertain path. We will be the trailblazers of a new landscape. Piloting into tomorrow. So when you look back in time, don’t. Look to the stars because whatever is behind you has already been discovered. Look forward, look up, look around, and when you still find yourself looking back, look ahead farther because before you is space that has never been seen before. Be-

cause space is the final frontier. These will be the voyages of the class of 2019. Our continuing mission: to explore strange new worlds. To seek out new life and new civilizations. To boldly go where no one has gone before… And if you can’t or don’t want to do that, look within yourself. Because, believe it or not, you are stardust. You are the stars, you are the moons, you are the planets, and you are the galaxies that embrace them. No matter how small you may seem, you have a future larger than you can dream. And because of that, you must find yourself first before you can examine the universe.


The Great Neck News, Friday, July 12, 2019

GN

13

Salutatorian Chloe Metz reflects on change

Four years ago, we were know-it-all ninth graders with iPhone 6s and unjustified confidence. We went into high school like little punks until we were blindsided by the workload. Suddenly, we had to work to get good grades. All those clichéd high-school movies lied to

us—there was no dancing and singing on cafeteria tables, nobody broke out into song in the middle of a basketball game, high school wasn’t easy. High school was a grind that challenged our notions of time and persistence. There were days when we muscled through school on fewer than four hours of sleep and days when we didn’t have time to prepare for a test and had to “wing it.” But there were also days when we would chuckle while Mr. Dickson fumed over his defeat in teacher basketball. There were days when we would watch Mr. Graham attempt to dance like us Gen Z’ers. In Ms. Tria’s class, we laughed at President Kennedy who told all of Berlin, “Ich bin ein Berliner,” which unintentionally translates to “I am a jelly donut.” In Ms. Macriagne’s class, we marveled at

King Henry VIII’s monstrous appetite, consuming 13 meals a day. That, folks, is how you gain the freshman 15. And who could forget when our school went viral for calling teachers by their first names? Especially the time a student addressed our health teacher Mr. Millevoi as “Jim,” making him drop his example birth control pills in utter shock. The laughs, the hidden gems of knowledge, the intriguing teacher stories—these are our memories. Four years later, we are finally graduating! Our high-school years have been unforgettable – from Leonardo DiCaprio FINALLY winning his Oscar to a dramatic change in presidency to the rise of several social movements. On January 1, 2017, many of us participated in the women’s march. On March 14, 2018, we walked out of Great Neck South and marched

for our lives to protest gun violence. In just four years, our worlds changed exponentially. We have become activists, young scientists, burgeoning musicians, engineers, and athletic stars. On this bittersweet occasion—bitter because you have to listen to me give this speech, and sweet because I’m almost done—I am reminded of a quote by Andy Bernard who says in The Office finale, “I wish there was a way to know you’re in the good old days before you’ve actually left them.” We might not realize it now, but we are and have been living in the good old days. Over the next few years, we will go to college, get jobs and start careers. The past four years were good, but the next four will be gold. So live in the moment, appreciate all that is good, and cherish the present, because it will one day become “the good old days.”

Deborah Malekan: savor the experience

We all have moments in our life where we take a step back and ask: “Was this all worth it?” When I was 10 years old, I threw up outside of Costco. I had a pizza, a good pizza, and it didn’t really sit well, so it came up again. If I’m being honest, it wasn’t the best of times. The Costco parking lot wasn’t the most accommodating place, and the forty-five minute drive home did little to soothe my nausea. On top of that, my mom didn’t want me to eat that pizza in the first place. “We have pizza at home,” she had said, a fact that I highly doubted but did not want to challenge her on. So much to my mother’s dismay, I ate the Costco pizza, and well, you know the rest. For a while after, I initiated my very own Costco boycott. It wasn’t that I meant to ban their products, but it was simply too hard for me to look at that store again without unpleasant memories resurfacing. Yet, with the passing of a few years, I realized how ridiculous I was being. Costco, home to free samples galore, was somewhere I needed to be, and one lousy experience was not going to tarnish all the beautiful memories it holds—memories of the first time I was

able to withstand the cold of the freezer room, when I first discovered those precious chocolate-covered almonds, and that time when they were sampling my favorite vanilla cake. In a way, it is much like high school. No, I have never thrown up in school, but trust me, there have been many grades that triggered that same sense of nausea. There have been plenty of moments where I debated “boycotting school,” but my desire to graduate along with the newly imposed seven day absence limit has nullified this protest. Still, there is much to say about embracing this correlation. Life is composed of millions of tiny moments, and expecting each and everyone to be perfect is irrational. The beauty of life is that sometimes we fall down, sometimes we don’t get the ACT score we want, sometimes we lose every game, but for all those times we fall, there are the moments we get back up again, the moments we look around and embrace one another. There is beauty in understanding that life exists not for the outcome, but rather for the experience. We are here to grow and to prosper, but with a mindset that accepts no mistakes or downfalls, we can achieve neither of those things. It took me four years to finally grasp that it is not the direct outcome that makes something “worth it” but rather the experience itself. The experience of eating that pizza is what I latch onto— the way the cheese melted softly and the luscious sauce and the crunchy yet fluffy crust—not the garbage can and the asphalt outside of Costco. It is the process of doing everything but studying in the library, being doubles partners with my

best friends, and burning brownies the night before that makes it “worth it.” Those are the things I continue to treasure, not my exam grades and match scores and college decisions. Those moments, the ones that simply exist as a vehicle for accomplishing something else, are the ones we must embrace, so why don’t we? As high school students, we are trained to value the results, often bombarding each other with questions like “what did you get on this test?” or “where are you going to school next year?” but sometimes, we just need to slow down and value the more important things. As human beings, we must learn to embrace the seemingly inconsequential moments, regardless of whether or not they yield the results we hope for. Ultimately, the result of something isn’t the experience; the experience is the experience. I tell people I play tennis, and for some reason they always think I’m really good. Truth be told, I think I’ve won maybe two competitive games in my entire tennis career. While the rest of my team was raking in win after win, there I was, unable to hit a forehand to save my life. Yet when I look back at those two years, my mind goes not to my embarrassing record, but rather to the memories my friends and I made. Yes, the match score is the result, but playing alongside my best friend was always the more meaningful experience. Often times, we choose to experience moments the wrong way, forgetting that we have the option to choose the good. For me, the moment was having the pizza, and even throwing it up hasn’t made me push that moment to a place where

I never want to think about it again. We must be capable of separating the joyful part of experiences from the negative part. I don’t view this story as one where “I threw up” but rather one where “I really liked a pizza… even though I threw up.” I don’t view tennis as a sport where I sucked, but rather one where I had a great time with my friends… even though I sucked. We are so ready to be released from high school simply because of some negative experiences, but that doesn’t mean that the whole thing should be thrown out, or thrown up. There is beauty in the four years we shared; however, our propensity to value the wrong things leads us to label something as either good or bad. But there is always gray. Now I’m not saying that we’ll throw up Gino’s or Daruma or Deli, but we might. Or maybe we’ll throw up words, slip out a simple “tef” or “BH” in front of our college friends and have ten confused faces look back at us (though, if you’re going to Bing, you don’t have to worry, they’ll all understand). Moving forward in college, or wherever the next four years take us, we must be cognizant of whether we concentrate our attention on valuing the right things. At the end of the day, none of us wants to be 50 years old with great GPAs and no stories to tell. None of us wants to reflect on our life, asking “was this all worth it?” because if we have to ask, then deep down, we know it wasn’t. So when you walk out of here today practically jumping with glee over the fact that it is finally over, take a little time to store some of these small memories. You’ll need them later on.


14 Blank Slate Media Newspapers, Friday, July 12, 2019

Opinion Editorial Cartoon

OUR VIEWS

Macy’s proposal a test for town Brookfield Properties and Macy’s are expected to submit their plans for a $400 million, mixedused development on the Manhasset Macy’s property to the Town of North Hempstead in coming days. The town’s response to these plans will provide a test of North Hempstead’s ability to balance the desires of area residents and village officials with the needs of healthy downtown business districts in the 21st century and a strong local economy. The project would add three apartment buildings containing 355 rental units, a hotel, an office building and retail and dining outlets to the Macy’s property on what is now a vast and unsightly parking lot surrounding the department store. Most of the 2,271 parking spaces would be in an underground lot. “The site has been a productive center of commerce for more than 50 years,” said Aaneen Oslen, vice president of mixed-use development for Brookfield. “With the changing landscape of retail real estate, the proposed project will ensure its success for the next 50 years.” The apartment building would also provide much-needed housing for young people as well as older adults. The entire project would bring jobs and tax revenue. But concerns, if not outright opposition, appear to be building among civic leaders and neighboring village officials. At a meeting with the Greater Council of Manhasset Civic Associations, members expressed legitimate concerns about the impact on the Manhasset school system, water system, adjacent neighborhood, traffic and an already exist-

ing downtown district on Plandome Road. Some village officials have echoed the concern about the impact on the downtown on Plandome Road as well as neighboring areas such as Great Neck, whose downtown is filled with empty storefronts. These concerns are, in some ways, a positive sign about the proposed Macy’s development. At a time when village officials have cited a decline in sales at brick-and-mortar locations as a reason for empty storefronts in their communities, even they apparently believe that a strong retail presence is possible on the Macy’s site. Which begs the question, what’s stopping them from developing a plan that keeps or restores their downtown shopping districts? Sue Auriemma, secretary of the Greater Council of Manhasset Civic Associations, pointed out that Manhasset’s downtown along Plandome Road has been struggling to hold on to businesses and attract new businesses because it doesn’t have sewers. Which begs another question, why not? Thanks to the efforts of the Manhasset Chamber of Commerce, which has been working with the Town of North Hempstead, sewers may be finally coming to Plandome Road. We hope the town’s dereliction in providing sufficient infrastructure to Manhasset’s business district does not negatively affect the plan presented by Macy’s and Brookfield Properties. Nor should the concerns of other villages that have failed to keep up with the needs of businesses in the 21st century.

BLANK SLATE MEDIA LLC 25 Red Ground Road, Roslyn Heights, NY 11577 Phone: 516-307-1045 • Fax: 516-307-1046 E-mail: hblank@theislandnow.com

It is true that the Macy’s site has advantages over the downtown districts. The partners have in Macy’s an anchor tenant that will attract shoppers by virtue of its well-known brand and aggressive advertising. They also have ample and, if they continue their current practice and those of other shopping centers, free parking. In contrast, downtown districts in villages require that shoppers pay for their time in a store and run the risk of getting a ticket. For some villages, this is a significant source of revenue but is counterproductive when downtown districts are competing with online stores and shopping centers where parking is free. The amount of parking is often an issue as well. Richard Nicolello, the presiding officer of the Nassau County Legislature, said county legislators actually receive funds that can be used to increase parking availability – but have routinely redirected the money to other uses. How about government funding new parking lots, only placing meters in front of storefronts to ensure they are available for quick purchases and making parking lots away from storefronts free? This would make the downtowns more competitive with malls, strip cen-

REPORTERS Janelle Clausen, Teri West, Jessica Parks, Tom McCarthy

The mayors of both Farmingdale and Mineola, which have both seen turnarounds in their downtowns, told attendees of Blank Slate Media’s recent community forum that building a consensus around a single plan is a key to revitalizing local downtown districts. Unfortunately, the leadership to bring these groups together seems missing in too many places. On the other hand, Great Neck, Manhasset and other communities in the Town of North Hempstead have something that Macy’s and Brookfield Properties want – a Main Street feel. We hope town officials will deal wisely with what Macy’s and Brookfield Properties are offering the Town of North Hempstead. There are legitimate concerns with the project that need to be addressed. The town officials should work with Macy’s and Brookfield Properties to overcome them. We also hope the town, as well as village officials, will look for ways to allow existing business districts to better compete with the Macy’s location as well as other shopping centers and online retailers. To do otherwise, would be bad for the Macy’s site, the downtown shopping districts and the communities that surround them.

PRODUCTION MANAGER Rosemarie Palacios

ARTS EDITOR Grace McQuade

EDITORIAL DESIGNERS Lorens Morris, Yvonne Farley

COLUMNIST Karen Rubin

CLASSIFIED ADVERTISING Peter Roberts

OFFICE MANAGER Holly Blank

ACCOUNT EXECUTIVES Stacy Shaughnessy, Melissa Spitalnick, Wendy Kates

COPY EDITOR Bill Dicke

ART DIRECTOR Jewell Davis

EDITOR AND PUBLISHER Steven Blank

ters and the Internet. What about the revenue lost? Find another way to finance your government not at the expense of local businesses. Local government also needs sensible, customer-friendly parking regulations. In one case – Great Neck Plaza – the mayor and trustees have discouraged dining in the villageby banning valet parking. They are the lone village in the Town of North Hempstead to do so. They also have many empty storefronts – including those formerly occupied by restaurants. The Great Neck Plaza business district, as well as other neighboring villages, might actually benefit from the people in the 355 rental apartments, office building and 200-room hotel planned by Macy’s and Brookfield Properties. With reasonable amenities such as valet parking and an improved infrastructure to enable new restaurants to open, the Macy’s project’s apartments, hotel and office building could become a new source of customers for downtown business districts. Macy’s and Brookfield Properties have another major advantage that villages and civic associations should consider – a coherent plan for an entire shopping district.

PUBLISHERS OF

Williston Times • Great Neck News Herald Courier • Roslyn Times Manhasset Times • Port Washington Times


Blank Slate Media Newspapers, Friday, July 12, 2019

15

KREMER’S CORNER

Trump fails test of time in 2 1/2 years

F

or almost three years, America has been witness to one of the oddest and most confusing spectacles in the past 50 years. That aberration is the tenure of Donald J. Trump as president. Depending on your age, most of our readers have lived under either a Bush, Clinton or Obama. We have seen them on their best days and their worst days and have drawn our own conclusions on what type of person we want occupying the Oval Office. Despite being a partisan, I have tried hard to understand what motivates Trump, what he has done and what he has failed to do. I have a number of friends who are staunch Trump supporters, but even they are weary and mystified over the conduct of a man who came to office as a real estate power, a television star and a candidate who pledged to make America great again. Trump supporters praise the rising stock market, low

unemployment and claim that the country was never in better shape than it is now. But I see an America that is more divided than when President Obama left office. His advocates talk about his legislative successes, but when you look closely, there are no Trump victories that emanated in the House or the Senate. He swore that he would not govern by executive order, but his every claim of success is based on some document he signed that was never approved by Congress. A great day on the stock market may help your 401-k plan, but nationally, wages for the common person or woman are stagnant. The Trump tax law enriched the one per cent of Americans and helped corporations buy back trillions in stock from the shareholders, but it didn’t help middle-class citizens with their struggle to survive. Unemployment is at an alltime low, but it was decreasing dramatically when Obama left

JERRY KREMER Kremer’s Corner office so the downward trend didn’t start on Jan. 20,2017, when Trump took office. Trump entered office sitting on a pile of pledges that he would “drain the swamp,” make everybody prosperous and would undo all the political evils of the past. Over 2 1/2 years he has seen many of his appointees resign due to conflicts of interest

and his so-called base is worse off now than ever before. Most of his key campaign aides have been convicted of some form of criminal acts and his Cabinet is made up of almost a dozen “acting” heads, due to the massive turnover in their departments. Can you name any successful deals that have been concluded under the Trump tenure? Reduction of the nuclear threat by North Korea? Last I looked Trump and the Korean dictator were still writing love letters to each other at the same time that Kim Jong-un is building new missile sites. Peace in the Middle East? Well into the Trump term, things have gotten worse in the Israel- Arab world. Pledges of cash to the Palestinians for development are useless without some type of autonomy. Remember all of the campaign promises to residents of the red states? At this point in time, farm bankruptcies are at an all-time high, coal mines are closing and manufacturing is

rapidly declining. New rounds of layoffs have eclipsed the promised jobs. The only business that seems to be growing is the sale of MAGA hats, the proceeds of which go to the Trump campaign. Can you name one recent president who used foul words or threw insults at a political competitor? Trump has reduced the level of political conversation to its lowest level in history. Every person who Trump dislikes is subject to taunts, name-calling and verbal abuse. Whether it’s a Bette Midler or Nancy Pelosi, no one is spared from the Trump tweet. One of the reasons former Vice President Joe Biden is leading in the polls is because voters view him as a welcome contrast to the current president. I am not a young man anymore and time is precious. But if the next 18 months went by in the blink of an eye, I would be very happy.

A LOOK ON THE LIGHTER SIDE

Family dialogue can be a mindfield

C

ommunicating with your nearest and dearest can be tricky at the best of times. For instance, one of my boys got very upset years ago when he thought I had threatened someone with a beating. “Mommy, who are you going to beat up here?” he asked in a tremulous voice. “No one!” I answered. “Whatever gave you that idea?” It eventually turned out that he’d overheard me talking politics with a friend. “We might lose the Senate,” I had apparently said, “but we’ll definitely beat them in the House.” It isn’t just me, confusion is everywhere. A friend told me that recently, with so many college graduates and world travelers home from school, she and her husband had called a family meeting. “We’re going to need some more rules,” she told them. “From now on, everyone has to be sure to leave the shower curtain open, so it doesn’t get moldy.” “You mean closed,” said her son. “No, I mean open,” she

said. “Closed is how it gets moldy.” “But that’s exactly why you should want it closed — so that it doesn’t,” he responded. This continued until one of the other children noticed that although the words sounded diametrically opposed, both mother and son were miming the same gesture for what should happen to the shower curtain — namely, two hands starting together but ending up far apart. “You both mean the same thing,” she exclaimed. “You’re just saying it differently. You, Mom, mean the curtain itself gets opened out, while my brother means that anyone looking at it from outside the shower would think the shower area is closed off.” “Exactly!” Mother and son said, together. Thank goodness they solved that one. Misunderstandings can even happen out of thin air. I was driving one of my boys somewhere, when he was old enough to sit in the front seat — say, 14 — but not yet old enough to drive. We came to

JUDY EPSTEIN A Look on the Lighter Side an intersection where a left turn would bring us to a traffic light that seemed always to be red. So I turned right, planning to go the long way around the block and avoid it. But the move puzzled my son, who knew that our ultimate destination lay to the left. “Why are you going this way?” he asked me. “To avoid the light,” I replied. Puzzled, he looked up at the cloudless sky. “Um, how, exactly, is that supposed to work?” It took me several days to

figure out that it seemed to him as if his crazy mother was planning to outwit the sun. Eventually, this boy went to college and was finally about to graduate. His university, in its infinite wisdom, announced that commencement would be held in its open-air football stadium…come rain, shine or thunderstorm. I packed for the worst: three ponchos, two umbrellas, two binoculars, and one waterproof portfolio for the diploma. The only thing that would carry it all was a college backpack. It made perfect sense to me, but it did not impress the guard at the stadium entrance. “No backpacks,” she barked. “There was nothing from the university about backpacks,” I protested. “It just said ’stadium attire.’ I only need this because of the rain. Here, see for yourself.” And I unzipped every zipper, opened every compartment and gave a guided tour of everything inside. The guard was adamant. “No backpacks,” she snapped again. “Then what am I supposed to do with it?” I wailed.

“You’ll have to check it,” she said.“Over there.” She waved her hand, away from the stadium, toward the whole rest of the campus. “No can do,” I said. I was afraid that if I wandered off in search of the mythical bag check, I might miss my child’s entire graduation… which wasn’t an option. On the other hand, I am no longer young enough for sprinting nimbly past stadium guards, so I stood rooted to the spot. Finally, someone came to their senses and let me in — bag and all. But recounting this story later, to the newly minted graduate, he had only one question for me. “Why didn’t you just let them check the bag?” he asked. Boom! Twenty-five minutes later I was still in mid-rant about why I couldn’t, shouldn’t, wouldn’t “just check the bag,” when it became clear he thought I had simply refused to let the guard look into it. “If only!” I said, and ranted on. It would have been easier to avoid the light.


16 Blank Slate Media Newspapers, Friday, July 12, 2019

ALL THINGS POLITICAL

Canceling student debt a bad idea

T

he recent Democratic presidential debates made one thing clear: cancelling outstanding student debt is on the table. U.S. Sen. Elizabeth Warren wants to wipe away $640 billion in outstanding loans, while U.S. Sen. Bernie Sanders would like to cancel all $1.6 trillion in student debt now on the books. As attractive as these proposals may sound, they are a mistake. Here’s why: First, loans when cancelled, don’t vaporize into thin air. In fact, legislation freeing student debt would transfer this financial burden to the American taxpayer. The deficit would then go up by roughly $1.6 trillion. That’s $1,600,000,000,000! The interest on the additional debt service alone would cost taxpayers, who didn’t take out college loans, over $30 billion per year. Second, wiping out student debt sends a message that accumulating debt isn’t a concern, because the government will save you. Use the 2008 mortgage crisis as an example. If all student loans suddenly disappeared, students and parents working several jobs

to pay for college educations, would discover this had been a waste of time. And what about the grandparents who have emptied their retirement accounts? The message being sent by some Democratic presidential hopefuls is this: Those who scrimped, saved and budgeted wisely to pay for college were foolhardy. Finally, if the government forgives student debt, where will the funding come from for other initiatives, like Universal Health Care? Where will the $3 trillion come from to fix America’s roads, bridges and drinking-water systems? Where will the federal government find funding for Social Security and disability before they go bankrupt? The United States already runs a trillion-dollar annual deficit during a strong economy. In other words, funding even one of the aforementioned initiatives would be difficult, especially during the eventual recession. What I don’t understand are the poor choices students make by running up $100,000 or more in undergraduate student debt. For New Yorkers in particular, going to a local community college for

ADAM HABER All Things Political two years and a top-notch SUNY School for two more, would cost a total of $65,000, which is what a private university’s tuition with room and board is for one year. Is going to a private university a better value and going to improve your future pay several times more than a state school? I don’t think so. Your average 18-year-old students can’t comprehend what the debt service is on a $100,000 student loan, or how that will affect

their future ability to purchase a home, save for retirement or even start a family. The standard repayment plan for a student loan is for 10 years but studies show the average bachelor’s degree takes 21 years to pay off. To pay off a $100,000 student loan at 6 percent over 15 years would cost $844 a month, which is over $10,000 a year of after-tax income. If the federal government can now borrow at roughly 2 percent, which is the current interest rate on the 10-year bond, why isn’t our government initiating student loans at the same interest rate? The difference in payments between 6 percent and 2 percent interest on a 15-year, $100,000 loan is $200 per month. Here’s a better solution to the student debt problem: the interest accruing on student loans could be frozen or even wiped out if borrowers can prove they are struggling to make payments, but the principal borrowed must eventually be repaid. That’s the very least that should be expected when a loan is taken out. Here’s another suggestion:

there should be a mandatory Intro to Finance class given to every high school senior. The curriculum should include costs of loans with different interest rates and payment schedules, the negative effects of poor short-term spending habits, suggestions for smart choices necessary for prudent long-term financial planning, and how to apply for every possible college scholarship out there. A prospective college student should have a thorough understanding of the future sacrifices that may need to be made to pay back outsize loans. Presidential hopefuls like to put forth initiatives where everything is free, such as wiping out outstanding student loans. They will offer anything they can in the hopes of getting elected, and let future generations worry about how to pay for it. Unfortunately, student debt needs to be paid back. Regardless of how attractive these candidates’ magical thinking may sound, the consequences for abandoning debt are real. Student debt doesn’t magically disappear on its own.

VIEW POINT

Climate crisis demands mobilization With all the coverage of the athe moon landing, I just realized what was missing from applying an Apollo Mission-level intensity and a World War II-scale mobilization to solving the most pressing, existential crisis this nation faces: climate change. Both the Race to the Moon and World War II mobilizations were propelled by the need to beat an enemy – Russia for domination of space and fascism in World War II – which overcame the knee-jerk responses of “too expensive” or “too disruptive” to society. Instead, solving the climate crisis requires cooperation – partisan cooperation and global collaboration. And that’s where it all broke down under Republicans going back to Former House Speaker Newt Gingrich and Trumpism. (Moment of nostalgia: Just 2 ½ years ago, we had a president, Barack Obama, who led the nation and the world to the Paris Climate Accord and implemented significant steps toward transitioning from a carbonbased economy to one fueled by clean, renewable energy.) So much these last 2 ½ years has felt so surreal, but none more than the back-to-back press calls I had: the first with EPA Administra-

tor Andrew Wheeler and Council of Environmental Quality Chair Mary Neumeyer, who were giving a preview of the speech Trump was about to give. The theme, “America’s Environmental Leadership Under President Donald J. Trump.” (gag) Laughably, Wheeler used as his measure of Trump’s masterful leadership the statistic that from 1970 to 2018, the combined emissions of the most common air pollutants fell 74 percent while the economy grew over 275 percent. The 1970 starting point pre-dated the Clean Air and Clean Water Acts and the EPA, His example of global “leadership” was that Trump withdrew from the Paris Climate Accord, which, he said, was unfair to U.S. trade. Mary Neumeyer, for her part, repeated at least four times the mantra that Trump “recognizes a strong economy is vital for environmental protection” – not that environmental protection is vital for a strong economy. The next day, U.S. Sen. Bernie Sanders (I-VT) and U.S. Reps. Alexandria Ocasio-Cortez (D-NY) and Earl Blumenauer (D-OR) held a press call about their plan to introduce a resolution declaring the climate crisis a national emergency

KAREN RUBIN View Point warranting massive-scale mobilization on the level of World War II to urgently halt, reverse, and address the consequences of climate change. Blumenauer compared the absurdity of Trump declaring a “national emergency” to justify building a wall on the southern border to the real national emergency of climate change – 93 degrees in Anchorage on July 4, record heat waves in Europe (113 degrees in Paris), record drought in Oregon, flooding in Nebraska, wildfires in California. “The U.S. has only 12 years to reverse global warming. It’s time for Congress to understand

this is an emergency and act like it,” he said. But there is, in fact, a connection between the refugee crisis here in Europe, Syria, Africa, and Latin America. People are escaping the political and economic turmoil which has as a root cause the climate catastrophes that are leaving people destitute and desperate. By mid-century, it is estimated there will be 150 million climate refugees – dwarfing the record 66 million refugees today. And that’s what the world has to look forward to – not in centuries or generations, not even in decades, but unfolding now. Margaret Klein Fellerman, founder and executive director of The Climate Mobilization (https:// www.theclimatemobilization. org/), said, “Global warming is accelerating and will cause the collapse of civilization this century if we fail to move toward zero emissions in years, not decades. A WWII-scale mobilization is necessary to reverse global warming and the mass extinction of species in order to protect humanity and the natural world from climate catastrophe.” Alan Minsky, executive director of Progressive Democrats for

America, said, “U.S. federal government leadership on this issue is necessary for the world. The U.S. has an outsized obligation, not only because we have the world’s largest carbon footprint, but also the balance of the world’s scientific research capacity and its brain trust. The American university system is unrivaled – the development of technology should be here.” More than 700 governments in 16 countries have already declared a climate emergency, including New York City. And if there has been any progress in the U.S., which Wheeler credits to Trump, it is because 26 states and U.S. territories have formed their own United States Climate Alliance, committed to upholding the 2015 Paris Climate Accord. Collectively, they represent 50 percent of the U.S. population. If the U.S. air and water quality has improved and carbon emissions been reduced, as Trump boasts, it is because of their efforts, certainly not overturning Obama’s standards for car fuelefficiency or coal plant emissions, or opening fossil fuel extraction on public lands. These are Trump’s only “policy” contributions. The money is there. Continued on Page 60


Blank Slate Media Newspapers, Friday, July 12, 2019

17

E A R T H M AT T E R S

Healthy soil helps immune system

P

residential candidate Marianne Williamson said during the first Democratic debate “we have a sickness care system in the United States. We just wait until somebody gets sick and then we talk about who is going to pay for the treatment and how they’re going to be treated … It gets back to not just big pharma, not just health insurance companies, but it has to do with chemical policies, it has to do with food, it has to do with drug policies, and it has to do with environmental policies.” I don’t think that Williamson should be our next president, but I do believe that she is making a good point and some politicians, scientists, and engaged citizens are addressing or have tried to address these issues. Unfortunately, it’s human nature to act only once something has happened, once a sickness has struck. And it certainly doesn’t help that a sick patient is more lucrative than a healthy one. On the other side, the National Cancer Institute says that

“making strides in cancer prevention is not only a public health imperative, it is also an economic imperative. By 2020, the United States will spend an estimated $174 billion each year on cancer care.” So why is it that research into cancer prevention receives only a fraction of cancer cure investments and only focuses on areas such as nutrition, physical activity and tobacco use? There is no mention of environmental exposures such as engine exhaust, pesticides, and other chemicals, like the exposure of many Long Island residents to chemicals such as 1,4-dioxane that currently have no standards set for maximum levels allowed in our drinking water. We all know that our government is not a corporation, nor should it be. But it should take a page out of the corporate playbook, find the root cause of this $174 billion problem and eliminate it. It won’t be fast, but we will never find a cure if we don’t start looking more diligently at

JULIANE SAARY-LITTMAN Earth Matters causes. And this strategy should be applied to a lot of different illnesses. Let’s not rely on our government. There are a couple of steps we should do to address those root causes: First, and you probably have already heard this, support public officials who recognize prevention as a major cost saver and are pushing for environmental exposure limits that will keep us healthy.

Second, when you hire somebody to take care of any part of your home, like cleaning services, painters, or landscapers, make sure to ask them about the cleaners, paints, fertilizers or pesticides they are planning to use on your property. And don’t just believe them when they tell you that all products used are perfectly safe. Do your own brief research to confirm their statement, just to be sure. Especially if you have young children at home and the service is part of a franchise with an outof-state head office as some may follow their more lax home state safety standards. Finally, we all need to recognize the long-term health benefits of not only eating healthy, but also supporting farmers and landscapers that keep our soil healthy. Simply put: Healthy soil -> healthy plants -> healthy people. Scientists have found that letting children play outdoors in the mud, aka healthy soil, is the best way to ensure they develop a strong immune system and fewer incidences of sickness or diseases

such as asthma. Healthy soil is so important for life on Earth yet so poorly understood or appreciated. Science and technology brought us the “green revolution:” chemical fertilizers, pesticides, herbicides, super-sized tractors, genetically modified crops adapted to agricultural chemicals. What is rarely apparent is the damage this is causing to the soil. Let’s all stop using synthetic pesticides and fertilizers, and let’s buy organic produce which has been grown in healthy soil whenever possible. It won’t break your bank, especially if you eat with the season. I am a strong believer that in the long run eating organic will save you a lot of money by avoiding those sky-high medical bills and missed work or school days. You could even consider it your personal contribution to eliminate the $174 billion problem. I look forward to seeing you on Saturday mornings at Port Washington’s own (organic) Farmers Market at the Town Dock.

