Page 1

Esteem Bathrooms O

2020 V1 2020 V1 Baths O Showering O Sanitaryware O Furniture O Taps O Heating O Accessories EB20_001_Front Cover and 12mm Spine_Generic.indd All Pages

15/11/2019 10:33


EB20_Inner Covers.indd A4 V

15/11/2019 10:01


Inspiring Creations

Choosing and planning a bathroom is an exciting time. After all, it’s the only room where you can truly relax, refresh and revitalise. Our collection has been carefully selected from leading manufacturers and suppliers to offer you a wealth of choice and styles. We realise that value is important to you, but not at the expense of good design. Whatever aspect of your bathroom you’re looking to revamp, you’ll find our selection of products to be more than suitable. We’ve included lots of handy hints, inspirational ideas and the very latest bathroom trends. Our knowledgeable and friendly bathroom team is always here to guide you if you’d like some extra advice.

Let’s start creating your dream bathroom.

For further technical details

Scan QR Code

www.esteembathrooms.com

EB20_Book.indb 3

18/11/2019 15:30


Contents Sanitaryware Inglis Risco Kisdon Aber Arch Aber Cube Glanni Aira Laja Narva Cube Narva Arch Tortum Trenton Belmore Vessel Basins Toilet Seats Ideal Standard

Frames & Cisterns WC Frames Concealed Cisterns - Basin Frames Concealed Cisterns WC Press Panels

Modular Furniture Belmore Malanda Narva Cube Laja Cube Trenton Serio Anta Sabie Travet Kopren Eland Papala Inglis Back to Wall Units Storage Columns

Fitted Furniture Shaker Style Slab Style Handles & Worktops Plinths & Panels

8-45 10 12 14 16 18 19 20 23 24 26 28 30 32 36 37 38

46-51 47 48 49 51

52-81 54 56 61 62 63 64 66 71 72 74 76 77 78 80 81

82-91 84 86 88 90

Cabinets

92-99

Mirrors

100-105

Baths

106-127

Standard Plus Baths Standard Shower Baths Premium Baths Freestanding Baths Premium Freestanding Baths

108 112 114 118 125

Bath Panels

128

Bath Accessories

129

Bath Screens Esteem 8 Esteem 6 Esteem 5

Taps & Waste

130-133 130 131 133

134-155

Bathroom Taps Aira Risco Blade Risco Vettis Canim Laja Narva Mina Tortum Trenton Kisdon Blos, Risco, Nachi & Alamar Belmore Emperor

136 137 138 139 140 141 142 143 144 145 146 147 148 149

Kitchen Taps

150

Wastes

154

Mixer Showers Thermostatic Showers Concealed Showers Shower Kit Components

156-173 158 164 168

4 Contents EB20_Book.indb 4

18/11/2019 15:30


Shower Enclosures Esteem 8 Quadrant Esteem 8 Sliding Doors Esteem 8 Pivot Doors Esteem 8 Bifold Doors Esteem 6 Level Access Sliding Doors Esteem 6 Sliding Doors Esteem 6 Single Door Quadrant Esteem 6 Double Door Quadrant Esteem 6 Pivot Doors Esteem 6 Bifold Doors Esteem 6 Corner Entry

Shower Trays Esteem Esteem Anti-Slip Evolved by JT Evolved by JT with JT Anti-Slip™

Wetrooms Corner Panel Glass to Glass Panel Deflector Panel & Linear Panel Bracing Kits

Wall Panelling Linda Barker Mutlipanel Classic Multipanel Heritage Multipanel Reflect Multipanel Tile Multipanel PVC Economy Multipanel WetFlor® Multipanel Flooring Click Multipanel Flooring Ceilings Multipanel Kitchen Splashbacks Multipanel

Towel Rails 22mm Straight Chrome 22mm Curved Chrome 25mm Straight - Chrome or White 25mm Curved - Chrome or White 25mm Coloured

174-185 174 176 177 178 179 180 181 182 183 184 185

186-189 186 187 188 189

190-197 192 194 195 196

198-213 200 202 204 206 207 208 209 210 212 213

214-221 216 217 218 219 220

Designer Towel Rails Narva - Stainless Steel Huka - Stainless Steel Edessa - Chrome Avis - Chrome Anta - Chrome Mardel - Chrome Aira - Chrome or White Laja - Chrome or White Risco - Chrome or White Heti - Chrome Riand - Chrome or White Inga - Chrome Teviot - Dual Actions Fulmer - Chrome or White Belmore Henfall - Sealed Electric

Designer Radiators Mackay Mela Bryde Kisdon Everest Alto Line Plan Verona Lo-Line Verona Verona Slimline Column Concept Column

222-237 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237

238-255 238 239 240 242 244 246 247 249 250 252 253 254

Radiator Valves

256-257

Electric Underfloor Heating

258-263

Lighting

266

Ventilation

267

Bathroom Accessories

268-273

Prices are subject to change without notice. We reserve the right to amend specifications at any time. All photographs and images are for illustrative purposes only. There may be items shown which are not included or may not be a true representation of the actual product. 11/19 VAT rate 20% at time of going to press. ©Esteem Bathrooms. All Rights reserved.

Contents EB20_Book.indb 5

5

18/11/2019 15:30


Planning your

bathroom

There’s a great deal to consider when thinking about your bathroom design. A room that will help ease you through some of the busiest times of your day, as well as welcoming you when you’re ready to relax and unwind.

Floor plan Whether the style you crave is one of understated elegance, full-on glamour or something more modest, planning ahead is the essential way to get the best out of your bathroom. Your first step should be to devise a floor plan – see inner back page. Think about what items you want to include, and how they will be used. It is crucial to make sure you factor in enough space for standing and moving around.

Suitability for all Think about who will be using your bathroom. Freestanding baths might look fantastic, but can be difficult for children or the less agile. Looks alone should not sway your decision, make sure you go for function as well as form.

Storage Modern minimalist designs only work if all bathroom products are carefully and cleverly concealed. Plumbing paraphernalia is also best hidden away. Concealing it within furniture is a great solution, as it still remains accessible for any maintenance.

6 Planning your Bathroom EB20_Book.indb 6

18/11/2019 15:30


Heating Underfloor heating is an excellent alternative to radiators, offering a warming solution for a contemporary bathroom. It is simple to install during the flooring phase, and provides heat across the entire room. Heated towel rails have also become a must-have for the modern bathroom. Choices range from the more traditional chrome and stainless steel finishes, to an array of colours that can be matched or contrasted with your other design preferences.

Decoration There are many materials, styles, textures and finishes to choose from when decorating a bathroom. Tiles in a wet environment are the most popular option, as they are both practical and wonderfully aesthetic. They can also help make spaces appear much larger. Using a panel of vibrant wall colour can create a dramatic look. Bold hues can add zest and warmth or when used sparingly against a sleek white bathroom will instantly create a modern contemporary feel. Adding texture with more tactile materials such as wood and glass can be wonderfully relaxing, adding a spa-like quality to your space.

Mirrors & Lighting Lighting can make a huge difference to the mood of your room. For example flush fitted recessed lights in the ceiling will help fill the room with a soft ambient light. Mirrors are not only a bathroom essential, their clever use can also make a bathroom seem both larger and brighter. And much like lighting, your bathroom may benefit from the use of multiple mirrors which can effectively alter any surroundings.

Planning your Bathroom EB20_Book.indb 7

7

18/11/2019 15:30


Sanitaryware / Xxx

Bright, bold and beautiful

Sanitaryware Modern Ceramics Traditional Ceramics Vessel Basins Toilet Seats Ideal Standard

8 Sanitaryware EB20_Book.indb 8

P10-31 P32-35 P36 P37 P38-45

Price includes VAT

18/11/2019 15:30


Hexagonal tiles are a top bathroom trend

Bathrooms that make a statement

Create a bathroom of distinction with one of our stylish suites. Choose between modern curves or more traditional angles. Now is the time to be inspired and create a truly unique space. “Quick-release and soft-close toilet seats are much more hygienic and will help make cleaning easier� Sanitaryware EB20_Book.indb 9

9

18/11/2019 15:30


Sanitaryware / Inglis

Sanitaryware

Sleek minimalist design

Comfort height pan

Inglis Inglis - Suite

ENTY YE

UA

RANT

E10139

Close Coupled WC Pan - White

w340 x h400 x d640

£323.46

E10140

Close Coupled Cistern - White

w340 x h450 x d135

£159.07

E10146

Soft Close Top Fix Quick Release Seat - White

w346 x d425

£85.40

E10141

1 Tap Hole Basin - White

w550 x h120 x d430

£177.20

E10142

Full Pedestal - White

w160 x h730 x d160

£85.40

E

10 Sanitaryware EB20_Book.indb 10

• Seats 5 year guarantee

Description

E

T

G

AR

20 10 W

Code

Size (mm)

RRP

Total £830.54

Price includes VAT

18/11/2019 15:30


Inglis / Sanitaryware

SOFT CLOSE

Inglis - Slim Soft Close Seat Code E10147

Description

Inglis - Comfort Height WC Pan Size (mm)

Slim Soft Close Seat - White

RRP

w346 x d425

£70.45

Code

Description

E10145

Comfort Height Back-to-Wall / Close Coupled WC Pan - White

Size (mm) w345 x h460 x d630

£382.16

E10140

Close Coupled Cistern - White

w340 x h450 x d135

£159.07

E10146

Soft Close Top Fix Quick Release Seat - White

w340 x d448

£85.40

SLIM SEAT

SOFT CLOSE

Inglis - Wall Hung WC Pan

Inglis - Short Projection WC Pan

Code

Description

E10148

Wall Hung WC Pan - White

w340 x h322 x d505

£295.71

E10147

Slim Soft Close Seat - White

w346 x d425

£70.45

Size (mm)

RRP

Inglis - Basin - 550mm

Code

Description

Size (mm)

RRP

E10144

Short Projection Close Coupled Back-to-Wall WC Pan - White

w345 x h400 x d610

£337.33

E10140

Close Coupled Cistern - White

w340 x h450 x d135

£159.07

E10146

Soft Close Top Fix Quick Release Seat

w340 x d448

£85.40

Size (mm)

RRP

Inglis - Back-to-Wall WC Pan

Code

Description

E10141

1 Tap Hole Basin - White

w550 x h120 x d430

E10142

Full Pedestal - White

w160 x h730 x d160

Size (mm)

All dimensions are in mm

EB20_Book.indb 11

RRP

RRP

Code

Description

£177.20

E10143

Back-to-Wall Pan - White

£85.40

E10146

Soft Close Top Fix Quick Release Seat

w345 x h395 x d515

£289.30

w340 x d448

£85.40

Sanitaryware

11 18/11/2019 15:30


Sanitaryware / Risco

Risco

Modern curved design

Risco - Suite

NT

Y FIVE

UA

E

TWE

G

AR YE

25 10 RANT

E

12 Sanitaryware EB20_Book.indb 12

Code

Description

Size (mm)

E10030

Close Coupled WC Pan - White

w355 x h400 x d620

£339.23

E10031

Close Coupled WC Cistern - White

w355 x h400 x d140

£145.38

E10019

Soft Close Seat with Quick Release - White

w381 x h75 x d470

£66.92

E10032

1 Tap Hole Basin - White

w560 x h175 x d480

£114.23

E10034

Full Pedestal - White

w185 x h710 x d190

£51.92 Total £717.69

Risco - Alternative Seat Option • Seats 1 year guarantee

Code

Description

E10020

Slimline Wrap - Soft Close Seat with Quick Release - White

RRP

Size (mm) w395 x h75 x d480

RRP £93.46

Price includes VAT

18/11/2019 15:30


Risco / Sanitaryware

RIMLESS OPTION

Risco - Wall Hung Pan

Risco - Close Coupled WC Pan Description

E10030

Close Coupled WC Pan - White

w355 x h400 x d620

£339.23

E10037

E10031

Close Coupled WC Cistern - White

w355 x h400 x d140

£145.38

E10038

w381 x h75 x d470

£66.92

E10019

w381 x h75 x d470

£93.46

E10020

E10019 E10020

Size (mm)

Soft Close Seat with Quick Release - White Slimline Wrap - Soft Close Seat with Quick Release - White

RRP

Code

Code

Risco - Back-to-Wall Pan Code

Description

E10036

Back-to-Wall Pan - White

E10019 E10020

Description

Size (mm)

Wall Hung Pan with Concealed Fixings White Wall Hung Rimless Pan with Concealed Fixings - White Soft Close Seat with Quick Release - White Slimline Wrap - Soft Close Seat with Quick Release - White

RRP

w355 x h355 x d500

£327.69

w355 x h355 x d500

£351.92

w381 x h75 x d470

£66.92

w381 x h75 x d470

£93.46

Risco - Basin - 560mm Size (mm)

Soft Close Seat with Quick Release - White Slimline Wrap - Soft Close Seat with Quick Release - White

RRP

Code

Description

Size (mm)

RRP

w355 x h420 x d500

£313.85

E10032

1 Tap Hole Basin - White

w560 x h175 x d480

£114.23

w381 x h75 x d470

£66.92

E10034

Full Pedestal - White

w185 x h710 x d190

£51.92

w381 x h75 x d470

£93.46

Risco - Basin - 450mm

Risco - Semi-Recessed Basin - 560mm

Code

Description

Size (mm)

RRP

E10033

1 Tap Hole Basin - White

w450 x h165 x d400

£103.85

E10010

Semi-Pedestal - White

w230 x h310 x d205

£36.92

Code

Description

E10035

Semi-Recessed Basin - White

Size (mm)

RRP

w560 x h165 x d450

£132.69

SMALL SIZE

Risco - Handrinse Cloakroom Basin - 400mm Code E10039

Description

Size (mm)

Handrinse Cloakroom Basin 1TH - White

w400 x h165 x d325

Risco - Handrinse Cloakroom Basin - 370mm RRP £118.85

Code E10040 E10041

All dimensions are in mm

EB20_Book.indb 13

Description Handrinse Cloakroom Basin 1TH - Left-Hand - White Handrinse Cloakroom Basin 1TH - Right-Hand - White

Size (mm)

RRP

w370 x h145 x d245

£114.23

w370 x h145 x d245

£114.23

Sanitaryware

13 18/11/2019 15:30


Sanitaryware / Kisdon

Kisdon

Reflect your style! ‘Meela’ mirror on page 103

Kisdon - Suite Code E10150 E10149 E10151

Description Close Coupled Enclosed Back, Rimless Pan 4.5 Litre - White Close Coupled Cistern 4.5 / 3 Litre Flush - White Slim Soft Close with Quick Release Seat - White

UA

RANT

£287.17

w375 x h430 x d125

£125.96

w370 x d450

£90.75

1 Tap Hole Basin - White

w560 x h155 x d160

£139.86

E10154

Full Pedestal - White

w180 x h725 x d160

£57.64

Total £701.38

• Seats 5 year guarantee

E

14 Sanitaryware EB20_Book.indb 14

w365 x h420 x d645

E

G

RRP

E10153

N YEAR TE

10

Size (mm)

Price includes VAT

18/11/2019 15:30


Kisdon / Sanitaryware

RIMLESS

Kisdon - Close Coupled Cistern Code E10150 E10149 E10151

Description

Kisdon - Basin - 560mm Size (mm)

Close Coupled Enclosed Back, Rimless Pan 4.5 Litre - White Close Coupled Cistern 4.5 / 3 Litre Flush - White Slim Soft Close with Quick Release Seat - White

RRP

w365 x h420 x d645

£287.17

w375 x h430 x d125

£125.96

w370 x d450

£90.75

Code

Description

Size (mm)

RRP

E10153

1 Tap Hole Basin - White

w560 x h155 x d450

£139.86

E10154

Full Pedestal - White

w180 x h725 x d160

£57.64

On trend! New style ‘slim’ seat

SOFT CLOSE

RIMLESS

Kisdon - Back-to-Wall Rimless WC Pan Code

Description

Size (mm)

E10152

Back-to-Wall Rimless Pan 4.5 Litre - White

E10151

Slim Soft Close with Quick Release Seat - White

Kisdon - Soft Close Seat RRP

w365 x h420 x d560

£258.33

w370 x d450

£90.75

Code

Description

Size (mm)

RRP

E10151

Slim Soft Close with Quick Release Seat - White

w370 x d450

£90.75

SLIM DEPTH

Kisdon - Semi-Recessed Basin - 560mm 1 Tap Hole - Standard Depth Code

Description

Size (mm)

E20139

Semi-Recessed Basin 1 Tap Hole

w560 x h130 x d450

All dimensions are in mm

EB20_Book.indb 15

Kisdon - Semi-Recessed Basin - 540mm 1 Tap Hole - Slim Depth RRP £182.52

Code

Description

E20140

Semi-Recessed Slim Basin 1 Tap Hole

Size (mm) w540 x h145 x d385

RRP £180.32

Sanitaryware

15 18/11/2019 15:31


Sanitaryware / Aber Arch

Aber Arch

Short projection WC Ideal for small spaces

Aber Arch - Suite

NT

RANT

RRP

E10081

Close Coupled WC Pan - White

w360 x h400 x d610

£303.46

E10082

Close Coupled Cistern - White

w360 x h390 x d140

£96.92

E10083

Soft Close Seat with Quick Release - White

w360 x h45 x d415

£85.38

E10084

1 Tap Hole Basin - White

w550 x h160 x d430

£121.15

E10052

Full Pedestal - White

w210 x h725 x d210

£61.15

Total £668.08

• Seats 1 year guarantee

E

16 Sanitaryware EB20_Book.indb 16

Size (mm)

E

UA

AR YE

TWE

Description

Y FIVE

25 10

G

Code

Price includes VAT

18/11/2019 15:31


Aber Arch / Sanitaryware

Striking angles with subtle curves

Aber Arch - Basin Half Pedestal

Aber Arch - Basin Full Pedestal

Code

Description

Size (mm)

E10084

1 Tap Hole Basin - White

w550 x h160 x d430

E10053

Semi-Pedestal - White

w185 x h385 x d275

RRP

Code

Description

£121.15

E10084

1 Tap Hole Basin - White

w550 x h160 x d430

£121.15

£66.92

E10052

Full Pedestal - White

w210 x h725 x d210

£61.15

SOFT CLOSE

Description

Size (mm)

E10085

%DFNWR:DOO3DQZLWKƓ[LQJV:KLWH

w360 x h400 x d540

E10083

Soft Close Seat with Quick Release - White

w360 x h45 x d415

All dimensions are in mm

EB20_Book.indb 17

RRP

SOFT CLOSE

Aber Arch - Back-to-Wall WC Pan Code

Size (mm)

Aber Arch - Close Coupled WC Pan RRP

Code

Description

Size (mm)

RRP

£242.31

E10081

Close Coupled WC Pan - White

w360 x h400 x d610

£303.46

£85.38

E10082

Close Coupled Cistern - White

w360 x h390 x d140

£96.92

E10083

Soft Close Seat with Quick Release - White

w360 x h45 x d415

£85.38

Sanitaryware

17 18/11/2019 15:31


Sanitaryware / Aber Cube

Aber Cube

NT

Y FIVE

• Seats 1 year guarantee

E

TWE

UA

AR YE

25 10

G

Aber Cube - Suite

RANT

E

Code

Description

Size (mm)

RRP

E10086

Close Coupled WC Pan - White

w360 x h400 x d630

£266.54

E10092

Close Coupled Cistern - White

w360 x h400 x d160

£118.98

E10083

Soft Close Seat with Quick Release - White

w360 x h45 x d415

£85.38

E10051

1 Tap Hole Basin - White

w500 x h135 x d410

£138.46

E10053

Semi-Pedestal - White

w185 x h1385 x d275

£66.92

Total £676.29

Aber Cube - Basin Half Pedestal - 500mm Code

Description

Size (mm)

E10051

1 Tap Hole Basin - White

w500 x h135 x d410

£138.46

E10053

Semi-Pedestal - White

w185 x h385 x d275

£66.92

SOFT CLOSE

RRP

Aber Cube - Close Coupled WC Pan Aber Cube - Basin Full Pedestal - 500mm Code

Description

E10051

1 Tap Hole Basin - White

w500 x h135 x d410

£138.46

E10052

Full Pedestal - White

w180 x h735x d180

£61.15

18 Sanitaryware EB20_Book.indb 18

Size (mm)

RRP

Code

Description

Size (mm)

RRP

E10086

Close Coupled WC Pan - White

w360 x h400 x d630

£266.54

E10092

Close Coupled Cistern - White

w360 x h160 x d400

£118.98

E10083

Soft Close Seat with Quick Release - White

w360 x h45 x d415

£85.38

Price includes VAT

18/11/2019 15:31


Glanni / Sanitaryware

Glanni

Wetroom style tray - see page 188 NT

Y FIVE

• Seats 1 year guarantee

E

TWE

UA

AR YE

25 10

G

Glanni - Suite

RANT

E

SOFT CLOSE

Code

Description

Size (mm)

RRP

E10086

Close Coupled WC Pan - White

w360 x h400 x d630

£266.54

E10087

Close Coupled Cistern - White

w360 x h400 x d160

£96.92

E10083

Soft Close Seat with Quick Release - White

w395 x h70 x d460

£85.38

E10090

1 Tap Hole Basin - White

w550 x h165 x d450

£138.46

E10091

Full Pedestal - White

w200 x h700 x d200

£61.15

Total £648.46

Glanni - Back-To-Wall WC Pan Code

Description

Size (mm)

RRP

E10088

Back-to-Wall Pan - White

w360 x h400 x d540

£260.77

E10083

Soft Close Seat with Quick Release - White

w395 x h70 x d460

£85.38

Glanni - Wall Hung WC Pan Code E10089 E10083

Description

Glanni - Basin - 550mm Size (mm)

Wall Hung WC Pan with Concealed Fixings - White Soft Close Seat with Quick Release - White

w360 x h335 x d500

£272.31

w395 x h70 x d460

£85.38

All dimensions are in mm

EB20_Book.indb 19

RRP

Code

Description

Size (mm)

RRP

E10090

1 Tap Hole Basin - White

w550 x h165 x d450

£138.46

E10053

Semi-Pedestal - White

w185 x h385 x d275

£66.92

Sanitaryware

19 18/11/2019 15:31


Sanitaryware / Aira

Aira

Fully enclosed WC pan Aira - Suite Code

Description

Size (mm)

RRP

E10063

Close Coupled WC Pan - White

w360 x h390 x d660

£279.23

E10075

Close Coupled WC Cistern - White

w360 x h430 x d160

£102.69

E10045

Soft Close Seat - Quick Release - White

w358 x h45 x d440

£85.38

E10060

1 Tap Hole Basin - White

w550 x h165 x d440

£122.31

E10061

Full Pedestal - White

w195 x h690 x d245

£55.38

Total £645.00

Aira - Alternative Seat Options

Y FIVE NT

UA

E

TWE

G

AR YE

25 10 RANT

E

20 Sanitaryware EB20_Book.indb 20

Code

• Seats 1 year guarantee

E10046 E10047

Description Slimline Soft Close Seat - Quick Release White Wrap Over Soft Close Seat - Quick Release - White

Size (mm)

RRP

w358 x h30 x d435

£91.15

w358 x h30 x d450

£91.15

Price includes VAT

18/11/2019 15:31


Aira / Sanitaryware

SOFT CLOSE

RIMLESS

Aira - Closed Back WC Pan

Aira - Close Coupled WC Pan

Code

Description

E10076

Close Coupled Rimless Fully BTW WC Pan - White

w360 x h400 x d665

E10077

Close Coupled WC Cistern - White

E10045 E10046 E10047

Size (mm)

Soft Close Seat with Quick Release - White Slimline Soft Close Seat with Quick Release - White Wrap Over Soft Close Seat with Quick Release - White

RRP

Code

Description

£321.92

E10063

Close Coupled WC Pan - White

w360 x h390 x d660

£279.23

w360 x h430 x d160

£109.62

E10075

Close Coupled WC Cistern - White

w360 x h430 x d160

£102.69

w358 x h45 x d440

£85.38

E10045

w358 x h45 x d440

£85.38

w358 x h30 x d435

£91.15

E10046

w358 x h30 x d435

£91.15

w358 x h30 x d450

£91.15

E10047

w358 x h30 x d450

£91.15

Soft Close Seat with Quick Release - White Slimline Soft Close Seat with Quick Release - White Wrap Over Soft Close Seat with Quick Release - White

RIMLESS OPTION

E10066 E10068 E10045

Description

Aira - Back-to-Wall WC Pan Size (mm)

Wall Hung WC Pan with Concealed Fixings - White Wall Hung Rimless WC Pan with Concealed Fixings - White Soft Close Seat with Quick Release - White

RRP

RIMLESS OPTION

Aira - Wall Hung WC Pan Code

Size (mm)

RRP

w360 x h520 x d350

£285.00

w360 x h520 x d350

£315.00

w358 x h45 x d440

£85.38

Code

Description

Size (mm)

RRP

E10065

Back-to-Wall WC Pan - White

w360 x 560 x 390

£260.77

E10067

Back-to-Wall Rimless WC Pan - White

w360 x 520 x 390

£315.00

E10045

Soft Close Seat with Quick Release - White

w358 x h45 x d440

£85.38

Aira - Short Projection Wall Hung Rimless WC Pan Code E10069 E10064

Description Wall Hung Rimless (470mm short projection) WC Pan with Concealed Fixings - White Slimline Soft Close Seat with Quick Release - White

Size (mm) w360 x h350 x d470

£315.00

w358 x h45 x d440

£85.38

All dimensions are in mm

EB20_Book.indb 21

RRP

RIMLESS

Sanitaryware

21 18/11/2019 15:31


Sanitaryware / Aira

Aira - Semi-Recessed Basin - 550mm Code

Description

E10062

Semi-Recessed Basin - White

Size (mm) w550 x h145 x d420

RRP £169.62

SMALL SIZE

Aira - Basin - Half Pedestal - 550mm Size (mm)

Aira - Corner Cloakroom Basin - 330mm

Code

Description

RRP

E10060

1 Tap Hole Basin - White

w550 x h165 x d440

£122.31

E10010

Semi-Pedestal - White

w230 x h310 x d205

£36.92

Aira - Wide Basin - Full Pedestal - 610mm Code

Description

E10079

1 Tap Hole Basin - White

w610 x h205 x d490

E10080

Full Pedestal - White

w200 x h690 x d200

22 Sanitaryware EB20_Book.indb 22

Size (mm)

Code

Description

E10078

Corner Cloakroom Basin - White

Size (mm) w330 x h160 x d445

RRP £109.62

Aira - Basin - Full Pedestal - 550mm RRP

Code

Description

Size (mm)

RRP

£133.85

E10060

1 Tap Hole Basin - White

w550 x h165 x d440

£122.31

£66.92

E10061

Full Pedestal - White

w195 x h690 x d245

£55.38

Price includes VAT

18/11/2019 15:31


Laja WC Options / Sanitaryware

Laja

Alternative WC Pan Options

NT

Y FIVE

Complements ‘Sabie’ vanity unit on page 71

E

TWE

UA

AR YE

25 10

G

RANT

E

Seats 1 year guarantee

RIMLESS OPTION

SOFT CLOSE

Laja Cube / Arch - Close Coupled WC Pan Code

Description

Size (mm)

RRP

E10042

Close Coupled WC Pan - White

w360 x h420 x d630

£199.62

E10043

Close Coupled WC Cistern - White

w360 x h370 x d150

E10047

Wrap Over Soft Close Seat with Quick Release - White

w358 x h30 x d450

Laja Cube / Arch - Close Coupled Rimless WC Pan Code

Description

£85.38

E10044

Close Coupled Rimless WC Pan - White

w360 x h420 x d630

£223.85

£91.15

E10043

Close Coupled WC Cistern - White

w360 x h370 x d150

£85.38

RIMLESS OPTION

Laja Cube / Arch - Wall Hung Rimless WC Pan

Code

Description

E10048

Back-to-Wall Pan - White

w360 x h420 x d520

£242.31

E10049

Back-to-Wall Rimless Pan - White

w360 x h420 x d520

£266.54

E10047

Wrap Over Soft Close Seat with Quick Release - White

w358 x h30 x d450

£91.15

All dimensions are in mm

EB20_Book.indb 23

RRP

RIMLESS

Laja Cube / Arch - Back-to-Wall WC Pan Size (mm)

Size (mm)

RRP

Code E10050 E10046

Description Wall Hung Rimless WC Pan with Concealed Fixings - White Slimline Soft Close Seat - Quick Release - White

Size (mm)

RRP

w360 x h320 x d520

£279.23

w358 x h25 x d450

£91.15

Sanitaryware

23 18/11/2019 15:31


Sanitaryware / Narva Cube

Narva Cube

Matching curved bath - see page 111 Narva Cube - Suite

NT

RANT

RRP

E10017

Close Coupled WC Pan - White

w355 x h400 x d620

£184.62

E10018

Close Coupled WC Cistern - White

w370 x h400 x d140

£65.16

E10019

Soft Close Seat with Quick Release - White

w360 x h75 x d430

£66.92

E10021

1 Tap Hole Basin - White

w535 x h170 x d425

£145.38

E10023

Full Pedestal - White

w180 x h710 x d190

£62.31

Total £524.39

• Seats 1 year guarantee

E

24 Sanitaryware EB20_Book.indb 24

Size (mm)

E

UA

AR YE

TWE

Description

Y FIVE

25 10

G

Code

Price includes VAT

18/11/2019 15:31


Narva Cube / Sanitaryware

SOFT CLOSE

SOFT CLOSE

Narva Cube - Wall Mounted Unit - 600mm Code

Description

E10026

1 Drawer Wall Mounted Unit - White

w600 x h460 x d490

E10025

1 Tap Hole Basin - White

w600 x h155 x d490

Narva Cube - Wall Mounted Unit - 800mm

Size (mm)

RRP

Code

Description

Size (mm)

RRP

£398.08

E10029

1 Drawer Wall Mounted Unit - White

w800 x h460 x d490

£450.00

£207.69

E10028

1 Tap Hole Basin - White

w800 x h155 x d490

£288.46

Narva Cube - Handrinse Cloakroom Basin - 450mm

Narva Cube - Basin Full Pedestal - 535mm

Code

Description

Code

Description

E10024

1 Tap Hole Cloakroom Handrinse Basin - White

w450 x h110 x d360

£115.38

E10021

1 Tap Hole Basin - White

w535 x h170 x d425

£145.38

E10023

Full Pedestal - White

w180 x h710 x d190

£62.31

E10023

Full Pedestal - White

w180 x h710 x d190

£62.31

E10053

Semi-Pedestal - White

w180 x h450 x d180

£66.92

E10053

Semi-Pedestal - White

w180 x h450 x d180

£66.92

Size (mm)

RRP

Size (mm)

RRP

Narva Cube - Close Coupled WC Pan Code

Description

E10017

Close Coupled WC Pan - White

w355 x h400 x d620

£184.62

E10018

Close Coupled WC Cistern - White

w370 x h400 x d140

£65.16

w360 x h75 x d430

£93.46

w360x h75 x d430

£66.92

E10020 E10019

Slimline wrap - Soft Close Seat - Quick Release - White Soft Close Seat with Quick Release - White

Size (mm)

All dimensions are in mm

EB20_Book.indb 25

RRP

SOFT CLOSE

Sanitaryware

25 18/11/2019 15:31


Sanitaryware / Narva Arch

Narva Arch

Short projection WC - Ideal for small spaces!

E

TWE

AR YE

UA

RANT

E

26 Sanitaryware EB20_Book.indb 26

Code

Description

Size (mm)

RRP

E10017

Close Coupled WC Pan - White

w355 x h400 x d620

£184.62

E10018

Close Coupled WC Cistern - White

w370 x h400 x d140

£65.16

E10019

Soft Close Seat with Quick Release - White

w360 x h75 x d430

£66.92

E10005

1 Tap Hole Basin - White

w560 x h200 x d460

£73.85

E10009

Full Pedestal - White

w160 x h690 x d170

£40.38

Total £430.93

Y FIVE NT

25 10

G

Narva Arch - Suite

Narva Arch - Alternative 2 Tap Hole Basin Option • Seats 1 year guarantee

Code

Description

E10006

2 Tap Hole Basin - White

Size (mm) w560 x h200 x d460

RRP £73.85

Price includes VAT

18/11/2019 15:31


Narva Arch / Sanitaryware

Narva Arch - Basin Full Pedestal - 500mm Code

Description

Size (mm)

E10007

1 Tap Hole Basin - White

w500 x h190 x d410

E10008

2 Tap Hole Basin - White

E10009

Full Pedestal - White

Narva Arch - Basin Full Pedestal - 560mm RRP

Code

Description

£71.54

E10005

1 Tap Hole Basin - White

w560 x h200 x d460

£73.85

w500 x h190 x d410

£71.54

E10006

2 Tap Hole Basin - White

w560 x h200 x d460

£73.85

w160 x h690 x d170

£40.38

E10009

Full Pedestal - White

w160 x h690 x d170

£40.38

Narva Arch - Basin Half Pedestal - 560mm Size (mm)

Size (mm)

RRP

Narva Arch - Semi-Recessed Basin - 550mm

Code

Description

RRP

E10005

1 Tap Hole Basin - White

w560 x h200 x d460

£73.85

E10006

2 Tap Hole Basin - White

w560 x h200 x d460

£73.85

E10010

Semi-Pedestal - White

w230 x h310 x d205

£36.92

Code

Description

E10011

Semi-Recessed Basin - White

Size (mm) w550 x h140 x d450

RRP £121.15

Narva Arch - Close Coupled WC Pan Code

Description

E10017

Close Coupled WC Pan - White

w355 x h400 x d620

£184.62

E10018

Close Coupled WC Cistern - White

w360 x h415 x d150

£65.16

w360 x h75 x d430

£93.46

w470 x h75 x d381

£66.92

E10020 E10019

Slimline Wrap - Soft Close Seat with Quick Release - White Soft Close Seat with Quick Release - White

Size (mm)

All dimensions are in mm

EB20_Book.indb 27

RRP

SOFT CLOSE

Sanitaryware

27 18/11/2019 15:31


Sanitaryware / Tortum

Tortum

Tortum - Suite Code

Description

Size (mm)

E10001

Close Coupled WC Short Projection Pan - White

w345 x h390x d610

£124.89

E10002

Close Coupled WC Cistern - White

w355 x h370 x d135

£54.30

E10003

Soft Close Seat - Standard - White

w355 x h65 x d425

£35.84

E10005

1 Tap Hole Basin - White

w560 x h200 x d460

£73.85

E10009

Full Pedestal - White

w160 x h690 x d170

£40.38

Total £329.25

Tortum - Alternative Seat Option Code

Description

E10004

Soft Close Seat with Quick Release - White

RRP

Size (mm) w355 x h70 x d425

RRP £72.76

Tortum - Close Coupled WC Short Projection Pan

TY FIVE

UA

E

TWE

G

AR YE

25 10 N

RANT

E

28 Sanitaryware EB20_Book.indb 28

• Seats 1 year guarantee

Code

Description

Size (mm)

RRP

E10001

Close Coupled WC Short Projection Pan - White

w345 x h390 x d610

£124.89

E10002

Close Coupled WC Cistern - White

w355 x h370 x d135

£54.30

E10003

Standard Soft Close Seat - White

w355 x h65 x d425

£35.84

E10004

Soft Close Seat with Quick Release - White

w355 x h70 x d425

£72.76

Price includes VAT

18/11/2019 15:31


Tortum / Sanitaryware

Tortum - Basin - 560mm - Full Pedestal Code

Description

Size (mm)

E10005

1 Tap Hole Basin - White

w560 x h200 x d460

E10006

2 Tap Hole Basin - White

E10009

Full Pedestal - White

Tortum - Basin - 500mm RRP

Code

Description

£73.85

E10007

1 Tap Hole Basin - White

w500 x h190 x d410

£71.54

w560 x h200 x d460

£73.85

E10008

2 Tap Hole Basin - White

w500 x h190 x d410

£71.54

w160 x h690 x d170

£40.38

E10009

Full Pedestal - White

w160 x h690 x d170

£40.38

Tortum - Basin - 560mm - Half Pedestal Code

Description

Size (mm)

RRP

1 Tap Hole Basin - White

w560 x h200 x d460

£73.85

E10006

2 Tap Hole Basin - White

w560 x h200 x d460

£73.85

E10010

Semi-Pedestal - White

w230 x h310 x d205

£36.92

Code

Description

E10011

Semi-Recessed Basin 1 Tap Hole - White

SOFT CLOSE

Description

Size (mm)

E10012

Back-to-Wall Pan - White

w345 x h390 x d500

E10004

Soft Close Seat with Quick Release - White

w355 x h70 x d425

RRP

Description

£138.46

E10013

Wall Hung Pan - White

w345 x h350 x d500

£163.85

£72.76

E10003

Standard Soft Close Seat - White

w355 x h65 x d425

£35.84

E10004

Soft Close Seat with Quick Release - White

w355 x h70 x d425

£72.76

Size (mm)

EB20_Book.indb 29

RRP

Tortum - Corner Cloakroom Basin - 440mm RRP

w365 x h160 x d320

£54.23

w365 x h160 x d320

£54.23

All dimensions are in mm

Size (mm)

SMALL SIZE

Tortum - Cloakroom Basin - 365mm

E10015

£121.15

Code

SMALL SIZE

1 Tap Hole Handrinse Cloakroom Basin - White 2 Tap Hole Handrinse Cloakroom Basin - White

w550 x h140 x d450

RRP

Tortum - Wall Hung WC Pan

Code

E10014

Size (mm)

SOFT CLOSE

Tortum - Back-to-Wall WC Pan

Description

RRP

Tortum - Semi-Recessed Basin - 550mm

E10005

Code

Size (mm)

Code

Description

E10016

Corner Cloakroom Basin (310 Projection) - 1TH - White

Size (mm) w440 x h160 x d400

RRP £66.92

Sanitaryware

29 18/11/2019 15:31


Sanitaryware / Trenton

Trenton

Trenton - Suite

NT

RANT

RRP

E20530

Close Coupled WC Pan - White

w360 x h440 x d665

£265.38

E20529

Close Coupled WC Cistern - White

w355 x h410 x d145

£114.23

E20534

Soft Close Seat - Quick Release - White

w365 x h25 x d440

£86.54

E10071

1 Drawer Wall Mounted Unit - White

w600 x h430 x d470

£387.69

E10070

1 Tap Hole Basin - White

w600 x h155 x d470

£193.85

Total £1,047.69

• Seats 1 year guarantee

E

30 Sanitaryware EB20_Book.indb 30

Size (mm)

E

UA

AR YE

TWE

Description

Y FIVE

25 10

G

Code

Price includes VAT

18/11/2019 15:32


Trenton / Sanitaryware

COMFORT HEIGHT

Trenton - Closed Back - Close Coupled WC Pan

Trenton - Closed Coupled WC

Code

Description

Code

Description

E20528

Close Coupled Close Back WC Pan White

w360 x h450 x d675

£290.77

E20530

Close Coupled WC Pan - White

w360 x h420 x d665

£265.38

E20529

Close Coupled WC Cistern - White

w355 x h410 x d145

£114.23

E20529

Close Coupled WC Cistern - White

w355 x h410 x d145

£114.23

w365 x h25 x d440

£86.54

E20534

Soft Close Seat with Quick Release - White

w365 x h25 x d440

£86.54

w365 x h22 x d440

£86.54

E20531

Close Coupled Rimless WC Pan

w360 x h420 x d675

£290.77

E20534 E20535

Size (mm)

Soft Close Seat with Quick Release White Wrap Over Soft Close Seat with Quick Release - White

RRP

Size (mm)

RRP

RIMLESS

Trenton - Rimless Wall Hung WC Pan Code E20533 E20535

Description

Size (mm)

Wall Hung Rimless (47cm short projection) WC Pan with Concealed Fixings - White Slimline Soft Close Seat with Quick Release - White

Trenton - Back-to-Wall WC Pan RRP

w360 x h420 x d500

£305.77

w365 x h22 x d440

£86.54

Trenton - Wall Mounted Unit - 600mm Code

Description

Size (mm)

E10071

1 Drawer Wall Mounted Unit - White

w600 x h430 x d470

E10070

1 Tap Hole Basin - White

w600 x h155 x d470

All dimensions are in mm

EB20_Book.indb 31

Code

Description

Size (mm)

RRP

E20532

Back-to-Wall WC Pan - White

w360 x h420 x d540

£260.77

E20534

Soft Close Seat with Quick Release - White

w365 x h25 x d440

£86.54

Trenton - Wall Mounted Unit - 800mm RRP

Code

Description

Size (mm)

RRP

£387.69

E10074

1 Drawer Wall Mounted Unit - White

w800 x h430 x d470

£443.08

£193.85

E10073

1 Tap Hole Basin - White

w800 x h155 x d470

£290.77

Sanitaryware

31 18/11/2019 15:32


Sanitaryware / Belmore Traditional

Belmore Close Coupled WC

ENTY YE

UA

• Seats 5 year guarantee

E

T

G

Belmore - Suite with Close Coupled WC

AR

20 10 W

RANT

E

Choice of basin support

Code

Description

Size (mm)

RRP

E10101

Close Coupled Pan - White

w373 x h421 x d705

£226.32

E10102

Close Coupled Cistern - White

w481 x h330 x d205

£185.74

E10108

2 Tap Hole Basin - White

w605 x h232 x d505

£188.95

E10109

Full Traditional Pedestal - White

w260 x h678 x d213

£91.82

E20175

Washstand

w544 x h755 x d443

£406.34

E10111

Soft Close Bar Hinge Seat - Natural Oak

w375 x d428

£160.13 Total £1259.30

Full Pedestal

Washstand

2 TH Cloakroom Basin - See Wastes P155

Belmore - Basin - 500 / 605mm Description

E10108

2 Tap Hole Basin - White

w605 x h232 x d505

£188.95

Code

Description

E10107

1 Tap Hole Basin - White

w605 x h910 x d505

£188.95

E10101

Close Coupled Pan - White

w373 x h421 x d705

£226.32

E10113

2 Tap Hole Cloakroom Basin White

w500 x h245 x d305

£169.73

E10102

Close Coupled Cistern - White

w481 x h330 x d205

£185.74

E10109

Full Traditional Pedestal - White

w260 x h678 x d213

£91.82

E10111

Soft Close Bar Hinge Seat - Natural Oak

w375 x d428

£160.13

E20175

Washstand

w544 x h755 x d443

£406.34

E10112

Soft Close Bar Hinge Seat - White

w375 x d428

£144.11

32 Sanitaryware EB20_Book.indb 32

Size (mm)

RRP

Belmore - Close Coupled WC

Code

Size (mm)

RRP

Price includes VAT

18/11/2019 15:32


Belmore Traditional / Sanitaryware

Belmore High Level Cistern

Classic traditional styling ENTY YE

20 10 UA

E

T

G

Belmore - Suite with High Level WC

AR

W

RANT

High Level Cistern

E

• Seats 5 year guarantee

Code

Description

Size (mm)

