Star Weekly - Brimbank North West - 6th May 2025

Mum’s bundle of new love

While many mothers will be receiving breakfast in bed or handmade cards this Mother’s Day, Rupinder Kaur Rekhi will be spending her Mother’s Day cradling the newest addition to her family – a little baby boy.

For Ms Rehki and her husband Gagandeep Singh Rekhi, the arrival of their son has been a heartwarming and emotional experience, bringing a mix of emotions and deep reflection.

“It’s mixed feelings when you go into labour of course,” Ms Rekhi said.

“But after that it’s all well – when we see the baby, it makes it all worth it.”

While Mother’s Day might be a little more low-key this year, there will still be room for celebration.

“Grandmother is here so maybe we will go out and have dinner to celebrate,” Ms Rekhi said.

For Mr Rehki, witnessing his wife’s labour gave him renewed appreciation for the strength of mothers everywhere.

“When I see my wife giving birth, I get even more respect for motherhood. I always have more respect for my mother and for my wife, for every mother in this world,” he said.

Brimbank backs Labor

By Laura Michell

Voters in Brimbank overwhelmingly backed Labor on Saturday night and helped return Anthony Albanese as prime minister.

In the electorates of Gorton and Fraser, Labor’s candidates Alice Jordan-Baird and Daniel Mulino secured 43.94 per cent and 42.85 per cent of the primary votes respectively. Those figures represent a first preference swing of 2.63 per cent and 0.76 per cent towards Labor.

DrMulinohasrepresentedFrasersince2019 while Ms Jordan-Baird was selected as Labor’s candidateforGortonfollowingtheretirement of long-serving MP Brendan O’Connor.

On Sunday night, the Australia Electoral Commission (AEC) said Ms Jordan-Baird would be the new MP for Gorton.

AECdatashowedthatMsJordan-Bairdhad secured 60.40 per cent of votes on a two-party basis, over Liberal candidate John Fletcher.

In Fraser, the AEC was projecting that Dr Mulino would retain the seat. As of Sunday night, Dr Mulino was ahead in the two-party count, with 60.87 per cent of votes.

The AEC conducted the two-party count for Fraser between Labor and the Greens after its candidate Huong Truong polled 7695 more first preference votes than Liberal candidate Satish Patel.

Ms Jordan-Baird took to social media on

Sunday to thank voters for putting their faith in her.

“I am incredibly honoured and humbled to have been elected to represent the seat of Gorton,” she said.

“Thank you to every single volunteer who gave their time, energy and heart to this campaign – I couldn’t have done it without you.

“I’m ready to get to work with the Labor team to deliver for our community – for families, for workers, for everyone. Let’s keep building a better future, together.”

On Facebook, Dr Mulino simply wrote:

“Thankyou,Fraser.Itisaprivilegetocontinue representing you”.

While most of Brimbank falls into Fraser or Gorton, parts of Keilor Park and Tullamarine are in the electorate of Maribyrnong.

Labor’s Bill Shorten retired as Maribyrnong MP in January, having represented the seat since 2007.

Labor has held the seat since it was created in 1969, with that trend continuing on Saturday night.

Labor candidate Jo Briskey won the seat with 62.38 per cent of votes on a two-party basis, over Liberal candidate Tim Beddoe. On Facebook on Sunday, Ms Briskey thanked voters for putting their trust in her.

Rupinder Kaur Rekhi and husband Gagandeep Singh Rehkhi with their 2-day-old son. (Damjan Janevski) 475083_06

Deeming is focused on the west

By Jaidyn Kennedy

Moira Deeming has been hand-picked by opposition leader Brad Battin to represent the Liberal Party’s increased focus on the western suburbs.

Lessthanfourmonthsafterbeingreadmitted to the party, the Western Metropolitan MP has been appointed as the “leader’s representative to the western suburbs”.

Ms Deeming said the decision came after herself and Battin agreed on taking a “different approach,” to engaging with the region.

Sunshine Repair Cafe co-ordinator

Michael Mink.

(Damjan Janevski)

471903_03

“We need to earn their trust not just their votes–wecan’tjustcomealongatelectiontime and be promising money here and there and nonsense like that,” she said. “It gives me extra time for advocacy based on the west – it just means that I can do my job more effectively.”

Ms Deeming increasing her time on the ground in the west and she is developing a website dedicated to communicating with constituents and processing their queries.

“It’s actually a massive little movement that’s started, we’ve got some experts involved already,” she said.

MsDeemingsaidpartofthefuturesitewould include a space for members of the community to offer professional expertise relating to their field to the party.

“If they are in the west and happen to be a business owner or a nurse, or if they know how to fix something and have a bit of knowledge, they can get on board,“ she said.

Her priorities are delivering several key infrastructure projects she believes have been “neglected” by the state government.

She said the electrification of the Melton rail line, the Outer Metropolitan Ring Road and

Volunteers needed for handy repairs

The Sunshine Repair Cafe provides a platform for residents to breathe new life into their broken possessions – but it needs more volunteers.

From electrical appliances and tools to furniture, clocks, and even clothing, the cafe’s team of skilled volunteers are dedicated to finding solutions and keeping items out of landfills.

About 15 to 20 people visit the cafe each month, a number Kororoit Creek Neighbourhood House co-ordinator Danielle Whelan hopes to grow with the help of additional volunteers.

The team is particularly keen to recruit individuals with expertise in electrical repairs, as these types of items are among the most sought-after services.

“The more volunteers we have the more items we can fix each month; we match items with volunteers and their skills, so if we don’t have a volunteer available to repair electricals or textiles and clothing on the day we won’t be able to give people an appointment to come in,“ Ms Whelan said.

“Electrical items are one of the key

things people seek repairs for, this could be replacing a damaged cord on an appliance, replacing a lamp fitting or battery in a power tool.

“There are very few options for repair for these types of things; and when there are options they are often more costly as buying a replacement item making it uneconomical for people to choose repair over buying something new.”

TherepaircaferunsonthefourthSundayof the month via appointment.

Details: sunshinerepaircafe@kcnh.org.au

Western Interstate Freight Terminal were top of her list.

MsDeemingsaidtheLiberalswillattemptto build off a swing against the state government at February’s Werribee by-election.

“From my perspective prior to Brad, there was a bit of an attitude that because these are such strong Labor areas they didn’t think Labor voters wouldn’t listen to them,” she said. “I love the fact that in Werribee, they showed thatyoucannottakethemforgrantedanymore and so that’s why this is a really key moment in time.”

all water heroes

Greater Western Water’s (GWW) National Water Week poster competition is back for 2025, with entries now open to all pre-schools and primary schools across its service region.

For the 2025 competition, students are encouraged to create a poster reflecting this year’s theme Water Heroes: Save Every Drop.

GWW spokesperson Kessia Thomson said the competition was a great opportunity for students to show theircreativesideandhowtheycarefor the environment at the same time.

“We’re encouraging all local students to get creative and enter a poster to this year’s competition. You can draw, you can paint or use some other materials including digital technology to create an A3 or A4 sized poster,” Ms Thomson said.

“Each year we are blown away not only by the talent and creativity of our localstudents,butalsobytheirideasfor water saving and caring for our water resources.”

The poster competition is open to all primary schools and pre-schools acrossVictoria,withprizesupforgrabs valued up to $100 for individuals and up to $500 for schools for each of the following categories: early learning / kindergarten, prep, year 1 and 2, year 3- 4 and year 5-6.

Local winners will be announced in October. First prize winners from GWW’s local competition will automatically be entered into the state competition, with winners announced during National Water Week (20-26 October).

To learn more about the categories, prizes and how to enter, visit National Water Week.

Labourer saves his boss’ life after cardiac arrest at work

It wasn’t the first day at work Connor Walker expected, with the 20-year-old labourer giving cardiopulmonary resuscitation (CPR) to his new boss to help save his life after a cardiac arrest.

Brad Allport, 63, remembers feeling unwell while having lunch with Connor. But that’s where his memory ends.

“He said he was getting a bit hot, then he dropped to the floor,” Connor said.

“I picked up his head and tried to wake him up and then I saw he was struggling to breathe.

“I called triple-0 straight away and moved

him onto the floor and they told me to start CPR.

“I didn’t really know what to do, I was in shock. I just wanted him to wake up.”

Brad was in cardiac arrest – when a person’s heart suddenly stops pumping blood effectively around the body.

Connor’s quick action was critical. In a cardiac arrest, for every minute that CPR is delayed, survival decreases by 10 per cent.

A Fire Rescue Victoria (FRV) crew from Station 51 (Keilor) soon arrived at the scene as part of the Emergency Medical Response (EMR) partnership with Ambulance Victoria

(AV), which aims to improve cardiac arrest survival rates by dispatching firefighters at the same time as an ambulance to ‘priority 0’ cases.

FRV station officer Elisabeth Andrew was first on scene.

“We delivered one shock with a defibrillator and recommenced CPR. Not long after the shock was delivered, Brad started to respond,” she said.

AV paramedics, including Mobile Intensive Care Ambulance (MICA) paramedics, gave Brad medication and oxygen as his condition rapidly improved and transported him to

Sunshine Hospital. Paramedic Peter Bollas said the sequence of events gave Brad the best chance of survival.

“This case was a classic example of how the chain of survival saves lives – with early recognition of the cardiac arrest, early CPR, early defibrillation and early advanced life support,” he said.

“Connor was pivotal in Brad’s outcome – recognising that something serious was wrong and starting CPR early most likely saved Brad’s life.”

Just a few weeks later, Brad is now back at work and not experiencing any lasting effects.

Call to name and shame dumpers

By Oscar Parry

Illegally dumped rubbish is again in the sights of Melton council, with a ‘name and shame’ approach and incentive program being investigated.

Councillor Phillip Zada said he was “absolutely sick and tired“ of talking about of discussing illegal rubbish and was seeking the council to find more ways to hold people accountable.

He raised a notice of motion at the April 28 council meeting calling for officers to investigate the possibility of introducing a name and shame approach to preventing illegal rubbish dumping.

This would include publicising the names of individuals and businesses found guilty of illegally dumping rubbish in accordance with relevant legislation and privacy protections.

CrZadaalsocalledforofficerstoinvestigate an incentive program for residents to provide substantiated reports of illegal rubbish dumping, with potential incentives including coffee or meal vouchers or credits applied to rates notices.

Melton council deals with 3500 tonnes of illegally dumped waste annually, at a cost of more than $5 million.

“Illegal rubbish dumping continues to be one of the most visible and frustrating issues

Olive harvest fest returns

CERES’ annual Olives to Oil event is coming to Brimbank to help residents experience the goodness of the pitted fruit.

Theeventisdesignedtobringpeopletogether to harvest olives and have them pressed communally into delicious, local olive oil.

Presented in partnership with My Smart Garden and Brimbank council, residents will beabletodropofftheirolivesononeofCERES localdrop-offdaysandpickupthecommunally pressedoliveoilattheorganisation’sfestivalon June 1.

When booking a spot, locals will be asked to select a weight category they expect to pick. Small quantities under 20 kilograms will be pressedforfree.Ifyou’reunsure,bringacouple of household buckets of olives and book a free spot. Pick your olives no earlier than two days before the drop-off date, to ensure freshness.

CERES said it was expecting the biggest year yet, planning for up to 50 tonnes of olives to be dropped off by more than 6000 people.

“It’s grown a lot since the first 200kg harvest in 2018,” CERES said.

For those who don’t have any olives to harvest, you are still welcome to register to come along to the festival or register to attend CERES’ harvesting and preserving workshop onMay14,attheWestvaleCommunityCentre.

Localsinterestedintheeventcanbookatime to bring their olives to the drop-off centre at VisyCaresHub,80bHarvesterRoad,Sunshine on Sunday, May 18, from 11am-3pm.

Details: ceres.org.au/olives-to-oil/

CERES Olives to Oil festival co-ordinator Samantha Hulls with one of the bottles of olive oil produced last year. (Damjan Janevski) 473927_02

Diabetes help in Vietnamese

Diabetes Victoria has established a new Vietnamese peer support group to provide culturally-relevant diabetes management help to the community.

The group, funded by a Brimbank council grant, aims to improve access to diabetes resourcesandsupportforthecity’sVietnamese population.

