Page 1

Southern Peninsula

Features inside: HEALTHY LIVING PAGES 24 - 27 FOOD & ENTERTAINMENT PAGE 28 SOUTHERN PENINSULA SCOREBOARD PAGE 31

Local news for local people

Your FREE Fortnightly Community Newspaper covering Safety Beach to Portsea For all your advertising and editorial needs, call us on 1300

FREE

22 February - 7 March 2011

MPNEWS (1300 676 397) or email: team@mpnews.com.au www.mpnews.com.au

Place for a garden ROSEBUD’S community garden is a growing concern. Nestled within Lawson Reserve, it is run by volunteers who have built raised garden beds, which are rented to the public. The garden has been operating for six years and is a focal point for gardeners, with annual open days, demonstrations and classes making it a community hub. The garden has 35 members who work at the garden on Wednesdays. Committee president Amalia Kerr said volunteers were welcome to join in working bees on the third Saturday each month. The committee meets monthly and will use a $5000 grant from Mornington Peninsula Shire to buy and install a second water tank and build a pergola. Vice-president Judy Lyew said the community garden planned to expand its art and cooking classes. Some of the produce grown there is given to needy families. Anyone who would like to join Rosebud Community Garden can call 5986 3467. Garden time: Rosebud Community Garden president Amalia Kerr, right, and vice-president Judy Lyew admire a crop in a rented vegetable bed.

Clean Ocean city media alert By Mike Hast CLEAN Ocean Foundation lit the fire under Melbourne media that saw Melbourne Water and the Environment Protection Authority take a battering after sewage was released into rivers, creeks and drains earlier this month. South-eastern suburbs including Berwick, Narre Warren North, Hampton Park and Lyndhurst received more than 150mm of rain overnight on 4-5 February with other suburbs getting 80mm.

Marshall’s HOLIDAY RENTALS

The rainstorm inundated homes, roads and, more dangerously, stormwater drains that flowed into Eastern Treatment Plant near Carrum. Sewage was released into drains and waterways, and it made its way into Port Phillip. The peninsula-based foundation’s CEO James Clark-Kennedy was the first to forensically examine a press release from Melbourne Water. Buried in the ninth and 10th paragraphs of the release was the crucial

Por

tse

a to

SORRENTO OFFICE We are the largest on the Mornington Peninsula

9best service 9best ROI

9biggest team 9100% holiday focus

D NTE

WASTS S E I E RT Y G U E

IT P P R O FOR QUAL

5984 5955 www.MyRentals.com.au 119 Ocean Beach Rd. Upstairs (cnr. Darling Rd.)

Ro

statement “targeted emergency releases [were made] in consultation with EPA Victoria”. These were “releases of waste water into drains and waterways via special emergency relief points, to reduce pressure on the overall network”. Melbourne Water stated the sewage plant handled up to 40 per cent of Melbourne’s waste water and was operating at close to full capacity as stormwater in the sewage system made its way into the plant at up to 20,000

RENTALS WANTED

seb

ud

HOLIDAY & PERMANENTS

)LHJO9L[YLH[Z Holiday Property Management

......a low cost alternative Services include: ‡ERRNLQJVDQGHQTXLULHV ‡DGYHUWLVLQJDQGPDUNHWLQJ ‡LQVSHFWLRQV ‡KRXVHNHHSLQJ ‡PDLQWHQDQFH Contact: 0411 412 103 or 0419 301 928 www.beachretreatsvic.com.au

litres per second. Normal dry weather flow was 5500 litres per second. “Flows into Western Treatment Plant at Werribee, which handles about 50 per cent of Melbourne’s waste water, have spiked at around 18,000 litres per second,” Melbourne Water stated. It was the term “waste water” that rang the alrm bells for Mr ClarkKennedy, a veteran of the long-running campaign to stop class C treated water being pumped into Bass Strait at Boags Rocks near popular Gunnamatta surf