RRP

E10103

High / Low Level Pan - White

w375 x h400 x d425

£193.21

E10110

High Level Cistern Inc Fittings - White

w481 x h2380 (total) x d200

£185.74

E10106

High Level Chrome Pipe / Bracket Kit

E10112

Soft Close Bar Hinge Seat - White

E10108 E10109

£433.39 w375 x d428

£144.11

2 Tap Hole Basin - White

w605 x h232 x d505

£188.95

Full Traditional Pedestal - White

w260 x h678 x d213

£91.82

Total £1,237.22

Soft Close Seat available in Natural Oak or White

Belmore - High Level WC

All dimensions are in mm

EB20_Book.indb 33

Code

Description

E10110

High Level Cistern Inc Fittings - White

E10106

High Level Chrome Pipe / Bracket Kit

E10111

Soft Close Bar Hinge Seat - Natural Oak

Size (mm) w481 x h2380 (total) x d200

RRP £185.74 £433.39

w375 x d428

£160.13

Sanitaryware

33 18/11/2019 15:32


Sanitaryware / Belmore Traditional

Belmore Low Level WC

Rounded Basin

ENTY YE

UA

• Seats 5 year guarantee

E

T

G

Belmore - Suite with Low Level WC

AR

20 10 W

RANT

E

Code

Description

Size (mm)

RRP

E10103

High / Low Level Pan - White

w375 x h400 x d425

£193.21

E10104

Low Level Cistern Inc Fittings (Ex Pipe)

w481 x h340 x d200

£185.74

E10105

Chrome Low Level Down Pipe

E10112

Soft Close Bar Hinge Seat - White

E10108 E10109

£88.61 w353 x d428

£144.11

2 Tap Hole Basin - White

w605 x h232 x d505

£188.95

Full Traditional Pedestal - White

w260 x h678 x d213

£91.82

Total £892.44

Belmore - Low Level WC Code

Description

Belmore - Rounded Edge Basin - 550mm Size (mm)

RRP

Code

Description

E10103

High / Low Level Pan - White

w375 x h400 x d425

£193.21

E10117

1 Tap Hole Rounded Edge Basin - White

E10104

Low Level Cistern Inc Fittings (Ex Pipe)

w481 x h340 x d200

£185.74

E10118

2 Tap Hole Rounded Edge Basin - White

E10105

Chrome Low Level Down Pipe

£88.61

E10109

Full Traditional Pedestal - White

E10111

Soft Close Bar Hinge Seat - Natural Oak

34 Sanitaryware EB20_Book.indb 34

w375 x d428

Size (mm) w550 x h918 x d470 inc. Pedestal w550 x h918 x d470 inc. Pedestal w260 x h678 x d213

RRP £183.60 £183.60 £91.82

£160.13

Price includes VAT

18/11/2019 15:32


Belmore Traditional / Sanitaryware

Belmore Back-to-Wall WC Pan

Half Counter Top Basin

ENTY YE

• Seats 5 year guarantee

See our range of ‘Shaker’ style fitted furniture on pages 84 - 85

G

Belmore - Back-to-Wall WC Pan Code

Description

E10114

Back-to-Wall WC Pan - White

E10111

Soft Close Bar Hinge Seat - Natural Oak

RANT

E

Belmore - Half Counter Top Basin - 550mm Size (mm)

RRP

w385 x h410 x d520

£281.82

w375 x d428

£160.13

All dimensions are in mm

EB20_Book.indb 35

UA

E

T

AR

20 10 W

Code E10115 E10116

Description 1 Tap Hole Semi Countertop Basin - White 2 Tap Hole Semi Countertop Basin - White

Size (mm)

RRP

w550 x h195 x d435

£225.23

w550 x h195 x d435

£225.23

Sanitaryware

35 18/11/2019 15:32


Sanitaryware / Vessel Basins

Trenton - Countertop Bowl - 550mm

Laja - Countertop Bowl - 400mm Code

Description

E10093

Countertop Bowl - White

Size (mm) w400 x h100 x d400

RRP £109.62

Aber Arch - Countertop Bowl - 550mm Code

Description

E10095

Countertop Bowl - White

Size (mm) w550 x h100 x d340

Code

Description

E10094

Countertop Bowl - White

Size (mm) w550 x h110 x d350

RRP £158.08

Tortum - Countertop Bowl - 410mm RRP £169.62

Code

Description

E10096

Countertop Bowl - White

Size (mm) w410 x h145 x d380

RRP £114.23

Risco - Countertop Bowl

Risco - Countertop Bowl - 540mm Code

Description

E10097

Countertop Bowl - White

36 Sanitaryware EB20_Book.indb 36

Size (mm) w540 x h145 x d360

RRP £146.54

Price includes VAT

18/11/2019 15:32


Toilet Seats / Sanitaryware

SOFT CLOSE

Tyrrell - Hi Gloss White Painted Seat

Winnie - Thermoset Wrap Over Seat

Code

Description

Size (mm)

RRP

E20505

Plastic Hinges - White

w363 x d390

£27.02

Code

Description

Size (mm)

RRP

E20508

Soft Close Quick Release - White

w380 x d455

£67.99

SOFT CLOSE

Nissi - Thermoset Seat

Chrissie - Thermoset Seat

Code

Description

Size (mm)

RRP

E20507

Adjustable Stainless Steel Hinges - White

w372 x d458

£45.01

Code

Description

Size (mm)

RRP

E20506

Soft Close Quick Release - White

w376 x d452

£57.01

SOFT CLOSE

Silk - D Shape Square Edge Seat

SOFT CLOSE

Volta - D Shaped Round Edge

Code

Description

Size (mm)

RRP

E20512

Soft Close Quick Release - White

w370 x d465

£71.00

Code

Description

Size (mm)

RRP

E20513

Soft Close Quick Release - White

w368 x d470

£72.99

SOFT CLOSE

Rira - Square Wrap Over

SOFT CLOSE

Traditional - Seat & Cover - Limed Oak

Code

Description

Size (mm)

RRP

E20514

Soft Close Quick Release - White

w356 x d435

£79.98

Code

Description

Size (mm)

RRP

8081LISC

Soft Close Hinges - Limed Oak

w370 x d475

£102.47

SOFT CLOSE

Traditional - Seat & Cover - Natural Oak

Traditional - Seat & Cover - Walnut

Code

Description

Size (mm)

RRP

8081NOSC

Soft Close Hinges - Natural Oak

w370 x d475

£99.00

All dimensions are in mm

EB20_Book.indb 37

SOFT CLOSE

Code

Description

Size (mm)

RRP

8081AWSC

Soft Close Hinges - Walnut

w370 x d475

£115.21

Sanitaryware

37 18/11/2019 15:32


Sanitaryware / Ideal Standard - Tesi

Ideal Standard

Aquablade flush system

Tesi Tesi - Suite

FE TI ME LI

111

11

CERAMICS

111

11

Description

T031301

450mm Handrinse Basin - 1 Taphole w450 x h160 x d360mm

T352001

Small Semi - Pedestal w255 x h263 x d175mm

T356401

Close Coupled WC Pan with Aquablade Technology Horizontal Outlet w360 x h400 x d660mm

£209.55

T357001

Close Coupled Cistern with Dual Flush Valve - 6/4 Litre w307 x h355 x d174mm

£179.87

T352701

Slim Seat & Cover - Soft Close w367 x h50 x d448mm

£153.67

RAN T E

E

G

UA

• Seats 5 year guarantee

Code

38 Sanitaryware EB20_Book.indb 38

RRP £108.27 £87.32

Total £738.68

Price includes VAT

18/11/2019 15:32


Ideal Standard - Tesi / Sanitaryware

SOFT CLOSE

SOFT CLOSE

Tesi - AquaBlade® Close Coupled WC Code

Description

T356401

Close Coupled WC Pan with Aquablade Technology Horizontal Outlet w360 x h400 x d660mm

T357001 T352701

Tesi - AquaBlade® Close Coupled Back-to-Wall WC RRP

Code

Description

£209.55

T355701

Close Coupled / Back-to-Wall WC Pan with Aquablade Technology - Horizontal Outlet w360 x h400 x d660mm

RRP £270.68

Close Coupled Cistern with Dual Flush Valve - 6/4 Litre w307 x h355 x d174mm

£179.87

T357001

Close Coupled Cistern with Dual Flush Valve - 6/4 Litre w307 x h355 x d174mm

£179.87

Slim Seat & Cover - Soft Close w367 x h50 x d448mm

£153.67

T352701

Slim Seat & Cover - Soft Close w367 x h50 x d448mm

£153.67

SOFT CLOSE

SOFT CLOSE

Tesi - AquaBlade® Back-to-Wall WC Code

Description

T353501

Back-to-Wall WC Pan with Aquablade Technology w360 x h400 x d550mm

S362467 T352701

Tesi - AquaBlade® Wall Mounted WC Bowl RRP

Code

Description

£323.04

T354501

Wall Hung WC Pan with Aquablade Technology w360 x h400 x d530mm

£401.63

Conceala 2 Universal Height, Top Inlet Cistern - Pneumatic Dual Flush Valve - No Flushplate - 6/4 Litre Dual Flush

£148.52

S362467

Conceala 2 Universal Height, Top Inlet Cistern - Pneumatic Dual Flush Valve - No Flushplate - 6/4 Litre Dual Flush

£148.52

Slim Seat & Cover - Soft Close w367 x h50 x d448mm

£153.67

T352701

Slim Seat & Cover - Soft Close w367 x h50 x d448mm

£153.67

E006067

Support Frame with Bolts for Wall Hung WC Pans w90 x h390 x d180mm

£270.00

Tesi - Handrinse Basin - 450mm

RRP

Tesi - Semi - Countertop Basin - 550mm

Code

Description

T031301

450mm Handrinse Basin - 1 Taphole w450 x h160 x d360mm

RRP

T352101

Small Full Pedestal w158 x h686 x d167mm

£78.60

T352001

Small Semi - Pedestal w255 x h263 x d175mm

£87.32

£108.27

Code

Description

T352601

550mm Semi - Countertop Basin - 1 Taphole w550 x h170 x d450mm

RRP £227.01

Tesi - Basin - 600/550/500mm Code

Description

T026501

600mm Pedestal Basin - 1 Taphole w600 x h170 x d475mm

£143.18

T028001

550mm Pedestal Basin - 1 Taphole w550 x h170 x d450mm

£130.96

T031201

500mm Pedestal Basin - 1 Taphole w500 x h160 x d420mm

£122.22

T351901

Full Pedestal w165 x h180 x d697mm

£78.60

T357301

Semi - Pedestal w177 x h340 x d293mm

£87.32

All dimensions are in mm

EB20_Book.indb 39

RRP

Sanitaryware

39 18/11/2019 15:33


Sanitaryware / Ideal Standard - Concept Air Cube

Ideal Standard Concept Air Cube

Aquablade flush system Concept Air Cube - Suite

FE TI ME LI

111

11

CERAMICS

111

11

Description

E076601

600mm Pedestal or Furniture Basin - 1 Taphole w600 x h160 x d460mm

£180.89

E078101

Full Pedestal w180 x h720 x d165mm

£108.88

E079801

Close Coupled Pan / Back-to-Wall with Aquablade Technology Horizontal Outlet w360 x h400 x d660mm

£401.97

E080401

Close Coupled Cistern with Dual Flush Valve - 6/4 Litre w293 x h355 x d176mm

£246.51

E081101

Slim Seat & Cover - Soft Close w366 x h41 x d447mm

£187.58

RAN T E

E

G

UA

• Seats 5 year guarantee

Code

40 Sanitaryware EB20_Book.indb 40

RRP

Total £1,125.83

Price includes VAT

18/11/2019 15:33


Ideal Standard - Concept Air Cube / Sanitaryware

Concept Air Cube - Basin Unit - 600/550/500mm

Concept Air Cube - Basin - 600/550/500mm

Code

Description

Code

*E0846––

E076801

600mm Cube Wall Hung Basin Unit 1 Drawer w535 x h400 x d412mm 550mm Cube Wall Hung Basin Unit 1 Drawer w485 x h400 x d412mm 500mm Cube Wall Hung Basin Unit 1 Drawer w435 x h400 x d412mm 600mm Basin for Pedestal or Furniture - 1 Taphole w600 x h160 x d460mm 550mm Basin for Pedestal or Furniture - 1 Taphole w550 x h160 x d460mm 500mm Basin for Pedestal or Furniture - 1 Taphole w500 x h160 x d450mm

EE23033967

Universal Space Saving Siphon

*E0844–– *E0842–– E076601 E076701

RRP £569.44

E076601

£535.96

E076701

£502.45 £180.89 £165.81

*E0817–– E076501 EE23033967

RRP

600mm Basin for Pedestal or Furniture - 1 Taphole w600 x h160 x d460mm 550mm Basin for Pedestal or Furniture - 1 Taphole w550 x h160 x d460mm 500mm Basin for Pedestal or Furniture - 1 Taphole w500 x h160 x d450mm Full Pedestal w180 x h720 x d165mm Semi - Pedestal w177 x h340 x d279mm

E076801 E078101 E077201

£165.81

£180.89 £165.81 £165.81 £108.88 £110.54

£34.05

Concept Air Cube - Vanity Unit - 500mm Code

Description

Description

Concept Air Cube - Unit with Vessel Basin - 600mm RRP

500mm Wall Hung Vanity Unit 1 Drawer w500 x h400 x d360mm 540mm Short Projection Mini Vanity Basin - 1 Taphole w540 x h155 x d380mm Universal Space Saving Siphon

Code

Description

£510.83

*E0826––

£209.36

E078601

£34.05

*E0848––

600mm Wall Hung Vanity Unit 1 Drawer with Open Shelf w600 x h517 x d440mm 400mm Vessel Basin - No Tapholes w400 x h135 x d400mm 600mm Worktop for Vessel Installation w604 x h18 x d442mm

EE23033967

*$YDLODEOHLQWKHIROORZLQJƓQLVKHV VY Matt Dark Brown carcass/fronts with Matt White interior trim

EQ Gloss Grey carcass/fronts with Matt White interior trim

PS Light Grey Wood carcass/fronts with Matt White interior trim

B2 Gloss White carcass/fronts with Matt White interior trim

RRP

Universal Space Saving Siphon

UK Light Brown Wood carcass/fronts with Matt Light Brown interior trim

SOFT CLOSE

£569.45 £264.64 £107.18 £34.05

KN Gloss White carcass/fronts with Matt Grey interior trim

SOFT CLOSE

Concept Air Cube - AquaBlade® Wall Mounted WC

Concept Air Cube - AquaBlade® Back-to-Wall WC

Code

Description

Code

Description

E079601

Wall Hung Pan with Aquablade Technology w360 x h410 x d540mm Support Frame with Bolts for Wall Hung WC Pans w90 x h390 x d180mm Conceala 2 Universal Height, Top Inlet Cistern - Pneumatic Dual Flush Valve - No Flushplate - 6/4 Litre Dual Flush Slim Seat & Cover - Soft Close w366 x h41 x d447mm

£452.21

E143201

£270.00

S362467

£148.52

E081101

Back-to-Wall Pan with Aquablade Technology Horizontal Outlet w360 x h400 x d545mm Conceala 2 Universal Height, Top Inlet Cistern - Pneumatic Dual Flush Valve - No Flushplate - 6/4 Litre Dual Flush Slim Seat & Cover - Soft Close w366 x h41 x d447mm

E006067 S362467 E081101

RRP

RRP £401.97 £148.52 £187.58

£187.58

Concept Air Cube - AquaBlade® Close Coupled Back-to-Wall WC Suite Code

Description

E079801

Close Coupled Pan / Back-to-Wall with Aquablade Technology Horizontal Outlet w360 x h400 x d660mm Close Coupled Cistern with Dual Flush Valve - 6/4 Litre w293 x h355 x d176mm Slim Seat & Cover - Soft Close w366 x h41 x d447mm

E080401 E081101

All dimensions are in mm

EB20_Book.indb 41

RRP £401.97 £246.51

SOFT CLOSE

£187.58

Sanitaryware

41 18/11/2019 15:33


Sanitaryware / Ideal Standard - Studio Echo

Ideal Standard Studio Echo

Short projection WC

Studio Echo - Suite

FE TI ME LI

111

11

CERAMICS

111

11

Description

E158901

Close Coupled Back-to-Wall WC Pan with Horizontal Outlet w362 x h400 x d610mm

£245.40

E150501

Close Coupled Cistern 6/4 Litre Dual Flush Valve Bottom 6XSSO\DQG,QWHUQDO2YHUÅ´RZZ[K[GPP

£168.72

T318301

Seat and Cover for Short Projection, Soft Close w368 x h42 x d411mm

£99.69

E156401

PP:DVKEDVLQ7DSKROHZLWK2YHUÅ´RZ w600 x h190 x d455mm

£131.91

E156801

Semi - Pedestal w177 x h340 x d279mm

RAN T E

E

G

UA

• Seats 5 year guarantee

Code

42 Sanitaryware EB20_Book.indb 42

RRP

£73.62 Total £719.34

Price includes VAT

18/11/2019 15:33


Ideal Standard - Studio Echo / Sanitaryware

Studio Echo - Handrinse Basin - 450mm Code

Description

E156701

PP+DQGULQVH%DVLQ7DSKROHZLWK2YHUÅ´RZ w450 x h170 x d360mm

E158401 E158301

Studio Echo - Basin - 600/550/500mm RRP

Code

Description

RRP

£95.10

E156401

PP:DVKEDVLQ7DSKROHZLWK2YHUÅ´RZ w600 x h190 x d455mm

£131.91

Full Pedestal w166 x h690 x d160mm

£73.62

E156501

PP:DVKEDVLQ7DSKROHZLWK2YHUÅ´RZ w550 x h180 x d450mm

£119.64

Semi - Pedestal w173 x h340 x d260mm

£73.62

E156601

PP:DVKEDVLQ7DSKROHZLWK2YHUÅ´RZ w500 x h180 x d415mm

£111.96

E156901

Full Pedestal w180 x h700 x d165mm

£73.62

E156801

Semi - Pedestal w177 x h340 x d279mm

£73.62

E015767

Basin Fixing Set with 120mm Rag Bolts for Solid Walls

£22.71

SPACE SAVING

Studio Echo - Corner Handrinse Basin - 450mm

Studio Echo - Semi - Countertop Basin - 550mm

Code

Description

Code

Description

T290601

PP&RUQHU+DQGULQVH%DVLQ7DSKROHZLWK2YHUÅ´RZ w450 x h170 x d410mm

E159401

PP6HPL&RXQWHUWRS:DVKEDVLQ7DSKROHZLWK2YHUÅ´RZ w550 x h180 x d440mm

E158401

Full Pedestal w166 x h690 x d160mm

RRP £122.70

SPACE SAVING

Studio Echo - Close Coupled WC

Studio Echo - Close Coupled Back-to-Wall WC

Code

Description

RRP

E158701

Close Coupled WC Pan with Horizontal Outlet w360 x h400 x d660mm

E150501

Close Coupled Cistern 6/4 Litre Dual Flush Valve Bottom 6XSSO\DQG,QWHUQDO2YHUÅ´RZZ[K[GPP

T318101

Seat and Cover for Short Projection, Soft Close w366 x h42 x d446mm

Code

Description

£184.05

E158901

Close Coupled Back-to-Wall WC Pan with Horizontal Outlet w362 x h400 x d610mm

£245.40

£168.72

E150501

Close Coupled Cistern 6/4 Litre Dual Flush Valve Bottom 6XSSO\DQG,QWHUQDO2YHUÅ´RZZ[K[GPP

£168.72

£99.69

T318301

Seat and Cover for Short Projection, Soft Close w368 x h42 x d411mm

SOFT CLOSE

E158501

Wall Mounted WC Pan with Horizontal Outlet w360 x h410 x d540mm

RRP

£99.69

SOFT CLOSE

Studio Echo - Wall Mounted WC Bowl Description

£168.72

£73.62

SOFT CLOSE

Code

RRP

Studio Echo - Back-to-Wall WC RRP

Code

Description

£260.75

T282701

£260.75

S362467

Conceala 2 Universal Height, Top Inlet Cistern - Pneumatic Dual Flush Valve - No Flushplate - 6/4 Litre Dual Flush

Back-to-Wall WC Pan with Horizontal Outlet w360 x h400 x d540mm

£148.52

S362467

£148.52

E006067

Support Frame with Bolts for Wall Hung WC Pans w90 x h390 x d180mm

Conceala 2 Universal Height, Top Inlet Cistern - Pneumatic Dual Flush Valve - No Flushplate - 6/4 Litre Dual Flush

£270.00

T318101

T318101

Seat and Cover for Short Projection, Soft Close w366 x h42 x d446mm

Seat and Cover for Short Projection, Soft Close w366 x h42 x d446mm

All dimensions are in mm

EB20_Book.indb 43

RRP

£99.69

£99.69

Sanitaryware

43 18/11/2019 15:33


Sanitaryware / Ideal Standard - Tempo

Ideal Standard Tempo

Short projection WC Tempo - Suite

FE TI ME LI

111

11

CERAMICS

111

11

Description

T328701

Close Coupled / Back-to-Wall WC Pan - Short Projection Horizontal Outlet w360 x h400 x d600mm

£229.86

T427001

Close Coupled Cistern with Dual Flush Valve - 6/4 Litre w314 x h382 x d177mm

£147.12

T679901

Seat and Cover for Short Projection T3287 Pan - Soft Close w370 x h40 x d395mm

£126.88

T059301

400mm Handrinse Basin - 1 Taphole w400 x h170 x d360mm

£87.36

T427201

Full Pedestal (400mm and 350mm Basins) w165 x h690 x d160mm

£69.89

RAN T E

E

G

UA

• Seats 5 year guarantee

Code

44 Sanitaryware EB20_Book.indb 44

RRP

Total £661.11

Price includes VAT

18/11/2019 15:33


Ideal Standard - Tempo / Sanitaryware

SOFT CLOSE

SPACE SAVING

Tempo - Close Coupled WC

Tempo - Close Coupled Back-to-Wall WC

Code

Description

RRP

Code

Description

T327601

Close Coupled WC Pan, Horizontal Outlet w360 x h400 x d665mm

T427001 T679301

RRP

£170.13

T328701

Close Coupled / Back-to-Wall WC Pan - Short Projection Horizontal Outlet w360 x h400 x d600mm

£229.86

Close Coupled Cistern with Dual Flush Valve - 6/4 Litre w314 x h382 x d177mm

£147.12

T427001

Close Coupled Cistern with Dual Flush Valve - 6/4 Litre w314 x h382 x d177mm

£147.12

Seat and Cover - Soft Close w365 x h40 x d425mm

£126.88

T679901

Soft Close Seat and Cover for Short Projection T3287 Pan w370 x h40 x d395mm

£126.88

SPACE SAVING

SPACE SAVING

Tempo - Handrinse Basin - 400/350mm Code

Description

T059301

400mm Handrinse Basin - 1 Taphole w400 x h165 x d360mm

T059501

Tempo - Wall Mounted Short Projection WC RRP

Code

Description

£87.36

T328801

Wall Hung WC Pan - Short Projection w360 x h400 x d480mm

£363.21

350mm Handrinse Basin - 1 Left Hand Taphole w350 x h150 x d300mm

£82.76

S362467

Conceala 2 Universal Height, Top Inlet Cistern - Pneumatic Dual Flush Valve - No Flushplate - 6/4 Litre Dual Flush

£148.52

T059701

350mm Handrinse Basin - 1 Right Hand Taphole w350 x h150 x d300mm

£82.76

E006067

Support Frame with Bolts for Wall Hung WC Pans w90 x h390 x d180mm

£270.00

T427201

Full Pedestal (400mm and 350mm Basins) w165 x h690 x d160mm

£69.89

T679901

Soft close Seat and Cover for Short Projection T3287 Pan w370 x h40 x d395mm

£126.88

T426701

Semi - Pedestal (400mm Only) w174 x h332 x d260mm

£69.89 *Available in the IROORZLQJƓQLVKHV

RRP

*Available in the IROORZLQJƓQLVKHV

WG White Gloss

WG White Gloss

SG Sandy Grey

SG Sandy Grey

Tempo - Pedestal destal Unit wit with i h Basin - 600/550/500mm 60

Tempo - Floor standing Vanity Basin Unit - 600mm

Code

Description scription

Code

Description

*E0775––

Pedestal Unit and Basin Pack inc Tempo 550mm Basin w450 x h730 x d550mm

£348.38

*E0774––

600mm Floorstanding Vanity Unit and Basin Pack w500 x h890 x d660mm

T058401

600mm Pedestal Basin - 1 Taphole w600 x h185 x d495mm

£119.54

T058601

550mm Pedestal Basin - 1 Taphole w550 x h185 x d450mm

£105.77

T058801

500mm Pedestal Basin - 1 Taphole w500 x h185 x d440mm

£105.77

RRP

*Available in the IROORZLQJƓQLVKHV

£571.37

*Available in the IROORZLQJƓQLVKHV

WG White Gloss

WG White Gloss

SG Sandy Grey

SG Sandy Grey

Tempo - Semi - Countertop Basin Unit - 650mm Code

Description

*E0778––

650mm Semi - Countertop Unit with 550mm Basin and Worktop w450 x h890 x d740mm

Tempo - WC Unit - 650mm RRP

All dimensions are in mm

EB20_Book.indb 45

RRP

£553.93

Code

Description

*E0776––

650mm WC Unit Pack inc Unit, Back-to-Wall Pan Seat, Worktop and Cistern w520 x h890 x d740mm

RRP £842.83

Sanitaryware

45 18/11/2019 15:34


Effective engineering

WC Frames & Cisterns WC Frames Concealed Cisterns WC Press Panels

46 WC Frames & Cisterns EB20_Book.indb 46

P47 P48-49 P50-51

Price includes VAT

18/11/2019 15:34


WC Frames / Frames

WC Frame - Dual Flush Cistern - 820mm Code

Description

E20357

Dual Flush - Requires Press Panel

WC Frame - Dual Flush Cistern - 980mm RRP £319.00

Code

Description

RRP

E20358

Dual Flush - Requires Press Panel

• 500mm wide

• 500mm wide

• Height adjustable between 795 - 820mm

• Height adjustable between 955 - 980mm

• Depth adjustable between 175 - 265mm

• Depth adjustable between 175 - 265mm

• Top or front access

• Top or front access

• Suitable for all press panels

• Suitable for all press panels

WC Frame - Dual Flush Cistern - 1180mm Code

Description

E20359

Dual Flush - Requires Press Panel

£319.00

WC Frame - Dual Flush Cistern - 1300mm RRP £303.00

Code

Description

RRP

E20360

Slimline Dual Flush - Requires Press Panel

£345.00

• 500mm wide

• 580mm wide

• Height adjustable between 1160 - 1180mm

• Height adjustable between 1180 - 1300mm

• Depth adjustable between 175 - 265mm

• Depth adjustable between 90 - 110mm

• Front access only

• Front access only

• Suitable for all press panels

• Suitable for all press panels

All dimensions are in mm

EB20_Book.indb 47

WC Frames & Cisterns

47 18/11/2019 15:34


Frames / Concealed Cisterns - Basin Frames

Concealed Dual Flush Cistern - 820mm Code

Description

E20385

Cistern Only - Requires Press Panel

Concealed Dual Flush Cistern - 980mm RRP £134.00

Code

Description

RRP

E20386

Cistern Only - Requires Press Panel

• Top or front access

• Top or front access

• Suitable for all press panels

• Suitable for all press panels

£134.00

Chrome

Concealed Dual Flush Cistern - 1180mm Code

Description

E20387

Cistern Only - Requires Press Panel

White

In-Wall Furniture Basin Frame RRP £134.00

Code

Description

RRP

E20393

Includes White Trap

£189.00

E20394

Includes Chrome Trap

£199.00

• Front access only • Suitable for all press panels

• Wall-hung support frame only • 30mm marine plywood bearer for secure WPKXGTUCNDCUKPƂZKPI • Supplied with full pre-wall instruction bolt kit

48 WC Frames & Cisterns EB20_Book.indb 48

Price includes VAT

18/11/2019 15:34


Concealed Cisterns / Frames

Torrent - Cistern

Torrent - Comfort Height Cistern

Code

Description

TR9001

Dual Flush concealed Cistern

RRP £135.53

Contactless Dual Flush Sensor Kit Code

Description

TR9014

Sensor Kit For Cisterns - Requires Batteries

NON CONTACT FLUSH

Code

Description

RRP

TR9008

Dual Flush Comfort Height Concealed Cistern

£100.97

Fluidmaster Compact - Concealed RRP £177.00

Code

Description

CN12218C

Fluidmaster compact concealed cistern

WATER SAVING FLUSH

SENSOR SWITCH

.

RRP £86.88

EASY INSTALL

r6JGEQPVCEVNGUUƃWUJUGPUQTMKVKUEQORCVKDNG with the TR9001 and TR9008 pneumatic concealed cisterns above

• Bottom, side, top and rear water supply

r#UJQTVYCXGCEVKXCVGUVJGTGFWEGFƃWUJ of the cistern, holding your hand up longer VTKIIGTUCHWNNƃWUJ

• qQWVNGVFWCNƃWUJXCNXGYKVJOONQPIECDNG

49 Frames EB20_Book.indb 49

All dimensions are in mm

• Suitable for modern, narrow 500mm furniture

WC Frames & Cisterns

49 18/11/2019 15:34


Frames / WC Press Panels

Polished Stainless Steel

Brushed Stainless Steel

Prespa SS - Dual Flush Press Panel Code

Finish/Colour

RRP

E20395

Polished Stainless Steel

£168.00

E20396

Brushed Stainless Steel

£168.00

Polished Stainless Steel

Brushed Stainless Steel

Glacier

Blue Atoll

Rouge

Mocha

Titan

Carbon

Safari

Forest

Glass Effect - Press Panel

Erie SS - Dual Flush Press Panel Code

Artic

Finish/Colour

Code

RRP

Finish/Colour

RRP

E20397

Polished Stainless Steel

£168.00

E20399

Arctic

£168.00

E20398

Brushed Stainless Steel

£168.00

E20400

Glacier

£168.00

E20401

Blue Atoll

£168.00

E20402

Rouge

£168.00

E20403

Mocha

£168.00

E20404

Titan

£168.00

E20405

Carbon

£168.00

E20406

Safari

£168.00

E20407

Forest

£168.00

Ice Auto - Dual Flush Electronic Press Panel Code

Description

E20408

Includes Manual Overide

50 WC Press Panels EB20_Book.indb 50

Finish/Colour Black

RRP £599.00

Price includes VAT

18/11/2019 15:34


WC Press Panels / Frames

Chrome

Satin

Black

White

Prespa - Dual Flush Press Panel Code

Chrome

Finish/Colour

Satin

Black

Erie - Dual Flush Press Panel RRP

Code

Finish/Colour

RRP

E20361

Chrome

£56.00

E20365

Chrome

£48.00

E20362

Satin

£56.00

E20366

Satin

£48.00

E20363

Black

£61.00

E20367

Black

£54.00

E20364

White

£43.00

E20368

White

£40.00

Chrome

Satin

Code

Finish/Colour

Chrome

White

Como - Dual Flush Press Panel

Satin

White

Muritz - Dual Flush Press Panel RRP

Code

Finish/Colour

RRP

E20369

Chrome

£36.00

E20372

Chrome

£36.00

E20370

Satin

£36.00

E20373

Satin

£36.00

E20371

White

£33.00

E20374

White

£33.00

All dimensions are in mm

EB20_Book.indb 51

White

WC Press Panels

51 18/11/2019 15:35


Modular Furniture / Xxx

Smart, stylish storage

Furniture Modular Furniture Fitted Furniture

52 Modular Furniture EB20_Book.indb 52

P54-81 P82-91

Price includes VAT

18/11/2019 15:35


Make your bathroom seem larger & brighter -Page 9

Matching bath panels - Page 91

Keep your bathroom clutter free and looking great 6JGRGTHGEVYC[VQETGCVGCFGUKIPGTNQQMTGĆƒGEVKPICYKFGXCTKGV[QHUV[NGU9GJCXG EQNQWTUCPFĆ‚PKUJGUVQEQORNGOGPVCP[DCVJTQQOENQCMTQQOQTGPUWKVG “Plumbing paraphernalia isn’t a pretty sight. Furniture helps keep everything hidden, but still accessible for maintenanceâ€? Modular Furniture EB20_Book.indb 53

53 18/11/2019 15:35


Modular Furniture / Belmore Traditional

Modular Furniture

Hand built and finished for a timeless feel

Belmore

CLASSIC LOOK

Taps Not Included

• 3 colours

• Simple classic chrome door knob

r*CPFRCKPVGFƂPKUJ

• Traditional design

54 Modular Furniture EB20_Book.indb 54

• Soft close doors

Price includes VAT

18/11/2019 15:35


Belmore Traditional / Modular Furniture

Belmore - 2 Door Floor Unit 565mm - Chalk White Code E20059 E20058

Description

Finish

2 Door Unit Chalk w530 x h745 x d370 White Ceramic Basin 1 Taphole White w565 x h120 x d390

Belmore - 2 Door Floor Unit 565mm - Mocha RRP

Code

£512.40

E20060

£155.85

E20058

Description

Finish

Belmore - 2 Door Floor Unit 565mm - Slate Grey RRP

2 Door Unit Mocha £512.40 w530 x h745 x d370 Ceramic Basin 1 Taphole White £155.85 w565 x h120 x d390

Code E20061 E20058

Description

Finish

2 Door Unit Slate w530 x h745 x d370 Grey Ceramic Basin 1 Taphole White w565 x h120 x d390

RRP £512.40 £155.85

Total £668.25

Total £668.25

Total £668.25

Belmore - Floor Cupboard Unit - 400mm - Chalk White

Belmore - Floor Cupboard Unit - 400mm - Mocha

Belmore - Floor Cupboard Unit - 400mm - Slate Grey

Code

Description

Finish

Code

Description

Code

Description

E20065

Floor Cupboard Unit w400 x h820 x d360

Chalk White

E20066

Floor Cupboard Unit w400 x h820 x d360

E21067

Floor Cupboard Unit w400 x h820 x d360

RRP £417.40

Belmore - 1 Door Cloakroom Unit - 420mm - Chalk White Code E20055 E20125

Description

Finish

Cloakroom Unit Chalk w410 x h730 x d350 White Ceramic Basin 1 Taphole White w420 x h130 x d360

RRP

Mocha £417.40

Belmore - 1 Door Cloakroom Unit - 420mm - Mocha RRP

Code

£417.40

E20056

£159.55

E20125

Total £576.95

All dimensions are in mm

EB20_Book.indb 55

Finish

Description

Finish

Finish Slate Grey

RRP £417.40

Belmore - 1 Door Cloakroom Unit - 420mm - Slate Grey RRP

Cloakroom Unit Mocha £417.40 w410 x h730 x d350 Ceramic Basin 1 Taphole White £159.55 w420 x h130 x d360 Total £576.95

Code E20057 E20125

Description

Finish

Cloakroom Unit Slate w410 x h730 x d350 Grey Ceramic Basin 1 Taphole White w420 x h130 x d360

RRP £417.40 £159.55

Total £576.95

Modular Furniture

55 18/11/2019 15:35


Modular Furniture / Malanda

Malanda

Oodles of space for all your essentials!

SOFT CLOSE

COLOUR CHOICE

Taps Not Included

rEQNQWTƂPKUJGU

• 1 to 3 drawer options

• Chrome plated handles

r2CKPVGFƂPKUJ

56 Modular Furniture EB20_Book.indb 56

• Soft close doors and drawers

Price includes VAT

18/11/2019 15:35


Malanda / Modular Furniture

Malanda - Floor Standing 3 Drawer Basin Unit 605mm - White Code E20105 E20096

Description

Finish

3 Drawer Floor Mounted Unit w570 x h820 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Malanda - 2 Door Wall Column Unit - 300mm White RRP

White

£618.09

White

£147.31

Code

Description

Finish

E20117

2 Door Wall Column Unit w300 x h1200 x d300

White

RRP £244.47

Total £765.40

Malanda - Floor Standing 2 Door Basin Unit 605mm - White Code E20113 E20096

Description

Finish

2 Door Floor Mounted Unit w570 x h820 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Malanda - Wall Mounted 2 Drawer Basin Unit 605mm - White RRP

Code

White

£409.92

E20101

White

£147.31

E20096

Description 2 Drawer Wall Mounted Unit w570 x h500 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Finish White

£445.16

White

£147.31

Total £557.23

Malanda - Wall Mounted 1 Drawer Basin Unit 505mm - White Code E20097 E20095

Description

Finish

1 Drawer Wall Mounted Unit w465 x h415 x d380 Ceramic Basin for Unit, 1 Taphole w505 x h50 x d400

Code

White

£283.95

E20109

White

£132.37

E20095

Total £416.32

EB20_Book.indb 57

Total £592.47

Malanda - Floor Standing 2 Door Basin Unit 505mm - White RRP

All dimensions are in mm

RRP

Description 2 Door Floor Mounted Unit w465 x h820 x d380 Ceramic Basin for Unit, 1 Taphole w505 x h50 x d400

Finish

RRP

White

£354.41

White

£132.37 Total £486.78

Modular Furniture

57 18/11/2019 15:35


Modular Furniture / Malanda

Malanda - Floor Standing 3 Drawer Basin Unit 605mm - Stone Grey Code E20106 E20096

Description 3 Drawer Floor Mounted Unit w570 x h820 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Finish

Malanda - 2 Door Wall Column Unit - 300mm Stone Grey RRP

Stone Grey

£618.09

White

£147.31

Code

Description

E20118

2 Door Wall Column Unit w300 x h1200 x d300

Finish Stone Grey

RRP £244.47

Total £765.40

Malanda - Floor Standing 2 Door Basin Unit 605mm - Stone Grey Code E20114 E20096

Description 2 Door Floor Mounted Unit w570 x h820 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Finish

Malanda - Wall Mounted 2 Drawer Basin Unit 605mm - Stone Grey RRP

Code

Stone Grey

£409.92

E20102

White

£147.31

E20096

Description 2 Drawer Wall Mounted Unit w570 x h500 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Finish Stone Grey

£445.16

White

£147.31

Total £557.23

Malanda - Wall Mounted 1 Drawer Basin Unit 505mm - Stone Grey Code E20098 E20095

Description 1 Drawer Wall Mounted Unit w465 x h415 x d380 Ceramic Basin for Unit, 1 Taphole w505 x h50 x d400

Finish

Total £592.47

Malanda - Floor Standing 2 Door Basin Unit 505mm - Stone Grey RRP

Code

Stone Grey

£283.95

E20110

White

£132.37

E20095

Description 2 Door Floor Mounted Unit w465 x h820 x d380 Ceramic Basin for Unit, 1 Taphole w505 x h50 x d400

Total £416.32

58 Modular Furniture EB20_Book.indb 58

RRP

Finish

RRP

Stone Grey

£354.41

White

£132.37 Total £486.78

Price includes VAT

18/11/2019 15:35


Malanda / Modular Furniture

Our most popular colour - Light Grey

Malanda - Floor Standing 3 Drawer Basin Unit 605mm - Light Grey Code E20107 E20096

Description

Finish

3 Drawer Floor Mounted Unit w570 x h820 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Malanda - 2 Door Wall Column Unit - 300mm Light Grey RRP

Light Grey

£618.09

White

£147.31

Code

Description

E20119

2 Door Wall Column Unit w300 x h1200 x d300

Finish Light Grey

RRP £244.47

Total £765.40

Malanda - Floor Standing 2 Door Basin Unit 605mm - Light Grey Code E20115 E20096

Description

Finish

2 Door Floor Mounted w570 x h820 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Malanda - Wall Mounted 2 Drawer Basin Unit 605mm - Light Grey RRP

Code

Light Grey

£409.92

E20103

White

£147.31

E20096

Description 2 Drawer Wall Mounted Unit w570 x h500 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Finish Light Grey

£445.16

White

£147.31

Total £557.23

Malanda - Wall Mounted 1 Drawer Basin Unit 505mm - Light Grey Code E20099 E20095

Description

Finish

1 Drawer Wall Mounted Unit w465 x h415 x d380 Ceramic Basin for Unit, 1 Taphole w505 x h50 x d400

Code

Light Grey

£283.95

E20111

White

£132.37

E20095

Total £416.32

EB20_Book.indb 59

Total £592.47

Malanda - Floor Standing 2 Door Basin Unit 505mm - Light Grey RRP

All dimensions are in mm

RRP

Description 2 Door Floor Mounted Unit w465 x h820 x d380 Ceramic Basin for Unit, 1Taphole w505 x h50 x d400

Finish

RRP

Light Grey

£354.41

White

£132.37 Total £486.78

Modular Furniture

59 18/11/2019 15:35


Modular Furniture / Malanda

For a textured look choose Basalt Wood

Malanda - Floor Standing 3 Drawer Basin Unit 605mm - Basalt Wood Code E20108 E20096

Description 3 Drawer Floor Mounted Unit w570 x h820 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Finish

Malanda - 2 Door Wall Column Unit - 300mm Basalt Wood RRP

Basalt Wood

£618.09

White

£147.31

Code

Description

E20120

2 Door Wall Column Unit w300 x h1200 x d300

Finish Basalt Wood

RRP £244.47

Total £765.40

Malanda - Floor Standing 2 Door Basin Unit 605mm - Basalt Wood Code E20116 E20096

Description 2 Door Floor Mounted Unit w570 x h820 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Finish

Malanda - Wall Mounted 2 Drawer Basin Unit 605mm - Basalt Wood RRP

Code

Basalt Wood

£409.92

E20104

White

£147.31

E20096

Description 2 Drawer Wall Mounted Unit w570 x h500 x d430 Ceramic Basin for Unit, 1 Taphole w605 x h50 x d450

Finish Basalt Wood

£445.16

White

£147.31

Total £557.23

Malanda - Wall Mounted 1 Drawer Basin Unit 505mm - Basalt Wood Code E20100 E20095

Description 1 Drawer Wall Mounted Unit w465 x h415 x d380 Ceramic Basin for Unit, 1 Taphole w505 x h50 x d400

Finish

Total £592.47

Malanda - Floor Standing 2 Door Basin Unit 505mm - Basalt Wood RRP

Code

Basalt Wood

£283.95

E20112

White

£132.37

E20095

Description 2 Door Floor Mounted Unit w465 x h820 x d380 Ceramic Basin for Unit, 1 Taphole w505 x h50 x d400

Total £416.32

60 Modular Furniture EB20_Book.indb 60

RRP

Finish

RRP

Basalt Wood

£354.41

White

£132.37 Total £486.78

Price includes VAT

18/11/2019 15:35


Narva Cube / Modular Furniture

Narva Cube

CERAMIC BASIN

Matching WC on page 25

SOFT CLOSE

Taps Not Included

Narva Cube - 1 Drawer Basin Unit - 600mm

Narva Cube - 1 Drawer Basin Unit - 800mm Code E10029 E10028

Description

Finish

1 Draw Wall Mounted Unit w800 x h490 x d420 1 Taphole Basin w800 x h155 x d490

RRP

White

£450.00

E10026

White

£288.46

E10025

Total £738.46

All dimensions are in mm

EB20_Book.indb 61

Code

Description 1 Draw Wall Mounted Unit w600 x h490 x d420 1 Taphole Basin w600 x h155 x d490