KIDS F IRST

More transparency from health insurers I was pleased to represent North Shore Child & Family Guidance Center as part of a significant advocacy effort, along with a broad array of mental health and substance use providers and consumers across New York State, that led to the December 2018 enactment of the Mental Health and Substance Use Disorder Parity Report Act. The new law will require commercial health insurers to submit key information to the state Department of Financial Services for analysis and evaluation of compliance with federal and state parity laws. The intent of this provision of the new law is to advance the need for greater accountability and transparency. Until now, existing parity laws – which demand that coverage and treatment for mental health and substance use disorders are on par with the coverage and treatment of physical

illnesses – have been widely ignored, putting lives at risk. The failure to enforce parity laws was made clear in January 2018, when the Guidance Center released Project Access, a Long Island-wide study on the difficulty or ease in which families were able to access healthcare for mental illness and addiction. You can access the full report on the center’s website, www.northshorechildguidance. org; click on the Project Access tab. This new legislation, which was passed one year after the release of Project Access, is a shared success and would not have been possible without strong grassroots support that included the generation of an enormous volume of letters, calls and social media posts from advocates. The challenge ahead will be to hold the DFS accountable, ensuring that they are taking adequate steps to verify the

ANDREW MALEKOFF Kids First data and information that will be provided to them by health insurers. Verification is essential to determining, for example, if the networks of providers on a health insurer’s plan are in fact real, as opposed to deceased, retired or no longer accepting insurance. They must also verify and report when waiting lists of valid providers are so long that access is delayed beyond a rea-

sonable time with respect to the urgency of the need. Before a recent client of ours found the Guidance Center, she told us a provider that was part of a large hospital system told her that the wait for an appointment for her teen was six months – and this was a girl in urgent need of care. I’m proud that at the Guidance Center we see emergency cases within 24 to 48 hours, and no one is turned away for inability to pay. One reason for the paucity of mental health and drug treatment providers is the substandard rates of reimbursement that health insurers pay such providers, as compared to what they pay physical health care providers. This must be exposed and corrected if found to be the case when access to care is denied. In addition to this promising advancement in New York state, this past April a federal court in the Northern District

of California found that the giant health insurer United Behavioral Health had been using flawed criteria, contrary to generally accepted standards, to determine medical necessity for the care and treatment of patients with mental health and substance use disorders. This decision fires a powerful warning shot at all insurance carriers who cut corners in determining medical necessity without regard for quality of care, and whose sole aim is enriching themselves at the expense of their beneficiaries living with mental health and substance use disorders. Now, according to leading mental health advocate and former Congressman Patrick Kennedy, a federal court is making it clear that there will be consequences for disregarding established standards of quality care in favor of a financial bottom line. We are making progress.

For the latest news, visit us at w w w.theislandnow.com


18 Blank Slate Media Newspapers, Friday, July 12, 2019

READERS WRITE

Accused of helping the undocumented

L

ast week, I wrote about Scott Warren, who provided food, water and medical services to migrants who were fearing death in their native lands. I was interested in knowing more about Scott Warren and his work. I learned that he was 36 years old and worked with an organization called “No More Deaths.” Government prosecutors Nathaniel Walters and Anna Wright said he was the “hub” of a conspiracy at his recent federal trial in Arizona on charges of aiding undocumented immigrants. Ross Carroll, writing in The Guardian, pointed to other charges against Warren including “driving in a wilderness area, entering a wildlife refuge without a permit and abandoning property,” the latter an apparent reference to leaving water, food and blankets. The absurdity of these charges would be laughable if the punishment weren’t so serious. Warren also instructed new

volunteers on distributing “harm reduction kits.” These consisted of chlorine to purify water, ointment for blisters, combs for removing cholla cactus spines, and a list of emergency numbers including 911. Do these actions sound like they are designed to shake the foundations of our republic? Supporters of the “orange Satan” make the following argument: The migrants make a conscious decision to come north and by so doing violate U.S. law. Strict law enforcement will deter others from risking their lives in a fruitless endeavor. There is no evidence to substantiate this claim. There is a name for this policy. It’s called zero tolerance. “Trumpites” can make the case that without borders we would be inundated with hordes of illegal immigrants. And as our president has stated, the illegals enter the U.S. carrying drugs, bringing disease and form gangs which commit serious crimes. The final argu-

ment is that it is unfair to all the legal immigrants who played by the rules. The Center for Constitutional Rights points out that zero tolerance “is meant to be cruel…to punish families. It is intentionally inhumane.” The Southern Poverty Law Center states “the administration’s callous ‘zero tolerance’ policy ‘…ripped apart thousands of families at the border as they sought safety in the United States.'” One should also question the administration’s argument about disease and gangs. Most seeking safe harbor in the U.S. are law-abiding and hardworking. At least six children have died while in U.S. custody. This catastrophe could have been avoided if more money had been allocated for processing migrants. Instead of building walls, we might think about ameliorating the economic conditions in Central America which lead to the “caravans.” Finally, it is hard to believe POTUS when he, accord-

ing to the Washington Post, has lied or exaggerated over 10,000 times since taking office. Having said this, one of the lessons we can learn has to do with the ends/means relationship. Democracies do not believe that the ends justify the means. In Warren’s case, our government’s end – to stop illegal entrants – may be legitimate, but the means (zero tolerance) aren’t. Dictatorships hold that using horrific means to achieve noble ends is acceptable. After the Russian revolution, the Bolshevik government murdered 4 million Kulaks who would not give up their land to collectivization. The Bolsheviks were willing to employ whatever means necessary to achieve their end. So, there must be limits as to what is permissible. During Vietnam, the U.S. condoned “waterboarding” as a means of extracting information from the enemy. This led to a national debate as to whether torture was permis-

sible. It flew in the face of everything this country stands for. It was argued that we were employing tactics more appropriate in autocratic regimes. Once we abandon time-honored principles this nation has stood for, we are no better than our enemies. And there is the admonition of Jesus: “What is it worth to gain the whole world and yet lose your own soul.” When Scott Warren’s trial ended in a hung jury, his attorney, Greg Kuykendall, issued a statement which puts the trial in a larger, historical context. He said, “…as a nation we have a long and consistent history of demonizing… those we fear. But just as deep and ever-present in America is a contingent of people – always a minority at first – who are resolute people of conscience. People who love, honor and respect all other people, regardless of race or status…” Dr. Hal Sobel Great Neck

Celender’s folly wreaks havoc on Plaza

C

alamity Jean rides again. Mayor Jean Celender’s ill-conceived TEP project has not even been completed, yet it already has created a monster much larger than the congestion and inconvenience to all the drivers, shoppers and residents who live in and pass through this area. In the past two weeks, there have been two vehicular accidents on the streets in front of the stores and two acts of overnight vehicular vandalism (July 2 and July 3) – one on a car and the other on a motorcycle – both of which were diagonally parked across from the post office, in close proximity to a non-working village lamppost in front of 8 Welwyn Road. Our car was one of the vehicles that was vandalized. It was not a “professional” job; after inspection of the damage, we were told that the vandalism was clearly done by amateurs. Maybe someone was “unhappy” that on that night we had the nerve to take away one of the parking spaces on the block that is “reserved” for Shop Delight’s employees. Or maybe someone was “unhappy” that we have openly and repeatedly asked our mayor for proper oversight of the non-resident, illegally

parked Shop Delight employees – to no avail. Or maybe the vandalism to our car was just coincidental. Shop Delight’s conditional use permit prohibits their employees from parking on the streets adjacent to the store. Celender has brazenly ignored the terms of the permit by allowing the employees to usurp as many spaces as they can on Welwyn Road, as close to the store as possible, for as many hours as they wish, without fear of parking tickets to the employees or retribution to the store. Our hypocritical mayor has made it impossible for residents of the area to find parking on our block while Shop Delight is open. That’s not new news. Everyone already knows that Jean Celender doesn’t care about the residents (e.g. the promise of the resident garage that was most recently breached) unless she can reap some personal gain. However, this time, her lack of concern for residents has given us a concrete reason to hold the mayor and the village responsible for the vandalism to our car. As of this writing, the village street lamp in front of 8 Welwyn Road has been out of service for over five months. We have per-

sonally reported this outage to the village multiple times, asking for it to be repaired, because the street is too dark without it. However, the non-working lamp is situated in front of a residential building. Therefore, in keeping with the mayor’s modus operandi, this repair garners the lowest possible priority because it would mainly benefit the residents of the area. Yet nothing has been spared by the village in the creation of this mayor’s ill-conceived, million dollar TEP atrocity. On the night that our car was vandalized, it was parked adjacent to that non-functioning village street lamp in front of 8 Welwyn Road; the situation was the same for the motorcycle vandalized on the following night. Because the area was very dark, the felon(s) could not be seen. Had the lamppost been repaired in a timely fashion, the vandal(s) would have been easy to spot. For that reason, we believe that the mayor and the village are responsible for vandalism that might have been prevented had there been adequate light on the street. The recent accidents and vandalism in the Welwyn/ Shoreward area since the TEP installation began are just the

tip of the iceberg. Unfortunately, there will be more of the same. For example, the mayor had pictures of bicycles stenciled onto the streets directly in back of the parked cars in front of the stores and directly in front of the post office where the buses turn. No bicyclist who values his life would ever attempt to ride there (or anywhere else in this area). And for this reckless assault on the lives of her constituents, the mayor collected big bucks in grant money. Jean Celender never responds to letters and emails. For that reason, Jay and Judy Linden spoke out in an open letter to Mayor Celender in the June 28 issue of the Great Neck News, adeptly calling her TEP project “ill-conceived, problematic and out of step with the needs of the community” and “a perfect match to your tenure as mayor.” In last week’s Great Neck News, Monica Braunfeld’s article asking for mayoral term limits did a praiseworthy job spelling out the best and worst characteristics of public servants, and she didn’t mince words when asking residents how much longer we are expected “to live under this regime of insanity,” with a plea to residents to wake up to “the disastrous impact this

mayor has been continuing to impose on GNP.” Sam Yellis’ article in last week’s Great Neck News shed light on the empty store issue in the village during a symposium which dealt with revitalization planning. He wrote an impassioned plea to reimagine a village “where we can cross Middle Neck Road, where pedestrians’ lives matter, where people are a priority, not cars, where bicycles and bicyclists are respected…” Jean Celender was not in attendance at the symposium. Where is the knight in shining armor who is ready and able to slay this dragon next March? We need you! Imagine our community if we had a mayor who actually cared. And we need plaza residents to get involved to make it happen. Remember Ben Franklin’s Revolutionary warning: “We must all hang together, or assuredly we shall all hang separately.” The message is still valid today. It’s time for the Jean Machine Regime to go. Muriel and Leo Pfeifer Village of Neck Plaza (We want our “Great” back!) Letters Continued on Page 50


Blank Slate Media Newspapers, Friday, July 12, 2019

19


20 The Great Neck News, Friday, July 12, 2019

GN

“ Words of Wisdom From G.N. Grads”

Michael Lu, South High valedictorian

Administration, faculty, staff, guests, distinguished guests, undistinguished guests—you know who you are… siblings, parents, grandparents, greatgrandparents, greater-grandparents, alumni, and my fellow classmates. Congratulations, you’ve all made it—to the end of this ceremony. All that remains between you and summer vacation is this speech, which I plan to make as long as possible… You’re welcome. You know, four years ago at Great Neck South, we started from the bottom. But now we’re here. In this school, we’ve experienced so much change; we’ve endured tragedy—such as the removal of the App Store on school iPads—and we’ve experienced triumph—such as student toilet paper going from quarter-Ply to half-Ply. In four years, our environment has transformed immensely. In addition, we, along with our aspirations, have likely changed as well. I realized this when attempting to write this speech. After receiving the

dreaded email that I was required to speak at graduation, I decided to tackle the task with the great work ethic that helped me survive high school, so I immediately began, at 2 a.m. last night with pencil, paper, and two cans of Red BullTM. To be honest, I was pretty desperate for scraps of inspiration, so I ended up consulting the middle school yearbook, and after looking through all the pictures of my classmates, and laughing at most of them, I found all the signatures at the back of the yearbook, and one stood out in particular: “Dear Michael, though you are single, and will likely be for the rest of your life, your work as a physics guru and a communist is admired.” signed Stephen Xia. Well… Four years later, I’m still single, but I’m not a communist, and after a year of physics with Mr. “HeWhoShallNotBeNamed”, I can safely say that the black magic known as physics is not my forte. It’s safe to say that I’ve changed a lot over the course of four years; in fact, we all have. We’ve given up braces, NokiaTM phones, bangs, and light up SketchersTM and acquired comb overs, and, for the lucky few, TimbsTM. For some of us, we’ve quit MinecraftTM and got hooked on FortniteTM. Instead of spreading butter on our breakfast toast, some of us now use avocados. And many of us have picked up an addiction to StarbucksTM coffee and Red BullTM. And finally, many of us are now part of the esteemed 1% because we own Airpods.

But we’ve also taken these four years to explore and eventually establish a foothold on a passion that we wish to pursue—whether it’s for art, science, athletics, engineering, or business. At this point, convention begs me to deliver the trite remarks, “Follow your dreams, you, future engineers, entrepreneurs, artists, lawyers…” But nah… I’m not gonna do that. Because the truth is, graduates, who we are today may not be who we are in another four years. We all remember how as freshmen, we’d sample ten different extracurriculars and then abandon eight and a half by the time we were seniors. Whether we continued with or quit DECA, Key Club, science research, robotics, track and field, or debate—the list goes on, it’s pretty likely that what we wanted to do in September of 2015 isn’t what we plan to do today. Similarly, what we plan to do today may not be what we plan to do when we graduate college. It’s common to realize how much we’ve changed in the past, but it’s less common to anticipate how much we will change in the future. Some of us who think we want to be engineers or doctors or artists right now may very well choose a different occupation in the future. Just as our aspirations may have transformed during high school, they could do the same in college. Sure, the world is currently begging us to quickly find solutions to its many problems: climate change is getting worse, student debt is bigger and better than ever, and Iron Man is dead. It’s a

scary world out there, one that needs fixing. However, we might not be “changing the world” in the next four years because we may be busy changing our goals. But there’s nothing wrong with taking a while to settle on a path that we’re truly passionate about, and more importantly, doing so doesn’t bar you from success. Take for instance a computer programmer on Wall Street who left his job to start an online sales company called Amazon. Or a young actor from Illinois who decided to become the 40th president of the United States. Or an Irish coffee farmer who decided to become an English teacher named Mr. Graham. We shouldn’t be afraid or ashamed of abandoning an old dream for a new one. Let’s not let our past constrict our future. Especially for young people like us, there’s enough time in life to switch our direction and still excel while contributing to society. There’s no bigger cliché in a graduation speech than to “follow your dreams”, and while it’s not terrible advice, I feel like there’s much more to it. Class of 2019, in the next four years and in the many years after, let’s pursue our goals with determination but be willing to change them with conviction. It’s true that many of us can never be sure where we’ll end up in the future, but we shouldn’t be afraid of how our aspirations may switch course; we should embrace it, and follow them wherever they take us.

Riding the waves of life: Rachel Schneider

Good afternoon and welcome! I am sure my classmates remember our first day at South High. We wondered would we be able to find our way around such a daunting building, what would our high school teachers expect of us, and would those intimidating 12th graders in their white tank tops direct us to the non-existent “third floor.” Congratulations! You successfully made it past that frightening first day, and have ridden the waves of South High.

After delving into this year’s graduation theme, “The Wave of the Future,” I’ve discovered there are two different types of waves that we have encountered in our lives. First, the dangerous tidal wave, the one we fear will crash over us and knock us off our feet. The second is the rolling wave, the calm swell we can float over with ease. I think we can agree that our high school experience can be categorized as full of both of these waves that we will never forget, no matter how much we want to forget some of the tidal waves. Our tidal waves possibly included losing the Student Government election, a first public failure, or receiving that disappointing score on our first freshman English quote ID test, an indication that high school would be more challenging than expected. Both of these obstacles left us discouraged, struggling to stand tall as the waves came crashing over us. But our rolling waves of winning the gym speedball tournament or simply finishing a Graham guide a whole day early

complemented these disappointments and kept us going, allowing us to enjoy moments of success. As we move on, we are far more equipped to face the waves ahead not only because of these incomparable experiences but also because of all of those who have stood by us through the many waves—our lifeguards. They knew when to let us swim on our own but also when to jump in when we needed assistance, all the while supervising us to avoid injuries. It was after these crashing tidal waves and during the rolling ones where we were able to experience our greatest growth and learn the most about ourselves as we worked to stay afloat. South High is truly a special place for encouraging us to step outside our comfort zone and to dive right into the next oncoming wave. The people at South are the biggest factor in making it such a special place, and without them it would just be a building of brick and mortar. While we have experienced these two waves in high school, we are off to

encounter another, new one. The last wave is the all encompassing, forceful power-wave that you see surfers prepare all their lives to ride. As our high school waves recede, we can see that energizing third wave building on the horizon, gaining power, as our future endeavors approach. Thanks to South, we are prepared and finally ready to take on this WAVE OF THE FUTURE that is full of so many new possibilities. As the famous author and aviator Anne Morrow Lindbergh once said: “The wave of the future is coming and there is no fighting it.” We are armed with the skills to carve it up and ride it to shore. While we began high school as those frightened freshmen, next to me now sits an incredible, inspiring class ready to conquer the world ahead of us, but the real question is…is the world ready for us? The horizon is the limit as we surf into the future. Thank you all for being here and for wishing us well as we enter the next chapter of our lives.


The Great Neck News, Friday, July 12, 2019

GN

21

Yoel Hawa, North High and the ‘Endgame’

Hello Seniors! This is the last time we’ll be hearing those words until four years from now! Well, we did it! I’ve been looking to 2019 for a long time. I knew that this year would be our grand finale. I knew that this year would finally bring the end…of Game Of Thrones. And the end of the Marvel movies as we know them, and the Star Wars movies, and The Big Bang Theory, and so many things that I love. And I’m missing one…oh right, and the end of our time in high school. I always thought it was fitting that 2019 would be a year of so many cultural endings. This year closes a chapter on the top two highest-grossing film franchises of all time, the most watched network TV series, and the most popular show in the world. And we will all be closing our current chapter alongside them. So, what

can we learn from all these simultaneous graduations? First of all, these cultural phenomena all ended with a big bang, if you will. The Big Bang Theory soared to new highs in terms of viewership, and secured its legacy as a top comedy show. Avengers: Endgame broke records to become the highest-grossing film domestically of all time, and was loved by everyone that saw it. And Game of Thrones…well, it tried. The point is, as these things ended, they left behind their marks on the world. In much the same way, as most of us move on to college next year, a part of us is always staying behind in various forms: the influence we have had on our parents and siblings at home, the friends that we’ve impacted that are still in high school, the teachers that we annoyed so much with our senioritis that they will never forget us, and so on. And yet, if you look closely, you’ll see that none of these so called “endings” is really ending at all. The Marvel Cinematic Universe is already moving on with its next phase. Disney has already begun to work on what comes next after Star Wars: Episode IX. The Big Bang Theory already has its own spinoff, and Game of Thrones might have as many as five spinoff shows to disappoint fans with. The parallels to us are pretty clear: this is not the end for us, just the end of our cur-

rent chapter. And now, we are ready to start our new life out in the world with the proverbial million dollar check that was promised to us four years ago finally in our hands. And no, sadly we cannot use that check to pay off our college debt. Now, I know I’m supposed to give some advice for this future I speak of in this speech, but let’s be honest, how am I, who’s at the exact same point as everyone on this stage, qualified to give any advice for our future? So instead, I’m going to draw on the wisdom of one of my personal heroes that’s also closing a chapter this year, someone that I even came to school dressed up as this year for Halloween. I am talking about Iron Man. This inventive, technology-minded genius always manages to find a solution to every problem he faces, and though I wrote this speech before seeing the newest Avengers movie, I can’t wait to see him in countless more movies…oh uh…nevermind. Anyway, in the first Iron Man movie, as he is preparing to go on his first test flight in his new suit, he tells his artificial intelligence butler, Jarvis, that “sometimes you gotta run before you can walk.” Though that line was intended to be humorous, and definitely a twist on the old saying, I actually think that it is a perfect piece of advice for us as we move

on to this very important time in our lives. Don’t get me wrong, sometimes it’s important that we move with care, that we carefully crawl, then walk, and only then break into a run. But sometimes, we should make like Tony Stark and go straight for the sprint. And if we do that we will probably fail. Many times we’ll go for that run and land flat on our face. But we just have to get up, dust ourselves off, and use what we’ve learned to try again. And sometimes, just sometimes, our risks will pay off, and we’ll be successful. So, I say that we run first. Run into new things and new opportunities. If we don’t land on our feet, then we’ll just get up and run somewhere new. Take risks, innovate, create, and lead the world of tomorrow. If we have faith in ourselves, then there’s no telling what we’ll be able to accomplish. Our time starts now. This isn’t even remotely the end. Well, of the speech yes, but this isn’t the end for us. This was just our prequel, our superhero origin story, our episodes one through three. And now, it’s time for us to use all that we’ve been soaking up for the past four years. It’s time for us to no longer crawl, or even walk. It is time for us to show the world all the incredible places where this Class of 2019 is going to run.

David Carbone’s Sally Passarella tribute

Good afternoon, everyone. My name is David Carbone, and I’m standing up here today because Mrs. Sally Passarella truly changed my life. Allow me to explain how. Mrs. Passarella was my English teacher during junior year. As you would expect in an English class, we did a lot of reading and we did a lot of writing. We also had to do the dreaded oral presentation. Lots of kids get nervous before having to stand up and speak in front of the whole class, but my nervousness knew no bounds. In the days leading up to the presentations, I found it hard to focus on class work, even in other classes. When the presentations started, I could barely

listen to anyone else because of the fear that I would be next. However, not getting called on one day was actually worse because the cycle would start again the next day. Ms. Passarella became aware of my situation and pulled me aside one day after class. She told me to relax because she wasn’t going to decide my overall grade for the quarter based on how I performed in front of the class. In fact, she said that if I was that uncomfortable presenting in front of the class, I didn’t have to do it. Instead, I could go to her office during a free period and give my presentation in front of just her and another teacher. I was blown away by this offer. Mrs. Passarella was the dean of students, she taught several English classes, and she probably had a lot of papers to grade, but she still found time to accommodate me and my fear. No other teacher ever made such an accommodation for me and I took her up on her offer. It was much easier for me to give my presentation this way. If this was all she did for me, it would have been enough. But when my presentation was over, Mrs. Passarella heaped praise on me and said it was too bad the rest of the class didn’t get to see it also. A few weeks later, Mrs. Passarella

brought me into her office and suggested that I consider being one of the morning announcers during my senior year because she thought I would be good at it. I was flattered that she thought of me but was also kind of confused. I reminded her that I couldn’t even speak in front of my English class and said I didn’t see how I could possibly address the entire school. She encouraged me to try it, saying that it would be a good way to overcome my anxiety over public speaking, and reassured me that if I did not enjoy it, I wouldn’t have to continue. I didn’t want to disappoint her, so with some hesitation, I agreed to try it out. When my senior year started, Mrs. Passarella wasn’t well enough to come back to school. Armed with a copy of Mrs. Passarella’s yearbook photo that I propped up in front of me, I went into the announcement room and stood in front of the microphone. I joined two other announcers—both of whom were more comfortable than I was—and gave a portion of the announcements. And…I loved it. So I continued to do it day after day, and I started to get more and more comfortable at the mic. I began ad libbing and tossing in jokes and snarky comments. I’ve also had to give some oral presen-

tations throughout my senior year and, while I’m not going to say that every one of them was amazing, what was amazing is that instead of being anxious for days on end, I would actually look forward to my turn. Because they have to hear me every day on the announcements, some of the teachers and staff started to call me “The Voice of Great Neck South.” I have to admit that I love hearing that—but it was Mrs. Passarella who helped to share that voice with everyone. So, as I started off by saying, the only reason I am up here today is because of Mrs. Passarella. The only reason I am up here—addressing all of you on a stage at the Tilles Center—is because of the positive impact that Mrs. Passarella has had on my life. And sadly for me—and for the entire Great Neck South community—the only reason I am up here is because Mrs. Passarella is not here with us today. Great Neck South was an immeasurably better place because of Mrs. Passarella. I’m just one of the many students whose lives she touched over the years and I know that I speak for all of us when I say that, while we will continue to miss her, the lessons she taught us and the changes she has made on our lives will live on in all of us.


22 The Great Neck News, Friday, July 12, 2019

GN

‘On the Beach’: Lucien Wostenholme

Students, teachers, administrators, parents, and guests—thank you for being a part of the Class of 2019 graduation ceremony. Right now, even looking out into the audience and standing amongst this sea of blue gowns, I am still just overwhelmed that I am able to stand on the same stage where the Disney Junior Dance Party took place in February. Now picture the scene: it’s the summer of 2006, just before the start of kindergarten at E.M. Baker. My grandpa and I, standing before a vast lake, scan the rocky, algae-strewn shoreline for stones. Despite the cloudy, foggy grey sky, we immerse ourselves in the natural world— fully mindful and present in the moment. I watch carefully, absorbed in an aura of youthful wonder, as my grandpa examines the stones with great thoroughness and care, weighing each one in his hands, poring over their potential and their individual qualities. Then, with incredible yet subtle touch, he skips them seven, eight, nine times—lightly skim-

ming the glassy water with neat, orderly ripples. Even without knowing most of my future classmates, save for a few from preschool, it is in these small, pre-elementary school moments when our class adventure truly began. On our first day of kindergarten, we all stood upon a rocky shoreline before a great lake— on the frontier between watching Blue’s Clues, singing, or whatever else we did at five years old, and grade school—the path, the journey that would transport us to adulthood. Each of us began at our own beach, searching for the little stones, testing, experimenting, trying, failing, succeeding at skipping stones various distances over the initially calm and placid body. Those stones became our little opportunities, our little choices that we made day by day. Though we all began in different places, from different backgrounds, families, and homes, slowly, the ripples from our collective stone throwing—our collective seizing of our chances—began to meet and intersect, warping the water across all three spatial dimensions in a truly elegant, universal way. Over the years of grade school, our beaches became one as our stones’ residual effects did. The little decisions, interactions, and choices we made with each new opportunity transported us to new places. We met new people, made new friends, and developed long-lasting relationships. Our great frontier was high school. At first, high school was a strange place. There were new conditions—new cur-

rents and waves—to take note of. While the upperclassmen and women were preparing for adulthood, we were just beginning to more fully shape our pattern of ripples. From a bird’s eye view, our stones’ shockwaves had barely ever reached beyond our simple circles of nearby friends and well-known places. The high school body of water changed that. As we spent our “freshman fight club” days reading Lord of the Flies and studying Kinematics formulas, more clubs, more teams, more classes presented themselves as new stones upon our shores – ones that begged to be tested, experimented with, and, eventually, skipped into the distance. Sometimes, the water was rough, choppy, unsettled – affecting the radiation of our stones’ pathways and interactions. Other times, big storms rolled directly onto our beaches and drenched us all, setting all of us back and threatening to erase our stones’ connections: a first taste of failure, first lost friendship, first cut from a team or play. Yet as a class, we learned that in order to keep our network of connected ripples and waves together, we needed to keep skipping stones—seizing our moments and choices—sometimes even faster than before. Some made it just far enough to be considered a success—passing our first test, meeting new people, experimenting with painting and sculpture, or making the freshmen team. A select few, though, began skipping for hundreds of feet at a time—paths carved into the blissful future. These were our major successes:

winning a gavel at Model Congress, earning a spot on the varsity basketball team, being selected for All-County and AllState in music, forging a deep connection with a teacher, classmate, or counselor, or even becoming a sought-after illustrator and artist. Slowly, we became more skillful, more refined with our stone skipping, and by the time we became Great Gatsby-reading juniors, we learned how to make our skips more intricate, ultimately crafting a strong, beautifully complex class identity. Now, as seniors approaching our next frontier—be it college, a gap year, work, or trade school— the experiences we’ve had, the challenges we’ve overcome, and the water-borne picture we’ve crafted will etch itself into our memories. As a class—the Class of 2019—we are ready to live in the moments on our new beach overlooking our new future. So I urge you today to reflect on your high school moments: the shores you’ve roamed, the currents you’ve dealt with, and the stones you’ve thrown. Remember to imagine that rocky beach facing the future—a boundless place fraught with all conditions, bad and good. Today, our last ripples have made their way onto our on-water image, and now we stand ready to create new ones. Our sea of blue is serenading us goodbye and beckoning to that future. Immerse yourselves in the natural world, seize your opportunities, and ride their new waves as far as you can go. Thank you, and may we move ever forward!

COMMUNITY NEWS

Honored for service to Scouts Girl Scouts of Nassau County (GSNC) recently held its 27th Annual Adult Recognition Awards Ceremony at LIU Post in Old Brookville, N.Y., recognizing and celebrating the adult volunteers for their service to Girl Scouts of Nassau County and to their communities. Among the honorees were local Great Neck resident Renee de Lyon and the late Terri Della Vecchia. Both were recognized for their adult volunteer service with the Girl Scouts in Great Neck. Renee de Lyon was awarded with the Appreciation Pin, signifying her immense dedication and outstanding achievements throughout the years. De Lyon readily assumed the role of trea-

surer for The Great Neck Service Unit this year. Already a leader for her daughter’s multi-level Cadette/Senior/Ambassador troop, Ms. De Lyon also chaired many events in the Great Neck service unit, a task few will take on. The girls have been grateful for everything she has planned. A long-standing volunteer, Vecchia began her years as a volunteer even before she graduated high school during WWII, having been recruited as a leader when a co-leader whose troop was caring for wounded soldiers needed help. Vecchia was an active member of several council committees for more than 15 years and served both the Glen Cove and Great Neck service units, serving as a co-

leader and event planner. Vecchia was always willing to share the rich history of Girl Scouting wherever and whenever the opportunity arose. She was recognized at the awards ceremony for her hard work, dedication, and volunteer services after she passed away in January of 2019. Her love of scouting was truly in her blood and was passed on to her children, grandchildren and great grandchildren. Girl Scouts of Nassau County appreciates the hard work and dedication of this community volunteer. Submitted by the Girl Scouts of Nassau County

PHOTOS COURTESY OF GIRL SCOUTS OF NASSAU COUNTY

Renee de Lyon, recipient of the Appreciation Pin from Girl Scouts of Nassau County, and Terri Della Vecchia at a previous GSNC Adult Recognition ceremony, were recently honored for their service.