HAND CRAFTED POTS, WATER FEATURES, FURNITURE, STATUES, ART GALLERY ELITE HOME & GARDEN DÉCOR 16 Mornington – Tyabb Rd Tyabb Phone 03 9397 6644 Open Thurs – Sun 9.30am - 4.00pm

www.topez.com.au

We urgently require permanent & holiday rental properties to meet demand in Portsea, Sorrento , Blairgowrie & Rye! Call our Rental Managers for a FREE appraisal now!

beach on the Mornington Peninsula. He briefed Melbourne journalists and next day a page three report in The Age saw every major television and radio news service pick up the story. Melbourne Water spokesman Chris Chesterfield was forced into making embarrassing apologies on air, saying the government authority had failed and would have to do better next time. Mr Clark-Kennedy said the EPA had failed its duties, too. Continued Page 8

A RECORD JANUARY!

1

While the others are passing properties in – we’re selling them across Portsea, Sorrento, Blairgowrie and Rye! ye e That’s why we are the number * REIV SALES RESULTS one agency in Portsea-Sorrento*... 2009 – CURRENT Call Troy Daly (Principal) on 0418 397 771 for a free appraisal & market report and experience the difference

NO.

109 OCEAN BEACH ROAD SORRENTO 5984 4388 www.jpdixon.com.au www.jpdixonportseasorrento.com.au


Southern Peninsula

Proudly published by Mornington Peninsula News Group Pty. Ltd

PHONE: 1300 MPNEWS (1300 676 397) Published fortnightly. Circulation: 23,000

Editor: Keith Platt, 5979 8564 or 0439 394 707 Journalist: Mike Hast, 5979 8564 Advertising Sales: Carolyn Wagener, 0407 030 761 Production/Graphic Design: Stephanie Loverso Publisher: Cameron McCullough, 0407 027 707 REGULAR CONTRIBUTORS: Neil Walker, Barry Irving, Cliff Ellen, Frances Cameron, Peter McCullough, Stuart McCullough, Gary Turner, Jaime McDougall, Marilyn Cunnington, Brad Stirton, Fran Henke. ADDRESS: Mornington Peninsula News Group, PO Box 588, Hastings 3915 E-mail: team@mpnews.com.au Web: www.mpnews.com.au DEADLINE FOR NEXT ISSUE: 1PM ON TUESDAY 1 MARCH NEXT ISSUE PUBLICATION DATE: TUESDAY 8 MARCH

Local news for local people We stand as the only locally owned and operated community newspaper on the Mornington Peninsula. We are dedicated to the belief that a strong community newspaper is essential for a strong community. We exist to serve residents, community groups and businesses and ask for their support in return.

To advertise in the next Southern Peninsula News please contact Carolyn Wagener on 0407 030 761 or email carolyn@mpnews.com.au Southern Peninsula

NEWS DESK

Council seal of approval for heritage dining By Keith Platt MORNINGTON Peninsula Shire is poised to back a planning scheme amendment to legitimise the running of a restaurant at Heronswood in a residential part of Dromana. A covenant attached to the historic property in Latrobe Pde restricts the use of buildings at the property to residential purposes only. However, council last year issued a permit – which runs out in July – allowing Heronswood to run a 70-seat restaurant. Residents opposed to the easing of the planning rules say the covenant was designed to stop commercial activity and protect the amenity of the neighbourhood. They say visitors’ cars and buses are parked on nature strips and block nearby roads. Heronswood has told council it has about 20,000 visitors a year, with about 55 being the daily average, but the number can be as high as 800 on specific open days. The number of concerns and objections raised by nearby residents (53) was far outweighed by support from people living in Melbourne suburbs and country areas (849). Heronswood has been a popular destination for garden tourists for more than 20 years and is the home of a retail plant nursery and Diggers Club, Australia’s largest garden club, an or-