Finish

RRP

White

£398.08

White

£207.69 Total £605.77

Modular Furniture

61 18/11/2019 15:35


Modular Furniture / Laja Cube

Laja Cube

RESIN BASIN

Matching WC on page 23 Taps Not Included

Laja Cube - Floor Standing 2 Drawer Unit - 594mm Code E10059 E10056

Description 2 Drawer Unit w594 x h730 x d476 1 Taphole Basin w594 x h155 x d476

Finish

Laja Cube - Wall Mounted 2 Drawer Unit - 594mm RRP

White

£439.62

E10058

White

£185.77

E10056

Total £625.38

62 Modular Furniture EB20_Book.indb 62

Code

Description

Finish

2 Drawer Unit w594 x h450 x d476 1 Taphole Basin w594 x h155 x d476

Laja Cube - Wall Mounted 1 Drawer Unit - 594mm RRP

Code

White

£371.54

E10057

White

£185.77

E10056

Total £557.31

Description 1 Drawer Unit w594 x h300 x d476 1 Taphole Basin w594 x h155 x d476

Finish

RRP

White

£297.69

White

£185.77

Total £483.46

Price includes VAT

18/11/2019 15:35


Trenton / Modular Furniture

Trenton

Matching WC - on page 31

SOFT CLOSE

Taps Not Included

Trenton - Wall Mounted 1 Drawer Unit - 600mm

Trenton - Wall Mounted 1 Drawer Unit - 800mm Code E10074 E10073

Description

Finish

1 Drawer Wall Mounted Unit w800 x h430 x d470 1 Taphole Basin w800 x h155 x d470

RRP

White

£443.08

E10071

White

£290.77

E10070

Total £733.85

All dimensions are in mm

EB20_Book.indb 63

Code

Description 1 Drawer Wall Mounted Unit w600 x h430 x d470 1 Taphole Basin w600 x h155 x d470

Finish

RRP

White

£387.69

White

£193.85 Total £581.54

Modular Furniture

63 18/11/2019 15:35


Modular Furniture / Serio

Serio Clever storage solutions

COLOUR CHOICE

SOFT CLOSE

Taps Not Included

Serio - Wall Mounted 1 Drawer Basin Unit - 500mm - White

Serio - Wall Mounted 1 Drawer Basin Unit - 500mm - Light Grey

Serio - Wall Mounted 1 Drawer Basin Unit - 500mm - Stone Grey

Code

Code

Code

E20086 E20081

Description 1 Drawer Unit w460 x h360 x d430 1 Taphole Basin w500 x h50 x d430

Finish

RRP

White

£431.27

E20087

White

£154.80

E20081

Total £586.07

64 Modular Furniture EB20_Book.indb 64

Description

Finish

RRP

1 Drawer Unit Light Grey £431.27 w460 x h360 x d430 1 Taphole Basin White £154.80 w500 x h50 x d430 Total £586.07

E20088 E20081

Description

Finish

RRP

1 Drawer Unit Stone Grey £431.27 w460 x h360 x d430 1 Taphole Basin White £154.80 w500 x h50 x d430 Total £586.07

Price includes VAT

18/11/2019 15:36


Serio / Modular Furniture

Serio - Floor Standing 2 Door Basin Unit - 500mm - White Code E20083 E20081

Description 2 Door Unit w460 x h820 x d430 1 Taphole Basin w500 x h50 x d430

Finish

RRP

Serio - Floor Standing 2 Door Basin Unit - 500mm - Light Grey

Serio - Floor Standing 2 Door Basin Unit - 500mm - Stone Grey

Code

Code

White

£576.44

E20084

White

£154.80

E20081

Description

Finish

RRP

2 Door Unit Light Grey £576.44 w460 x h820 x d430 1 Taphole Basin White £154.80 w500 x h50 x d430

Total £731.24

E20085 E20081

Description

Finish

RRP

2 Door Unit Stone Grey £576.44 w460 x h820 x d430 1 Taphole Basin White £154.80 w500 x h50 x d430

Total £731.24

Total £731.24

Serio - Wall Mounted 1 Drawer Basin Unit - 600mm - White

Serio - Wall Mounted 1 Drawer Basin Unit - 600mm - Light Grey

Serio - Wall Mounted 1 Drawer Basin Unit - 600mm - Stone Grey

Code

Code

Code

E20094 E20082

Description 1 Drawer Unit w570 x h420 x d460 1 Taphole Basin w600 x h50 x d455

Finish

RRP

White

£473.97

E20093

White

£198.55

E20082

Description

Total £672.52

Serio - Floor Standing 2 Door Basin Unit - 600mm - White Code E20091 E20082

Description 2 Door Unit w570 x h820 x d455 1 Taphole Basin w600 x h50 x d455

Finish

RRP

RRP

E20092 E20082

Description

Finish

RRP

1 Drawer Unit Stone Grey £473.97 w570 x h420 x d460 1 Taphole Basin White £198.55 w600 x h50 x d455

Total £672.52

Total £672.52

Serio - Floor Standing 2 Door Basin Unit - 600mm - Light Grey

Serio - Floor Standing 2 Door Basin Unit - 600mm - Stone Grey

Code

Code

White

£582.85

E20090

White

£198.55

E20082

Total £781.40

All dimensions are in mm

EB20_Book.indb 65

Finish

1 Drawer Unit Light Grey £473.97 w570 x h420 x d460 1 Taphole Basin White £198.55 w600 x h50 x d455

Description

Finish

RRP

2 Door Unit Light Grey £582.85 w570 x h820 x d455 1 Taphole Basin White £198.55 w600 x h50 x d455 Total £781.40

E20089 E20082

Description

Finish

RRP

2 Door Unit Stone Grey £582.85 w570 x h820 x d455 1 Taphole Basin £198.55 White w600 x h50 x d455 Total £781.40

Modular Furniture

65 18/11/2019 15:36


Modular Furniture / Anta

Anta See our range of Storage Columns - page 81

COLOUR CHOICE

SOFT CLOSE

Available in 4 Colours - White Finish Pictured Taps Not Included

r%GTCOKEDCUKPYKVJDWKNVKPQXGTƃQY

• Cloakroom unit has reversible door

• Chrome plated handles

• Painted gloss White, Dark Blue, Anthracite or 5VQPG)TG[28%YTCRRGFƂPKUJ )TG[KPVGTPCNU

rOORNWODKPIXQKFQPƃQQTOQWPVGFWPKVU 66 Modular Furniture EB20_Book.indb 66

Price includes VAT

18/11/2019 15:36


Anta / Modular Furniture

White Finish Also Available E20029

Anta - Wall Mounted Unit 2 Door - 600mm - D. Blue

Anta - Wall Mounted Unit 2 Door - 600mm - Anthracite

Code

Code

Description

Finish

2 Door Wall Unit w585 x h520 x d445 1 Taphole Basin w600 x h45 x d460

E20145 E20030

RRP

Description

Dark Blue

£309.57

E20028

White

£219.90

E20030

2 Door Wall Unit w585 x h520 x d445 1 Taphole Basin w600 x h45 x d460

Finish

RRP

Anthracite

£309.57

White

£219.90

Total £529.47

Total £529.47

White Finish Also Available E20026

Anta - Full Depth Floor Standing Basin Unit - 600mm - Dark Blue

Anta - Full Depth Floor Standing Basin Unit - 600mm - Anthracite

Anta - Full Depth Floor Standing Basin Unit - 600mm - Stone Grey

Code

Code

Code

E20144 E20030

Description 2 Door Unit w585 x h820 x d445 1 Taphole Basin w600 x h45 x d460

Finish

RRP

Dark Blue

£438.75

E20025

White

£219.90

E20030

Description 2 Door Unit w585 x h820 x d445 1 Taphole Basin w600 x h45 x d460

Total £658.65

Finish

RRP

Anthracite £438.75 White

£219.90

E20027 E20030

Description

Finish

2 Door Unit w585 x h820 x d445 1 Taphole Basin w600 x h45 x d460

Stone Grey

£438.75

White

£219.90

Total £658.65

RRP

Total £658.65

White Finish Also Available E20022

Anta - Full Depth Floor Standing Basin Unit - 505mm - Dark Blue

Anta - Full Depth Floor Standing Basin Unit - 505mm - Anthracite

Anta - Full Depth Floor Standing Basin Unit - 505mm - Stone Grey

Code

Code

Code

E20141 E20024

Description 2 Door Unit w490 x h820 x d375 1 Taphole Basin w505 x h45 x d385

Finish

RRP

Dark Blue

£406.73

E20021

White

£203.90

E20024

Total £610.63

All dimensions are in mm

EB20_Book.indb 67

Description 2 Door Unit w490 x h820 x d375 1 Taphole Basin w505 x h45 x d385

Finish

RRP

Anthracite £406.73 White

£203.90

Total £610.63

E20023 E20024

Description

Finish

2 Door Unit w490 x h820 x d375 1 Taphole Basin w505 x h45 x d385

Stone Grey

RRP £406.73

White

£203.90

Total £610.63

Modular Furniture

67 18/11/2019 15:36


Modular Furniture / Anta

Reversible door

White Finish Also Available E20018

Anta - Cloakroom Floor Standing Wash Unit - 520mm Dark Blue

Anta - Cloakroom Floor Standing Wash Unit - 520mm Anthracite

Anta - Cloakroom Floor Standing Wash Unit - 520mm Stone Grey

Code

Code

Code

E20142 E20020

Description 1 Door Unit w500 x h810 x d240 1 Taphole Basin w520 x h45 x d250

Finish

RRP

Dark Blue

£312.79

E20017

White

£152.67

E20020

Description

Finish

1 Door Unit w500 x h810 x d240 1 Taphole Basin w520 x h45 x d250

Total £465.45

RRP

Anthracite £312.79 White

£152.67

E20019 E20020

Description

Finish

1 Door Unit w500 x h810 x d240 1 Taphole Basin w520 x h45 x d250

Stone Grey

£312.79

White

£152.67

Total £465.45

RRP

Total £465.45

White Finish Also Available E20032

Anta - Full Depth Floor Standing Basin Unit - 700mm - Dark Blue

Anta - Full Depth Floor Standing Basin Unit - 700mm - Anthracite

Anta - Full Depth Floor Standing Basin Unit - 700mm - Stone Grey

Code

Code

Code

E20146 E20036

Description 2 Door Unit w690 x h820 x d445 1 Taphole Basin w700 x h45 x d460

Finish

RRP

Dark Blue

£457.97

E20031

White

£236.98

E20036

Description

Finish

RRP

2 Door Unit Anthracite £457.97 w690 x h820 x d445 1 Taphole Basin White £236.98 w700 x h45 x d460

Total £694.95

E20033 E20036

Description

Finish

RRP

2 Door Unit Stone Grey £457.97 w690 x h820 x d445 1 Taphole Basin White £236.98 w700 x h45 x d460

Total £694.95

Total £694.95

Alternative Anta Handles Available - 160mm or 320mm

Chrome Handle - E20154 or 55

68 Modular Furniture EB20_Book.indb 68

Black Handle - E20156 or 57

Price includes VAT

18/11/2019 15:36


Anta / Modular Furniture

Plenty of storage space

CERAMIC BASIN

SOFT CLOSE

Anthracite 3 Drawer Basin Unit Shown. Taps Not Included

White Finish Also Available E20136

Anta - Floor Standing 3 Drawer Basin Unit - Dark Blue

Anta - Floor Standing 3 Drawer Basin Unit - Anthracite

Anta - Floor Standing 3 Drawer Basin Unit - Stone Grey

Code

Code

Code

E20143 E20030

Description 3 Drawer Basin Unit w585 x h820 x d445 1 TH Ceramic Basin w600 x h45 x d460

Finish

RRP

Dark Blue

£653.30

E20137

White

£219.90

E20030

Total £873.21

All dimensions are in mm

EB20_Book.indb 69

Description 3 Drawer Basin Unit w585 x h820 x d445 1 TH Ceramic Basin w600 x h45 x d460

Finish

RRP

Anthracite £653.30 White

£219.90

Total £873.21

E20138 E20030

Description

Finish

3 Drawer Basin Unit w585 x h820 x d445 1 TH Ceramic Basin w600 x h45 x d460

Stone Grey

RRP £653.30

White

£219.90

Total £873.21

Modular Furniture

69 18/11/2019 15:36


Modular Furniture / Anta

COMBI UNIT

ISOCAST BASIN Stone Grey Combi Unit Shown. Tap, WC & Cistern Not Included

White Finish Also Available E20130 (LH) E20133 (RH)

Anta - Back-to-Wall Floor Standing Combi Unit - Dark Blue

Anta - Back-to-Wall Floor Standing Combi Unit - Anthracite

Anta - Back-to-Wall Floor Standing Combi Unit - Stone Grey

Code

Code

Code

Description

Finish

RRP

Back-to-Wall Floor Mtd E20147 Dark Blue £557.22 w990 x h835 x d275 Isocast 1 TH Basin - LH White £239.12 E20128 w1000 x h25 x d280 LEFT-HANDED

Code

Description

EB20_Book.indb 70

E20128

Finish

RRP

Finish

LEFT-HANDED

Total £796.34

Back-to-Wall Floor Mtd E20148 Dark Blue £557.22 w990 x h835 x d275 Isocast 1 TH Basin - RH White £239.12 E20129 w1000 x h25 x d280 RIGHT-HANDED Total £796.34

70 Modular Furniture

E20132

Description

Code E20135 E20129

RRP

Back-to-Wall Floor Mtd Anthracite £557.22 w990 x h835 x d275 Isocast 1 TH Basin - LH White £239.12 w1000 x h25 x d280

Description

E20131 E20128

Finish

RRP

Finish Stone Grey

£557.22

White

£239.12

LEFT-HANDED

Total £796.34

Back-to-Wall Floor Mtd Anthracite £557.22 w990 x h835 x d275 Isocast 1 TH Basin - RH White £239.12 w1000 x h25 x d280 RIGHT-HANDED Total £796.34

Description Back-to-Wall Floor Mtd w990 x h835 x d275 Isocast 1 TH Basin - LH w1000 x h25 x d280

Code E20134 E20129

RRP

Total £796.34

Description

Finish

Back-to-Wall Floor Mtd w990 x h835 x d275 Isocast 1 TH Basin - RH w1000 x h25 x d280 RIGHT-HANDED

Stone Grey

RRP £557.22

White

£239.12

Total £796.34

Price includes VAT

18/11/2019 15:36


Sabie / Modular Furniture

Sabie

Sleek curved design

COLOUR CHOICE

SOFT CLOSE

CURVED DOOR

Taps Not Included

• Soft close double doors

• Polished chrome handles

• Sleek curved doors with linear style handles

• Isocast basin with built-in QXGTƃQY

• Gloss White, Stone Grey or .KIJV)TG[ƂPKUJ • 50mm plumbing void

Sabie - Floor Standing Curved Unit 2 Door - 600mm White

Sabie - Floor Standing Curved Unit 2 Door - 600mm Light Grey

Sabie - Floor Standing Curved Unit 2 Door - 600mm Stone Grey

Code

Code

Code

E20068 E20067

Description 2 Door Unit w590 x h730 x d395 Isocast Basin, 1TH w600 x h140 x d400

Finish

RRP

White

£559.36

E20069

White

£244.47

E20067

Total £803.83

All dimensions are in mm

EB20_Book.indb 71

Description

Finish

2 Door Unit w590 x h730 x d395 Isocast Basin, 1TH w600 x h140 x d400

Light Grey

RRP £559.36

E20070

White

£244.47

E20067

Total £803.83

Description

Finish

2 Door Unit w590 x h730 x d395 Isocast Basin, 1TH w600 x h140 x d400

Stone Grey

RRP £559.36

White

£244.47

Total £803.83

Modular Furniture

71 18/11/2019 15:37


Modular Furniture / Travet

Travet

Optional Travet Chrome Handles

COLOUR CHOICE

SOFT CLOSE

E20162 500mm

E20167 700mm

E20172 900mm

Taps Not Included

r%GTCOKEDCUKPYKVJDWKNVKPQXGTƃQY

r9JKVG.KIJV)TG[QT&CTM)TG[)NQUUÆ‚PKUJ

• Soft close runners with full adjustment

• Thin edged design

• Additional Chrome plated handle options

r5RCEGGHÆ‚EKGPVYCNNOQWPVGFWPKVU

72 Modular Furniture EB20_Book.indb 72

Price includes VAT

18/11/2019 15:37


Travet / Modular Furniture

Travet - Wall Mounted 1 Drawer Unit - 500mm - White

Travet - Wall Mounted 1 Drawer Unit - 500mm - Light Grey

Travet - Wall Mounted 1 Drawer Unit - 500mm - Dark Grey

Code

Code

Code

E20160 E20161

Description 1 Drawer Wall Mounted Unit w500 x h300 x d420 1 Taphole Basin w500 x h130 x d420

Finish

RRP

White

£465.37

E20158

White

£139.14

E20161

Description 1 Drawer Wall Mounted Unit w500 x h300 x d420 1 Taphole Basin w500 x h130 x d420

Total £604.50

Finish

RRP

Light Grey

£465.37

E20159

White

£139.14

E20161

Description 1 Drawer Wall Mounted Unit w500 x h300 x d420 1 Taphole Basin w500 x h130 x d420

Total £604.50

Finish

RRP

Dark Grey Gloss

£465.37

White

£139.14

Total £604.50

Travet - Wall Mounted 1 Drawer Unit - 700mm - White

Travet - Wall Mounted 1 Drawer Unit - 700mm - Light Grey

Travet - Wall Mounted 1 Drawer Unit - 700mm - Dark Grey

Code

Code

Code

E20165 E20166

Description 1 Drawer Wall Mounted Unit w700 x h300 x d420 1 Taphole Basin w700 x h130 x d420

Finish

RRP

White

£552.13

E20163

White

£192.24

E20166

Description 1 Drawer Wall Mounted Unit w700 x h300 x d420 1 Taphole Basin w700 x h130 x d420

Total £744.38

Finish

RRP

Light Grey

£552.13

E20164

White

£192.24

E20166

Description 1 Drawer Wall Mounted Unit w700 x h300 x d420 1 Taphole Basin w700 x h130 x d420

Total £744.38

Finish

RRP

Dark Grey Gloss

£552.13

White

£192.24

Total £744.38

Travet - Wall Mounted 1 Drawer Unit - 900mm - White

Travet - Wall Mounted 1 Drawer Unit - 900mm - Light Grey

Travet - Wall Mounted 1 Drawer Unit - 900mm - Dark Grey

Code

Code

Code

E20168 E20171

Description 1 Drawer Wall Mounted Unit w900 x h300 x d420 1 Taphole Basin w900 x h130 x d420

Finish

RRP

White

£636.78

E20169

White

£281.75

E20171

Total £918.53

All dimensions are in mm

EB20_Book.indb 73

Description 1 Drawer Wall Mounted Unit w900 x h300 x d420 1 Taphole Basin w900 x h130 x d420

Finish

RRP

Light Grey

£636.78

E20170

White

£281.75

E20171

Total £918.53

Description 1 Drawer Wall Mounted Unit w900 x h300 x d420 1 Taphole Basin w900 x h130 x d420

Finish

RRP

Dark Grey Gloss

£636.78

White

£281.75

Total £918.53

Modular Furniture

73 18/11/2019 15:37


Modular Furniture / Kopren

Kopren

Great for Cloakrooms!

COLOUR CHOICE

SOFT CLOSE

ISOCAST BASIN

Taps Not Included

r+UQECUVDCUKPYKVJPQQXGTƃQY

VQDGWUGFYKVJQRGPYCUVG

• Painted gloss white edgebanded MFC

rOORNWODKPIXQKFQPƃQQT mounted units

• Adjustable wall hangers on wall mounted units

• Chrome plated handle

• Soft close hinges

74 Modular Furniture EB20_Book.indb 74

• Coordinating cabinets and back-to-wall units available • Left-hand hinge only

Price includes VAT

18/11/2019 15:37


Kopren / Modular Furniture

Kopren - Wall Mounted Cloakroom Unit including Basin - White

Kopren - Wall Mounted Cloakroom Unit including Basin - Stone Grey

Kopren - Wall Mounted Cloakroom Unit including Basin - Anthracite

Code

Description

Code

Description

Finish

Code

Description

E20040

1 Door Unit w400 x h585 x d220

E20041

1 Door Unit w400 x h585 x d220

Stone Grey

E20042

1 Door Unit Anthracite £321.33 w400 x h585 x d220

Finish White

RRP £321.33

RRP £321.33

Finish

RRP

Kopren - Floor Standing Cloakroom Unit including Basin - White

Kopren - Floor Standing Cloakroom Unit including Basin - Stone Grey

Kopren - Floor Standing Cloakroom Unit including Basin - Anthracite

Code

Description

Code

Description

Finish

Code

Description

E20037

1 Door Unit w400 x h860 x d220

E20038

1 Door Unit w400 x h860 x d220

Stone Grey

E20039

1 Door Unit Anthracite £364.03 w400 x h860 x d220

Finish White

RRP £364.03

All dimensions are in mm

EB20_Book.indb 75

RRP £364.03

Finish

Modular Furniture

RRP

75 18/11/2019 15:37


Modular Furniture / Eland

Eland

COLOUR CHOICE

SOFT CLOSE

CERAMIC BASIN

Taps Not Included

Eland - Floor Standing Cloakroom Unit - Gloss White Code E20121 E20124

Description 1 Door Unit w460 x h880 x d295 Right Handed 1TH Ceramic Basin

Finish

Eland - Floor Standing Cloakroom Unit - Basalt Wood RRP

White

£398.19

E20122

White

£196.42

E20124

Total £594.61

76 Modular Furniture EB20_Book.indb 76

Code

Eland - Floor Standing Cloakroom Unit - Stone Grey

Description

Finish

1 Door Unit w460 x h880 x d295 Right Handed 1TH Ceramic Basin

Basalt Wood

RRP £398.19

E20123

White

£196.42

E20124

Total £594.61

Code

Description

Finish

1 Door Unit w460 x h880 x d295 Right Handed 1TH Ceramic Basin

Stone Grey

RRP £398.19

White

£196.42

Total £594.61

Price includes VAT

18/11/2019 15:37


Papala / Modular Furniture

Papala

Papala - Floor Standing Unit 2 Door - White Code E20052 E20054

Description 2 Door Floor Mounted Unit w610 x h860 x d400 1 Taphole Ceramic Basin w610 x d400

Finish

RRP

White

£289.30

White

£111.02 Total £400.32

Papala - Wall Mounted Unit 1 Drawer - White Code SOFT CLOSE ..

E20053 E20054

Taps Not Included

All dimensions are in mm

EB20_Book.indb 77

Description 1 Drawer Wall Mounted Unit w610 x h410 x d400 1 Taphole Ceramic Basin w610 x d400

Finish

RRP

White

£208.17

White

£111.02 Total £319.19

Modular Furniture

77 18/11/2019 15:37


Modular Furniture / Inglis

Inglis One piece Basin top

COMBI UNIT

ISOCAST BASIN

COLOUR CHOICE

SOFT CLOSE

Taps Not Included

r+UQECUVDCUKPYKVJDWKNVKPQXGTƃQY

• Discrete chrome WC panel trim

• Chrome plated handles

• Soft Close Doors

• Gloss White, Clay, Havana Oak or 1ZHQTF$NWGƂPKUJ

• 50mm plumbing void

78 Modular Furniture EB20_Book.indb 78

• Concealed cistern and WC not included • Unit depth 270mm, basin depth 380mm

Price includes VAT

18/11/2019 15:37


Inglis / Modular Furniture

Inglis - Semi Counter Top & Back-to-Wall WC Combi Unit - Floor Standing - Havana Oak Code E20072 E20078

Description

Finish

Back-to-Wall Floor Mounted Unit w1000 x h850 x d270 Isocast 1 Taphole Basin - Right Handed w1000 x d380

Inglis - Semi Counter Top & Back-to-Wall WC %QODK7PKV(NQQT5VCPFKPI1ZHQTF$NWG RRP

Code

Havana Oak

£606.36

E20174

White

£381.11

E20078

Description

Finish

Back-to-Wall Floor Mounted Unit w1000 x h850 x d270 Isocast 1 Taphole Basin - Right Handed w1000 x d380

Oxford Blue

£606.36

White

£381.11

Total £987.47

E20071 E20077

Back-to-Wall Floor Mounted Unit w1000 x h850 x d270 Isocast 1 Taphole Basin - Left Handed w1000 x d380

Total £987.47

Havana Oak

£606.36

E20173

White

£381.11

E20077

Back-to-Wall Floor Mounted Unit w1000 x h850 x 270 Isocast 1 Taphole Basin - Left Handed w1000 x d380

Oxford Blue

£606.36

White

£381.11

Total £987.47

Inglis - Semi Counter Top & Back-to-Wall WC Combi Unit - Floor Standing - White Code E20076 E20078

Description

Finish

Back-to-Wall Floor Mounted Unit w1000 x h850 x d270 Isocast 1 Taphole Basin - Right Handed w1000 x d380

Total £987.47

Inglis - Semi Counter Top & Back-to-Wall WC Combi Unit - Floor Standing - Clay RRP

Code

White

£606.36

E20080

White

£381.11

E20078

Description

Finish

Back-to-Wall Floor Mounted Unit w1000 x h850 x d270 Isocast 1 Taphole Basin - Right Handed w1000 x d380

E20077

Back-to-Wall Floor Mounted Unit w1000 x h850 x d270 Isocast 1 Taphole Basin - Left Handed w1000 x d380

£606.36

White

£381.11

£606.36

E20079

White

£381.11

E20077

All dimensions are in mm

EB20_Book.indb 79

Total £987.47

White

Total £987.47

RRP

Clay

Total £987.47

E20075

RRP

Back-to-Wall Floor Mounted Unit w1000 x h850 x 270 Isocast 1 Taphole Basin - Left Handed w1000 x d380

Clay

£606.36

White

£381.11 Total £987.47

Modular Furniture

79 18/11/2019 15:37


Modular Furniture / Back-to-Wall Units

Back-to-Wall Units

White

Anthracite

Light Grey

Stone Grey

Dark Blue

Curved Edge - Back-to-Wall WC Unit

Nutmeg

Code

Description

Finish

RRP

E20006

w562 x h860 x d230

White

£365.08

E20005

w562 x h860 x d230

Anthracite

£365.08

E20007

w562 x h860 x d230

Nutmeg

£365.08

E20008

w562 x h860x d230

Light Grey

£365.08

E20004

w562 x h860 x d230

Stone Grey

£365.08

E20150

w562 x h860 x d230

Dark Blue

£365.08

• %WTXGFGFIGWPKVUTGEQOOGPFGFHQT5GTKQ R #PVC R 5CDKG R (WTPKVWTG • Concealed cistern not included - See page 49

White

Anthracite

Light Grey

Stone Grey

Square Edge - Back-to-Wall WC Unit

Basalt Wood

Code

Description

Finish

RRP

E20009

w562 x h860 x d230

White

£291.44

E20013

w562 x h860 x d230

Anthracite

£291.44

E20010

w562 x h860 x d230

Basalt Wood

£291.44

E20011

w562 x h860 x d230

Light Grey

£291.44

E20012

w562 x h860 x d230

Stone Grey

£291.44

• 5SWCTGGFIGWPKVUTGEQOOGPFGFHQT/CNCPFC R -QRTGP R CPF'NCPF R HWTPKVWTG • Concealed cistern not included - See page 49 80 Modular Furniture EB20_Book.indb 80

Price includes VAT

18/11/2019 15:38


Storage Columns / Modular Furniture

Storage Columns

Anta - Wall Mounted Storage Column - White Code

Description

E20015

2 Door Unit w350 x h1000 x d240

Anta - Wall Mounted Storage Column - Anthracite

Finish White

RRP £345.87

Code

Description

E20014

2 Door Unit Anthracite £345.87 w350 x h1000 x d240

Finish

RRP

• Soft close hinges Left-hand opening only • Chrome plated handles • Painted Gloss White, Anthracite, Dark Blue or Stone Grey PVC YTCRRGFƂPKUJ )TG[ KPVGTPCNU • Adjustable wall hangers

Anta - Wall Mounted Storage Column - Stone Grey

r(KZGFUJGNHKPWRRGT cupboard

Code

Description

Finish

E20016

2 Door Unit w350 x h1000 x d240

Stone Grey

All dimensions are in mm

EB20_Book.indb 81

Anta - Wall Mounted Storage Column - Dark Blue RRP

£345.87

Code

Description

E20149

2 Door Unit w350 x h1000 x d240

Finish Dark Blue

RRP £345.87

Modular Furniture

81 18/11/2019 15:38


Fitted Furniture

‘Shaker’ style designed for traditional tastes

Shaker units in stone grey with Strata solid surface worktop.

82 Fitted Furniture EB20_Book.indb 82

Price includes VAT

18/11/2019 15:38


Fitted Furniture

Fitted Furniture *GNRVQWPKH[VJGNQQMQH[QWTDCVJTQQOCPFOCZKOKUG[QWTCXCKNCDNGURCEGD[CFFKPIƂVVGFHWTPKVWTG%JQQUG HTQOVYQFQQTUV[NGUKPCTCPIGQHEQPVGORQTCT[ƂPKUJGU All units have soft close hinges. With the basin unit offering an adjustable shelf, easy pipe access with a TGOQXCDNGDCEMRCPGNCPFCOORNWODKPIXQKF6JGƃQQTWPKVUJCXGVJGCFFKVKQPCNDGPGƂVQHCTGOQXCDNG door for easy access.

It’s easy to add furniture to your new bathroom 

5GNGEVCFQQTUV[NGCPFÆ‚PKUJ 5GGDGNQY



&GEKFGQPCEQODKPCVKQPQHWPKVUDCUGFQP[QWTƃQQTURCEGCXCKNCDNG 2CIG



%JQQUGCYQTMVQRCPFJCPFNGUVQDCNCPEGVJGNQQMQH[QWTWPKVU 2CIG

Complement your bathroom by adding designer accessories 

2KEMCNKIJVKPIQRVKQPVJCVUWKVU[QWTUV[NG 2CIG



5GNGEVEQQTFKPCVKPIDCVJRCPGNU 2CIG



%QORNGVG[QWTDCVJTQQOYKVJCP'UVGGOVCR 2CIG CPFCFGUKIPGTVQYGNTCKN 2CIG

Door Style & Finishes Shaker Style

Slab Style

#XCKNCDNGKPÆ‚PKUJGU

#XCKNCDNGKPÆ‚PKUJGU

Natural White

Stone Grey

Mid Grey

All dimensions are in mm

EB20_Book.indb 83

Gloss White

Stone Grey

Dark Chestnut

Mid Grey

Fitted Furniture

83 18/11/2019 15:38


Fitted Furniture / Shaker Style Units

Shaker Style

Choose a worktop style - See Page 88

Standard width Shaker unit with Galactic Black Strata solid worktop surface

'CU[VQETGCVGCUGCONGUUƂVVGFNQQM

Coordinating wall units & bath panels available

Choice of 6 different handles

5JCMGTEQNQWTƂPKUJGU5NCDEQNQWTƂPKUJGU

Soft close doors

Laminate or Solid surface worktops available

84 Fitted Furniture EB20_Book.indb 84

Price includes VAT

18/11/2019 15:38


Shaker Style Units / Fitted Furniture Natural White - NW / Stone Grey - ST / Mid Grey - MT Description Back-to-wall WC Unit w500 x h820 x d353 Total RRP TBC £310.99 Back-to-wall WC Unit w600 x h820 x d353 Total RRP RRP £325.42 £325.42 Total Back-to-wall WC Unit w500 x h820 x d218 Total RRP £301.32 WC Not Included

Shaker Back-to-Wall WC Unit

Back-to-wall WC Unit w600 x h820 x d218 Total RRP TBC £319.48

Carcass Code

Fascia Code

Finish

CA5023._ _

SW5020._ _

.NW / .ST / .MT

£219.19

£91.80

$GGƓQLVKWRFRGH

CA6023._ _

SW6020._ _

.NW / .ST / .MT

£225.13

£100.29

$GGƓQLVKWRFRGH

CA5022._ _

SW5020._ _

.NW / .ST / .MT

£209.52

£91.80

$GGƓQLVKWRFRGH

CA6022._ _

SW6020._ _

.NW / .ST / .MT

£219.19

£100.29

$GGƓQLVKWRFRGH

STD DEPTH

STD DEPTH

SLIM DEPTH

SLIM DEPTH

Natural White - NW / Stone Grey - ST / Mid Grey - MT Description 1 Door Floor Cupboard w300 x h820 x d353 Total RRP TBC £246.79 1 Door Floor Cupboard w300 x h820 x d218 Total RRP TBC £236.18 Plinths Available Separately

Shaker 1 or 2 Door Floor Cupboard

2 Door Floor Cupboard w600 x h820 x d353 Total RRP TBC £363.04

Carcass Code

Fascia Code

Finish

CA3033._ _

SW3030._ _

.NW / .ST / .MT

£200.91

£45.88

$GGƓQLVKWRFRGH

CA3032._ _

SW3030._ _

.NW / .ST / .MT

£190.30

£45.88

$GGƓQLVKWRFRGH

CA6033._ _

SW6030._ _

.NW / .ST / .MT

£271.24

£91.80

$GGƓQLVKWRFRGH

STD DEPTH

SLIM DEPTH

STD DEPTH

Natural White - NW / Stone Grey - ST / Mid Grey - MT Description

Plinths Available Separately

Shaker Semi Countertop Basin Unit Please ensure both the Carcass and the Fascia are ordered together to complete each unit. All dimensions are in mm

EB20_Book.indb 85

Carcass Code

Fascia Code

Finish

Semi Countertop Basin Unit w500 x h820 x d353

CA5013._ _

SW5010._ _

.NW / .ST / .MT

Total RRP TBC £354.39

£262.59

£91.80

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w600 x h820 x d353

CA6013._ _

SW6010._ _

.NW / .ST / .MT

Total RRP TBC £363.04

£271.24

£91.80

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w700 x h820 x d353

CA7013._ _

SW7010._ _

.NW / .ST / .MT

Total RRP TBC £387.76

£287.47

£100.29

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w500 x h820 x d218

CA5012._ _

SW5010._ _

.NW / .ST / .MT

Total RRP TBC £345.74

£253.94

£91.80

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w600 x h820 x d218

CA6012._ _

SW6010._ _

.NW / .ST / .MT

Total RRP TBC £354.39

£262.59

£91.80

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w700 x h820 x d218

CA7012._ _

SW7010._ _

.NW / .ST / .MT

Total RRP £379.07

£278.78

£100.29

$GGƓQLVKWRFRGH

STD DEPTH

STD DEPTH

STD DEPTH

SLIM DEPTH

SLIM DEPTH

SLIM DEPTH

Fitted Furniture

85 18/11/2019 15:38


Fitted Furniture / Slab Style Units

Slab Style Slab Furniture with Isocast Basin Shown - Not Available in 500mm Width Units

Slab Semi Countertop Basin Unit

Gloss White - W / Stone Grey - ST / Dark Chestnut - DC / Mid Grey - MT Description

Carcass Code

Fascia Code

Finish

CA5013._ _

MU5010._ _

.W / .ST / .DC /.MT

Total RRP TBC £350.12

£262.59

£87.53

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w600 x h820 x d353

CA6013._ _

MU6010._ _

.W / .ST / .DC /.MT

Total RRP TBC £358.77

£271.24

£87.53

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w700 x h820 x d353

CA7013._ _

MU7010._ _

.W / .ST / .DC /.MT

Total RRP TBC £382.43

£286.40

£96.02

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w500 x h820 x d353

500mm Width Plinths Available Separately

600mm Width Plinths Available Separately

STD DEPTH

STD DEPTH

Gloss White - W / Stone Grey - ST / Dark Chestnut - DC / Mid Grey - MT Description

Carcass Code

Fascia Code

Finish

CA5012._ _

MU5010._ _

.W / .ST / .DC /.MT

Total RRP TBC £341.47

£253.94

£87.53

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w600 x h820 x d218

CA6012._ _

MU6010._ _

.W / .ST / .DC /.MT

Total RRP TBC £350.12

£262.59

£87.53

$GGƓQLVKWRFRGH

CA7012._ _

MU7010._ _

.W / .ST / .DC /.MT

£278.78

£96.02

$GGƓQLVKWRFRGH

Semi Countertop Basin Unit w500 x h820 x d218

700mm Width Plinths Available Separately

STD DEPTH

Semi Countertop Basin Unit w700 x h820 x d218 Total RRP TBC £374.80

SLIM DEPTH

SLIM DEPTH

SLIM DEPTH

Please ensure both the Carcass and the Fascia are ordered together to complete each unit.

86 Fitted Furniture EB20_Book.indb 86

Price includes VAT

18/11/2019 15:38


Slab Style Units / Fitted Furniture

Gloss White - W / Stone Grey - ST / Dark Chestnut - DC / Mid Grey - MT Description

Carcass Code

Fascia Code

Finish

Back-to-wall WC Unit w500 x h820 x d353

CA5023._ _

MU5020._ _

.W / .ST / .DC /.MT

Total RRP TBC £306.72

£219.19

£87.53

$GGƓQLVKWRFRGH

Back-to-wall WC Unit w600 x h820 x d353

CA6023._ _

MU6020._ _

.W / .ST / .DC /.MT

Total RRP TBC £321.15

£225.13

£96.02

$GGƓQLVKWRFRGH

CA5022._ _

MU5020._ _

.W / .ST / .DC /.MT

£209.52

£87.53

$GGƓQLVKWRFRGH

CA6022._ _

MU6020._ _

.W / .ST / .DC /.MT

£219.19

£96.02

$GGƓQLVKWRFRGH

Back-to-wall WC Unit w500 x h820 x d218

STD DEPTH

STD DEPTH

SLIM DEPTH

WC Not Included

Slab Back-to-Wall WC Unit

Total RRP £297.05 Back-to-wall WC Unit w600 x h820 x d218 Total RRP TBC £315.22

SLIM DEPTH

Gloss White - W / Stone Grey - ST / Dark Chestnut - DC / Mid Grey - MT Description 1 Door Floor Cupboard w200 x h820 x d353 Total RRP TBC £225.08

Plinths Available Separately

Slab 1 Door Floor Cupboard

1 Door Floor Cupboard w300 x h820 x d353 Total RRP TBC £244.66 1 Door Floor Cupboard w200 x h820 x d218 Total RRP TBC £216.08 1 Door Floor Cupboard w300 x h820 x d218 Total RRP TBC £236.17

Plinths Available Separately

Slab 2 Door Floor Cupboard

2 Door Floor Cupboard w600 x h820 x d353 Total RRP TBC £363.04

Carcass Code

Fascia Code

Finish

CA2033._ _

MU2030._ _

.W / .ST / .DC /.MT

£187.71

£37.38

$GGƓQLVKWRFRGH

CA3033._ _

MU3030._ _

.W / .ST / .DC /.MT

£200.91

£43.75

$GGƓQLVKWRFRGH

CA2032._ _

MU2030._ _

.W / .ST / .DC /.MT

£178.70

£37.38

$GGƓQLVKWRFRGH

CA3032._ _

MU3030._ _

.W / .ST / .DC /.MT

£190.30

£45.88

$GGƓQLVKWRFRGH

CA6033._ _

MU6030._ _

.W / .ST / .DC /.MT

£271.24

£91.80

$GGƓQLVKWRFRGH

STD DEPTH

STD DEPTH

SLIM DEPTH

SLIM DEPTH

STD DEPTH

Please ensure both the Carcass and the Fascia are ordered together to complete each unit.

All dimensions are in mm

EB20_Book.indb 87

Fitted Furniture

87 18/11/2019 15:38


Fitted Furniture / Handles - Strata Solid Worktops

Handles Choose from various handle and doorknob options to create your look.

Richmond

Indiana

Carolina

Montana

Furniture Knobs

Stamford

Stockton

Furniture Handles

Code

Description

Finish

FHRIC.C

Richmond Knob

Chrome

FHIND.C

Indiana Round Knob

FHCAR.C

Carolina Square Knob

RRP

Code

Description

Finish

RRP

£11.24

FHMON.C

Montana Bar Handle

Chrome

£10.79

Chrome

£10.79

FHSTA.C

Stamford Handle

Chrome

£23.53

Chrome

£9.70

SCHH04C.128

Stockton Handle

Chrome

£16.97

Worktops Our worktops have been developed to be used with our semi-countertop basins. Just like our units they are available in standard or slim depths. 1WT5VTCVCUQNKFUWTHCEGQTNCOKPCVGYQTMVQRTCPIGUCTGFGUKIPGFVQÆ‚PKUJ[QWTWPKVURGTHGEVN[#NVGTPCVKXGN[[QW can opt for our Isocast worktops with integrated basin for a sleek contemporary look.