BLANK SLATE MEDIA July 12, 2019

YOUR GUIDE TO THE ARTS, ENTERTAINMENT AND DINING

LONG ISLAND SUMMER FESTS BY B I L LY F I T Z PAT R I C K

T

he summer season on Long Island is typically the busiest time of year for families looking to get out of the house together. From Manhattan to Montauk, there are plenty of events to choose from to enjoy the warm weather with your family and find activities everyone will enjoy. The events that tends to draw a sizable crowd are local fairs and festivals – and Long Island has plenty of those all summer long. Here are some of the events that will be happening across Long Island the next few weeks: July The Long Island Summer Festival: Happening Friday, July 12, from 5 p.m. to 11 p.m. and Saturday, July 13, from 2 p.m. to 11 p.m., the Long Island Summer Festival will be taking place at the Smith Haven Mall in Lake Grove. The festival will host hundreds of local vendors and have a wide variety of food options. It will also feature a carnival-like experience, which includes rides and Long Island’s only Hot-Air Balloon trips. Tickets are on sale now and are available online, along with more information, at www.longislandfestival.com. Children 12-and-under are free to enter, while all others will be charged $5 to get in. Babylon Block Party: This year’s first date for the Babylon Block Party already took place last month, so if you missed out on June’s event, you won’t want to make the same mistake this month. July’s Babylon Block Party will be held on Thursday, July 18, from 5 p.m. to 9 p.m. along Deer Park Avenue. The festivities include live music and outdoor dining, as well as games, vendors, artisans and bouncy houses for the kids to enjoy. If you can’t make it out to Babylon on July 18, don’t worry, another block party will be happening on Aug. 29. Admission to the event is free for all ages. Great South Bay Music Festival: The 13th annual music festival is back at Shorefront Park in Patchogue again, with live

Great South Bay Music Festival (credit/greatsouthbaymusicfestival.com) performances happening all weekend long from July 18 to July 21. The Great South Bay Music Festival features over 60 performers on four different stages, including 2018 Long Island Music Hall of Fame inductee Taking Back Sunday, of Levittown. The festival also features an artisan markets for those interested in arts and crafts and a fun and educational KIDZONE. Tickets are required for admission and can be purchased online at www.greatsouthbaymusicfestival.com. Rockaway Beach Boardwalk Art Craft & Gift Fair: For those who love to shop-tillyou-drop, this event is an opportunity for you to shop local from established artisans and high-quality craft and gift vendors along the Rockaway Beach Boardwalk. The fair is happening Saturday, July 20, and Sunday, July 21, from 10 a.m. to 6 p.m.

along with additional dates in the future (Aug. 17-18, Sept. 14-15) in case you’re busy all weekend. Admission and parking to attend the event as a customer are both free of charge. For more information, head to www.rockawaybeachboardwalk.com. Taste of Montauk: The Montauk Chamber of Commerce will be hosting its 7th annual Taste of Montauk event on Sunday, July 28, from 6 p.m. to 9 p.m. The event will be held on the Great Lawn of Gurney’s Star Island Resort & Marina and will feature locally produced craft beers, Long Island wine, and plenty of food from restaurants located at the end of Long Island’s south fork. The event is 21-plus and tickets are $85 in advance or $95 on the day of the event, if available. For more information, visit www.montaukchamber. com.

August Garvies Point Museum Day: Glen Cove’s Garvies Point Museum and Preserve will be hosting its Museum Day on Saturday, Aug. 3, from 10 a.m. to 4 p.m. The day will be fun and educational for all ages and includes insect studies, nature walks, bird-watching, paper-making workshop, butterfly gardens, rock and mineral identifications, movies and more. Admission to Museum Day is $5 for those aged 5 and up. More information can be found at www. garviespointmuseum.com. Massapequa Park Village Street Fair: From Sunrise Highway to Clark Boulevard, Massapequa Park will once again be hosting its annual street fair on Sunday, Aug. 4, from 10 a.m. to 6 p.m. This year’s fair features more than 150 vendors down Park Boulevard, live entertainment, children’s rides, a rock-climbing wall, mechanical bull, clam shucking, pony rides, a petting zoo, face painting, plenty of food and a slapshot booth, courtesy of the New York Islanders. Admission to the event is 100 percent free and if it rains, there’s no need to worry, the rain date is scheduled for the following Sunday, Aug. 11. Sayville Summerfest: An art show, a classic car show, a four-mile run and live musical performances are just some of the exciting things you can find at this year’s Sayville Summerfest. Hosted by the Greater Sayville Chamber of Commerce, Sayville Summerfest will be happening all weekend from Friday, Aug. 9, to Sunday, Aug. 11. In addition to everything already listed, Sayville Summerfest will also feature over 200 craft and food vendors, rides, games and a beer and wine tasting tent. For more information, including the full schedule of live musical performances, head to www. sayvillechamber.com. Italian Festival in New Hyde Park: New Hyde Park is hosting its annual Italian Festival for five days in late August, from Wednesday, Aug. 21, through Sunday, Aug. 25. The festival features plenty of Italian dishes, along with zeppoles, pastries, famous stuffed cellinis, rides, games, live music and much more. On Saturday, Aug. 24, a fireworks show will be held at night. The festival costs just $1 for adults to enter and on Sunday, Aug. 25, admission is free for community appreciation day, the final day of the festival. Also part of community appreciation day are half-priced pasta dishes until 5 p.m. The festival will be held at Michael J. Tully Park from 6 p.m. to 11 p.m. Wednesday to Friday, 3 p.m. to 11 p.m. Saturday and 3 p.m. to 10 p.m. on Sunday. More information can be found through Cellini Lodge 2206 on its website, www.cellinilodge2206.org.


24 Blank Slate Media Newspapers, Friday, July 12, 2019

TAILS FROM THE OTHER SIDE WITH PSYCHIC MEDIUM JEFFERY WANDS

THE TOP SEVEN EVENTS Florida Georgia Line: Canâ&#x20AC;&#x2122;t Say I Ainâ&#x20AC;&#x2122;t Country Tour Saturday, July 20, gates: 6 p.m., show: 7 p.m. The duoâ&#x20AC;&#x2122;s Canâ&#x20AC;&#x2122;t Say I Ainâ&#x20AC;&#x2122;t Country Tour is Tyler Hubbard and Brian Kelley and comes after releasing their fourth studio album, Canâ&#x20AC;&#x2122;t Say I Ainâ&#x20AC;&#x2122;t Country, on Feb. 15. Dan + Shay and FGLâ&#x20AC;&#x2122;s â&#x20AC;&#x153;Up Downâ&#x20AC;? collaborator Morgan Wallen will join them on the road as support acts. Where: Northwell Health at Jones Beach Theater, 895 Bay Parkway, Wantagh Info & Tickets: 866-558-8468 or 516-7851600 â&#x20AC;˘ jonesbeach.com

!"#$%&'"%()&*+(, 7:30 PM - 9:45 PM The evening will be followed by a book signing from Jeffrey.

.  /  LIU Post 720 Northern Boulevard, Greenvale, NY

  0   1  1                                    

THE HYSTERICAL COMEDY COMES TO PORT WASHINGTON!

â&#x20AC;&#x153;Raucously Funny!â&#x20AC;? - Rocky Mountain News (Denver)

You are invited to laugh with the women in your life until you cry...or pee. Experience this truly brilliant and uplifting female comedy that explores the womanâ&#x20AC;&#x2122;s world with joy, heart and intelligent wit. This 2-woman comedy with song, dance & stories celebrates all things female, from girlhood to womanhood!

Itâ&#x20AC;&#x2122;s no secret that every woman deserves a laugh like this.

JULY 10 - AUGUST 11, 2019

â&#x20AC;&#x153;Weird Alâ&#x20AC;? Yankovic Saturday, July 20, doors: 5:30 p.m., show: 7 p.m. â&#x20AC;&#x153;Weird Alâ&#x20AC;? Yankovic is the biggest-selling comedy recording artist in history, earning four Grammys and 15 career nominations. Yankovic is stopping at Forest Hills Stadium as part of his Strings Attached tour, joined by the Queens Symphony Orchestra. Where: Forest Hills Stadium 1 Tennis Place, Forest Hills Info & Tickets: 888-929-7849 foresthillsstadium.com

2

Joe DeGuardiaâ&#x20AC;&#x2122;s Star Boxing presents â&#x20AC;&#x153;Rockinâ&#x20AC;&#x2122; Fights XXXVâ&#x20AC;? Friday, July 19, doors: 7 p.m., show: 7:30 p.m. Joe DeGuardiaâ&#x20AC;&#x2122;s Star Boxing â&#x20AC;&#x153;Rockinâ&#x20AC;&#x2122; Fightsâ&#x20AC;? series at The Paramount has developed some of Long Island and Star Boxingâ&#x20AC;&#x2122;s biggest stars, such as former world champion Chris Algieri, light heavyweight star Joe Smith Jr. and junior welterweight knockout artist Cletus â&#x20AC;&#x153;The Hebrew Hammerâ&#x20AC;? Seldin. The â&#x20AC;&#x153;Rockinâ&#x20AC;&#x2122; Fightsâ&#x20AC;? series at The Paramount oďŹ&#x20AC;ers an aďŹ&#x20AC;ordable and extremely entertaining night out, that is guaranteed to see action packed professional ďŹ ghting. Where: The Paramount 370 New York Ave., Huntington Info & Tickets: 631-673-7300 paramountny.com

3

Mike DelGuidice - Performing the music of Billy Joel and much more Saturday, July 20, doors: 6:30 p.m., show: 8 p.m.

â&#x20AC;&#x153;Laugh Out Loud Comedy!â&#x20AC;? - Broadway World

â&#x20AC;&#x153;Rollicking, Good-Natured Sketch Comedy!â&#x20AC;? - Minneapolis Star Tribune

â&#x20AC;&#x153;Intelligent... Astute... Truly Brilliant!â&#x20AC;? - Denver Post

Wed 2pm, Thur 2 & 7pm, Fri 8pm, Sat 2 & 8pm, Sun 2pm

The Jeanne Rimsky Theater at Landmark on Main Street 232 Main St., Suite 1, Port Washington, NY 11050

1-855-448-7469

 

 1-888-264-1788

1

â&#x20AC;˘   

Mike DelGuidice and the band all currently are touring members of Billy Joelâ&#x20AC;&#x2122;s band, and when they are not performing at the groundbreaking residency at MSG, they are performing at their Long Island home â&#x20AC;&#x201C; The Paramount. Welcoming them back for their 24th sold-out show â&#x20AC;&#x201C; Mike and the band never disappoint with a high energy, crowdpleasing performance â&#x20AC;&#x201C; playing all the major hits. Where: The Paramount 370 New York Ave., Huntington Info & Tickets: 631-673-7300 paramountny.com

4


Blank Slate Media Newspapers, Friday, July 12, 2019

FOR THE COMING WEEK Take Flight: Bats & Taps – Nature and Brews Night Friday, July 19, 7 p.m. to 9 p.m. A bat biologist chats bat conservation on a twilight gardens walk. Later, sample beers from featured brewery Barrier Brewing Company as sourced by Hicksville Beer and Soda and handmade cheese from Goodale Farms. 21+ only. Where: Old Westbury Gardens 71 Old Westbury Road, Old Westbury Info & Tickets: 516-333-0048 oldwestburygardens.org

5

Electric Mud/5Dead X’s Wednesday, July 24 at 8 p.m. The two bands will be performing on Wednesday, July 24 at My Father’s Place. Electric Mud was started by brothers Marc and Matty in Staten Island back in 2008, while 5Dead X’s was founded by Chris Kinnear in late 2018, with Jason Liebman, Chris Crosby, and Joe Pess. Where: My Father’s Place 1221 Old Northern Blvd, Roslyn Info & Tickets: 516-413-3535 myfathersplace.com

6

50+ Comedy Tour Thursday, July 25 at 8 p.m. The 50+ Comedy Tour returns to the Gold Coast Arts Center with a new lineup of comedians over 50. The lineup features Scott Schendlinger, Rob Falcone, David Weiss, plus a surprise guest.

F

E! E R

Sunday, July 14, 2019

Soulful Sunday Morning

Where: Gold Coast Arts Center 113 Middle Neck Road, Great Neck Info & Tickets: 516-829-2570 goldcoastarts.org

11:00 AM Multigenerational Worship Service for family and friends with LIVE Cosmic Orchestra, an extension of the Soulful Sundown Friday evening program.

7

Family Coffee* House and Religious Education Sunday Summer Program Kick-Off

TO ADVERTISE YOUR BUSINESS OR EVENT IN THIS SECTION, GO TO WWW.THEISLANDNOW.COM/ LOCAL-EVENTS

Our first-ever, interactive, spin on Soulful Sundown Coffee* House (*now with lemonade) led by Strummin’ and Drummin’. (Or tour the Veatch House or join a UUCSR Philanthropy discussion.) Picnic lunches brought from home are welcome.

During Summer Services: 11:00 AM–12:30 PM

PAINT! &

For Children K-Grade 6 & Childcare for younger kids

Unitarian Universalist Congregation at Shelter Rock

Human. Kind.

Aug. 4

July 21

DISCOVER! R!

July 28

DANCE!

Aug. 11

SLIME! SLIME!

48 Shelter Rock Rd Manhasset, NY 11030 uucsr.org | 516.627.6560

25


26 Blank Slate Media Newspapers, Friday, July 12, 2019

Come Visit

THE OYSTER BAY RAILROAD MUSEUM 102 Audrey Avenue, Oyster Bay We are open Sat. & Sun. 10AM-4PM and invite you to our Visitor Center, Theodore Roosevelt's historic train station, display yard with railroad equipment and turntable.

THE TOP EVENTS FOR KIDS FOR THE COMING WEEK Geology of Garvies Point & Long Island Saturday, July 20, 11 a.m. to 12 p.m. Learn about local geological phenomena including concretions, rattlestones, Cretaceous clays and plant fossils, and more. Followed by a walk along the rocky beach. Where: Garvies Point Museum & Preserve 50 Barry Drive, Glen Cove Info: 516-571-8010 or http://www.garviespointmuseum.com/

1

Apollopalooza Saturday, July 20, 12 p.m. to 3 p.m.

Go aboard the newly acquired DE/DM locomotive and M7 cab simulators.

516-558-7036

or on the web @ www.obrm.org Admission: $6.00 13-61 Adults, $5.00 Seniors 62+, $4.00 children 6-12, 5 and under FREE

On July 20, 1969, Apollo 11 landed on the Moon. Come celebrate the anniversary of this momentous step in space history as you learn about astronauts Neil Armstrong and Buzz Aldrin, explore rocket science, and more. Where: Long Island Children’s Museum 11 Davis Ave., Garden City Info: 516-224-5800 or licm.org

2

Shark Invasion Sunday, July 21, 11 a.m. to 2 p.m. It’s Shark Week and we’re celebrating this apex predator with lots of hands-on activities. See a real shark jaw and a Megalodon tooth! Find out about sharks’ amazing senses, and excavate a real shark tooth fossil and turn it into a necklace to wear home. Where: The Whaling Museum & Education Center of Cold Spring Harbor 301 Main Street, Cold Spring Harbor Info: 631-367-3418 or https://www.cshwhalingmuseum.org/

3

Kidz Bop Live Sunday, July 21, Gates: 3 p.m., show: 4 p.m.

INGENIOUS BUBBLE WIZARDRY.” “

Following the success of last year’s tour, which sold out multiple shows across the country, The KIDZ BOP Kids are hitting the road again in 2019 with a Bop-Stop at Jones Beach on Sunday, July 21. Where: Northwell Health at Jones Beach Theater 895 Bay Pkwy, Wantagh Info & Tickets: 516-221-1000 or http://KIDZBOP.jonesbeach.com

4

-THE NEW YORKER

JoJo Siwa: D.R.E.A.M. the Tour Sunday, July 21, Doors: 5:30 p.m., show: 7 p.m. Nickelodeon superstar JoJo Siwa is a YouTube personality, singer, dancer, entrepreneur, social media influencer, New York Times bestselling author and star on Nickelodeon’s “Lip Sync Battle Shorties.” On July 21, Siwa will be taking her “D.R.E.A.M. the Tour” to Forest Hills Stadium.

Telecharge.com or 212.239.6200 For groups or birthdays call 866.642.9849

New World Stages 340 W. 50th St.

GazillionBubbleShow.com G azillionBubbleShow com

Where: Forest Hills Stadium 1 Tennis Place, Forest Hills Info & Tickets: http://foresthillsstadium.com/event/jojo-siwa/

5


Blank Slate Media Newspapers, Friday, July 12, 2019

  

   35(6(17('%<7+(526/<1 &+$0%(52)&200(5&(

  

NKTFHTEMuJ

     

   

/(7,7%/((' $  52//, 1 * 6 7 2 1( 6  7 5,% 8 7 ( % $ 1 ' X  ©#SJOHZPVSPXOCMBOLFU DIBJSTSFGSFTINFOUT 5DLQ'DWH7KXUVGD\-XO\WKDWSP 410/403&%#:

:+($7/(<3/$=$

27


28 Blank Slate Media Newspapers, Friday, July 12, 2019

Tributes to Isadora Preserve celebrates 4 Duncan, Walt Whitman years of music, poetry Dance Visions NY has several exciting programs in the lap of nature coming up at Long Island landmarks throughout July. On Sunday, July 21, at 2 p.m., Dance Visions NY will be performing at Sands Point Preserve Conservancy, both indoors at Hempstead House and outdoors in the beautiful Rose Garden overlooking the Long Island Sound. Admission to the performance is free for members or $15 per car for non-members. The group will also be performing on Thursday, July 25, at 8 p.m. at the Steppingstone Waterside Theater in Kings Point. Highlights of the program for both dates include the late American and French dancer Isadora Duncan’s “Tribute to Greek Gods,” created to

Schubert’s Symphony in C (the Great), and new Jucovy works. “Earth Trilogy” recently premiered at “Take Root” at Green Space, in Long Island City, and includes Isadora Duncan’s dances of nature, “Delicate Web,” which illustrates the possible effects of climate change on humanity, and “Hymn,” a prayer for the Earth created to a Native American medley arranged for the dance by soprano and choral director, Farah Chandu. “Jolted Reverie,” another new work, is set to music of Beethoven and music of percussionist Napoleon Revels Bey, who will play live at the concert along with pianist Paul Baserman. Another new work, “Tangos,” will premiere at this program. “Tangos“ includes duets,

featuring one man and four women, and an enticing finale, created to the stunning music of Astor Piazollo. Lastly on Saturday, July 27, at 3:30 p.m., the group will present a dance/poetry performance in honor of Walt Whitman’s 200th birthday anniversary, called “I Hear America Singing, I see America Dancing” outdoors on the lawn of the Walt Whitman Birthplace. Whitman’s 200th birthday also coincides with Isadora Duncan’s 141st birthday. Duncan was greatly influenced by Whitman, calling him her “spiritual teacher.” The dance group will pay tribute to the two influencers through word, dance and music. Excerpts of poems by Whitman are illustrated by authentic Duncan dances under the direction of Beth Jucovy. Duncan dance pianist Mark Fiedler will play many of these works live to the music of Chopin, Brahms, Gluck, Strauss, Schubert and the group will be reviving a work to the music of Micheal Sheyne. The program will be performed outdoors at the birthplace of Walt Whitman, located at 246 Walt Whitman Rd. in Huntington Station.

Judea plans summer Shabbat services The Jewish Sabbath (Shabbat) is a year-round observance and celebration. During the months of July and August, Temple Judea introduces some interesting variables making observance even more exciting and perhaps unexpected within the range of the traditional songs, Torah readings, blessings and prayers. For starters, wine and cheese will be served in the lobby at 6 p.m. each Friday evening, followed by the Shabbat service in the Sanctuary at 6:30 pm. All are invited to attend. The Adult Volunteer Choir will assist in the responsibilities of observing the traditions, prayers and songs of Shabbat each week in July and August, including the two weeks of Shabbat when Rabbi Chizner is on vacation. The new cantor, Deborah Jacobson, who has recently been appointed

by Temple Judea, will begin her term in August. The Adult Volunteer Choir is a group of congregants who are thoroughly familiar with and trained in conducting the Shabbat service. They come from a variety of vocations including two lawyers, a poet/ author, two psychologists, the manager of a dental office, an insurance broker and a professional actor/musician/comedian. Tod Groman is the leader and trainer of the group. He is joined by Sha Beaman, Karen Blum, Irving Flamer, Dr.Stanley Goldklang, Susan Goldklang, Paula Groothuis, Dr. Vin Guarerra, and Spencer Herman. Temple Judea is located at 333 Searingtown Road, Manhasset (off Exit 36 on LIE) and can be reached at www.templejudea.com or (516) 621-8049. New members are always welcome.

The Sands Point Preserve Conservancy, located on the Gold Coast of Long Island, presents Summer Playlist, the third in four magical concerts comprising the new Four Seasons in Music series, on Saturday, July 13, in historic Hempstead House and Rose Garden. Artistic Director Kathryn Lockwood created this captivating, thought-provoking series, gathering brilliant, internationally renowned artists to perform in beautiful venues across the Guggenheim Estate. The series is designed for adults, but children 8 years and older are welcome. A summerthemed dinner follows the concert outside in the Rose Garden overlooking the Long Island Sound. Summer Playlist celebrates the sunny days and sultry nights of summer with an eclectic-mix of poetry and music. The “playlist” features classics by Bach and Mozart, exciting new works, and folk tunes from around the globe. The Conservancy welcomes an ensemble of world-class musicians such as Lockwood (viola), Todd Reynolds (violin), Nathan Koci (accordion), Yousif Sheronick (percussion), and Sheri Hammerstrom (poetry reader). The concert is set inside Hempstead House, where the living room will be transformed into a European-style courtyard. “Summer lifts our spirits and inspires dance and song,” said Lockwood. “You’ll be uplifted by an exuberant Gigue by Bach, touched by a romantic waltz from accordionist-composer Guy Klucevsek, seduced by the breathless beauty of ‘Oblivion,’ the famous love song by the legendary Argentine master Astor Piaz-

zolla; and swept away by the sensual pulse of Indifference, a showcase for our entire ensemble. Summer breezes carry you to lands near and far while taking you on a journey to an exciting world of innovative music-making.” Also on the program: the sizzling Indian accents of Shirish Korde’s “Joy,” a virtuoso duet for viola and percussion performed by duoJalal (violist Kathryn Lockwood and percussionist Yousif Sheronick); the haunting Americana of Bill Carson’s colorful arrangement of the traditional Bright Summer Morning; the Central European folk flavors of Klucevsek’s witty “Moose Mouth Mirror;” and the virtuosity and timeless quality of Sheronick’s “Expanding Time.” Following the concert, guests will enjoy a bountiful summer supper in the Rose Gardens, originally designed by Florence Guggenheim. The superb seasonal dinner menus are created by master chef Nicola Zanghi, prepared by Philip Stone Catering. Cocktails begin at 6:30 p.m., followed by the concert in Hempstead House at 7 p.m. Dinner and dessert in the Rose Garden will take place at 8 p.m., following the concert. The final concert in the 2019 series is Autumn Leaves on Oct. 5. For Sands Point Preserve Conservancy members, adult tickets cost $100 and $50 for those aged 8 to 18. For nonmembers, adult tickets are $110 and $60 for those 8 to 18 years old. Tickets can be purchased online at www.sandspointpreserve.org or can be purchased by phone by calling 516-304-5076.

www.facebook.com/TheIslandNow


A Blank Slate Media/Litmor Publications Special Section â&#x20AC;¢ July 12, 2019


30 Blank Slate Media Newspapers, Friday, July 12, 2019

Home remedies for joint pain can provide relief

S

tiff, painful joints affect a vast number of people. According to the American College of Rheumatology, arthritis and other rheumatic diseases afflict roughly 23 percent of Americans, while Canadian Health Surveys indicate that nearly 17 percent of the Canadian adult population have arthritis. The number of people living with arthritis is expected to increase as the Baby Boomer generation continues to age. Treatments for joint pain and stiffness range from medication to physical therapy. Finding the right regimen may take some effort, including some trial and error. For those looking for treatments they can try at home, consider these homespun remedies. (Note: Check with a physician to confirm the safety of alternative treatments before adding herbs to or modifying your existing medications.) • Exercise more. Regular movement helps to maintain

garlic, celery, and kelp should be included in diets as well.

flexibility in the body’s joints. Those with joint pain may shy away from exercise, but they could be doing themselves a disservice. Low-impact exercises, like swimming and water aerobics, can work out muscles and joints without adding extra stress. Walking can replace jogging or running, and yoga and pilates may be just the thing for deep stretching. • Lose weight. Joint pain is often tied to obesity. Losing just a few pounds can ease up strain on certain joints, such as the hips, feet and knees. Shedding weight can improve mobility and decrease pain and potential future damage to joints. Exercise goes handin-hand with healthy eating to lose weight. • Consider hot and cold therapies. Using a heating pad, hot shower or bath or an ice pack can work wonders on arthritis-related pains. Hot treatments will loosen up stiff joints, while cold therapy is best for acute pain relief. Do

• Go for a massage. The Arthritis Foundation says regular massages can help reduce pain and stiffness and improve range of motion. The massage therapist should have experience working on people with arthritis. In addition, massages should be performed by licensed physical therapists and guided by a doctor’s recommendation.

not apply hot and cold packs to the skin directly, as this can injure the skin. Wrap them in a towel first before application. • Include anti-inflammatory foods and beverages in your diet. Explore the many different natural foods and

herbs that are purported to reduce inflammation in the body. Ginger, turmeric, flaxseed, grape juice, and bromelain can alleviate inflammation and stiffness. Foods such as fatty fish and nuts high in omega-3 fatty acids also will help fight inflammation. Blueberries,

• Increase magnesium intake. Magnesium can alleviate pain and reduce inflammation. It is best ingested through dark, leafy greens but also can be taken in supplement form. Magnesium oil can be applied topically to sore joint areas. Joint pain can impact daily life and make activities less enjoyable. Fortunately, there are plenty of ways that do not require harsh medications to loosen joints and combat pain.

ADVERTORIAL

What is home health care?

Home Health Care

Marian Care, Inc. provides personal care asssistance such as bathing, dressing, laundry and meals.

Licensed by the New York State Department of Health Home Health Care Aides • Companions A Tradition Of Caring for over 30 years 467 Willis Ave., Wiliston Park, NY 11596 Call: (516) 741-8600 • Toll Free 1-800-738-0007 www.mariancare.net

Home health care is supportive care provided directly for an individual. Assistance may occur in the home, a rehabilitation center or assisted living facility, a nursing home or hospital. Most times, the care helps older adults live independently for as long as possible even with illness or injury in the comfortable and familiar surroundings of home! A home health aide can help you with tasks such as bathing, dressing, toileting, laundry, light housekeeping and meal preparation. Are the home health aides background-checked? Marian Care, Inc. is a licensed agency, therefore, our home health aides must be certified and registered with the New York State Department of Health. Their backgrounds are thoroughly screened and fingerprints are registered with the criminal history database of New York State. What are the advantages of going through an agency for a home health aide? You will have the peace of

mind knowing that all the necessary measures have been considered when placing one of our aides in your home. Also, if the situation calls for a replacement aide, an agency is prepared for the challenge. Do you have any Registered Nurses working with Marian Care, Inc.? Yes. Our registered nurses are responsible for developing a tailored care plan according to the specific needs of the individual. The RN’s ensure that the aides are up to date on their in-service training and equipped with the skills needed to give you quality care at home. An RN will also visit you in your home every three months to ensure that you are receiving the care you deserve. Marian Care, Inc. provides services to Nassau, Suffolk, and Queens county residents. Marian Care, Inc. is accredited by CHAP- Community Health Accreditation Program – meeting the industry’s highest nationally recognized standards.

Licensed by the New York State Department of Health

467 Willis Ave., Wiliston Park, NY 11596 Call: (516) 741-8600 Toll Free 1-800-738-0007 www.mariancare.net


Blank Slate Media Newspapers, Friday, July 12, 2019

Dedicated to luxury real estate

# 1 Agent 2018

Co ldwell Ban ker Residential Br oker ag e L ong Is la nd & Que e ns Luxury & Senior Living Expert

S S

SHELLEY SCOTTO

A S SO C I AT E RE A L ES T AT E BR O K E R IN TE RN A TION A L P RE SIDE NT ’S E LI TE #1 AS S O CI AT E B RO K E R NA S SA U , S UF FO LK , QUE E NS

Bringing the perfect blend of luxury and service

To find out t he val ue of your propert y in today’ s re al es tate ma rket v isit :

www.MyNassauPropertyValue.com C o l d w e l l B a n k e r R e s i d e n t i a l B r o k e r a g e : D i r e c t - 516-570-1537 C a l l - 516-816-7428 © 2018 Coldwell Banker Residential Brokerage. All Rights Reserved. Coldwell Banker Residential Brokerage fully supports the principles of the Fair Housing Act and the Equal Opportunity Act. Operated by a subsidiary of NRT LLC. Coldwell Banker, Coldwell Banker Logo, coldwell Banker Previews International, the Coldwell Banker Previews International Logo and “Dedicated to Luxury Real Estate” are registered trademarks and unregistered service marks by Coldwell Banker Real Estate LLC.

31


32 Blank Slate Media Newspapers, Friday, July 12, 2019

How to eat after 50 Friendly fats People over age 50 should increase their intake of unsaturated fats and reduce consumption of saturated fats. Nutrient-rich unsaturated fats can guard against heart conditions, protect against stroke, keep skin supple, and even help men and women maintain good neurological health. Omega-3 fatty acids can be found in nuts, olives, seeds, and fatty fishes. Increase protein

A

s people age, their dietary needs begin to change. Foods that were once staples of your diet as a youth may be restricted once you hit a certain age, while other foods you may have always avoided may now be necessary to fuel and support a healthy body.

Eating healthy foods and exercising may not be enough to sustain health, as hormonal changes and other health effects as a person reaches age 50 can have a profound impact on his or her nutritional requirements. The following are a few things men and women over 50 may want to consider as they look to eat a healthy diet for years to come.

Vitamin D Both men and women age 50 and up have a reduced ability to produce vitamin D through exposure to the sun. Extra vitamin D will be needed from foods and supplements. Everyone over the age of 50 should take a daily vitamin D supplement of 400 IU (10 µg), according to Canada’s Food Guide. Without adequate vitamin D, bone strength and health can deteriorate because vitamin D promotes calcium absorption. Vitamin D also has other roles, including helping neuromuscular and immune function and reducing inflammation.

Respect. Tradition. Compassion. For four generations, New York’s Jewish Community has turned to Sinai Chapels for guidance and comfort in their time of need. We honor and respect all Jewish traditions and customs, attending to every funeral detail according to each family’s personal and religious preferences.

To learn more, contact us today:

718.445.0300 | 800.446.0406

According to Christine Gerbstadt, MD, RD, a spokesperson for the Academy of Nutrition and Dietetics, as they age, men and women need more protein in their diets to maintain their muscle mass. The amount of protein needed at a younger age no longer may be adequate. Look for lean sources of protein from fish and poultry. Beans are also a low-fat source of protein that can help fulfill daily protein requirements. More fiber Eating more fiber can help with digestive and intestinal problems, such as constipation. Constipation can occur when fiber intake is not enough, coupled with a more sedentary lifestyle. The best way to get fiber is through diet. Leave the skins on fruit and vegetables and choose whole fruits

over juices. Whole-grain breads and cereals also are good sources of fiber. Dry beans and lentils can add a fiber boost. Always increase fiber slowly to determine your tolerance. Fewer calories The National Institute on Aging says women over the age of 50 need between 1,600 and 2,000 calories, depending on how physically active they are. Men need between 2,000 and 2,400 calories per day. With each passing year there is a decrease in the energy required to maintain body weight, so caloric intake should be adjusted accordingly. More water As a person ages, his or her body may not signal it is thirsty as well as it once did, so it’s possible that you may not recognize when you are thirsty or dehydrated. The Mayo Clinic recommends around nine to 10 cups of beverages per day to remain hydrated. Eating healthy and changing one’s diet is important as a person ages, as dietary needs at age 50 may be quite different from what they were at age 30.