“We identified a gap in culturally inclusive diabetes support, especially for communities that face additional barriers in accessing health information and services,” Diabetes Victoria peersupportteamlead GiovannaTavernasaid.

“This Vietnamese peer support group was created as a one-year pilot to improve access to diabetes-related support in Brimbank, which has one of the highest numbers of Vietnamese people living with type 2 diabetes in Victoria.

“We know that language, culture, and trust areimportant.That’swhythisgroupisdelivered inVietnamesebydiabetesnurseeducatorYung

across our municipality,” Cr Zada said.

“Despite repeated warnings, educational campaigns, and enforcement efforts, the problempersists–affectingourenvironment, streetscapes, and sense of community pride.

“These measures aim to foster community vigilance, increase enforcement outcomes, and send a strong message that illegal dumping is not tolerated.”

CrBobTurnersaidillegalrubbishdumping is a “big, important problem” in Melton and “has been for many years,“ with the issue “just getting worse“.

This is the latest measure the council is seeking to halt the impact of illegal rubbish dumping.

The council at its February council meeting agreed to write to Environment Minister Steve Dimopoulos calling on the state government to help local councils with the costs.

The council was to request the state government release funding from the sustainability fund that is collected from the waste levy, for increased financial support of local councils to manage illegal rubbish dumping.

A government spokesperson said at the time it knows the impact waste has in its communities, which is why it’s strengthening laws for the Environment Protection Authority to crack down on illegal dumping.

Nguyen, who shares cultural understanding and language with the community.”

Nearly 16,500 people in Brimbank are living with type 2 diabetes, according to the National Diabetes Services Scheme.

The new peer support group provides a safe, welcoming space for locals to learn practical self-management strategies, connect with health professionals, and share their experiences with others who understand their cultural context.

“When information is shared in a person’s first language and in a respectful, familiar environment, it can be easier to ask questions, sharestories,andbuildconfidenceinmanaging diabetes,” Ms Taverna said.

“This leads to stronger community connections and better health outcomes.”

The next session is Thursday, May 9, from 10am-noon, at St Albans Community Centre, 33 Princess Street, St Albans.

Diabetes nurse educator Yung Nguyen. (Supplied)

Melton joins asylum taskforce

By Oscar Parry

As the “fastest growing city in Australia,” Melton council will be the next Australian municipality to join a mayoral taskforce that aims to support people seeking asylum.

Melton will become a general member council of the Local Government Mayoral Taskforce Supporting People Seeking Asylum, which aims to support and reduce the waiting times for applicants seeking refugee status in Australia.

The taskforce consists of more than 40

councils across Australia. It collaborates with refugees and asylum seeker organisations to advocate to the federal government to address policies and guidelines affecting humanitarian arrivals.

The taskforce’s priorities include providing all people waiting for their protection application with a valid visa and associated workrights;simplifyingtheapplicationprocess and expanding the eligibility for a government support service program for those seeking asylum,?????? and ensuring an independent and effective merits review process for all

humanitarian applications.

At the April 28 council meeting Melton mayor Steve Abboushi said joining the taskforce was important “personally, but also from a perspective of the community”.

“As the fastest growing city in Australia, and having met with a number of refugees seeking asylum in the city … I know how important it is for this cohort to be represented but also for them to feel empowered,” Cr Abboushi said.

“My father was a refugee … and this country providedtheincredibleopportunitiestomyself and my eight siblings … and I’d like to think

Urgent cry for food relief funding

Neighbourhood houses, including Duke Street Community House are crying out for more state government funding to keep their food relief programs running.

Duke Street Community House provides a weekly food relief service at Central West Shopping Centre, Braybrook, where it feeds on average 300-400 people a week.

Duke Street Community House manager Emma Price said demand was consistently growing, with 165 new people seeking food relief since January.

“People are getting more and more

desperate. We see hundreds of people, and each person’s story is more tough than the last,” she said.

“Demand far exceeds our limited capacity. We are a tiny organisation pulling the weight of much bigger (and funded) players.”

Last year, neighbourhood houses received $2.5 million in food relief funding in the state budget, with Duke Street receiving $40,000.

The food relief program costs Duke Street about $55,000 annually to run.

NHVic chief executive Keir Paterson said the rapidly growing community demand for

food relief and material relief has placed an unsustainable cost burden on neighbourhood houses.

“We’re calling on the state government this May to commit for $2.7 million in the first year, or $10.8 million over four years to fund food relief services in neighbourhood houses - and that only covers around half the total cost,” he said.

A spokesperson said the state government would be focused on making sure “every dollar of investment goes to where it matters most” when it hands down the budget.

that if we can be a voice for refugees in our community and they too go on and grow older and have those opportunities as afforded to them, then that would be a blessing to them also.”

As a general member council, Melton’s role will include assisting the executive in selecting and implementing the taskforce’s priorities and providing resources where needed to help achieve these priorities.

InFebruary2025,Dandenongcouncilmayor Jim Memeti wrote to Melton, inviting it to join the taskforce.

Brimbank SES needs helpers

Members from the Brimbank State Emergency Service (SES) are hosting a recruitment drive to attract new volunteers.

Hopingtoboostmember-numbers,the unit is putting together an information session to answer questions, provide insight and share experiences with interested locals.

Attendees will hear about the role SES playsasthestate’speakcontrolagencyfor natural disasters such as floods, storms, earthquakes, tsunamis and landslides. It also provides the largest road crash rescue network in Victoria.

It takes thousands of dedicated volunteers from across the state to provide emergency assistance 24-hours a day, seven days a week, 365 days a year, Brimbank SES deputy controller Bailey Lambert said.

Through the recruitment session, Mr Lambert said, people will find out more about those volunteer positions.

“We’regiving[people]theopportunity to hear about what we do and learn more about the range of rewarding voluntary roles available within SES,” he said. To volunteer for VICSES, applicants firstgothroughaselectionandscreening process to ensure they understand the roleandcanmeetthetimecommitments required for training and performing volunteer duties.

Each volunteer receives accredited, recognised training as part of their role, ranging from first aid, general rescue and chainsaw operations, through to community education, media training and more.

The information session will be held on Monday, June 16, from 7pm, at 66 Stadium Drive, Keilor Park.

Details: www.facebook.com/ BrimbankSES/

Diverse panel guides priorities to shape Brimbank’s future

Cleanliness, traffic management and safety are high on the list of issues important to the community, according to a resident-led panel.

Formed last year, the Deliberative EngagementPanelbrought50demographically representative locals together to have their voices heard in shaping Brimbank’s development.

Since then, the group has met four times to discuss the challenges impacting council, the opportunities available and the decision-making processes currently in place. Recently the group handed down its report for council’s consideration, listing key priorities as well as some suggested guidelines for the organisation to follow.

According to the panel, the main areas council needed to focus on included safer and greenerpublicspaces,improvedaccesstopublic transport, homelessness, and the development of economic and social opportunities that support community wellbeing.

One of the most significant outcomes of the panel’s work was the development of seven guiding principles that should be used for council decision-making.

These principles covered inclusivity, health and safety, financial accountability, economic opportunity, communication, belonging, and innovation.

Through in-depth discussions, the panel also considered challenges such as balancing

growth with sustainability and addressing community needs in a fair and equitable way.

Panel member Irena Kaluski said the deliberations within the group were a good exercise in developing a better understanding of the decisions council needs to make regularly.

“Itactuallyhelpedbuildrapportbetweenthe community and council,” she said.

“I think it was great because it also enabled people to express their views in a safe environment.

“Because we all came from different backgrounds, it was good to hear different perspectives because they also had different priorities and challenges.”

Ms Kaluski said the work done by the panel highlightedtheimportanceofthecommunity’s role in “shaping the future of Brimbank”.

“It also re-enforced that engagement is a two-way street,” she said.

“Council needs to reach out, but the community also has a responsibility to participate.

“Everytime council launches consultation sessions, put your name down there.”

Council is now inviting people to join the Brimbank Community Voice group.

It is open to residents, ratepayers and business owners aged 18 and over.

Details: yoursay.brimbank.vic.gov.au/ brimbank-community-voice

Duke Street House manager Emma Price with food relief volunteers. (Damjan Janevski) 474990_03

Walk, run with meaning

The vibrant colours of pink and teal will blend beautifully with the backdrop of Caroline Springs Lake for the fourth edition of the Mother’s Day Classic (MDC).

This national fundraising event is held on Mother’s Day each year to raise money and honourthosewhohavefoughtorarecurrently fighting breast and ovarian cancer.

The Caroline Springs event will be held on May 11, from 7.30am.

Participants from running clubs, those on wheels, and dog walkers are all invited to take part in a variety of events, including a four-kilometre walk of honour and an eight-kilometre run.

The walk will begin with a minute’s silence, followed by tribute cards being handed out for participants to fill out and carry with them during the walk.

Mother’s Day Classic Foundation director Nicole Oborne said there will be 85 events acrossthenationthisyear,makingitespecially meaningful to have a local one for residents to call their own.

“This event is incredibly important because it gives purpose and meaning to Mother’s Day and while we all need to look after our own wellbeing, this event brings a sense of hope and meaning to our community,” she said.

“On the day, large families will come together in honour of mothers, aunties, grandmothers, and also male participants doing it for their female loved ones and themselves.

“Seeing the community come together like this is something we need to do more often, and having a lake to embrace makes it even more special.”

Briefs

Cheaper childcare

A builder has been appointed to construct a state government-run childcare centre in Kings Park. The centre, which has the interim name of Early Learning Victoria Kings Park, will offer childcare fees below the market rate. It is one of 14 government-run centres that will open in 2026.

Tobacco store fires

A Tullamarine tobacco store has been targeted in a second suspected arson attack in just over a week. The most recent fire broke out in the early hours of Wednesday, April 30, when emergency services were called to the Melrose Drive premises about 1.20am. It’s believed offenders used a vehicle to ram the store’s roller door before pouring an accelerant inside and setting it alight. The earlier attack occurred on Tuesday, April 22, when local police on patrol noticed flames coming from the same premises about 5.20am. Detectives believe the two attacks are linked and are appealing for public assistance.

FOR BREAKING NEWS, VISIT Web: starweekly.com.au

Brimbank & North West Star Weekly @starweeklynews @star_weekly

on Bridgestone Ecopia car & SUV, Bridgestone Potenza and Firestone

Caroline Springs Mother’s Day Classic event 2024, participants warming up for the walk and run.

‘‘ When you are feeling broken, the way to healing is through helping others ’’

- Liz Skitch

Four walls and a caring lifeline

Thomastown Neighbourhood House manger Liz Skitch runs a community hub from a room inside the local library, offering connection, creativity, and crisis support. Tom Ingleton spoke with Liza about mental health, hidden trauma, and why neighbourhood houses are crucial - but under resourced - pillars of community care.

Tucked away in a quiet room inside the Thomastown Library, you’ll find what might just be the suburb’s most essential service – though most people don’t realise it until they walk through the door.

There’s mental health slogans, and then there are mental health saviours and the latter certainly applies to the Thomastown Neighbourhood House.

“We didn’t know you were here!” is the most common thing people say when they discover the neighbourhood house, manager Liz Skitch says.

But once they do, it doesn’t take long for the truth to land.

Across Victoria, mental health services are overwhelmed and recent studies highlight this epidemic is only getting worse.

According to the Australian Bureau of Statistics, one in five Australians will experience a mental illness this year, yet in outer-metro areas like Whittlesea, access to psychologists remains critically low– just 2.2 per 1000 people.

Liz is many things to the community –actress, comedian and an award-winning performer – one thing she is not though is a psychologist.

However, she is very often the first point of contact for individuals in distress at the neighbourhood house.

“You give me a reason to leave the house,” one regular told her.

Another: “Thanks to your playgroup, I now have friends all over the neighbourhood.”

Inatimemarkedbyskyrocketingloneliness, cost-of-living stress and the long tail of the Covid-19 pandemic, places like this – warm, inclusive, and quietly revolutionary – are holding communities together.

And they’re doing it under the radar, on shoestring budgets, and with a kind of fierce love that can’t be faked.

When someone walks in clearly struggling,

Liz doesn’t offer a script.

“I listen. Then if I can help – I do,” Liz says.