Strata solid surface #XCKNCDNGKPÆ‚PKUJGUUWRRNKGFKPOOCPFOONGPIVJUCPFECPDGEWVCPFÆ‚PKUJGFCVKPUVCNNCVKQP

Arctic White

Carrera Marble

Grey Quartz

Galactic Black

Strata Solid Surface Worktop - Standard Depth

Strata Solid Surface Worktop - Slim Depth

Description

Description

Strata Solid Surface Worktop

Arctic White

F3W12A.AR

RRP £447.22

Strata Solid Surface Worktop

Finish

Code

RRP

Arctic White

F2W12A.AR

£314.28

Carrera Marble

F2W12A.CA

£314.28

Grey Quartz

F2W12A.GQ

£314.28

F3W12A.CA

£447.22

Grey Quartz

F3W12A.GQ

£447.22

Galactic Black

F3W12A.GA

£447.22

Galactic Black

F2W12A.GA

£314.28

Arctic White

F3W18A.AR

£567.55

Arctic White

F2W18A.AR

£456.50

Carrera Marble

F3W18A.CA

£567.55

Carrera Marble

F2W18A.CA

£456.50

Grey Quartz

F3W18A.GQ

£567.55

Grey Quartz

F2W18A.GQ

£456.50

Galactic Black

F3W18A.GA

£567.55

Galactic Black

F2W18A.GA

£456.50

w1880 x d365

88 Fitted Furniture EB20_Book.indb 88

Code

Carrera Marble

w1280 x d365

Strata Solid Surface Worktop

Finish

w1280 x d230

Strata Solid Surface Worktop w1880 x d230

Price includes VAT

18/11/2019 15:38


Laminate Worktops / Isocast Basins / Fitted Furniture

9QTMVQRU EQPVKPWGF Laminate #XCKNCDNGKPÆ‚PKUJGUUWRRNKGFKPOOCPFOONGPIVJUYKVJUSWCTGGFIKPIHQTEWVVKPIVQNGPIVJ

Gloss White

Black Granite

Portland Stone

Laminate Worktop - Standard Depth Description

Laminate Worktop w1500 x d365

Laminate Worktop w2000 x d365

Riven Slate

Laminate Worktop - Slim Depth

Finish

Code

RRP

Gloss White

F3W15.W

£143.25

Black Granite

F3W15.BG

£143.25

Portland Stone

F3W15.PS

£143.25

Riven Slate

F3W15.SL

Gloss White

Description

Finish

Code

Gloss White

F2W15.W

£120.53

Black Granite

F2W15.BG

£120.53

Portland Stone

F2W15.PS

£120.53

£143.25

Riven Slate

F2W15.SL

£120.53

F3W20.W

£177.09

Gloss White

F2W20.W

£153.86

Black Granite

F3W20.BG

£177.09

Black Granite

F2W20.BG

£153.86

Portland Stone

F3W20.PS

£177.09

Portland Stone

F2W20.PS

£153.86

Riven Slate

F3W20.SL

£177.09

Riven Slate

F2W20.SL

£153.86

Laminate Worktop w1500 x d230

Laminate Worktop w2000 x d230

RRP

Isocast Basins #XCKNCDNGKPOOOOQTOOUK\GU+UQECUVDCUKPUJCXGCINQUUÆ‚PKUJCPFCTGFWTCDNGRTCEVKECN and easy to clean. Isocast - Basins Description

Finish

Code

RRP

w1000 x h155 x d453 - Left

Isocast

IS1002S.L

£377.44

w1000 x h155 x d453 - Right

Isocast

IS1002S.R

£377.44

w1000 x h155 x d310 - Left

Isocast

IS1002SM.L

£377.44

w1000 x h155 x d310 - Right

Isocast

IS1002SM.R

£377.44

Z[K[Gb/HIW

Isocast

IS1202S.L

£415.92

Z[K[Gb5LJKW

Isocast

IS1202S.R

£415.92

Z[K[Gb/HIW

Isocast

IS1200SM.L

£415.92

Z[K[Gb5LJKW

Isocast

IS1200SM.R

£415.92

w1500 x h155 x d453 - Left

Isocast

IS1500S.L

£497.89

w1500 x h155 x d453 - Right

Isocast

IS1500S.R

£497.89

w1500 x h155 x d310 - Left

Isocast

IS1502SM.L

£496.63

w1500 x h155 x d310 - Right

Isocast

IS1502SM.R

£496.63

Sanitaryware For ceramic basins and WC pans please choose your semi-countertop basin and back-to-wall pan from the Esteem sanitaryware range on pages 8 - 45. All dimensions are in mm

EB20_Book.indb 89

Fitted Furniture

89 18/11/2019 15:39


Fitted Furniture / Panels - Plinths - Wall Units

Panels & Plinths /CVEJKPIRNKPVJCPFƂNNGTRCPGNUYKNNEQORNGVGVJGWPKV TWPVQJGNRƂPCNKUG[QWTFGUKTGFNQQM

Panels & Plinths Description

Code

Finish

RRP

1500mm Plinth

AF15060._ _

.W / .ST / .NW /.DC / .MT $GGƓQLVKWRFRGH

£60.91

2000mm Plinth

AF20060._ _

.W / .ST / .NW /.DC / .MT $GGƓQLVKWRFRGH

£76.80

Return Plinth

AF3360._ _

.W / .ST / .NW /.DC / .MT $GGƓQLVKWRFRGH

£39.51

Universal Filler Clad On End Panel

AF3561._ _

.W / .ST / .NW /.DC / .MT $GGƓQLVKWRFRGH

£64.10

Gloss White - W / Stone Grey - ST / Natural White - NW / Dark Chestnut - DC / Mid Grey - MT

Don’t forget Plinths!

Mirrors & Wall Units Mirrors Code

Size (mm)

Finish

RRP

AF6050.G

w500 x h600 x d32

Mirror

£178.70

AF7050.G

w500 x h700 x d32

Mirror

£200.91

9CNN%WRDQCTFU 5VCPFCTF5NKO&GRVJ Description

Carcass Code

Fascia Code

Finish

CA3040._ _

MU3030._ _

.W / .ST / .DC / .MT

CA3040._ _

SW3030._ _

.NW / .ST / .MT

1 Door Wall Cupboard Carcass w300 x h640 x d218

Total RRP £217.98 £217.98

Gloss White - W / Stone Grey - ST / Natural White - NW / Dark Chestnut - DC / Mid Grey - MT

2 Door Wall Cupboard Carcass w600 x h640 x d218

£172.10

£45.88

CA6040._ _

MU6030._ _

CA6040._ _

SW6030._ _

$GGƓQLVKWRFRGH

£217.98

.W / .ST / .DC / .MT £316.93 .NW / .ST

£316.93

Gloss White - W / Stone Grey - ST / Natural White - NW / Dark Chestnut - DC / Mid Grey - MT £225.13

£91.80

$GGƓQLVKWRFRGH

£316.93

Carcass & Fascia units to be ordered together

90 Fitted Furniture EB20_Book.indb 90

Price includes VAT

18/11/2019 15:39


Coordinating Bath Panels / Fitted Furniture

Coordinating Bath Panels Bath Panels Description 1700mm Front Bath Panel 700mm End Bath Panel

Code

Finish

RRP

BP4000._ _

.W / .ST / .NW /.DC / .MT $GGƓQLVKWRFRGH

BP4001._ _

.W / .ST / .NW /.DC / .MT $GGƓQLVKWRFRGH

£190.82

£116.59

“Matching bath panels have been designed to complement the colours of ޜÕÀwÌÌi`vÕÀ˜ˆÌÕÀi”

Gloss White - W / Stone Grey - ST / Natural White - NW / Dark Chestnut - DC / Mid Grey - MT

Keep all your colours uniform

Bathroom Taps #FFVJGƂPKUJKPIVQWEJVQ[QWTDCVJTQQOYKVJCVCR from the Esteem bathroom taps range on pages 136 - 149.

All dimensions are in mm

EB20_Book.indb 91

Fitted Furniture

91 18/11/2019 15:39


Cabinets

Perfectly practical

Cabinets & Mirrors Cabinets Mirrors

92 Cabinets EB20_Book.indb 92

P94-99 P100-105

Price includes VAT

18/11/2019 15:39


Space for all your essentials

Finishing touches for an elegant bathroom Our collection of cabinets will keep things organised and create more space. Adding an attractive mirror to your design will help make your bathroom look bigger and brighter. “LED lighting in mirrors helps to simulate natural light, while demister pads prevent the glass from steaming up� Cabinets EB20_Book.indb 93

93 18/11/2019 15:39


Cabinets

Integrated lighting

94 Cabinets EB20_Book.indb 94

Price includes VAT

18/11/2019 15:39


Kendell - Nubia - Vanda - Mackay / Cabinets

GLASS SHELVES

Kendell - Slimline - Aluminium Code

Description

E20325

Includes Double Sided Mirrored Doors, 3 Adjustable Glass Shelves, Removable Base Trays

GLASS SHELVES

Nubia - Slimline - Gloss White Size (mm)

RRP

w450 x h700 x d100

£322.38

Code

Description

E20326

Includes Double Sided Mirrored Doors, 3 Adjustable Glass Shelves, Removable Base Trays

Size (mm) w450 x h700 x d100

SENSOR SWITCH

Vanda - Overhead Lighting - Aluminium Code

Description

Size (mm)

E20327

Includes Single Mirrored Door, LED Lights, IP44, Infrared on/off Switch, Recharging Socket

w515 x h700 x d140

Allow 55mm Additional Height For Light Fitting

All dimensions are in mm

EB20_Book.indb 95

RRP £352.28

SENSOR SWITCH

Mackay - Slimline - Overhead Lighting - Aluminium RRP £626.61

Code

Description

E20330

Includes Double Offset Doors, LED LIghts, IP44, Infrared on/off Switch, Recharging Socket, 3 Adjustable Shelves

Size (mm) w615 x h700 x d100

RRP £635.17

Allow 55mm Additional Height For Light Fitting

Cabinets

95 18/11/2019 15:39


Cabinets / Laguna - Tulare - Rupa

LED LIGHTS

Laguna - Single Door - Aluminium Code

Description

E20342

Includes Single Mirrored Door, 2 Internal Shelves, Shaver Socket, LED Lighting, Rocker Switch

Size (mm) w510 x h650 x d135

LED LIGHTS

Laguna - Double Door - Aluminium RRP £374.69

Code

Description

E20343

Includes Double Mirrored Doors, 2 Internal Shelves, Shaver Socket, LED Lighting, Rocker Switch

Size (mm) w670 x h650 x d135

SENSOR SWITCH

Tulare - Integrated Lighting - Aluminium Code

Description

E20329

Includes Double Doors, Fluorescent Lights, IP44, IR Switch, Recharging Socket, 3 Adjustable Shelves

96 Cabinets EB20_Book.indb 96

Size (mm) w654 x h700 x d135

RRP £465.44

SENSOR SWITCH

Rupa - Integrated Lighting - Aluminium RRP £776.08

Code

Description

Size (mm)

E20328

Includes Single Mirrored Door with Inside Mirror, Fluorescent Lights, w544 x h700 x d135 Infrared on/off Switch, IP44, Recharging Socket, 3 Adjustable Shelves

RRP

£699.22

Price includes VAT

18/11/2019 15:39


Blanche - Selina - Carey / Cabinets

SOFT CLOSE

Carey - Single Door - Aluminium Code

Description

E20333

Includes Soft Close Single Door, 2 Adjustable Glass Shelves

SOFT CLOSE

Selina - Double Door - Aluminium Size (mm)

RRP

w440 x h650 x d130

£212.44

Code

Description

E20332

Includes Soft Close Doors, 2 Adjustable Glass Shelves

Size (mm) w600 x h650 x d130

RRP £297.83

KEY LOCK

Blanche - ‘Medicab’ Lockable - White Code

Description

Size (mm)

E20331

Includes 2 Keys, Optional BS5378 First Aid Label, Adjustable Shelf, LH or RH Opening

w337 x h420 x d155

All dimensions are in mm

EB20_Book.indb 97

RRP £135.58 Blanche - Medicab

Cabinets

97 18/11/2019 15:39


Cabinets / Balaton Single Door

White

Anthracite

Light Grey

COLOUR CHOICE

Balaton - Single Door Code

Finish/Colour

Size (mm)

RRP

E20334

White

w475 x h650 x d130

£184.67

E20335

Anthracite

w475 x h650 x d130

£195.35

E20336

Stone Grey

w475 x h650 x d130

£195.35

E20355

Light Grey

w475 x h650 x d130

£185.74

E20152

Dark Blue

w475 x h650 x d130

£195.35

Stone Grey

• Available in 5 colours rKPVGTPCNUJGNXGU CFLWUVCDNG • Left-handed hinges • Sleek rounded corners • Soft close door Dark Blue

98 Cabinets EB20_Book.indb 98

Price includes VAT

18/11/2019 15:39


Balaton Double Door / Cabinets

Sleek round edges

White

Anthracite

Light Grey

COLOUR CHOICE

Balaton - Double Door Code

Finish/Colour

Size (mm)

RRP

E20337

White

w600 x h650 x d130

£247.67

E20338

Anthracite

w600 x h650 x d130

£254.07

E20339

Stone Grey

w600 x h650 x d130

£254.07

E20356

Light Grey

w600 x h650 x d130

£240.19

E20153

Dark Blue

w600 x h650 x d130

£254.07

Stone Grey

• Available in 5 colours rKPVGTPCNUJGNXGU CFLWUVCDNG • Sleek rounded corners • Soft close door Dark Blue

Colour match Modular furniture available see pages 5 - 75 All dimensions are in mm

EB20_Book.indb 99

Cabinets

99 18/11/2019 15:39


Illuminated Mirrors / Enro

Mirrors

Integrated touch button

Enro Mirror Illustrated

HEATED DEMIST

.

.

.

.TOUCH BUTTON

Enro - LED Perimeter - Backlit Code

Description

Size (mm)

E20176

Demister Pad, Touch Control. Horizontal or Vertical Hung

w450 x h600

£257.89

E20177

Demister Pad, Touch Control. Horizontal or Vertical Hung

w500 x h700

£274.32

E20178

Demister Pad, Touch Control. Horizontal or Vertical Hung

w600 x h800

£306.03

E20179

Demister Pad, Touch Control. Horizontal or Vertical Hung

w1200 x h600

£405.75

100 Mirrors EB20_Book.indb 100

RRP

Price includes VAT

18/11/2019 15:39


Guri - Ora / Illuminated Mirrors

Mirror with music!

Touch sensitive controls

HEATED DEMIST

.

.

.

Guri - LED - Bluetooth Music Connection Code

Description

Size (mm)

E20345

Includes Treble LED layer Backlit Inner Frame, Demister Pad

w500 x h700

HEATED DEMIST

.

Ora (Small).'&$CEMNKV5NKO2TQƂNG RRP £503.87

Code

Description

Size (mm)

E20346

Slim Design (30mm Depth). Includes Demister Pad, Infrared on/off Switch

w450 x h700

RRP £455.83

Mirrors with demister pads for a steam-free reflection!

.

SENSOR

.SWITCH

HEATED DEMIST

SENSOR

HEATED DEMIST

.

.

.

.

.SWITCH

.

Ora (Medium).'&$CEMNKV5NKO2TQÆ‚NG Code

Description

Size (mm)

E20347

Slim Design (30mm Depth). Includes Demister Pad, Infrared on/off Switch

w600 x h800

All dimensions are in mm

EB20_Book.indb 101

Ora (Large).'&$CEMNKV5NKO2TQƂNG RRP £487.86

Code

Description

E20348

Slim Design (30mm Depth). Includes Demister Pad, Infrared on/off Switch

Size (mm) w1200 x h500

RRP £608.48

Mirrors 101 18/11/2019 15:40


Illuminated Mirrors / Nata - Kartos - Penlog

.

HEATED DEMIST

.

.

.

SENSOR

SENSOR

.

.SWITCH

Nata - Pill Shaped LED Lit Perimeter Code

Description

Size (mm)

E20412

Includes Infrared Contactless Switch, Heated Demister Pad, IP44 Rated

w500 x h800

HEATED DEMIST

.

.SWITCH

Kartos - Oval Shaped LED Lit Perimeter RRP £483.93

Code

Description

Size (mm)

E20411

Includes Infrared Contactless Switch, Heated Demister Pad, IP44 Rated

w490 x h650

RRP £403.28

Edge lit to simulate daylight

.

HEATED DEMIST

.

.

SENSOR

.SWITCH

Penlog - Circular Shaped LED Lit Perimeter Code

Description

E20410

Includes Infrared Contactless Switch, Heated Demister Pad, IP44 Rated

102 Mirrors EB20_Book.indb 102

Size (mm) 550mm Diameter

RRP

Penlog Circular Shaped LED Lit Mirror Shown

£336.26

Price includes VAT

18/11/2019 15:40


Meela - Wilton - Upton - Avon - Penti - Taupo / Illuminated Mirrors

SENSOR

.

.SWITCH

Meela - LED Frame Edge lit

Wilton - LED Backlit - Vertical Edge

Code

Description

Size (mm)

E20349

Includes Frame Edge Perimeter Lighting

w500 x h700

.

RRP £297.83

Code

Description

Size (mm)

E20319

Includes IP44, Pull Cord Switch

w450 x h700

HEATED DEMIST

.

.

RRP £204.96

HEATED DEMIST

.

Upton - LED Backlit

Avon - LED Backlit

Code

Description

Size (mm)

E20323

Includes Heated Demister Pad, IP44, Rocker Switch

w500 x h700

RRP £233.78

Code

Description

Size (mm)

E20324

Includes Heated Demister Pad, IP44, Rocker Switch

w600 x h800

RRP £269.01

HEATED DEMIST

.

.

SENSOR

HEATED DEMIST

.

.

.SWITCH

.

Penti - LED Backlit

Taupo - LED Backlit

Code

Description

Size (mm)

E20340

Includes Infrared Sensor, IP44, Heated Demister Pad

w500 x h700

All dimensions are in mm

EB20_Book.indb 103

RRP £289.30

Code

Description

Size (mm)

E20341

Includes Infrared Sensor, IP44, Heated Demister Pad

w800 x h600

RRP £322.38

Mirrors 103 18/11/2019 15:40


Illuminated Mirrors / Miranda - Darwell - Ashford - Gailey

Miranda - LED - Twin Vertical Strip Code

Description

Size (mm)

E20315

Includes Heated Demister Pad, IP44, Infrared on/off Switch, Shaver Socket

w600 x h800

Darwell - LED - Vertical Strip RRP £482.50

Description

Size (mm)

E20321

Includes Heated Demister Pad, IP44, Rocker Switch

w500 x h700

104 Mirrors EB20_Book.indb 104

Description

Size (mm)

E20320

Includes IP44, Pull Cord Switch

w450 x h600

RRP £204.96

Gailey - LED - Rectangular Strip

Ashford - LED - Rectangular Strip Code

Code

RRP £244.47

Code

Description

Size (mm)

E20322

Includes Heated Demister Pad, IP44, Rocker Switch

w600 x h800

RRP £278.62

Price includes VAT

18/11/2019 15:40


Dora - Barlee - Hillier - Dunstan / Non-Illuminated Mirrors

Dora - Bevelled - Frosted Border Code

Size (mm)

E20316

w495 x h710

Barlee - Bevelled - Mirrored Border RRP £129.18

Code

Size (mm)

E20317

w420 x h800

RRP £125.97

Dunstan - Coloured Wooden Frame Code

Hillier - Bevelled - Mirrored Border Code

Size (mm)

E20318

w405 x h595

All dimensions are in mm

EB20_Book.indb 105

RRP £104.61

Colour/Finish

Size (mm)

RRP

E20350

White

w500 x h700

£103.56

E20351

Anthracite

w500 x h700

£103.56

E20352

Stone Grey

w500 x h700

£103.56

E20353

Light Grey

w500 x h700

£103.56

E20151

Dark Blue

w500 x h700

£103.56

Mirrors 105 18/11/2019 15:40


Baths

Relax, refresh and revitalise

Baths

Standard Plus Baths Standard Shower Baths Premium Baths Freestanding Baths Premium Freestanding Baths Panels Freestanding Bath Accessories Bath Screens

106 Baths EB20_Book.indb 106

P108-111 P112-113 P114-117 P118-124 P125-127 P128 P129 P130-133

Price includes VAT

18/11/2019 15:40


#NWZWTKQWUUQCMKPCEQOHQTVCDNGDCVJVWD #VVJGGPFQH[QWTFC[PQVJKPIDGCVUCNQPIJQVUQCMKPCDCVJHQTCHGGNKPIQHTGNCZCVKQPCPF wellbeing. Our great selection of baths will allow you to take some time out and treat yourself. “A popular choice for style and function, L and P-shaped baths in addition to the more traditional straight bath styles, are a great way to maximise space with matching bath screens�

Baths EB20_Book.indb 107

107 18/11/2019 15:40


Standard Plus Baths / Laja

Laja

Single Ended Bath

NT

Y FIVE

UA

E

TWE

AR YE

25 10

G

RANT

E

Laja - Single Ended Bath Code

Description

RRP

E40053

Length 1700 x Width 700mm

£234.69

E40054

Length 1700 x Width 750mm

£282.71

E40055

Length 1800 x Width 800mm

£400.07

Laja

Double Ended Bath

NT

Y FIVE

E

TWE

UA

AR YE

25 10

G

RANT

E

Laja - Double Ended Bath Code

Description

RRP

E40056

Length 1700 x Width 700mm

£288.03

E40057

Length 1700 x Width 750mm

£346.73

E40058

Length 1800 x Width 800mm

£405.39

Bath panels available on page 128.

108 Baths EB20_Book.indb 108

Price includes VAT

18/11/2019 15:40


Risco / Standard Plus Baths

Risco

Single Ended Bath

NT

Y FI V E

UA

E

TWE

AR YE

25 10

G

RANT

E

Risco - Single Ended Bath Code

Description

RRP

E40038

Length 1500 x Width 700mm

£221.90

E40039

Length 1600 x Width 700mm

£221.90

E40040

Length 1700 x Width 700mm

£204.82

E40041

Length 1700 x Width 750mm

£282.71

E40042

Length 1800 x Width 800mm

£373.38

Risco

Double Ended Bath

NT

Y FI V E

UA

E

TWE

AR YE

25 10

G

RANT

E

Risco - Double Ended Bath Code

Description

E40043

Length 1700 x Width 700mm

£266.70

E40044

Length 1700 x Width 750mm

£320.04

E40045

Length 1800 x Width 800mm

£400.07

All dimensions are in mm

EB20_Book.indb 109

RRP

Baths 109 18/11/2019 15:40


Standard Plus Baths / Tortum

Hand grips included

Tortum

Single Ended bath

Tortum - Twin Grip - Single Ended Baths Code

Description

E40059

Length 1700 x Width 700 x 5mm Thick

£288.43

E40060

Length 1700 x Width 700 x 8mm Thick

£347.10

NT

Y FIVE

THICKNESS OPTION

E

TWE

UA

AR YE

25 10

G

RRP

RANT

E

#NN5VCPFCTF2NWU$CVJUJCXGGZVTCƂDTGINCUU reinforcing and a superior timber frame to improve strength and rigidity. Bath panels available on page 128.

110 Baths EB20_Book.indb 110

Price includes VAT

18/11/2019 15:40


Narva / Standard Plus Baths

Sleek curved design

Narva

NT

Y FI V E

UA

E

TWE

G

AR YE

25 10

Curved End Bath

RANT

E

Narva%WTXGF$CVJ.GHV*CPF 0Q6CR*QNGU

Narva%WTXGF$CVJ4KIJV*CPF 0Q6CR*QNGU

Code

Description

Code

Description

E40068

L1700 x W750mm - Left-Hand (RH Curve)

£333.57

E40069

L1700 x W750mm - Right-Hand (LH Curve)

£333.57

E40070

Reinforced Universal 1700 Curved Panel

£300.29

E40070

Reinforced Universal 1700 Curved Panel

£300.29

RRP

Total £633.86

All dimensions are in mm

EB20_Book.indb 111

RRP

Total £633.86

Baths

111 18/11/2019 15:40


Standard Shower Baths / Laja

Laja

L - Shaped Shower Bath

Left-Hand bath shown

Angular style matching ‘Glanni’ suite on page 19

Laja - 1700 Shower Bath - Left-Handed Code

Description

E40046

Length 1700 x Width 850 x Width 700mm

E40048

Universal 1700 x 3mm Bath Panel

E40052

Universal Shower Bath Screen

Laja - 1700 Shower Bath - Right-Handed RRP

Code

Description

£354.20

E40047

Length 1700 x Width 850 x Width 700mm

£97.67

E40048

Universal 1700 x 3mm Bath Panel

£228.56

E40052

Universal Shower Bath Screen

Total £680.43

Laja - 1500 Shower Bath - Left-Handed Code

Description

E40049

Length 1500 x Width 850 x Width 700mm

E40051

Universal 1500 x 3mm Bath Panel

E40052

Universal Shower Bath Screen

Y FIVE

UA

RANT

112 Baths EB20_Book.indb 112

£97.67 £228.56

Laja - 1500 Shower Bath - Right-Handed RRP

Code

Description

£354.20

E40050

Length 1500 x Width 850 x Width 700mm

£97.67

E40051

Universal 1500 x 3mm Bath Panel

£228.56

E40052

Universal Shower Bath Screen

RRP £354.20 £97.67 £228.56 Total £680.43

Code

Description

E40065

Universal 700 x 3mm End Panel

RRP £47.18

E

TWE

G

AR YE

25 10

£354.20

Total £680.43

Total £680.43 NT

RRP

E

Price includes VAT

18/11/2019 15:40


Risco / Standard Shower Baths

Risco

P - Shaped Shower Bath

Left-Hand bath shown

Extra space for showering!

Risco - 1675 Shower Bath - Left-Handed Code

Description

E40031

Length 1675 x Width 850 x Width 750mm

E40033

Universal 1675 x 3mm Bath Panel

E40037

Universal Shower Bath Screen

Risco - 1675 Shower Bath - Right-Handed RRP

Code

Description

£333.70

E40032

Length 1675 x Width 850 x Width 750mm

£93.22

E40033

Universal 1675 x 3mm Bath Panel

£201.94

E40037

Universal Shower Bath Screen

Total £628.87

Risco - 1500 Shower Bath - Left-Handed Code

Description

E40034

Length 1500 x Width 850 x Width 750mm

E40036

Universal 1500 x 3mm Bath Panel

E40037

Universal Shower Bath Screen

RRP

Y FIVE

RANT

Code

Description

£333.70

E40035

Length 1500 x Width 850 x Width 750mm

£93.22

E40036

Universal 1500 x 3mm Bath Panel

£201.94

E40037

Universal Shower Bath Screen

RRP £333.70 £93.22 £201.94 Total £628.87

Code

Description

E40066

Universal 750 x 3mm End Panel

RRP £47.18

E

All dimensions are in mm

EB20_Book.indb 113

£201.94

E

TWE

AR YE

UA

£93.22

Risco - 1500 Shower Bath - Right-Handed

25 10

G

£333.70

Total £628.87

Total £628.87 NT

RRP

Baths 113 18/11/2019 15:40


Premium Baths / Arco Puracast

Handy built-in, integral shelf

Arco

P-Shaped Premium Shower Bath Left-Hand bath shown

Arco - 1700 P-Shaped Shower Bath - Left-Handed

Arco - 1700 P-Shaped Shower Bath - Right-Handed

Code

Description

Code

Description

PBSBLH17

Length 1700 x Width 850 x Width 700mm

£508.00

PBSBRH17

Length 1700 x Width 850 x Width 700mm

£508.00

PBSBLHP

1700 Shower Bath Side Panel

£170.00

PBSBRHP

1700 Shower Bath Side Panel

£170.00

PBSBS

Shower Bath Screen (reversible)

£255.00

PBSBS

Shower Bath Screen (reversible)

£255.00

RRP

Total £933.00

RRP

Total £933.00

Arco - 1500 P-Shaped Shower Bath - Left-Handed

Arco - 1500 P-Shaped Shower Bath - Right-Handed

Code

Description

Code

Description

PBSBLH15

Length1500 x Width 850 x Width 700mm

£495.00

PBSBRH15

Length 1500 x Width 850 x Width 700mm

£495.00

PBSBLHP15

1500 Shower Bath Side Panel

£170.00

PBSBRHP15

1500 Shower Bath Side Panel

£170.00

PBSBS

Shower Bath Screen (reversible)

£255.00

PBSBS

Shower Bath Screen (reversible)

£255.00

TY FIVE

E

TWE

UA

Total £920.00

RRP

Total £920.00

AR YE

25 10

G

N

RRP

RANT

114 Baths EB20_Book.indb 114

E

Code

Description

PB700EP

Reinforced 700mm End Panel

RRP £72.00

Price includes VAT

18/11/2019 15:40


Wave Puracast / Premium Baths

Wave

NT

Y FI V E

UA

E

TWE

G

AR YE

25 10

Premium Bath

RANT

E

Double ended bath shown

Wave5KPING'PFGF$CVJ 0Q6CR*QNGU Code

Description

PBSE17X7

Length 1700 x Width 700mm

PBSE17X75

Length 1700 x Width 750mm

Wave&QWDNG'PFGF$CVJ 0Q6CR*QNGU RRP

Code

Description

RRP

£399.00

PBDE17X75

Length 1700 x Width 750mm

£459.00

£459.00

PBDE18X80

Length 1800 x Width 800mm

£529.00

Bath panels available on page 128.

All Puracast Premium Baths Include: rOO.WEKVGYKVJNC[GTUQHTGUKPDQPFGFÆ‚DTGINCUUGPECRUWNCVKQPHQTUVTGPIVJCPFTKIKFKV[ r5QNKFEQTGTGKPHQTEKPI WRVQOO KPURGEKÆ‚EMG[CTGCUKORTQXGUUVTGPIVJCPFFWTCDKNKV[ All dimensions are in mm

EB20_Book.indb 115

Baths 115 18/11/2019 15:40


Premium Baths / Bloque Puracast

8 different sizes available

Bloque Premium Bath

Bloque5KPING'PFGF$CVJ 0Q6CR*QNGU PBBQSE13X7

Length 1300 x Width 700mm

PBBQSE14X7

Code

Description

£395.00

PBBQDE17X75

Length 1700 x Width 750mm

£470.00

Length 1400 x Width 700mm

£399.00

PBBQDE18X80

Length 1800 x Width 800mm

£530.00

PBBQSE15X7

Length 1500 x Width 700mm

£410.00

PBBQSE16X7

Length 1600 x Width 700mm

£420.00

PBBQSE17X7

Length 1700 x Width 700mm

£435.00

PBBQSE17X75

Length 1700 x Width 750mm

£485.00

EB20_Book.indb 116

RRP

NT

Y FIVE

25 10

G

UA

AR YE

116 Baths

RRP

E

Description

TWE

Code

Bloque&QWDNG'PFGF$CVJ 0Q6CR*QNGU

RANT

E

Price includes VAT

18/11/2019 15:41


Platto Puracast / Premium Baths

Platto

NT

Y FI V E

UA

E

TWE

AR YE

25 10

G

Premium Bath

RANT

E

Single ended bath shown

Platto5KPING'PFGF$CVJ 0Q6CR*QNGU Code

Description

PBPLSE1675X7

Length 1675 x Width 700mm

Platto&QWDNG'PFGF$CVJ 0Q6CR*QNGU RRP £435.00

Code

Description

PBPLDE1675X75

Length 1675 x Width 750mm

RRP £454.70

Bath panels available on page 128.

All Puracast Premium Baths Include: rOO.WEKVGYKVJNC[GTUQHTGUKPDQPFGFÆ‚DTGINCUUGPECRUWNCVKQPHQTUVTGPIVJCPFTKIKFKV[ r5QNKFEQTGTGKPHQTEKPI WRVQOO KPURGEKÆ‚EMG[CTGCUKORTQXGUUVTGPIVJCPFFWTCDKNKV[ All dimensions are in mm

EB20_Book.indb 117

Baths 117 18/11/2019 15:41


Freestanding Baths / Wilmslow - Brentwood

Wilmslow Double Ended Bath

Wilmslow - Double Ended Bath Code

Description

RRP

SY-FSB301

Length 1695 x w755 x h620mm (including feet)

£728.57

SY-FSB302

Length 1795 x w785 x h620mm (including feet)

£768.57

12mm THICK

Brentwood Slipper Bath

Brentwood - Slipper Bath Code

Description

SY-FSB303

Length 1555 x w725 x h775mm (including feet)

£728.57

SY-FSB304

Length 1685 x w725 x h775mm (including feet)

£768.57

118 Baths EB20_Book.indb 118

RRP

12mm THICK

Price includes VAT

18/11/2019 15:41


Cambridge - Marlow / Freestanding Baths

Cambridge Single Ended Bath

Cambridge - Single Ended Bath Code

Description

RRP

SY-FSB305

Length 1470 x w735 x h635mm (including feet)

£768.57

SY-FSB306

Length 1780 x w800 x h635mm (including feet)

£768.57

12mm THICK

Marlow

Double Ended Slipper Bath

Subtle period styling Marlow - Double Ended Slipper Bath Code

Description

RRP

SY-FSB307

Length 1750 x w730 x h770mm (including feet)

All dimensions are in mm

EB20_Book.indb 119

£768.57

12mm THICK

Baths

119 18/11/2019 15:41


Freestanding Baths / San Marlo

San Marlo

Modern Freestanding Bath

San Marlo - Modern Freestanding Bath Code

Description

SY-FSB201

Length 1555 x w745 x h580mm

£985.71

SY-FSB202

Length 1655 x w750 x h580mm

£985.71

SY-FSB203

Length 1800 x w750 x h580mm

£1,082.86

Our most popular freestanding bath

RRP

Requires Standard Waste

120 Baths EB20_Book.indb 120

Price includes VAT

18/11/2019 15:41


Kingston - Lido / Freestanding Baths

Kingston

Modern Freestanding Bath

Kingston - Modern Freestanding Bath Code

Description

SY-FSB205

Length 1700 x w765 x h580mm

RRP ÂŁ1,082.86

Requires Standard Waste

Lido

Modern Freestanding Bath

Lido - Modern Freestanding Bath Code

Description

SY-FSB404

Length 1705 x w800 x h580mm

RRP ÂŁ1,185.71

Requires Standard Waste

All dimensions are in mm

EB20_Book.indb 121

Baths

121 18/11/2019 15:41


Freestanding Baths / Arruba - Pebble

Arruba

Modern Freestanding Bath

Arruba - Modern Freestanding Bath Code

Description

SY-FSB204

Length 1600 x w725 x h740mm

RRP £1,082.86

Includes Waste

Pebble

Modern Freestanding Bath

Pebble - Modern Freestanding Bath Code

Description

SY-FSB308

Length 1660 x w850 x h610mm

RRP £1,311.43

Includes Waste

122 Baths EB20_Book.indb 122

Price includes VAT

18/11/2019 15:41


Ibiza - Boat / Freestanding Baths

Ibiza

Modern Freestanding Bath

Ibiza - Modern Freestanding Bath Code

Description

SY-FSB207

Length 1830 x w720 x h730mm

RRP £1,082.86

Includes Waste

Boat

Freestanding Bath

Boat - Freestanding Bath Code

Description

SY-FSB310

Length 1770 x w785 x h740mm

RRP

Classic design

£1,082.86

Requires Standard Waste

All dimensions are in mm

EB20_Book.indb 123

Baths

123 18/11/2019 15:41


Freestanding Baths / Slipper

Slipper

Also avaible in Black

Freestanding Bath

Shown in White

Slipper - Modern Freestanding Bath - White Code

Description

SY-FSB309

Length 1750 x w760 x h870mm

Slipper - Modern Freestanding Bath - Black RRP

£1,282.86

Code

Description

SY-FSB309BLK

Length 1750 x w760 x h870mm

RRP £1,311.43

Slipper Baths Require a Solid Clip Waste

124 Baths EB20_Book.indb 124

Price includes VAT

18/11/2019 15:41


Essence / Premium Freestanding Baths

Essence

Premium Freestanding Bath

Available in 2 sizes

NT

Y FIVE

E

TWE

UA

AR YE

25 10

G

RANT

E

Essence - 1500 Modern Freestanding Bath Code

Description

PB109

Length 1500 x w640 x h600mm

Essence - 1700 Modern Freestanding Bath RRP £1,090.00

Code

Description

PB108

Length 1700 x w690 x h600mm

RRP £1,200.00

Essence Baths Require a Separate Recommended Waste

All dimensions are in mm

EB20_Book.indb 125

Baths

125 18/11/2019 15:41


Premium Freestanding Baths / Arco

Arco

Premium Freestanding Bath

Description

PB106

Length 1700 x w790 x h590mm

25 10

TWE

RRP £1,350.00

Y FIVE

G

UA

E

Code

NT

AR YE

Arco - Premium Freestanding Bath

RANT

E

Requires Separate Recommended Waste

126 Baths EB20_Book.indb 126

Price includes VAT

18/11/2019 15:41


Platto / Premium Freestanding Baths

Platto

Premium Freestanding Bath

Description

PB1014

Length1700 x w810 x h580mm

25 10

TWE

RRP £1,300.00

Y FIVE

G

UA

E

Code

NT

AR YE

Platto - Premium Freestanding Bath

RANT

E

‘Wow-factor’ bath fillers available - page 147

Requires Standard Waste

All Puracast Premium Baths Include: rOO.WEKVGYKVJNC[GTUQHTGUKPDQPFGFƂDTGINCUUGPECRUWNCVKQPHQTUVTGPIVJCPFTKIKFKV[ r5QNKFEQTGTGKPHQTEKPI WRVQOO KPURGEKƂEMG[CTGCUKORTQXGUUVTGPIVJCPFFWTCDKNKV[ All dimensions are in mm

EB20_Book.indb 127

Baths

127 18/11/2019 15:41


Bath Panels

Front Panel - Universal

End Panel - Universal

Code

Description

Finish

E40064

1500mm Side Panel (3mm Thickness)

White

E40063

1600mm Side Panel (3mm Thickness)

E40062 E40061

RRP

Code

Description

Finish

£83.24

E40065

700mm End Panel (3mm Thickness)

White

£47.18

White

£83.24

E40066

750mm End Panel (3mm Thickness)

White

£47.18

1700mm Side Panel (3mm Thickness)

White

£83.24

E40067

800mm End Panel (3mm Thickness)

White

£47.18

1800mm Side Panel (3mm Thickness)

White

£111.00

Bath Front Panel & Plinth

RRP

Bath Front Panel & Plinth

Code

Description

Finish

352875WT

DLX 1700mm (15mm Thickness)

White

352876WT

DLX 1800mm (15mm Thickness)

White

RRP

Code

Description

Finish

RRP

£109.98

352877WT

DLX 700mm (15mm Thickness)

White

£64.99

£129.10

352878WT

DLX 800mm (15mm Thickness)

White

£74.96

Front of panel

Back of panel

Reinforced Front Panel

Reinforced End Panel

Code

Description

Finish

352873WT

1700mm Front Panel

White

RRP £64.55

Puracast Front Panel Description

Finish

PB1700SP

Puracast 1700mm Front Panel

White

PB1800SP

Puracast 1800mm Front Panel

White

EB20_Book.indb 128

Description

Finish

RRP

352879WT

700mm End Panel

White

£43.02

352874WT

800mm End Panel

White

£43.02

Puracast End Panel

Code

128 Bath Panels

Code

RRP

Code

Description

Finish

RRP

£145.00

PB700EP

Puracast 700mm End Panel

White

£72.00

£176.00

PB750EP

Puracast 750mm End Panel

White

£79.00

PB800EP

Puracast 800mm End Panel

White

£85.00

Price includes VAT

18/11/2019 15:41


Freestanding Bath Accessories

Stowaway Bath Waste Code

Description

352854

1 ½” - Exposed

Standard Pop-up Bath Waste RRP £131.23

Code

Description

352855

1 ½” - Exposed

Chain Waste Kit Description

352864

Includes Waste, P Trap and Telescopic Pipe Shrouds - Exposed

RRP £380.80

Ultra Shallow P Trap Description

352859

1 ½” - Exposed

£207.32

Code

Description

352856

1 ½” - Exposed

RRP £222.83

Code

Description

352863

Exposed

RRP £80.43

5JCNNQY'ZRQUGF26TCR RRP £53.61

All dimensions are in mm

EB20_Book.indb 129

RRP

Outlet Waste Pipe

Code

Code

Click Clack Bath Waste

Code

Description

352860

1 ½” - Exposed

RRP £53.61

Bath Accessories

129 18/11/2019 15:41


Bath Screens / Esteem 8

Bath Screens

Esteem 8 Curved top

Code

Description

Size (mm)

Adjustment

E50128 E50127

Curved Top Bath Screen with Chrome Frame

w800 x h1400

775-800

£382.46

Square Top Bath Screen with Chrome Frame

w800 x h1500

775-800

£403.97

LIF

ETIME

10

LIFETIME G

UA

8mm GLASS

E RANT

• Toughened safety glass

• 180 degree wall hinge

• Reversible

r%QPEGCNGFƂZKPIU

• Polished Aluminium

• 25mm adjustment

130 Bath Screens EB20_Book.indb 130

RRP

E

Esteem - Bath Screen - 8mm

Square top

EASY CLEAN GLASS

Price includes VAT

18/11/2019 15:41


Esteem 6 / Bath Screens

Functional integrated towel rail

Esteem 6 Esteem - Angled Bath Screen - 6mm Description

E50172

Angled Bath Screen with Silver Frame includes Rail

Size (mm)

Adjustment

w850 x h1500

850-875

Not recommended for use with pumped or pressurised systems

RRP £262.56

ETIME

10

LIFETIME G

UA

6mm GLASS

E

Code

LIF

RAN

TE

• Frameless with radius glass

• Ultracare glass protection system

• Reversible

r5WKVCDNGHQTUVCPFCTFDCVJOKZGTCPFGNGEVTKEUJQYGTU

• Rotates 180º for access All dimensions are in mm

EB20_Book.indb 131

Bath Screens

131 18/11/2019 15:41


Bath Screens / Esteem 6

Esteem 6 Inward Folding Bath Screen

Code

Description

E50176

Clear Glass with Silver Frame

LIF

10

w910 x h1500

880-905

RRP £358.12

Code

Description

E50175

Clear Glass with Silver Frame

LIF

6mm GLASS

E

UA

Adjustment

ETIME

LIFETIME G

Size (mm)

Esteem - Power Shower Bath Screen - 6mm

E RANT

POWER SHOWER PROOF

10

LIFETIME G

UA

Size (mm)

Adjustment

w820 x h1500

810-835

RRP £288.60

ETIME

6mm GLASS

E

Esteem - Inward Folding Bath Screen - 6mm

Power Shower Bath Screen

E RANT

POWER SHOWER PROOF

• Frameless with radius glass

• Frameless with square glass

• Reversible

• Reversible

• Ultracare glass protection system

• Unique sealing system • Ultracare glass protection system

132 Bath Screens EB20_Book.indb 132

Price includes VAT

18/11/2019 15:41


Esteem 5 / Bath Screens

Esteem 5 Curved top

Square top

Code

Description

Size (mm)

Adjustment

E50173 E50174

RRP

Curved Top Bath Screen - Clear Glass with Silver Frame

w820 x h1360

810-825

£141.13

Square Top Bath Screen - Clear Glass with Silver Frame

w820 x h1360

810-825

£141.13

LIF

ETIME

10

LIFETIME G

UA

E

Esteem - Bath Screen - 5mm

RANT

E

Not recommended for use with pumped or pressurised systems

• Frameless with radius or square glass

• Glass thickness: 5mm

• Ultracare glass protection system

• Reversible

r5WKVCDNGHQTUVCPFCTFDCVJOKZGTGNGEVTKEUJQYGTU

• Rotates 180º for access

All dimensions are in mm

EB20_Book.indb 133

Bath Screens

133 18/11/2019 15:41


Fantastic ďŹ nishes

Taps Bathroom Taps Kitchen Taps Wastes

EB20_Book.indb 134

P136-149 P150-153 P154-155

18/11/2019 15:41


Striking creations, crafted to perfection Taps are a crucial highlight of your bathroom or kitchen. Our range is designed to enhance the appearance of any room. “A minimalist look with a slim, high-rise tap combined with a vessel basin will create a contemporary designer feel� Taps EB20_Book.indb 135

135 18/11/2019 15:41


Bathroom Taps / Aira

Aira

N YEAR TE

G

Aira/QPQ$CUKP/KZGT%NKEM9CUVG Operating Pressure

Description

E60051

Mono Basin Mixer - Click Waste

HP

£154.00

E60052

Mini Mono Basin Mixer - Click Waste

HP

£140.00

RRP

Aira - 2 Hole Bath Filler Description

E60054

2 Hole Bath Filler

136 Taps EB20_Book.indb 136

RANT

E

Aira6CNN/QPQ$CUKP/KZGT%NKEM9CUVG

Code

Code

UA

E

10

Bathroom Taps

Code

Description

E60053

Tall Mono Basin Mixer - Click Waste

Operating Pressure HP

RRP £185.00

Aira - 4 Hole Bath Filler Operating Pressure HP

RRP £167.00

Code

Description

E60055

4 Hole Bath Filler

Operating Pressure HP

RRP £334.00

Price includes VAT

18/11/2019 15:41


Risco Blade / Bathroom Taps

Risco Blade

N YEAR TE

G

Risco Blade/QPQ$CUKP/KZGT%NKEM9CUVG Code

Description

Operating Pressure

E60061

Mini Mono Basin Mixer - Click Waste

LP

E60060

Mono Basin Mixer - Click Waste

LP

Description

Operating Pressure

E60064

2 Hole Pillar Pattern Bath Filler

HP

All dimensions are in mm

EB20_Book.indb 137

RANT

E

Risco Blade - Basin/Bath Taps RRP

Code

Description

£100.00

E60062

Basin Pillar Tap Pair

LP

£91.00

£111.00

E60063

Bath Pillar Taps (Pair)

LP

£106.00

Risco Blade - 2 Hole Pillar Pattern Bath Filler Code

UA

E

10

Bathroom Taps

Operating Pressure

RRP

Risco Blade*QNG$CVJ5JQYGT/KZGT RRP £163.00

Code

Description

E60065

2 Hole Bath & Shower Mixer

Operating Pressure HP

RRP £208.00

Taps

137 18/11/2019 15:41


Bathroom Taps / Risco

Risco

N YEAR TE

G

Risco/QPQDNQE$CUKP/KZGT%NKEM9CUVG Code

Description

Operating Pressure

E60037

Mini Monobloc Basin Mixer - Click Waste

LP

E60038

Monobloc Basin Mixer - Click Waste

LP

Description

E60041

2 Hole Leg Bath Filler

138 Taps EB20_Book.indb 138

RANT

E

Risco - Basin/Bath Taps RRP

Code

Description

£100.00

E60039

Basin Taps (Pair)

LP

£91.00

£111.00

E60040

Bath Taps (Pair)

LP

£106.00

Risco - 2 Hole Leg Bath Filler Code

UA

E

10

Bathroom Taps

Operating Pressure

RRP

Risco*QNG.GI$CVJ5JQYGT/KZGT-KV

Operating Pressure HP

RRP £163.00

Code

Description

E60042

2 Hole Leg Bath Shower Mixer & Kit

Operating Pressure HP

RRP £208.00

Price includes VAT

18/11/2019 15:41


Vettis / Bathroom Taps

Luxurious, cascading waterfall design

Vettis

N YEAR TE

G

Vettis/QPQ$CUKP/KZGT%NKEM9CUVG Operating Pressure

Description

E60067

Mini Mono Basin Mixer - Click Waste

LP/HP

£118.00

E60066

Mono Basin Mixer - Click Waste

LP/HP

£127.00

RRP

Vettis - 2 Hole Bath Filler Description

E60069

2 Hole Bath Filler

E

Code

Description

E60068

3 Hole Bath Filler

Operating Pressure

RRP

HP

£248.00

Vettis*QNG$CVJ5JQYGT/KZGT Operating Pressure LP/HP

All dimensions are in mm

EB20_Book.indb 139

RANT

Vettis - 3 Hole Bath Filler

Code

Code

UA

E

10

Bathroom Taps

RRP £203.00

Code

Description

E60070

2 Hole Bath & Shower Mixer

Operating Pressure LP/HP

RRP £220.00

Taps

139 18/11/2019 15:42


Bathroom Taps / Canim

Sleek minimalist design

Canim

N YEAR TE

G

Canim/QPQDNQE$CUKP/KZGT%NKEM9CUVG Code

Description

Operating Pressure

E60056

Monobloc Basin Mixer & Click Waste

LP/HP

Description

E60058

2 Hole Bath Filler

140 Taps EB20_Book.indb 140

RANT

E

Canim6CNN/QPQ$CUKP/KZGT%NKEM9CUVG RRP £118.00

Canim - 2 Hole Bath Filler Code

UA

E

10

Bathroom Taps

Code

Description

E60057

Tall Mono Basin Mixer & Click Waste

Operating Pressure LP/HP

RRP £158.00

Canim*QNG$CVJ5JQYGT/KZGT-KV Operating Pressure LP/HP

RRP £172.00

Code

Description

E60059

2 Hole Bath Shower Mixer & Kit

Operating Pressure LP/HP

RRP £217.00

Price includes VAT

18/11/2019 15:42


Laja / Bathroom Taps

Laja

N YEAR TE

G

Laja/QPQDNQE$CUKP/KZGT%NKEM9CUVG Code

Description

Operating Pressure

E60032

Monobloc Basin Mixer - Click Waste

LP

Description

E60035

2 Hole Bath Filler

E

RRP £118.00

Code

Description

Operating Pressure

RRP

E60033

Basin Taps (Pair)

LP

£104.00

E60034

Bath Taps (Pair)

LP

£115.00

Laja*QNG$CVJ5JQYGT/KZGT-KV Operating Pressure LP

All dimensions are in mm

EB20_Book.indb 141

RANT

Laja - Basin/Bath Taps

Laja - 2 Hole Bath Filler Code

UA

E

10

Bathroom Taps

RRP £167.00

Code

Description

E60036

2 Hole Bath Shower Mixer & Kit

Operating Pressure LP

RRP £212.00

Taps

141 18/11/2019 15:42


Bathroom Taps / Narva

Our best selling range of taps!