Blank Slate Media Newspapers, Friday, July 12, 2019

North Shore

Vein Center

33


34 Blank Slate Media Newspapers, Friday, July 12, 2019

Senior living options abound

ADVERTORIAL

S

enior living communities often present an affordable and comfortable option for adults over the age of 55. Filled with like-minded and similarly aged residents, these communities can be the right fit for individuals no longer interested in or capable of taking care of a larger home. Senior communities are located all across the country. Finding one that meets your needs takes only a little research. Although they are often moderately priced and offer a variety of amenities, senior living communities sometimes suffer from a bad reputation. But such communities are not the “old age homes” that some people purport them to be. Rather, they’re entire living neighborhoods that cater to the needs of an active resident base. These communities can range from independent living private homes or condos to managed care facilities. Residents may be able to enjoy organized outings, recreation, shopping, and socialization without having to venture far from property grounds. Some communities offer food services or an on-site restaurant.

• Determine the fees associated with a community. Can Medicaid or longterm care insurance pay for all or a portion of the fees? Which types of services does the monthly fee cover? • Who is eligible to live in the community? Some restrict all residents to a particular age, while others do not. Rules may be in effect that include an age cut-off limit. • Investigate the types of residents and who would be your immediate neighbors. What percentage of people live in the community all year long, and how many are part-time residents? • Look into the particular home owner’s association rules. Bylaws may indicate that the property must be kept in a certain manner. You may not be able to paint exterior items a certain color, nor put up fencing or set up outdoor patio furniture. Get the details before you sign anything. • Is this the type of community where you can age in place? Meaning, are there separate accommodations if you eventually need assisted living care? Some communities offer living options that vary depending on residents’ ages.

Fifty-five and older communities offer conveniences that many find irresistible. They’re frequently located close to shopping, dining and healthcare providers. Taxes, insurance, utilities, and maintenance expenses may be covered in one fee. Clubhouses, golf courses, lakes, card rooms, and many other offerings are designed to appeal to residents of many ages.

• Be sure there are activities or amenities that appeal to you. You eventually want to find your niche and get together with a group of friends who share the same interests.

Now that baby boomers have reached the age where retirement communities are a consideration, there has been an influx of interest. Those considering a move to one of these communities should research some information before purchasing a unit.

• Some communities are gated, which can increase feelings of safety. If this is a priority, look for housing under security.

• You may want to find a community close to your children or other relatives. This way you will not have to travel far to visit others, and they will be able to visit you easily in return.

Following these guidelines can mean discovering a community where anyone can feel comfortable for years to come.


Blank Slate Media Newspapers, Friday, July 12, 2019 ADVERTORIAL

1991 Marcus Ave., Suite 110, Lake Success, NY (516) 466-4700 • www.neuroli.com

We’re all forgetful sometimes, But if your forgetfulness is caused by Alzheimer’s disease, you may be interested in the GRADUATE 1 clinical study.

1991 Marcus Ave., Suite 110, Lake Success, NY (516) 466-4700 • www.neuroli.com

35


36 Blank Slate Media Newspapers, Friday, July 12, 2019

Top causes of wrinkles

Coping with agerelated hair loss ttitude goes a long way in regard to self-esteem. With a positive spin, it’s possible to get through difficult situations and even have a favorable outlook on getting older. But even the most optimistic among us may at times worry about the physical signs of aging and wonder what can be done to make them feel and look their best.

A

Wrinkles and a little extra weight around the middle certainly garner attention, but hair loss is another age-related concern. As people age, their hair changes in several ways. Graying through loss of melanin pigment is the most apparent. MedlinePlus, the health information resource from the U.S. National Library of Medicine, says that strands of hair also can become less dense and smaller through the years. Many follicles also may stop producing new hairs. Regardless of age, it is customary for a person to lose about 100 hairs a day. If those hairs are not replaced as readily as they once were, patches of thinning and balding hair may appear. The rate at which hair falls out is largely determined by genetics, according to Headcovers Unlimited, a company that produces wigs, scarves and other headwraps. But nearly everyone will experience some sort of age-related hair loss. Hormonal changes during menopause can cause noticeable thinning and scalp exposure that may be mistaken for actual hair loss. There are many ways to mitigate hair loss. Here are some handy tips.

Getting older brings about many physical and emotional changes. Wrinkles are one such physical change that is widely associated with aging.

Try a new cut. Work with your stylist to determine a haircut that can suggest the appearance of thickness and camouflage the loss of density or bare spots. Graduated layers kept close to the face can help, as can pixie cuts. Men can choose to go entirely bald and bold. Treat hair gently. Avoid harsh chemical processes and constant heat styling. Protect fragile hair from damage by pampering it. Look for thickening formulas. Many shampoos, serums and conditioners tout volumizing or thickening properties. These can help plump up hair and make thinning less apparent. Talk to your doctor. Hair loss may be a result of medication, a skin condition or aging. Doctors may suggest products, such as Minoxidil and Lipogaine formulas, that can be used on the scalp to reduce hair loss and help follicles produce new hair strands. Hair thinning and hair loss can be a symptom of getting older. Knowledge is key to improve hair’s appearance at any age.

Some people begin fighting wrinkling long before their first wrinkle even appears. A poll of 2,000 women conducted by DermStore found that around 30 percent of women under 35 regularly use anti-wrinkle products. The average millennial user starts at age 26 compared to the average currently 55-year-old woman, who began using wrinkle-reduction products at around age 47. As skin ages, its natural tendency is to become less elastic. However, other factors also contribute to the formation of wrinkles. Understanding the main culprits behind wrinkles can help people combat them more effectively. Exposure to UV light: The Mayo Clinic says that ultraviolet radiation speeds up the natural aging process and is the primary cause of early wrinkling. UV from the sun can break down the supportive connective tissue in the skin, which includes collagen and elastin fibers. Using sunscreen and staying out of the sun as much as possible can help. Exposure to pollution: Pollution can cause free radical damage that contributes to wrinkling, advises Maral Skelsey, M.D., director of the Dermatologic Surgery Center of

Washington. Other data indicates those who live in urban settings have more wrinkles and age spots than those who live in rural areas. Washing off skin contaminants from the air each day may be beneficial. Smoking: The contaminants in cigarette smoke can damage the skin, promoting wrinkles, states the skincare company Nivea. Also, dragging on a cigarette purses the lips and can form deep wrinkles around this area of the face. Poor diet and stress: Stress and eating unhealthy foods, such as a diet high in sugar, may contribute to premature aging of the skin. According to Kristina Goldenberg, MD, boardcertified dermatologist of Goldenberg Dermatology, after sugar is ingested it goes through a process called glycation, which involves binding to different proteins in the body. These proteins include collagen and elastin. By binding to these building blocks of the skin, sugar weakens collagen and elastin and will lead to an appearance of fine lines and wrinkles. Stress can increase cortisol levels that affect the skin’s ability to stay hydrated and elastic. Avoiding wrinkle triggers and following a dermatologist’s advice on skincare products and care can help people stave off wrinkles.


Blank Slate Media Newspapers, Friday, July 12, 2019

Pros and cons of joint replacement surgery

Look Beautiful All The Time!

To people outside the medical field, joint replacement surgery might sound like a solution that’s considered only after all other options have been exhausted. But joint replacement surgery has become very common, even though some studies have suggested certain procedures are being performed unnecessarily. A 2014 study published in the journal Arthritis and Rheumatology found that one-third of patients who undergo knee replacement surgery may not be appropriate candidates for the procedure because their symptoms are not severe enough to merit aggressive intervention like surgery. The decision to undergo surgery is always a patient’s to make. Weighing some pros and cons of joint replacement surgery can help patients make the most informed decisions possible.

Save money and time every day with permanent cosmetics.

Pros The Cleveland Clinic notes that many patients who have undergone joint replacement surgeries have experienced dramatic improvement within a relatively short time after undergoing the surgery. Much of that improvement is related to pain, which for many people becomes overwhelming prior to surgery. Another benefit to joint replacement surgery is the recovery time. For example, the Cleveland Clinic notes that patients who have knee replacement surgery are usually standing and even moving the joint the day after their surgeries. Within six weeks, those same patients are typically walking comfortably with very little support. While each patient is different, any fears that joint replacement surgery will require patients to be immobile for months after surgery are unwarranted. Joint replacement surgery also can be a long-term solution, whereas the alternatives might not be. The Cleveland Clinic says that roughly 85 percent of knee implants will last 20 years, and that life expectancy figures to grow as technology advances.

Cons As beneficial as joint replacement surgery can be, it’s not without downsides. Cost is one such disadvantage. How much a patient pays for the surgery depends on his or her coverage, but AARP notes that the average knee replacement surgery costs $31,000. Such costs can be prohibitive for aging men and women who are no longer working. Another potential disadvantage to going under the knife, especially for those who are borderline candidates for replacement surgeries, is the likelihood that surgery won’t have a significant impact on quality of life. A 2017 study published in the journal BMJ found that knee replacement had minimal effects on quality of life, especially for patients whose arthritis was not severe.

Joint replacement surgeries are common. When deciding if surgery is their best option, patients should consider the pros and cons of going under the knife before making their final choice.

Eyebrow Shaping Eyeliner Beauty Marks Illuminations Scar Camouflage Lips Microblading Eyebrows Areola Nipple Re-pigmentation Medicinal Tattoo Bring this ad for a Complimentary Consultation

PERMANENT COSMETICS

1129 Northern Blvd. Suite 301, Manhasset, NY 11030 516-627-0722• olga@pcosmetics.com www.permanentcosmeticsbyolga.com

Recognize It • Rely On It

Certified Permanent Cosmetic Professional of the Society of Permanent Cosmetic Professional (SPCP)

37


38 Blank Slate Media Newspapers, Friday, July 12, 2019

Yogurt is a dietary source of probiotics, healthy bacteria and yeasts that may improve overall health.

Exercises to support stronger hips Surgery is not an inevitable side effect of aging. In fact, men and women over 50 can employ various preventive techniques to strengthen their bones and joints in the hopes of avoiding the surgical wing of their local hospitals.

According to AARP, more than 370,000 men and women undergo hip replacement surgeries in the United States each year. Some may think such

Feel your best, starting with your stomach Did you know that they key to personal health may begin in the core of the body? Doctors

good and bad bacteria, for example, probiotic-rich foods and supplements can more readily replace what’s lost.

and researchers are learning more and more about how the immune system and other functions of the body are tied to microscopic players housed in the stomach and intestines. Improving this digestive environment can benefit the body in various ways.

Dietary sources of probiotics include some yogurts, cheeses, kefir, sauerkraut, miso, kimchi, pickles, and beverages like kombucha, a fermented tea. Getting probiotics from foods is the most natural way to supplement good gut bacteria, as the foods meld with the probiotics in ways that doctors may never understand to deliver the most benefits.

Understanding probiotics Bodily bacteria outnumber body cells by 10 to one, offers the health and wellness resource Healthline. Most of the bacteria in the body are harmless, and many of them in the gut actually are linked to numerous health benefits, such as weight loss, enhanced immune function, reduced risk of disease, and improved digestion. Unfortunately, bad bacteria also vie for space in the gut. If the good bacteria and yeasts, or probiotics, are not in abundance to push out the bad bacteria, like salmonella and E. coli, those bad bugs can proliferate, causing problems. It is essential to keep an abundance of probiotics available to stay healthy and maintain the “good vs. bad” balance in the gut.

Getting probiotics While the body can be healthy without the addition of probiotics, having more can be beneficial. The Cleveland Clinic says that food and supplements containing probiotics assist the good bacteria already present in your gut. When a course of antibiotics wipes out both

The downside is it’s impossible to measure just how many probiotics can be acquired from foods. That is what makes supplementation so handy. Capsules and tablets are loaded with a variety of different active bacteria and yeast cultures to aid the digestive system in measurable ratios. Some tout anywhere from one to 30 billion active colony-forming units (CFUs) per serving.

surgeries are a final solution to their hip pain, but that might not be the

Good Morning Stand with your feet shoulderwidth apart and keep your hands at your sides. With your knees slightly bent and your back naturally arched, bend at your hips as if you’re bowing out of respect as far as you can go, or until your torso is almost parallel to the floor. Return to the starting position. During the exercise, keep your core braced and don’t bow your back.

Hip Abduction Side effects Probiotics are generally healthy for people to consume in amounts found in foods, advises the Mayo Clinic. Most healthy adults can safely add foods or dietary supplements that contain probiotics to their diets. Introducing probiotics may cause temporary and mild flatulence, discomfort and bloating. Probiotics can be yet another tool to improve overall health at any age, but especially for adults looking to minimize illness risk.

Stand with your feet shoulderwidth apart. Loop a resistance band around both ankles, and then raise your right leg out to the side as far as you can. Hold in this position for a moment before slowly returning to the starting position. Switch legs and then repeat the exercise on the other side.

Hip Adduction Loop one end of a resistance band low around a solid object,

case, as AARP notes than one in 10 hip replacement recipients will need a second procedure for any number of reasons, including infection or mechanical failure. A proactive approach that focuses on strengthening and protecting the hips can help aging men and women reduce their risk of one day needing hip replacement surgery. The following are a handful of exercises, courtesy of the AARP, that can help men and women strengthen their hips.

then stand to the left of that object before looping the other end of the band around your right ankle. Place your legs shoulder-width apart, and then pull in your right leg until your ankles touch. Repeat with your left leg, this time moving to the right side of the object.

Glute Bridge Lie on your back with your knees bent and your feet flat on the floor. Raise your hips to form a straight line from your shoulders to your knees, using some type of support if you need to. Clench your butt at the top of the movement, pause, and lower yourself back down. Men and women unaccustomed to exercise should consult their physicians before performing any of these exercises. In addition, if necessary, perform the exercises under the supervision of a personal trainer who can advise you on proper form and help you reduce your risk of injury.


Blank Slate Media Newspapers, Friday, July 12, 2019 ADVERTORIAL

SEE YOUR WAY CLEAR

When is the "right time" to have cataract surgery? If you are noticing vision problems and have been told you have cataracts, it's likely your cataracts are bad enough to require surgery. In some cases, people experience bothersome vision problems such as glare and halos at night even before their eye doctor notices significant clouding of the lenses in their eyes during a dilated eye exam. This condition, called dysfunctional lens syndrome, often is reason enough for many people to consider cataract surgery, especially if they need better visual acuity for driving at night. If your night vision is blurry and headlight glare is bothersome when you drive, you may need cataract surgery. However, financial considerations and insurance requirements also are factors when considering the best time to have cataract surgery.

Some insurance companies (including Medicare) consider cataract surgery to be "medically necessary" and a covered service only after the cataract has caused corrected visual acuity to be reduced below a specified level. Often, this criterion is 20/40 or worse (20/40 is the legal vision requirement to get an unrestricted driver's license in most states). Be sure to review the details of your insurance policy with your insurance agent or your eye doctor's staff so you understand if your vision qualifies you for coverage of your cataract surgery as a medically necessary expense. If you plan to pay for your cataract surgery completely out-of-pocket, you can have the procedure done at any time, provided your cataract surgeon feels you are a good candidate and that you will benefit from surgery.

Focal Point Optical

Doctor available for cataract & glaucoma testing, exams, contact lens fittings, dry & red eyes. By appt. only.

If you are over the age of 60, and it has been more than a year since your last eye exam, talk to us today about your vision care needs.

MEDICARE ASSIGNMENTS ACCEPTED

$

COME IN FOR YOUR EYE EXAM.

2453 Jericho Tpke. (Between Herricks Rd & Marcus Ave) 516-746-3836

MOST UNION PLANS & MEDICARE ASSIGNMENT ACCEPTED. (We Accept Eyemed)

Visit Us At: www.focalpointgcp.com

70 OFF

30 OFF

$

Any Two Complete Pairs of Prescription Eyeglasses

Any One Complete Pair of Prescription Eyeglasses

At time of purchase. Not retroactive. $100 min. purchase per pair. Cannot be combined w/any other offer or Union plans. W/coupon only. Exp. 7/31/19

At time of purchase. Not retroactive. $100 min. purchase. Cannot be combined w/any other offer or Union plans. W/coupon only. Exp. 7/31/19

OUR EXPERIENCE & QUALITY MAKE THE DIFFERENCE FULL-SERVICE, FAMILY OWNED OPTICAL CENTER SINCE 1982

Focal Point Optical FAMILY OPTICAL CENTER

FAMILY OPTICAL CENTER

GARDEN CITY PARK

GARDEN CITY PARK

COME IN FOR YOUR EYE EXAM.

2453 Jericho Tpke. (Between Herricks Rd & Marcus Ave) 516-746-3836

MOST UNION PLANS & MEDICARE ASSIGNMENT ACCEPTED. (We Accept Eyemed)

Visit Us At: www.focalpointgcp.com

COMING

Real Relationships. Real Warmth. Real Care. The Regency is an assisted living setting with vital seniors who share your interests, caring staff, and upscale amenities that elevate comfort to another level. Building on The Regency’s quarter-century reputation of excellence, we’ve created a secure, self-contained neighborhood dedicated to seniors with Alzheimer’s or other form of memory loss – allowing our residents to age in place.

39

SOON

A Dedicated Memory Care Neighborhood

516-674-3007 94 School Street, Glen Cove, NY 11542 www.TheRegencyAtGlenCove.com


40 Blank Slate Media Newspapers, Friday, July 12, 2019

The importance of knowing your family medical history The National Center for Biotechnology Information states that family history might be one of the strongest inluences on a person’s risk for developing cancer, heart disease, stroke, diabetes, and more.

people at an increased risk of certain cancers. Doctors may recommend biannual checkups to stay apprised of any changes in health that may signal a risk. A thorough health care professional will record your family medical history and ask you to update it routinely in an effort to ensure you get the best, most effective care possible. You can help the process by having the information needed at the ready. The Centers for Disease Control and Prevention suggests the following.

When visiting a physician for the first time, patients may notice an extensive section on family history on one of the requisite forms they fill out before meeting the doctor. Though it can be hard to remember family members’ conditions, doctors have good reason to ask about their patients’ family’s medical histories.

Family medical histories can be vital to one’s own health care. The National Center for Biotechnology Information states that family history might be one of the strongest influences on a person’s risk for developing cancer, heart disease, stroke, diabetes, and more. While you cannot modify your genetic makeup, knowing your family’s medical history can help you take the steps necessary to protect yourself. Family history reports can serve as warning signs for illnesses. These clues can help doctors prescribe certain screening tests at earlier ages to catch potential diseases when they are most treatable. For example, the U.S. National Library of Medicine says that healthcare professionals may recommend more frequent screenings (such as mammography or colonoscopy) and screening at an earlier age for

Talk to family. Make a list of close family members and discuss any conditions or issues they might have had and at what ages. Learn about chronic diseases. Speak to your relatives about chronic diseases like diabetes or high blood pressure, being sure to ask how severe such issues were and if any required hospitalization. Plot your ancestry. Learn about your ancestry and if any medical issues are more common among people who share that ancestry. Record everything you learn. Keep the information where it can be easily accessed and updated. For example, My Family Health Portrait is a free web-based tool to organize family health information and share it with doctors. Family history plays a key role in how doctors will approach patients’ treatment and preventive care.

Smart ways to embrace retirement Retirement is on the horizon for a significant number of people. Around 10,000 people retire each day in the United States, according to a study by Merrill Lynch and Age Wave, a consultancy studying the cultural and economic impacts of aging. But many soon-to-be retirees are not fully prepared for life after their work life ends. Shedding new light on this next chapter can make retirement something to look forward to even more.

How retired are you? Retirement may no longer mean what it once did. Some retirees remove themselves entirely from the active employment market, while others prefer to keep at least one toe in the professional water. Some retirees change fields and do part-time work. Others may volunteer their time without getting paid. Still, some choose to use retirement as an opportunity to spearhead a new business venture that may not have been possible beforehand. Retirees should reflect on their goals, as well as their finances, and make plans accordingly.

Don’t neglect health care Retiring may involve finding health insurance and preparing for other types of health care later in life. The U.S. Census Bureau says that employmentbased insurance covered 55.4 percent of the population in 2015, the most recent years for figures, followed by

Medicaid (19.5 percent) and Medicare (16 percent). Residents of other countries may be covered by government standardized health programs. It pays to know the rules of each plan to avoid unnecessary expenses that can eat into retirement dollars. For those Americans who will be relying solely on Medicare, find a counselor who can spell out the intricacies of the plan, or use the free tool on Medicare.gov.

See retirement as a beginning, not an end Quite often soon-to-be retirees focus on the end of a career or the end of a stage in life without putting enough focus on the possibilities ahead. This is a prime time to find a new social network, travel, join a ministry, and much more.

Choose your living space Retirement can be an opportunity to shed an old skin and try on a new one — especially as it pertains to housing. There are options to downsize for empty-nesters or even to secure resources to “age in place.” According to United Income, a money management service, retirees should try out particular scenarios and locations prior to jumping in. Rent in a particular neighborhood, or house sit and try things on for size. Airbnb and other types of services can make this trial easy. A new outlook on retirement can open up a world of opportunities.

LIKE US ON FACEBOOK AT FACEBOOK.COM/THEISLANDNOW


Blank Slate Media Newspapers, Friday, July 12, 2019

41


42 Blank Slate Media Newspapers, Friday, July 12, 2019

THE BEST IN LOCAL COVERAGE

and 19 awards

to prove it!

2018 NYPA Better Newspaper Contest Editorial Cartoon First Place Williston Times Best Small Ad Space First Place Manhasset Times General Excellence Second Place Great Neck News Best Advertising Campaign Second Place Williston Times

Spot News Coverage Third Place Great Neck News Rookie of the Year Third Place Coverage of Elections/ Politics Honorable Mention Williston Times Spot News Photo Honorable Mention Manhasset Times

2018 Press Club of Long Island media awards Editorial/commentary First Place: “Show More Long Island Vision for Pedestrian Safety” Paul Glader Website Home Page Design First Place Theislandnow.com Non-Local News/Feature Second Place: Noah Manskar “NHP Author Reunites “ Best Headline Second Place: Noah Manskar “Band stops playing at Eleanor Rigby’s” Government/Politics Third Place: “Terry’s Town Power” Noah Manskar Breaking News Third Place: Noah Manskar “Applause and then a resignation call”

Editorial/Commentary Third Place: Steven Blank “Bringing politics to a gang fight” Non-Local News/Feature Third Place: Amelia Camurati “9/11 Bond Stays Strong” Humor Column Third Place: Judy Epstein “Watch out for that real estate column” Editorial Cartoon Third Place: Matt Bodkin “Working in Nassau County” Best Headline Third Place: Steven Blank “Applause and then a resignation call”

W

Subscribe today!

Online: Theislandnow.com/free-subscription Phone: (516) 307-1045 X 206 Fax: (516) 307-1046 Email: stabakin@theislandnow.com 0DQKDVVHW7LPHV *UHDW1HFN1HZV 5RVO\Q7LPHV

3RUW:DVKLQJWRQ7LPHV :LOOLVWRQ7LPHV +HUDOG&RXULHU1HZ+\GH3DUN

1DPH $GGUHVV







&LW\





6WDWH 



Did you know?



$SW =,3

Those poised to begin a health regimen n that includes probiotics would be wise to also educate themselves about the closely named, yet vastly different, “prebiotics” that are also beneficial to health. Prebiotics are to probiotics what fertilizer is to a vegetable garden. e Prebiotics are essentially a special type ficial of soluble fiber that is used by the benefi bacteria as fuel, advises the prebiotic supplement company Prebiotin. Examples of good sources of prebiotics include bananas, onions, garlic, Jerusalem artichokes, apple skins, beans, and chicory root. The prebiotic fiber moves through the small intestine undigested and fermented until it reaches the large intestine. Once there, beneficial bacteria break it down and use it as food. Thusly, the prebiotics can then multiply readily and improve the balance of good and bad bacteria in the gut. Eating prebiotic foods can fuel the process, but many probiotic supplements now have a combination formula that includes prebiotics in the recipe.

Your Healthy Life Is Our Mission WE MANAGE: Diabetics, Blood Pressure, Coronary Artery Disease, Obesity, Asthma

You are always treated with understanding & compassion

We respect the dignity of every patient. WALK-INS ALWAYS WELCOME

WE PROVIDE: Preventive Care, Minor Trauma Care, Blood Testing, EKG, Holter, Spirometry

IMMUNIZATIONS for: • State-of-the-Art Facility with • FLU Confidential Electronic Medical • PNEUMONIA • SHINGLES Recording System. • Comprehensive Annual and School Physicals

3KRQH

• FLU SHOTS NOW AVAILABLE

(PDLO

Affiliated With: Northwell Health (formerly North Shore LIJ). Flushing Hospital Medical Center

(No apppointment necessary)

6LJQDWXUH 5HTXLUHG  'DWH

25 Red Ground Road East Hills, NY 11577 516-307-1045 www.theislandnow.com

*For first-time subscribers only. This publication is delivered on Friday. You may cancel anytime.

Mon, Wed, Fri 10:00 am - 6:00 pm, Tues-2:00 pm - 6:00 pm, Sat-10:00 am - 2:00 pm.


Blank Slate Media Newspapers, Friday, July 12, 2019

VAR Home Improvements Will Make Your Dream Home A Reality! SUMMER SPECIAL - 10% OFF Any Home Improvement! SPECIALIZING IN: RESIDENTIAL BRICK and MASONRY • REMODELING • EXTENSIONS & DORMERS • KITCHENS • BLOCK • TILES • STOOPS • DRIVEWAYS • TREE REMOVAL • PAVERS • ROOFS • WINDOWS • DEMOLITION • WATERPROOFING • FIRE & WATER RESTORATION • COMPLETE HOMES & BUSINESS MASONRY

We Do The Complete Job Inside or Out

LOCAL FAMILY OWNED BUSINESS FREE NO OBLIGATION ESTIMATES!

516

352-2754

We will take care of all of your insurance claims

100’s of satisfied customers to the area

Quality Work • Competitive Prices CALL: (cell) 516-384-8155 www.varhomes.com WE WILL BEAT any legitimate estimate

Licensed & Bonded: Nassau #44061-H, Suffolk #1276743, NYC #H1860870000, city of Long Beach #5846

Email: varhomes@gmail.com No Salesmen, Deal Directly With Owner

43


44 Blank Slate Media Newspapers, Friday, July 12, 2019

FREEDOM

to live carefree

Imagine having the luxury lifestyle you deserve without the concerns of living alone or maintaining a home. At The Bristal, we are committed to helping seniors stay independent while knowing that expert care is there if needed – delivered by a team who treat you like family. Every day you’ll enjoy a vibrant community, countless social events with new friends, and the unmatched services and amenities you’ve come to expect from The Bristal.

SCHEDULE YOUR VISIT TODAY!

EAST MEADOW

WESTBURY

516-219-8190

516-226-9585

For a list of all locations in the tri-state area, visit: THEBRISTAL.COM

Licensed by the State Department of Health. Eligible for Most Long Term Care Policies. Quality Communities by The Engel Burman Group.


Blank Slate Media Newspapers, Friday, July 12, 2019

45

SAVE THE DATE

10th Annual

MONDAY, August 5, 2019 Glen Head Country Club Glen Cove Road, Glen Head, NY 10:30 a.m. - 4:00 p.m. 10:30 am. Shopping Boutique Opens, Noon Luncheon and Program 1:30 pm Mah-jongg, Canasta and Bridge Bring your own Mah-jongg sets & cards

or contact Jill Abrams Lapensohn, Director of Northeast Development, at jill@jafco.org for further information.


46 Blank Slate Media Newspapers, Friday, July 12, 2019

 

  

 



     

               

      !"   !"#$  %  &



 

  %& '  '(    )*  (  + " $+ ! ,     -

 !   ! & '", ) %/ (

, !" #& 

 ! " #  " $# ' #  "#  ( )(*+ ' #  "#"(

,#- #./  0 # &/  #.-"

  

     %-  /  7 2 ! ,

   ,, ( **',  3 ,"% 

 A  9!: $:     8#    +  (   # -



2   #,  #!& , ## & , ,#-  # #- ,  .- #, & ,   , ,#- #- 4  ",  ,

 #, ,#- #4  ,-#,#-,  /,  ",, ,  ,#        , / ,#?.  #>  &  "4  *:.*,   .5# , # 819!,  *  # ," ! &4# ' ,!   # ' ,!  / *::;*+ !"# , ,#!  @6#  ,# 4  @   #  "  "#&,,# & <# #?&,,# ,#-  ,. ,#-, # &4 &  #> *.*, A%# ,     %# #%#  B @%#  / @   #,#' , %,## & 8#2 #- # #38  // ,#-.3      -C .* >  > #  #,    /  ,-  ,# .  '  #   #D  /$!  ?, ,E 4;#-  &   ,# *? #,# / ", , A2,- 5

%   :: 7/DA' (/! FB #A%# , %# #%#  .B &D  ,     %  2#-5  # %  #  ;,#G# # ,",#-,#, & # #" ,4 & , ,    #D  #  ,#-. 

   .  + " $#+ ! ,  !/$!   /!!

 !/$!   1,&&  2#- (

, !"#3,  

 4 &  '", & 

      

  

2#   (  5  % )6/ 4789:!+ 0;< !:9

 

 6 * 0=

@3  <- =(  5  ;&    + " $+ ! , /9  $/ 



2# 0  ( - #3

   A +;* #!"+;*  #!"#%,  =<#

;&   (  + " $+ ! ,  $/$!  9/$!

    25$6&4  $  # '& , , & *++&/   # /, 7#,# 

 ?/$!   1,&&  2#- (

, !"#& 



  ! , %& '  '(    )*   + " 9+ ! ,     -

 9/9   1,&&  2#- (

, !"#& 



%& '  0(  1 )* 23 4 

 

; ;;/ 7 @ % < 2  

 !   ! & '", ) %/ (

, !" #& 



  

  25$6&4  $  # '& , , & *++&/   # /, 7#,# 

< 0- < (  2

 

     25$6&4  $  # '& ,  , &*++&/   #/, 7#,# 

 

   A ', ' # :1 

', ',



"    ( B& # C 5 7-

  ' >  ,  !" # -

 

     2 ! ,

   !9! ( &# ?  !"#  ,#- #

   9,:!  9,:!  

          .,#4 0,"# 

,#.&=+*;:?; +

   ; ,

   ?  4!", ,#' &  2,# - " F #, 

;  DB 

03 =-/ 2# )E( & 

3 73/ 2  2&

   $ 6" - # &   * , !"#   #



     (    4

   &/    ( *?+  %   (  ,#- #.  /  0# &/  #.-"

  

>2#   5 C>    $, 2 #& #' ,#%   ' ,#% (   ,#- #

 /$!  $! % ,#-#  * %  F#"



 5 4 + #+ 4&+  6+  #+  2# -+ # 6

 9   ! !&, ",' , *    !&, ",



 

%& '  0 1 )*



"# <#

%& '  &  F -&  6 ;( E

%   -   3 @- C  "  ? 1  , % ,&* ##, ( 1 

,

%-  /  7(  2 ! ,  A  9!: :     8#    +  (   # -



 



#&   ; 2# -/ ! , 

   +,!!A!  / -% (   / -% ( (   / -

 

HHHHHH /  / &  "# #,# #,#/ ,# .HHHHHH$, ,  0

/ IHH ,  ##.&H ;"# H

G %5#

   

            


Blank Slate Media Newspapers, Friday, July 12, 2019

47

 

  

                 

 )     *+ ' ) 

 

 

"7<1(#<1  9<= $  "5, <   % $   $>11 $  5   :  



   

    ! 