“The heart-breaking thing is that more often than not, the best we can do is provide a safe space and a phone number to a better resourced organisation.”

What Liz wishes for is modest but urgent: a social worker on-site, food vouchers to give, transport for those who are stranded and can’t access services.

“Wedoourbesttopartnerwithorganisations like Foodbank and Whittlesea Community Connections but this is not enough.”

In that one sentence is the quiet frustration of countless front-line workers across Victoria, whoareholdingspaceforotherswhileburning out themselves.

One moment that stayed with Liz this year happened in a surprise setting – the Death Cafè.

It’s one of Thomastown Neighbourhood House’s more unconventional offerings, a philosophy-based program that facilitates conversations about end of life.

“One of the women shared how she lost her daughter to leukaemia, many years ago,” Liz recalls. “I was struck by her resilience and her creativity. Despite her grief, she’s committed to her community. It reminded me you never know what someone’s carrying.”

It’s a lesson that echoes across the programs the centre runs – from playgroups and craft workshops to dance classes and legal aid visits.

The weight of people’s stories isn’t always visible. But it’s there.

Since the pandemic, GPS and psychologists have increasingly referred patients to neighbourhoodhousesforwhatsomecountries call “green scripts” which directs patients to attend places doing activities that boost social cohesion and wellbeing without ever feeling like clinical intervention.

“Social cohesion is at an all-time low. Loneliness is at an all-time high,” Liz says.

“Butwhenanewparticipantjoinsourgroup, wefocusontheirstrengths.Beforelong,wecan see confidence grow and friendships flourish, “When you are feeling broken, the way to healing is through helping others.”

It’s healing through connection – and often, through creativity.

One of Liz’s highlights each week is a Monday afternoon dance party called Lets Move for young adults with disabilities.

“It’s pure joy,” Liz says. “That’s how I keep going – friendship and creativity.”

But Liz didn’t enter this role at a gentle time.

She became manager mid-pandemic, when all the programs were shut down and the focus turned to emergency food relief.

Suddenly, she was running a pantry out of the library foyer five days a week, with food linesstretchingtowardthenearbysportsfields.

“Ifeltoutofmydeptheveryday,”Lizadmits. “It was like trying to fill a bottomless well.”

Theneedhasn’teased.Ifanything,it’sgrown.

Now, with the cost-of-living crisis biting harder, the support of partners like Foodbank Victoria–whichbringsitsmobilesupermarket to Thomastown on Wednesdays – has become essential.

But so too has the advocacy for more sustainable support.

When asked what she wants politicians and mental health services to understand, Liz doesn’t hesitate.

“Neighbourhood houses provide a sense of belonging and purpose – which is often the key to overcoming mental health challenges from depression and loneliness, to stress and anxiety,” Liz says. “We provide safe spaces for people. But across Victoria, most neighbourhood house managers are working full-time hours in part-time roles. Burn-out is common. It’s not sustainable.”

Liz believes every house should have at least two staff present at all times to ensure safety and adequately support the wide range of

services they provide.

And in Thomastown, there is a desperate need for a larger space.

“We’re grateful to the City of Whittlesea and the state government for the support we do have,” Liz adds.

“But demand is surging, and our capacity hasn’t grown with it.”

It’s a confronting question – what would happen if Thomastown Neighbourhood House didn’t exist?

“There are very few spaces people can go to for free without feeling pressure to spend money,” Liz says.

“Shopping centres have become the default for when we have free time these days.”

Liz is also a passionate advocate for public outdoor spaces, encouraging locals to kick a ball around at the oval, explore local parks or visit the new Whittlesea Gardens skate park.

In a community where many women are migrants, caregivers, or survivors of trauma – including family violence – the role of Thomastown Neighbourhood House is bigger than just activity programs.

“We see people rebuild confidence here,” Liz says. “We see healing. Sometimes people come inquietandwithdrawnandafewmonthslater, they’re running art class.”

Asked if she ever worries about her own mental health and carrying the emotional toll of caring for others, Liz is candid: “Stress and anxiety – it’s a big one for me. But I try to remember to breathe“.

And perhaps that’s the greatest power of neighbourhood houses like this one, they don’t just help others find stability –they model what compassion looks like in action, and yet community organisations like Liz’s are chronically underfunded and under-recognised.

As Liz states in a simple yet poignant truth “Neighbourhood houses are more important than ever.”

Thomastown Neighbourhood House manager Liz Skitch. (Damjan Janevski) 475040_02

New kit helps with STI prevention

As a significant step in STI prevention for Australian women, the country’s first self-test kit for chlamydia and gonorrhoea is now available nationwide, offering greater privacy and fast results according to the company behind the break-through.

The first of its kind in Australia, the self-test kitdetectschlamydiaandgonorrhoeawithone swab sample, producing a positive or negative result for both infections in 15 minutes.

STIs affect almost one in six (16 per cent) Australians in their lifetime and over the last 10 years, cases have increased at an alarming rate in Australia, with rates of chlamydia and gonorrhoea increasing by 26 per cent and 157 per cent respectively.

‘‘

The self-test kit eliminates the anxiety associated with clinical settings and transforms the experience into a routine part of self-care

’’

- Steven Quinlan

Chlamydia is the most reported communicable disease in Australia, with over 110,000 reported cases in 2023, but is often asymptomatic,leadingtoundiagnosedcasesas peopleremainreluctanttotestfortheinfection due to perceived stigma or lack of awareness.

Gonorrhoea presents with pain or discomfort in the throat, eyes, cervix and other areas but, similarly, it is often mistaken for other infections and remains undiagnosed.

Steven Quinlan, sales director at Touch Biotechnology which developed the self-test kit, says it gives “women immediate control overtheirsexualhealthinawaythattraditional clinical testing does not“.

“Touch Biotechnology’s STI self-test kit for chlamydia and gonorrhoea works similarly to the common rapid antigen tests, using a single swab, buffer solution and test cassette to test for both infections in women, supporting early diagnosis and treatment,” he explained.

“By enabling women to easily test themselves when and where suits them, the self-test kit eliminates the anxiety associated with clinical settings and transforms the experience into a routine part of self-care.

“KnowingtheirSTIstatusalsohelpswomen to communicate better with healthcare providers, access the right medication, and reduce the risk of antibiotic misuse, which can lead to drug resistance.

“Affordable and discreet self-test kits remove the barriers that have traditionally kept women from seeking care. When

infections are caught early, swift action can be taken to prevent complications, such as infertility or chronic pelvic pain.

“In underserved communities, where access to healthcare can be limited, this type of testing is especially important. If adopted in healthcare centres, these kits could increase testing capacity, reduce costs, and improve overall health outcomes for women and the community.”

The Chlamydia and Gonorrhoea Rapid Test (for female) is now available for purchase at pharmacies, distributors, and online nationwide, to be completed discreetly at home. Prior to this, the only option for women to test for gonorrhoea and chlamydia was to complete an individual lab or PCR test. This invasive process could be costly and takes too long, with results typically taking one to three days.

Citations: 1. https://www.health.gov.au/topics/sexual-health/about 2. https://nindss.health.gov.au/pbi-dashboard/ 3. https://sti.guidelines.org.au/sexually-transmissible-infections/chlamydia/ 4. https://www.healthdirect.gov.au/gonorrhoea-the-clap

The facts:

What are chlamydia and gonorrhoea? Chlamydia and gonorrhoea are both bacterial sexually transmitted infections (STIs) that affect both men and women. Chlamydia is caused by Chlamydia trachomatis. It often doesn’t show symptoms, especially in women, but can lead to serious health issues like infertility if untreated. It can be cured with antibiotics.¹ Gonorrhoea is caused by Neisseria gonorrhoeae. It can cause symptoms like painful urination and discharge, but many people don’t experience symptoms. Like chlamydia, it can be treated with antibiotics, though some strains are becoming resistant to treatment.²

What are the risks of untreated chlamydia and gonorrhoea? If left untreated, chlamydia and gonorrhoea can lead to serious health complications for both men and women. For women, untreated chlamydia and gonorrhoea can cause pelvic inflammatory disease (PID), which can lead to chronic pain, infertility, and an increased risk of ectopic pregnancy. These infections can also increase the risk of HIV transmission.³ Additionally, untreated STIs can contribute to the spread of the infection to others, as well as cause more severe health issues over time. Timely treatment with antibiotics is essential to avoid these risks.

What are the symptoms of chlamydia and gonorrhoea?

Many people, particularly women, may not experience any symptoms, which is why these infections can often go undiagnosed. For women with chlamydia, common symptoms include abnormal vaginal discharge, painful urination, and pain during sex. Some may also experience lower abdominal pain or bleeding between periods or after sex.¹ Gonorrhoea, like chlamydia, may not always present clear symptoms. In women, symptoms often include increased vaginal discharge, painful urination, pelvic or abdominal pain, and bleeding between periods or after sex.

Lauren’s wish is for zero breast cancer deaths

Lauren Philpot, 24, is raising awareness for a cause very close to her heart having lost her mother, Leigh, to breast cancer.

A lifelong Maribyrnong resident, Lauren is a passionate crusader for breast cancer research having raised more than $142,000 for the Mother’s Day Classic over the past four years.

Lauren’s mum, Leigh, was diagnosed with breast cancer in September 2017, just five months after her 50th birthday. She beat it only forthecancertoreturninApril2021,asStage4 Metastatic Breast Cancer.

In 2021 Lauren formed, The Leigh Leigh’s to take part in their first Mother’s Day Classic. Around 50 of Lauren and Leigh’s family and friends donned their sneakers to participate in the MDC location at Flemington Racecourse and raised an incredible $15,800 for their efforts.

The following year, Lauren put her hand up to become an ambassador for MDC. She pushed her Mum in her wheelchair around the MDC’s biggest location at The Tan, with the group raising $8,500.

In 2023, Leigh could not make the start line for the Mother’s Day Classic as she was in hospital. Lauren, her brother Max and The Leigh Leighs Facetimed when they crossed the finish line. That year they raised $30,600.

“One of the last events Mum ever attended was the Mother’s Day Classic Media Launch,” Lauren said. “A few weeks later, she cheered The Leigh Leigh’s on Mother’s Day from her hospital bed only to pass away a couple days after that.

“Don’t cry, she would tell me. She was afraid, but so incredibly brave.

“She kept fighting to stay alive, even when

her body had already shut down.”

Leigh sadly passed away in May 2023.

“My Mum and I had a wish that we still share, zero deaths caused by Breast Cancer by 2030,” Lauren explained.

“For that to happen, there needs to be more funds going towards research.”

Last year Lauren led The Leigh Leigh’s in Leigh’slegacy,supportingothersgoingthrough the same thing. More than 100 participants walked in Leigh’s honour, raising $16,200.

This year Lauren is stepping up to host a Mother’s Day Classic event at Maribyrnong, one of 85 locations that will take place on Sunday, May 11. Lauren, a lifetime resident of the area, will stage an MDC event on the banks of Maribyrnong River starting/finishing at CoulsonGardens.Thelocationwillplayhostto a festival hub including market, entertainment and food trucks.

“The Maribyrnong River is very special to me. It’s a place where Mum and I walked everyday during COVID. Walking the river was the highlight of our day. It wasn’t just because we got out of the house. It was because we would share a special time together and just talk.

“We have lived in Maribyrnong my whole life. Our family has been affiliated with lots of

different clubs and communities in the area.

“Sport has also been a major part of our lives, including the Maribyrnong Park FC,Williamstown VFL FC and Rosamond Bowling Club.

“The local community has been so generous supporting this cause and all are behind our MDC event.”

The Mother’s Day Classic is primed for another record-breaking year, with organisers announcingarenewedcommitmenttofunding researchtoreducedeathsandimprovesurvival for breast and ovarian cancer.

Every day in Australia 63 people are diagnosed with breast or ovarian cancer. Every day 12 people die from those two diseases.

Lauren’s team has already $71,000 raised, with a goal of reaching $100,000 in 2025.

“When I decided to run this event, not only did I want to raise money and awareness for breast and ovarian cancer. I wanted to promote community engagement. So, I am doing that by bringing two councils, numerous clubs, and communities together. Everyone is welcome, dogs too!”