Narva

N YEAR TE

G

Narva/QPQDNQE$CUKP/KZGT%NKEM9CUVG Code

Description

Operating Pressure

E60020

Mini Monobloc Basin Mixer - Click Waste

LP

E60021

Monobloc Basin Mixer - Click Waste

LP

Description

E60025

2 Hole Leg Bath Filler

142 Taps EB20_Book.indb 142

RANT

E

Narva - Basin/Bath Taps RRP

Code

Description

£85.00

E60023

Basin Taps (Pair)

LP

£82.00

£94.00

E60024

Bath Taps (Pair)

LP

£97.00

Narva - 2 Hole Leg Bath Filler Code

UA

E

10

Bathroom Taps

Operating Pressure

RRP

Narva*QNG.GI$CVJ5JQYGT/KZGT-KV

Operating Pressure LP

RRP £120.00

Code

Description

E60026

2 Hole Leg Bath Shower Mixer & Kit

Operating Pressure LP

RRP £167.00

Price includes VAT

18/11/2019 15:42


Mina / Bathroom Taps

Mina

N YEAR TE

G

Mina/QPQDNQE$CUKP/KZGT%NKEM9CUVG Code

Description

Operating Pressure

E60027

Monobloc Basin Mixer & Click Waste

LP

Description

E60030

2 Hole Deck Bath Filler

E

RRP £113.00

Code

Description

Operating Pressure

RRP

E60028

Basin Taps (Pair)

LP

£73.00

E60029

Bath Taps (Pair)

LP

£91.00

Mina&GEM$CVJ5JQYGT/KZGT-KV

Operating Pressure LP

All dimensions are in mm

EB20_Book.indb 143

RANT

Mina - Basin/Bath Taps

Mina - 2 Hole Deck Bath Filler Code

UA

E

10

Bathroom Taps

RRP £163.00

Code

Description

E60031

2 Deck Bath Shower Mixer & Kit

Operating Pressure LP

RRP £226.00

Taps

143 18/11/2019 15:42


Bathroom Taps / Tortum

Tortum

N YEAR TE

G

Tortum/QPQDNQE$CUKP/KZGT%NKEM9CUVG Code

Description

Operating Pressure

E60008

Mini Monobloc Basin Mixer & Click Waste

LP

E60009

Monobloc Basin Mixer & Click Waste

LP

Description

E60012

Deck Bath Filler

144 Taps EB20_Book.indb 144

RANT

E

Tortum - Basin/Bath Taps RRP

Code

Description

£64.00

E60010

Basin Taps (Pair)

LP

£50.00

£62.00

E60011

Bath Taps (Pair)

LP

£61.00

Tortum - Deck Bath Filler Code

UA

E

10

Bathroom Taps

Operating Pressure

RRP

Tortum&GEM$CVJ5JQYGT/KZGT-KV Operating Pressure LP

RRP £86.00

Code

Description

E60013

Deck Bath Shower Mixer & Kit

Operating Pressure LP

RRP £122.00

Price includes VAT

18/11/2019 15:42


Trenton / Bathroom Taps

Trenton

N YEAR TE

G

Trenton/QPQ$CUKP/KZGT%NKEM9CUVG Code

Description

Operating Pressure

E60014

Mini Mono Basin Mixer & Click Waste

LP

E60015

Mono Basin Mixer & Click Waste

LP

Description

E60018

Deck Bath Filler

E

RRP

Code

Description

Operating Pressure

RRP

£82.00

E60016

Basin Taps (Pair)

LP

£61.00

£95.00

E60017

Bath Taps (Pair)

LP

£77.00

Trenton&GEM$CVJ5JQYGT/KZGT-KV Operating Pressure LP

All dimensions are in mm

EB20_Book.indb 145

RANT

Trenton - Basin/Bath Taps

Trenton - Deck Bath Filler Code

UA

E

10

Bathroom Taps

RRP £118.00

Code

Description

E60019

Deck Bath Shower Mixer & Kit

Operating Pressure LP

RRP £163.00

Taps

145 18/11/2019 15:42


Bathroom Taps / Kisdon

Kisdon

N YEAR TE

G

Kisdon/QPQ$CUKP/KZGT%NKEM9CUVG Operating Pressure

Description

E60072

Mini Mono Basin Mixer & Click Waste

LP/HP

£118.00

E60071

Mono Basin Mixer & Click Waste

LP/HP

£127.00

RRP

Kisdon - 2 Hole Bath Filler Description

E60074

2 Hole Bath Filler

146 Taps EB20_Book.indb 146

RANT

E

Kisdon - 3 Hole Bath Filler

Code

Code

UA

E

10

Bathroom Taps

Code

Description

E60073

3 Hole Bath Filler

Minimum Operating Pressure HP

RRP £248.00

Kisdon*QNG$CVJ5JQYGT/KZGT

Minimum Operating Pressure LP/HP

RRP £203.00

Code

Description

E60075

2 Hole Bath & Shower Mixer

Minimum Operating Pressure LP/HP

RRP £293.00

Price includes VAT

18/11/2019 15:42


Blos - Risco - Nachi - Alamar / Bathroom Taps

N YEAR TE

N YEAR TE

RANT

E

Description

E60076

Wall Mounted Basin Mixer & Click Waste

Operating Pressure

RRP

LP

£213.00

Blos - Wall Mounted Bath Filler Code

Description

E60077

Wall Mounted Bath Filler

UA

E

RANT

Risco9CNN/QWPVGF$CUKP/KZGT

Blos9CNN/QWPVGF$CUKP/KZGT Code

G

E

UA

E

10

10

G

Code

Description

Operating Pressure

E60079

Wall Mounted Basin Mixer & Click Waste

RRP

LP

£208.00

Risco - Wall Mounted Bath Filler

Operation Pressure

RRP

LP

£208.00

Code

Description

E60080

Wall Mounted Bath Filler

Operation Pressure

RRP

LP

£203.00

Suitable for freestanding baths

N YEAR TE

N YEAR TE

10

G

E

UA

RANT

E

UA

E

10

G

RANT

E

Nachi(NQQT/QWPVGF$CVJ5JQYGT/KZGT-KV

Alamar(NQQT/QWPVGF$CVJ5JQYGT/KZGT-KV

Code

Description

Code

Description

E60078

Bath Shower Mixer & Kit

E60081

Bath Shower Mixer & Kit

Operating Pressure LP

All dimensions are in mm

EB20_Book.indb 147

RRP £653.00

Operating Pressure LP

RRP £653.00

Taps

147 18/11/2019 15:42


Bathroom Taps / Belmore

Belmore

N YEAR TE

G

Belmore - Basin Taps Code

Description

E60047

Basin Taps (Pair) - 1/2

UA

RANT

Operating Pressure LP

RRP £86.00

Code

Description

E60048

Bath Taps (Pair)

Operating Pressure LP

Belmore*QNG$CVJ5JQYGT/KZGT-KV

Code

Description

Code

Description

E60049

Monobloc Basin Mixer & Pop-Up Waste

E60050

2 Hole Bath Shower Mixer & Kit

EB20_Book.indb 148

E

Belmore - Bath Taps

Belmore/QPQDNQE$CUKP/KZGT2QR7R9CUVG

148 Taps

E

10

Bathroom Taps

Operating Pressure LP

RRP £158.00

Operating Pressure LP

RRP £109.00

RRP £428.00

Price includes VAT

18/11/2019 15:42


Emperor / Bathroom Taps

Emperor

N YEAR TE

G

Emperor/QPQDNQE$CUKP/KZGT Code

Description

E60043

Monobloc Basin Mixer

LP

RRP £79.00

Emperor - Bath Taps Description

E60045

Bath Taps (Pair)

E

Code

Description

E60044

Basin Taps (Pair)

Operating Pressure

RRP

LP

£52.00

Emperor - 2KNNCT/QWPVGF$CVJ5JQYGT/KZGT-KV Operating Pressure LP

All dimensions are in mm

EB20_Book.indb 149

RANT

Emperor - Basin Taps

Operating Pressure

Code

UA

E

10

Bathroom Taps

RRP £59.00

Code

Description

E60046

Pillar Mounted Bath Shower Mixer & Kit

Operating Pressure LP

RRP £208.00

Taps

149 18/11/2019 15:42


Kitchen Taps

150 Kitchen Taps EB20_Book.indb 150

Price includes VAT

18/11/2019 15:42


Emperor - Dawson - Trenton - Mina / Kitchen Taps

N YEAR TE

N YEAR TE

E

RANT

E60084

Operating Pressure

Finish

LP

Chrome

RRP £73.00

Code E60083

Operating Pressure

Finish

LP

Chrome

RANT

E60082

Finish

LP

Chrome

All dimensions are in mm

EB20_Book.indb 151

10

E

Emperor/QPQDNQE-KVEJGP/KZGT

£93.00

G

E

UA

RRP

N YEAR TE

10

G

Operating Pressure

E

RANT

Dawson/QPQDNQE-KVEJGP/KZGT

N YEAR TE

Code

UA

UA

E

Trenton/QPQDNQE-KVEJGP/KZGT Code

10

G

E

UA

E

10

G

RANT

E

Mina/QPQDNQE-KVEJGP/KZGT RRP £62.00

Code E60085

Operating Pressure

Finish

LP

Chrome

RRP £111.00

Kitchen Taps

151 18/11/2019 15:42


Kitchen Taps / Inca - Narva - Nurst - Laja

N YEAR TE

N YEAR TE

G

E

RANT

E

Inca/QPQDNQE-KVEJGP/KZGT%GTCOKE*CPFNGU

Narva/QPQDNQE-KVEJGP/KZGT

Code

Code

Operating Pressure

Finish

LP

Chrome

E60086

RRP £109.00

Operating Pressure

Finish

LP

Chrome

E60087

N YEAR TE

RANT

Code

Operating Pressure

Finish

LP

Chrome

E60088

152 Kitchen Taps EB20_Book.indb 152

£118.00

10

E

Nurst/QPQDNQE-KVEJGP/KZGT

E

RRP

G

E

UA

RANT

N YEAR TE

10

G

UA

UA

E

UA

E

10

10

G

RANT

E

Laja/QPQDNQE-KVEJGP/KZGT RRP £109.00

Code

Operating Pressure

Finish

HP

Chrome

E60089

RRP £122.00

Price includes VAT

18/11/2019 15:42


Pertes - Risco - Belon - Avip / Kitchen Taps

N YEAR TE

N YEAR TE

E

RANT

Finish

E60104

MP

Brushed Nickel

£173.55

E60103

MP

Chrome

£132.70

RRP

Code

Operating Pressure

Finish

E60095

LP

Brushed Nickel

£181.00

E60090

LP

Chrome

£140.00

N YEAR TE

RANT

E

Belon/QPQDNQE-KVEJGP/KZGT E60105

Finish

MP

Chrome

All dimensions are in mm

EB20_Book.indb 153

10

G

E

UA

RRP

N YEAR TE

10

G

Operating Pressure

E

RANT

Risco/QPQDNQE-KVEJGP/KZGT

Operating Pressure

Code

UA

UA

E

Pertes/QPQDNQE-KVEJGP/KZGT Code

10

G

E

UA

E

10

G

RANT

E

Avip - /QPQDNQE-KVEJGP/KZGT(NGZK5KNKEQPG5RQWV RRP £159.27

Code

Operating Pressure

Finish

RRP

E60107

MP

Brushed Nickel

£245.02

E60106

MP

Chrome

£224.58

Kitchen Taps

153 18/11/2019 15:42


Wastes

Mushroom Clicker Basin Waste Code

Description

Spring Plug Basin Waste RRP

Code

Description

Slotted Flip Top Basin Waste RRP

Code

Description

Solid Flip Top Basin Waste RRP

Code

Description

RRP

Slotted 201314 - EST 1 1/4" ÂŁ26.83 Chrome Plated Solid ÂŁ28.83 201317 - EST 1 1/4" Chrome Plated

Slotted 201753 - EST 1 1/4� £22.61 Chrome Plated Solid £24.44 201773 - EST 1 1/4� Chrome Plated

1 1/4" 201877 - EST ÂŁ23.44 Chrome Plated

1 1/4" 201876 - EST ÂŁ24.61 Chrome Plated

Pop-Up Combi Bath Waste

Clicker Plug Combi Bath Waste

Brass Plug Combi Bath Waste

Tidy Plug Combi Bath Waste

Code

Description

RRP

1 1/2� 201830 - EST ZLWK2YHUŴRZ £44.00 Chrome Plated

154 Wastes EB20_Book.indb 154

Code

Description

RRP

1 1/2" 201995 - EST ZLWK2YHUĹ´RZ ÂŁ47.44 Chrome Plated

Code

Description

RRP

1 1/2� 201760 - EST £18.06 Chrome Plated

Code

Description

201116- EST

1 1/2� ZLWK2YHUŴRZ £23.33 Chrome Plated

RRP

Price includes VAT

18/11/2019 15:42


Wastes

Slotted Brass Plug & Chain - Basin Waste

Square Bottle Trap Brass

Code

Code

Description

RRP

Description

Brass Bottle Trap Traditional RRP

Code

Description

Brass Bottle Trap Modern RRP

Code

Description

RRP

1 1/4� Includes 201243 - EST £17.94 Chain & Stay, Chrome Plated

1 1/4" 300mm Externa & 202163 - EST ÂŁ78.08 Wall Flange, 76mm Seal, CP

1 1/4" 300mm External Piece 202166 - EST ÂŁ47.13 & Wall Flange, CP

1 1/4" 300mm External & Wall 202117 - EST ÂŁ68.13 Flange, 76mm Seal, CP

Mushroom Spring $CVJ9CUVG1XGTĆƒQY

Mushroom Clicker Combi Waste

Pop-Up - Combi Bath 9CUVG&GNWZG

Bath Filler Waste & 1XGTĆƒQY

Code

Code

Code

Code

Description

202480 - EST

Chrome Plated ÂŁ82.44

Description

RRP

1 1/2" 202007 - EST ZLWK2YHUĹ´RZ ÂŁ48.61 Chrome Plated

Description

1 1/2" 202015 - EST ZLWK2YHUĹ´RZ ÂŁ50.83 Chrome Plated

All dimensions are in mm

EB20_Book.indb 155

RRP

Description

RRP

1 1/2" 200886 - EST ZLWK2YHUĹ´RZ ÂŁ57.06 Chrome Plated

Wastes

RRP

155 18/11/2019 15:42


Mixer Showers

Stimulating surroundings

Showering /KZGT5JQYGTU Shower Enclosures Shower Trays Wetrooms Wall Panelling

156/KZGT5JQYGTU EB20_Book.indb 156

P158-173 P174-185 P186-189 P190-197 P198-213

Price includes VAT

18/11/2019 15:42


Time to get gloriously drenched

Long, hot showers are one of life's simple pleasures. Our complete showering range comes in all shapes, styles and sizes - each one designed with your satisfaction and enjoyment in mind. “Dual outlet shower systems allow you to switch between a wÝi`…i>`>˜`>“œÀiyi݈LiŜÜiÀˆ˜}…>˜`ÃiÌ” /KZGT5JQYGTU 157 EB20_Book.indb 157

18/11/2019 15:43


/KZGT5JQYGTUThermostatic Showers

Mixer Showers All showers are suitable for use with unvented water supplies, combi boilers, gravity and mains pressure systems.

158/KZGT5JQYGTU EB20_Book.indb 158

Price includes VAT

18/11/2019 15:43


Thermostatic Showers - Ores - Carra/KZGT5JQYGTU

Ores - Single Outlet Bar Shower - Thermostatic Minimum Operating Pressure 0.2 Bar

E80001 VE YEAR FI

UA

£123.69

Code

Minimum Operating Pressure

RRP

0.2 Bar

E80002

£159.27

VE YEAR FI

VALVE

E

5 10

G

RRP

E RANT

5 10

G

UA

SAFE TOUCH

E

Code

Carra - Single Outlet Bar Shower - Thermostatic

RANT

E

VALVE

• Thermostatic bar shower

• Thermostatic bar shower

r+PENWFGUUNKFGTCKNMKVCPFHCUVƂZDTCEMGVU

r+PENWFGUUNKFGTCKNMKVCPFHCUVƂZDTCEMGVU

All dimensions are in mm

EB20_Book.indb 159

/KZGT5JQYGTU 159 18/11/2019 15:43


/KZGT5JQYGTUThermostatic Showers - Carra Twin - Narva - Narva Twin

Code

Minimum operating pressure 0.4 bar

E80003

Narva - Single Outlet Thermostatic RRP

£385.98

Code

Minimum operating pressure 0.2 bar

E80006

VALVE

UA

RAN

£204.60

SAFE TOUCH

TE

Code

Minimum operating pressure 0.4 bar

E80007

VALVE VE YEAR FI

E

5 10

G

RRP

5 10

G

UA

RAN

RRP £451.92

VALVE VE YEAR FI

SAFE TOUCH

E

VE YEAR FI

Narva Twin - Dual Outlet Bar Thermostatic

TE

5 10

G

UA

SAFE TOUCH

E

Carra Twin - Dual Outlet Bar Shower

RANT

E

• Thermostatic bar shower

• Thermostatic bar shower

• Thermostatic bar shower

• Telescopic riser rail

• Smooth hose

• Telescopic riser rail

• Includes overhead soaker UNKFGTCKNMKVCPFHCUVƂZ brackets

• Metal handles

• Smooth hose

• Includes slide rail kit and HCUVƂZDTCEMGVU

• Metal handles

• Multifunction handset

• Multifunction handset

• Includes overhead soaker UNKFGTCKNMKVCPFHCUVƂZ brackets • Push button selector handset

160/KZGT5JQYGTU EB20_Book.indb 160

Price includes VAT

18/11/2019 15:43


Thermostatic Showers - Laja Twin - Glanni - Glanni Twin/KZGT5JQYGTU

Laja Twin - Dual Outlet Bar Thermostatic Minimum operating pressure 0.4 bar

E80008

RRP £459.03

Code

Minimum operating pressure 0.2 bar

E80004

VALVE

RAN

Code

Minimum operating pressure 0.4 bar

E80005

SAFE TOUCH

TE

5 10

G

UA

RAN

RRP £354.84

VALVE VE YEAR FI

SAFE TOUCH

E

UA

£254.43

VE YEAR FI

E

5 10

RRP

VALVE

VE YEAR FI

G

Glanni Twin - Dual Outlet Bar Thermostatic

TE

5 10

G

UA

SAFE TOUCH

E

Code

Glanni - Single Outlet Bar Thermostatic

RANT

E

• Thermostatic bar shower

• Thermostatic bar shower

• Thermostatic bar shower

• Telescopic riser rail

• Includes slide rail kit and HCUVƂZDTCEMGVU

• Telescopic riser rail

• Smooth hose • Includes large thin overhead soaker slide TCKNMKVCPFHCUVƂZ brackets

All dimensions are in mm

EB20_Book.indb 161

• Includes overhead soaker slide rail kit and HCUVƂZDTCEMGVU

/KZGT5JQYGTU 161 18/11/2019 15:43


/KZGT5JQYGTUThermostatic Showers - Ceirano - Osca

Ceirano5KPING.GXGT'ZRQUGF6JGTOQUVCVKE Code

Description

E80017

Mini Exposed Valve Shower and Kit

RRP £253.78

UA

RANT

Description

RRP

E80018

Maxi Exposed Valve and Kit

£268.89

VE YEAR FI

VALVE

E

G

Code

E

5 10

G

UA

VALVE

E

VE YEAR FI

5 10

Osca&WCN.GXGT'ZRQUGF6JGTOQUVCVKE

RANT

E

• Adjustable pipe centres 135-155mm

• Adjustable pipe centres 136-158mm

• Thermostatic valve

• Thermostatic valve

r OKP DCT OCZ QRGTCVKPIRTGUUWTG

r OKP DCT OCZ QRGTCVKPIRTGUUWTG

r4KUGTTCKNYKVJCFLWUVCDNGÆ‚ZKPIDTCEMGV

r4KUGTTCKNYKVJCFLWUVCDNGÆ‚ZKPIDTCEMGV

• Multi mode handset

• Multi mode handset

162/KZGT5JQYGTU EB20_Book.indb 162

Price includes VAT

18/11/2019 15:43


Thermostatic Showers - Moncallier - Diatto/KZGT5JQYGTU

Moncallier&WCN.GXGT'ZRQUGF6JGTOQUVCVKE Code

Description

E80019

Mini Exposed Valve and Kit

RRP £269.96

VALVE

E80020

Maxi Concealed Valve and Kit

5 10

G

E

RANT

Description

RRP £288.83

VE YEAR FI

5 10 UA

Code

E

UA

VALVE

E

VE YEAR FI

G

Diatto - Dual Lever Concealed - Thermostatic

RANT

E

• Adjustable pipe centres 135-155mm

• Thermostatic valve

• Thermostatic valve

r OKP DCT OCZ QRGTCVKPIRTGUUWTG

r OKP DCT OCZ QRGTCVKPIRTGUUWTG

r4KUGTTCKNYKVJCFLWUVCDNGÆ‚ZKPIDTCEMGV

r4KUGTTCKNYKVJCFLWUVCDNGÆ‚ZKPIDTCEMGV

• Multi mode handset

• Multi mode handset All dimensions are in mm

EB20_Book.indb 163

/KZGT5JQYGTU 163 18/11/2019 15:43


/KZGT5JQYGTUConcealed Showers - Narva

Narva N YEAR TE

UA

E

10

G

RANT

E

LOW PRESSURE 2 bar

VALVES • Access for servicing from the front • Easy clean cartridge

Narva - Two Handle Single Outlet - Concealed

Narva - Three Handle Dual Outlet - Concealed

Code

Description

Code

Description

E80021

Two Handle Single Outlet Concealed Valve with Brass Plate

£248.08

E80023

Three Handle Two Outlet Concealed Valve with Brass Plate

£294.23

E80040

Slide Rail Kit, Chrome Pan Handle Single Function Handset and Standard 1.5m Hose

£45.58

E80040

Slide Rail Kit, Chrome Pan Handle Single Function Handset and Standard 1.5m Hose

£45.58

E80038

Round Wall Outlet Elbow

£23.08

E80036

Wall Arm and 200mm ABS Head (all chrome)

£74.14

E80063

Complete Pack

Total £316.73

E80038

Wall Outlet Elbow

£23.08

E80064

Complete Pack

164/KZGT5JQYGTU EB20_Book.indb 164

RRP

RRP

Total £437.02

Price includes VAT

18/11/2019 15:44


Concealed Showers - Narva/KZGT5JQYGTU

Narva - Two Handle Single Outlet - Concealed Code E80021 E80036 E80065

Description

RRP

Two Handle Single Outlet concealed valve with Brass Plate Wall Arm and 200mm ABS Head (all chrome) Complete Pack

Code

£248.08

E80023

£74.14

E80036

Total £322.21

E80027 E80066

All dimensions are in mm

EB20_Book.indb 165

Narva - Three Handle Dual Outlet - Concealed with Slide Rail

Narva - Three Handle Dual Outlet - Concealed Description

RRP

Three Handle Dual Outlet Concealed Valve with Brass Plate Wall Arm and 200mm ABS Head (all chrome) Chrome Bath Filler Waste DQG2YHUŴRZ Complete Pack

£294.23 £74.14 £72.69

Total £441.06

Code E80023 E80040

Description

RRP

Three Handle Dual Outlet £294.23 Concealed Valve with Brass Plate Slide Rail Kit, Chrome Pan Handle Single Function Handset and £45.58 Standard 1.5m Hose

E80038

Wall Outlet Elbow

£23.08

E80027

Chrome Bath Filler Waste and 2YHUŴRZ

£72.69

E80067

Complete Pack

Total £435.58

/KZGT5JQYGTU 165 18/11/2019 15:44


/KZGT5JQYGTUConcealed Showers - Laja

Laja N YEAR TE

UA

E

10

G

RANT

E

VALVES

Laja - Three Handle Dual Outlet - Slimline

Laja - Two Handle Single Outlet - Concealed Code

Description

E80024

Two Handle Single Outlet Concealed Valve with Brass Plate

E80034

Wall Arm and 200mm ABS Head (all chrome)

E80068

Complete Pack

166/KZGT5JQYGTU EB20_Book.indb 166

Code

Description

£248.08

E80026

Three Handle Dual Outlet Concealed Valve with Brass Plate

£294.23

£80.22

E80033

Wall Outlet Elbow with Bracket. Smooth Hose and Square Pencil ABS Head

£89.94

Total £328.30

E80035

Wall Arm with 200mm Slimline Head

E80069

Complete Pack

RRP

RRP

£139.42 Total £523.59

Price includes VAT

18/11/2019 15:44


Concealed Showers - Laja/KZGT5JQYGTU

Laja - Two Handle Single Outlet - Concealed

Laja - Two Handle Dual Outlet Concealed

Laja - Three Handle Dual Outlet - Concealed

Code

Code

Code

E80024 E80042

Description

RRP

Two Handle Single Outlet Concealed Valve with Brass Plate Slide Rail Kit and Square Handset with Standard 1.5m Hose

E80039

Wall Outlet Elbow

E80070

Complete Pack

RRP

E80026

Description

RRP

Three Handle Dual Outlet Concealed Valve with Brass Plate Slide Rail Kit and Square Handset with Standard 1.5m Hose

£248.08

E80025

£65.77

E80042

£24.23

E80039

Wall Outlet Elbow

£24.23

E80039

Wall Outlet Elbow

£24.23

Total £338.08

E80034

Wall Arm and 200mm ABS Head

£80.22

E80034

Wall Arm and 200mm ABS Head

£80.22

E80071

Complete Pack

Total £435.60

E80072

Complete Pack

All dimensions are in mm

EB20_Book.indb 167

Description

Two Handle Dual Outlet Concealed £265.38 Valve with Brass Plate Slide Rail Kit and Square Handset £65.77 with Standard 1.5m Hose

E80042

£294.23 £65.77

Total £464.45

/KZGT5JQYGTU 167 18/11/2019 15:44


/KZGT5JQYGTUShower Kit Components

Create your own Shower 1.

Select a Single Outlet or Dual Outlet Valve.

2.

Combine your valve with one of the accompanying options below

TGOGODGT[QWYKNNTGSWKTGVYQKH[QWJCXGCFWCNQWVNGVXCNXG Slide Rail Kit & Wall Elbow (Page 169) Fixed Head (Page 170) Bracket Fixed Handset (Page 171)



$CVJ(KNNGT9CUVG1XGTƃQY 2CIG

Single Outlet

Dual Outlet

Narva - Two Handle Single Outlet Valve Code

Description

E80021

Single Outlet Valve with Brass Plate

Narva - Two Handle Dual Outlet Valve RRP

£248.08

Laja - Two Handle Single Outlet Valve Code

Description

E80024

Single Outlet Valve with Brass Plate

168/KZGT5JQYGTU EB20_Book.indb 168

Code

Description

E80022

Dual Outlet Valve with Brass Plate

Laja - Two Handle Dual Outlet Valve RRP £265.38

Narva - Three Handle Dual Outlet Valve RRP £248.08

Code

Description

E80023

Dual Outlet Valve with Brass Plate

Code

Description

E80025

Dual Outlet Valve with Brass Plate

RRP £265.38

Laja - Three Handle Dual Outlet Valve RRP

£294.23

Code

Description

E80026

Dual Outlet Valve with Brass Plate

RRP £294.23

Price includes VAT

18/11/2019 15:44


Shower Kit Components/KZGT5JQYGTU

Slide Rail Kits & Wall Outlet Elbow

Wall Outlet Elbow

Narva - Slide Rail Kit with Standard Hose Code

Description

E80040

Includes Chrome Pan Handle Single Function Handset and Standard 1.5m Hose

E80038

Wall Outlet Elbow

Wall Outlet Elbow

Narva - Slide Rail Kit with Smooth Hose RRP

Code

Description

RRP

£45.58

E80041

Includes Chrome Pan Handle Single Function Handset and Standard 1.5m Smooth Hose

£97.26

£23.08

E80038

Wall Outlet Elbow

£23.08

Wall Outlet Elbow

Laja - Slide Rail Kit with Standard Hose Code

Description

E80042

Includes Square Handset and Standard 1.5m Hose

E80039

Wall Outlet Elbow

EB20_Book.indb 169

Laja - Slide Rail Kit with Smooth Hose RRP

All dimensions are in mm

Wall Outlet Elbow

Code

Description

RRP

£65.77

E80043

Includes Square Handset and Smooth 1.5m Hose

£96.66

£24.23

E80039

Wall Outlet Elbow

£24.23

/KZGT5JQYGTU 169 18/11/2019 15:44


/KZGT5JQYGTUShower Kit Components

(KZGF*GCF-KV

Laja(KZGF*GCF-KV#$5*GCF Code

Description

E80034

Wall Arm and 200mm ABS Head

Laja(KZGF*GCF-KV5NKONKPG*GCF RRP £80.22

Narva(KZGF*GCF-KV#$5*GCF Code

Description

E80036

Wall Arm and 200mm ABS Head (all chrome)

Code

Description

E80035

Wall Arm and 200mm Slimline Head

RRP £139.42

Narva(KZGF*GCF-KV5NKONKPG*GCF RRP £74.14

Code

Description

E80037

Wall Arm and 200mm Slimline Head

RRP £127.12

$CVJ(KNNGT9CUVG1XGTƃQY

2TGOKWO$CVJ(KNNGT9CUVGCPF1XGTƃQY Code

Description

Finish

E80027

3UHPLXP:DVWH 2YHUÅ´RZ

Chrome

170/KZGT5JQYGTU EB20_Book.indb 170

5VCPFCTF$CVJ(KNNGT9CUVGCPF1XGTƃQY RRP £72.69

Code

Description

Finish

202480-EST

6WDQGDUG:DVWH 2YHUÅ´RZ

Chrome

RRP £52.00

Price includes VAT

18/11/2019 15:44


Shower Kit Components/KZGT5JQYGTU

$TCEMGV(KZGF*CPFUGV

Narva$TCEMGV(KZGF*CPFUGVYKVJ5VCPFCTF*QUG

Narva$TCEMGV(KZGF*CPFUGVYKVJ5OQQVJ*QUG

Code

Description

Code

Description

E80030

Wall Outlet Elbow with Bracket and Round Pencil ABS Head

E80031

Wall Outlet Elbow with Bracket and Round Pencil ABS Head

RRP £58.36

RRP £80.22

Laja$TCEMGV(KZGF*CPFUGVYKVJ5VCPFCTF*QUG

Laja$TCEMGV(KZGF*CPFUGVYKVJ5OQQVJ*QUG

Code

Description

Code

Description

E80032

Wall Outlet Elbow with Bracket and Square Pencil ABS Head

E80033

Wall Outlet Elbow with Bracket and Square Pencil ABS Head

RRP

All dimensions are in mm

EB20_Book.indb 171

£68.08

RRP £89.94

/KZGT5JQYGTU 171 18/11/2019 15:44


/KZGT5JQYGTUShower Kit Components

Narva - Pan Handle Single Function ABS Handset - Chrome Code

RRP

E80044

Laja - ABS Pencil Handset

Laja - ABS Handset

£13.27

Code

RRP

E80045

£14.42

Narva - ABS Pencil Handset

Code

RRP

E80046

£16.73

Code

RRP

E80047

£12.12

Double Lock Chrome Shower Hose 1500mm

Double Lock Chrome Shower Hose 2000mm

Smooth Shower Hose - 1500mm

Smooth Shower Hose - 2000mm

Code

Description

Code

Description

Code

Code

E80048

7mm Bore

E80049

7mm Bore

RRP £12.12

E80028

£14.42

RRP

E80050

£33.46

RRP

E80052

172/KZGT5JQYGTU EB20_Book.indb 172

E80051

£53.08

Code E80029

Round Wall Bracket Handset Holder Code

RRP £40.96

Narva - Brass Shower Arm - 360mm

Laja - Brass Shower Arm - 400mm Code

RRP

RRP £46.73

Square Wall Bracket Handset Holder RRP

Code

£33.46

E80053

RRP £38.65

Price includes VAT

18/11/2019 15:44


Shower Kit Components/KZGT5JQYGTU

Narva - Slimline Shower Head - 200mm Code

Description

E80054

Round Polished Appearance - 200mm Diameter

Narva - Slimline Shower Head - 250mm RRP £92.31

Narva - Slimline Shower Head - 300mm Code

Description

E80056

Round Polished Appearance - 300mm Diameter

£230.77

Laja - Slimline Shower Head - 250mm Description

E80058

Square Polished Appearance - 250mm Diameter

£169.04

Narva - Round Shower Head - 200mm Description

E80060

Round ABS Chrome Shower Head - 200mm Diameter

EB20_Book.indb 173

E80055

Round Polished Appearance - 250mm Diameter

£167.88

Code

Description

E80057

Square Polished Appearance - 200mm Diameter

RRP £103.27

Code

Description

RRP

E80059

Square Polished Appearance - 300mm Diameter

£230.19

Laja - Square Shower Head - 200mm RRP

All dimensions are in mm

RRP

Laja - Slimline Shower Head - 300mm RRP

Code

Description

Laja - Slimline Shower Head - 200mm RRP

Code

Code

£26.54

Code

Description

RRP

E80061

Square ABS Chrome Shower Head - 200mm Diameter

£26.54

/KZGT5JQYGTU 173 18/11/2019 15:44


Shower Enclosures / Quadrants - Esteem 8

Shower Enclosures

Curved Quadrant design - Our best selling Shower Enclosure

Esteem 8 Quadrant

Single Door Quadrant

174 Shower Enclosures EB20_Book.indb 174

Price includes VAT

18/11/2019 15:44


Quadrant - Esteem 8 / Shower Enclosures

Single Door Offset Quadrant

Esteem 8 - Single Door Quadrant Code

Description

E50101

w900 x h1900 x d900 - Chrome

Esteem 8 - Double Door Quadrant

Adjustment

RRP

850/880

£1,019.48

Esteem 8 - Single Door Offset Quadrant Code

Description

Adjustment

E50095

Offset w900 x h1900 x d760 - Chrome

E50096

Offset w1000 x h1900 x d800 - Chrome

E50099

Offset w1200 x h1900 x d800 - Chrome

E50104

Offset w1200 x h1900 x d900 - Chrome

UA

8mm GLASS

E

T

AR

G

Code

Description

Adjustment

RRP

E50106

w800 x h1900 x d800 - Chrome

750-780

£968.00

E50107

w900 x h1900 x d900 - Chrome

850-880

£968.00

E20536

w1000 x h1900 x d1000 - Chrome

950 - 980

£1,298.94

RRP

850/880720/740 950/980750/780 1150/1180750/780 1150/1180850/880

£984.22 £1,004.02 £1,040.07 £1,040.07

ENTY YE

20 10 W

Double Door Quadrant

RAN

TE

EASY CLEAN GLASS

• Height 1900mm

• Chrome top caps & cover caps

• Reversible

• Stayclear coated glass

r%QPEGCNGF(KZKPIU

• BS EN14428

All dimensions are in mm

EB20_Book.indb 175

Shower Enclosures

175 18/11/2019 15:44


Shower Enclosures / Sliding Doors - Esteem 8

Esteem 8 Sliding Doors

Sliding Doors with Side Panel

Esteem 8 - Sliding Doors

Esteem 8 - Side Panels

Code

Description

Code

Description

E50108

w1000 x h1900 - Chrome

930-990

£762.04

E50123

w700 x h1900 - Chrome

660-680

£360.99

E50109

w1100 x h1900 - Chrome

1030-1090

£762.04

E50124

w760 x h1900 - Chrome

720-740

£360.99

E50110

w1200 x h1900 - Chrome

1130-1190

£762.04

E50125

w800 x h1900 - Chrome

760-780

£373.96

E50111

w1400 x h1900 - Chrome

1350-1390

£803.22

E50126

w900 x h1900 - Chrome

860-880

£401.07

E50118

w1700 x h1900 - Chrome

1650-1690

£849.58

UA

8mm GLASS

E

T

AR

G

RRP

Adjustment

RRP

ENTY YE

20 10 W

Adjustment

RANT

E

• Height 1900mm

r%QPEGCNGF(KZKPIU

• Stayclear coated glass

• Reversible

• Chrome top caps & cover caps

• BS EN14428

176 Shower Enclosures EB20_Book.indb 176

EASY CLEAN GLASS

Price includes VAT

18/11/2019 15:44


Pivot Doors - Esteem 8 / Shower Enclosures

Esteem 8 Pivot Doors

Pivot Doors with Side Panel

Esteem 8 - Pivot Doors

Esteem 8 - Side Panels

Code

Description

E50120

w760 x h1900 - Chrome

690-750

E50121

w800 x h1900 - Chrome

E50122

w900 x h1900 - Chrome

UA

E

T

AR

G

RRP

Code

Description

Adjustment

RRP

£638.46

E50123

w700 x h1900 - Chrome

660-680

£360.99

730-790

£638.46

E50124

w760 x h1900 - Chrome

720-740

£360.99

830-890

£695.09

E50125

w800 x h1900 - Chrome

760-780

£373.96

E50126

w900 x h1900 - Chrome

860-880

£401.07

ENTY YE

20 10 W

Adjustment

RANT

E

8mm GLASS

EASY CLEAN GLASS

• Height 1900mm

r%QPEGCNGF(KZKPIU

• Stayclear coated glass

• Reversible

• Chrome top caps & cover caps

• BS EN14428

All dimensions are in mm

EB20_Book.indb 177

Shower Enclosures

177 18/11/2019 15:44


Shower Enclosures / Bifold Doors - Esteem 8

Esteem 8 Bifold Doors

Bifold Doors with Side Panel

Esteem 8 - Bifold Doors

Esteem 8 - Side Panels

Code

Description

E50091

w760 x h1900 - Chrome

690-750

E50092

w800 x h1900 - Chrome

E50093 E50094

UA

E

T

AR

G

RRP

Code

Description

Adjustment

RRP

£643.59

E50123

w700 x h1900 - Chrome

660-680

£360.99

730-790

£643.59

E50124

w760 x h1900 - Chrome

720-740

£360.99

w900 x h1900 - Chrome

830-890

£684.82

E50125

w800 x h1900 - Chrome

760-780

£373.96

w1000 x h1900 - Chrome

930-990

£756.91

E50126

w900 x h1900 - Chrome

860-880

£401.07

ENTY YE

20 10 W

Adjustment

RANT

E

EASY CLEAN GLASS

• Height 1900mm

r%QPEGCNGF(KZKPIU

r5VC[ENGCTEQCVGFINCUU OO

• Reversible

• Chrome top caps & cover caps

• BS EN14428

178 Shower Enclosures EB20_Book.indb 178

Price includes VAT

18/11/2019 15:44


Level Access Sliding Doors - Esteem 6 / Shower Enclosures

Esteem 6

Level Access Sliding Doors

Level Access Sliding Doors with Side Panel

Adjustment Alcove Fitting

Adjustment with Side Panel

Code

Description

RRP

E50178

w1000 x h1900 - Silver Frame - Left Handed

940-990

976-1017

£414.62

E50179

w1100 x h1900 - Silver Frame - Left Handed

1040-1090

1076-1117

£425.91

E50180

w1200 x h1900 - Silver Frame - Left Handed

1140-1190

1176-1217

£433.44

E50181

w1400 x h1900 - Silver Frame - Left Handed

1340-1390

1386-1417

£508.75

E50182

w1700 x h1900 - Silver Frame - Left Handed

1640-1690

1676-1717

£565.23

E50183

w1000 x h1900 - Silver Frame - Right Handed

940-990

976-1017

£414.62

E50184

w1100 x h1900 - Silver Frame - Right Handed

1040-1090

1076-1117

£425.91

E50185

w1200 x h1900 - Silver Frame - Right Handed

1140-1190

1176-1217

£433.44

E50186

w1400 x h1900 - Silver Frame - Right Handed

1340-1390

1386-1417

£508.75

E50187

w1700 x h1900 - Silver Frame - Right Handed

1640-1690

1676-1717

£565.23

Code

Description

E50166

w700 x h1900 - Silver Frame

665-690

£184.11

E50167

w760 x h1900 - Silver Frame

725-750

£184.11

E50168

w800 x h1900 - Silver Frame

765-790

£194.11

E50169

w900 x h1900 - Silver Frame

865-890

£208.12

E50188

w1000 x h1900 - Silver Frame

960-990

£239.10

EB20_Book.indb 179

LIF

ETIME

10

LIFETIME 6mm GLASS G

UA

RANT

E

• Height 1900mm • Level entry product • Easy installation

Esteem 6 - Side Panels

All dimensions are in mm

See coloured shower trays on page 188

E

Esteem 6 - Level Access Sliding Doors

Adjustment

RRP

• Ultra smooth running doors • Optional waterguard strip supplied • Quick release door for easy cleaning Shower Enclosures