"#$     !  "   #   %& ' 

"# $ %&'

 $



 

" % ( )  *  $ +  %,  . ,, $/   - 

 23 4 - 56  - 

7(..1  ,  , (   ,5,   '&1  

,

=%  ,+     9<=, 8 $  "  0 ,+ -    8

=,$ ,$,  $ 8 ,(0 4 0 $-) %9 4 88, -  ?$

=+ 0   ,+ %  5, %@0$A5, :  B  $ $ C 8D  , E- 

#%  ,+,   $F   ( &&! , :0 /    $ "  $ 5$ 

,,  ,   "  ,   -5,  +B$  , 8         "   -G( >>>2'

=  8  , >1,   " +,$, ,       , , $  ", F  %  ,+, %,  -

 

 ! 8 +

,!   -   &  

.  / #(/ #"   % $ 4 5     22    ,+   *   -,  /   .,$-  61317'22

 

 !  (  ! 

    5 ) * '

$ + 0$$

  12 ,3', 0   



 

 

0 +   -   

## #(#.1  5,  

8 &32 ,   +   / 8 

" 5,    ,8 !!!     

 4 - @

">

0  $/ '2  "/  #  

> +!  :- 8  

$ %#,  5, +   >>G    ,     + - $.$", /    - $613!2!!!!  

 

- >-,   0)   /44) 

""($ 5   ;H  "" 5,  7>2 ,      

    //9):4

/)%  '   ;      .1( "<1 5,  $ !72    /  

 

 !  (0 !8 

"   *  &!9:  +  / 8  - . ,,$/   - 



   - ; 4= % 4

"> 0   "0 $/  7&  +  $



 ! 

3 A 

$#.1( <.1 5,  $ !72    /  

 

" 72;2&72   2& , 

  3'# 4  2 ?   5  )    ##  % % $ 8   &1%  +  % / -$ .$ / 8  -" 613;73;'''



 8 )   > @

<<.1(#"$ / #$(/ 7# 0, "  & 0$,0  ,  -D",./ D",- $6C3!E!!; 2'2' - 5B%& * B8+ @ B  

 $ %&'

 $



    

" % % $ 8   &1%  +  % / -$ ./ 8  -" 613;73;'''



 



-)  )(-

 )'   $.1( ..1  5,  

8 &32 ,   +   / 8 

 -'48 C)      ;  * (' D 

@ ' 8 

$$(##  ,  , (   ,5,   '&1  

,



. > 0( ,,   )  ,0,  72% ,

9



*8

" %  +  72     8 



  

" %,!>!>+    ,



/ 9  ?  86 0*+; ?>  "(7 5,  $ !72     



 

* =/!3,

$# %#,  5, +   >>G  ,      + - $.$", /  - $613!2!!!!

> - @

"> 8112 $ +  %, 

%  @: ;   4



$ 5,  $ !72     



IIIIII5, 8    $          -IIIIII<.,JII,   - $I ;  I

 


48 Blank Slate Media Newspapers, Friday, July 12, 2019

CROSSWORD PUZZLE

Honor Flight L.I. to hold reunion of vets Honor Flight Long Island will hold a reunion on Aug. 10 at the American Airpower Museum, to celebrate local World War II and Korean War veterans who took a free, early-morning flight on May 11 for a one-day tour of their Washington, D.C. military memorials. They also saw the Tomb of The Unknown Soldier and were greeted by officers from their respective branches. Our heroes landed late that evening at Long Island MacArthur Airport to a raucous welcome by the Long Island Bagpipe and Drum Band and to thunderous applause from hundreds of family and friends. The veterans’ tour in D.C. was sponsored by Honor Flight Long Island, a local, non-profit chapter of the national Honor Flight Network. HFLI organizes, hosts and pays for the biannual flights each spring and fall. As part of the day’s events, veterans and their guardians (volunteers who make the trips possible) fly to BaltimoreWashington International Airport, where a motor coach takes them to D.C. and the WWII, Korean and Vietnam memorials, Arlington National Cemetery, Air Force, Navy and other memorials. Each Honor Flight trip transports 50 veterans for free, thanks to donations from across Long Island. They are accompanied

by 50 guardians; next generation, ablebodied volunteers who donate $400 to offset costs. If there is no family member to act as a guardian, HFLI has a list of volunteers ready to step up for the privilege and donate the required fee. HFLI is now accepting applications for future flights from WWII, Korean and Vietnam War veterans. Veterans from other theatres of conflict with life-limiting illnesses are encouraged to apply for future flights. HFLI’s Gala Honor Flight Reunion will be held on Saturday, August 10 from 11 a.m. to 1 p.m., at the American Airpower Museum located at 1230 New Hwy., Farmingdale. Help applaud veterans during the Ceremony of Honors, as each is presented with their own tribute journal full of photographs taken during the May 11 D.C. tour. In addition, an official U.S. Military Band will play the iconic musical themes from each branch of service. The public, family and friends are invited to come early to can marvel at the museum’s fantastic exhibitions of military aircraft from WWII and beyond. To apply for spots on upcoming flights or become a guardian, go to www.honorflightlongisland.org or contact Virginia Bennett at 631-702-2423 or vbennett@ southamptontownny.gov.

Honor Flight Long Island Holds August 10th Reunion of Veterans Who Took May 11th Flight to Visit Washington D.C. Military Memorials

Motorcycle run, car show to aid veterans On Sunday, July 14, thousands are expected to gather in Holbrook to support veterans with the seventh annual Kick Stands Up motorcycle poker run and car show. The event will have bikes and custom cars on display for those in attendance to check out, along with live music, food and drinks, vendors and raffle prizes. Admission is free for those interested in attending, but

those who want to participate in the motorcycle run or put their car on display must pay to register for the event. Kick Stands Up will be held at the Four Seasons Sunrooms & Windows located at 5005 Veterans Memorial Hwy., Holbrook. The motorcycle run will begin there, making stops in Oakdale, Ronkonkoma, Shirley and Continued on Page 49


Blank Slate Media Newspapers, Friday, July 12, 2019

49

Paramount comedy Motorcycle run,car series kicks off show to aid vetertans The Paramount comedy series is scheduled to begin on July 27, starting with Long Island native Jim Breuer and his residency at the venue, “Comedy, Stories & More.” The Paramount’s comedy series consists of 16 shows and will continue through the second half of the summer into the fall months, concluding in November. The full comedy series schedule includes: Saturday, July 27 at 8:00 p.m.: The Jim Breuer Residency “Comedy, Stories & More.” Thursday, Aug. 1 at 8 p.m.: Jay Pharoah. Friday, Sept. 6 at 8 p.m.: Pablo Francisco. Sunday, Sept. 8 at 7:30 p.m.: Kevin James. Saturday, Sept. 14 at 8 p.m.: Ryan Hamilton. Thursday, Sept. 19 at 8 p.m.: “Mr.

and Mrs. America” Andrew Dice Clay and Roseanne Barr. Sunday, Sept. 22 at 8 p.m.: T.J. Miller “Touring in Perpetuity” Tour. Friday, Sept. 27 at 7:30 p.m.: SteveO “The Bucket List.” Friday, Oct. 4 and Saturday, Oct. 5 at 8 p.m.: Bumping Mics featuring Jeff Ross and Dave Attell. Friday, Oct. 25 at 8 p.m.: “Kreeps with Kids” comedy tour with Robert Kelly, Ron Bennington, Jim Florentine and Rick Vos. Sunday, Oct. 27 at 7 and 9:30 p.m.: Bret Kreischer “Body Shots” tour. Saturday, Nov. 2 at 7:30 and 10:30 p.m.: Ken Jeong. Tuesday, Nov. 5 at 8 p.m.: Norm MacDonald. Tickets can be purchased through TicketMaster or at The Paramount box office. Box office hours are Monday to Sunday, 10 a.m. to 6 p.m.

Continued from Page 48 Coram before returning to the starting line. The event starts at 9 a.m. and runs until 3 p.m., with kickstands for the motorcycle run going up at 11 a.m. All proceeds from the event will benefit the Suffolk County United Veterans project, providing housing and support services for at-risk and homeless veterans. For more information, contact Ruth McDade with Suffolk County United Veterans at 631-4717242 or rmcdade@mhaw.org.

M A K I N G YO U R R E A LT Y DREAMS A REALITY MATTHEW DONNO Licensed Real Estate Salesperson Leading Edge Award Recipient 2018* O: 516.627.2800 M: 516.382.2070 matthew.donno@elliman.com

© 2019 DOUGLAS ELLIMAN REAL ESTATE. EQUAL HOUSING OPPORTUNITY.

elliman.com/longisland

110 WALT WHITMAN ROAD, HUNTINGTON STATION, NY 11746. 631.549.7401.*AT DOUGLAS ELLIMAN REAL ESTATE.


50 Blank Slate Media Newspapers, Friday, July 12, 2019

READERS WRITE

Discouraging tolerance center support shameful

A

s a rabbi in the Lake Success district of Great Neck, I was not actively engaged in the recent Village of Great Neck elections. However, the unwarranted personal attacks and threats against Steve Markowitz – and by extension the Holocaust and Tolerance Center – highlight some disturbing trends within our Great Neck community. I have known Steve Markowitz for many years. He has always been, what we call in Hebrew an osek b’tzorchei tzibbur b’emunah –an individual genuinely and faithfully dedicated to the needs of our community.

Steve has served with distinction as president of a local synagogue, and as a passionate defender of Israel and Jewish causes. He has actively collaborated with a diverse group of religious and political leaders to combat antisemitism and all forms of racism in our county. Following an anti-Semitic incident several years ago, it was Steve who initiated a partnership with the Great Neck School District to introduce the Holocaust as part of the curriculum. He has cultivated strong relationships with a diverse population within our town and presently serves as chair of the Holocaust Memo-

rial and Tolerance Center in Glen Cove. The disgraceful attacks against him do an injustice to Steve and to anyone dedicated to fighting hatred in all its ugliness. As a longtime Jewish activist, I understand and appreciate the efforts and passionate concerns of individuals and groups who speak out against intolerance, racism and religious discrimination. There are many legitimate reasons for all of us to be vocal and assertive when it comes to combating antisemitism and any other form of racism within our town. However, I would caution against impulsive reactions or

threats which are ill-timed and misdirected. Criticizing Steve and threatening to discourage people from supporting the highly acclaimed work of the HMTC, is counterproductive and shameful. There are other more effective, constructive and positive ways to make our voices heard and to exercise our influence. Great Neck’s diversity should be a source of strength and not a cause for ignorance or selfaggrandizement. There are too many of us, who refrain from any community responsibility and only speak out (often vituperatively) when an incident touches

our backyard. Attacking the character of noble, community-minded individuals like Steve Markowitz violates, for me, the Jewish prohibition of causing someone public shame. I suggest a more positive and global approach: Establishing community forums and dialogues, which will further communal esprit d’corps and provide opportunities for needed dialogue and conversation. The era of intolerance must end. Michael Klayman Rabbi Lake Success Jewish Center

A spokesman for An advocate for tolerance Jewish values W

W

e have known Steve Markowitz for close to 20 years as a fellow congregant at Temple Israel, as a former president of the Temple Israel congregation, leader of the Great Neck Democrats, and chairperson of the Holocaust center. To accuse him of anti-Semitism or anti-Jewish orthodox beliefs defies logic and is the height of absurdity.

Steve Markowitz has been nothing but an asset to the entire Jewish community, and to the town of Great Neck. We can think of no greater blessing to the Jewish community and no person better able to articulate or support Jewish values in these fragile time. Cheryl and Seth Moin Saddle Rock

e write in response to the recent vicious and completely unwarranted attacks on Steve Markowitz. We have lived in Great Neck 49 years, and have known Steve for a great portion of these. He has been a community leader in various capacities, whether in his village, his temple, as leader of the local Democratic Party affiliate, and, most recently, the Holocaust Museum and Tolerance Center. He has been a strong advo-

cate of tolerance in the community, and, in particular, has been actively involved in supporting dialogue among all branches of the Great Neck Jewish community. He worked closely with us in our attempts, some years ago, to have a new Main Library building designed and built reflective of the needs of a highly-literate community such as Great Neck. (Unfortunately, we were not completely successful in that goal). We have found him to be

completely honest, outspoken with his opinions where necessary, and a strong advocate of soliciting community input and opinions. Great Neck needs more individuals of Steve’s honesty and integrity. As we noted above, these attacks on Steve’s character and leadership qualities are unwarranted and unfounded. Their perpetrators should apologize. Mischa and Charlotte Schwartz Great Neck

Model of decency Markowitz elevated center and integrity In regard to any articles casting doubt on Steve Markowitz’s intentions and political and religious affiliations, I would like to report my support for Steve’s involvement in the betterment of Great Neck. I was a very early founding member of HMTC and Steve was most supportive of our goal: the teach young people about the dangers of intolerance. We brought in middle and high school students from schools in Queens, Nassau and Suffolk for intensive all-day tolerance workshops. The teachers were grateful and students left with heightened awareness. Steve was most supportive of this program. He certainly never espoused “antireligious animus”. I never heard any claims about the Great Neck Library From Mr. Markowitz. As head of the Democratic Party,

Steve never took any antagonistic positions toward any groups. I have known Steve for many years. I was on the board of The Holocaust Center and an Assistant Superintendent of Schools in Great Neck for 11 years (after teaching and being an assistant principal in Great Neck). At no time during my life and career in Great Neck have I heard Steve disparage any group of people from any community. I don’t know what this is all about, but Steve Markowitz deserves to be viewed as a model Great Neck resident and a spokesman for decency and integrity Arlette Sanders, PhD Former teacher and administrator in GNPS Former Director at HMTC North Shore Towers

I

have been affiliated with The Holocaust Memorial and Tolerance Center of Nassau County (HMTC) since it opened in 1992. Under HMTC’s first two chairmen I was the center’s treasurer. For the past seven years, I have been the vice chairman under our third chairman, Steven Markowitz. I have known Steve since he became an HMTC board member 15 years ago. I was shocked and saddened to learn of the recent attacks, the hate mail, etc. and the anti-Steven comments, and the request that Steve be removed from the chairmanship of HMTC. This is not the Steve that I know. This to me is politics at its worst. Steve has donated his

time and devotion to HMTC to bring the center to new heights. Steve stands behind the Center’s Mission Statement: “To teach the history of the Holocaust. We teach about the dangers of anti-Semitism, racism, bullying and all other manifestations of intolerance. We advocate respect for every human being.” This is the Steve that I know. Under Steve’s leadership HMTC has become highly respected and is constantly requested for our programs. Currently, HMTC is working hard in the Great Neck schools dealing with anti-Semitism, and intolerance between all races. Under Steve’s leadership of our small but devoted staff, we run our programs for the police department, nurses,

attorneys, teachers, students and more. We have had many different speakers come to the Center to tell their story. We’ve had the Yazidi refugees tell about the current genocide against them. And we had the South Korean “Comfort Women” tell about the atrocities by the Japanese during WW II. I invite the anti-Steve people to come to the center and sit in on a bullying program because we all need to get along by discussion. Sit down with Steve. Learn who he is and what he stands for. I know Steven Markowitz and I’m proud to be his vice chairman and honored to be his friend. Neil Tannor Roslyn


Blank Slate Media Newspapers, Friday, July 12, 2019

51

READERS WRITE

Mess at Mill Pond should be cleaned

I

have lived on Mill Pond most of my life. Since the town had a group come in, they messed up the pond. Never have I seen it so bad. When I was younger you could walk around the pond.

My father crabbed and got eels. I ask every one to come and see the mess. And the smell is so bad. Please, someone do something. Grace Bellomo Port Washington

Religion’s role in Wiesenfeld brings out worst attacks scary G

G

reat Neck, please stop and put on the brakes! I am saddened and shocked when someone targets and denigrates anybody, let alone Steven Markowitz, a community advocate whose longstanding role at the Holocaust Memorial & Tolerance Center speaks to

his dedication to remedy hatred aimed at human beings. The religious undertow of these recent incidents makes it more frightening. True power is love and peace. Are we working to achieve that power? Michelle Schimel Port Washington

reat Neck, like our country, has become divided both by political and religious interests, led by the self-proclaimed Pied Piper Jeffrey Wiesenfeld. Wiesenfeld leading the band in opposition of all those that oppose his opinions on both politics and religion, is bent on destroying anyone and everyone who does not agree with him. He relishes the idea that it’s his way or the highway. Well, I have enjoyed this community for almost three-score years

and never have I seen a community so divided. We came to Great Neck with common interests in education,in beauty, location, neighborhood safety; yet we have a man who distorts the truth, corrupts the minds of manyto turn good people against good people, friends against friends telling us how we should practice our faith our religion. Wiesenfeld’s observance of our common faith violates the very principle of Jewish law. We shall

not speak disparagingly of others, violating Halacha. He poisons the minds of good people with his corrupting thoughts. He purports to have the only good thoughts and the only way that one should believe. This self-righteousness is the poison. He has created trepidations and fear; he is not a problem solver but a problem maker. Charles Schneider Great Neck

No better man Markowitz should step than Markowitz down as center chairman

I

have known Mr. Markowitz for more than 40 years as a neighbor, a friend, a business associate, a twotime speaker at the Rotary Club of Great Neck, as the leader of the local Democratic Party, and as the head of the Holocaust Museum. In every capacity, he is the consummate gentleman: honest, friendly, punctual, generous, etc., and to accuse him of

acting in any way contrary to what I’ve stated here is plain folly – because the truth will always out, and will reveal the true character and motive of the attackers. I am not so naïve as to believe that there are no other men as good as Steve Markowitz, but you will never find any that are better. Michael Flamhaft Great Neck

For your latest community news visit us 24 hours a day 7 days a week at www.theislandnow.com

T

his is a classic example which law professors often use to show one of the categories that invalidates the testimony by a witness. Mr. Jones sued his neighbor, Mr. Smith, claiming that he had lent his antique vase to Mr. Smith, but when Smith returned it to him, it was cracked. “Your honor, the case should be dismissed,” Mr. Smith said at the trial. “First, I never borrowed an antique vase from Mr. Jones, and second, when I returned the antique vase to Mr. Jones, it was in a perfect shape and had no cracks,” Smith professed as his defense. Obviously the judge rules in favor of Jones as Smith has lost credibility due to assertions of inconsistent statements about the same event. The case of the antique vase is similar to Steven Markowitz’s 2015 campaign e-mail. According to a July 5 article in the Great Neck News, “In an earlier conversation with Blank Slate Media publisher Steve Blank, Markowitz said he did not remember writing the email.”

However, Markowitz asserted in a second statement, “As for the email from 2015, Markowitz said he never wrote it.” Both statements “not remember writing” and “never wrote it,” are inconsistent assertions about the same event which quashes Markowitz’s credibility. What makes the situation even more depraved is that the email was sent while Mr. Markowitz was the chairman of the Holocaust Memorial and Tolerance Center of Nassau County, an organization with the mission of promoting tolerance: “I think the callers should tailor the script according to whom they’re talking. Have no reluctance to tell people that you know that this election is about an attempt by right wing Orthodox groups to take over the village. Most people are unaware and are generally apathetic but not when you scare them a little” was the message he sent to the campaign members of the previous mayor (Great Neck News, June 14, 2019, page 22). On a Sunday in late March there was a solidarity rally against antiSemitism at Great Neck’s Village

Green. At times, Steven Markowitz was seen standing on the platform next to the officials. Needless to say, after what has transpired, he no longer could be invited or attend a similar event without causing controversy, protests and possibly boos from the audience. Clearly, after his “scare them a little” e-mail and subsequently by making the inconsistent statements about the same e-mail, he has lost his “credibility” to many. It is foreseeable that should Mr. Markowitz be present as an official in a future event similar to the event in late March, it only could do harm instead of healing. It would bring heartache especially to those whose families were affected by the Holocaust. Does the Holocaust Center really need such a controversial individual as its chairman? Mr. Markowitz not being involved in the Holocaust organization would be a win-win situation for all, better sooner than later. Leon Manoucheri Great Neck


52 Blank Slate Media Newspapers, Friday, July 12, 2019

READERS WRITE

Markowitz unfairly attacked in my race

I

ran for mayor of our fine village this June. It was a brief five-week campaign that we ran on the issues I thought were important to our community. But instead, the brevity of the campaign made the community’s lack of familiarity with me the issue. I lost the election and now advocate for peace and harmony. Now, in the election aftermath, individuals attack my campaign and its supporters for losing in a most unsportsmanlike, foul manner with a message of hate, projecting their own intolerance for others. In the utmost height of intolerance, individuals attack Steve Markowitz, the chair of the Holocaust and Tolerance Center, for supporting a non-Jewish candidate, a Chinese-American veteran for mayor and a black woman

for trustee. Steve Markowitzis a man who has worked tirelessly to fight intolerance across Long Island and New York, from helping kids in our schools stand up to bullies and intolerance, to fighting intolerance in our backyard. And, for this effort, he is now being attacked. These attacks and threats against Steve Markowitz are unjustified, reprehensible, divisive and damaging to the future of our community. My campaign was focused on the issues and calls for a debate were unheeded.We never at any time issued any messages of hate of any kind, including anything anti-Orthodox or anti-Persian. Nor did we anonymously call rabbis with messages of racism and lies, leave hate literature at synagogues, nor write fraudulent

racist letters to the press to rile up the opposition. Not a single message of hate was directed at the opposition. The only messages of hate were to rile up the opposition. This was only done to my campaign while I stayed on the issues and tried to have a debate. Also, individuals in our community have fabricated a partisan fight from this non-partisan election.Personally, I am a political moderate and have been a registered Republican and Democrat. I have also worked for both Democrats and Republicans. I care about issues, not parties. Of my trustees, one is a Republican/Independent, the other a Democrat. However, at no time was there ever any partisan involvement in my campaign. I worked with Steve Markow-

itz and hold him in the highest regard. I worked with Ben Meed at the American Gathering for Jewish Holocaust Survivors to build their online presence. I gained an understanding of the horror of the Holocaust and I have made an effort to impart this to my children, before I ever thought of moving to Great Neck. I’ve talked with them about the horrors of the Holocaust, that there are even people who would pretend such horrors never happened, that this is something humanity must never forget, and that we must fight at every turn. I’ve taken my children to a Holocaust survivor book reading and to a Holocaust Memorial and Tolerance Center benefit. This event my youngest child found so moving she initiated a Facebook fund-raiser, rais-

ing $95 for the center. Also, the Great Neck Chinese community has an excellent relationship with the Holocaust Memorial and Tolerance Center, which Steve Markowitz has been instrumental in building. He is a man who has long worked effectively to build peace and harmony in our community beyond politics, for the greater good, for all of us. Steve Makowitz is an individual who I respect and admire. Steve Markowitz is an honest, selfless leader. I believe in him. The election is over. The rancor is done. We must move forward and strive to work together for the greater good of our community. James Wu Great Neck

Bral is mayor for only some – not all

O

ur once quiet, nice, idyllic old village of Great Neck has slowly eroded over the past few years. We talk, we put up signs, our schools have neon signs lit up against bullying and hate. Our library has a poster “I pledge to not remain silent to hate, intolerance or violence.” Not in our town, yet sad to say this past June election proved otherwise. I have seen four mayors come and go over the years but never, never so much controversy, hysteria, bad mouthing to point of lies and slander against James Wu and his two trustee candidates’ party, Village For All.

Note the word “all.” Mayor Bral’s Alliance Party was supposed to be responsive to its residents. That, to me, means all residents, not a portion of our population. I do not blame so much our trustees, Anne Mendelson, Steve Hope, Norman Namdar or our Deputy Mayor Bart Sobel. No one speaks up, they just occupy the seats at the board meetings, which leaves me to believe that they have been instructed to sit there and not to engage with the public who might question why Bral purchased a piece of someone’s back yard at a cost of $150,000. Because the owner didn’t want to pay tax on it? Why

are we renting a public parking lot for $3,500 a month and a lot of East Shore, also a car dealer, for $5,000 a month when Great Neck public school rents to a car dealer the Watermill property for $20,000 monthly? Why make a commitment in the back room to a school board member B.B. to sell our historic village hall on the pretense of overcrowding at Baker School? Why does Bral say his goal is to keep Great Neck an affordable place to live — for who? Certainly not the middle class. Take Millbrook Court and Academy Gardens, for example. Why has what was supposed to be a $12,000 to $15,000 Wool-

ey’s Lane footbridge for a few to cross climbed to $200,000? Yes, $200,000. Why pay VHB $100,000 for a plan that we had spent $85,000 on previously to the same firm? Why does, after four years, the construction of a temple next to 7-11 still remain a giant hole with few steel girders and why does 733 Middle Neck Road have three derelict buildings that look like the London Blitz in World War Two? I could go on and on back to the election. Now we live in a village with criminals. I say criminals because running around under cover of darkness, trespassing on homeowners prop-

erty, vandalizing and stealing what belongs to someone else is a crime and whoever was responsible should be prosecuted. I hold Mayor Bral’s Alliance Party responsible. He could have sent word out to stop these tactics but he chose not to. I understand Mayor Bral’s background. His growing up in an authoritarian country, Iran, but that cannot and should not work in our Village Hall. We need to install term limits, fair and decent behavior in future elections. Jean Pierce Great Neck

Trump and Eisenhower as patriots

A

ccording to what we have heard, Donald Trump is the most patriotic president since Dwight D. Eisenhower. As presidents, both stood as the head of our military. Eisenhower was the 34th president of the United States, serving two terms, from 1953 to 1961. As a five-star General in the United States Army, he served as the Supreme Commander of the Allied Expeditionary Forces in Europe during World War II. No need to say more about President Eisenhower’s patriotism. Donald Trump, the 45th President of the United States, was born in 1946, shortly after World War II had ended. Back

in those days we had what was called a “draft” which made all young men between the ages of 19 to 26 eligible to be drafted for a military service requirement of 21 months. Deferments from the “draft” were given to full-time students, to young men whose service would cause hardship upon his family and to individuals who had a medical condition that would make it difficult to serve. In 1964, Trump began his college career at Fordham University and after two years he transferred to Wharton and graduated in 1968 with a B.S. in economics. During those four years, Trump received four deferments, one for each of the

years he attended college. The United States entered the Vietnam war in 1965 and involvement ended in 1973. While in school, Trump in 1966 was deemed fit for military service based upon a medical examination and in July 1968, after graduating Wharton, a local draft board classified him as eligible to serve. However, in October 1968, he was given a medical deferment due to “bone spurs” in his heels. It didn’t hurt that his father, Fred Trump, a successful builder in his own right, preferred that Donald join him in the business. Only recently did the two daughters of the New York podi-

atrist who had made the diagnosis say that their father did it as a favor to the doctor’s landlord, Fred Trump. During the war, there were many young men who opposed the war and staged numerous protests. Some even went to Canada to avoid being drafted. Whether right or wrong, there was substance behind their behavior. But what about all the young men who were not as privileged as Trump who served and suffered serious injuries or died? They did not have the connections to keep them from being drafted. For all Trump supporters who fought in the war, why aren’t they questioning

the fact that Trump evaded the draft. The fix was in. The bottom line: Donald Trump, the President of the United States, was in fact, a “draft dodger.” And now, he has the fate of other young men in his hands if he decides, even on a whim, that we should once again go to war. Veterans who voted for Trump, you should be ashamed. How would you have liked to have him in the foxhole with you? Do you think he would have had your back? No way, especially since he was suffering from “bone spurs”. Alvin H. Goldberg Great Neck


Blank Slate Media Newspapers, Friday, July 12, 2019

53

READERS WRITE

Unjust attacks against good man

I

have known Steve Markowitz for 31 years. He is the most honest, upstanding, genuine, caring individual in the Great Neck community. He has worked arduous hours at the Holocaust Center because he believes so strongly in protecting people’s rights against tolerance, bigotry and anti-Semitism. It amazes me that others can write such hurtful and untrue statements about a man who loves his community dearly and now is a victim of a slanderous and unjust attack. Please reach out to close members of the community who have had the pleasure of

working closely with Steve for such a long time. At that point, you will hear the truth about this upstanding, honest and ethical individual. I know the real truth will come out in Steve’s behalf once this issue is properly investigated. Steve’s reputation is pristine and anyone who truly has had the pleasure of working with Steve will agree. This incident is just a personal attack and an unnecessary smear campaign. I know Steve’s name will be exonerated in the days to come. Sharon Tracy Port Washington

Markowitz leads anti-Semitism fight

I

t has come to my attention that Steve Markowitz has come under attack from members of the Great Neck community. Even worse, they are smearing Steve as being anti-Semitic. I’ve known Steve since I moved to Long Island 18 years ago. I’m a personal friend of his, have worked professionally with him, and teamed up with him for charitable endeavors. Steve is one of the finest individuals I’ve ever met. He has tremendous integrity. A wonderful family man. He is a pillar in the community for so many reasons. Most important though, is his uncompromising stance against anti-Semitism and concern for advancing Jewish issues locally and nationally.