Participantscancontestthe8kmrun8:30am or 4km walk at 9:30am. Hosted by The Leigh Leigh’s. You can register at mothersdayclassic. com.au

Lauren Philpot and her late mum, Leigh.

Spoil mum with her favourite treats on Mother’s Day

Mother’s Day is the perfect occasion to show your appreciation by treating your mum to something truly special – and what better way than with delicious food? Whether you opt for breakfast in bed, a luxurious brunch, an elegant afternoon tea, or a beautifully prepared dinner,theeffortandloveyouputintocreating a memorable meal will mean the world to her. Here are some ideas to inspire you:

Breakfast in Bed

Start her day with a tray full of her favourite breakfast items. Freshly baked croissants or pastries, a bowl of mixed berries, and a glass of freshly squeezed orange juice make for a light but indulgent option. If she prefers something heartier, homemade pancakes topped with whipped cream and strawberries, or a classic eggsBenedict,wouldbearealtreat.Don’tforget a good cup of coffee or a pot of her favourite tea to complete the experience.

Elegant Brunch

If a late morning meal suits your plans, an elegant brunch can be a wonderful way to celebrate. Think smoked salmon bagels with cream cheese and dill, a colourful frittata loaded with vegetables, or a fluffy quiche Lorraine. Fresh fruit salads, yogurt parfaits with granola, and freshly baked muffins can add variety and color to the table. A Mimosa or Bellini (or a non-alcoholic sparkling juice) makes a festive touch that feels extra special.

Afternoon Tea

Spoil your mum with a homemade afternoon tea. Arrange a selection of delicate finger sandwiches, such as cucumber and cream cheese, smoked salmon and dill, or egg mayonnaise. Serve alongside scones with clotted cream and jam, mini cakes, macarons, and dainty pastries. Brewing a pot of

high-quality tea and presenting everything on a pretty tiered stand will make it feel just like a luxury hotel experience at home.

Homemade Dinner

For a truly memorable evening, prepare a homemade dinner featuring her favourite dishes. Start with a light appetizer like a fresh Caprese salad or a creamy mushroom soup. For the main course, dishes like roast chicken with garlic and herbs, pan-seared salmon with

lemonbuttersauce,orarichvegetarianlasagna canbeshowstoppers.Pairthemealwithagood wine if she enjoys it. Finish with a decadent dessert such as a chocolate lava cake, lemon tart, or a classic pavlova topped with fresh fruits.

Sweet Treats and Extras

Don’t forget the power of homemade sweet treats.Bakingabatchofherfavouritecookies,a moist carrot cake, or a luscious cheesecake can

be the icing on the cake (literally). You could also create a small box of homemade truffles or chocolate-dipped strawberries as a gift.

No matter what you cook or bake, the key is totailorthemealtowhatyourmumlovesmost. Add thoughtful touches like a handwritten menu,avaseoffreshflowers,oraheartfeltcard to make the meal even more special. When it comes to spoiling mum, it’s the love, time, and effort that truly count.

Mum’s the word and so is “yum”! Lock in your Mother’s Day plans with us for a lunch or dinner she’ll love, complete with mouthwatering specials and $3 oysters all day long. Tables are booking up fast, so don’t leave Mum hanging reserve your spot now! Book Now!

Race in and treat mum to a special dining experience

We all know the burden that comes with the perennial issue of deciding where to take mum for Mother’s Day. A trip out to the country or a ticket to a show is always cherished. However, coming up with something memorable is what every mum really wants.

The great news is a well established local Broadmeadows venue has a brilliant option that needs strong consideration .

If you’ve never dined in the City View Bistro at The Meadows, Saturday May 10 needs to be the night you head along and give it a try (with mum of course).

For those who have already enjoyed a meal at this elevated bistro dining gem with its views over the Melbourne city skyline and sensational racetrack, you’ll be pleased to learn it offers an inspired and very affordable menu and a team of hospitality staff who have taken the bistro dining concept to a whole new level. Plenty of recent Google reviews add weight to this claim.

Now, in case this dining experience alone doesn’t sound enough for that most special person we’re discussing, don’t forget a Saturday evening in the City Bistro revolves around all the fun and excitement of world-class metropolitan greyhound racing.

A 12 race card provides a very unique night of entertainment, whereby your table in the bistro remains yours for the entire evening and allows you to explore the venue and engage in the racing on offer. Complimentary track entry and parking are provided and the bistro dining room bar is very kind on the hip pocket.

All Mother’s Day eve reservations kick mum’s night off with a complimentary beverage. For the more adventurous a range of delicious cocktails and premium spirits can be purchased to accompany the meals.

If this sounds like a night that a mum you know would enjoy, you can make an online booking by visiting www. melbournegreyhounds.org.au or calling (03) 9355 5222.

Plus, there’s free children’s meals and a posy of flowers for mum to take home at the end of the night. May is also seafood month in the bistro – adding a special touch to the already extensive and tasty menu.

MY PLACE

As an artist and advocate for marginalised members of the community, Brimbank’s Shannon Meilak has been at the forefront of igniting crucial conversations. She spoke to Prealene Khera about what motivates her to continually push for inclusive change.

What is your connection to Brimbank?

I’ve lived in Brimbank for more than 40 years, running small businesses, serving on council’s arts and heritage advisory committee, and shooting an internationally acclaimed film here.

What do you like about where you live and what would you change?

There is a real opportunity for change and growth in the area. We have some great parks inBrimbank,butIbelieveit’stimetoprioritise nature – particularly increasing tree canopies in barren areas. We have playgrounds, but not enough trees. Brimbank deserves spaces where people can connect with nature.

I also love Brimbank’s cultural diversity, buttruediversitymeansincludingeveryone–people with disabilities, the LGBTQIA+, and religious minorities. Brimbank particularly lacks support for disabled adults and I want to help change that. As someone from a diverse cultural background, I acknowledge that council recognises cultural diversity, but we can do better to ensure no one is left isolated. By strengthening inclusion for all, Brimbank can become an even stronger, more unified community that truly embraces every individual.

Tell us a bit about the advocacy work you’ve done.

I’ve always believed in giving back to my community – whether through youth workshops in photography and film making, organising events for Clean Up Australia Day, or establishing community groups like the Brimbank Disability Advocacy & Support

and the Brimbank Sustainability & Climate Action groups.

I’ve also stood up for local causes, such as the campaign against Melbourne Airport’s third runway and the campaign against racism and fascism in Brimbank. Recently, I completed a photographic exhibition showcasing survivors of domestic and family Violence, and worked on both a radio and TV show showcasing incredible people with disabilities. It’s about creating change and amplifying underrepresented voices.

What accomplishment of yours are you really proud of?

Locally, I’m proud to have co-designed Access for All Abilities Play’s new website, worked with Victoria Police to establish more accessible community forums and events, and supported the formation of Lifeline Western Melbourne’s first inclusion policy.

I’m grateful for the opportunities I’ve had to create local films and collaborate with esteemed directors overseas. My films have screened across six continents, earning numerous awards. Although I haven’t yet had the chance to showcase my work in Brimbank, this recognition led to the honour of judging the Free Speech Film Festival in Philadelphia.

I’m also fortunate to have served as a Youth Ambassador for the Make Poverty History campaign, joining Hugh Evans to meet then-opposition leader Kevin Rudd. Volunteering during the Black Saturday Bushfires was also a meaningful experience, and I was humbled to be recognised by the Whittlesea mayor for my contributions.

Mother’s Day craft made with love

Each month, Stephanie Martinez will share an exciting craft project designed to inspire and spark creativity.

Stephanie starred in the first season of Making It on Network 10, where she discovered and ignited her passion for crafting.

Join Stephanie as she explores the endless possibilities of crafting and turn everyday materials into something extraordinary.

This month, Stephanie is creating a Mother’s Day card.

Materials White card stock (for the card) Red paper strips (for quilling)

Equipment Craft glue

Scissors Craft knife

Pencil

Quilling tool (optional)

Step 1: Fold a piece of white card stock in half to create the card base.

Step 2: Draw a heart shape on the front of the card and cut it out with a craft knife or scissors to create a heart window.

Step 3: Cut thin strips of red paper (about 5mm wide) for quilling.

Step 4: Use a quilling tool or roll each paper strip into a tight coil by hand. Apply a small amount of glue to the end of the strip to secure the coil in place.

Step 5: Arrange the quilted coils into a heart shape on the inside of the card, aligning it with the cut-out window.

Step 6: Once satisfied with the placement, glue each quilled piece in place. Let it dry completely.

Step 7: Close the card, and your beautiful quilled heart design will be visible through the heart-shaped window.

Stephanie Martinez.

Shannon Meilak has continued to fiercely advocate for inclusive communities.

(Attie Mohebali) 452162_07

Masters games beckon for mum

By Gladys Barreta

Mother of two and athletic star Karley Crommie is showing that motherhood can be the beginning of, or an opportunity to rediscover new skills and achieve personal bests.

The Sydenham local is celebrating a story of self-discovery and strength after realising she needed to do something for herself and her health.

Realising fitness was better on the athletics track than in the gym, Crommie refocused on doing what she loved and is set to compete at this year’s Australian Masters Games.

‘‘ As a teenager, it was all about winning. I always compared myself to others. Now, it’s about getting a personal best ’’

- Karley Crommie

Having always been passionate about track and field, Crommie re-joined athletics a few months after her first child was born and discovered a joy in achieving personal bests rather than simply aiming for podium finishes.

Crommie is now coaching Little Athletics at Keilor and continues to run personal bests on the athletics track, recently breaking national indoorrecordsinthe60mand200m(Women’s 35s) at the Australian Masters Indoor Championships.

“After I had my firstborn, I remember walking up a big flight of stairs and being so outofbreath,”sherecalled. “IknewIneededto

do something for my health.

“As a teenager, it was all about winning. I always compared myself to others. Now, it’s

about getting a personal best – just improving, season by season.

“As a mum, you need your ‘you’ time, and

running is a great way for me to involve my kids.”

Crommie wants to show other mothers that there are many ways to stay active while involving and bringing the kids along for the ride.

Crommie’s son, Jesse,10, and daughter, Violet, 8, have always been supportive, recording her races and cheering her on from the sidelines.

“Sometimes they’ll record my races, and you can hear them in the footage yelling, ‘Go mum!’ Then they’ll meet me at the finish line and say, ‘That was awesome, mum!’ It means everything,” she said.

Crommie recently clocked 12.80 seconds in the 100m, a time faster than her best as a teenager.

At the Australian Masters Nationals, held from April 18-21, Ms Crommie ran her personal best for the 60m, which was recorded as a Victorian Masters record.

“IfeellikeI’matmypeak,butattheupcoming games, I hope I can execute a perfect race, get a personal best, and beat it,” she said.

“There are a couple of other mothers who have joined athletics and are now competing in Masters events.

“I feel supported in the Masters community, and there are older mums coming out to support me.”

CrommiewillbecompetingattheAustralian Masters Games in Canberra from October 18-25.

“You don’t have to jump straight into competition. Just find something you love and do it for you. Your body has been through a lot, so give it time. Don’t be afraid to put yourself first; your kids will see that, and they’ll be proud of you for it,” she said.

“New mothers, or mothers-to-be, find your thing and make time for it.”

Mother of two, Karley Crommie is rediscovering her speed as a Masters athlete. (Supplied)

As part of Victoria’s Big Build, we’re building the Metro Tunnel and its five new underground stations, with three stations now complete. Work is continuing on two stations, and we’re testing trains through the tunnel to make sure they operate smoothly and safely.

While we work, disruptions could affect your travel

Train disruptions: Buses replace trains in both directions

Sunbury Line 10 to 11 May 17 to 18 May 24 to 25 May 7 to 8 June

Arden Station

Remembrance journeys

The memory of Anzac Day is still fresh in our minds for another year – a moving service of remembrance and history at a local cenotaph across Australia.

But imagine being overseas for Anzac Day at places where the battles actually took place. Each year thousands of Australians follow in the footsteps of the Anzacs at Gallipoli and on the Western Front, and while many choose to coincide their battlefield travel with Anzac Day commemorations, remembrance travel takes place throughout the year with specialist operator Mat McLachlan Battlefield Tours offering weekly departures of its four-day Western Front Explorer from April to November, and private Gallipoli tours departing any day of choice year-round.