179 18/11/2019 15:44


Shower Enclosures / Sliding Doors - Esteem 6

Esteem 6 Sliding Doors

Sliding Doors with Side Panel

Esteem 6 - Sliding Doors Door Opening Aperture

Adjustment Alcove Fitting

Adjustment with Side Panel

w1000 x h1900 - Silver Frame

390

940-990

966-1016

£311.76

E50138

w1100 x h1900 - Silver Frame

440

1040-1090

1066-1116

£350.18

E50139

w1200 x h1900 - Silver Frame

490

1140-1190

1166-1216

£331.24

E50140

w1400 x h1900 - Silver Frame

590

1340-1390

1366-1416

£448.17

E50141

w1700 x h1900 - Silver Frame

740

1640-1690

1666-1716

£489.50

Code

Description

E50137

RRP

Esteem 6 - Side Panels Description

Adjustment

E50166

w700 x h1900 - Silver Frame

665-690

£184.11

E50167

w760 x h1900 - Silver Frame

725-750

£184.11

E50168

w800 x h1900 - Silver Frame

765-790

£194.11

E50169

w900 x h1900 - Silver Frame

865-890

£208.12

E50188

w1000 x h1900 - Silver Frame

960-990

£239.10

Esteem 6 - Inline Panels

Esteem 6'ZVGPUKQP2TQÆ‚NG

Code

Description

E50170

w200 x h1900 - Silver Frame

£203.33

E50171

w300 x h1900 - Silver Frame

£203.33

180 Shower Enclosures EB20_Book.indb 180

RRP

RRP

Code

Description

RRP

E50177

w40 x h1900 - Silver Frame

£55.56

LIF

ETIME

10

LIFETIME 6mm GLASS G

UA

E

Code

RANT

E

• Height 1900mm • Chromed plastic top caps • Easy installation • Reversible • Magnetic door seal

Price includes VAT

18/11/2019 15:44


Single Door Quadrant - Esteem 6 / Shower Enclosures

Esteem 6

Single Door Quadrant

Single Door Quadrant

Esteem 6 - Single Door Quadrant Code

Description

E50151

w900 x h1900 x d900 - Silver Frame

Door Opening Aperture

Adjustment

450

865-890

RRP £361.48

Esteem 6 - Single Door Offset Quadrant Door Opening Aperture

Adjustment

w800 x h1900 x d900 - Silver Frame

450

865-890 / 765-790

£361.48

E50157

w800 x h1900 x d1000 - Silver Frame

450

965-990 / 765-790

£395.36

E50160

w800 x h1900 x d1200 - Silver Frame

450

1165-1190 / 765-790

£414.19

E50163

w900 x h1900 x d1200 - Silver Frame

450

1165-1190 / 865-890

£433.02

Description

E50154

Description

E50177

w40 x h1900 - Silver Frame

LIF

ETIME

10

LIFETIME 6mm GLASS

Esteem 6'ZVGPUKQP2TQÆ‚NG Code

RRP

G

RRP £55.56

UA

E

Code

RANT

E

• Height 1900mm • Chromed plastic top caps • Easy installation • Reversible • Magnetic door seal

All dimensions are in mm

EB20_Book.indb 181

Shower Enclosures

181 18/11/2019 15:44


Shower Enclosures / Double Door Quadrant - Esteem 6

Esteem 6

Double Door Quadrant

Double Door Offset Quadrant

Esteem 6 - Double Door Quadrant Door Opening Aperture

Adjustment

w800 x h1900 x d800 - Silver Frame

380

765-790

£354.63

w900 x h1900 x d900 - Silver Frame

510

865-890

£354.63

Description

E50145 E50146

RRP

LIF

Esteem 6 - Double Door Offset Quadrant Door Opening Aperture

Adjustment

w800 x h1900 x d900 - Silver Frame

450

865-890 / 765-790

£371.24

E50148

w800 x h1900 x d1000 - Silver Frame

450

965-990 / 765-790

£406.05

E50149

w800 x h1900 x d1200 - Silver Frame

450

1165-1190 / 765-790

£425.38

E50150

w900 x h1900 x d1200 - Silver Frame

520

1165-1190 / 865-890

£444.72

Code

Description

E50147

RRP

Description

E50177

w40 x h1900 - Silver Frame

182 Shower Enclosures EB20_Book.indb 182

10

LIFETIME 6mm GLASS G

UA

RANT

E

• Height 1900mm • Chromed plastic top caps • Easy installation

Esteem 6'ZVGPUKQP2TQÆ‚NG Code

ETIME

E

Code

• Reversible

RRP

• Magnetic door seal

£55.56

Price includes VAT

18/11/2019 15:44


Pivot Doors - Esteem 6 / Shower Enclosures

Esteem 6 Pivot Doors

Pivot Door with Inline Panel

Pivot Door with Extension Panel

Esteem 6 - Pivot Doors Door Opening Aperture

Adjustment Alcove Fitting

Adjustment with Side Panel

w700 x h1900 - Silver Frame

400

640-690

666-716

£268.16

E50130

w760 x h1900 - Silver Frame

460

700-750

726-776

£268.16

E50131

w800 x h1900 - Silver Frame

500

740-790

766-816

£274.16

E50132

w900 x h1900 - Silver Frame

600

840-890

866-916

£296.17

Description

E50129

Esteem 6 - Inline Panels

RRP

Esteem 6'ZVGPUKQP2TQÆ‚NG

Code

Description

RRP

E50170

w200 x h1900 - Silver Frame

£203.33

E50171

w300 x h1900 - Silver Frame

£203.33

Code

Description

E50177

w40 x h1900 - Silver Frame

LIF

10

LIFETIME 6mm GLASS G

RRP £55.56

ETIME

UA

E

Code

RANT

E

• Height 1900mm • Chromed plastic top caps • Easy installation • Reversible • Magnetic door seal

All dimensions are in mm

EB20_Book.indb 183

Shower Enclosures

183 18/11/2019 15:45


Shower Enclosures / Bifold Doors - Esteem 6

Esteem 6 Bifold Doors

Bifold Doors with Side Panel

Esteem 6 - Bifold Doors Door Opening Aperture

Adjustment Alcove Fitting

Adjustment with Side Panel

w760 x h1900 - Silver Frame

435

700-750

730-780

£312.18

E50134

w800 x h1900 - Silver Frame

475

740-790

770-820

£312.18

E50135

w900 x h1900 - Silver Frame

575

840-890

870-920

£328.19

E50136

w1000 x h1900 - Silver Frame

675

940-990

970-1020

£395.36

Description

E50133

RRP

LIF

Esteem 6 - Side Panels Code

Description

Adjustment

E50166

w700 x h1900 - Silver Frame

665-690

£184.11

E50167

w760 x h1900 - Silver Frame

725-750

£184.11

E50168

w800 x h1900 - Silver Frame

765-790

£194.11

E50169

w900 x h1900 - Silver Frame

865-890

£208.12

E50188

w1000 x h1900 - Silver Frame

960-990

£239.10

Esteem 6 - Inline Panels

Esteem 6'ZVGPUKQP2TQÆ‚NG

Code

Description

E50170

w200 x h1900 - Silver Frame

£203.33

E50171

w300 x h1900 - Silver Frame

£203.33

184 Shower Enclosures EB20_Book.indb 184

RRP

RRP

Code

Description

E50177

w40 x h1900 - Silver Frame

RRP £55.56

ETIME

10

LIFETIME 4mm DOORS G

UA

E

Code

RANT

E

• Height 1900mm • 6mm side panels / inline panels • Chromed plastic top caps • Easy installation • Reversible • Magnetic door seal

Price includes VAT

18/11/2019 15:45


Corner Entry - Esteem 6 / Shower Enclosures

Esteem 6 Corner Entry

Esteem 6 - Corner Entry Adjustment

w760 x h1900 x d760 - Silver Frame

375

725-750

£468.13

E50143

w800 x h1900 x d800 - Silver Frame

400

765-790

£508.83

E50144

w900 x h1900 x d900 - Silver Frame

470

865-890

£590.25

Description

E50142

Description

E50177

w40 x h1900 - Silver Frame

LIF

ETIME

10

LIFETIME 6mm GLASS G

UA

RANT

E

• Height 1900mm

Esteem 6'ZVGPUKQP2TQÆ‚NG Code

RRP

E

Door Opening Aperture

Code

RRP £55.56

• Chromed plastic top caps • Easy installation • Reversible • Magnetic door seal

All dimensions are in mm

EB20_Book.indb 185

Shower Enclosures

185 18/11/2019 15:45


Shower Trays / Esteem Low Profile

Shower Trays N YEAR TE

UA

E

10

G

ANTI-SLIP AVAILABLE

RANT

E

• 45mm acrylic capped stone resin

Rectangle Flat-to-Floor

rOOHCUVĆƒQYYCUVGCNUQCXCKNCDNG • 23 sizes available • Fully compatible with the Esteem shower enclosure ranges • #XCKNCDNGYKVJNGICPFRCPGNUGVVQTCKUGQHHVJGĆƒQQT • Anti-slip rated to class “Câ€? standard Esteem.QY2TQĆ‚NG5SWCTG Code

Description

Size (mm)

RRP

HES76100

Square

760 x 760

ÂŁ111.70

HES80100

Square

800 x 800

ÂŁ120.34

HES90100

Square

900 x 900

ÂŁ165.48 Quadrant Flat-to-Floor

Esteem.QY2TQĆ‚NG4GEVCPING Description

Size (mm)

HES976100

Rectangle

900 x 760

ÂŁ162.84

Code

Description

HES980100

Rectangle

900 x 800

ÂŁ187.88

HES80Q100

800mm Quadrant

550

ÂŁ147.25

HES1076100

Rectangle

1000 x 760

ÂŁ193.80

HES90Q100

900mm Quadrant

550

ÂŁ151.09

HES1080100

Rectangle

1000 x 800

ÂŁ208.32

HES100Q100

1000mm Quadrant

550

ÂŁ261.85

HES1090100

Rectangle

1000 x 900

ÂŁ220.03

HES1180100

Rectangle

1100 x 800

ÂŁ221.21

Esteem.QY2TQĆ‚NG1HHUGV3WCFTCPV

HES1276100

Rectangle

1200 x 760

ÂŁ197.63

Code

Description

Size (mm)

HES1280100

Rectangle

1200 x 800

ÂŁ185.50

HES976LQ100

Left Hand

900 x 760

ÂŁ234.95

HES1290100

Rectangle

1200 x 900

ÂŁ215.56

HES976RQ100

Right Hand

900 x 760

ÂŁ234.95

HES1480100

Rectangle

1400 x 800

ÂŁ334.11

HES980LQ100

Left Hand

900 x 800

ÂŁ253.50

HES1490100

Rectangle

1400 x 900

ÂŁ334.11

HES980RQ100

Right Hand

900 x 800

ÂŁ253.50

HES1580100

Rectangle

1500 x 800

ÂŁ379.44

HES1080LQ100

Left Hand

1000 x 800

ÂŁ260.78

HES1680100

Rectangle

1600 x 800

ÂŁ404.92

HES1080RQ100

Right Hand

1000 x 800

ÂŁ260.78

HES1770100

Rectangle

1700 x 700

ÂŁ411.91

HES1280LQ100

Left Hand

1200 x 800

ÂŁ300.81

HES1776100

Rectangle

1700 x 760

ÂŁ425.92

HES1280RQ100

Right Hand

1200 x 800

ÂŁ300.81

HES1780100

Rectangle

1700 x 800

ÂŁ468.51

HES1290LQ100

Left Hand

1200 x 900

ÂŁ333.52

HES1790100

Rectangle

1700 x 900

ÂŁ542.15

HES1290RQ100

Right Hand

1200 x 900

ÂŁ333.52

186 Shower Trays EB20_Book.indb 186

RRP

Esteem.QY2TQĆ‚NG3WCFTCPV

Code

Size (radius)

RRP

RRP

Price includes VAT

18/11/2019 15:45


Esteem Anti-Slip / Shower Trays

Esteem Anti-Slip.QY2TQÆ‚NG5SWCTG Code

Description

Size (mm)

RRP

ASHES76100

Square

760 x 760

£211.62

ASHES80100

Square

800 x 800

£223.95

ASHES90100

Square

900 x 900

£362.71

Esteem Anti-Slip.QY2TQÆ‚NG4GEVCPING Code

Description

Size (mm)

RRP

ASHES976100

Rectangle

900 x 760

£361.29

ASHES980100

Rectangle

900 x 800

£362.22

ASHES1076100

Rectangle

1000 x 760

£376.50

ASHES1080100

Rectangle

1000 x 800

£376.50

ASHES1090100

Rectangle

1000 x 900

£408.25

ASHES1180100

Rectangle

1100 x 800

£417.60

ASHES1276100

Rectangle

1200 x 760

£415.47

ASHES1280100

Rectangle

1200 x 800

£416.07

ASHES1290100

Rectangle

1200 x 900

£447.72

ASHES1480100

Rectangle

1400 x 800

£581.52

ASHES1490100

Rectangle

1400 x 900

£592.47

ASHES1580100

Rectangle

1500 x 800

£638.50

ASHES1680100

Rectangle

1600 x 800

£662.49

ASHES1770100

Rectangle

1700 x 700

£659.94

ASHES1776100

Rectangle

1700 x 760

£674.72

ASHES1780100

Rectangle

1700 x 800

£745.27

ASHES1790100

Rectangle

1700 x 900

£779.10

Esteem Anti-Slip.QY2TQÆ‚NG3WCFTCPV Code

Description

Size (radius)

ASHES80Q100

800mm Quadrant

550

ASHES90Q100

900mm Quadrant

ASHES100Q100

1000mm Quadrant

Rectangle Legs & Panels

Panels are 95mm high

Quadrant on legs

Esteem.QY2TQÆ‚NG2CPGN-KV RRP

Code

Description

£280.86

HESP100Q100

1000mm Quadrant Panel Kit 1

£87.75

550

£339.61

HESP1290Q100

1200mm x 900mm Quadrant Panel Kit 2

£99.65

550

£408.42

HESP1290100

1200mm x 900mm Panel Kit 3

£87.75

HESP1810100

1800mm x 1000mm Panel Kit 6

£99.65

HESP76100

760mm x 760mm Panel Kit 5

£81.80

Esteem Anti-Slip.QY2TQÆ‚NG1HHUGV3WCFTCPV

RRP

Code

Description

Size (mm)

ASHES976LQ100

Left Hand

900 x 760

£360.48

ASHES976RQ100

Right Hand

900 x 760

£363.28

ASHES980LQ100

Left Hand

900 x 800

£377.67

ASHES980RQ100

Right Hand

900 x 800

£377.67

ASHES1080LQ100

Left Hand

1000 x 800

£383.58

ASHES1080RQ100

Right Hand

1000 x 800

£383.58

ASHES1280LQ100

Left Hand

1200 x 800

£394.04

ASHES1280RQ100

Right Hand

1200 x 800

£394.04

Esteem.QY2TQÆ‚NG5JQYGT6TCR9CUVG

ASHES1290LQ100

Left Hand

1200 x 900

£556.75

Code

Description

ASHES1290RQ100

Right Hand

1200 x 900

£556.75

HW90

Shower Trap 90mm Waste

All dimensions are in mm

EB20_Book.indb 187

RRP

RRP £21.13

Shower Trays

187 18/11/2019 15:45


Shower Trays / Evolved by JT

Product codes for colours are available upon request. NT

AWARD WINNING

E

TWE

UA

AR YE

25 10

G

Astro White

Y FIVE

RANT

E

• A uniquely designed 25mm shower tray • Available in square, rectangle and quadrant • ABS capped acrylic stone resin, double skinned HQTGZVTCUVTGPIVJ r+PUVCNNUƃCVVQƃQQTQTQPNGIUYKVJCP Evolved™ by JT Riser Kit option

Astro Slate

• JT Anti-Slip™ option available Evolved by JT - Quadrant RRP

Colour Option RRP

Code

Description

E80Q100

800mm Quad Gloss White 25mm Tray

beb

£327.65

E90Q100

900mm Quad Gloss White 25mm Tray

beb

£387.02

Evolved by JT - Square

Astro Sand

Colour Option RRP RRP

Code

Description

Size (mm)

E76100

Gloss White 25mm Tray

760 x 760

beb

£237.54

E80100

Gloss White 25mm Tray

800 x 800

beb

£290.78

E90100

Gloss White 25mm Tray

900 x 900

beb

£407.51

Evolved by JT - Rectangle Colour Option RRP

Code

Description

Size (mm)

RRP

E1076100

Gloss White 25mm Tray

1000 x 760

beb

£407.51

E1080100

Gloss White 25mm Tray

1000 x 800

beb

£407.51

E1276100

Gloss White 25mm Tray

1200 x 760

beb

£434.12

E1280100

Gloss White 25mm Tray

1200 x 800

beb

£434.12

E1290100

Gloss White 25mm Tray

1200 x 900

beb

£434.12

E1480100

Gloss White 25mm Tray

1400 x 800

beb

£726.97

E1490100

Gloss White 25mm Tray

1400 x 900

beb

£726.97

E1580100

Gloss White 25mm Tray

1500 x 800

beb

£726.97

E1680100

Gloss White 25mm Tray

1600 x 800

beb

£958.36

E1780100

Gloss White 25mm Tray

1700 x 800

beb

£958.36

E1880100

Gloss White 25mm Tray

1800 x 800

beb

£1,116.04

188 Shower Trays EB20_Book.indb 188

Astro Black

Mistral Grey

Price includes VAT

18/11/2019 15:45


Evolved by JT with JT Anti-Slipâ„¢ / Shower Trays

Wetroom style, flat-to-the floor tray

Anti-Slip coating can be applied to all colour options

Other colour options available

Astro White

Astro Slate

Astro Sand

Astro Black

Mistral Grey

Gloss White Colour Shown

Evolved by JT - Quadrant with JT Anti-Slipâ„¢ Size (radius)

RRP

Colour Option RRP

Code

Description

ASE80Q100

Gloss White 25mm Tray

800

beb

£458.70

ASE90Q100

Gloss White 25mm Tray

900

beb

£541.84

Evolved by JT - Square with JT Anti-Slipâ„¢ Colour Option RRP

Code

Description

Size (mm)

RRP

ASE76100

Gloss White 25mm Tray

760 x 760

beb

£332.56

ASE80100

Gloss White 25mm Tray

800 x 800

beb

£407.10

ASE90100

Gloss White 25mm Tray

900 x 900

beb

£570.50

Rectangle

Evolved by JT - Rectangle with JT Anti-Slipâ„¢ Colour Option RRP

Code

Description

Size (mm)

RRP

ASE1076100

Gloss White 25mm Tray

1000 x 760

beb

£570.50

ASE1080100

Gloss White 25mm Tray

1000 x 800

beb

£570.50

ASE1276100

Gloss White 25mm Tray

1200 x 760

beb

£607.78

ASE1280100

Gloss White 25mm Tray

1200 x 800

beb

£607.78

ASE1290100

Gloss White 25mm Tray

1200 x 900

beb

£607.78

ASE1480100

Gloss White 25mm Tray

1400 x 800

beb

£1,017.76

ASE1490100

Gloss White 25mm Tray

1400 x 900

beb

£1,017.76

ASE1580100

Gloss White 25mm Tray

1500 x 800

beb

£1,017.76

ASE1680100

Gloss White 25mm Tray

1600 x 800

£1,130.00

£1,341.70

ASE1780100

Gloss White 25mm Tray

1700 x 800

£1,130.00

£1,341.70

Code

Description

ASE1880100

Gloss White 25mm Tray

1800 x 800

£1,316.00

£1,562.45

EP1810100

Gloss White Panel Kit 1800 x 1000mm

All dimensions are in mm

EB20_Book.indb 189

Square

Quadrant

Evolved by JT - Quadrant Panel Kit Code

Description

RRP

EP100Q100

Gloss White Panel Kit 1000mm Quadrant

beb

Colour Option RRP £143.23

Evolved by JT - Square & Rectangle Panel Kit RRP beb

Colour Option RRP £143.23

Shower Trays

189 18/11/2019 15:45


Wetrooms

Clever and contemporary

Wetroom Solutions Corner Panel Glass-to-Glass Panel &GĆƒGEVQT2CPGN Linear Panel Bracing Kits

190 Wetrooms EB20_Book.indb 190

P192-193 P194 P195 P195 P196-197

Price includes VAT

18/11/2019 15:45


Ceiling bracing kit for extra stability - Page 19

&RQÆ“JXUDWLRQVKRZQ[&RUQHU3DQHODQG&HLOLQJ%UDFH.LW

Create your perfect wetroom tailored to your own individual style #TCPIGQHOQFGTPYGVTQQOINCUURCPGNUQNWVKQPUFGUKIPGFVQƂVUVTCKIJVFQYPVQVJGƃQQTQTYKVJQWTNQYNGXGNUJQYGTVTC[UVQ create a perfect unobtrusive look.

Wetrooms EB20_Book.indb 191

191 18/11/2019 15:45


Wetrooms / Corner Panel Corner Panel

3URƓOH(GJLQJLQFOXGHG%UDFLQJRSWLRQVDYDLODEOH

LIF

ETIME

10

G

UA

E

LIFETIME

EASY CLEAN

RANT

E

2m HIGH

Code

Description

RRP

E50031

400 Corner Wet Room Panel

£220.95

E50032

500 Corner Wet Room Panel

£228.57

E50033

600 Corner Wet Room Panel

£240.00

E50034

700 Corner Wet Room Panel

£251.43

E50035

760 Corner Wet Room Panel

£255.24

E50036

800 Corner Wet Room Panel

£259.05

E50037

900 Corner Wet Room Panel

£270.48

E50038

1000 Corner Wet Room Panel

£281.90

E50039

1100 Corner Wet Room Panel

£300.95

E50040

1200 Corner Wet Room Panel

£320.00

E50041

1400 Corner Wet Room Panel

£339.05

E50058

400 Corner Wet Room Panel

£247.62

E50059

500 Corner Wet Room Panel

£259.05

E50060

600 Corner Wet Room Panel

£274.29

E50061

700 Corner Wet Room Panel

£285.71

E50062

760 Corner Wet Room Panel

£297.14

E50063

800 Corner Wet Room Panel

£300.95

E50064

900 Corner Wet Room Panel

£316.19

E50065

1000 Corner Wet Room Panel

£331.43

E50066

1100 Corner Wet Room Panel

£354.29

E50067

1200 Corner Wet Room Panel

£377.14

E50068

1400 Corner Wet Room Panel

£400.00

8mm

10mm

0HDVXUHPHQW,QFOXGHV3URƓOH

&RUQHU3DQHO)L[HG'HŴHFWRU3DQHO/RZ/HYHO%UDFH

192 Wetrooms EB20_Book.indb 192

&RUQHU3DQHO[)L[HG'HŴHFWRU3DQHO/RZ/HYHO%UDFHZLWK6LGH3DQHO%UDFH

Price includes VAT

18/11/2019 15:45


Corner Panel / Wetrooms

• Corner Panel

• x2 Corner Panels

• x2 Corner Panels

• Corner Panel (in alcove)

• Low Level Brace Kit

• x2 Low Level Brace Kits

• Low Level Brace Kit

• Low Level Brace Kit

• Side Panel Brace Kit

• x2 Corner Panels

• Corner Panel

• Corner Panel

• x2 Corner Panels

• x2 Ceiling Brace Kits

• Ceiling Brace Kit

• 3LYRWLQJ'HŴHFWRU3DQHO

• )L[HG'HŴHFWRU

• Low Level Brace Kit

• Low Level Brace Kit

• x2 Corner Panels • Glass-to-Glass Panel • 'HŴHFWRU3DQHO • Low Level Brace Kit

“Corner Panels are a single piece of thick glass which separate a shower situated in the corner of a bathroom. Bright, large white tiles can create the illusion of space in smaller areas” Corner Panel with Low Level Brace.

All dimensions are in mm

EB20_Book.indb 193

Wetrooms

193 18/11/2019 15:45


Wetrooms / Glass-to-Glass Panel Glass-to-Glass Panel

3URƓOH(GJLQJLQFOXGHG%UDFLQJRSWLRQVDYDLODEOH LIF

ETIME

10

G

UA

HIGH

RANT

Description

RRP

E50042

600 Glass-to-Glass Front Wet Room Panel

£240.00

E50043

700 Glass-to-Glass Front Wet Room Panel

£251.43

E50044

760 Glass-to-Glass Front Wet Room Panel

£255.24

E50045

800 Glass-to-Glass Front Wet Room Panel

£259.05

E50046

900 Glass-to-Glass Front Wet Room Panel

£270.48

E50047

1000 Glass-to-Glass Front Wet Room Panel

£281.90

E50048

1100 Glass-to-Glass Front Wet Room Panel

£300.95

E50049

1200 Glass-to-Glass Front Wet Room Panel

£320.00

E50069

600 Glass-to-Glass Front Wet Room Panel

£274.29

E50070

700 Glass-to-Glass Front Wet Room Panel

£285.71

E50071

760 Glass-to-Glass Front Wet Room Panel

£297.14

E50072

800 Glass-to-Glass Front Wet Room Panel

£300.95

E50073

900 Glass-to-Glass Front Wet Room Panel

£316.19

E50074

1000 Glass-to-Glass Front Wet Room Panel

£331.43

E50075

1100 Glass-to-Glass Front Wet Room Panel

£354.29

E50076

1200 Glass-to-Glass Front Wet Room Panel

£377.14

8mm

10mm

0HDVXUHPHQW,QFOXGHV3URƓOH

E

LIFETIME

2m

EASY CLEAN

Code

E

Corner Panel x2. Glass-to-Glass Panel. Low Level Brace x2.

&RUQHU3DQHO[*ODVVWR*ODVV3DQHO)L[HG'HŴHFWRU3DQHO&HLOLQJ%UDFH6WUDLJKW%UDFH.LW

“Glass-to-Glass Panels are a single piece designed to be connected to each other to form a solid corner shape of glass. This design will suit larger bathrooms and allows for more light within the shower area”

194 Wetrooms EB20_Book.indb 194

Price includes VAT

18/11/2019 15:45


Deflector & Linear Panel / Wetrooms &GƃGEVQT2CPGN Code

Description

RRP

E50050

)L[HG'HŴHFWRU3DQHO

£163.81

E50051

3LYRWLQJ'HŴHFWRU3DQHO

£209.52

E50052

3LYRWLQJ'HŴHFWRU3DQHO

£217.14

E50053

3LYRWLQJ'HŴHFWRU3DQHO

£220.95

E50077

)L[HG'HŴHFWRU3DQHO

£194.29

E50078

3LYRWLQJ'HŴHFWRU3DQHO

£247.62

E50079

3LYRWLQJ'HŴHFWRU3DQHO

£255.24

E50080

3LYRWLQJ'HŴHFWRU3DQHO

£262.86

8mm

10mm

0HDVXUHPHQW,QFOXGHV3URƓOH LIF

ETIME

10

LIFETIME G

UA

EASY CLEAN

2m HIGH

E

3URƓOH(GJLQJLQFOXGHG%UDFLQJRSWLRQVDYDLODEOH

RANT

E

Linear Panel Code

Description

RRP

E50054

1000 Linear Wet Room Panel

£281.90

E50055

1100 Linear Wet Room Panel

£300.95

E50056

1200 Linear Wet Room Panel

£320.00

E50057

1400 Linear Wet Room Panel

£339.05

E50081

1000 Linear Wet Room Panel

£331.43

E50082

1100 Linear Wet Room Panel

£354.29

E50083

1200 Linear Wet Room Panel

£377.14

E50084

1400 Linear Wet Room Panel

£400.00

8mm

10mm

0HDVXUHPHQW,QFOXGHV3URƓOH LIF

ETIME

10

G

UA

EASY CLEAN

2m HIGH

E

LIFETIME

Linear Panel - Requires Bracing.

RANT

E

• x2 Corner Panels

• Linear Panel

• Linear Panel

• Linear Panel

• Glass-to-Glass Panel

• x2 Ceiling Brace Kits

• x2 Low Level Brace Kits

• [3LYRWLQJ'HŴHFWRU3DQHOV

• 'HŴHFWRU3DQHO

• x2 Low Level Brace Kits

• Low Level Brace Kit

All dimensions are in mm

EB20_Book.indb 195

Wetrooms

195 18/11/2019 15:45


Wetrooms / Bracing Kit Options

Bracing Kits

E50088

2 x Low Level Straight & 45 Deg Bracing Kits - Square

Square

Square

Low Level Straight & 45 Deg Bracing Kit

1 Metre Ceiling Bracing Kit

Code

Description

E50088

Low Level Brace Kit + 45 Deg - Square

RRP £102.86

Code

Description

E50089

Bracing Kit Ceiling 1000mm - Square

RRP £99.05

Square

Low Level Straight & 45 Deg Kit + Side Panel Bracing Kit

196 Wetrooms EB20_Book.indb 196

Code

Description

RRP

E50088

Low Level Brace Kit - Straight + 45 Deg - Square

£102.86

E50090

Side Panel Brace Kit (use with E50088) - Square

£102.86

Price includes VAT

18/11/2019 15:45


Bracing Kit Options / Wetrooms Round

Straight & 45 Deg Bracing Kit

Round

Code

Description

E50086

Brace Kit + 45 Deg - Round

RRP £102.86

Round

Straight 90 Deg Bracing Kit Code

Description

E50085

Brace Kit for 90 Deg Only - Round

Straight 90 Deg + Side Panel Bracing Kit RRP £64.76

Code

Description

RRP

E50085

Brace Kit for 90 Deg Only - Round

E50087

Side Panel Brace Kit - Round (use with E50085 or E50086)

£64.76 £102.86

E50086 Straight & 45 Deg Bracing Kit / E50087 Side Panel Brace Kit - Round

All dimensions are in mm

EB20_Book.indb 197

Wetrooms

197 18/11/2019 15:46


Wall Panelling / Xxx

Stunning surfaces

Wall Panelling Linda Barker Multipanel Classic Multipanel Heritage Multipanel 4GƃGEV/WNVKRCPGN Tile Multipanel PVC Economy Multipanel 9GVƃQT® Multipanel Flooring Click Multipanel Flooring Ceilings Multipanel Kitchen Splashbacks Multipanel

198 Wall Panelling EB20_Book.indb 198

P200-201 P202-203 P204-205 P206 P207 P208 P209 P210-211 P212 P213

Price includes VAT

18/11/2019 15:46


The smart alternative to bathroom & kitchen tiles 'CU[VQKPUVCNNCPFGXGPGCUKGTVQOCKPVCKPQWTYCNNRCPGNUĆƒQQTUCPFEGKNKPIUCTGRGTHGEVHQT [QWTUJQYGTDCVJTQQOQTMKVEJGP#XCKNCDNGKPCDTQCFTCPIGQHEQNQWTUVGZVWTGUCPFĆ‚PKUJGU enabling you to create a contemporary design that matches your personality. “With no grout joints where mould can thrive, shower panels simply wipe clean - protecting your walls from water ingressâ€?

Wall Panelling EB20_Book.indb 199

199 18/11/2019 15:46


Wall Panelling / Linda Barker Multipanel

Linda Barker Collection

Natural N and Authentic Tones

Linda Barker Multipanel - Calacatta Marble Shown

Sophistication made simple 5GV[QWTKOCIKPCVKQPHTGGCPFETGCVGDGCWVKHWNYCVGTRTQQHURCEGUYKVJ/WNVKRCPGNVJGNWZWTKQWU and practical way to refurbish your bathroom. Quick and easy to install, Multipanel lets you achieve stunning looks that will last for years to come. With Multipanel you can say hello to years of easy care and goodbye to cleaning grout and mould. #PFDGECWUG/WNVKRCPGNoUDGCWVKHWNYCNNUƃQQTUCPFEGKNKPIUEQOGKPCJWIGUGNGEVKQPQHGZSWKUKVG EQNQWTUCPFVGZVWTGUCYJQNGJQUVQHFGUKIPRQUUKDKNKVKGUQRGPWRHQT[QWVQTGKPXGPV[QWTDCVJTQQOKP a style uniquely yours.

200 Wall Panelling EB20_Book.indb 200

E E N YE

15 10

FI

G

UA

E

• Easy cleaning - a quick wipe down and • Smooth and virtually seamless results with watertight Hydrolock joint you’re done

FT

R

• Completely waterproof with no need to grout

A

• Quick and easy installation

RANT

E

Price includes VAT

18/11/2019 15:46


Linda Barker Multipanel / Wall Panelling Elements

Wood

Elements panels really pack a punch by conveying mood and atmosphere. Subtle hues and the incredibly solid CRRGCTCPEGQHVJGUGRCPGNUƂVVJGDKNNRGTHGEVN[HQT achieving that ultra modern industrial look.

With a slightly weathered look, our panels GZWFGIGPVNGYCTOVJCPFVGZVWTGVJCVYKNN transform your bathroom into a place of calm and tranquillity.

T

Stone Elements 8831

T

Concrete Elements 8830

T

Corten Elements 8832

T

T

Graphite Elements 8833

Concrete Formwood 6362

T

Salvaged Planked Elm 9480

Key

Stone

T 6GZVWTGF

Emulate the swankiest hotel bathrooms by getting the look and feel of real stone and marble, but at a fraction of the cost. T

T

Calacatta Marble 3460

Bianca Luna 3421

Soapstone Stellar 3459

Dolce Macchiato 3478

Linda Barker Collection - Panels

)HUUR*UDƓWH 9483

1HUR*UDƓWH 9485

Jet Noir 3476

'ZVTWUKQPU

Bright Polished

Satin Anodised

White/ Black

RRP

RRP

RRP

Type A Internal Corner

£48.34

£23.44

£25.87

Type B External Corner

£51.23

£27.23

£29.53

£318.76

Type 100 Flush Corner

£64.03

£34.07

£36.94

2400 x 900

£318.76

Type C End Cap (L-shaped)

£43.73

£13.43

£16.13

2400 x 598

£170.92

Type D Continuous ‘H’ Joint

£40.80

£18.23

£20.74

Type E Quadrant End Cap

£52.70

£19.00

£22.24

Type Y Last Corner

£48.34

£23.44

£25.87

7\SH;%DVH3URƓOH

n/a

£24.07

n/a

Description

Size (mm)

RRP

Unlipped Panel

2400 x 1200

£295.68

Description

Unlipped Panel

2400 x 900

£295.68

Unlipped Panel

2400 x 598

£147.84

Hydrolock Panel

2400 x 1200

Hydrolock Panel Hydrolock Panel

*These extrusions are for the Linda Barker, Classic and Heritage Collections. Hydrolock joint

All dimensions are in mm

EB20_Book.indb 201

Wall Panelling

201 18/11/2019 15:46


Wall Panelling / Classic Multipanel

Classic

Timeless Sophistication

E E N YE

UA

E

G

R

FI

A

15 10 FT

RANT

E

&ODVVLF0DUƓO&UHDPZLWK/LQGD%DUNHU'ROFH0DFFKLDWR)HDWXUH:DOO6KRZQ

#EQNNGEVKQPQHGPFWTKPIEQNQWTUCPFƂPKUJGU Crafted to complement the widest range of interiors, our timeless Classic Collection is guaranteed to bring more than a little sophistication and elegance to your home. Choose from Classic’s fabulous colours, VGZVWTGUCPFƂPKUJGUVQCEJKGXGCUGPUGQHFTCOCVJCVRGTHGEVN[OCVEJGU[QWTQYPFGUKIPXKUKQP;QWECP also combine feature walls with our other ranges such as the Linda Barker Collection.

Classic Collection - Panels - Standard Description

Size (mm)

Unlipped Panel

2400 x 1200

Unlipped Panel

Classic Collection - Panels - Premier RRP

Description

Size (mm)

£239.78

Unlipped Panel

2400 x 1200

£263.52

2400 x 900

£239.78

Unlipped Panel

2400 x 900

£263.52

Unlipped Panel

2400 x 598

£119.89

Unlipped Panel

2400 x 598

£131.76

Hydrolock Panel

2400 x 1200

£262.86

Hydrolock Panel

2400 x 1200

£286.60

Hydrolock Panel

2400 x 900

£262.86

Hydrolock Panel

2400 x 900

£286.60

Hydrolock Panel

2400 x 598

£142.97

Hydrolock Panel

2400 x 598

£154.84

202 Wall Panelling EB20_Book.indb 202

RRP

Price includes VAT

18/11/2019 15:46


Classic Multipanel / Wall Panelling Earth textures /WNVKRCPGN%NCUUKE%QNNGEVKQPJCUCPGZSWKUKVGUGNGEVKQPQHVGZVWTGFÆ‚PKUJGUCNNTKEJKPFGRVJCPFEQNQWT VJCVVTCPUOKVYCTOVQPGURGTHGEVHQTETGCVKPIVJGWNVKOCVGGPXKTQPOGPVHQTTGNCZCVKQP T

Riven Marble 9241

P T

0DUÆ“O&UHDP 9477

P T

Warm Mica 835

P T

Jupiter Silver 3458

P T

T

Arctic Stone 3331

Key

Stone

Riven Slate 2859

T 6GZVWTGF

P Premier

'NGICPVVTCFKVKQPCNINQUUÆ‚PKUJGUFGUKIPGFVQETGCVGCYQYHCEVQTKP[QWTJQOG(GCVWTKPIPCVWTCNCPF RTGEKQWUUVQPGVJGUGÆ‚PKUJGUVTCPURQTVVJGPCVWTCNYQTNFKPVQVJGJGCTVQH[QWTJQOG

Classic Marble 141H

Grey Marble 139H

Natural India 194H

Travertine 3526

Antique Marble 701

Cappuccino Stone 7256

Contemporary /QFGTPINQUURCPGNUETGCVGCUVWPPKPIDCEMFTQRHQT[QWTKPVGTKQT9KVJURGEVCEWNCTNKIJVTGƃGEVKQPVJGUG striking panels enhance room dynamics, creating a bright, vibrant space. P

White G85

Frost White 049

Blizzard G030

All dimensions are in mm

EB20_Book.indb 203

P

White Snow 3308

P

Twilight G033

P

Stardust 3306

Wall Panelling

203 18/11/2019 15:46


Wall Panelling / Heritage Multipanel

Heritage

Cool Relaxed Colours

Heritage Collection Winchester Linewood, Faversham Matte and Click Flooring Natural Weathered Oak Shown

Escape to a world of elegance The subtle colour harmonies of the Heritage Collection will help you create a charming period style DCVJTQQOVJCVGZWFGUECNOCPFUGTGPKV[5WORVWQWUVGZVWTGUCPFJWGUYKNNGPJCPEGCPFVTCPUHQTOCP[ space, giving you a cool elegant bathroom that you’ll admire for years to come. Heritage Collection - Panels

'ZVTWUKQPU

Bright Polished

Satin Anodised

White/ Black

RRP

RRP

RRP

Type A Internal Corner

£48.34

£23.44

£25.87

Type B External Corner

£51.23

£27.23

£29.53

Type 100 Flush Corner

£64.03

£34.07

£36.94

£291.72

Type C End Cap (L-shaped)

£43.73

£13.43

£16.13

£157.39

Type D Continuous ‘H’ Joint

£40.80

£18.23

£20.74

Type E Quadrant End Cap

£52.70

£19.00

£22.24

Type Y Last Corner

£48.34

£23.44

£25.87

7\SH;%DVH3URƓOH

n/a

£24.07

n/a

Description

Size (mm)

Unlipped Panel

2400 x 1200

£268.64

Description

Unlipped Panel

2400 x 900

£268.64

Unlipped Panel

2400 x 598

£134.32

Hydrolock Panel

2400 x 1200

£291.72

Hydrolock Panel

2400 x 900

Hydrolock Panel

2400 x 598

E E N YE

UA

E

G

R

FI

A

15 10 FT

RRP

RAN

TE

204 Wall Panelling EB20_Book.indb 204

*These extrusions are for the Linda Barker, Classic and Heritage Collections.

Price includes VAT

18/11/2019 15:46


Heritage Multipanel / Wall Panelling Smooth Each of these modern neutrals blend perfectly with other colours from the Heritage palette.

Kew Gloss 10665

Esher Matte 5344

Faversham Matte 5349

Henley Gloss 10232

Textile

Linewood

With the look of woven fabric, you can introduce a sense of depth to your design.