‘... the change to the covenant will remove any doubt that Heronswood in general should continue to operate.’ ganisation the Blazeys use to preserve “the best traditions” of gardening. “The supporting submissions reflect the community benefit of Heronswood at a general level, although some objections query the benefit to the local area, or more precisely the balance between costs/impacts and benefits,” a report by strategic planner Russell Smith to council’s 21 February development assessments committee stated. “While there are a number of issues that are still be resolved, it is considered that the proposal does possess a realistic capability to provide net community benefit, and that support for the current amendment can be used to ensure improvements that will benefit the surrounding neighbourhood and ensure proper operation into the future.” The final decision on the planning scheme amendment rests with a government-appointed panel. Mr Smith’s report said council’s consent would recognise “that the change to the covenant will remove any doubt that Heronswood in general should continue to operate”. The shire suggests the panel ap-

proves the planning scheme amendment while attaching a string of conditions in a bid to ease the parking situation in nearby streets. Heronswood, owned by Clive and Penny Blazey, was built in 1870 for William Edward Hearn (1826-1888), one of the first professors at the University of Melbourne. The heritagelisted house is Picturesque Gothic and the garden was laid out by Edward Latrobe Bateman (1815?-1897). The restaurant, originally given a permit for 20 seats, has been operating since 1994. A spokesman for several objectors, Ron Corcoran, said a long-running issue was that visitors parking in the Heronswood car park, a shire-owned service road, often blocked access for residents living in the six blocks on the north side of the property. “You’re made to feel like the bad guy if you complain about Heronswood. We acknowledge all the good work done in the name of gardening and preserving the historic property, but it is not appropriate to have a commercial operation in a residential area.” Mr Corcoran said one good thing to come out of the controversy was Kangerong Ward councillor and mayor Graham Pittock’s idea of forming a consultative group to monitor Heronswood’s expansion while the covenant removal application went through the state planning system.

The buck stops here – halfway up the cliff THE day started with a cliff-hanger for emergency crews on Saturday 12 February – quite literally. A bucks night group, at the start of its festivities, had decided to go for a walk along the cliffs off the Esplanade, Mt Martha, when one of the group, Carl Arena, decided to take a short cut. Climbing the cliff he came to a sudden stop and realised he could go no further. Panic ensued and an emergency call was placed.

Hastings SES and nearby CFA brigades were called in and began preparing to rappel down for a rescue. “We were at the top preparing to go down, but it was decided that it was too dangerous and steep,” said SES spokeswoman Danielle Denatris. “Considering the gentleman was unhurt, it was decided to bring in the police air wing and winch him to safety.” Safely returned to flat ground, at nearby Martha Cove Mr Arena and his

friends spoke to police before being allowed to continue their bucks’ “night”. “It was just a stag night prank gone wrong. Fortunately it had a happy ending,” said Ms Denatris. Hastings SES has had a busy start to 2011, with 135 callouts in six weeks, including sending crews to Swan Hill during the recent floods and also to assist Narre Warren with the downpour two weekends ago.

Airlift: The police air wing arrivers to rescue a man trapped on cliffs at Mt Martha while emergency crews and his friends watch from below. CFA crews were used to redirect traffic along the Esplanade while the rescue took place.

PAGE 2

Southern Peninsula News 22 February 2011


A premier swim of fun, games and champers

Rivals: Pier to Perignon swim founders Ted Baillieu and Robbie Robertson in the early 1990s.

PORTSEA’S own celebrity swimmer, Premier Ted Baillieu, will be among those tackling the 4000-metre Pier to Perignon race from Sorrento to Portsea pier on Saturday 26 February. Entries have closed for the 23rd annual event, but it should be a great spectacle with 700 competitors battling an outgoing tide in a swim described as a major event on the national swim calendar. The first male and female across the line win a $200 bottle of Dom Perignon champagne, the same prize “awarded” in 1989. Mr Baillieu co-founded the race with his architect mate Robbie Robertson when they bet a bottle of champagne for the first to swim from Sorrento to the Portsea pub, near the pier. Tales of their two-man contest inspired dozens to turn up the following year and they later handed the event to Portsea Surf Life Saving Club. The Premier has swimming in his genes as he is the descendant of James George Baillieu of Haverfordwest in Wales, a crew-