As it is a major area of advocacy for me, Steve has been a mentor to me in the area of fighting anti-Semitism. He has stood with me on many initiatives relating to fighting hate and he recruited me to join the board of the Nassau Holocaust Museum. Serving alongside Steve on the board was an honor and privilege. Anyone who thinks Steve is anything but a leader in relation to Jewish issues in our community is truly ignorant and not worthy of participating in the debate. I have so much more to say but will leave it at that. I’m happy to speak further on the topic at your convenience. Brad Gerstman Roslyn

A shameful campaign

I

read with utter amazement the recent article regarding Steve Markowitz that was written in the July 5 issue of the Great Neck News. The disparaging way in which Steve Markowitz has been described as well as the letters to the editor that were published from individuals who seem to have some other agenda are shameful. This is an attempt to under-

mine the reputation of a prominent and well-known citizen who has been a staunch supporter of Jewish causes for decades. I’ve known Steve for almost 30 years, and I can safely say that Steve is someone who gives his time, effort and energy to institutions and individuals who advocate for the greater good. I know him best as past president of Temple Israel of Great Neck where he put great emphasis on

bringing the Conservative, Reform, Orthodox and Sephardic communities together. The people involved in this terrible campaign against Steve have no idea who he is or what he has contributed to the Great Neck and Long Island community, and to the Jewish community as a whole. He doesn’t deserve this. Sam Husney Great Neck

Standard bearer for tolerance

I

have been on the board of directors of the Holocaust Memorial and Tolerance Center for 25 years and know Steve Markowitz for 15 of those years. He has performed an outstanding job as chairman of the center. Part of his job is to fulfill the mission statement that includes the word “tolerance.” Never once did I hear him say anything against our Orthodox community or any other community. We have been asked for help

from schools, religious organizations, including the Westbury Muslim Center. We have taught 23,000 students, per year, from public schools and religious organizations from Queens to Suffolk County, including the Nassau and Suffolk County Police, universities, hospital staff, the message of the Holocaust. He has been a meaningful supporter for the State of Israel and has worked tirelessly to combat BDS and anti-Semitism. In my opinion, having

worked with Steve for those 15 years, he has always upheld the highest standards, and the false statements that have been published by scurrilous individuals who seeks political advantage by falsifying accusations against the righteous Steve Markowitz. Hopefully, we can expect more from you and your supporters than what has been falsely published. Murray Slimowitz North Hills

Divided VGN must be united

T

his is a very dangerous time for our Jewish community, both in the United States and around the world. Acts of anti-Semitic violence and harassment are at record levels. Israel faces unprecedented threats from so many international fronts.That is why I am so profoundly offended when political attacks and agendas undermine the need to be united and move forward as one com-

munity. Steve Markowitz has been a champion, both for our Jewish community and on behalf of the State of Israel. His leadership in Temple Israel, the Jewish Community Relations Council and as Chairman of the Holocaust Memorial and Tolerance Center has been essential for Great Neck and our faith. In addition, Steve has been pivotal in educating so many communities on Long Island and

building trust with them. Our Great Neck community has a very important role to play on Long Island and nationally in the battle for justice and against intolerance. We are at our best when we come together. The challenges before us demand that for ourselves and generations to come. Robert Zimmerman Great Neck

Markowitz victim Linking Sater, Chabad unfair of evil gossip S imply stated: why are we linking personal religious affiliations to a possible criminal’s ac-

I

n the wake of our contentious village election, a small group of people have indicted Steve Markowitz for spurious reasons. These people are guilty of lashon hara (evil gossip) and wrong about Steve. His contributions to our community are vast. I’ve know him for over

30 years. His leadership of the Great Neck scholarship fund, Temple Israel and the HMTC have been exemplary. I don’t think anyone has added more to the good fortunes of our community than Steve. David Levin Great Neck

tions? If every time the press ties an individuals house of worship to a possible criminal act the list could be endless. Can you imagine if News-

day linked each member of Congress’ or the state Legislature’s affiliation with their church, mosque or synagogue in headline form? I believe there would be a public outrage. But here in Port Washington, former resident Felix Sater’s actions constantly

bring headlines linking him to Chabad. Why should his religious affiliation be linked to presentday legal issues? If not all, why then one? Bill Ostrower Port Washington

For the latest news, visit us at www.theislandnow.com


54 Blank Slate Media Newspapers, Friday, July 12, 2019

READERS WRITE

Better times ahead for Nassau bus riders

T

he recent Nassau County public notice for a $20 million grant application to the Federal Transit Administration on behalf of Nassau Inter County Express bus system, which appeared in Newsday July 3, was great news. Our local bus system is a four-way partnership between fares paid by riders along with funding provided by Nassau County, New York State Department of Transportation and Federal Transit Administration in financing public bus transportation operated by NICE. They operate a fleet of 280 buses out of the Mitchell Field bus garage. NICE also operates a fleet of 122 Able Ride paratransit vehicles out of the Stewart Avenue facility. Both facilities were constructed by federal capital grants with local matching funds provided by Nassau County and the state Department of Transportation. It was the same funding sources for construction of the Rockville Centre bus garage, Hempstead Intermodal Bus Terminal and Mineola Intermodal Bus Terminal/Commuter Park-

ing Garage. All four of these investments combined cost almost $100 million. In today’s dollars, it would be far higher. NICE attempts to schedule bus replacements on a 500,000 mile or 12-year cycle, whichever comes first, based upon federal Department of Transportation guidelines. Since 1973, buses operated by NICE under contract to Nassau County are now on the fourth replacement cycle. Most buses operated by NICE are under 12 years old. This was not the case decades earlier when the average age of the fleet was closer to 12 years. Over time, there have been other capital investments, including compressed natural gas fueling stations, facility modifications to accommodate CNG buses inside garages, new fare collection equipment, automatic vehicle locator equipment, real time communications systems to notify riders for anticipated arrival of the next bus, shelters, bus stop signs and other support equipment necessary to run the system. Just like a homeowner, what is new

today requires constant maintenance, periodic upgrades and eventual replacement years later. Capital physical assets of any bus system (including revenue vehicles along with bus facility components such as HVAC, bus washers, paint booths, engine shops, bays, pits, lifts, doors, fueling stations, lighting, security systems and many others) eventually reach the end of their useful life based upon straight line depreciation and/or manufactures warranty. Significant changes in technology also require replacement of outdated equipment. In 2020, Nassau County has wisely requested $20 million from the Federal Transit Administration. These funds — matched by $2 million from Albany and $2 million from Nassau County — will pay for 23 Compressed Natural Gas replacement buses, 14 replacement paratransit vehicles, engineering and design services (for development of future capital projects), five replacement non-revenue dispatch, patrol or service vehicles, shop improvements to heating, ventilation, air

conditioning, CNG fueling station dispensing system improvements and bus area operations improvements and capital cost of contracting, which maintains NICE’s revenue fleet and support facilities in a state of good repair. We have come a long way over 46 years since Nassau County took control of all bus routes from a group of private operators in 1973. In 1973, Nassau County purchased equipment, routes and some facilities from numerous private bus operators, most of which were experiencing serious financial difficulties. These included Bee Line, Rockville Centre Bus Corporation, Utility Lines, Stage Coach Lines, Schenck Transportation, Inc., Nassau Bus Line, Hempstead Bus Corporation, Jerusalem Avenue Bus Lines, Universal Auto Bus, Roosevelt Bus Lines, Stage Coach Lines, Hendrickson Bus Corporation and others. Nassau County followed up that same year by entering into a lease and operating agreement with the Metropolitan Transportation Authority to continue

providing local bus service. This resulted in creation of the Metropolitan Suburban Bus Authority. Years later, the Metropolitan Suburban Bus Authority was followed by Long Island Bus and on Jan. 1, 2012, Nassau Inter County Express managed by Transdev. Many of the same routes operated by MSBA, LI Bus and NICE today can be traced back to the various private bus operators. Over that time period, Nassau County, Albany and Washington combined have invested over $740 million in capital improvements and almost $1 billion in operating subsidy. NICE services continue to be one of the best bargains around. It is a model, cost-effective suburban bus operator for others to emulate. Let us give thanks to the hardworking men and women of Nassau County Department of Public Works Transportation Division and NICE bus who make all of this possible. Larry Penner Great Neck

Everyone in Great Neck needs to be heard

A

s a resident of Great Neck for over 50 years, I have consistently worked within this community to bring people together. Anyone in this community who knows me is completely aware that, in every capacity, I have spent decades working with community leaders of all faiths to ensure that we celebrate and honor diversity and provide opportunities to work together and build a stronger community. I’ve done this work in partnership with Rabbi Robert Widom of Temple Emmanuel and other

friends within this community who share the same values that I do. People who fundamentally believe and practice creating a community that provides space and opportunity for people of all races and faith to thrive and contribute. My desire to see a community that honors and respects all residents is the reason why I wanted to join with James Wu and Harold Citron. Our vision was to bring community back to the Village of Great Neck, where people who have lived in this community for years do not have to feel un-

comfortable in their own community. Our goal was to create transparency and restore competence, integrity and morale in Village Hall and village government. Our vision for the future of Great Neck is not about spreading hate and division. The reality is there are people who have raised their children in this community and have been here for decades and they need to be heard. There are good people in Great Neck from various walks of life and our goal was to foster inclusiveness, acceptance and re-

spect for all residents. As long as I am a resident of Great Neck, I will continue to advocate for what I believe is right. I have been in this community since 1965 and I have watched people be completely pushed out and people who left on their own because they no longer felt welcome. I talk to residents from all ethnic backgrounds that have been here for years and talk about how much they don’t feel like it’s their community any longer. The fact that so many residents feel this way is unacceptable. It is a disgrace

to live in a community, pay taxes, and feel that you don’t belong in your own community. So please know, I want to make it very clear that advocating for all residents is about wanting to live in a community that is inclusive, not divisive. We are all human beings and my hope for the future of Great Neck is compassion will move us towards building a community where everyone feels proud to be a resident. Julia Shields Great Neck

Attacks on Markowitz harm community

I

continue to admire Steve Markowitz and his lifetime of dedication promoting tolerance and understanding amongst all peoples and for his ceaseless fight against antisemitism.His selfless efforts on behalf of many causes and total dedication to the Holocaust Memorial and Tolerance Center are a testimonial to his commitment.

He is amongst the most decent and accepting people I have known. To even suggest that he is disposed against any segment of the Jewish community, or disrespectful of any race, religion, faction or nationality would be ludicrous and laughable if it were not a serious matter Those (he or they) who

make this despicable charge and attempt to assail Mr. Markowitz’ stellar reputation, for whatever self-serving perceived advantage, does so with deliberate and complete disregard for the well being of the community. It has been reported that they are now attempting to leverage their distempered venom to dissuade financial sup-

port to the Nassau Holocaust Center, one of our country’s most venerable institutions. This vicious and unjustified bullying has no place in our town. People such as Steve Markowitz and so many other selfsacrificing citizen volunteers have worked so hard to bring the many beautiful, disparate and changing cultures and

challenging human nuances into one relatively harmoniously functioning mosaic. To allow the virus of hate and voice of dissonance to destroy our progress would be as a sin. Gary Ackerman Roslyn Former U.S. Congressman


Blank Slate Media Newspapers, Friday, July 12, 2019

55

READERS WRITE

Shame on Nike for caving to Kaepernick

N

ike has recently been in the news for withdrawing from the marketplace a new Independence Day-themed shoe featuring the Revolutionary War-era flag designed by Betsy Ross that was used on the original Fourth of July. The pusillanimous cowards who run Nike did this in response to a complaint from Colin Kaepernick who is well known for his hostility to American Patriotic Symbols. Not only will I never purchase another product from Nike but I am looking to purchase a shirt with the Revolutionary-era flag design.

I want to preface my remarks by stating that I am proud to be a fourth generation American, while my children are fifth generation and my grandchildren are sixth generation. I still get a thrill every time I hear the Star Spangled Banner, America the Beautiful and G-d Bless America . The web site Educational Background states that Mr. Kaepernick graduated from the Universality of Nevada with a degree in business education. The United States that he hates so much gave him an opportunity to make tens of millions of dollars playing football. While he was in college I won-

der if he ever took any courses in American or World History. Since I am unsure, I think that it would be advisable for him to visit England , Belgium , France or any other Country in Europe where World War I or II were fought. He should visit the graves of the brave soldiers that gave their lives protecting the freedom that he thinks so little of. He should also visit the concentration camps that we helped liberate. These concentration camps murdered millions whose only crime was that they were Jews. Mr. Kaepernick should learn about the hundreds of thousands of men and

women who gave their lives for their flag and of the many more who suffered traumatic physical and mental injuries. It was the United States that helped win World War I, World II and the Cold War. It was the United States that defeated the Central Powers in World War I, the Nazis and Fascists in World War II and the Communists in the Cold War. I am sick and tired of socalled “Entertainers” and “Athletes” whose only claim to fame is their ability is to excel in a small niche pontificating on the “shortcomings” of the United States of America. Their contribution to what

makes the United States great is minimal at best. Since Mr. Kaepernick thinks so little of the United States and the service and sacrifice of so many heroes that made it possible for him to play a game for a living, I would like to invite him to move to a county of his own choice such as Cuba, Venezuela or Iran. In fact, I am willing to pay for a one-way flight there so he can learn to appreciate the greatest country that ever existed, the United States of America. Jack Lipsky Great Neck

Review Macy’s, Brookfield plan carefully

D

onald Davret makes some good and valid points in his letter about the proposal to redevelop the Macy’s property in Manhasset. It’s unfortunate he couldn’t make the points without displaying such utter contempt for his neighbors, but I guess that’s our culture now. (Yes, I live in Munsey Park but didn’t realize I was a “Biddy” or “bloviator” until Mr. Davret so kindly pointed it out to me.) I signed the petition against the Brookfield proposal. But not because I’m opposed to change or development. As Mr. Davret points out, change and development are inevitable and historical facts, particularly in this area. I’ve been aware of this throughout my 27 years in Manhasset, as I’ve watched once-modest houses

maxed-out or demolished and 6-bed 6-bath mansions erected in their stead, cars multiply to choke every driveway and road, and wooded areas give way to landscaped tracts infested with leafblowers. But this is no longer 1680 – or 1929, or 1992 for that matter. Increased population density, inadequate infrastructure and an overheated economy mean that more people in a wider radius will be affected by any major development at the foot of Spinney Hill than would have been the case even just a decade ago. The impact of any plan to redevelop the Macy’s parcel deserves careful public review. The concerns of all the affected communities — including the “mobile communities” of commuters condemned

Markowitz is a voice for inclusion

B

ravo to Steve Markowitz for being willing to voice unpopular thoughts that should be brought to everyone’s attention. The mayor of the Village of Great Neck has used the public trust to allow zoning variances that further the interests of a specific sector of the community. Local government should be based on respect for all members of the community. Steve Markowitz has participated in many civic, religious and

political institutions. These institutions – including the Holocaust Memorial and Tolerance Center, the Gold Coast Art Center, the Great Neck Student Aid Fund – have been enriched by his participation and leadership. His personal philosophy and his political views have always espoused inclusion and fairness. I applaud his bravery for speaking out when others seek to abuse the democratic process. Varda Solomon Great Neck

daily to drive the area’s roads or ride the LIRR or NICE buses — need to be taken into account. Manhasset’s residents and those in the surrounding towns have a legitimate right to express their opposition to proposals they believe to be poorly conceived. Organized opposition and the online petition are a flag to the elected officials (whom Mr. Davret seems also to hold in contempt), that they need to weigh the potential benefits of a plan like Brookfield’s against its potential negative effects; effects that will have longterm, and possibly unintended impacts. Mr. Davret may well be an expert at brick-and-mortar retail. It hardly takes an expert to see that the Macy’s time capsule in Manhasset Valley is a white el-

ephant, or that Manhasset’s retail stores outside the AmericanaApple Store bubble are struggling. Additional housing for empty nesters who want to cash in and stay in the neighborhood, or for millennials and others who want to return to their beloved Manhasset would be nice, of course. But I’m not sure I share Mr. Davret’s apparent optimism about how this project will improve the lot of these suburban exiles. I doubt that Brookfield is driven by benevolence towards the elderly or the young who struggle. The market will rule. It will be interesting to see how local authorities fare in any effort to shape the proposed redevelopment: it’s worth taking a glance at Brookfield’s global heft. The pressure it can bring to

bear on local communities and institutions charged with representing the public interest should give one pause. Brookfield is not your neighbor. Nature and real estate abhor a vacuum. The Macy’s parcel is a vacuum that will inevitably be filled. With what? On what scale? At whose ultimate cost? To benefit whom? What, if any, common good can the local population actually gain from a redevelopment plan? People who express opposition to the Brookfield proposal have a right, and are right to ask such questions, even if they’re “biddies.” Peace to you, Mr. Davret. Kevin S. Kennedy Manhasset

Shame on those criticizing Markowitz

N

ever in my 45 years in Great Neck have I witnessed anything like the vicious and totally unwarranted attacks on Steve Markowitz. After winning an election, (Robert) Spitalnick and (Jeff) Wiesenfeld have mounted a hate campaign against Steve – for reasons I cannot fathom. Is their extreme reaction simply because they were challenged? How dare they

turn a nasty, sustained, personal vendetta against Steve into an attack on the Holocaust Memorial and Tolerance Center – which fosters understanding of anti-Semitic hatred – in the name of combatting “anti-religious animus”? I’ve known Steve Markowitz for 20 years. Although we are polar opposites in politics, he is a very caring friend and wise counselor. When we engage in spir-

ited discussions, he always responds respectfully, with no personal hatred towards me or anyone else who may hold different views. There is not one hateful bone in his body. Steve does not deserve the bile and slander that have been thrown at him. Shame on you! Jack Epstein Lake Success Letters Continued on Page 56


56 Blank Slate Media Newspapers, Friday, July 12, 2019

Business&RealEstate Who wins from economic expansion? We have now surpassed the longest economic expansion in U.S. history (since 1854!) this month and it’s officially, breaking the record of 120 months of economic growth from March 1991 to March 2001, according to the National Bureau of Economic Research. Starting in June of 2009, our record-setting run saw GDP growing cumulatively by 25 percent, far slower than previous expansions. While the unemployment rate has dropped to 3.6 percent in May, the lowest since 1969, job growth has been relatively slower than during other postwar recoveries. Our recovery obviously started way before our current president; however, he may take all the credit, (and provide no credit to anyone else). However, the consuming public and small independent businesses have been the true crusaders and have really brought our country back from the catastrophe of our economic collapse in 2008 to its current stellar state and have made it shine and have set an example for its accomplishments to the rest of the world, whereby, quitters never win and winners never quit! But the truth be told is in the real facts and figures so, go to

snoops.com if you want to check everyone’s statements for their accuracy and truthfulness to find out. So it’s an amazing time in the U.S. for a certain percentage of the population and those that are entrepreneurs and independent business people and most importantly the real estate industry as a whole, for without us my belief is that the economy would not have reached its astonishing level of record-setting success. However, I do realize that the economy hasn’t been good or great for everyone and I’m quite sure it’s different in every country; but those countries with smaller populations, the challenge of earning a living wage is connected to a multitude of reasons, which I will not elaborate in this column, but a future one. Most important, those that aren’t earning enough should either think of changing their vocation, job or business, (get your real estate license) if possible, go back to school and learn a different trade that pays more, assuming you have six to 12 months or whatever is needed to pay your current and future bills, and, if possible, to start a side business to add a second stream of income to your current one.

PHILIP A. RAICES Real Estate Watch For in order to purchase a home in the U.S. today, the average price is approximately $252,000, which may sound like bupkis (for those who understand Yiddish) and a ridiculously small amount of money for my readers, whose average value is $750,000 to a multiple of millions of dollars, but for many, is a struggle and thereby forces them to rent and make their landlords richer and more wealthier by handing over all the benefits. Many of us live in a “bubble world” of lavishness, opulence and wealth way above a typical U.S. citizen or immigrant. More important, I believe is that it’s a new world out here and lazy and lacka-

daisical individuals, and there are plenty of you out there, need not apply and will have to accept their consequences later on! But here are some scary but candid and upfront facts to dwell upon and deal with now and not procrastinate for another day: A great many people looking to retire one day, don’t have four hundred dollars extra saved to their name, or what some would say, “ and don’t have a pot to piss in” for emergencies, as per the Government Accountability Office. I quote from the Street.com, “According to a 2018 study by Northwestern Mutual, 21 percent of Americans have no retirement savings and an additional 10 percent (1 in 3) have less than $5,000 in savings. A third of Baby Boomers currently in, or approaching, retirement age have between nothing and $25,000 set aside. Those between 55-64 have a median savings of $107,000, which is pretty shocking, considering we are supposedly considered the wealthiest country in the world, really? Today, one needs at least one million dollars to retire comfortably. The Economic Policy Institute paints an even bleaker picture. Their data from 2013 reports

that “nearly half of families have no retirement account savings at all.” For most age groups, the group found, “median account balances in 2013 were less than half their pre-recession peak and lower than at the start of the new millennium.” The EPI further found these numbers even worse for millennials. Nearly six in 10 have no retirement savings whatsoever. But financial experts advise that the average 65-year-old have between $1 million and $1.5 million set aside for retirement. workers with savings. If any of my readers or anyone you know are in this position, tell them to “wake up and smell the coffee” and make a change in their lifestyle and/or savings, because if you or they keep doing the same thing, expecting different results, it’s called “business insanity” or on an individual basis, “personal financial insanity.” Philip A. Raices is the owner/ Broker of Turn Key Real Estate at 3 Grace Ave. Suite 180 Great Neck. He has earned designations as a graduate of the Realtor Institute and a certified international property specialist. He can be reached by email, at:Phil@TurnKeyRealEstate.Com, or by cell: (516) 647-4289.

READERS WRITE

Markowitz support is political Markowitz brings

S

ubsequent to the local papers publishing Steve Markowitz’s 2015 campaign letter – which included non-tolerant language about the Orthodox Jews – the news is that Mr. Markowitz is reaching out to some fellow Democratic friends, acquaintances and some rabbis requesting from them to write character reference letters and send them to the local newspapers. Some accommodated his request letter by sending the most beautiful letters. In fact, some al-

luded that Markowitz is the best person in the world! Some went as far as saying that they are sure that Markowitz never wrote the letter! I believe that Mr. Markowitz, as any other human, probably has some redeeming qualities. But going as far as saying the best person ever, is not suitable for the situation as it is an obvious overstatement. Some who wrote that they would not believe that Markowitz wrote the email are even voicing a worse overstatement as to testifying to such requires to be next to

Mr. Markowitz at all times which is not feasible. However, fellow Democratic friends of Markowitz like Schimmel and Gary Ackerman are proving a great point. Their supports hints that they hold the position of chairman of the Holocaust Center has a political value to the Democratic party. The museum started by Borris Chartan, a Holocaust survivor in 1989 for reasons other than politics! Sara Povic Great Neck

LETTERS POLICY Letters should be typed or neatly handwritten, and those longer than 750 words may be edited for brevity and clarity. All letters must include the writer’s name and phone number for verification. Anonymously sent letters will not be printed. Letters must be received by Monday noon to appear in the next week’s paper. All letters become the property of Blank Slate Media LLC and may be republished in any format. Letters can be e-mailed to news@theislandnow.com or mailed to Blank Slate Media, 25 Red Ground Road, East Hills, NY 11577.

groups together

I

am writing to express my support for Steven Markowitz, thechairman of the Holocaust Memorial and Tolerance Center of Nassau County, who has been the subject of an unjustified smear campaign. I have known Steven for almost 40 years, and he has been relentless in his efforts to fight all forms of intolerance. I have served with Steven on the board of trustees of Temple Israel of Great Neck, where, as a board member and president, he has worked to bring the Conservative, Reform, Orthodox, and Sephardic communities together.

In these roles, he started what has been a successful inter-synagogue rabbinic dialogue that has lasted for decades. I have also witnessed his leadership of the Holocaust Memorial and Tolerance Center, which under his leadership has become one of the most important local institutions for fighting intolerance both outside and inside the Jewish community. I am available to discuss these issues further if it would be at all helpful in informing your readership. Arden Smith DPM Village of Great Neck


The Great Neck News, Friday, July 12, 2019

GN

Recent Real Estate Sales in Great Neck Great Neck Real Estate Market Conditions MEDIAN SALES PRICE $928,000 Demographics near Great Neck, NY Population Population Density Median Age People per Household Median Household Income Average Income per Capita

City 10,143 7,535 38 3 81,778 39,915

County 1,361,350 4,744 41.3 3 98,401 42,949

57

2 Fairfield Road, Great Neck Sold Price: $1,880,000 Date: 02/07/2019 6 beds, 4 Full/1 Half baths Style: Exp Ranch # of Families: 1 Schools: Great Neck Total Taxes: $34,430 MLS# 3030641

15 Hayden Avenue, Great Neck Sold Price: $798,000 Date: 06/28/2019 4 beds, 1 Full/1 Half baths Style: Colonial # of Families: 1 Lot Size: 60x125 Schools: Great Neck Total Taxes: $11,535 MLS# 3113964

40 Red Brook Road, Great Neck Sold Price: $1,165,000 Date: 07/02/2019 5 beds, 4 Full baths Style: Split # of Families: 1 Lot Size: 125x173 Schools: Great Neck Total Taxes: $25,921 MLS# 3125247

26 Hicks Lane, Great Neck Sold Price: $1,300,000 Date: 06/28/2019 4 beds, 3 Full/1 Half baths Style: Colonial # of Families: 1 Lot Size: 95x95 Schools: Great Neck Total Taxes: $19,230 MLS #3052038

Editorâ&#x20AC;&#x2122;s note: Homes shown here were recently sold in Great Neck by a variety of real estate agencies. The information about the homes and the photos were obtained through the Multiple Listing Services of Long Island. The homes are presented based solely on the fact that they were recently sold in Great Neck and are believed by Blank Slate Media to be of interest to our readers.

DISCOVER THE DANIEL GALE DIFFERENCE. Great Neck Office | 516.466.4036 42B Middle Neck Road, Great Neck, NY | danielgale.com Each office is independently owned and operated.


58 The Great Neck News, Friday, July 12, 2019

GN

Cell node battle could continue in court Continued from Page 1 will continue to suffer irreparable harm because of the Village prohibiting ExteNet from providing telecommunications services,” Christopher Fisher and Brendan Goodhouse, attorneys for Extenet, argued in court papers. The lawsuit follows Lake Success trustees rejecting nine of 13 node proposals from ExteNet Systems Inc., a company that designs, builds and manages distributed networks, to boost cell phone coverage and data capacity in May. Residents flooded public hearings regarding the proposed cell nodes, questioning their need while raising concerns. Among their worries had been aesthetics, placement and impacts on property values. Fisher and Goodhouse argue in court papers that the village violated the Telecommunications Act’s nondiscrimination provisions, “placing a substantially higher procedural and substantive burden on them” – more than $78,000 of fees. They also argue that over a roughly two-year period, ExteNet extensively modified its applications to respond to concerns, only to see most of the nodes denied with “after the

fact findings” based on items “not within the limited authority reserved to the village.” Among those items, ExteNet argued, are “undefined and not ascertainable aesthetic standards,” “an alleged failure to demonstrate a lack of alternatives” when many were offered, and “claimed negative effects” from installing small utility equipment on poles. Lake Success Mayor Adam Hoffman said that the village is working on a response, but otherwise could not comment on pending litigation. The lawsuit against Lake Success by ExteNet would not be the first in the area. The Village of Munsey Park in the Manhasset region was sued when it did not act on an application to construct a node in August. The suit was dropped in December, after which the two parties began working in a “spirit of cooperation,” and a conditional use permit was granted to ExteNet to install a cell node in the village in April. The legal action also comes as the villages of Plandome and Flower Hill weigh applications from ExteNet to install 10 and 18 cell nodes in their respective villages.

PHOTO BY BILLY FITZPATRICK

Mayor Adam Hoffman said the Village of Lake Success is preparing a response to a lawsuit by ExteNet, following a May decision to block the installation of several cell nodes. Kings Point village approved an application by ExteNet earlier this year to install 31 cellular nodes throughout the village. Paired with it was the approval of a new village telecommunications law, which aims to accommodate these small cell facilities and comply with Federal Communications Commission regulations. In Lake Success, six nodes were unanimously rejected: No. 1 at the right of way adja-

cent to 1 Pine Hill Road, No. 5 at the right of way adjacent to 21 Briarfield Drive, No. 8 at the right of way adjacent to 75 Horace Harding Blvd., No. 11 at the right of way adjacent to 37 Meadow Woods Road, No. 12 near 2 Bridle Path, and No. 13 at the corner of Lakeville Road and Windsor Gate. Trustees also voted down No. 9 at the right of way at the intersection of Horace Harding Boulevard and Fairway Drive,

No. 2 at the right of way adjacent to 354 Lakeville Road, and No. 10 at the right of way adjacent to 255 Lakeville Road. Nodes No. 3, at the right of way adjacent to 334 Lakeville Road, No. 4 adjacent to 318 Lakeville Road, No. 6 near the northeast quadrant at Horace Harding Boulevard and Lakeville Road, and No. 7a in the Lake Success Golf Club were approved.

Roslyn Grist Mill promises a revival Continued from Page 5 grants to be completed. They have flowed in. To date, the state has contributed $1 million, the county has given $440,000 and an additional $820,000 has come from donations, trusts and foundations. That $2.26 million is 40 percent of what the Roslyn Landmark Society estimates the project will require. “In terms of being a museum, I think that it will be an attractive option for all surrounding communities and eventually word will spread throughout Long Island and also Westchester and Manhattan,” said Roslyn Landmark Society Trustee Jordan Fensterman. “I think that people will be very interested in coming and seeing an area that is really a time capsule for how America was.” In August, the society successfully began the first phase of restoration, having hazardous materials abated, beams stabilized and the roof repaired. In coming weeks, a company from Pennsylvania will come to raise it. The building had been at street level until around 1900, when the parking lot across the street was built, Kroplick said. “The lake used to come right to the road,” said Roslyn Landmark Society Secretary Jay Corn. “That parking lot is all

filled, so to bring it back to grade level is really bringing it back to its original location, and that’s exciting.” The building served as a water-powered mill for more than 150 years, according to the Roslyn Landmark Society. As of 2017, it was one of 21 wind and water mills still standing on Long Island, according to Kroplick. “The mill was the center of the economy when it was built,” Corn said. “The farmers used to bring their grain there. That mill probably supplied half of Manhattan with flour.” One of the Roslyn Grist Mill’s most renowned visitors was America’s first president. George Washington wrote about a stop at the owner Hendrick Onderdonck’s house, which was next to the grist mill, in his diary, according to the Roslyn Landmark Society. “Breakfasted at a Mr. Underduncks at the head of a little bay; where we were kindly received and well entertained,” Washington wrote. “This Gentleman works a Grist & two Paper Mills, the last of which he seems to carry on with Spirit, and to profit-distc. from. Oyster bay 12 Miles. From hence to Flushing where we dined.”

After retiring from its original purpose, the grist mill was converted into a teahouse in 1920. It remained so for 54 years, garnering tourist attention.

P

“ eople who love grist mills just go crazy when they see this.” Howard Kroplick PRESIDENT OF THE ROSLYN LANDMARK SOCIETY

For years after that, it had a sign out front proclaiming restoration would begin soon, Kroplick said. He moved to East Hills in 1984, and remembers it being one of the first things he noticed. “That was always the question, when are they going to do anything?” he said. “The only thing that you saw being changed for like 30 years was the sign in front when new politicians came in.” The Roslyn Landmark Society was founded in 1961. Roger Gerry sought to restore homes in the area and have it designated as historic. “Roslyn eventually got on board and said run with it,” Corn, who knew Gerry,

said. “He really was responsible for saving what was there and creating this little bucolic village that is a trip back in time.” The grist mill project has momentum now, Kroplick said. The mayor of the Village of Roslyn is supportive, the state and county are supportive and the Roslyn Landmark Society has recently invested in other restoration projects. It even has an Instagram page devoted to the grist mill. “We eat and walk in the area around the pond all the time and see the grist mill in a state of disrepair,” Fensterman said. “My children have asked about it, and I’m excited that it has progressed to the point where it’s going to be a community resource.” A recent accomplishment was having a historic marker sign placed out front. Despite its location on the village’s main street, people who have lived in Roslyn for years had never known where the grist mill actually was, Kroplick said. Standing inside the grist mill, he spotted a family peering at the sign from across the street. “That’s what’s great,” Kroplick said. “Here you’ve got people who’ve been ignoring this building forever now see that something’s being done.”