%TGCVGVGZVWTGCPFKPVGTGUVQP[QWTYCNNU YKVJVJGWPFGTUVCVGFÆ‚PGITCKPQH.KPGYQQF. T

T

Marlow Linewood L7927

Esher Linewood L5344

T

Faversham Linewood L5349

T

Winchester Linewood L7961

T

Sarum Twill Plex 8827

T

Neutral Twill Plex 8826

T

Graphite Twill Plex 8829

Dark Grey Sealant Recommended with Graphite Twill Plex When Using Hydrolock Joint

Wood

Radiating warm tones, waterproof panels that look and feel just like wood and act as a counterpoint to cooler shades. T

T

T

T

Key T 6GZVWTGF Alabaster Oak 8854

Rural Oak 8853

Delano Oak 8966

All dimensions are in mm

EB20_Book.indb 205

Logan Oak 8967

Wall Panelling

205 18/11/2019 15:47


Wall Panelling / Reflect Multipanel

Reflect

High Shine Impression

5HÅ´HFW0XOWLSDQHO$TXD6KRZQ

Refresh your bathroom with a DGCWVKHWNCPFJCTFYGCTKPIHCWZINCUU

+H[QWYCPVVJGUNGGMEQPVGORQTCT[NQQMQHINCUUVJG4GƃGEV4CPIGKUHQT[QW/CFGHTQOCVQWIJFWCN NC[GTGFCET[NKEVJGUGOOVJKEMJKIJN[TGƃGEVKXGRCPGNUJCXGCUVWPPKPIFGRVJVJCVETGCVGVJGNWUVTGCPF KNNWUKQPQHTGCNINCUU'CU[VQEWVCPFƂV[QWECPETGCVGCIQTIGQWUDGURQMGFGUKIPVJCVYKNNJCXGGPFWTKPI good looks for years to come. #XCKNCDNGKPCJCPFRKEMGFEQNNGEVKQPQHEQNQWTU4GƃGEV4CPIGKUVJGRGTHGEVEJQKEGHQTCUVWPPKPIFGUKIP statement in your bathroom. 4GƃGEV'ZVTWUKQPU$TKIJV2QNKUJGF Description

White MRFWHI

Aqua MRFAQU

RRP

Type 10 - Internal Corner - 2500mm

£30.73

Type 12 - External Corner - 2500mm

£30.73

Type 14 - End Cap - 2500mm

£23.06

Type 16 - Mid-Joint - 2500mm

£27.67

)RUXQLQWHUUXSWHGFRORXUWKH5HÅ´HFWUDQJHH[WUXVLRQVFDQEHFRORXU matched to the panel colour - contact us for details.

All decors Description Black MRFBLK

206 Wall Panelling EB20_Book.indb 206

2440 x 1220 x 4mm

Grey MRFGRY

RRP £608.64

4GƃGEV4CPIG;GCT)WCTCPVGG Price includes VAT

18/11/2019 15:47


Tile Range Multipanel / Wall Panelling

Tile Range

Beautiful tile effect without the hassle of grout. Tile effect wall panels offer the same high-end look of tiles, but without the installation and maintenance issues. These 3mm VJKEMYCVGTRTQQHRCPGNUECPDGKPUVCNNGFQXGTGZKUVKPIVKNGU

Clean, fresh & mould-free Classic Brick

Bold Bevels

5K\GQHGCEJVKNGZOO T

5K\GQHGCEJVKNGZOO T

T

T

White MTPRWH

White

Black

Horizontal MTPBHWH

Vertical MTPBVBL

Vertical MTPBVGR

Horizontal MTPBHBL

White Galaxy MTPRWG

White Slate MTPRWS

Large Format Tile

Grey

Vertical MTPBVWH

T

T

5K\GQHGCEJVKNGZOO T

T

T

Horizontal MTPBHGR

Key T 6GZVWTGF

White Stone - Embossed SS5101

Light Grey Stone - Embossed SS9385

Charcoal Stone - Embossed SS5071

Embossed 5K\GQHGCEJVKNG5OCNNZOOCPF.CTIGZOO

White Large Matt 5101L Small Gloss 5101S

White Slate Large Matt 7145L Small Gloss 7145S

Graphite Large Matt 9196L Small Gloss 9196S

Black Slate Large Matt 7146L Small Gloss 7146S

Bright Polished

Satin Anodised

White/Black

RRP

RRP

RRP

Type F - End Cap (l shaped) - 2450mm

£32.03

£25.73

£25.54

Type G - Continuous ‘h’ joint - 2450mm

£40.27

£20.36

£24.40

Type H - External Corner - 2450mm

£48.37

£25.87

£28.40

Type J - Internal Corner - 2450mm

£40.10

£21.10

£26.27

Type Z - Last Corner - 2450mm

£40.10

£21.10

£26.27

#NWOKPKWO'ZVTWUKQPU Description

Black Large Matt 5071L Small Gloss 5071S

All Colours Description

RRP

2440 x 1220 x 3mm

£198.79

6KNG4CPIG;GCT)WCTCPVGG All dimensions are in mm

EB20_Book.indb 207

Wall Panelling

207 18/11/2019 15:47


Wall Panelling / PVC Economy Multipanel

PVC Economy Stylish practical panels

Cost effective without compromise on quality or looks, the multipanel Economy range is a great choice. +VKUSWKEMCPFGCU[VQÆ‚VVJCPMUVQCPKPPQXCVKXGVQPIWGCPFITQQXGU[UVGO#XCKNCDNGKPCEJQKEGQH attractive designs. S

P

Snow Drift MPPSD

Sunlit Quartz MPPSQ

White Marble MPPWHM

S

Byzantine Marble MPPBM

P Premier

P T

Aruban Sand MPPAS

P

Urban Stucco Venetian MPPUSV P

Urban Stucco Grey MPPUSG

P

Moonlit Quartz MPPMQ

T 6GZVWTGF

•

 ZZOO28%RCPGNU

•

Tongue and groove installation

•

P

Urban Concrete Grey MPPUCG

S

Roman Marble MPPRM

S Standard

P

 %NCUUÆ‚TGTCVKPI

PVC Economy - Wall Panelling Description

S

RRP

P

RRP

2400 x 100 x 10mm PVC Panel - Single Panel Pack (Product code plus SP)

£144.58

£156.05

2400 x 100 x 10mm PVC Panel - Double Panel Pack

£251.06

£274.03 Urban Concrete Grey PVC Economy Panels Shown

28%'EQPQO[4CPIG;GCT)WCTCPVGG 208 Wall Panelling EB20_Book.indb 208

Price includes VAT

18/11/2019 15:47


WetFlor Multipanel / Flooring

WetFlor

®

Modern safety flooring Vinyl WetFlor® provides a practical and safe solution for more active bathrooms. With impressive slip resistance and easy maintenance, it makes for a great choice for those with young EJKNFTGPQTYJGPGZVTCVTCEVKQPKUTGSWKTGF

Technical details

A perfect companion to Multipanel wall coverings to create a high quality bathroom with beautiful long lasting looks.

•

R11 slip resistance

•

OYKFGTQNNOGVTGEWVNGPIVJUCXCKNCDNGWRVQO HWNNTQNN

•

5WKVCDNGHQTWUGYKVJWPFGTƃQQTJGCVKPI

• •

2.0mm thick vinyl 44.RGPFWNWOVGUV YGV

Coving profile (B)

(A)

(C)

PVC - 1.90m length.

Available in two sizes: A

Type 18

Type 35

18mm

35.5mm

B

25mm

50mm

C

1.3mm

1.4mm

Welding rod

Multipanel WetFlor® welding rods ensure a watertight seal between sheets and at coved corners. The 2mm wide rods are available by the linear metre in a base colour matching your chosen WetFlor® décor.

Classic Collection Blizzard and Twilight - WetFlor® Quicksilver

WetFlor® Range 5V[NKUJCPFFWTCDNGUNKRTGUKUVCPVƃQQTKPIHQT[QWT/WNVKRCPGNYGVTQQO

Coral MWFCRL

Saturn MWFSAT

Mars MWFMAR

Tidal Wave MWFTID

Neptune MWFNEP

Quicksilver MWFQUI

Deep Sea MWFDEE

WetFlor - Accessories Description

RRP

WetFlor Safety Vinyl Flooring - Price per m² 1.9m wide rolls – cut lengths available by the metre WetFlor 2mm wide Welding Rods

£3.05

All dimensions are in mm

EB20_Book.indb 209

£60.02

9GV(NQT4CPIG;GCT)WCTCPVGG Wall Panelling

209 18/11/2019 15:48


Flooring / Click Timber Multipanel

Click

Interlocking Installation

Markham Calhoun Oak Click Timber Flooring Shown

Click Timber - Flooring Plank Effect #PGNGICPVCPFVKOGNGUUENCUUKEVJGUGDGCWVKHWNVKODGTGHHGEVUYKNNKPUVCPVN[CFFCPGUUGPEGQHNWZWT[VQ [QWTKPVGTKQTU%JQQUGHTQOCYKFGTCPIGQHƂPKUJGUVQEQORNGOGPVCP[FÅEQTHTQOVJGVTCFKVKQPCN%NCUUKE Oak and warm richness of American Walnut to the understated Aspen Oak for a more minimalist look. 6JGUWDVNGDGCFEQCVKPIOGCPUVJCV[QWECPNQQMHQTYCTFVQ[GCTUQHCITGCVNQQMKPIƃQQT

Aspen Oak Limed

MTFCASP

Markham Calhoun Oak

MTFCMAR

Coastal Grey Oak

MTFCCOA

Driftwood Grey Oak - (7 Pieces - 1.86m2 - Plank measures - 1210 x 220mm)

MTFCDGO

Aspen Oak Black

MTFCAOB

Natural Weathered Oak

MTFCNWO

Warm Smoked Oak

MTFCWSO

Click Timber - Interlocking Panel Flooring Description 8 Pieces - 1.84m2 (each plank measures 1210 x 190mm)

210 Wall Panelling EB20_Book.indb 210

RRP £136.96

%NKEM(NQQT4CPIG;GCT)WCTCPVGG Price includes VAT

18/11/2019 15:48


Click Tile Flooring Multipanel / Flooring

Click Tile - Flooring Tile Effect %NKEMXKP[NVKNGUCTGFGUKIPGFVQOKOKEVJGPCVWTCNDGCWV[QHTGCNUVQPGCPFOCTDNG#FFKPICNWZWTKQWUVQWEJ VQ[QWTJQOGVJKUDGCWVKHWNVGZVWTGFƃQQTKPIETGCVGUCYGNEQOKPICPFYCTOURCEGVQTGNCZKP

Rimini

MTFCRIM

Piemonte

MTFCPIE

Espana Cadiz

MTFCESC

Urban Anthracite Grey

MTFCUAG

Sicilia

MTFCSIC

Medina Black

MTFCMBL

Click Tiles - Interlocking Panel Flooring Description

RRP

10 Pieces - 1.84m2 (each tile measures 605 x 304mm) Urban Graphite Grey

£142.70

MTFCUGG

Sicilia Click Tile Flooring Shown

Click Premier - Flooring Tile Effect Premier tiles include embedded metallic foils to create a sparkle effect.

White Diamond

MTFCDIA

Silver Opal

MTFCOPA

Pearl

MTFCPEA

Black Onyx

MTFCONY

Click Premier Tiles - Interlocking Panel Flooring Description

RRP

10 Pieces - 1.84m2 (each tile measures 605 x 303mm)

All dimensions are in mm

EB20_Book.indb 211

£167.58

Wall Panelling

211 18/11/2019 15:48


Wall Panelling / Ceilings Multipanel

Ceiling panels No more painting! Multipanel Ceiling - White Gloss Shown

Ceilings Complete your bathroom design with a simple paint and plaster-free ceiling. 6JGUGUNGGMEGKNKPIRCPGNUCTGVJGRGTHGEVEJQKEGHQTVJQUGYJQFQPQVYCPVVJGFKHÆ‚EWNVVKOGEQPUWOKPI job of painting, plastering and decorating hard-to-reach places.

White Matt

White Sparkle

Soft Grey Marble

MCPMW

White Gloss

MCPGW

MCPWS

White Ash

MCPWA

Pergamon Marble

MCPPM

MCPSGM

Panels 8mm PVC Panels 2700mm x 250mm x 8mm (4 panels per pack)

%GKNKPI2CPGN'ZVTWUKQPU Coverage 2.7

Price £76.08

Type K Cont Joint

Type L End Cap

Type M Ceiling Mount

Type N Internal Corner

Type O External Corner

Type P Clip-In Trim

Silver

£9.04

£9.04

£9.04

£13.13

£13.13

£9.04

White

£9.04

£9.04

£9.04

£13.13

£13.13

£9.04

Type/Finish

%GKNKPI5RNCUJDCEM4CPIG;GCT)WCTCPVGG 212 Wall Panelling EB20_Book.indb 212

Price includes VAT

18/11/2019 15:48


Kitchen Splashbacks Multipanel / Wall Panelling

Kitchen Splashbacks - Easy cleaning, stunning looks Multipanel walls can also be used as splashbacks in your kitchen. Combine with stainless steel hob splashback • ZOOZOO • 1mm thick stainless steel wrapped around 6mm/12mm thick moisture resistant MDF • Use 7mm thick stainless steel hob splashback with Multipanel 4GƃGEV and Tile range • Select 13mm thick stainless steel hob splashback with Linda Barker, Classic and Heritage collections %QODKPG4GƃGEVTCPIGYKVJDCEMEQNQWTGF glass hob splashback • ZOOZOO • 4mm thick toughened glass, back-painted to match Multipanel 4GƃGEVsplashbacks All Decor Size

760 x 700mm 760 x 1000mm

Stainless steel hob splashback PPWKLFN IRUXVHZLWK7LOHDQG5HÅ´HFW5DQJHV 

£205.86

£250.38

13mm thick (for use with Linda Barker, Heritage, Classic Collections)

£227.80

£272.64

Back-coloured Glass hob splashback PPWKLFN IRUXVHZLWK7LOHDQG5HÅ´HFWUDQJHV

£277.36

All dimensions are in mm

EB20_Book.indb 213

£371.57

Stainless Steel Kitchen Splashback with Black Small Embossed Tile Range Shown

Wall Panelling

213 18/11/2019 15:48


Towel Rails / Xxx

Wonderfully warming

Heating Towel Rails Designer Towel Rails Designer Radiators Radiator Valves 'NGEVTKE7PFGTƃQQT*GCVKPI

214 Towel Rails EB20_Book.indb 214

P216-221 P222-237 P238-255 P256-257 P258-263

Price includes VAT

18/11/2019 15:48


Designed to create a great impression

Stylish heating is an important aspect to any home. Our collection of towel rails and radiators has DGGPECTGHWNN[EJQUGPVQTGĆƒGEVCNNVCUVGUJGNRKPI[QWOCMGCTGCNFKHHGTGPEGVQ[QWTNKXKPIURCEG “Remember to calculate the heat loss of your space to make sure your new radiator meets your requirementsâ€? Towel Rails EB20_Book.indb 215

215 18/11/2019 15:49


Towel Rails / 22mm Straight Chrome

Towel Rail

Straight Chrome Bar - 22mm

E E N YE

MILD STEEL

E

FI

UA

R

G

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

OO5VTCKIJV%JTQOG6QYGN4CKN %GPVTCN*GCVKPI1PN[ Code

Height (mm)

Width (mm)

Watts

BTUs

Electric Element (Watts)

E70001

600

400

172

586

100

£78.19

RRP

E70003

600

500

208

711

125

£86.82

E70004

600

600

245

837

150

£93.83

E70005

800

300

167

569

100

£82.77

E70002

800

400

209

711

125

£86.37

E70006

800

500

252

858

150

£94.61

E70007

800

600

295

1005

150

£103.17

E70447

800

750

359

1225

200

£122.85

E70008

1000

300

204

695

150

£97.62

E70009

1000

400

256

874

150

£106.61

E70010

1000

500

305

1053

200

£115.46

E70011

1000

600

361

1231

200

£127.17

E70012

1200

300

250

854

200

£110.11

E70013

1200

400

313

1070

200

£121.23

E70014

1200

500

378

1291

200

£132.19

E70015

1200

600

443

1512

300

£135.79

E70448

1200

750

537

1837

300

£138.26

E70016

1400

500

431

1470

300

£154.67

E70017

1400

600

504

1721

300

£168.26

E70018

1600

400

412

1407

300

£153.54

E70019

1600

500

495

1689

300

£165.15

E70020

1600

600

580

1979

400

£178.96

E70021

1800

400

464

1584

400

£174.52

E70022

1800

500

558

1903

400

£184.09

E70023

1800

600

654

2232

400

£199.46

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

216 Towel Rails EB20_Book.indb 216

Price includes VAT

18/11/2019 15:49


22mm Curved Chrome / Towel Rails

Towel Rail

Curved Chrome Bar - 22mm

E E N YE

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

OO%WTXGF%JTQOG6QYGN4CKN %GPVTCN*GCVKPI1PN[ Code

Height (mm)

Width (mm)

Watts

BTUs

Electric Element (Watts)

RRP

E70024

800

500

251

858

150

£100.02

E70025

800

600

295

1005

150

£106.77

E70026

1000

500

309

1053

200

£122.01

E70027

1000

600

361

1231

200

£131.45

E70028

1200

500

378

1291

200

£137.77

E70029

1200

600

443

1512

300

£140.37

E70030

1400

500

431

1470

300

£157.04

E70031

1400

600

504

1721

300

£170.24

E70032

1600

500

495

1689

300

£173.22

E70033

1600

600

580

1979

400

£185.22

E70034

1800

500

558

1903

400

£195.44

E70035

1800

600

654

2232

400

£211.78

E70449

1800

750

815

2761

400

£237.37

Dual fuel option available with these rails. See electrical elements on page 257 $OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 217

Towel Rails

217 18/11/2019 15:49


Towel Rails / 25mm Straight - Chrome or White

Premium Rail Straight Bar - 25mm

OO5VTCKIJV%JTQOG %GPVTCN*GCVKPI1PN[ Height (mm)

Width (mm)

Watts

BTUs

Electric Element (Watts)

E70036

800

300

177

604

100

£117.00

E70037

800

400

226

771

125

£139.24

E70038

800

500

275

938

150

£145.55

E70039

800

600

324

1105

200

£163.76

E70040

1000

500

351

1198

300

£188.93

E70041

1000

600

414

1413

400

£207.25

E70042

1200

300

273

932

200

£164.19

E70043

1200

400

351

1196

300

£193.91

E70044

1200

500

428

1460

300

£198.21

E70045

1200

600

505

1723

400

£215.33

E70046

1500

500

534

1823

300

£250.66

E70047

1500

600

631

2154

400

£281.33

E70048

1800

400

521

1779

600

£254.61

E70049

1800

500

638

2176

600

£291.00

E70050

1800

600

754

2572

600

£326.65

Code

RRP

OO5VTCKIJV9JKVG %GPVTCN*GCVKPI1PN[ BTUs

Electric Element (Watts)

271

923

100

£83.05

346

1179

125

£91.91

500

420

1434

150

£100.48

600

495

1689

200

£112.13

1200

300

423

1444

200

£114.67

1200

400

543

1853

300

£119.22

E70057

1200

500

663

2261

300

£132.56

E70058

1200

600

782

2669

400

£145.84

E70059

1500

500

819

2796

300

£147.18

E70060

1500

600

968

3304

400

£160.27

E70061

1800

400

792

2703

600

£173.82

E70062

1800

500

969

3305

600

£185.82

E70063

1800

600

1145

3908

600

£207.42

Height (mm)

Width (mm)

Watts

E70051

800

300

E70052

800

400

E70053

800

E70054

800

E70055 E70056

Code

RRP

25mm - Straight Chrome - Sealed Electric Rails Code

E

FI

R

UA

A

G

RANT

E

Width (mm)

Watts

800

500

150

£262.80

E70083

800

600

200

£284.05

E70084

1200

500

300

£348.99

E70085

1200

600

400

£375.11

E70082

E E N YE

15 10 FT

Height (mm)

MILD STEEL

DUAL .FUEL .OPTION .

25mm BARS

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

218 Towel Rails EB20_Book.indb 218

Price includes VAT

18/11/2019 15:49


25mm Curved - Chrome or White / Towel Rails

Premium Rail Curved Bar - 25mm

OO%WTXGF%JTQOG %GPVTCN*GCVKPI1PN[ Code E70064

Height (mm)

Width (mm)

Watts

BTUs

Electric Element (Watts)

800

500

275

938

150

£159.49

RRP

E70065

800

600

324

1105

200

£181.73

E70066

1000

500

351

1198

300

£192.74

E70067

1000

600

414

1413

400

£211.34

E70068

1200

500

428

1460

300

£223.02

E70069

1200

600

505

1723

400

£242.58

E70070

1500

500

534

1823

300

£268.80

E70071

1500

600

631

2154

400

£298.87

E70072

1800

500

638

2176

600

£304.84

E70073

1800

600

754

2572

600

£346.59

OO%WTXGF9JKVG %GPVTCN*GCVKPI1PN[ Height (mm)

Width (mm)

Watts

BTUs

Electric Element (Watts)

E70074

800

500

420

1434

150

£102.64

E70075

800

600

495

1689

200

£114.42

E70076

1200

500

663

2261

300

£135.14

E70077

1200

600

782

2669

400

£150.42

E70078

1500

500

819

2796

300

£148.20

E70079

1500

600

968

3304

400

£166.20

E70080

1800

500

969

3305

600

£193.02

E70081

1800

600

1145

3908

600

£213.95

RRP

E E N YE

15 10 FT

A

UA

E

G

R

Dual fuel option available with these rails. See electrical elements on page 257

FI

Code

RAN

TE

MILD STEEL

DUAL FUEL .OPTION .

.

25mm BARS

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 219

Towel Rails

219 18/11/2019 15:49


Towel Rails / 25mm Coloured

Coloured Rail Straight Bar - 25mm

Hot tip! Coloured rails have around 30% more heat output than Chrome rails

E E N YE

Espresso Gloss Rail

220 Towel Rails EB20_Book.indb 220

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RAN

TE

COLOUR OPTIONS

DUAL FUEL .OPTION .

.

25mm BARS

Price includes VAT

18/11/2019 15:49


25mm Coloured / Towel Rails

Alternative colours available

Anthracite Textured

Mocha Brown Textured

Black Gloss

Cappuccino Textured

Latte Beige Textured

OO%QNQWTGF6QYGN4CKN %GPVTCN*GCVKPI1PN[ Code

Colour

Height (mm)

Width (mm)

Watts

BTUs

Electric Element (Watts)

RRP

E70086

Anthracite

800

500

420

1434

150

£153.75

E70087

Black

800

500

420

1434

150

£153.75

E70088

Cappuccino

800

500

420

1434

150

£153.75

E70089

Espresso

800

500

420

1434

150

£153.75

E70090

Latte Beige

800

500

420

1434

150

£153.75

E70091

Mocha Brown

800

500

420

1434

150

£153.75

E70092

Anthracite

1200

300

424

1444

200

£169.05

E70093

Black

1200

300

424

1444

200

£169.05

E70094

Cappuccino

1200

300

424

1444

200

£169.05

E70095

Espresso

1200

300

424

1444

200

£169.05

E70096

Latte Beige

1200

300

424

1444

200

£169.05

E70097

Mocha Brown

1200

300

424

1444

200

£169.05

E70098

Anthracite

1200

500

663

2261

300

£194.93

E70099

Black

1200

500

663

2261

300

£194.93

E70100

Cappuccino

1200

500

663

2261

300

£194.93

E70101

Espresso

1200

500

663

2261

300

£194.93

E70102

Latte Beige

1200

500

663

2261

300

£194.93

E70103

Mocha Brown

1200

500

663

2261

300

£194.93

E70104

Anthracite

1200

600

783

2669

400

£211.05

E70105

Black

1200

600

783

2669

400

£211.05

E70106

Cappuccino

1200

600

783

2669

400

£211.05

E70107

Espresso

1200

600

783

2669

400

£211.05

E70108

Latte Beige

1200

600

783

2669

400

£211.05

E70109

Mocha Brown

1200

600

783

2669

400

£211.05

E70110

Anthracite

1800

500

969

3305

600

£266.25

E70111

Black

1800

500

969

3305

600

£266.25

E70112

Cappuccino

1800

500

969

3305

600

£266.25

E70113

Espresso

1800

500

969

3305

600

£266.25

E70114

Latte Beige

1800

500

969

3305

600

£266.25

E70115

Mocha Brown

1800

500

969

3305

600

£266.25

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 221

Towel Rails

221 18/11/2019 15:49


Designer Towel Rails / Narva - Stainless Steel RTY YEA HI

UA

E

R

T

30 10

G

RANT

E

STAINLESS STEEL

DUAL FUEL .OPTION .

.

Narva

Narva

Straight Stainless Steel

Curved Stainless Steel

Narva - Straight Rounded Bar - Stainless Steel Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Bars

Pipe Centres

Watts

BTUs

800

400

12

368

197

672

E70190

£376.64

E70192

£491.37

E70191

£562.26

800

500

12

468

243

829

E70193

£412.29

E70195

£526.36

E70194

£597.92

800

600

12

568

269

918

E70196

£471.00

E70198

£585.06

E70197

£656.62

1200

400

18

368

294

1003

E70199

£514.77

E70201

£630.98

E70200

£700.39

1200

500

18

468

348

1187

E70202

£555.98

E70204

£671.87

E70203

£741.60

1200

600

18

568

402

1372

E70205

£651.44

E70207

£766.80

E70206

£837.06

1600

400

24

368

391

1334

E70208

£713.08

E70210

£833.46

E70209

£898.74

1600

500

24

468

464

1583

E70211

£798.79

E70213

£917.53

E70212

£984.41

1600

600

24

568

536

1829

E70214

£842.97

E70216

£963.63

E70215

£1,028.62

Code

RRP

Code

RRP

Code

RRP

Narva - Curved Rounded Bar - Stainless Steel Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Bars

Pipe Centres

Watts

BTUs

800

500

12

468

243

829

E70217

£428.46

E70219

£547.33

E70218

£614.08

800

600

12

568

269

918

E70220

£489.54

E70222

£607.80

E70221

£675.16

1200

500

18

468

348

1187

E70223

£613.14

E70225

£729.92

E70224

£798.76

1200

600

18

568

402

1372

E70226

£699.03

E70228

£816.09

E70227

£884.65

1600

500

24

468

464

1583

E70229

£830.94

E70231

£948.63

E70230

£1,016.56

1600

600

24

568

536

1829

E70232

£876.54

E70234

£996.28

E70233

£1,062.16

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

222 Designer Towel Rails EB20_Book.indb 222

Price includes VAT

18/11/2019 15:49


Huka - Stainless Steel / Designer Towel Rails

Huka

Straight Bar Stainless Steel

RTY YEA HI

R

T

30 10 UA

E

G

STAINLESS STEEL

RANT

E

DUAL FUEL .OPTION .

.

Huka - Straight Rounded Bar - Stainless Steel Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

BTUs

600

750

100

9

718

419

1430

E70350

£413.12

E70352

£535.58

E70351

£598.74

600

1000

100

9

968

517

1765

E70353

£476.53

E70355

£598.74

E70354

£662.15

800

750

100

12

718

529

1805

E70356

£502.01

E70358

£624.22

E70357

£687.63

800

1000

100

12

968

682

2327

E70359

£549.00

E70361

£671.08

E70360

£734.62

Dual fuel option available with these rails. See electrical elements on page 257 All dimensions are in mm

EB20_Book.indb 223

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

Designer Towel Rails

223 18/11/2019 15:49


Designer Towel Rails / Edessa - Chrome

E E N YE

E

MILD STEEL

Edessa Straight Tube

E

DUAL FUEL .OPTION ..

Curved Tube

.

RANT

MILD STEEL

Edessa

DUAL .FUEL .OPTION ..

UA

E

FI

E

FI

G

RANT

R

R

UA

E E N YE

15 10

A

G

FT

A

15 10 FT

.

.

Edessa - Straight Oval Tube - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

BTUs

772

500

76-99

13

450

290

988

E70302

£192.32

E70304

£317.62

E70303

£377.94

772

600

76-99

13

550

347

1185

E70305

£207.54

E70307

£332.59

E70306

£393.16

1186

500

76-99

20

450

465

1586

E70308

£267.19

E70310

£391.39

E70309

£452.81

1186

600

76-99

20

550

553

1886

E70311

£292.55

E70313

£416.46

E70312

£478.17

1508

500

76-99

25

450

581

1982

E70314

£326.81

E70316

£450.38

E70315

£512.46

1508

600

76-99

25

550

686

2339

E70317

£356.02

E70319

£479.31

E70318

£541.64

1738

500

76-99

30

450

686

2342

E70320

£375.69

E70322

£498.76

E70321

£561.32

1738

600

76-99

30

550

815

2781

E70323

£410.59

E70325

£533.40

E70324

£596.24

Code

RRP

Code

RRP

Code

RRP

Edessa - Curved Oval Tube - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

772

500

76-99

13

450

290

988

E70326

£196.11

E70328

£321.44

E70327

£381.73

772

600

76-99

13

550

347

1185

E70329

£210.98

E70331

£336.06

E70330

£396.63

1186

500

76-99

20

450

465

1586

E70332

£272.49

E70334

£396.54

E70333

£458.12

1186

600

76-99

20

550

553

1886

E70335

£298.39

E70337

£424.86

E70336

£484.04

1508

500

76-99

25

450

581

1982

E70338

£333.38

E70340

£456.85

E70339

£519.00

1508

600

76-99

25

550

686

2339

E70341

£363.13

E70343

£486.35

E70342

£548.75

1738

500

76-99

30

450

686

2342

E70344

£383.18

E70346

£506.15

E70345

£568.80

1738

600

76-99

30

550

815

2781

E70347

£418.77

E70349

£541.64

E70348

£604.39

BTUs

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

224 Designer Towel Rails EB20_Book.indb 224

Price includes VAT

18/11/2019 15:49


Avis - Chrome / Designer Towel Rails

Avis

Straight Rounded Bar Chrome

Avis - Minimalist Straight Rounded Bar - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

BTUs

800

500

100-115

3

462

140

478

E70269

£221.12

E70271

£346.14

E70270

£406.74

1200

500

100-115

4

462

199

678

E70272

£255.63

E70274

£379.33

E70273

£441.25

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

FT

EE N Y E

G

UA

E

FI

AR

15 10 RANT

E

MILD STEEL

DUAL FUEL .OPTION .

.

All dimensions are in mm

EB20_Book.indb 225

Dual fuel option available with these rails. See electrical elements on page 257 Designer Towel Rails

225 18/11/2019 15:49


Designer Towel Rails / Anta - Chrome

Anta

Straight Rounded Bar Chrome

Great towel hanging functionality

E E N YE

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

Anta - Modern Straight Rounded Bar - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

BTUs

800

400

94-110

9

368

163

556

E70275

£397.58

E70277

£519.51

E70276

£583.20

800

500

94-110

9

468

189

664

E70278

£411.32

E70280

£533.08

E70279

£596.94

1200

400

94-110

13

368

235

800

E70281

£508.33

E70283

£629.75

E70282

£693.95

1200

500

94-110

13

468

271

924

E70284

£527.91

E70286

£649.42

E70285

£713.56

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

226 Designer Towel Rails EB20_Book.indb 226

Price includes VAT

18/11/2019 15:49


Mardel - Chrome / Designer Towel Rails

Mardel

E E N YE

UA

MILD STEEL

E

FI

G

R

Curved Rounded Bar Chrome

A

15 10 FT

RANT

E

Mardel4QWPF6WDG%WTXGF$CT%JTQOG(KPKUJ %GPVTCN*GCVKPI1PN[ Code

Height (mm)

Width (mm)

Thickness

Pipe Centres

Watts

BTUs

RRP

E70387

800

500

170-190

455

416

1419

£196.07

E70388

1160

500

170-190

455

592

2021

£270.88

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 227

Designer Towel Rails

227 18/11/2019 15:49


Designer Towel Rails / Aira - Chrome or White

Aira

Curved Tube Chrome or White

E E N YE

Aira - Curved Chrome

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

Aira - Curved Oval Tube - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Bars

Pipe Centres

Watts

BTUs

800

500

15

455

235

802

E70152

£190.58

E70154

£317.81

E70153

£376.20

800

600

15

555

274

934

E70158

£225.82

E70160

£350.72

E70159

£411.44

1100

500

20

455

316

1078

E70164

£266.81

E70166

£394.11

E70165

£452.43

1100

600

20

555

378

1289

E70170

£285.85

E70172

£413.08

E70171

£471.47

Code

RRP

Code

RRP

Code

RRP

Aira - Curved Oval Tube - White Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Bars

Pipe Centres

Watts

BTUs

800

500

15

455

543

1856

E70155

£120.69

E70157

£253.26

E70156

£306.35

800

600

15

555

556

1901

E70161

£139.74

E70163

£267.25

E70162

£325.39

1100

500

20

455

583

1992

E70167

£171.54

E70169

£298.93

E70168

£357.16

1100

600

20

555

587

2005

E70173

£190.58

E70175

£317.81

E70174

£376.20

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

228 Designer Towel Rails EB20_Book.indb 228

Price includes VAT

18/11/2019 15:49


Laja - Chrome or White / Designer Towel Rails

Laja

Square Bar Chrome or White

E E N YE

Laja - Chrome Finish

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

Laja - Square Bar - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Bars

Pipe Centres

Watts

BTUs

1000

500

12

470

257

876

E70116

£251.56

E70118

£383.05

E70117

£437.18

1165

500

15

470

314

1071

E70122

£284.18

E70124

£414.63

E70123

£469.80

1165

600

15

570

365

1245

E70128

£315.16

E70130

£445.42

E70129

£500.78

1700

500

20

470

434

1480

E70134

£370.86

E70136

£501.63

E70135

£556.52

Code

RRP

Code

RRP

Code

RRP

Laja - Square Bar - White Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Bars

Pipe Centres

Watts

BTUs

1000

500

12

470

409

1396

E70119

£190.58

E70121

£317.81

E70120

£376.20

1165

500

15

470

420

1435

E70125

£209.65

E70127

£336.95

E70126

£395.27

1165

600

15

570

437

1492

E70131

£229.07

E70133

£356.40

E70132

£414.73

1700

500

20

470

501

1714

E70137

£266.81

E70139

£394.14

E70138

£452.43

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 229

Designer Towel Rails

229 18/11/2019 15:49


Designer Towel Rails / Risco - Chrome or White

Risco

Flat Bar Chrome or White

E E N YE

Risco - Chrome Finish

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

Risco - Contemporary Flat Bar - Chrome Finish Height (mm)

Width (mm)

Bars

Pipe Centres

Watts

BTUs

Central Heating Only Code

RRP

Dual Fuel Code

Electric Only RRP

Code

RRP

950

500

9

462

246

839

E70140

£264.32

E70142

£396.44

E70141

£449.97

1300

500

13

462

330

1125

E70146

£350.31

E70148

£489.38

E70147

£535.93

Risco - Contemporary Flat Bar - White Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Bars

Pipe Centres

Watts

BTUs

950

500

9

462

289

986

E70143

£203.31

E70145

£330.63

E70144

£388.93

1300

500

13

462

389

1327

E70149

£304.93

E70151

£432.13

E70150

£490.55

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

230 Designer Towel Rails EB20_Book.indb 230

Price includes VAT

18/11/2019 15:49


Heti - Chrome / Designer Towel Rails

Heti

Cube & Oval Bar Chrome

E E N YE

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

Heti - Ultra Modern Cube & Oval Bar - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

BTUs

1080

500

85

6

50

392

1338

E70438

£568.42

E70432

£402.57

E70435

£485.49

1460

500

85

8

50

524

1788

E70439

£754.04

E70433

£588.19

E70436

£671.12

1840

500

85

10

50

656

2238

E70440

£699.92

E70434

£534.06

E70437

£616.99

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 231

Designer Towel Rails

231 18/11/2019 15:49


Designer Towel Rails / Riand - Chrome or White

Riand

Straight Flat Bar Chrome or White

E E N YE

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

Riand - Ultra Modern Straight Flat Bar - Chrome Finish Height (mm) 1200

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

BTUs

500

141

15

100

282

962

Central Heating Only Code E70441

RRP £335.37

Dual Fuel Code

Electric Only RRP

E70442

£520.99

Code E70443

RRP £466.86

Riand - Ultra Modern Straight Flat Bar - White Finish Height (mm) 1200

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

BTUs

500

141

15

100

377

1286

Central Heating Only Code E70444

RRP £228.00

Dual Fuel Code E70445

Electric Only RRP

£413.62

Code E70446

RRP £359.49

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

232 Designer Towel Rails EB20_Book.indb 232

Price includes VAT

18/11/2019 15:49


Inga - Chrome / Designer Towel Rails

Inga

Straight Flat Bar Chrome

E E N YE

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

Inga - Ultra Modern Straight Flat Bar - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Depth (mm)

Bars

Pipe Centres

Watts

BTUs

1200

500

118

15

60

354

1209

E70296

£435.82

E70298

£557.37

E70297

£621.44

1400

600

118

18

60

436

1488

E70299

£480.63

E70301

£602.12

E70300

£666.28

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 233

Designer Towel Rails

233 18/11/2019 15:49


Designer Towel Rails / Teviot - Dual Action

Practical towel storage

MILD STEEL

E

FI

R

UA

Dual Action Chrome & White

A

G

Teviot

E E N YE

15 10 FT

RANT

E

Teviot - Dual Action Straight Rounded Bar - Chrome Finish - Featuring White Column Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Thickness

Bars

Pipe Centres

Watts

BTUs

1200

500

85-100

10

455

850

2900

E70389

£597.98

E70451

£729.47

E70450

£783.60

1200

600

85-100

10

555

1170

3992

E70390

£645.06

E70453

£776.56

E70452

£830.68

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

234 Designer Towel Rails EB20_Book.indb 234

Price includes VAT

18/11/2019 15:49


Fulmer - Chrome or White / Designer Towel Rails

Fulmer

E E N YE

G

UA

MILD STEEL

E

Dual Action Chrome or White

R

FI

A

15 10 FT

RANT

E

Fulmer - Chrome Finish

Fulmer - Dual Action Straight Rounded Bar - Chrome Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Thickness

Bars

Pipe Centres

Watts

BTUs

1200

500

85-110

25

455

377

1286

E70391

£377.27

E70455

£508.77

E70454

£562.89

1200

600

85-110

25

555

452

1544

E70392

£396.00

E70457

£527.49

E70456

£581.62

Code

RRP

Code

RRP

Code

RRP

Fulmer - Dual Action Straight Rounded Bar - White Finish Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Thickness

Bars

Pipe Centres

Watts

BTUs

1200

500

85-110

25

555

683

2331

E70393

£280.83

E70459

£412.33

E70458

£466.45

1200

600

85-110

25

455

570

1945

E70789

£294.82

E70461

£444.13

E70460

£498.25

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 235

Designer Towel Rails

235 18/11/2019 15:49


Designer Towel Rails / Belmore

Belmore Traditional

Classic traditional design

For radiator valves see page 25 E E N YE

MILD STEEL

E

FI

UA

R

G

A

15 10 FT

RANT

E

DUAL FUEL .OPTION .

.