man aboard the migrant ship Priscilla that arrived in Port Phillip in 1853. In the celebrated book The Land Boomers about the early years of Melbourne and the people who made it world-famous, author Michael Cannon writes that James Baillieu jumped ship and swam ashore to Sorrento, emerging from hiding after his ship had offloaded sick passengers to the hospital ship Lysander, moored off Sorrento to take migrants arriving from England who had smallpox and other diseases. James redeemed himself by volunteering to help aboard Lysander where he worked for several months before snagging a job as a boatman with the customs department and then as a

lighthouse keeper at Queenscliff, where he settled. In November 1853 he married Emma Pow and started the Baillieu dynasty in Australia. Unlike other swims on the crowded summer calendar, the Pier to Perignon is not about winners and also-rans. Everybody starts at one place at the same time, hence the need to limit numbers to 700 people. Entry is first in, best dressed, and this year places were filled 24 hours after applications opened. Spectators are likely to see entertainment at both piers and on beaches between the two towns, including all manner of eccentrics as well as clowns, buskers and even pipe bands.

Horsing around at shire’s expense MORNINGTON Peninsula Shire and Melbourne Water have organised a free horse property management workshop from 9.15am-3.30pm on Saturday March 5 at Bentons Square

Community Centre, 145 Bentons Rd, Mornington. It will be run by acclaimed author and horse property specialist Jane Myers. Bookings are essential on 5950 1263.

Housing ‘affordability’ plan Shire moves to cut costs of rent, leases, mortgages By Keith Platt DROMANA, Rosebud, Rosebud West, Tootgarook, Rye and Sorrento are among 15 Mornington Peninsula towns listed as being suitable for public housing projects. A draft plan released by Mornington Peninsula Shire says it supports public housing, also known as “social” or “affordable” housing, making up three per cent of the shire’s housing stock within 10 years. The current percentage is 1.4. To achieve the target there would need to be 146 government or not-forprofit group subsidised houses built each year. The policy is aimed at mainly providing more affordable housing for rental.

Demand for all types of housing on the peninsula has soared, increasing prices and rents. Increasing numbers of people are having trouble meeting mortgage payments while public housing waiting lists have blown out to 10 years. There are a growing number of people “sleeping rough” on the peninsula. Towns fitting the criteria for public housing are Baxter, Somerville, Tyabb, Hastings, Crib Point and Balnarring on the Western Port side, and Mt Eliza, Mornington, Mt Martha, Dromana, Rosebud, Rosebud West, Tootgarook, Rye and Sorrento on Port Phillip side. The shire wants developers to agree to include public housing in new subdivisions.

It will relax some planning and design rules and discount shire land by up to 25 per cent to make it easier for more public houses to be built. Criteria for choosing locations included the houses being built within urban growth boundaries, within one kilometre of public transport, and near shops, schools, employment opportunities and recreation facilities. A preamble to the draft policy states the peninsula is undergoing a prolonged and increasing shortage of public housing for specific vulnerable groups, including the elderly, people with disabilities, carers and singleparent families. “Low waged singles and families are also experiencing increasing diffi-

culty obtaining suitable housing,” the draft Mornington Peninsula Shire Social Housing and Affordable Housing Policy states. While acknowledging that responsibility for public housing rests mainly with the state and federal governments, the shire says it has “an important role to play” in such areas as planning, consulting the community and encouraging and providing incentives for public housing. The shire defines affordable housing as the cost of housing (rent or mortgage) not exceeding 30 per cent of a household’s income. It is also housing rented, leased or sold below the market rate. A “sustainable” rent is 25 per cent of a household’s income.

Housing and social justice officer Peter Sibly said the shire had three or four pieces of land that could be sold for subdivision to private developers with a discount being offered if they set aside 25 per cent of the blocks for public housing. The land had yet to be identified as being surplus to the shire’s needs and included four hectares at Hastings as well as other blocks in Rosebud and Baxter. Commercial developers could not be forced to include public housing in their plans, although SA and the ACT had legislated to make this mandatory. Mr Sibly said the shire would encourage the state government to pass similar legislation.