“The Gallipoli landings on 25 April 1915 marked the beginning of Australian service and sacrifice during the First World War,” War historian and battlefield tour operator, Mat McLachlan said.

“The Anzacs served at Gallipoli for eight long months, before the failed campaign was finally called off and the Gallipoli Evacuation took place in December 1915. Anzac troops thenwentontoserveontheWesternFrontfor three long years in bloody and costly battles that became synonymous with the futility and horror of war.”

“Gallipoli was where the Anzac legend began, while the Western Front was where modern warfare erupted, the Anzac legend was cemented, and where remembrance began.Today,GallipoliandtheWesternFront are incredibly meaningful and memorable places to visit, with many remnants from this history easy to be seen.”

It feels like something very Australian to do – to visit these places we have heard of at Services and read about in history books. But for some battlefield pilgrims the trip is very personal - including the group Mat has just had with him overseas.

ACT pilgrim Wendy Farnham visited the Western Front for the third time this year following her Anzac grandfather, James Bruce Lithgow, who served in the 36th Battalion on the Western Front from late 1916 and was one of the ‘lucky’ ones who made it home. During her Western Front tour, Wendy had the honour of reading the Ode of Remembrance at the Menin Gate Last Post Ceremony.

Wendy herself is veteran who served for more than 46 years, including tours in Iraq and East Timor. Anzac Day 2025 was Wendy’s third visit to the Western Front with Mat McLachlan but her first for Anzac Day. Wendy will then join Mat for his Gallipoli Signature Tour in May this year to explore

the Gallipoli Peninsula.

Gary and Jan Lloyd from Glandore, Adelaide followed in the footsteps of five Anzac relatives who all served at Gallipoli.

Three will forever lie at Gallipoli. Two survived to fight another day on the Western Front and made it through the war, including Gary’s grandfather, and their Gallipoli Anzac relative who went on to make aviation history.

Gary’s grandfather, Frederick Gerald Lloyd, landed with the two brothers on 25 April, took part on the May offensive (in which Rupert was shot and killed) coming out of it with a shrapnel wound in the leg,

took part in the Battle of Lone Pine (in which William was killed in action), and fought on until the Gallipoli Evacuation in December 1915. Frederick went on to serve on the Western Front – arriving on the 1st of April 1916 in France.

“My grandfather served at Gallipoli from the first day of the landings on 25th April 1915 right through the campaign to the evacuation, which for him was 18 December 1915,” he said before he left for his tour.

“I have his diary that describes the places he was at, the conditions he experienced, and the death of mates around him. He also took photos that I have, so I really want to walk in

his footsteps up Artillery Road to Lone Pine and visit Shrapnel Gully Cemetery where he took photos of the graves of some fallen mates.

“Whilst my grandfather went on to fight on the Western Front and survive the war, we have other close relatives who did not leave Gallipoli, so we want to visit their memorials to pay our respects and thank them ‘in person’ for their sacrifices.”

Mat McLachlan Battlefield Tours offers commemorative Anzac Day tours and tours throughout the year to Australia’s significant WWI and WW2 battlefields, as well as Vietnam. Visit battlefields.com.au.

Gary and Jan Lloyd photo taken at the RAAF Edinburgh base in Adelaide.

Sleeping under the stars at Gallipoli.

Anzac Day at Villers-Brettoneux, Western Front.

Wendy Farnham recites the Ode of Remembrance at the Menin Gate in Ypres on her Mat McLachlan Anzac Day on the Western Front battlefield tour.

Menin Gate in Ypres, Flanders, Belgium - battlefield pilgrims from Australia visit to pay respects ahead of Anzac Day. (Supplied: Mat McLachlan)

Anzac Day at Polygon Wood.

Curated luxury escapes

For those seeking alluring booking incentives to make the final decision on where and when to travel, here are twelve offers from Viking. The offers apply to select Asia ocean voyages sailing between September and November 2025, so those who are yet to book haven’t missed the boat for competitively priced travel this year.

From now until 30 June, 2025, Viking is offering travellers the opportunity to save up to AUD $15,800 per couple on twelve of its popular itineraries across China, Southeast Asia and the Far East.

This pricing comes at a time when Asia destinations are in high demand with travelers. The Asia itineraries on offer include popular destinations for Australian and New Zealand travelers, such as Japan, Hong Kong, China, Indonesia and Thailand.

The autumn sailing dates are perfect for travelers wanting to avoid crowds, heat, and humidity while exploring the magnificent temples, ancient cultural traditions and authentic regional cuisine that Asia offers.

Discover More of Asia For Less Ocean Voyage Highlights:

Twenty-two-day Gems of China and Japan from Beijing to Tokyo, includes Tibet, is priced from $13,295 per person in a Veranda Stateroom, with savings of up to $15,800 per couple based on 7 November 2025 departure.

Twenty-two-day Pearls of Japan and China from Tokyo to Beijing, includes Tibet, is priced from $14,295 per person in a Veranda Stateroom, with savings of up to $13,800 per couple based on 31 October 2025 departure.

Fifteen-day Coastal Jewels of China from Beijing to Hong Kong or vice versa is priced from $5,795 per person in a Veranda Stateroom, with savings of up to $12,800 per couple. Departures on 5 and 19 September and 3 October 2025.

Twenty-Two-day Best of China from Hong Kong to Beijing, includes Tibet, is priced from $12,795 per person in a Veranda Stateroom, with savings of up to $12,800 per couple based on 5 September and 3 October 2025 departures.

Twenty-Two -day Wonders of China, a round trip from Beijing, includes Tibet, is priced from $12,795 per person in a Veranda Stateroom, with savings of up to $12,800 per couplebasedon19September2025departure.

Fifteen-day Jewels of Japan & China from Tokyo to Beijing or vice versa is priced from $6,295 per person in a Veranda Stateroom, with savings of up to $12,200 per couple based on 31 October and 14 November 2025 departures.

Seventenn-day Komodo & the Australian Coast from Bali to Sydney is priced from $7,795 per person in a Veranda Stateroom, with savings of up to $10,800 per couple based on 14 and 16 November 2025 departures.

Fifteen-day Southeast Asia & Hong Kong from Hong Kong to Bangkok is priced from $7,795 per person in a Veranda Stateroom, with savings of up to $10,800 per couple based on 19 October 2025 departure.

Twenty-day Classic China Discovery

from Hong Kong to Beijing or vice versa is priced from $10,795 per person in a Veranda Stateroom, with savings of up to $10,800 per couple based on 5 and 14 September and 3 October 2025 departures.

Fifteen-day Far Eastern Horizons from Hong Kong to Tokyo is priced from $10,795 per person in a Veranda Stateroom, with savings of up to $8,800 per couple based on 4 October 2025 departure.

Twenty-Six-day North Pacific Crossing

from Vancouver to Tokyo is priced from $6,795 per person in a Veranda Stateroom, with savings of up to $8,800 per couple based on 9 September 2025 departure.

Thirteen-day Bangkok, Bali & Beyond from Bangkok to Bali is priced from $6,795 per person in a Veranda Stateroom, with savings of up to $6,200 per couple based on 2 November 2025 departure.

For more information, please visit www. viking.com or phone 138 747.

Hailed as one of the most beautiful places to see cherry blossoms in Tokyo, Chidorigafuchi.

The Wong Tai Sin-Temple Bridge in Hong-Kong.The extraordinary Terracotta Army located in Xi’an was discovered by local villagers in March 1974.

The understated luxury of the Explorers Lounge on board Viking.

LEE MCCARTHY

EUROPEAN SOJOURN

Amsterdam to Bucharest or vice versa

23 DAYS | 8 COUNTRIES | 19 GUIDED TOURS

SET SAIL: APR-OCT 2026; MAY-OCT 2027

From $13,495pp in Standard Stateroom

From $18,495pp in Veranda Stateroom

GRAND EUROPEAN TOUR

Amsterdam to Budapest or vice versa

15 DAYS | 4 COUNTRIES | 12 GUIDED TOURS

SET SAIL: MAY-NOV 2025; MAR-NOV 2026; APR-NOV 2027

From $6,895pp in Standard Stateroom

From $11,695pp in Veranda Stateroom

Discover More FOR LESS

Uncover the history, culture and traditions of the world’s most captivating destinations – for less.

Our voyages are meticulously crafted to offer you immersive experiences, exceptional service and everything you need included.

Save up to 30% on selected river and ocean voyages booked by 30 June 2025*.

RHINE GETAWAY

Amsterdam to Basel or vice versa

8 DAYS | 4 COUNTRIES | 6 GUIDED TOURS

SET SAIL: JUN-NOV 2025; MAR-NOV 2026; 2027

From $2,995pp in Standard Stateroom

From $4,195pp in Veranda Stateroom

ROTHENBURG,

Luxury Cunard Voyage from Sydney to London

Sail on board the stunning Queen Anne during a half-world voyage to Southampton, paired with a London hotel stay.

In Sydney Harbour, greet the newest member of Cunard’s illustrious fleet, Queen Anne, as she sets sail on the 45-night voyage to Southampton. Cruising on board this iconic ship promises an exquisite experience filled with gala evenings, classic a ernoon tea services, and culinary delights from a choice of world-class restaurants.

Explore the beaches of Fiji before crossing the International Date Line to Hawaii’s Honolulu. Next, you’ll enjoy a night in port In Los Angeles ahead of the passage through the Panama Canal, modern marvel of engineering. Tropical bliss awaits in Curacao, Aruba and Miami before you cross the Atlantic Ocean to Southampton. Here, you’ll disembark and transfer to London, where your holiday culminates with a two-night stay in the heart of the city.

Sydney, Port Vila, Suva, Honolulu, Los Angeles (overnight in port), Puerto Quetzal, Panama Canal (scenic cruising), Willemstad, Oranjestad, Miami, Ponta Delgada, Southampton, London

In sun-drenched Miami, the options for exploration and entertainment are endless. Bask on the famed shores of South Beach, explore the vibrant street art of Wynwood Walls, or indulge in culinary delights Little Havana’s diverse eateries.

The brand-new Queen Anne is a luxurious cruise liner offering opulent accommodations, fine dining, and exquisite service, promising an unforgettable voyage of elegance and indulgence on the high seas.

Sydney, Port Vila, Suva, Honolulu, Los Angeles (overnight in port), Puerto Quetzal, Panama Canal (scenic cruising), Willemstad, Oranjestad, Miami, Ponta Delgada, Southampton

Complimentary Oceanview to Balcony upgrade

Keilor Optus tower knocked back

By Tara Murray

An application for a telecommunication pole in the green wedge zone in Keilor has been knocked back by Brimbank council.

Optus had submitted an application to build the telecommunications pole at 110 Milburn Road, which would have a maximum height of 28.41 metres.

The site had been chosen because there is an identified need to improve the mobile communications coverage provided by Indara and Optus to the community, which comprises

Connecting locals with local work

Mayiik Awer spent almost a year without a job and was unsure what he wanted to do.

The decision to get some help from the Brimbank pathways employment program changed his life.

“It gave me an opening to get a job,” he said.

“They helped with cover letters and my resume.

“They have a better understanding of what an employer wants. I’m working a job that I’ve never worked before and I really enjoy it. It’s pretty amazing.”

As part of Brimbank council’s employment pathway, the council is hosting the Brimbank Local Jobs Showcase from May 14, to connect people with local job opportunities.

Mr Awer said he recommends the program and showcase to anyone in Brimbank looking for a job.

“I just came in and needed some help with my resume and it really helped,” he said.

“It gives them [job seekers] more opportunities to help them with more options and other roles

“It will be easier for them to get a job and they will get a lot of support. They [the employment program] know what the employer wants to hear.

“I recommend it for all youth and I want more people to know about it.”

The showcase is at Visy Cares Hub, 80b Harvester Road, Sunshine, from 1-5pm.

the residential properties within Keilor, nearby commercial and industrial properties, and commuters along the Calder Freeway Council officers recommended granting a permit for the pole but the majority of councillors instead decided to vote against issuing a permit.

Mayor Thuy Dung and councillors Maria Kerr and Katherine Nikolic supported the original recommendation.

Cr Virginia Tachos said while there is a need to provide telecommunications coverage by Optus, there had to be a balance with residents’

concerns.