Belmore - Traditional - Chrome Finish Featuring White Column Height (mm)

Central Heating Only

Dual Fuel

Electric Only

Width (mm)

Depth (mm)

Face to Face Connections

Watts

BTUs

965

540

230

395

392

1337

E70260

£518.68

E70262

£638.02

E70261

£704.31

965

673

230

528

554

1890

E70263

£618.13

E70265

£736.99

E70264

£803.78

965

765

230

620

653

2228

E70266

£707.65

E70268

£825.98

E70267

£893.27

Code

RRP

Code

RRP

Code

RRP

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

236 Designer Towel Rails EB20_Book.indb 236

Price includes VAT

18/11/2019 15:49


Henfall - Sealed Electric / Designer Towel Rails

Henfall Sealed Electric Chrome

E E N YE

MILD STEEL

ELECTRIC ONLY

E

FI

UA

R

G

A

15 10 FT

RANT

E

Henfall - Round Tube Shaped Bar - Chrome Finish - Sealed Electric Code E70376

Description

Height (mm)

Width (mm)

Depth (mm)

Watts

Electric Only Rail

719

545

80

110

RRP £246.32

$OOKHDWRXWSXWVDUHVKRZQDWr&ŤWLQFRPSOLDQFHZLWK%6(1

All dimensions are in mm

EB20_Book.indb 237

Designer Towel Rails

237 18/11/2019 15:50


Designer Radiators / Mackay

Designer Radiators Mackay - 2 Column Radiator - White Height (mm)

Width (mm)

Depth

No. of Sectons

Watts

BTUs

E70362

500

988

68

22

817

2788

£443.65

E70363

600

636

68

14

616

2102

£319.77

E70364

600

812

68

18

792

2703

£389.65

E70365

600

1252

68

28

1232

4204

£566.08

E70366

1800

284

68

6

774

2641

£292.26

E70367

1800

372

68

8

1032

3522

£361.26

E70368

1800

460

68

10

1290

4402

£430.20

Code

RRP

Mackay - 3 Column Radiator - White Height (mm)

Width (mm)

Depth

No. of Sectons

Watts

BTUs

E70369

500

988

100

22

1131

3859

£534.47

E70370

500

1252

100

28

1440

4914

£658.55

E70371

600

636

100

14

852

2908

£392.21

E70372

600

812

100

18

1097

3743

£476.15

E70373

1800

372

100

8

1412

4818

£438.92

E70374

1800

460

100

10

1764

6019

£521.31

E70375

1800

548

100

12

2117

7224

£603.66

Code

E E N YE

MILD STEEL

E

FI

UA

R

G

A

15 10 FT

RRP

RANT

E

Mackay Tubular Column White

238 Designer Radiators EB20_Book.indb 238

Price includes VAT

18/11/2019 15:50


Mela / Designer Radiators

Mela

Large Tubular Column White Mela - Contemporary Column Radiator Vertical - White Height (mm)

Width (mm)

Depth

No. of Sectons

Watts

BTUs

E70243

1800

230

65

3

922

3147

£291.25

E70244

1800

370

65

5

1538

5245

£430.74

E70245

1800

510

65

7

2153

7344

£570.16

Code

RRP

Mela - Contemporary Column Radiator Horizontal - White Height (mm)

Width (mm)

Depth

No. of Sectons

Watts

BTUs

E70235

450

506.5

90

7

398

1358

£234.66

E70236

450

784.5

90

11

625

2132

£359.72

E70237

450

993

90

14

796

2716

£456.73

E70238

450

1202

90

17

966

3296

£553.71

E70239

550

506.5

90

7

505

1723

£264.57

E70240

550

784.5

90

11

793

2705

£406.86

E70241

550

993

90

14

1009

3443

£516.73

E70242

550

1202

90

17

1226

4183

£626.49

Code

E E N YE

MILD STEEL

E

FI

UA

R

G

A

15 10 FT

RRP

RANT

E

Mela - Towel Warmer Bar Accessory Chrome Finish Code

Length

Finish

E70257

200

Chrome

£52.96

E70258

340

Chrome

£56.94

E70259

480

Chrome

£61.14

All dimensions are in mm

EB20_Book.indb 239

RRP

Contemporary twist on a classic design Designer Radiators

239 18/11/2019 15:50


Designer Radiators / Bryde

Bryde

Rectangular Column Choice of Finishes

E E N YE

EB20_Book.indb 240

MILD STEEL

FINISH OPTIONS

E

FI

240 Designer Radiators

UA

R

G

Shown in Chrome Finish

A

15 10 FT

RANT

E

Price includes VAT

18/11/2019 15:50


Bryde / Designer Radiators

Chrome Finish

Matt Black

White

Bryde - 3 Column Radiator - Chrome Finish Height (mm)

Width (mm)

Depth

Bars

Watts

BTUs

E70176

1200

252

70

5

242

825

£279.51

E70179

1200

352

70

7

339

1155

£323.97

E70182

1800

252

70

5

351

1196

£330.32

E70185

1800

358

70

7

491

1675

£501.82

Code

RRP

Bryde - 3 Column Radiator - Matt Black Height (mm)

Width (mm)

Depth

Bars

Watts

BTUs

E70178

1200

252

70

5

367

1253

£216.00

E70181

1200

358

70

7

515

1755

£241.39

E70184

1800

252

70

5

533

1817

£260.08

E70187

1800

358

70

7

746

2545

£311.27

Code

RRP

Bryde - 3 Column Radiator - White

Bryde - Towel Warmer Bar Accessory

Height (mm)

Width (mm)

Depth

Bars

Watts

BTUs

E70177

1200

252

70

5

367

1253

£216.00

E70180

1200

358

70

7

515

1755

£241.39

E70183

1800

252

70

5

533

1817

£260.08

E70186

1800

352

70

7

746

2545

£311.27

Code

All dimensions are in mm

EB20_Book.indb 241

RRP

Code

Length

Finish

RRP

E70188

266

Chrome

£54.06

E70189

375

Chrome

£60.44

Designer Radiators

241 18/11/2019 15:50


Designer Radiators / Kisdon

Kisdon

Horizontal Panel Anthracite or White

E E N YE

Shown in Anthracite

Kisdon - Single Panel - Horizontal - White Code

Height (mm)

Width Pipe Thickness (mm) Centres

Watts

BTUs

UA

E

G

R

FI

A

15 10 FT

RANT

E

Kisdon - Single Panel - Horizontal - Anthracite RRP

Code

Height (mm)

Width Pipe Thickness (mm) Centres

Watts

BTUs

RRP

E70410

450

900

81

850

420

1433

£235.29

E70414

450

900

81

850

420

1433

£237.73

E70411

450

1200

81

1150

552

1883

£266.65

E70415

450

1200

81

1150

552

1883

£269.37

E70412

598

900

81

850

560

1910

£285.16

E70416

598

900

81

850

560

1910

£287.81

E70413

598

1200

81

1150

736

2511

£325.77

E70417

598

1200

81

1150

736

2511

£328.77

Kisdon - Double Panel - Horizontal - White Code

Height (mm)

Width Pipe Thickness (mm) Centres

Watts

BTUs

Kisdon - Double Panel - Horizontal - Anthracite RRP

Code

Height (mm)

Width Pipe Thickness (mm) Centres

Watts

BTUs

RRP

E70418

450

900

126

850

654

2231

£392.00

E70422

450

900

126

850

654

2231

£401.97

E70419

450

1200

126

1150

858

2927

£455.75

E70423

450

1200

126

1150

858

2927

£459.22

E70420

598

900

126

850

872

2975

£501.13

E70424

598

900

126

850

872

2975

£504.03

E70421

598

1200

126

1150

1144

3903

£575.05

E70425

598

1200

126

1150

1144

3903

£578.37

242 Designer Radiators EB20_Book.indb 242

Price includes VAT

18/11/2019 15:50


Kisdon / Designer Radiators

Kisdon

Vertical Panel Anthracite or White

E E N YE

Shown in White

Kisdon - Single Panel - Vertical - White Code

Height (mm)

Width End to Thickness (mm) End

UA

MILD STEEL

E

G

R

FI

A

15 10 FT

RANT

E

Kisdon - Single Panel - Vertical - Anthracite

Watts

BTUs

RRP

Code

Height (mm)

Width End to Thickness (mm) End

Watts

BTUs

RRP

E70394

1800

228

80

204

402

1371

£208.52

E70398

1800

228

80

204

402

1371

£210.95

E70395

1800

376

80

376

670

2286

£284.24

E70399

1800

376

80

376

670

2286

£287.15

E70396

1800

524

80

528

938

3200

£359.94

E70400

1800

524

80

528

938

3200

£363.28

E70397

1800

672

80

680

1206

4114

£435.66

E70401

1800

672

80

680

1206

4114

£439.48

Kisdon - Double Panel - Vertical - White Code

Height (mm)

Width End to Thickness (mm) End

Watts

BTUs

Kisdon - Double Panel - Vertical - Anthracite RRP

Code

Height (mm)

Width End to Thickness (mm) End

Watts

BTUs

RRP

E70402

1800

228

122

204

627

2193

£329.53

E70406

1800

228

122

204

627

2193

£349.74

E70403

1800

376

122

376

1045

3565

£480.25

E70407

1800

376

122

376

1045

3565

£509.27

E70404

1800

524

122

528

1463

4991

£631.17

E70408

1800

524

122

528

1463

4991

£668.87

E70405

1800

672

122

680

1881

6417

£782.08

E70409

1800

672

122

680

1881

6417

£828.41

All dimensions are in mm

EB20_Book.indb 243

Designer Radiators 243 18/11/2019 15:50


Designer Radiators / Everest VE YEAR FI

UA

E

5 10

G

RANT

E

Everest Flat Panel Horizontal Lines

Everest Line - Type 11 Single Convector - White Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

3031105

300

500

63

235

802

£109.04

3031110

300

1000

63

469

1601

3031115

300

1500

63

704

3051104

500

400

63

3051106

500

600

3051108

500

3051110

Everest Line - Type 22 Double Convector - White Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

3032205

300

500

102

465

1587

£147.57

£157.88

3032210

300

1000

102

929

3171

£208.64

2401

£218.96

3032215

300

1500

102

1394

4756

£269.72

298

1017

£113.72

3052204

500

400

102

555

1894

£169.16

63

448

1530

£125.91

3052206

500

600

102

833

2843

£193.60

800

63

598

2040

£150.36

3052208

500

800

102

1110

3788

£218.03

500

1000

63

746

2545

£174.80

3052210

500

1000

102

1388

4737

£242.46

3051112

500

1200

63

897

3060

£199.23

3052212

500

1200

102

1666

5686

£266.88

3051114

500

1400

63

1046

3570

£223.65

3052214

500

1400

102

1943

6631

£291.32

3051116

500

1600

63

1194

4075

£248.09

3052216

500

1600

102

2222

7580

£315.75

3051118

500

1800

63

1343

4584

£272.51

3052218

500

1800

102

2499

8526

£340.16

3061104

600

400

63

348

1188

£118.42

3062204

600

400

102

640

2184

£186.07

3061106

600

600

63

522

1782

£142.84

3062206

600

600

102

961

3280

£210.51

3061108

600

800

63

696

2375

£167.28

3062208

600

800

102

1281

4372

£234.94

3061110

600

1000

63

870

2969

£191.71

3062210

600

1000

102

1601

5464

£259.38

3061112

600

1200

63

1044

3563

£216.15

3062212

600

1200

102

1921

6556

£283.80

3061114

600

1400

63

1219

4158

£240.56

3062214

600

1400

102

2241

7649

£308.25

3061116

600

1600

63

1392

4751

£265.01

3062216

600

1600

102

2563

8744

£332.68

3061118

600

1800

63

1566

5345

£289.44

3062218

600

1800

102

2883

9836

£357.09

3061120

600

2000

63

1741

5939

£313.85

3062220

600

2000

102

3203

10928

£381.52

Code

244 Designer Radiators EB20_Book.indb 244

RRP

Code

RRP

Price includes VAT

18/11/2019 15:50


Everest Concept / Designer Radiators

Everest Concept Flat Panel Horizontal Lines Slate Grey

VE YEAR FI

Everest Line Concept - Type 11 Single Convector Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

3261104

600

400

63

348

1187

£192.35

3261106

600

600

63

522

1781

3261108

600

800

63

696

3261110

600

1000

63

3261112

600

1200

3261114

600

1400

Code

RANT

E

Everest Line Concept - Type 22 Double Convector Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

3262204

600

400

102

640

2184

£260.00

£216.77

3262206

600

600

102

961

3279

£284.42

2375

£241.19

3262208

600

800

102

1281

4371

£308.87

870

2968

£265.64

3262210

600

1000

102

1601

5463

£333.30

63

1044

3562

£290.06

3262212

600

1200

102

1921

6554

£357.71

63

1218

4156

£314.48

3262214

600

1400

102

2241

7646

£382.17

All dimensions are in mm

EB20_Book.indb 245

UA

E

5 10

G

RRP

Code

RRP

Designer Radiators

245 18/11/2019 15:50


Designer Radiators / Alto Line

Alto Line Flat Panel Vertical Lines

VE YEAR FI

UA

E

5 10

G

RANT

E

Alto Line - Type 22 Double Convector - White Code

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

3162203

1600

300

102

1026

3501

£481.17

3162205

1600

500

102

1710

5835

£505.58

3182205

1800

500

102

1845

6295

£530.01

246 Designer Radiators EB20_Book.indb 246

RRP

Price includes VAT

18/11/2019 15:50


Plan / Designer Radiators

Plan

Smooth Flat Panel Minimalist

VE YEAR FI

Plan - Type 11 Single Convector - White

UA

E

5 10

G

RANT

E

Plan - Type 22 Double Convector - White

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

4031105

300

500

63

235

802

£133.43

4032205

300

500

102

465

1587

£212.42

4031110

300

1000

63

469

1601

£208.60

4032210

300

1000

102

929

3171

£287.59

4031115

300

1500

63

704

2401

£283.77

4032215

300

1500

102

1394

4756

£362.79

4051104

500

400

63

298

1017

£155.99

4052204

500

400

102

555

1894

£238.69

4051106

500

600

63

448

1530

£186.07

4052206

500

600

102

833

2843

£268.76

4051108

500

800

63

597

2040

£216.15

4052208

500

800

102

1110

3788

£298.82

4051110

500

1000

63

746

2545

£246.21

4052210

500

1000

102

1388

4737

£328.91

4051112

500

1200

63

895

3060

£276.28

4052212

500

1200

102

1666

5686

£358.99

4051114

500

1400

63

1044

3570

£306.36

4052214

500

1400

102

1943

6631

£389.06

4051116

500

1600

63

1194

4075

£336.42

4052216

500

1600

102

2222

7580

£419.13

4051118

500

1800

63

1343

4584

£366.50

4052218

500

1800

102

2499

8526

£449.20

4061104

600

400

63

348

1188

£174.80

4062204

600

400

102

640

2184

£259.38

4061106

600

600

63

522

1782

£204.86

4062206

600

600

102

961

3280

£289.45

4061108

600

800

63

696

2375

£234.94

4062208

600

800

102

1281

4372

£319.50

4061110

600

1000

63

870

2969

£265.02

4062210

600

1000

102

1601

5464

£349.58

4061112

600

1200

63

1044

3563

£295.10

4062212

600

1200

102

1921

6556

£379.67

4061114

600

1400

63

1218

4158

£325.15

4062214

600

1400

102

2241

7649

£409.74

4061116

600

1600

63

1392

4751

£355.21

4062216

600

1600

102

2563

8744

£439.80

4061118

600

1800

63

1566

5345

£385.29

4062218

600

1800

102

2883

9836

£469.87

4061120

600

2000

63

1741

5939

£415.35

4062220

600

2000

102

3203

10928

£499.93

Code

All dimensions are in mm

EB20_Book.indb 247

RRP

Code

RRP

Designer Radiators

247 18/11/2019 15:50


Designer Radiators / Plan Concept

Plan Concept Smooth Flat Panel Slate Grey

VE YEAR FI

Plan Concept - Type 11 Single Convector Width (mm)

Depth (mm)

Watts

BTUs

4251104

600

400

63

348

1187

£248.72

4251106

600

600

63

522

1781

4251108

600

800

63

696

4251110

600

1000

63

4251112

600

1200

4251114

600

1400

248 Designer Radiators EB20_Book.indb 248

RANT

E

Plan Concept - Type 22 Double Convector

Height (mm)

Code

UA

E

5 10

G

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

4252204

600

400

102

640

2184

£333.30

£278.78

4252206

600

600

102

961

3279

£363.37

2375

£308.87

4252208

600

800

102

1281

4371

£393.43

870

2968

£338.94

4252210

600

1000

102

1601

5463

£423.51

63

1044

3562

£369.01

4252212

600

1200

102

1921

6554

£453.59

63

1218

4156

£399.07

4252214

600

1400

102

2241

7646

£483.66

RRP

Code

RRP

Price includes VAT

18/11/2019 15:50


Verona Lo-Line / Designer Radiators

Verona Lo-Line Flat Panel Contemporary Solution

VE YEAR FI

UA

E

5 10

G

RANT

E

Verona Lo-Line - .QY2TQÆ‚NG9JKVG Code

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

248308

148

800

125

541

1846

£303.43

248311

148

1400

125

946

3228

£401.61

248314

148

2000

125

1352

4613

£508.69

248315

148

2200

125

1487

5074

£544.39

248323

296

2200

125

2453

8370

£829.98

All dimensions are in mm

EB20_Book.indb 249

RRP

Designer Radiators

249 18/11/2019 15:50


Designer Radiators / Verona

Verona

Flat Panel Horizontal Lines

VE YEAR FI

Verona - Single Panel - White

UA

E

5 10

G

RANT

E

Verona - Double Panel - White

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

248363

592

500

71

501

1709

£258.81

248415

592

600

125

1018

3474

£562.25

248364

592

600

71

601

2051

£276.66

248416

592

700

125

1188

4054

£597.94

248365

592

700

71

701

2392

£294.50

248417

592

800

125

1358

4634

£633.64

248366

592

800

71

802

2737

£312.36

248418

592

900

125

1527

5210

£669.34

248368

592

1000

71

1002

3419

£348.07

248419

592

1000

125

1697

5790

£705.04

248370

592

1200

71

1202

4101

£383.75

248421

592

1200

125

2036

6947

£776.43

248371

592

1400

71

1403

4787

£419.45

248422

592

1400

125

2376

8107

£847.83

248372

592

1600

71

1603

5470

£455.15

248423

592

1600

125

2715

9264

£919.23

248373

592

1800

71

1804

6156

£490.85

248424

592

1800

125

3055

10424

£990.62

248374

592

2000

71

2004

6838

£526.55

248425

592

2000

125

3394

11581

£1,062.02

Code

250 Designer Radiators EB20_Book.indb 250

RRP

Code

RRP

Price includes VAT

18/11/2019 15:50


Verona / Designer Radiators

Verona Flat Panel Vertical Lines

VE YEAR FI

UA

E

5 10

G

RANT

E

Verona8GTVKECN2TQÆ‚NG9JKVG Code

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

248340

1800

444

71

852

2907

£330.21

248341

1800

592

71

1136

3876

£419.45

248342

1800

740

71

1420

4845

£508.69

248343

2000

444

71

942

3214

£419.45

248344

2000

592

71

1256

4286

£508.69

248345

2000

740

71

1570

5357

£597.94

All dimensions are in mm

EB20_Book.indb 251

RRP

Designer Radiators

251 18/11/2019 15:50


Designer Radiators / Verona

Verona Slimline Flat Panel Side Edge Feature

VE YEAR FI

UA

E

5 10

G

RANT

E

Verona Slimline'FIG2TQÆ‚NG9JKVG Code

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

248300

1800

320

130

872

2976

£356.98

248301

1800

440

130

1199

4092

£446.22

248302

1800

520

130

1417

4836

£535.48

248303

1800

640

130

1744

5952

£624.71

248304

2000

320

130

978

3338

£419.45

248305

2000

440

130

1344

4587

£508.69

248306

2000

520

130

1589

5423

£597.94

248307

2000

640

130

1956

6676

£687.19

252 Designer Radiators EB20_Book.indb 252

RRP

Price includes VAT

18/11/2019 15:50


Column Concept / Designer Radiators

Column Concept Tubular Form Slate Grey

Right on trend! - Slate Grey

VE YEAR FI

UA

E

5 10

G

RANT

E

Column 3 Concept - Slate Grey - 3 Tube Depth

Column 4 Concept - Slate Grey - 4 Tube Depth

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

263133

600

628

100

792

2703

£436.52

263134

600

858

100

1096

3741

263135

600

1042

100

1340

263136

600

1272

100

1644

Code

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

263140

600

628

136

1037

3538

£454.36

£481.14

263141

600

858

136

1436

4900

£525.77

4573

£561.47

263142

600

1042

136

1756

5991

£615.01

5611

£677.48

263143

600

1272

136

2155

7353

£713.18

All dimensions are in mm

EB20_Book.indb 253

RRP

Code

RRP

Designer Radiators

253 18/11/2019 15:50


Designer Radiators / Column

Column 2 - White - 2 Tube Depth

Column 3 - White - 3 Tube Depth

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

263012

500

628

62

499

1703

£214.18

263028

600

628

62

589

2010

263029

600

858

62

815

263030

600

1042

62

263031

600

1272

62

Code

Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

263016

500

444

100

464

1583

£232.04

£232.04

263018

500

858

100

929

3171

£303.43

2782

£294.50

263019

500

1042

100

1135

3874

£401.61

997

3403

£356.98

263020

500

1272

100

1393

4754

£517.62

1223

4174

£464.08

263021

500

1456

100

1600

5459

£553.32

263022

500

1870

100

2064

7044

£696.10

263032

600

444

100

548

1870

£249.89

263033

600

628

100

792

2703

£285.59

263034

600

858

100

1096

3741

£330.21

263035

600

1042

100

1340

4573

£410.54

263036

600

1272

100

1644

5611

£526.55

263037

600

1456

100

1888

6444

£571.16

263038

600

1870

100

2436

8314

£731.82

263044

750

858

100

1337

4563

£410.54

263045

750

1042

100

1635

5580

£481.92

263046

750

1272

100

2006

6844

£624.71

263047

750

1456

100

2303

7858

£731.82

VE YEAR FI

G

UA

E

5 10 RANT

E

Column Vertical Tubes Choice of Depth

254 Designer Radiators EB20_Book.indb 254

RRP

Code

RRP

Price includes VAT

18/11/2019 15:50


Column / Designer Radiators

Column 4 - White - 4 Tube Depth Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

263025

500

858

136

1217

4152

£374.84

263026

500

1042

136

1487

5074

£464.08

263027

500

1272

136

1825

6227

£562.25

263040

600

628

136

1037

3538

£303.43

263041

600

858

136

1436

4900

£374.84

263042

600

1042

136

1756

5991

£464.08

263043

600

1272

136

2155

7353

£562.25

263050

750

628

136

1266

4320

£356.98

263051

750

858

136

1753

5981

£464.08

263052

750

1042

136

2143

7312

£553.32

263053

750

1272

136

2630

8974

£696.10

Code

RRP

Column Vertical - White - 2 Tube Depth Height (mm)

Width (mm)

Depth (mm)

Watts

BTUs

263054

1800

352

62

868

2962

£285.59

263055

1800

444

62

1116

3809

£374.84

263056

2000

352

62

1197

4084

£294.50

263057

2000

444

62

1242

4239

£383.75

Code

All dimensions are in mm

EB20_Book.indb 255

RRP

Designer Radiators

255 18/11/2019 15:50


Radiator Valves Square Radiator Valves - Angled Code

Description

E70717

15mm - Chrome (Pair)

Square Radiator Valves - Straight RRP £47.52

Modern Radiator Valves - Straight Code

Description

E70715

15mm - Chrome (Pair)

Description

E70734

½” x 15mm - Chrome (Pair)

RRP £27.41

Description

E70732

½” x 15mm - Chrome (Pair)

256 Radiator Valves EB20_Book.indb 256

E70718

15mm - Chrome (Pair)

RRP £47.52

Code

Description

E70716

15mm - Chrome (Pair)

RRP £26.21

Traditional Crosshead Valves - Angled RRP

£99.66

Traditional Crosshead Capstan Valves - Angled Code

Description

Modern Radiator Valves - Angled

Traditional Wheel Valve & Lockshield - Angled Code

Code

Code

Description

E70731

½” x 15mm - Chrome (Pair)

RRP £42.82

Art Deco Crosshead Valves - Angled RRP

£47.84

Code

Description

E70733

½” x 15mm - Chrome (Pair)

RRP £63.47

Price includes VAT

18/11/2019 15:50


Radiator Valves

Thermostatic Radiator Valves - Angled Code

Description

E70714

15mm - Chrome (Twin Pack)

Thermostatic Radiator Valves - Straight RRP £23.97

Corner Radiator Valves Code

Description

E70719

15mm - Chrome (Pair)

Code

Description

RRP

E70713

15mm - Chrome (Twin Pack)

£24.77

Corner TRV & LS Pack RRP £25.29

Pipe Cover Set

Code

Description

RRP

TRVCNR

15mm - Chrome (Pack)

£76.46

Towel Rail Electric Element

Code

Description

E70720

15mm - Chrome

RRP £21.51

Code

Description

RRP

TRE150

150W - Includes Tee Piece & ½” Plug

£52.80

TRE250

250W - Includes Tee Piece & ½” Plug

£54.00

TRE400

400W - Includes Tee Piece & ½” Plug

£55.20

TRE600

600W - Includes Tee Piece & ½” Plug

£56.40

TRE800

800W - Includes Tee Piece & ½” Plug

£82.80

M & F Dual Fuel Elbow Code

Description

DFE12

½” - Chrome

All dimensions are in mm

EB20_Book.indb 257

RRP £7.20

Radiator Valves

257 18/11/2019 15:50


Electric Underfloor Heating

Don’t want radiators in your minimalist bathroom? 7PFGTĆƒQQT*GCVKPIKUCITGCVYC[VQMGGRTQQOUYCTO+VKUUKORNGVQKPUVCNNYJGPVKNKPIJGNRUYKVJ condensation, provides heat across the whole room and feels lovely and cosy under bare feet. “Floor heating has lower running costs than central heating systems, and is a more environmentally-conscious way to heat your home.â€? 258 Electric Underfloor Heating EB20_Book.indb 258

Price includes VAT

18/11/2019 15:50


Electric Underfloor Heating

&RPELQHG(OHFWULF8QGHUÅ´RRU+HDWLQJ 8QFRXSOLQJ6\VWHP6KRZQ

Feel the glow from beneath your feet.

4WPPKPI%QUVU

2TQXKFKPIVJGWNVKOCVGHGGNKPIQHEQOHQTVCPFNWZWT[ KVKUKPGZRGPUKXGVQKPUVCNNCPFTWP

Time (hours)

1m2

2m2

4m2

5m2

10m2

15m2

25m2

1

1.8p

3.6p

7.2p

9p

18p

27p

45p

2

3.6p

7.2p

14.4p

18p

36p

54p

90p

3

5.4p

10.8p

21.6p

27p

54p

81

135p

4

7.2p

14.4p

28.8p

36

72p

108p

180p

5

9p

18p

36p

45p

90p

135p

225p

6

10.8p

21.6p

43.2p

54p

108p

162p

270p

7

12.6p

25.2p

50.4p

63p

126p

189p

315p

8

14.4p

28.8p

57.6p

72p

144p

216p

360p

$GPGƂVU Affordable luxury. 7PFGTƃQQTJGCVKPIFQGUPoVJCXGVQDGCPGZRGPUKXG GZVTCXCICPEG 1WT7(* 7PFGT(NQQT*GCVKPI TCPIGKUCP economical way to bring warmth to any room. Standard radiator system • +HDWULVHVIURPŴRRUWRFHLOLQJ • Heat loss through roof • Creates draughts and uneven heat • &ROGŴRRUVDQGKRWKHDGV

8QGHUŴRRUKHDWLQJV\VWHP • Even heat spread • Comfortable room temperature • No draughts • :DUPŴRRUV

Standard radiator system

(OHFWULFXQGHUÅ´RRUKHDWLQJ

Heated Area

*These running cost calculations assume an output of 150w/m2 in a well insulated environment and an electricity tariff of 14p/kWh

Low Running Costs 1WTWPFGTƃQQTJGCVKPIQHHGTUOCP[GEQPQOKECN advantages; • Rapid heat up times • Fully programmable touchscreen thermostat

Convection causes drafts and uneven heat spread

Even spread of heat for maximum comfort

All dimensions are in mm

EB20_Book.indb 259

• UFH can be programmed to allow for different times and temperatures in different rooms • Heat a 2m2CTGCHQTNGUUVJCPRFC[

Electric Underfloor Heating

259 18/11/2019 15:51


Electric Underfloor Heating

Applications UFH products have a wide range of applications and can be installed on timber and concrete substrates. 5WKVCDNGHQTCNOQUVCNNƃQQTƂPKUJGUJGTGCTGUQOG GZCORNGU

What type of UFH do I require? Product

Tiles

Stone

Laminate

Porcelain

Carpet

150w/m2 Mat

•

•

•

•

•

2

200w/m Mat

•

•

•

•

•

Cable Kit

•

•

•

•

•

For small awkward areas use cable kit. For regular areas 1-24m2 use 150w/m2 mat. For high output use 200w/m2 mat.

Floor Tiles

Floor Tiles

Tile Adhesive Tile Adhesive

Uncoupling Membrane

Vario Pro Mat Kit

Tile Adhesive

Tile Adhesive

Thermosphere Mesh Concrete Insulation Board

Timber Insulation Board

Tile Adhesive

Stable Timber Substrate

Concrete Substrate Floor

(OHFWULF8QGHUÅ´RRU+HDWLQJ0HVK

&RPELQHG8QGHUÅ´RRU+HDWLQJ & Uncoupling System

#NYC[UEJGEMYKVJ[QWTƃQQTKPIOCPWHCEVWTGTDGHQTGKPUVCNNKPIQXGTCPGNGEVTKECNWPFGTƃQQTJGCVKPIU[UVGO

Cable Kit Layout

Mat System Layout

Simple installation in irregular areas

5KORNGƃGZKDNGKPUVCNNCVKQP

Diagram below shows a typical bathroom layout.

Diagram below shows a typical bathroom layout.

260 Electric Underfloor Heating EB20_Book.indb 260

Price includes VAT

18/11/2019 15:51


Electric Underfloor Heating

Installation

Insulation Boards Coated

Insulation Boards Uncoated

'HƂEKGPVWPFGTƃQQTJGCVKPI UFH mats can be laid onto any substrate and we always recommend that you lay them onto insulation board for OCZKOWOGHƂEKGPE[CPFRQVGPVKCNN[TGFWEGFTWPPKPIEQUVU There are two types of insulation board - Coated and Uncoated. • %CPOCMGWPFGTƃQQTJGCVKPIOQTGGHƂEKGPV

For use with timber substrates

For use with concrete substrates

• From just 6mm thick • Fast, simple installation • YCVGTCPFTQVRTQQH

Conduit & Sensor Installation Diagram below shows an insulated timber substrate.

Cuts easily using a sharp blade

Vastly Reduce Heat Up Times (NQQTEQPUVTWEVKQPCPFƂPKUJYKNNIQXGTPJGCVWRVKOGU 5WHƂEKGPVKPUWNCVKQPYKNNITGCVN[TGFWEGJGCVWRVKOGUCPF you will notice the difference in your energy bills. A wellKPUWNCVGF7(*U[UVGOECPDGWRVQOQTGGHƂEKGPV Average heat up times can be seen in the table below: Concrete & 50mm Insulation Board

0.5 hours

Concrete & 10mm Insulation Board

1.0 hour

Un-insulated Concrete

5.0 hours

Concrete & Sub Surface Insulation

3.0 hours

Chipboard & 10mm Insulation Board

0.5 hours

Un-insulated Chipboard

1.0 hour

All dimensions are in mm

EB20_Book.indb 261

Thermosphere Mesh with insulation board bathroom installation

Without Insulation

With Insulation

$YRLGKHDWORVVDQGPD[LPLVHWKHHIƓFLHQF\RI\RXUXQGHUŴRRUKHDWLQJV\VWHP

Electric Underfloor Heating

261 18/11/2019 15:51


Electric Underfloor Heating

Features 3.5mm Twisted Twin Cable Unique, stress free Twisted Twin cable construction creates a longer lasting heating cable with zero GNGEVTQOCIPGVKEƂGNF5CHGGXGPKPYGVCTGCU

Thermosphere Mesh - 150W/m2 Heating Mat Voltage Resistance (V) (Ohms)

Thermosphere Mesh - 200W/m2 Heating Mat

Mat/Cable Length

Output (W)

Area (M2)

TSM-150-0100

2.0

150

1.0

230

353

£57.60

TSM-150-0150

3.0

225

1.5

230

231

TSM-150-0200

4.0

300

2.0

230

TSM-150-0250

5.0

375

2.5

TSM-150-0300

6.0

450

TSM-150-0400

8.0

TSM-150-0500

Voltage Resistance (V) (Ohms)

Mat/Cable Length

Output (W)

Area (M2)

TSM-200-0100

2.0

200

1

230

265

£61.20

£86.40

TSM-200-0150

3.0

300

1.5

230

176

£91.80

176

£115.20

TSM-200-0200

4.0

400

2

230

132

£122.40

230

141

£144.00

TSM-200-0250

5.0

500

2.5

230

106

£153.00

3.0

230

118

£172.80

TSM-200-0300

6.0

600

3

230

88

£183.60

600

4.0

230

88

£230.40

TSM-200-0400

8.0

800

4

230

66

£244.80

10.0

750

5.0

230

70

£288.00

TSM-200-0500

10.0

1000

5

230

53

£306.00

TSM-150-0600

12.0

900

6.0

230

59

£345.60

TSM-200-0600

12.0

1200

6

230

44

£367.20

TSM-150-0800

16.0

1200

8.0

230

44

£460.80

TSM-200-0800

16.0

1600

8

230

33

£489.60

TSM-150-1000

20.0

1500

10.0

230

35

£576.00

TSM-200-1000

20.0

2000

10

230

27

£612.00

TSM-150-1200

24.0

1800

12.0

230

29

£691.20

TSM-200-1200

24.0

2400

12

230

22

£734.40

Code

RRP

Code

Programmable Thermostat

Manual Thermostat

• Improved 7 day 6 event schedule

• Simple on off controls

• Manual temperature boost

• Easy temperature adjustment

• Floor temperature sensor

• Adjustable temperature limits

• Ambient temperature sensor

• Floor temperature sensor

• Wi-Fi versions available

• Ambient temperature sensor

• Available in Black or White

• Available in Black or White

Programmable Thermostat Code

Description

SCP-W-01

Programmable Control - White

WSK-W-01

RRP

Manual Thermostat Code

Description

£148.39

SCM-W-01

Manual Control - White

£108.43

Wireless Programmable Control & Hub Kit - White

£262.80

SCM-B-01

Manual Control - Black

£108.43

SCP-B-01

Programmable Control - Black

£148.39

WSK-B-01

Wireless Programmable Control & Hub Kit - Black

£262.80

262 Electric Underfloor Heating EB20_Book.indb 262

RRP

RRP

Price includes VAT

18/11/2019 15:51


Electric Underfloor Heating

Econoboard Uncoated

8CTKQ2TQ7PFGTƃQQT*GCVKPI%CDNG-KV8 Mat/Cable Output Area Area Resistance Length (M) (W) (130W M²) (195W M²) (Ohms)

Code

RRP

Pack Size Thickness (Boards) (mm)

Code

Board Size Board Area Pack Area (mm) (M2) (M2)

RRP

HDMC-012-0150

12.0

150

1.15

0.8

352.7

£69.23

CIB-006-20

20

6

1.2 x 0.6m

0.72

14.4

£183.60

HDMC-018-0225

18.0

225

1.73

1.15

235.1

£103.85

CIB-105-10

10

10.5

1.2 x 0.6m

0.72

7.2

£135.60

HDMC-025-0300

25.0

300

2.31

1.5

176.3

£138.46

Econoboard Coated

HDMC-031-0375

31.0

375

2.88

1.9

141.1

£173.08

Code

HDMC-037-0450

37.0

450

3.46

2.3

117.6

£207.69

HDMC-050-0600

50.0

600

4.62

3.1

88.2

£276.92

HDMC-061-0750

61.0

750

5.77

3.9

70.5

£346.15

HDMC-075-0900

75.0

900

6.92

4.6

58.8

£415.38

HDMC-100-1200

100.0

1200

9.23

6.2

44.1

£553.85

HDMC-125-1500

125.0

1500

11.54

7.7

35.3

£692.31

HDMC-150-1800

150.0

1800

13.85

9.2

29.4

£830.77

HDMC-200-2400

200.0

2400

18.46

12.31

22.0

£1,107.69

Decoupling Membrane Code

2 stud space

Pack Size Thickness (Boards) (mm)

Board Size (mm)

Board Area Pack Area (M2) (M2)

RRP

TIB-006-08

8

6

1.2m x 0.6m

0.72

5.76

£217.20

TIB-010-06

6

10

1.2m x 0.6m

0.72

4.32

£176.40

TIB-012-06

6

12

1.2m x 0.6m

0.72

4.32

£187.20

TIB-020-06

6

20

1.2m x 0.6m

0.72

4.32

£218.40

TIB-030-04

4

30

1.2m x 0.6m

0.72

2.88

£168.00

TIB-040-03

3

40

1.2m x 0.6m

0.72

2.16

£146.40

TIB-050-02

2

50

1.2m x 0.6m

0.72

1.44

£103.20

3 stud space

Mat Length (M)

RRP

HDM-005

5x1

£102.00

HDM-015

15 x 1

£306.00

Cable Kit

Heating Mat

Insulation • Coated or uncoated

• 12 Kit sizes available

• Fully self adhesive

• Zero maintenance

• Adds only 3mm build up

• 0DNHV8)+PRUHHIƓFLHQW

• Simple installation

• (IƓFLHQWKHDWLQJ

• From 6mm thick

• Fully earthed

• Safe, simple & reliable

• Simple installation

• Cost effective

• Cost effective

• Cost effective

Dual Control Thermostat

SmartHome Touch Controls

• #ODKGPVƃQQTUGPUQTU

• Amazon & Google assistant compatible

• Portrait & landscape mode

• Control from your mobile

• Available in Black & White

• #ODKGPVƃQQTUGPUQTU

• Dual Relay for 2 in 1 control

• Available in Black or White

• Control a tower rail or mirror heater

• Kit includes wireless hub

• 8 home screen colour options

• Manual boost features

Dual Control Thermostat Code

Description

DC-W-01

Thermotouch Dual Control - White

DC-B-01

Thermotouch Dual Control - Black

All dimensions are in mm

EB20_Book.indb 263

SmartHome Touch Controls RRP

Code

Description

RRP

£250.48

SHK-W-01

SmartHome Control & Hub Kit - White

£382.80

£250.48

SHK-B-01

SmartHome Control & Hub Kit - Black

£382.80

Electric Underfloor Heating

263 18/11/2019 15:51


Amazing ambience

Lighting & Ventilation Lighting Ventilation

264 Lighting & Ventilation EB20_Book.indb 264

P266 P267

Price includes VAT

18/11/2019 15:51


A refreshing approach to bathroom design 1WTGZVTCEVQTHCPURTQXKFGCHTGUJENGCPGTCVOQURJGTGHQT[QWTTQQO6JG[JGNRMGGR[QWT bathroom properly ventilated, to prevent mould and mildew. Bright, clear light is essential as you prepare for the day. Spotlights and downlights are ideal for directing a focused light towards any surfaces that are in high use. “Combine one light with another to ensure full coverage or brighten up certain areas to create a particular mood� All dimensions are in mm

EB20_Book.indb 265

Lighting & Ventilation

265 18/11/2019 15:51


Lighting / Spotlights - Ceiling Lights

Lighting Marius - Ceiling Light - Chrome Code

Size (mm)

0650

Ø310 x h120

RRP £91.00

Inertia - Ceiling Light - Chrome

Marius ceiling light shown

Code

Size (mm)

0680

w300 x h80 x d300

RRP £157.00

Momentum - Ceiling Light - Chrome Code

Size (mm)

0690

Ø310 x h125

RRP £157.00

Quartet - LED Spotlight - Chrome Code

Size (mm)

6140

w850 x h120 x d95

RRP £242.00

Trilogy - LED Spotlight - Chrome Quartet LED Spotlight shown

266 Lighting & Ventilation EB20_Book.indb 266

Code

Size (mm)

6150

Ø250 x d120

RRP £181.00

Price includes VAT

18/11/2019 15:51


Inline & Wall Mounted Fans / Ventilation

Ventilation

Hush7NVTC3WKGV.QY2TQÆ‚NG9CNN/QWPVGF(CP

Breeze - Wall Mounted Fan

Code

Description

Code

Description

31500

Size (mm)

Colour/Finish

RRP

Size (mm)

Colour/Finish

Wall Mounted - Timer

158 x 158 x 30

White

£96.00

31100

33100

Wall Mounted - Timer

158 x 158 x 30

Chrome

£119.00

32400

Accessory Kit

White

32500

Accessory Kit

Brown

RRP

Wall Mounted - Timer

152 x 152 x 33

White

£57.00

32800

Wall Mounted - Timer

152 x 152 x 33

Chrome

£82.00

£18.00

32400

Accessory Kit

White

£18.00

£18.00

32500

Accessory Kit

Brown

£18.00

Cyclone - non-illuminated

Cyclone - LED illuminated

Cyclone - High Powered Inline Fan Code

Description

Size (mm)

Colour/Finish

33300

RRP

Wet Room Inline Fan, Non-Illuminated

145 x 15

White

£142.00

33400

Wet Room Inline Fan, Non-Illuminated

145 x 15

Chrome

£155.00

32600

Wet Room Inline Fan, Cool White LED

145 x 15

White

£172.00

32700

Wet Room Inline Fan, Cool White LED

145 x 15

Chrome

£184.00

Accessory Kit These kits include 3 metres of ŴH[LEOHšFPGXFWLQJDƓ[HG grille and 2x steel hose clamps. Compatible with Breeze and Hush fans.

Cyclone - LED illuminated shown Cyclone motor in the loft

Ducting

Air extracted outside

Cyclone fascia mounted to ceiling Ideal for large bathrooms and wetrooms

External wall grille

Inline Fan - Remotely sited within the loft space, connected to both the fascia and external wall JULOOHYLDÅ´H[LEOHGXFWLQJZKLFKLVVXSSOLHGZLWKWKH&\FORQH)DQ

All dimensions are in mm

EB20_Book.indb 267

Lighting & Ventilation

267 18/11/2019 15:51


Bathroom Accessories

268 Bathroom Accessories EB20_Book.indb 268

Price includes VAT

18/11/2019 15:51


Square / Accessories

Square - Toilet Roll Holder Code SQ ROLL C

Square - Towel Ring

Size (mm) w147 x h160 x d66

RRP £41.16

Square - Soap Dish Code SQ DISH C

SQ HOLD C

Size (mm)

SQ RING C

w190 x h205 x d60

RRP £35.87

Square - Robe Hook Size (mm) w147 x h160 x d66

RRP £33.05

Square - Tumbler & Holder Code

Code

Code SQ HOOK C

Size (mm) w48 x h48 x d65

RRP £18.43

Square)NCUU5JGNH 6QWIJGPGF)NCUU

Size (mm) w67 x h95 x d123

RRP £32.80

Code SQ SHELF C

Size (mm) w467 x h48 x d135

RRP £52.34

Square - Towel Rail Code SQ RAIL C

All dimensions are in mm

EB20_Book.indb 269

Size (mm) w597 x h48 x d64

RRP £67.78

Bathroom Accessories

269 18/11/2019 15:51


Accessories / Round

Round - Toilet Roll Holder Code RD ROLL C

Round - Towel Ring

Size (mm) w148 x h105 x d60

RRP £26.50

RD DISH C

Size (mm)

RD RING C

Round - Soap Dish Code

Code

w190 x h205 x d60

RRP £25.84

Round - Robe Hook Size (mm) w138 x h50 x d118

RRP £28.83

Code RD HOOK C

Size (mm) w48 x h55 x d50

RRP £14.78

Round - Towel Rail Code RD RAIL C

270 Bathroom Accessories EB20_Book.indb 270

Size (mm) w595 x h48 x d72

RRP £35.91

Price includes VAT

18/11/2019 15:51


Traditional / Accessories

Traditional - Toilet Roll Holder - Chrome Code N2 ROLL C

Size (mm) w142 x h100 x d73

Traditional - Towel Ring - Chrome RRP £35.71

N2 RING C

Traditional - Soap Dish - Chrome Code N2 DISH C

Size (mm) w143 x h50 x d113

N2 HOLD C

Size (mm) w125 x h95 x d95

Size (mm) w190 x h210 x d73

RRP £33.66

Traditional - Robe Hook - Chrome RRP £37.92

Code N2 HOOK C

Traditional - Tumbler & Holder Code

Code

Size (mm) w50 x h85 x d70

RRP £26.54

Traditional - Glass Shelf - Chrome Fittings RRP £37.72

Code N2 SHELF C

Size (mm) w550 x h78 x d135

RRP £63.07

Traditional - Towel Rail - Chrome Code N2 RAIL C

All dimensions are in mm

EB20_Book.indb 271

Size (mm) w625 x h50 x d73

RRP £53.20

Bathroom Accessories

271 18/11/2019 15:51


Accessories / Wire baskets

9KTG$CUMGV9CNN(KZGF Code COMP BASK03 C

9KTG$CUMGV%QTPGT(KZGF

Size (mm)

RRP

w270 x h70 x d190

£69.25

Code

Size (mm) w290 x h50 x d160

COMP BASK04 C

9KTG$CVJ$CUMGV9CNN(KZGF Code COMP BASK01 C

Size (mm) w435 x h90 x d120

COMP BASK06 C

Size (mm) w200 x h320 x d200

272 Bathroom Accessories EB20_Book.indb 272

RRP £47.09

Code

Size (mm)

COMP BASK05 C

w290 x h45 x d165

RRP £47.09

9KTG$CUMGV9CNN(KZGF RRP £92.76

9KTG$CUMGV%QTPGT(KZGF Code

9KTG$CUMGV%QTPGT(KZGF

Code COMP BASK02 C

Size (mm) w355 x h50 x d130

RRP £69.00

9KTG$CUMGV9CNN(KZGF RRP £126.34

Code COMP BASK07 C

Size (mm) w200 x h430 x d200

RRP £131.50

Price includes VAT

18/11/2019 15:51


Accessories

Free Standing Mirror 8” Code

Description

COMP FSMR C

Double sided mirror swivels IRU[PDJQLƓFDWLRQ

RRP £66.92

Code

Description

COMP EXTMR C

Double sided mirror swivels IRU[PDJQLƓFDWLRQ

Wall Mounted Mirror 8” Code

Description

COMP WMMR C

Double sided mirror swivels IRU[PDJQLƓFDWLRQ

Size (mm)

COMP TIERS C

w600 x h257 x d215

RRP £77.52

£80.76

Code

Size (mm)

COMP BRU C

w76 x h390 x d76

RRP £35.51

Code COMP LINE C

Size (mm) w91 x h91 x d31

RRP £27.89

Towel Stacker RRP £88.17

All dimensions are in mm

EB20_Book.indb 273

RRP

Clothes Line

Tier Towel Shelf Code

Free Standing Metal Toilet Brush & Holder

'ZVGPFKPI5JCXKPI/KTTQT

Code COMP TSTACK1 C

Size (mm) w235 x h500 x d175

RRP £105.49

Bathroom Accessories

273 18/11/2019 15:52


Bathroom Layout Planner

=

MM

NOTES

EB20_Book.indb 274

18/11/2019 15:52


EB20_Inner Covers.indd A4 V

15/11/2019 10:01


Esteem Bathrooms O

2020 V1 2020 V1 Baths O Showering O Sanitaryware O Furniture O Taps O Heating O Accessories EB20_001_Front Cover and 12mm Spine_Generic.indd All Pages

15/11/2019 10:33

Profile for HPS Merchant

Esteem Bathroom 2020 Brochure  

Esteem Bathroom 2020 Brochure  

Advertisement