‡)XOO/DQGVFDSLQJ6HUYLFH ‡*DUGHQ0DNHRYHUV ‡*DUGHQ5HMXYHQDWLRQ ‡'URXJKW7ROHUDQW3ODQWV

FOR ALL YOUR GARDEN NEEDS

P: 5984 0989

0408 143 055 SORRENTO

www.jmhs.com.au

Southern Peninsula News 22 February 2011

PAGE 3


NEWS DESK

‘Queen’ of shire’s mayors bows out PAT Anderson is one of the key people behind the scenes who make local government work on the Mornington Peninsula as the assistant to the mayor and the 11 elected councillors. She will be sorely missed after leaving the shire council at the end of the month, deciding to pull up stumps and seek a quieter life after a lifetime of work. Pat started with the Shire of Mornington in 1993, the year before the Kennett government forced the amalgamation of Victoria’s 210 municipalities to create 78. Her first boss was governance manager Wal Morrison, then based at the shire office in Queen St, Mornington, now one of three offices of the “super� municipality, the amalgamation of Mornington, Hastings and Flinders shires. She had come from recruitment and training giant Drake International, having worked for the company in Sydney, Brisbane, New Zealand and South Africa, where she met her husband-to-be Alex. Back in Australia, a stint with a drilling and exploration company followed before the couple moved from Sydney to Melbourne for Mr Anderson’s work and Pat did some temp work for Drake. A friend told her about a 12-month maternity leave job at the shire and Pat never left, until the end of the month, that is, after she has handed the reins to her replacement, Paula Creek.

Queen bee: Pat Anderson, centre, with former and current councillors and mayors, from left, David Gibb, David Renouf, 2011 mayor Graham Pittock, Susan Beveridge, Reade Smith, Tim Rodgers, David Jarman, Anne Shaw, Brian Stahl, Bill Goodrem, Frank Martin and Antonella Celi at a farewell morning tea.

“Some of the people from those early days included CEO David Collings, Jan Cover, John Ross, Kevin Clarke,� Pat said when reminiscing with The News. “I’ve been lucky to work with a great number of good people.� Pat has been busy in the office of the mayor, but also found time for a couple of other creations – her two sons James, born in 1981, and Ross, 1983. James is a captain in the army and has served in Iraq and East Timor. Ross is a construction manager in Canada, and Pat is looking forward to a big family reunion this month for

Alex’s 70th birthday. Paula replaced Pat on 21 February, but Pat will stay until the end of the month to complete the handover. She says her job has been to be a “mentor, carer and speechwriter� for mayors and councillors. “I was on call almost 24/7 in the early days,� she said. She knew the job would be a major commitment and sat down with her family to make sure they were happy. Pat has run the mayor’s office since 1997 when councillors were first elected to the amalgamated shire after three years of commissioners following the big change. David

Jarman (see photo) was the first mayor. “The job requires a capacity to listen and be able to make gentle suggestions.� Another part of her job has been to look after community members with whom she came into contact. “I’ve made so many friends.� Pat will stay involved with Red Cross and Peninsula Hospice Service in her “retirement�, but it’s really a Clayton’s retirement as she recently completed a civil celebrant’s course and has already conducted a few weddings. A chance to play more golf beckons,

too, and she is looking forward to playing a few rounds with girlfriends, perhaps at Cerberus golf course in Crib Point. Mayor Graham Pittock said Pat had been a great help during his short time as mayor. “At her morning tea I said ‘the transition period will require much tolerance and good humour, and, Pat, please tell me I said that’.â€? He said Pat’s knowledge of names and personalities on the peninsula was boundless. “She has made this a happier place to work.â€? Longtime councillor and twice mayor David Gibb said Pat had provided advice and wise counsel to many councillors over the years. “She has a light touch of advice. Pat sees angles that councillors don’t seeâ€? and had the capacity to impart this knowledge.â€? Pat had the unique ability to communicate equally with superiors and subordinates in the council as well as members of the community. ď Ž Paula Creek has almost 10 years’ experience as an executive assistant in federal and state governments as well as the private sector. She was a former executive assistant to the commanding officer at HMAS Cerberus and, more recently, was a senior executive assistant at the Department of Primary Industries. She is a volunteer at the Starlight Foundation and at the Peninsula Animal Aid in Pearcedale. Mike Hast