The council said Milburn Road displays a rural character as it is unsealed and absent of kerbs and footpaths.

The site is currently being leased for agricultural purposes, with a large farm building located central to the site’s eastern frontage.

“Ihavetoalsobalancethiswiththeconcerns of our community members, some who are agricultural producers, and have expressed their concerns,” Cr Tachos said.

“If I can summarise the objections; the

suitability of a tower in a green wedge zone, the visible and visual dominance, the destruction of the farm agricultural aesthetic, Keilor country town character was raised, radiotian, electronic field omissions, impacting health and crops, flight path concerns.”

Cr Tachos mentioned the impact that electronic field omissions can have on bees and that the project has the potential to have a negative impact on Keilor Garden Markets.

Cr Duyen Anh Pham said the location wasn’t consistent with this infrastructure and it should be in a commercial or industrial zone.

Have your say on Melton

Melton council residents might hear a knock at their door from late May onwards as part of a survey covering satisfaction of council services and facilities.

Professional field researchers will randomly select homes across the municipality to ask residents about a range of topics, including their satisfaction with local planning and council programs, the sense of community in Melton council, and local issues.

Atotalof800homeswillbeinvolved in the survey.

This data will then inform the council’s ongoing services by helping to reveal where residents’ needs are being met, and where they are not.

Residentswhohavebeenselectedfor the survey can expect a knock on their door between Saturday, May 17 and Sunday, June 8 for the approximately 15-minute survey.

Responses are confidential.

Melton mayor Steve Abboushi said it is important that the council hears from the community to understand if itismeetingitsneedsandexpectations in terms of service delivery.

“The survey helps [Melton council] to gain insight into the community’s satisfaction with council services and identify areas that may need improvement,” Cr Abboushi said.

“We look forward to hearing what our community thinks council is doing well, and anything they’d like to see changed in the future.“

The field researchers will carry photo identification.

Mayiik Awer. (Supplied)

COMMUNITY CALENDAR

WANT YOUR EVENT LISTED? Community Calendar is made available free of charge to not-for-profit organisations to keep the public informed of special events and activities. Send item details to Star Weekly Community Calendar, Corner Thomsons Road and Keilor Park Drive, Keilor Park, 3042, or email to westeditorial@starweekly.com.au by 9am Wednesday the week prior to publication

Africa’s Got Talent

Africa’s Got Talent is a vibrant, youth-led capacity-building initiative that celebrates the artistic and cultural talents of African-Australian youth. Held annually by Africa Day Australia, the showcase brings together the best emerging performers from across Victoria through a series of auditions that highlight creativity, passion, and cultural pride. It’s on Saturday, May 24, 5.30-9.30pm at the Bowery Theatre, 33 Princess Street, St Albans.

 africadayaustralia.org/

Over 50’s club

The Keilor Over 50’s Recreation Club meets at Kealba Hall, 24 McShane Drive, Kealba, on Tuesdays from 10am-3pm and Wednesdays from 7-10pm. Have a coffee and a chat, play social table tennis, pool and card games, go on organised outings and enjoy barbecues. First two visits are free then annual membership fees apply.

 Graeme, 0404 809 640, keilorover50@ gmail.com, or www.keilorover50.com.au

Jobs showcase

Looking for your next job opportunity?

Visit the Visy Cares Hub on Wednesday, May 14, from 1-5pm to connect with employers, training providers, and industry experts at the Brimbank Local Jobs Showcase. Explore local job opportunities in food manufacturing, retail, leisure, local government and more. Meet employers, connect with Registered Training Organisations (RTOs), explore career pathways, ask questions, and even apply on the spot. At 80b Harvester Road, Sunshine.

 www.trybooking.com/events/ landing/1350481

Plant-based cooking

Struggling to make the most of your fresh produce or stuck in a cooking rut?

Head to Brimbank Aquatic and Wellness Centre, 90 Taylors Road, Keilor Downs, on Saturday, May 10 for a hands-on cooking demonstration and discover delicious plant-based pizza recipes. This event is brought to you by My Smart Garden, a free educational gardening program designed to help you grow food, reduce waste, and create a more sustainable home. Workshop runs from 10am-noon. Registration required.

 events.humanitix.com/plant-based-lowwaste-cooking

Keilor Park Tennis Club social night

Join the club on Monday nights for a free social hit and get to know other club members. All levels are welcome. Female players are also required for Thursday competition from 10am to 2pm and also for the B grade mixed team on Wednesday, 7pm to 9pm.

 keilorparktennis@gmail.com

Brimbank Book Group

Be inspired by thought-provoking books with a group of like-minded, literary fans with our Brimbank Book Group. All welcomed. This group, for adults, meets on the first Monday of the month, from 2-3 pm at Deer Park Library. Bookings are not essential, but please feel free to register your interest if you’d like to receive a reminder email.

 library@brimbank.vic.gov.au

Women working together

A program connecting women aged 50 and above and in need of assistance, with mentors and mentees. Open to women across the western suburbs, including Brimbank.

 9655 2131, EmploymentSupport@ cotavic.org.au, or cotavic.org.au/ our-programs/employment-support/

This week’s photographer’s choice picture is of Werribeeks members Carmel Gerdsen, Debbie Conway and John Tulloch. (Ljubica Vrankovic) 475439_01

Create & Chat

Dig out your craft projects and get inspiration from fellow like-mindedcrafters with the Create & Chat sessions at Sunshine Library from 10-11am on the first Tuesday of every month. All skill levels are welcome.

 library@brimbank.vic.gov.au

National seniors meeting

On the first Wednesday of every month at 1.30pm, the metro west branch of national seniors meets at the Deer Park Club, with meals available to purchase. The group also holds lunches on different Fridays each month, as well as activities such as theatre visits, bus trips and more.

 0425 713 004, or lesley1.collins@outlook. com

Learn to Relax Group

IPC Health’s Living Well team is running a free Learn to Relax Group at IPC Health Deer Park, 106 Station Road, every Tuesday at 11am. This group is for people over 18 years who are interested in learning how to relax and finding ways to effectively manage their stress. Registration is required to attend this group.

 livingwell@ipchealth.com.au, or 1300 472 432

Women’s only conversation English Duke Street Community House is inviting locals to make friends, learn new skills and practice English in this fun and free women’s social group. Tuesdays during school terms, 9.30am-noon, at Duke Street Community House, 27 Duke Street, Sunshine.

 9311 9973, or dukest@dsch.org.au

Expressive art program for adults

Explore art making, prompted by thoughts and feelings, guided by a facilitator. Free, all materials provided. Every Monday, from 10 am to noon, at the Duke Street Community House.

Musicians wanted Westgate Concert Band is seeking new members. Do you play Woodwind, Brass or Percussion and are looking for a welcoming place to play enjoyable and challenging music? Rehearsals are held Saturday mornings during school terms, 9am to noon, at Braybrook College.

 westgateconcertband@gmail.com

Sunshine Repair Cafe

Do you enjoy fixing things or have skills in mending clothing and textiles? Kororoit Neighbourhood House is looking for volunteer repairers for the newly launched Repair Café in Brimbank. Events happen once a month and are an opportunity to meet others in the community and share your skills while helping fix broken household items.

 sunshinerepaircafe@kcnh.org.au, or 0413 434 082

Card games

Love playing the card game 500? Card games are played every Monday, from 7-10pm, at the Sunshine RSL offices, 99 Dickson Street, Sunshine.

 Leisa, 0425 768 808

Keilor Day View Club

The Keilor Day View Club meets at 11am on the first Thursday of each month at Green

Gully Soccer Club, Green Gully Reserve, Club House Place, Keilor Downs. The club is inviting locals to come along and enjoy a meal and fun with a friendly group of ladies.

 Robyn, 0425 387 880

Deer Park Lions Club

Deer Park Lions Club is looking for new members. It holds dinner meetings on the first Wednesday of every month at the Deer Park Senior Citizens Club, 119 Station Road, Deer Park.

 Michael, 0417 307 572

Sunshine Community Brass

Sunshine Community Brass is looking for trumpet and percussion players to join its vibrant band of musicians. With more than 90 years of history, the band rehearses at 45 Furlong Road, North Sunshine, on Tuesdays, from 7.30pm.

 Andrew, 0419 444 620

St Albans senior citizens

St Albans Senior Citizens group meet at the centre at the corner of Alfrieda and William streets, St Albans, on Monday, Wednesday and Friday, from 9am-2pm. Annual membership: $10. Cost: $1 entry on attendance day.

 Roma, 0435 991 064

Caroline Springs Rotary

The Rotary Club of Caroline Springs is inviting new guests to join its meetings in person or via Zoom. Meetings are held every Wednesday at the Western Emergency Relief Network in Ravenhall, from 7pm.

 rotarycarolinesprings@gmail.com

The Dress is more that it seams

‘The Dress’ might just epitomise the notion that things aren’t always what they seem –especially in Melbourne at the end of the 19th century.

While widow Hannah may live in a grand mansion and not want for anything, loneliness is an unspoken curse.

For her flamboyant tailor Bertin, the advent of department stores and retail therapy is a hit to the pocket and prominence alike.

Essence Theatre Productions chairperson Alaine Beek, who wrote the play, quite literally puts herself in Hannah’s shoes by playing the character herself.

“In those days when you were a widow, you

were often just given tenancy and you didn’t really own much,” Ms Beek said.

“Wepresumewealthypeoplehadthishappy, exciting life, but it wasn’t necessarily the case.

“Women had very limited power, and it could actually be quite boring.”

Hannah loves Bertin for the light he brings to her overcast life, but his escapades are something she desperately tries to evade.

The dynamic duo will embark on a tale of insistence and resistance when he tries to drag her along to a masquerade ball, where he will try and showcase his work.

On top of facing the loss of his livelihood, Bertin must also walk a fine line as a gay man

in a society that can be both ambivalent and persecutory.

“Bertin’ssexuality–it’srevered,butit’snever spoken about, but if he gets in the wrong circle he could be in trouble,” Ms Beek said.

The show will be staged at Werribee Park Mansion on Friday, May 9 at 8pm.

Tickets: https://www.essencetheatre. productions/the-dress-booking-page

Alaine Beek and Scott Middleton will depict the friendship of Hannah and Bertin in The Dress. (Supplied)

Artists share their creative journey

Altona’s Louis Goel Gallery has another exhibition that art lovers from the inner-west and beyond can enjoy.

ThreeArtists,OneJourneyfeaturesthework of Amanda Neville, Ilona Herreiner and and Juan Vasquez who are all based at the Altona Artisans ceramic studio at the Louis Joel Arts and Community (LJAC) centre.

Opened on April 26, the exhibition will run through until May 14 and features ceramics, mosaics,wood,andclaysculpturesthatexplore the shared creative journey of three artists shaping raw materials into expressive forms. Neville’s intricate mosaics piece together

colour and texture, telling stories through fragments, while Vasquez’s ceramics celebrate thefluidityandstrengthofclay,capturingboth tradition and innovation.

Herreiner’s sculptures, crafted from wood and clay, speak of transformation and organic movement.

Though working in different mediums, each artist shares a deep connection to process, material, and storytelling.

Their hands shape, carve, and construct, bridging past and present, form and emotion.

The exhibition allows patrons to experience this dialogue, where art becomes a reflection of

touch, time, and vision.

The Louis Joel Gallery is located within the LJACcentreandisopenfrom 9.30am-4.30pm Tuesday - Friday, and from 11am - 2pm on Saturday and Sunday. Three Artists, One Journey closes at 3pm on Thursday, May 14.

For more information: https://www.ljac. com.au/about-louis-joel-gallery/ Those wanting to learn from the three artists as well as viewing their work, can do so at a range of courses offered at the Altona Artisans ceramic studio.

Details: //www.ljac.com.au/altonaartisans/

An optimistic art exhibition for the times

Brimbank Gallery in Sunshine is proud to present Onward & Upward, a solo exhibition byacclaimedAustralianartistPatrickFrancis, running until May 30.

This vibrant and emotionally resonant exhibition showcases a compelling new body of work that continues Francis’ unique exploration of humanity, movement, and transformation through bold colour and expressive form.

Known for his distinct style of figurative abstraction and powerful visual storytelling, Patrick Francis brings an intuitive energy to his work, celebrating both individual identity and shared experience.