The Great Neck News, Friday, July 12, 2019

GN

59

Team USA win also a win for L.I. U.S. defender Crystal Dunn was born in NHP, played soccer for South Side High School BY TOM M CC A RT HY The United States women’s soccer team’s 2-0 victory over the Netherlands on Sunday to capture the World Cup was also a win for Long Island. Crystal Dunn, a defender for the women’s soccer team, was born in New Hyde Park and raised in Rockville Centre. She attended South Side High School, where she was a four-year starter for the school’s soccer team. During her tenure at South Side, she served as forward and midfielder and as team captain in 2008 and 2009. On Monday, a day after winning, Dunn tweeted, “Woke up this morning and all I can still say is W.O.W… I’m a WORLD CHAMPION.” This was the first World Cup appearance for the 26-yearold player. On the team, she is a defender, but the Team USA’s website says, “Versatile and ruthless, Crystal Dunn excels

in virtually every position on the field.” According to the USA soccer website, Dunn won five separate Player of the Year awards as a senior in high school, including the New York Gatorade Player of the Year award. In a News12 interview, former South Side coach Judy Croutier said, “She was just able to hit another speed that other people couldn’t.” Even before heading off to college, where she led the University of North Carolina at Chapel Hill to a national championship, Dunn was making a national impact. She played on the U-17 national team before helping her Rockville Centre high school achieve a state title her senior year. “Dunn plays as if the girl with the ball – in the rare instances she doesn’t have possession herself – just stole her lunch money,” Newsday’s Chris Mascaro wrote in 2009, following South Side’s Class A

PHOTO BY TERI WEST

Crystal Dunn featured in a Nike ad campaign in the subway. state win. In 2015, Dunn was a year into her professional career when the last World Cup roster was announced, and she learned she hadn’t made it. “I think as soon as I got that news, I went through my venting stage,” Dunn told USA Today Sports that

year. “But then I was like, I’m gonna prove to myself I can reach my potential and get to where I gotta go. I started saying that I have things to work on.” In 2016 she played more games for the women’s national team than she had in her first three years com-

bined, according to U.S. Soccer. She was also an Olympian in the Rio games, where her goal against Colombia helped the United States tie. She has played on professional teams in Maryland and England and is currently a forward for the North Carolina Courage.

COMMUNITY & SCHOOL NEWS

G.N. media students win PSA awards Great Neck Public Schools Television (GNPS/TV) is the recipient of seven awards, including Best Overall Video, through the Long Island Youth Safety Coalition (LIYSC) High School Public Service Announcement Video Contest, sponsored by the Nassau County District Attorney’s Office. Winners were recognized during an awards ceremony at the Morrelly Homeland Security Center in Bethpage on June 4. This video contest encouraged high school students across Nassau County to create public service announcements based on five topics that pertain to youth and schools. Contest entries from GNPS/TV were created by South High School students enrolled in the Advanced Filmmaking class under the direction of Robert Zahn, director of educational television and broadcast media. The Nassau County District Attorney’s Office evaluated more than 60 submissions and

awarded first, second, and thirdplace for each category. GNPS/ TV was announced as the winner of six awards in the Mental Health, School Gun Safety, and Violence Against Young Women categories. Additionally, the first-place video in the Mental Health category, “Fine: Know the Signs and Get Help,” was awarded Best Overall Video, the highest award in the PSA contest. GNPS/TV awards and student creators are listed below. Mental Health Best Overall Video and First place: “Fine: Know the Signs and Get Help,” by Yang Wang, Jongwon Kim, Alexander Jasen, Seungmin (Samuel) Roh, and Gordon Zhang. Third place: “Don’t Cope Alone,” by Grace Song, Rosanna Gao, Karthika Nair, and Phoebe Smith. School Gun Safety First place: “School Gun Safety: Know the Procedure,” by Jamie Brown, Maya Porshi-

PHOTO BY ANNA ZAHN

Robert Zahn and award-winning students from GNPS/TV are congratulated by musician Meredith O’Connor and Rene Fiechter, an assistant district attorney and the director of community affairs at an awards ceremony on June 4. an, Abigail Lee, and Ryan Chen. Second place: “School Gun Safety: Be Aware,” by Katherine Chian, Ethan Jiang, Andrew Lee, and Spencer Lee. Violence Against Young Women First place: “Respect Wom-

en,” by Katherine Chian, Ethan Jiang, Andrew Lee, and Spencer Lee. Third place: “Girls Are Not Toys,” by Abisa Osei-Amankwah, Sarah Bernstein, Jack Lenga, Luqing Ni, and Derek Yu. During the awards ceremo-

ny on June 4, winners were applauded by Nassau County District Attorney Madeline Singas, representatives from the District Attorney’s Office, and pop singer Meredith O’Connor.


60 Blank Slate Media Newspapers, Friday, July 12, 2019

SCHOOL & CAMP DIRECTORY

State seeks cap on water contamination Continued from Page 9 After the regulations are adopted, the Environmental Facilities Corp. and the Department of Environmental Conservation will work with the Department of Health to remediate water systems that test above the maximum levels. All public water systems will be required to test their water within specified time frames and comply with the adopted maximum contaminant levels. Most water suppliers in the state will be required to submit their first round of testing within three months of the regulation’s adoption. To adopt the regulations, a Notice of Proposed Rulemaking in the New York State Register is expected to be published on July 24, which will commence a 60-day comment period. After assessments of public comments, the proposal will be revised or submitted for adoption by the Public Health and Health Planning Council, under the condition of approval by the state health commissioner. “This long-awaited first step puts New York on a path to cleaner drinking water. Establishing Maximum Contaminant Levels for PFOA, PFOS, and 1,4-dioxane will require all public

Sport Psychology Dr. Tom Ferraro

has specialized in sport psychology for 20 years and works in the fields of golf, tennis, soccer, baseball, football, wrestling, lacrosse, figure skating, gymnastics, softball, fencing and more. He has helped professional teams, Olympians and elite young athletes learn how to manage the intense pressure of competitive sports. He appears on both TV and radio and has sport psychology columns in 5 different newspapers and has been featured in The New York Times, Wall street Journal and the London Times. Golf Digest includes him in their list of top mental game gurus in America. For a consultation see below: Williston Park Professional Center 2 Hillside Ave, Suite E. Williston Park NY 11596

water systems in New York to test for these chemicals and take action when elevated levels of contamination are discovered,” said Maureen Cunningham, senior director for clean water at Environmental Advocates of New York. “However, recent science shows that there is likely no safe level of these chemicals, and the state MCLs must reflect this. Environmental Advocates will continue to urge the Department of Health to bring their MCLs in line with the most recent science during the public commenting period,” she said. Nassau County Executive Laura Curran welcomed the move. “Ensuring that our Long Island drinking water remains safe for current residents and future generations is critical,” she said. “We commend Governor Cuomo and the State Health Department for taking aggressive action and proposing unprecedented and necessary standards to safeguard the health and safety of our residents. Nassau County’s Department of Health upholds all measures to help protect the drinking water supply for our residents and will continue to support water suppliers in Nassau County to make the required improvements.”

VIEW POINT

Climate crisis demands mobilization Continued from Page 16 Instead of spending $700-$800 billion on defense each year, $4.6 billion on for-profit prison companies that are starving and torturing children and parents in concentration-camp-like conditions, billions on royalties and incentives to fossil fuel companies, and $1.5 trillion more in tax-giveaways to the largest, most profitable companies and the top 1%, that money could be spent on research and development of clean, renewable energy technologies, new agricultural processes, conservation and low or zero-carbon infrastructure.

Apparently, defense is so bloated that Trump can move billions of it for his pet projects. “It isn’t that we can’t address this problem,” Sanders said. “We know exactly what has to be done – massive investment in sustainable energy, energy efficiency, transforming transportation system. We know what has to be done. The problem is lack of political will. We have a president who is ignorant, dangerously ignorant, and a fossil fuel industry that is making billions today as we destroy this planet. We have to stand up to them and begin the process of transformation.”

(building parallel to E. Williston railroad station)

drtomferraro.com drtferraro@aol.com

(516) 248-7189

www.facebook.com/TheIslandNow


Blank Slate Media Newspapers, Friday, July 12, 2019

PROFESSIONAL GUIDE â&#x2013;¼ COMPUTER / TECH SUPPORT â&#x2013;¼ *647<;,9 796)3,4:&

)5,(1'/<&(57,),(' &20387(55(3$,5(;3(576

÷'DWDUHFRYHU\ ÷9LUXVUHPRYDO  1HWZRUNVDQGSULQWHUV ÷:LðVHWXS ÷5HJXODUPDLQWHQDQFH 0(17,21&28321&2'($1'*(7

6-(5@:,9=0*,@6<5,,+

2QHWLPHXVHRQO\&DQQRWEHXVHG LQFRQMXQFWLRQZLWKDQ\RWKHUFRX SRQRURIIHU2IIHUH[SLUHV 9DOLG IRU DQ\ QHZ VHUYLFH H[FHSW VXEVFULSWLRQ IHHV 0XVW PHQWLRQ FRXSRQDWWLPHRIVDOH

*HSSUV^MVYH-9,,KPHNUVZPZ

LAW â&#x2013;¼

Dâ&#x20AC;&#x2122;Angelo Law Associates, PC Stephanie A. Dâ&#x20AC;&#x2122;Angelo, Esq. Elder Law Wills & Trusts Asset Preservation Estate Planning Probate & Estate Administration/Litigation 901 Stewart Avenue, Suite 230 Garden City, NY 11530

(516) 222-1122

HEALTH CARE MANAGEMENT â&#x2013;¼

Family Care Connections,® LLC

Dr. Ann Marie Dâ&#x20AC;&#x2122;Angelo, PMHCNS-BC Doctor of Nursing Practice Advanced Practice Nurse Care Manager Assistance with Aging at Home/Care Coordination Nursing Home & Assisted Living Placement PRI / Screens / Mini Mental Status Exams

(516) 248-9323

WWW.DRANNMARIEDANGELO.COM

901 Stewart Avenue, Suite 230 Garden City, NY 11530 MEDICAID ELIGIBILITY AND APPLICATIONS

WWW.DANGELOLAWASSOCIATES.COM

TUTORING ALL SUBJECTS â&#x2013;¼

3RUW7XWRULQJ $FDGHPLF6XFFHVV $FDGHPLF6XFFHVV  

 7(6735(3 6$7,6$7,, $&7 $3 66$7 &+6(( ,6((

 78725,1*$//68%-(&76

&RPPRQ&RUH0DWK (QJOLVK 5HJHQWV$3DQG+RQRUV3K\VLFV0DWK+LVWRU\(DUWK6FLHQFH%LRORJ\DQG&KHPLVWU\ 6SDQLVK )UHQFK &ROOHJH0DWK 6FLHQFHV 5HDGLQJ6WXG\6NLOOVDQG7HVW7DNLQJ6WUDWHJLHV 2UJDQL]DWLRQDO6NLOOV1RWH7DNLQJ &ROOHJH&RXQVHOLQJ5HVXPH (VVD\V

 3RUW:DVKLQJWRQ%OYG3RUW:DVKLQJWRQ1< LQIR#SRUWWXWRULQJFRP

TUTOR â&#x2013;¼

TUTORING â&#x2013;¼

Private / Small Group Tutoring Available Specializing in Grades K-6

Audrey Sullivan M.S.Ed. Educator 347-628-8872 (voice/text) seguenow@aol.com Licensed Teacher/NYC Dept./NYS Dept. of Education

TUTORING â&#x2013;¼

MATH â&#x20AC;¢ SAT â&#x20AC;¢ ACT

TI-84 TI-89

# Algebra # Core Curriculum NYS Licensed # Geometry Grades 7-12 # Algebra 2 + Trig # Pre-Calc # AP Calculus

NORM: 625-3314

ENGLISH â&#x20AC;¢ ACT â&#x20AC;¢ SAT ing ritical Read C # 25+ Years # Writing Experience # Grammar # Essays

LYNNE: 6 2 5 - 3 3 1 4

CHECK US OUT ON FACEBOOK AT FACEBOOK.COM/ THEISLANDNOW AND TWITTER: @THE ISLANDNOW

61


62 Blank Slate Media Newspapers, Friday, July 12, 2019

BUYERâ&#x20AC;&#x2122;S GUIDE â&#x2013;¼ AWNINGS

CLEANING

CARPENTRY

SWEENEY CUSTOM CARPENTRY and PAINTING Renovations Custom Closets Sheetrock Repairs Interior/Exterior

New Doors New Windows New Moldings Free Estimates

A Complete Home Service by Reliable Professionals Homes â&#x20AC;¢ Apts. â&#x20AC;¢ Offices â&#x20AC;¢ Carpet Cleaning Window Wash â&#x20AC;¢ Floors Stripped & Waxed Move In Move Out â&#x20AC;¢ Attics â&#x20AC;¢ Garages Basements â&#x20AC;¢ Rubbish Removal â&#x20AC;¢ Pressure Cleaning â&#x20AC;¢ All Cleaning Supplies Included

516-884-4016

FREE ESTIMATES

Cell: 516-770-0514

Lic# H0454870000

Enjoy Instant Shade & Comfort All Summer Mention Blank Slate Media and

MASTER CLEANING

CHIMNEY SPECIALISTS

SAVE $200 One Coupon Per Awning

ADVERTISE HERE 516.307.1045

INTERIOR & EXTERIOR / RESIDENTIAL & COMMERCIAL â&#x20AC;¢ Thermal Windows â&#x20AC;¢ Doors â&#x20AC;¢ Siding & Gutters â&#x20AC;¢ Dormers & Extensions â&#x20AC;¢ Basements â&#x20AC;¢ Kitchens â&#x20AC;¢ Bathrooms â&#x20AC;¢ Decks

GOLDEN HAMMER HOME IMPROVEMENTS

P er fe ct ion Is N o A cc id en t!

516-354-1127

FREE ESTIMATES Lic. & Insured

chimneykinginc.com

CLEANING

CLEANING

New York Real Cleaning Commercial & Residential â&#x20AC;¢ House, Apartment, Office â&#x20AC;¢ Construction Clean Up â&#x20AC;¢ Power Washing Windows Cleaning â&#x20AC;¢ Move In & Out Cleaning

Call RICHIE: 917-553-8008 nycrealcleaningservice.com

DEEP CLEANING EXPERTS CLEANING & JUNK REMOVAL

ADVERTISE HERE 516.307.1045

Letty Osorio Cleaning +RXVHV2I¿FHV$SDUWPHQWVHWF *RRGUHFRPPHQGDWLRQV <HDUV([SHULHQFH )UHH(VWLPDWHV

ADVERTISE HERE 516.307.1045

347-876-5901 COMMERCIAL/RESIDENTIAL PAINTING

STRONG ARM PAINTING INTERIOR & EXTERIOR â&#x20AC;¢ TAPE â&#x20AC;¢ SPACKLE â&#x20AC;¢ SHEETROCK â&#x20AC;¢ MOLDING Residential & Commercial Free estimates / Bonded Insured

516-538-1125

ADVERTISE HERE 516.307.1045 ADVERTISE HERE 516.307.1045

CONTRACTING CJM CONTRACTING INC.

CHRIS MULLINS

Specializing in General Contracting Including Churches & Cathedrals ALL RENOVATIONS, EXPERT LEAK REPAIRS Dormers & Extensions â&#x20AC;¢ Bathrooms â&#x20AC;¢ Kitchens â&#x20AC;¢ Roofing â&#x20AC;¢ Flat Shingle â&#x20AC;¢ Attics â&#x20AC;¢ Masonry â&#x20AC;¢ Stoops â&#x20AC;¢ Brickwork â&#x20AC;¢ Waterproofing â&#x20AC;¢ Painting â&#x20AC;¢ Windows â&#x20AC;¢ Power Washing â&#x20AC;¢ Plumbing â&#x20AC;¢ Electric SMALL JOBS WELCOME. Having Hardships? Weâ&#x20AC;&#x2122;ll help and bring hope FREE Estimates Licensed & Insured

516-428-5777 Lic.# H18C6020000

Liability, Disability & W/C Ins.

ADVERTISE HERE 516.307.1045


Blank Slate Media Newspapers, Friday, July 12, 2019

BUYERâ&#x20AC;&#x2122;S GUIDE â&#x2013;ź

DEMOLITION AND JUNK REMOVAL

CONTRACTING

MASON CONTRACTING CORP. # 45 YEARS EXPERIENCE # OLD CRAFTSMANSHIP # NO JOB TO SMALL OR TOO BIG WE BUILD:

*6473,;,+,4630;065 1<529,46=(3

Driveways, Patios, Pool Patios, Chimneys, Steps, Barbeques, Waterproofing and Drywells All work is done and supervised by owner, ANDY DISPIRITO We work with every kind of stone, bricks, cinder block, Belgium block, granite, railroad ties, etc. Fully Outdoor Kitchens and more Licensed & Insured

Please call: ANDY @

ADVERTISE HERE 516.307.1045

516-759-3235

HOME IMPROVEMENT

I I I I I I

Painting Carpentry Siding Roofing Dry Wall Repairs

Affordable | Reliable | Professional Interior & Exterior |Free Estimates

DREAM CHASERS

LICENSED and INSURED

HOME IMPROVEMENTS

516-319-0109

:H5HPRYHDQG'HPR$Q\WKLQJ :H7DNHLW'RZQ7DNH,W$SDUW 7DNHLW$ZD\ $QG/HDYH<RXU+RPHRU%XVLQHVV6ZHSWDQG&OHDQ 5HVLGHQWLDO&RPPHUFLDO %RQGHG,QVXUHG)UHH(VWLPDWHV

:;965.(94*65;9(*;05.05* JUNK REMOVAL

Elegant Touch Remodeling

S E R V I N G B O T H R E S I D E N T I A L & C O M M E R C I A L

Deal direct with owner - Serving li over 25 years

â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

All Types of Home Improvements Free Estimates â&#x20AC;˘ Free design service extensions â&#x20AC;˘ Kitchens dormers â&#x20AC;˘ bathrooms decks â&#x20AC;˘ siding

ADVERTISE HERE 516.307.1045



HOME IMPROVEMENT

â&#x20AC;&#x153;Quality Construction with a Personal Touchâ&#x20AC;?

ADVERTISE HERE 516.307.1045

ADVERTISE HERE 516.307.1045

Dumpsters to meet your spring cleaning or renovation needs

ADVERTISE HERE 516.307.1045

631.281.7033 Licence #H18H2680000

LAWN SPRINKLERS

COMPETITIVE PRICING * SAME DAY DELIVERY â&#x20AC;˘ Largest Inventory on Long Island â&#x20AC;˘ Professional & Friendly â&#x20AC;˘ Serving Long Island for Over 60 Years

ADVERTISE HERE 516.307.1045

*If booked by 11am. Some restrictions apply, call for details.

516-937-0900 â&#x20AC;˘ 631-491-4923

â&#x20AC;˘ Spring Turn-Ons â&#x20AC;˘ Backflow Device Tests â&#x20AC;˘ Free Estimates â&#x20AC;˘ Installation â&#x20AC;˘ Service/Repairs

Joe Barbato (516) 775-1199

ADVERTISE HERE 516.307.1045

WintersBros.com

MASONRY FREE ESTIMATES LOU: 516 850-4886

FAMILY OWNED & OPERATED

DRIVEWAYS & PARKING LOTS RETAINING WALLS FOUNDATIONS DRYWELL WATER DRAINAGE WATER PROOFING

SIDEWALKS PATIOS / PAVERS BRICK / BLOCK BLUE STONE STEPS / STOOPS BELGIUM BLOCK CULTURED STONE

Contracting LLC

MASONRY â&#x20AC;˘ PAVING â&#x20AC;˘ CONCRETE

FULLY INSURED

LIC: #H2219010000

ADVERTISE HERE 516.307.1045

63


64 Blank Slate Media Newspapers, Friday, July 12, 2019

BUYERâ&#x20AC;&#x2122;S GUIDE â&#x2013;ź

PAINTING

MOVING

3/¡V3DLQWLQJ 6HUYLFHV,QF

N.Y.D.O.T.#10405

MOVING & STORAGE INC.

Long Island and New York State Specialists

â&#x20AC;˘ Residential â&#x20AC;˘ Commercial â&#x20AC;˘ Piano & Organ Experts â&#x20AC;˘ Boxes Available FREE ESTIMATES www.ajmoving.com

516-741-2657

      

           ! " #   " $%# &# # % !  ! ! ! '%# % (  ) *% + , '%# %

PAINTING, POWERWASHING

RESD/COMM CLEANING

SWEENEY PAINTING

STRONG ARM CLEANING

and CARPENTRY Interior B. Moore Paints Dustless Vac System Renovations

Exterior Power Washing Rotted Wood Fixed Staining

Residential and Commercial Cleaning Specialist â&#x20AC;˘ Post construction clean ups â&#x20AC;˘ Stripping, waxing floors â&#x20AC;˘ Move ins and move outs

$OO(VWLPDWHVDUH)UHH

516-884-4016

Free estimates / Bonded Insured

-*%%./0*#1

Lic# H0454870000

www.strongarmcleaningny.com



114 Jericho Tpke. Mineola, NY 11501

516-538-1125

ROOFING

PAINTING

ADVERTISE HERE 516.307.1045

PAINTING & WALLPAPER est. 1978

Interior and Exterior â&#x20AC;˘ Plaster/Spackle Light Carpentry â&#x20AC;˘ Decorative Moldings Power Washing www.MpaintingCo.com

516-385-3132 New Hyde Park

516-328-7499 Licensed & Insured

STONE, TILES AND PAVERS

â&#x20AC;&#x2DC;Deliver Excellence, Deliver Valueâ&#x20AC;?

:\WWS`/PNO8\HSP[`;PSLZHUK6\[KVVY7H]LYZHUK :`U[OL[PJ(Y[PĂ&#x201E;JPHS;\YMZHUK.YHZZLZ[V-P[(SS5LLKZ  235 235 /23 ( "%  ',%    2,, %  -!  %  3%%  %  )!6,%7 (!% 8   (( '

;V)\`7YVK\J[Z*HSS  2% ! 3%% 2 4,! 3%%  2  

&&&1%%,1

WANTED TO BUY

TREE SERVICE

OLD VILLAGE TREE SERVICE 24 HOUR EMERGENCY SERVICE Owner Operated Since 1989

ADVERTISE HERE 516.307.1045 ADVERTISE HERE 516.307.1045 ADVERTISE HERE 516.307.1045

Licensed & Insured

FREE ESTIMATES Member L.I. Arborist Assoc.

516-466-9220 WINDOW REPAIRS

ADVERTISE HERE 516.307.1045 WINDOW TREATMENTS

631-385-7975

WINDOW REPAIRS & RESTORATIONS

Outdated Hardware â&#x20AC;˘ Skylights â&#x20AC;˘Andersen Sashes â&#x20AC;˘ New Storm Windows â&#x20AC;˘ Wood Windows â&#x20AC;˘ Chain/Rope Repairs â&#x20AC;˘ Falling Windows â&#x20AC;˘ Fogged Panes â&#x20AC;˘ Mechanical Repairs â&#x20AC;˘ Wood Repairs

ALL BRANDS W W W. S K YC L E A RW I N D OW. CO M Call Mr. Fagan â&#x20AC;˘ 32 Years Experience Lic. # H080600000 Nassau

*CUSTOM WINDOW TREATMENTS TOP BRANDS AT DISCOUNT PRICES* WE BRING THE SHOWROOM TO YOU FREE CONSULTATION

516-426-2890

WWW.MADEINTHESHADENSLI.COM

FAMILY OWNED & OPERATED


Blank Slate Media Newspapers, Friday, July 12, 2019

nassau

65

COMMUNITY CLASSIFIEDS To advertise here call:516.307.1045

â&#x2013;ź EMPLOYMENT, MARKETPLACE, REAL ESTATE, AUTO, PETS HELP WANTED

HELP WANTED

HELP WANTED

To Place Your Ad Call

OPERATIONS SUPPORT SPECIALIST.

516.307.1045

Fax: 516.307.1046

WEâ&#x20AC;&#x2122;RE HIRING

e-mail: jsmith@theislandnow.com

What Could Be More REWARDING Join Our Team as a Direct Support Professional

In Person: 25 Red Ground Rd. Roslyn Heights, NY 11577

Become an integral part of our corporate commitment for supporting adults with intellectual and development disabilities by assisting in home care, teaching daily living skills and promoting independence within our group homes located in NASSAU & SUFFOLK.

Weâ&#x20AC;&#x2122;re Open: Monâ&#x20AC;&#x201C;Thurs: 9am-5:30pm Fri: 9am-6pm

OPEN HOUSE INTERVIEWS CONDUCTED TUESDAY, JULY 9th (From 3:30 pm to 6:00 pm) Brentwood Multi-Service Center 555 Washington Ave. Brentwood, N.Y

Deadlines

â&#x20AC;˘ Great Neck News â&#x20AC;˘ Williston Times â&#x20AC;˘ New Hyde Park Herald Courier â&#x20AC;˘ Manhasset Times â&#x20AC;˘ Roslyn Times â&#x20AC;˘ Port Washington Times â&#x20AC;˘ Garden City News â&#x20AC;˘ Bethpage Newsgram â&#x20AC;˘ Jericho Syosset News Journal â&#x20AC;˘ Mid Island Times â&#x20AC;˘ Syosset Advance

HELP WANTED

Is seeking an energetic and forward thinking

Phone:

Tuesday 11:00am: Classified Advertising Tuesday 1:00pm: Legal Notices/ Name Changes Friday 5:00pm Buyersâ&#x20AC;&#x2122;s Guide Error Responsibility All ads placed by telephone are read back for verification of copy context. In the event of an error of Blank Slate Media LLC we are not responsible for the first incorrect insertion. We assume no responsiblity for an error in and beyond the cost of the ad. Cancellation Policy Ads must be cancelled the Monday before the first Thursday publication. All cancellations must be received in writing by fax at: 516.307.1046 Any verbal cancellations must be approved by a supervisor. There are no refunds on cancelled advertising. An advertising credit only will be issued.

HELP WANTED

WEDNESDAY JULY 17th (From 3:30 pm to 6:00 pm) Ethical Humanist Society of LI 38 Old Country Rd. Garden City. N.Y.

Competitive salaries, paid training, career advancement, generous time off, health/dental insurance, long term life insurance, tuition reimbursement, plus matching retirement savings plan NO PRE-REGISTRATION REQUIRED, OPEN TO THE PUBLIC WE WILL PROVIDE YOU DETAILS OF ALL OPENINGS ON LONG ISLAND QUESTIONS ? PLEASE CALL US AT:

Nassau County Andrew.chung@yai.org / 516.742.9549 Ext. 1-1 Suffolk County Daniel.dern@yai.org / 631.967.7102 Seeing beyond diability

%ODQN6ODWH0HGLDKDVDQLPPHGLDWHRSHQLQJIRU

,1%281'287%281'6$/(6 %ODQN6ODWH0HGLD/LWPRU$GYHUWLVLQJ*URXSLVDIDVWJURZLQJ JURXSRIDZDUGZLQQLQJZHHNO\QHZVSDSHUVDQGZHEVLWHV 7KLVLVDGLUHFWKLUHIXOOWLPHSHUPDQHQWSRVLWLRQZLWKDJJUHVVLYH FRPPLVVLRQEDVHGFRPSHQVDWLRQDQGIXOOEHQHĆ&#x201C;WV 5HVSRQVLELOLWLHV

&RQWDFWH[LVWLQJDQGSRWHQWLDOFXVWRPHUVDERXWDGYHUWLVLQJLQRXU QHZVSDSHUVDQGRQRXUZHEVLWHDVZHOODVVSRQVRULQJFRPSDQ\HYHQWV +DQGOHFXVWRPHULQTXLULHV 'RFXPHQWDQGXSGDWHFXVWRPHUUHFRUGVEDVHGRQLQWHUDFWLRQV 'HYHORSDQGPDLQWDLQDNQRZOHGJHRI WKHHYROYLQJSURGXFWVDQGVHUYLFHV

4XDOLILFDWLRQV Â&#x2021;  Â&#x2021; Â&#x2021; Â&#x2021; Â&#x2021; 

3UHYLRXVH[SHULHQFHLQFXVWRPHU VHUYLFHVDOHVRURWKHUUHODWHGILHOGV $ELOLW\WREXLOGUDSSRUWZLWKFOLHQWV $ELOLW\WRSULRULWL]HDQGPXOWLWDVN 3RVLWLYHDQGSURIHVVLRQDOGHPHDQRU ([FHOOHQWZULWWHQDQGYHUEDO FRPPXQLFDWLRQVNLOOV

Â&#x2021; 6DODU\SOXVFRPPLVVLRQ Â&#x2021; &RQWDFWPDQDJHPHQWV\VWHP Â&#x2021; $GYHUWLVLQJDJHQF\TXDOLW\DGV



(PDLODUHVXPHDQGFRYHUOHWWHUWRVEODQN#WKHLVODQGQRZFRP2UFDOO 6WHYHQ%ODQNIURP0RQWR)ULSPWRSPDWH[W N E W H Y D E PA R K

www.gcnews.com

www.theislandnow.com

25 105 RedHillside GroundAvenue, Road Roslyn 11577 Suite I,Heights, Williston New Park, York NY 11596

Full Time Seasonal Help/Laborer â&#x20AC;˘ Mon.-Fri. from 6:30am â&#x20AC;&#x201C; 2:30pm. â&#x20AC;˘ Must be 18 years of age or older, must have valid Driverâ&#x20AC;&#x2122;s License. â&#x20AC;˘ Starts immediate through Labor Day possibly longer. Please send in or drop off resume to: Village of Williston Park 494 Willis Ave., Williston Park, NY

821 Franklin Avenue, Suite 208, Garden City, NY 11530

JOB OPPORTUNITY: $18.50 P/H NYC$15 P/H LI$14.50 P/H UPSTATE NYH. If you currently care for your relatives or friends who have Medicaid or Medicare, you may be eligible to start working for them as a personal assistant. No Certificates needed. 347-462-2610 or 347-565-6200

(or a near full time position with flexible hours)

apply to: cquinn@crosscheckinspections.com. www.crosscheckinspections.com CrossCheck Inspection: 805 3rd Ave., New Hyde Park NY 11040

Leading Merrick Auto Body Shop Has (3) Excellent Openings Available â&#x20AC;˘ FRONT PERSON-Must be good with customers & writing estimates â&#x20AC;˘ COMBO Heavy background â&#x20AC;˘ DETAILER/ Prep person GOOD PAY/ VACATION TIME SITUATION WANTED

ANNOUNCEMENTS

CARE GIVER: NEED A COMPANION or nursing assistant for your loved ones at home or in a health care facility? Call 516-410-9943 for a NY State certified nursing assistant with excellent references !

LUNG CANCER? And Age 60+? You and your family may be entitled to significant cash award. Call 866951-9073 for information. No risk. No money out of pocket.