Trivia night banks on local support

NEPEA N FL OOD REL IEF BENEF IT R 5XVVHOO0RUULV :HQG\6WDSOHWRQDQG3DXO1RUWRQ 5RQ0DUWLQLDQG%DQG 0LFN3HDOLQJ 7KH/RYH6WDUVIHDWXULQJ/LVD%DGH 0XQVWHU7HUUDFH 7RQ\%\UQH %LJDQG+RUQ\ SLHFHKLJKHQHUJ\ELJEDQG

6WUD\/RYH 6DQ)UDQ'LVFR (OOLRW*REOHWFRPHGLDQ &R[\ 0ROO\0HOGUXPWR0& $QGVXUSULVHJXHVWVÂŤ Sunday 13th March, Labour Day wknd. Sorrento Football Ground Gates open 1pm, Music starts 2pm until 8pm

7LFNHWV Children under 12 free Teens $10 Adults $30 Tickets available at Hotel Sorrento, Rye & Blairgowrie Newsagencies. Enquiries call Hotel Sorrento 03 5984 8000 Tickets also on sale at the gate Bring your picnic rug & a picnic hamper. Drinks on sale at the ground, & some foods. 6WULFWO\12%<2 $OOSURFHHGVJRLQJWRDWDUJHWRI 7KLVLVWRUHEXLOGWKHKLVWRULFDUWGHFR5H[ &LQHPDWKHFHQWUHSLHFHRIWKHWRZQRI &KDUOWRQZKLFKZDVGHYDVWDWHGE\WKHIORRGV 'RQDWLRQVDUHWD[GHGXFWLEOH

Family Friendly Event

PAGE 4

Southern Peninsula News 22 February 2011

Winners are grinners: Winning team members of the community bank board and spouses.

A TRIVIA night organised by staff of Rye and Dromana community bank branches raised almost $8000 for Victoria and Queensland flood victims. Peninsula businesses donated gifts and vouchers including Rattray & Walker, Boatshed Furnishings, Christos Cafe, Lamattina & Sons, Pizza Dâ&#x20AC;&#x2122;oh restaurant, Hillview Quarries, Dunes, Carrington Park, Flinders, Portsea and Moonah Links golf clubs, Ella Bache

Rye, Nepean Disposal, Just Magic, Peninsula Hot Springs, Flinders Wellness, Hvezda Hair & Beauty, Coloured Girl, Little Shop of Shoes, Blairgowrie Cafe, Rye Beach Pharmacy, painter John Whitelaw, Jet Cafe, Healing Contact, McCrae Bottleshop, Crittenden Estate, Flinders Hotel, South Coast Dance School, Ultimate Battlefield, Pig & Whistle restaurant, Gregâ&#x20AC;&#x2122;s Butchers and McGuiness & Hosking so-

licitors. Bank branchesâ&#x20AC;&#x2122; senior manager Gary Sanford MCâ&#x20AC;&#x2122;d. Fifteen teams competed included bank branch staff, a community bank board team, a state support team led by regional manager Cora Clough and teams from West Rosebud Bowls Club, which donated the venue. It was neck and neck in the final round between the state support team and the board member team with the board team winning by three points.