Onward & Upward is a reflection on perseverance, joy, and the pursuit of personal growth, all deeply embedded in his signature style—vivid, direct, and deeply human.

Francis, a Melbourne-based artist, has exhibited widely across Australia and internationally. His work is held in major public and private collections, including the NationalGalleryofVictoria,Artbank,andthe Art Gallery of New South Wales. Recognised not only for his artistic achievements but also his advocacy for artists with disabilities, Francis’ practice continues to redefine expectations and expand conversations around contemporary Australian art.

Brimbank Gallery invites the community to experience Onward & Upward, where each work resonates with energy, optimism, and a bold sense of momentum.

The gallery is located onthe first floor of the Brimbank Community & Civic Centre. It is open Monday to Friday, 9am to 5pm. Entry is free.

There are about 900 species of eucalypts inAustralia,andanupcomingworkshop at the Melton Botanic Garden will give you the opportunity to sketch and appreciate just some of these incredible trees.

Friends of Melton Botanic Garden and environmental psychology doctor

Kathleen Bagot are partnering to host a two-hour nature sketching and journaling workshop this month, providing sketching skills and an opportunity to practise mindfulness in an outdoor setting with like-minded nature enthusiasts.

The event coincides with Botanic Gardens Week.

The workshop starts with a guided nature-based mindfulness practice, followed by a warm up with some different sketching techniques and discussion of template options.

There will then be a discussion about eucalypts, and the session will end with a chance to share your thoughts and sketching pages with other attendees.

All supplies will be provided to participants new to nature sketching or journaling, and no experience or art skills are required.

Experienced sketchers are welcome to bring their own favourite journal and supplies, or use those provided.

Ms Bagot said the event is aimed at being accessible and inclusive to all who would like to attend.

“You don’t have to be an artist or a scientist to do nature journaling … it really is about slowing down [and] noticingwhat’sinnature,”MsBagotsaid.

She said that a previous workshop held on March 23 for National Eucalypt Day sold out.

Theworkshopwillbeheldfrom10am–noon on Sunday, May 25 at the Melton Botanic Garden.

Tickets can be purchased online. Details: events.humanitix.com/naturesketching-eucalypts-in-melton-botanicgarden-25-may

The work of artists Juan Vasquez, Ilona Herreiner, and Amanda Neville is on display in the Three Artists, One Journey exhibition at the Louis Joel Gallery in Altona until May 14. (Ljubica Vrankovic) 472730_01

Artist Patrick Francis and exhibition curator Richard Orjis. (Supplied)

Environmental psychology doctor Kathleen Bagot at the Melton Botanic Garden. (Damjan Janevski 475273_01

PUZZLES

To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.

ACROSS

1 Also known as (1,1,1)

3 Sacrilegious (11)

9 Difficult to understand (7)

10 Captivate (7)

11 Somewhat (8)

12 Smear, often with oil (6)

14 Spawn, similar to caviar (3)

15 Without aim (11)

17 Restrictions (11)

19 For this, ad – (Lat) (3)

20 Cease (6)

21 Plastic unit containing audio or visual tape (8)

24 High-protein pulse (7)

25 Middle Eastern national (7)

26 Impediment (11)

27 Televisions (abbr) (3)

DOWN

1 Inherited from one’s family (9)

2 Whenever you like (7)

3 Stereotypically masculine (5)

4 Speed up (10)

5 Bars (4)

6 Designer of goods and structures (9)

7 Opening (7)

8 Separate metal from ore (5)

13 Crowning ceremony (10)

15 Metallic element (9)

16 People living together in communities (9)

18 Of the Freemasons (7)

19 Highest in temperature (7)

20 Rummage (5)

22 Wait on (5)

23 Operator (4)

can you list? The centre letter must be included and each letter may only be used once. No colloquial or foreign words. No capitalised nouns, apostrophes or plural nouns ending in “s”.

1 What was the first successful contact lens made of?

2 ‘Herbst’ is German for which season?

3 What astrological term is used to describe the apparent backwards movement of a planet through the sky?

4 The legal drama series The GoodFight starring Christine Baranski (pictured) is a spin-off of which show?

5 What is the name of Taylor Swift’s 2023–2024 concert tour?

6 In which decade were the first Grammys awarded?

7 In which ocean would you find The Bahamas?

8 JojoRabbit, Hunt for the Wilderpeople and Boy were all directed by which filmmaker?

9 What are homonyms?

10 True or false: chickens can recognise up to 100 faces?

Still keeping ahead of the game

By Chris Riley, Marque Motoring

It’s amazing how the Toyota Corolla has evolved over the years.

Back in the day it was basic, vanilla transport and that’s the way it stayed for years.

Then someone, somewhere flipped a switch and things began to change dramatically, starting with the 11th gen Corolla in 2012.

But it was just a warm up for the current model which arrived in early 2018, with its complex, unrepentant, multi-faceted design.

Sittinglowerthanbeforewithasteeplyraked windscreen, it presents a predatory nose, with a designthatisasgoodasanythingfromEurope.

The long and short of it is that the company has been able to transform the image of the car from staid and conservative into something much more sporty with younger buyer appeal - and Corolla remains the best-selling cars in the world.

Styling Corolla hatch starts from $30,630 for the AscentSport,$33,780fortheSX,$37,620forthe ZR - all with a 1.8-litre hybrid petrol-electric drivetrain and CVT automatic.

And, if the sporty ZR doesn’t float your boat, there’s also the high performance, all-wheel drive GR Corolla to consider.

But bring your money with you, because it’s a big hike in price: $67,990 in manual form or $70,490 with an automatic (before on-road costs). Two-tone paint adds $775 and is offered in combination with white, grey, red, silver and blue.

Our test vehicle, the ZR Hybrid hatch, is priced from $43,280 by the time you put it on the road in Sydney. The price varies a little depending on your address.

Finished in black over silver, the ZR looks stunning.

Standard kit includes 18-inch alloys, dual zone climate air and a combination of real and artificial suede trim, with heated sports seats up front with red accents and an eight-way, power-adjust driver seat with lumbar support.

There’s also a premium gear lever and steering wheel, smart entry and start, electric parking brake, adaptive cruise control, road sign recognition, auto lights and wipers, auto-dimming rear view mirror, front and rear parking sensors and rear privacy glass. In the lights department, it has auto high beam, bi-LED headlights, along with LED daytime, tail and front/rear fog lights.

ZR steps up to a full 12.3-inch digital instrument cluster along with windscreen head-up display.

Corolla comes with a five-year unlimited kilometre warranty.

Infotainment

Infotainment consists of an 8.0-inch touchscreen with premium JBL 8-speaker audio, plus Bluetooth, satellite navigation, AM/ FMandDAB+digitalradio,andwirelessApple CarPlay and wired Android Auto.

You also get 12 months of complimentary access with remote connect to Toyota Connect Services which automatically notifies emergency services in the event of an accident as well as provides remote access to the car.

There’s also a wireless charge pad, two USB-C ports and a 12 volt outlet in the front (but nothing for rear seat passengers).

Safety

Corolla has been awarded a full five stars for safety by ANCAP. It comes with a rear view camera, seven airbags including a driver knee airbag and autonomous emergency braking (City, Interurban & Vulnerable Road User) as well as lane keep assist (LKA) with lane departure warning (LDW).

An upgraded Toyota Safety Sense suite starts with the pre-collision safety system which adds motorcycle detection, intersection collision

avoidance support for crossing vehicles and left/right turn, emergency steering assist and acceleration suppression at low speeds.

Cameras and radar sensors have also been improved offering a wider range for detection of obstacles or vehicles.

Blind spot monitor has been added across thehatchrange,whilelanetraceassisthasbeen expanded to include the emergency driving stop system feature that has been designed to bring the vehicle to a gradual stop if it detects the driver is no longer making vehicle inputs.

The active cruise control system has also been enhanced and now offers four distance settings, the ability to detect other vehicles earlier, and the addition of deceleration assist when changing lanes.

But it misses out on auto reverse braking.

Isofix child restraint anchorage points are provided for the rear outboard seats.

Engines/transmissions

With the introduction of the upgraded fifth-generation hybrid powertrain, performance has been boosted with a 13kW increase in power to deliver a combined output of 103kW.

The upgraded hybrid teams a 1.8-litre petrol engine with a newly developed high-output motor generator, power control unit and downsized hybrid transaxle.

The front, axle-mounted drive motor has been enhanced by doubling the number of magnets per pole inside the rotor, while the newly developed lithium-ion battery reduces weight by 14 per cent while increasing both input and output power.

Thehybriddrivesthefrontwheelsexclusively via a continuously variable transmission (CVT).

Driving Corolla’s low stance and wind-cheating profile places the car quite close to the ground. As a result,itcanmakegettinginandoutdifficultat timesanditmeansdrivewaysandspeedhumps also need to be approached with caution, as the low front apron is prone to scraping.

Sports seats with bolstered sides add to the difficulty. The sloping rear roof line also makes entry to the back seat more difficult than it probably should be and you might find it a little cramped once you’re in.

The boot gains some extra space, with a puncture kit instead of a spare tyre to make room for the hybrid battery pack.

Of note Corolla’s cousin the Lexus UX scores a larger 2.0-litre engine as the basis for its hybrid that produces a combined 146kW.

Putting the transmission of the hybrid in Power mode delivers more satisfying throttle response, with a turn of speed thanks to the boost from the electric motor. But make sure you don’t pull the transmission lever back all the way or you’ll find yourself in B instead of D, which is regenerative braking mode.

Traffic sign monitor recognises physical speed signs only.

It doesn’t recognise electronic speed signs, nor does it differentiate between standard signs, timed school zones or bus and truck advisory speed - so until it encounters a real speed sign it could be telling you fibs.

Steering is sharp and the hatch corners flat and hard, but the ride is overly harsh and the cabincanbecomequitenoisydependingonthe surface.

Toyota does not permit operation of the satellite navigation system while the car is in motion.

It’s super annoying, but you have to be in park with the handbrake activated. And that means pulling over and spending precious minutes on the task.

Sluggish response from the touchscreen makes the task that much more difficult. You can bang in the name of a street only to look up and discover it failed to recognise the first letter and that means starting over.

Of course, you could try appealing to the car’s voice activation system, but that’s an even more frustrating experience.

At the end of the day the hybrid is all about economy and this is where the Corolla excels. Rated at 4.0L/100km, we were getting 5.2L after almost 400km of mixed driving.

Summing up

You can’t really go wrong with the Corolla ZR hybrid hatch, but it commands a steeper price these days at more than $43K on the road.

There’s no longer a petrol model to distract buyers, but the hybrid powertrain provides immediate, accessible, no frills fuel savings to the average motorist, with no need for user intervention.

Beware the low ride height however which makes entry and exit more difficult than you might think.

You can’t really go wrong with the Corolla ZR hybrid hatch. (Pictures: Supplied)

Competition heats up in the sun

There was plenty of sporting action around the grounds and courts on Saturday. StarWeeklyphotographer

out shooting some of the action.

Williamstown’s Tom Downie. 475540_01

Keilor Park’s Caitlyn Crameri. 475729_09

Spotswood’s Lachlan Heriot and Yarraville Seddon’s Wil Baker. 475545_14

Werribee Centrals’ Michael Culliver. 475479_01

Werribee Centrals’ Olivia Edwards. 475482_23

Keilor Park’s Isabella Arvanitis and Burnside Heights’ Krissy Trang. 475729_13

Yarraville Seddon’s Corey Hitchcock. 475545_02

Werribee Centrals’ Kai Gomes Pattiyage and Inverleigh’s Jarvis Miles. 475479_08

Williamstown’s Justin Plapp. 475540_22

Williamstown’s Toby Triffett. 475540_09

Werribee Centrals’ Ellie Tubbs. 475482_09

Ljubica Vrankovic was

Westgate keen to build after a frustrating start

Westgate has had a slightly frustrating start to the FV state league 1 north-west season, but is yet to drop a game despite only having one win on the board.

Westgate has four draws out of its five matches,withtheotherawinheadingintothe weekend’s round six match.

Coach Anthony Barberi said it has been slightly frustrating but understands that they haven’t had things go all their way and hadn’t got the results they were after.