ELDER CARE: trained to care for patients with various illnesses. Over 12 years experience. Prepare nutritious and appetizing meals, light housekeeping. Flexible for any working arrangement. Excellent references. Please call Anne 347898-5804 NANNY F/T My amazing, wonderful, reliable nanny of 15 years who has cared for my little one like family is available immediately. Driverâ&#x20AC;&#x2122;s license. Call Coline 803-543-4361 NURSES AIDE/COMPANION Experienced. Available to take care of your elderly loved ones. Excellent references, honest and reliable. Call 347-882-4753

%HQHILWV

Herald Courier Roslyn Times Great Neck News Williston Times Manhasset Times Port WashingtonTimes

Full Time position in a supportive environment

Call Ron 516-395-6640

yai.org

:(Ĺ?5(+,5,1*

Â&#x2021;  Â&#x2021; Â&#x2021; Â&#x2021;

This position offers the opportunity to work on varied projects related to administration, operations, marketing, finance, and technology and will interface directly with the companyâ&#x20AC;&#x2122;s Managing Principal and COO

CAREER TRAINING AIRLINE CAREERS Start here. Get trained as FAA certified Aviation Technician. Financial aid for qualified students. Job placement assistance. Call AIM for free information 866-296-7094

ANNOUNCEMENTS A PLACE FOR MOM has helped over a million families find senior living. Our trusted, local advisors help find solutions to your unique needs at no cost to you. Call: 1-800-404-8852

THE U.S. CENSUS BUREAU is now recruiting thousands of Census Takers in your area. Nobody knows your community better than you! Visit 2020census.gov/jobs to learn more!

GET DIRECTV ! ONLY $35/month. 155 Channels & 1000s of Shows/ Movies on Demand (w/SELECT All Included Package). PLUS Stream on UP to FIVE Screens Simultaneously at No Additional Cost. Call DIRECTV 1-888-534-6918

Visit us online at www.theIslandnow.com

SHARE YOUR EVENTS CALL NOW 516.307.1045

MARKETPLACE A.T. STEWART EXCHANGE CONSIGNMENT SHOP ******************** TURN YOUR TREASURES INTO CASH! Come to Consign/Stay to Shop! 109 Eleventh Street, Garden City 516-746-8900 Antiques-Furniture-Jewelry-Silver- Mirrors-LampsArtwork-China-Crystal-Collectibles Tuesday-Friday 10-4 Saturday 12-4 (10% Sr. Discount Tues) All proceeds benefit The Garden City Historical Society Email: store@atstewartexchange.org Like us on Facebook & Instagram INVITED ESTATE SALES BY TRACY JORDAN Looking to sell items from your home? Consider doing an Online Auction! Online Auctions reach more interested buyers than tag sales and can often sell for more than what you would make at an estate or tag sale. Invited Estate Sales by Tracy Jordan can do both! You can sell your items online reaching potential buyers locally or globally as well as hosting a private sale from your home! Let us guide you on what items to put in auction including furniture, housewares, decorative items, jewelry, collectibles, coins, artwork and anything else you may no longer want or need. Our services can help you to maximize your selling experience whether you are selling 1 item or 500 items. We are a one stop service for all your needs when you are moving or selling a property! Selling, donating, discarding and cleaning out services can be done to meet your time frame with minimal stress. Estate and Tag Sales Online Auctions Cleanout and Moving Services Home Staging Services Appraisals Contact for more info: info@invitedsales.com or Call: 516-279-6378 to schedule a consultation or receive more information. www.invitedsales.com


66 Blank Slate Media Newspapers, Friday, July 12, 2019

â&#x2013;¼ AUTOS, REAL ESTATE, HOME IMPROVEMENT HELP WANTED

HELP WANTED

HELP WANTED

TAG SALE Avital Gallery 336: Paintings, Royal Copenhagen, Rosenthal and more. Hours Wednesday, Thursday, Sunday 12-4, Friday 10-12 or by appointment. 770 Middle Neck Road, Great Neck, NY 11024. 516304-5640 or cell 516-528-9765. Free parking in back.

WANTED TO BUY LOOKING TO BUY! Oriental items, clothing, art, old & modern furniture, estates, jewelry, silver, glassware, dishes, old photos, coins & stamps, flatware. Call George 718-386-1104 or 917-775-3048 RARE RECORD COLLECTIONS WANTED: Autographs, memorabilia, obscure artists. All sizes/ categories. House-calls, drop-offs. All About Records 396 Rockaway Ave #E Valley Stream Charles 516-945-7705 groupssound@aol. com

WE ARE KITCHEN AND BATH RENEWAL EXPERTS kitchen refresh your Revive and ! ts ne cabi & bathroom CALL FOR AN IN-HOME QUOTE TODAY !

855.5.2RENEW

NEW YORK NOW PROTECTS THE RIGHTS OF VICTIMS OF CHILD SEXUAL ABUSE If you were previously a victim of child sexual abuse, The New York Child Victims Act temporarily allows you to revive your claim. There is a limited time to file a case; do not delay in contacting us.

GREENBERG, MARIA, GREENBERG & ASSOCIATES ONLY PROSECUTES SEXUAL ABUSE CASES

PETS

PET SERVICES A GARDEN CITY ANIMAL LOVER doesnâ&#x20AC;&#x2122;t want to leave your precious pooch or fantastic feline alone all day. Iâ&#x20AC;&#x2122;m reliable, dependable and will walk and feed your pet while you work or travel. Please call Cheryl at 516-971-3242

AUTOMOTIVE

AUTOS WANTED AUTO BUYERS! We visit you. Highest cash paid. Or donate, tax deduct + cash. DMV#1303199. Please call Luke 516-VAN-CARS OR 516-297-2277 DONATE YOUR CAR to Wheels For Wishes, benefitting Make-aWish. We offer free towing and your donation is 100% tax deductible. Call 631-317-2014 Today!

Our firm will file your claim anonymously to protect your privacy.

LIST YOUR PROPERTY FOR RENT/SALE HERE CALL NOW 516.307.1045

CALL (833) VICTIM 9 â&#x20AC;¢ (833) 842-8469 www.NYvictim.com

AUTOS WANTED

Trucks

REAL ESTATE FOR RENT

SERVICE DIRECTORY

APARTMENT FOR RENT

ATTORNEY

GARDEN CITY BORDER APARTMENT: Spacious, Bright 2BR Apt $1,785.00 + Electric. Gated Parking/Garage Available, Laundry Room, Air Conditioning, Hardwood Floors, LIRR, NO BROKER FEE. www.gcbapts.com Voice or text: 516-524-6965

COMPUTERS LIST YOUR APARTMENT SERVICES FOR RENT CALL TO PLACE YOUR AD HERE 516.307.1045

COMPUTER ISSUES? FREE DIAGNOSIS by GEEKS ON SITE! Virus removal, data recovery! 24/7 Emergency Service, in home repair/ on line solutions. $20 off any service! 844-892-3990

REAL ESTATE FOR SALE

HOME IMPROVEMENTS

OUT OF TOWN REAL ESTATE

AFFORDABLE NEW SIDING! Beautify you home! Save on monthly energy bills with beautiful NEW SIDING from 1800 Remodel! Up to 18 months no interest. Restrictions apply 855-773-1675

NEW MANUFACTURED HOMES in active adult 55+ landlease community in historic Smyrna Delaware. Close to Rehoboth Beach and Dover Downs. Low Taxes. 302-6595800 or www.BonAyreHomes.com NORTH FORK North Fork Home for Sale 1305 Hiawathas Path in Laughing Waters HOA, featuring walk to Peconic Bay private beach & 2 marinas w/slips for boats up to 25 ft. Home is year-round 3 Bed/2 Bath with Master Ensuite, Full Basement, .34 lot w/fenced in private back yard w/room for pool. Includes Southold Park District access to Founders Wharf & beach. $599k, motivated sellers! Contact: North Fork Real Estate, Sheila Izzo 631-348-5551 MLS #3141336

SERVICE DIRECTORY

SERVICES SPECTRUM TRIPLE PLAY! TV, Internet & Voice for $99.97/mo. 100 MB per second speed. Free Primetime on Demand. Unlimited Voice. NO CONTRACTS. Call 1-855-977-7198 or visit: http ://tripleplaytoday.com/press

AUTOS WANTED

Vans

Since 1980

STEPHANIE A. Dâ&#x20AC;&#x2122;ANGELO, ESQ. Elder Law, Wills & Trusts Asset Preservation, Estate Planning, Probate & Estate Administration/ Litigation 901 Stewart Ave, Ste 230 Garden City, NY 11530 5 1 6 - 2 2 2 - 1 1 2 2 www.dangelolawassociates.com

Suvs ®

Get CASH Today!

®

1-800-We-Buy-Cars

AMBIANCE PROFESSIONAL SERVICES *Handyman & Remodeling *Kitchen Installations *Furniture Assembly *Finish Carpentry *Minor Electrical & Plumbing 25 year GC Resident Lic & Ins H18E2170000 Call BOB 516-741-2154 AQUATEC LAWN SPRINKLERS SPRING TURN ONSBackflow Device Tests Free Estimates Installation Service/Repairs Joe Barbato 516-775-1199 ARIS HOME IMPROVEMENT All phases of repairs inside and out Roofing, Driveway, Siding, Masonry, Brick, Kitchen, Bathrooms, Extensions, Patios, Fencing, Porch, Basement, etc. Licensed and Insured. Call Aris or Vicky 516-406-1842 BATHROOM RENOVATIONS EASY, ONE DAY updates! We specialize in safe bathing. Grab bars, no slip flooring & seated showers. Call for a free in home consultation: 888-657-9488 Home Improvement Climate Change causing your Roof and Siding to Leak? The Time is now to Call ARIS Construction To Fix this before Winter sets in. 516-406-1842 MADE IN THE SHADE Custom Window Treatments Blinds, Shades, Shutters, Draperies Top Brands at Discount Prices! Family owned & operated www.madeintheshadensli. com 516-426-2890

AUTOS WANTED

JUNK CARS BOUGHT Auto Wrecking Frank & Sons

ANY YEAR â&#x20AC;¢ ANY CONDITION

800WeBuyCars.com

1-800-932-8922

516-997-5736 D O N AT E YO U R C A R Wheels For Wishes

benefiting

Make-A-Wish ® Suffolk County or Metro New York WheelsForWishes.org

* 100% Tax Deductible * Free Vehicle Pickup ANYWHERE * We Accept Most Vehicles Running or Not * We Also Accept Boats, Motorcycles & RVs

Metro New York Call:(917)336-1254 Suffolk County Call:(631)317-2014

* Car Donation Foundation d/b/a Wheels For Wishes. To learn more about our programs or        


Blank Slate Media Newspapers, Friday, July 12, 2019

67

▼TUTORING, CLEANING, SERVICES HOME IMPROVEMENTS MASONRY All types of stonework Pavers, Retaining Walls, Belgium Block Patios, Foundations, Seal coating, Concrete and Asphalt driveways, Sidewalks, Steps. Free Estimates Fully Licensed & Insured #H2219010000 Boceski Masonry Louie 516-850-4886 PAULIE THE ROOFER STOPPING LEAKS IS MY SPECIALTY! Slate & Tile Specialists All types of Roofing Local References Licensed & Insured 516-621-3869

PARTY HELP

TUTORING

TUTORING

CLEANING

SERVICES

LADIES & GENTLEMEN RELAX & ENJOY Your Next Party! Catering and Experienced Professional Services for Assisting with Preparation, Serving and Clean Up Before, During and After Your Party Bartenders Available. Call Kate at 516-248-1545

MATH, SAT, ACT TUTOR: Algebra, Geometry, Algebra 2 plus Trig, PreCalc, AP Calculus. Norm 625-3314

ENGLISH, ACT, SAT TUTOR: 25+ year experience Critical Reading, Writing, Grammar, Essays. Lynne 625-3314

HOUSE CLEANING Excellent service with great references, reliable, own transportation. Please call Mirian at 516-642-6624

CLEANING

SERVICES

GARDEN CITY WINDOW CLEANING HOME WINDOW CLEANING INTERIOR/EXTERIOR SERVICE BY OWNER Fully Insured/ 25 yrs experience 516-764-5686 631-220-1851

A & J MOVING & STORAGE: Established 1971. Long Island and New York State specialists. Residential, Commercial, Piano & Organ experts. Boxes available. Free estimates. www.ajmoving.com 516-741-2657 114 Jericho Tpk, Mineola NYDOT# 10405

COMPLETE DEMOLITION/ JUNK REMOVAL SERVICE: Strong Arm Contracting Inc. We Remove and Demo Anything. We Take it Down, Take it Apart & Take it Away and Leave Your Home or Business Swept Clean. Residential/Commercial Bonded/Insured Free Estimates. 516-538-1125

LIST YOUR SERVICES CALL 516.307.1045

TUTOR- SUMMER HW ASSIGNMENTS GC High School Senior, Honor Student (National Honor Society, 100 GPA) will tutor your child in Math, Science, English, Social Studies Has drivers license; Text 917-648-1057

www.theIslandnow.com

YOUR AD HERE 516.307.1045

Saving a Life EVERY 11 MINUTES

HEALTH SERVICES FAMILY CARE CONNECTIONS, LLC Dr. Ann Marie D’Angelo PMHCNS-BC Doctor of Nursing Practice Advanced Practice Nurse Care Manager Assistance with Aging at Home/Care Coordintion Nursing Home & Assisted Living Placement PRI / Screens / Mini Mental Status Exams Medicaid Eligibility and Apllications 516-248-9323 www.drannmariedangelo.com 901 Stewart Ave, Ste 230 Garden City, NY 11530 Painting & Paperhanging

alone I’m never

Life Alert® is always here for me even when away from home.

INTERIOR & EXTERIOR PAINTING Plastering, Taping, Sheetrock Skim Cutting, Old Wood Refinish, Staining, Wallpaper Removal & Hanging, Paint Removal, Power Washing, Wood Replacement

One touch of a button sends help fast, 24/7.

JOHN MIGLIACCIO Licensed & Insured #80422100000 Call John anytime: 516-901-9398 (Cell) 516-483-3669 (Office)

:Yll]ja]kF]n]jF]]\;`Yj_af_&

FREE Information Kit

1-855-225-1434

Get help paying dental bills and keep more money in your pocket This is real dental insurance — NOT just a discount plan You can get coverage before your next checkup

Don’t wait! Call now and we’ll rush you a FREE Information Kit with all the details. Insurance Policy P150NY 6129

! FREE

FIRST AID

KIT

WHEN YOU ORDER!

+HOS2QWKH*R

For a FREE brochure call:

DENTAL Insurance CALL NOW!

with

®

STRONG ARM PAINTING Interior & Exterior Tape, Spackle, Sheetrock, Molding. Residential and Commercial Bonded and Insured FREE ESTIMATES 516-538-1125 www.strongarmcleaningny.com

A less expensive way to help get the dental care you deserve!

+HOSDW+RPH GPS !

MICHELANGELO PAINTING & WALLPAPER Interior, Exterior, Plaster/Spackle, Light Carpentry, Decorative Moldings & Power Washing. Call: 516-328-7499

Physicians Mutual Insurance Company

DISH TV $59.99 for 190 Channels + $14.95 High Speed Internet. Free Installation, Smart HD DVR Included, Free Voice Remote. Some restrictions apply. Call 1-800-943-0838

1-855-225-1434 Visit us online at

www.dental50plus.com/nypress MB17-NM003Ec

1-800-404-9776

Do you know THESE MEN? William Authenrieth Hugo Bedoya Edward Brennan Douglas Brown Joseph P. Byrns Gerard J. Chasse Angelo J. Ditta

Michael R. Hands Martin Osborne Charles A. Ribaudo Ernest E. Robinson Afred B. Soave Raymond Stegmann

If you have information regarding alleged abuse or its cover-up involving these men, CONTACT US.

The NY Child Victims Act may be able to help you!

646-493-1850

57 West 57th Street, 3rd Floor New York, NY 10019


68 Blank Slate Media Newspapers, Friday, July 12, 2019

Opioid deaths see Town dog tethering decline in Nassau regulations approved Continued from Page 10 Deaths dropped by 11 to 184 in 2017, according to the medical examiner’s office, and then by another 37 people in 2018 to 147 – an overall difference of about 24.6 percent. This is the lowest overdose death count since 2014, when 149 people died from overdoses. “The opioid epidemic continues to be the most pressing public health crisis facing our communities, but this dramatic drop in overdose deaths shows that our work to bridge the treatment gap is saving lives,” Nassau County District Attorney Madeline Singas said. Singas said that since the district attorney’s office partnered with Maryhaven’s New Hope Center to provide inpatient treatment in 2015, the facility helped more than 2,200 people get “the support they need to break free from addiction.” Singas also thanked the county executive, Nassau County Police Department and “law enforcement partners at every level.” Nassau County Executive Laura Curran credited much of the drop in overdose deaths to a “three-pronged strategy of enforcement, education and treatment to fight the opioid crisis” by the district attorney and said the county is “com-

mitted to building on this commendable process.” “That’s why at my direction, Nassau County has mobilized at full-scale to meet the long-term treatment and education challenges necessary to eradicate this epidemic in Nassau County,” Curran said. “We cannot wait this out – for every additional life we can save, there is another family that does not have to bury a loved one.” Nassau County Police Commissioner Patrick Ryder said the department and district attorney’s office have been in a “full-court press for the last two years” against the heroin epidemic and overdoses. In that time they have seen a decline in overdoses, both fatal and nonfatal, and the need to use naloxone – better known as Narcan – to block the effects of opioid overdoses, Ryder said. Still, Ryder added, they intend to keep on pushing with initiatives under “Operation Natalie” such as the “Takedown Drugs Programs” in wrestling, lacrosse and Little League. “We thank all of these organizations for their continued support, that we stand together and for sending the right message that we will continue to work together to take down drugs,” Ryder said.

Continued from Page 10 In other business, the Town Board awarded a $1.08 million contract to Galvin Brothers to expand the Hempstead Harbor Shoreline Trail by one mile south. This will be partly funded by $450,000

worth of grants. The 200 acres of woodlands across the street from North Hempstead Beach Park was also renamed Hempstead Harbor Woods, which will be the location of a mountain bike trail and hiking trail.

VIDEO STILL FROM TOWN OF NORTH HEMPSTEAD YOUTUBE

Town Supervisor Judi Bosworth, pictured here with North Hempstead Animal Shelter Director Jenna Givargidze, pets Royal, a dog at the North Hempstead Animal Shelter.


70 Blank Slate Media Newspapers, Friday, July 12, 2019

OUR TOWN

Birth order’s impact on your personality “Mom always liked you best!” The Smothers Brothers capitalized on that little sibling problem and their skits were hysterical. Poor Tommy Smothers was always being beaten and outsmarted by older brother Dick. We take for granted that we’ve been raised in a family and acknowledge that mothers and fathers have had a profound influence on our development. But, what is less commonly understood is the way that our siblings have determined who we are. The Marx Brothers and the Three Stooges all worked together and the world laughed long and hard as they smacked each other around, but how often have you heard anyone talk about how siblings influence our personality? Not too often

I suspect. The first guy to discuss birth order was Alfred Adler, one of the co-founders of psychoanalysis, and he developed his theory of birth order back at the beginning of the 20th century. He suggested that the place you had in your family had a big impact. Here is how Adler analyzed birth order: The Firstborn: Adler believed that the oldest sibling is the most dominant, feels the most responsibility, and pressure and is often the most neurotic and depressed in the family. They are the ones who are more likely to end up in an asylum. Research has also shown that firstborns are the brightest in the family. That is certainly true in my family. I was the middle child in my family and grew

DR. TOM FERRARO Our Town up thinking I was mentally deficient since my older brother was so smart. He was the one who got all the scholarships and all the academic awards. The Middle Child: The middle child is thought to have feelings of inferiority, becomes attention seeking, is highly competitive, feels unloved and

Born first, in the middle or last has a big effect on who you are

never gets enough attention. I must say that describes me well. But the good news about being a middle child is that they are often the ones who benefit from what the older siblings teach them. My older brother, not my teachers, introduced me to writers like Fyodor Dostoyevsky and Henry Miller and he was the one who took me to museums when I was younger. Middle children often seek out paths different from their older siblings and are the ones who tend to be the most successful in the family. The Youngest Child: The youngest sibling is usually described as the least responsible, most spoiled and most indulged. They are often the most fun, charming, social and outgoing. My family is proof of that with my youngest sibling being

chock full of charisma and social grace. Everyone wants to be around this guy. I recall that we once went shopping for some clothes for his two girls and remember how all the sales girls buzzed around him like bees to honey. And I felt like Mr. Invisible. Yes, indeed, my younger brother David has charm plus. It is of interest that all the hard science research fails to support much of these findings, but I think that isn’t because birth order is meaningless but more because the research is weak and not yet sensitive enough to measure these things. It makes sense that siblings have a big impact because they are the ones we spend so much time with as we grow up. In the family we all vie for parental love and approval and actually go to great lengths to get some. When I was a kid, I realized that we had a big family of seven and I once asked my mother the question that all kids either ask or think about: “Hey, Mom, Do you have any favorites in the family?” Kind of like what Tommy Smothers would shout to Dick, “Mom always liked you best!” My mother was a sly one and she cleverly answered, “Oh, Tommy, my love is like a big apple pie and I cut up the pieces equally between all of you. Everyone gets exactly the same size slice.” Somehow I never really believed that. But my question gets to the point Alfred Adler was consumed by: What goes on in the family? I think children will go to great lengths to gain the attention from parents and will go even further to differentiate themselves from their siblings. We all want a bigger piece of the pie don’t you think?

7-Week Summer Semester: June 28 - August 14 Fall 2019-2020 Semester: Sept 4 - Jan 21, 2020

NOW REGISTERING! Cherry Lane Gymnastics New Hyde Park

516-775-2828

Mommy & Me Classes • Pre-School Classes • Girls Instructional Classes

MANHASSET SCHOOL OF DANCE

Classes For All Ages and Levels

Ballet • Tap • Hip Hop • Jazz • Contemporary • Competition Team Call to schedule your FREE TRIAL LESSON Today!

47 Manhasset Ave., Manhasset, NY 11030 516-869-1600 www.movesandmotionsdance.com

###################

Voted “Best of the North Shore” 2015•2016•2017•2018

###################

##############################

##############################


The Great Neck News, Friday, July 12, 2019

GN

71

COMMUNITY NEWS

Coming up at the G.N. Park District Steppingstone Waterside Theatre: Head to Steppingstone Park, Saturday, July 13, when Strawberry Fields, featuring former members of the hit Broadway musical “Beatlemania,” perform. On Sunday, July 14, Plaza Productions presents “Mamma Mia,” featuring ABBA’s top hits including “Dancing Queen,” “Money, Money” and of course “Mamma Mia.” Performances begin at 8 p.m. and are free for Great Neck Park District residents, only with a valid park pass. Each park pass holder is allowed to bring two guests. For additional information visit website www.gnparks. org or call 516-487-4673. Special Sunday and Monday family events: On Monday, July 15, make your way to Firefighters Park at 6 p.m. for a magic show. Enjoy Sunday Funday in Allenwood Park on Sunday, July 21 from 11 a.m.

to 1 p.m. Have fun while playing games, dancing and singing at this interactive children’s event. Parkwood Family Aquatic Center: Become a member today. It’s never too late. Enjoy free events and programs with your membership. Visit the center on Sunday, July 14 from 9:30 to 11:30 a.m., for “Bring Your Own Float” day. Children under age 16 must be accompanied by a parent. Become a member at www.gnparks.org or at Great Neck House, 14 Arrandale Ave. Rotary Band concert in the Village Green: Free Rotary Band concert in the Village Green on Wednesday, July 17 at 7:30 p.m. Bring chair or blanket. Moved to Parkwood Sports Complex if weather inclement. Call 516-487-4673 for more information. Nature Program – Early

summer seasonal stroll: Saturday, July 13 at 10 a.m. join an early summer seasonal stroll in Kings Point Park. Meet in the paved lot at the Steamboat Road entrance. Register online at gnparks.org or call 516-4874673. Children under 16 may not attend. Sail this summer at Steppingstone Marina: Adult sailing

begins at Steppingstone Marina on Thursday, July 11 and runs through August 1. In addition to adult sailing programs, family courses, new waterfront activities, kayak and sailboat rentals, the marina has a summertime sailing program (ages 7 to 17), July 1 to August 30. For those who love to sail or would like to learn, this full or half-day pro-

gram will have you “on board” in no time! Register weekly or for the whole summer. There are additional activities at Parkwood Sports Complex and optional transportation, daily lunches and field trips. Also offered is sail school (beginners through expert level, ages 7 to 17) for a more competitive, intensive experience on the water. Shake a leg and all hands on deck! Check it out at www. gnparks.org. Outdoor Movie in the Village Green: The animated film, “Mary Poppins Returns,” is showing outdoors in the Village Green on Thursday, July 25 at 6 p.m. The film stars Emily Blunt, Lin-Manuel Miranda and Ben Whishaw. It is rated PG and runs 2h 10min. Bring your own chair/blanket. Rain location Parkwood Sports Complex. Call 516-487-4673 for more information.

Play by N. Shore resident LIRR at Belmont to premiere in New York Ellen Pober Rittberg, a Roslyn High School alum who returned to Roslyn in 2009 and lived there for six years, is having the Manhattan debut of her play Sci Fi at New York Theater Festival’s Summerfest. The festival is New York City’s largest theater festival. Sci Fi will have performances July 29 at 6:15 p.m., Aug. 2 at 9 p.m. and Aug. 4 at 4 p.m. at Hudson Guild Theater, 441 West 26th Street. It began as a play in Roslyn over 25 years ago when Rittbergdid a staged reading of it at Nassau County Festival for the Arts, held at the museum in Roslyn. She learned the craft of writing plays in Great Neck after seeing saw a newspaper community announcement that there was a playwriting course being given at St. Paul’s Episcopal Church in Great Neck by Ann Early. So you could say Sci Fi, a dystopian near future play about what happens to people and relationships once freedom and democracy have disappeared, has decidedly Long Island roots. Ticket information can be found at http:// www.newyorktheaterfestival.com/sci-fi/ Submitted by Ellen Pober Rittberg

PHOTO COURTESY OF ELLEN POBER RITTBERG

Ellen Pober Rittberg, playwright and former Roslyn resident.

www.facebook.com/TheIslandNow

Continued from Page 5 Phillips is critical of the location of the proposed train station, noting that the station is not in Belmont, but in Bellerose Terrace. On the station, Phillips said, “It doesn’t solve the problems of Elmont residents.” Dominick Longobardi, mayor of the Village of Floral Park, said that he has asked engineers to review the plans for the proposed LIRR station. In a statement to residents Longobardi wrote, “Although a train station may be helpful in that it may alleviate some traffic, it’s not a panacea and, quite frankly, generates additional concerns as to the placement of the train station and its impact on surrounding residents.” Longobardi said his three concerns about the Belmont Park project are traffic, parking and security. He said that while the original plans for the arena project had a parking lot, the parking burden will be on the residents in more updated plans. Longobardi said that in order to be successful, the arena must be open at least 250 days a year and he is concerned about the effect the constant influx of consumers for games will have on the community. At Monday’s village board meeting Longobardi said, “As this

project progressed new elements were introduced such as the use of the south parking lot for the “Shopping Experience,” forcing the major majority of the parking to be behind the main racetrack and placing it adjacent to our grammar school and many of our homes, leaving our residents to deal with all kinds of issues from security, tailgating, light and noise pollution, etc. We have discussed ways to alleviate these issues such as natural barriers, directed lighting.” Longobardi is requesting more time to review the project’s final Environmental Impact Statement, which has 22 large chapters. Longobardi and the Floral Park village board said they doubt that a public comment period closing at noon on July 23 is enough time to respond. The new LIRR station has the support of state Sens. Anna Kaplan (D-Great Neck) and Todd Kaminsky (D-Long Beach), Hempstead Town Supervisor Laura Gillen and Nassau County Executive Laura Curran. “I am confident that this project will deliver real, long-term benefits for Long Islanders. Let’s say ‘yes’ to jobs, ‘yes’ to economic opportunity, and ‘yes’ to creating a Long Island that will thrive in the future,” Curran said in a news release.

www.TheIslandNow.com


72 The Great Neck News, Friday, July 12, 2019

GN

MINDYâ&#x20AC;&#x2122;S SIGNATURE INVENTORY LET THE EXPERT SHOW YOU â&#x20AC;&#x2DC;ROUND TOWN

160 Middle Neck Rd #2-K | $618,000 | Web#3137114

44 Deepdale le Dr D | $1,188,000 $1 $ 1 8,0 0 00 0 | Web# W 3120392

15 Canterbury #A-7 | $198,000 | Web# 3079621

#3 H | $198,000 000 | Web# 3123663 30 Stoner Avee #3-H

16 Canterbury #1-B | $228,00 | Web# 3121482

-O | $558,000 $5 58,000 | Web# 3143014 4 Maple Dr #4P-O

180 S Middle Neck Rd #2-P | $328,000 | Web# 3138891

Web# b# 3128706 45 Hillpark Ave #3-N | $585,000 | W

2 Sheffield Rd | $948,000 | Web# 3108608

50 Brompton Rd #1-E | $298,000 | Web# 3128762

20 Canterbury Rd #2-J | $650,000 | Web# *1351206

8 Barstow Rd #4-H | $376,000 | Web# 3102867

21 Barstow Rd #2-I | $348,000 | Web# 3125593

90 Schenck Ave #1-F | $398,000 | Web# 3127004

25 Canterbury #3-C | $468,000 | Web# *1351209

90 Schenck Ave #2-H | $258,000 | Web# 3127003

Mindy GREENBERG AT DOUGLAS ELLIMAN REAL ESTATE

Mindy Greenberg, Lic. Assoc. R. E. Broker O: 516.498.2125 | M: 917.974.4500 mindy.greenberg@elliman.com GreatNeckForSale.com Board Of Directors: Long Island Board of Realtors, Nassau North Shore Division Interior Design Celebrity: Home + Garden Television Great Neck South Graduate: Class of 1978 Great Neck Resident Most Listed & Most Sold     2018, 2017 & 2016

elliman.com/longisland 110 WALT WHITMAN ROAD, HUNTINGTON STATION, NY, 11746. 631.549.7401. © 2019 DOUGLAS ELLIMAN REAL ESTATE. ALL MATERIAL PRESENTED HEREIN IS INTENDED FOR INFORMATION PURPOSES ONLY. WHILE THIS INFORMATION IS BELIEVED TO BE CORRECT, IT IS REPRESENTED SUBJECT TO ERRORS, OMISSIONS, CHANGES OR WITHDRAWAL WITHOUT NOTICE. ALL PROPERTY INFORMATION, INCLUDING, BUT NOT LIMITED TO SQUARE FOOTAGE, ROOM COUNT, NUMBER OF BEDROOMS AND THE SCHOOL DISTRICT IN PROPERTY LISTINGS SHOULD BE VERIFIED BY YOUR OWN ATTORNEY, ARCHITECT OR ZONING EXPERT. EQUAL HOUSING OPPORTUNITY. *EXCLUSIVE LISTING

Profile for The Island Now

Great Neck 2019_07_12  

www.theislandnow.com

Great Neck 2019_07_12  

www.theislandnow.com

Advertisement