Going green â&#x20AC;&#x201C; shireâ&#x20AC;&#x2122;s garden waste service starts THE shireâ&#x20AC;&#x2122;s garden material collection service starts Monday 28 February. The service is for residents in urban parts of the shire only. It costs about $130 a year and is for grass clippings and weeds, garden prunings, small branches, bark, untreated timber sawdust, leaves and flowers, but no plastic bags, general rubbish, soil, bricks, food waste

or plant pots will be accepted. The shire reserves the right to not collect the 240-litre bins if they contain rubbish. It did two audits of general waste that showed 6-14 per cent of waste going to landfill was green waste and many residents wanted the service. To find out if your property is classified as urban, call the shireâ&#x20AC;&#x2122;s customer service on

1300 850 600 or go to the shire website www.mornpen.vic. gov.au and look under: â&#x20AC;&#x153;Your Property: Rubbish, Recycling & Wasteâ&#x20AC;? then â&#x20AC;&#x153;Green Waste Collection Serviceâ&#x20AC;?. Residents can still take green waste for a fee or voucher to Rye landfill in Truemans Rd, Tyabb transfer station in McKirdys Rd and Mornington transfer station in Watt Rd.


Art in the wetlands and being right neighbourly DREAMHOUSE Theatre Company was formed after community concerns about the lack of arts in Rosebud West. It is part of the Rosebud West Community Renewal program, a joint venture between Mornington Peninsula Shire and the state government’s Department of Planning and Community Development. Excitement is building as opening night of the troupe’s first play is on Friday 4 March, followed by performances on Saturday and Sunday. 3940 Arts project officer Jo Ridgeway says Wetlands Project: One Last Chance follows a successful mural project. Theatre and television actor and director Kaarin Fairfax of Mt Eliza,

best known for her recent role in Bed of Roses on ABC television, and Ms Ridgeway led a scriptwriting group and trained the actors and production people. The story is a snapshot of life in Rosebud West where changes have bought a sense of loss. Residents are confronted by the neglect of their wetlands and their own sense of connection and stewardship of the neighbourhood. They discover how to rejuvenate the wetlands and community. The show will be performed at Tootgarook Wetlands in the Truemans Road Recreation Reserve. A free preview for Rosebud West residents is at 8pm on Thursday 3 March. Opening night is at 6.30pm on

Friday 4 March with the show at 8pm. Saturday’s performance is at 8pm and Sunday’s at 5pm. Tickets cost $15 for adults, $10 for concession and under-14s free. Call 5987 3078 or email info@tourism. mornpen.vic.gov.au ROSEBUD West Community Renewal project’s second Neighbour Day is on Sunday 27 March from 11am-3pm at Vern Wright Reserve, Elizabeth Ave, Rosebud West. Renewal project officer Libby Wilson said the event encourages residents to develop good relationships within their community and a greater sense of community caring.

“It’s also an opportunity to promote local activities, businesses and services,” she said. Highlights include performances by Eastbourne Primary School band, demonstrations of dog obedience by Southern Peninsula Dog Obedience Club, a pet parade, and a “Greet or Meet the People in the Street” with prizes and competitions focused on neighbours. There will be a free sausage sizzle and free devonshire tea if you bring a neighbour. Other groups taking part include Rosebud West Bowls Club, the tennis club, Sorrento SES, Rosebud fire brigade, the shire with its mobile library and Beachcomber youth bus.

Proceeds from a trash and treasure stall will go towards a slippery slide for the Vern Wright playground. To donate, call 5986 5478. Other stalls will have art and craft made by Mornington Peninsula residents and a free bus courtesy of Rosebud RSL will take people to and from the event. All passengers will have their names entered into a lucky draw to win a grocery voucher. For timetable and route, call 5986 5478. For details and the bus timetable and route, call 5986 5419 or 5986 5478 or email communityrenewal@mornpen. vic. gov.au Mike Hast

Play time: Daniel Hedley (left) and Jack Hollister-Clarke are set for their theatrical debuts. Noise works: Eastbourne Primary School band, playing at last year’s Neighbour Day, return next month.