Westgate was sitting in fifth spot heading into the weekend action.

“We know we have been in winning positions in every game,” he said.

“We haven’t been able to see out the results.

“It’s not through a lack of effort or trying. We have a brand new team and lots of new faces.

“We have been unsettled due to a number of injuries.

“We had a great pre-season and it’s still relatively positive and we’ve played some good football.”

Westgate has added 18 new players to the squad of 24 including promoting some of the younger players.

With so many new players, Barberi said they knew it was going to take some time to settle into their best.

“We’re not disappointed given the amount of injuries and the new squad we have, we’ve

done reasonably well,“ he said. “We had a good run in the cup [Australia Cup] and lost to Avondale and had a good showing.

“We’ve been rather good, we have not had results go our way.”

Barberi, who used to coach Avondale for eight years, said it was a good opportunity to play one of the best teams in the state.

Westgate is hoping that the next couple of weeks it will get most of its playing squad back on the park with all but one or two expected to return shortly.

Barberi said once that happens he is hoping itwillhelpturnsomeofthosedrawsintowins.

“We are hoping to get a settled line up, our best 11 on the pitch,” he said

13, and twins

15.

Little athletes race away

Three Keilor Little Athletics stars have been travelling the country the past month as they take on the best in the country.

Twins Sienna and Hannah Gec, and Gabriel Owusu-Afriyie all competed at the Athletics Australia national championships in early April, before competing at the Little Athletics national championships late last month.

The twins also competed at the Stawell Gift in between, with Sienna winning gold in the Little Athletics girls 100 metre event.

Speaking between the two national championships, all three said they were excited for the opportunity.

For Hannah, it was the first time she had made nationals for little athletics and it was also her first season doing senior athletics and qualifying for that nationals.

“Ididn’texpecttomakeitthisyear,”shesaid. “It was the last year to qualify for nationals for our age group [in little aths].

“I just nicked it too. It was first state medal as well. I got second to Sienna.”

HannahsaidPerthandrepresentingVictoria

forthefirsttimewasamazingandseewhatthat next level was like.

She competed at the heptathlon at both events and also competed in the 100 metre mixed relay alongside her sister at Adelaide, winning bronze. She finished fifth at the heptathlon at Adelaide.

Sienna finished third in the heptathlon in Perth.

She was hoping to win two medals in Adelaide and was able to come away with bronze in the heptathlon and silver alongside her sister in the mixed 4 x 100 metres under-15 relay.

Sienna said competing with her sister was an amazing feeling. Both said training with each other was nice and it really pushed them.

“It’sgoingtobesuchagreatexperiencegoing back to Adelaide and competing for the last time for nationals [Little Athletics],” Sienna said.

“For us both competing in the same event, the heptathlon, representing Victoria, is like an opportunity that will come around only

“Once we can solidify our starting line up … Our best is still yet to come that is for sure.

“There’s a bit of improving to do and it will take some time

“We’re not expecting unrealistic results early. We are building and it will not happen straight away.”

Westgate was due to face Clifton Hill on Friday night, after deadline.

In other state league matches at the weekend, Keilor Park was away against Yarraville, Sydenham Park took on Upfield, Western Suburbs faced Brimbank Stallions andWestvaleOlympicwasathometoBallarat City.

Tara Murray

Knights look to NPL success

Melbourne Knights are hoping to take the momentum from a dominant Australia Cup performance into the National Premier League.

It’s been a tough NPL season so far for theKnights,buttheyshowedtheirpower upfrontintheirroundfiveAustraliaCup match.

On April 29, the Knights faced Werribee City in the fifth round of the knockout cup.

It was a performance coach Ivan Franjic was happy with, as the side won 3-0 after leading 0-0 at half time.

Mazis, Ciaran Bramwell and Leo Maziz were the goal scorers for the Knights.

“We had 36 shots, it was a good dominant performance,” Franjic said.

“We would have liked to have scored more but we’ve progressed to the next round of the cup.

“The boys played well, but some days they don’t go in.”

Franjic said they’ve been working really hard and there’s been a lot of positives.

He’s hoping that they can continue that momentum into the league.

“We’re building and starting to get the scores,” he said. “We’ve had a fair few injuries since round two.

“We’re starting to get them coming backintotheside.Itmakesittoughwhen you have key personnel out.”

Franjic said for the first part of the season, they’ve regularly had seven players out of their best side. He said three of them were long-term injuries andplayersunlikelytoreturnthisseason.

In the NPL competition, the Knights were sitting in 12th spot with just three wins ahead of the weekend’s match after deadline.

once around.

“I’m very privileged for her to join me.”

Sienna said it was really cool seeing other states tracks at nationals and seeing the wide range of talent on show.

Gabrielcameawaywiththreesilversandone bronze at the Little Athletics championships in the under-13s, after winning two silver medals at the nationals in Perth.

He said after Perth it hasn’t surprised him that he came away with a medal.

“It’s a good experience for me, and I’m really looking forward to it,” he said.

“I’mnormallylikefirst,secondorthird,soit’s good to be representing Victoria at nationals.

“It [Perth] was a really good experience. In the hurdles I did really well. I came in as the third-fourth fastest time, so I was expecting a medal.”

Hurdles is Gabriel’s favourite event. He said he was expecting to win three medals at the Little Athletics championships.

All three said they would like to take their careers to the world stage.

Franjic is hoping they can now kick start their season as they look to return to finals this season.

“It’s been looking positive the last few weeks and we want to continue that on Sunday,“ Franjic said.

“We want to be higher up the table.

“We believe we are a better team than what we’re showing so far. We’ll keep fighting and hopefully progress up the table.”

The Knights were due to face Dandenong City on Sunday, after deadline. The Thunder entered the game in eighth spot.

Franjic said it would be another challenge.

“We respect every opposition, but we are focusing on ourselves.”

In other NPL matches at the weekend, Green Gully was away to Preston Lions and St Albans Saints faced Dandenong Thunder.

Gabriel Owusu-Afriyie,

Sienna and Hannah Gec,

(Damjan Janevski). 472528_03

Brookers starting to take control on the field

By Tara Murray

Braybrook showed some glimpses of what it can do as it got on the board in the Western Football League division 2 competition.

It’s been a tough start on the scoreboard for the Brookers, but on Saturday they were able to come away with a strong win against a struggling Tarneit.

Brookers coach Geoff Maddern said it was nice to see a little bit of what they had been working on come together,

“We’ve got quite a few new players on the list and it will take a little bit of time to gel and they played a bit better yesterday [Saturday].

“Round one we had nine new players, we were pretty close to nine or 10 on Saturday. It’s going to take a little bit of time.”

Maddern said the most pleasing thing for the coaches on Saturday was the connection between the three lines.

He said it was much better and there was more communication as well.

“There was a bit more connection, where theyliketoleadandwheretheywanttheball.” he said.

On Saturday, the Brookers jumped out of the blocks and led 52-7 at the first break.

That set the tone for the rest of the day, with the Brookers winning, 25.15 (165)-5.7 (37).

Maddern said the scoreboard didn’t reflect the match.

“We got off to a flyer which always helps,” he said. “Tarneit were competitive and worked hard.”

Jarrod Garth kicked 14 goals and starred up forward, while Jack Vivian kicked six goals.

Nathan Spackman was strong down back, while the two Condo brothers, Justin and Matthew, were the other standouts.

Maddern said they were hoping they could build some momentum now.

“It is huge,” he said of momentum.

“When you are losing the guys start to drop their heads. You can quickly turn it around and we did that with our performance on Saturday.

“There’s things to work on and things are taking shape a little bit.”

The Brookers face Laverton this week.

Maddern said they are a good young side that has been playing some good football.

In other results, Albanvale fell short against the Suns, 14.18 (102)-12.9 (81).

The Suns kicked the only four goals of the final quarter to come from a goal behind at the last break.

Sunshine Heights was also on the wrong endofitonSaturday,losingtoWestFootscray, 22.12 (144)-9.14 (68).

Jacob Poa, Joey Greto and John Whitehouse were the Dragons best.

422892_19

Blues undefeated on top

Keilor continues to show strong early season form, this time accounting for Aberfeldie in the top of the table Essendon District Football League premier division season. Both sides entered the match undefeated and it was last season’s premiers that remained that way.

The Blues led at every break on the way to a 12.13 (85)-8.14 (62) win.

Blues coach Mick McGuane said it was a great game of football between two good sides.

“It was a good result,” he said. “You sort of want to play against the top teams before the competition bends down on who looks like it will be separating from the others.

“We knew Aberfeldie was going really well and recruited heavily; they’ve got some talent around the ball and a forward line that is clearly a threat.

“To keep them to the scoreline we did, we defended the ground well and with good intent.Ithoughtthatwasapointofdifference early in the game.”

McGuane said he thought they played well in the first quarter before both teams were

feeling each other out in the second quarter.

On the scoreboard, the third quarter would break them apart as the lead went from 12 points to 29 points.

“It was pretty good footy actually,”

McGuane said.

Matthew Bartlett and Cody Brand kicked three goals each.

McGuane said they had a lot of good contributors, with their back six rock solid all day.

He singled out the role of Blair Wyllie in the rcuk.

“He had a standout game,” he said. “There wasnogenuineruckoutthereforbothteams. Wyllie fits that category.

“He did a fantastic job, two years ago he was playing in the thirds.”

The Blues line up was anywhere from being at full strength, showing the depth the side has.

Corey Ellis and Josh Honey were among the outs from the side on the weekend.

“You don’t know how the pennies will drop with VFL aligned boys,” he said. “We have 11 in the system, one available yesterday

Sports shorts

VNL

The City West Falcons continued its winning streak, while the Western Warriors fell short in the Victorian Netball League. The Falcons faced the North East Blaze on Wednesday night and were able to build into a 79-51 win. Jane Cook shot 64 goals for the Falcons. Earlier, the Warriors had lost to the Boroondara Express on Monday night, 61-43. Most of the damage was done in the second quarter which the Warriors lost 17-8.

NBL1

Keilor Thunder got the winning double on Saturday night in the National Basketball League 1 South competition. The women started the night with a 95-67 win against the Nunawading Spectres, 95-67. The Thunder won the first three quarters, before the Spectres finished strongly. Issy Bourne top scored with 22 points. The men’s side then won a thriller against the Spectres, 102-100. Deng Dut top scored with 32 points.

Western FL

[Saturday].

“Some premiership players from last year’s team are still unavailable, Corey Mitch and Nathan [Ellis], Mason Thomas. Riley Ham hasn’t played a game yet and is not far away.

“And Thomas [McGuane] when he’s available, there’s north a dozen players that are more than capable senior listed players.”

The win has the Blues sitting 4-0.

McGuane said they were pretty happy with how the season had started.

“You just don’t know after a premiership if the hunger or the competitive drive is still there,” he said.

“We’ve hit the ground running, really happy with them.”

Itwillbetopagainstbottomthisweek,with the Blues to face a struggling East Keilor.

McGuane said he would coach the group stronger in this match to make sure they respect the Cougars and play the type of football they want to be playing.”

In other results, Deer Park got its second win of the season as it beat Essendon Doutta Stars, 19.10 (124)-14.13 (97).

Caroline Springs fell just short against Werribee Districts in the Western Football League division 1 competition. Coming off their first win of the season, the Lakers were in trouble early, down by 27 points. The Lakers managed to make it a game and were down by less than a goal at the next two breaks. The Tigers finished the quarter with two goals to one to seal a 13.14 (92)-11.11 (77). Steven Kyriazis, Lachlan Mellon and Ben Caluzzi were named their best.

FV

Westgate got another win on the board, while the Western Suburbs had a good win against Brimbank Stallions in FV state league 1 north-west. Westgate kept its run of not losing a match alive with a 1-0 win against Clifton Hill. Western Suburbs beat Brimbank Stallions 2-0, Keilor Park beat Yarraville Glory 3-1, while Sydenham Park had a 1-1 draw with Upfield.

FOR MORE SPORT, VISIT Web: starweekly.com.au

Brimbank & North West Star Weekly @starweeklynews @star_weekly

Kane Barbuto. (Ljubica Vrankovic)

Liam McGarity. (Ljubica Vrankovic) 421550_16

TIPPING 2025

Benny Nguyen OBrien

Comazzetto