Mayor ‘satisfied’ with executive bonuses By Keith Platt MORNINGTON Peninsula Shire mayor Graham Pittock says he is satisfied with the operation of a bonus scheme for senior officers. Executives at the shire on annual salary packages of $110,000-$200,000 stand to receive a five per cent bonus each year. Directors can get up to 10 per cent. Insiders claim the bonus appears to be paid as a matter of course, but Cr Pittock says he is satisfied “everything is above board”. Neighbouring Frankston has no bonus scheme for executives and the Shire of Cardinia abandoned a similar scheme two years ago. A policy information memo writ-

ten by team support and development manager John Rankine says pay and conditions at the shire are good and “generally” meet the needs of staff “but they are not the best in local government”. He said bonus and gratuity payments are one of the most common features of wages and salaries in local government. The CEO Michael Kennedy makes the final decision on awarding bonuses. In 2010 there were 47 bonus payments totaling $281,344, an average of $5986. The 46 gratuity payments to members of the shire’s 668 staff averaged $2868. “The value of these payments can be

seen in the extent to which the shire delivers innovative services and the extent to which our team members will go that extra distance to ensure the work gets done,” Mr Rankine stated. A “classic example” was the effort put in by staff on fire management. “The (many) staff involved in this program do not put in the effort because of the potential bonus or gratuity; they do it because it is important work that will make a difference in our community and they take professional pride in the result.” The mayor and Cr Leigh Eustace were briefed last month about the bonus scheme by Mr Rankine. “It was all right once we found out how the system works,” Cr Pittock

said. “Councillors were ignorant about what was going on. “As an incentive, the system works well. “Executives can get up to five per cent, but I don’t know if they all get it. They have goals set and they have to exceed them.” Cr Pittock said shire officers, when answering inquiries from The News (‘Call for shire to explain executives’ salary secrets’13/1/2011) before Christmas, “could have been more open”. The Australian Services Union also had trouble breaching the wall of secrecy surrounding the awarding of the bonuses and wrote to the shire in December requesting more information.

“We’ve asked who gets these bonuses and payments and criteria [for awarding them], but the shire was unwilling or unable to tell us,” ASU organiser Michelle Jackson said. “I’ll be writing to them to seek full disclosure under the Fair Work Act.” Ms Jackson, who is negotiating a new wages deal for shire staff, also wanted details about the staff gratuity scheme. “We got a politician’s answer,” she said last week. “They didn’t tell us anything we didn’t already know.” The shire’s current $169.2 million budget includes $52.33 million for staff costs, up $3.66 million on the previous year.

BIDWELL ELECTRICS REC: 20109 ABN: 76-960-550-973

ƔHome Energy Auditing ƔSolar Panels ƔEnergy Monitors ƔGreen Switches ƔNew Installation Work ƔSwitchboard Upgrades ƔUnderground Cabling ƔShed Wiring ƔTV Points and Antennas ƔTelephone & Data Points ƔHome Theatre ƔPlasma/LCD Wall Mounting SAVE MONEY NOW ON YOUR ELECTRICITY BILLS Get a home energy audit and install an energy monitor and some green switches

CALL NOW: 0404 498 864 E-MAIL: ajbidwell@bigpond.com Southern Peninsula News 22 February 2011

PAGE 5


NEWS DESK

Closer weather eye on climate change storms By Mike Hast MORNINGTON Peninsula Shire is watching weather events more closely after a series of wild storms over the past couple of years. The shire is more closely monitoring its six weather stations when it knows heavy storms are due and sending out “SWAT” drain clearing teams when problems arise. Focusing attention on drainage this and coming weeks and months was the flooding of Koo Wee Rup and Narre Warren on the weekend, and the earlier floods in northern Victoria and Queensland. Koo Wee Rup was inundated after the Bunyip River broke its banks, and parts of Narre Warren and adjacent suburbs went under after they received a huge dump of rain, with Lyndhurst topping the region with 180mm. It is widely acknowledged the Mornington Peninsula was lucky to escape with rainfall totals of less than a quarter of that received by many southeast region suburbs and towns. The 2010-11 shire budget allocated $3 million for new drainage works and programs to better understand stormwater, up 50 per cent from the previous year’s $2m, and the shire’s director of sustainable infrastructure, Alex Atkins, says it is likely to

remain at or above $3 million for the foreseeable future. On top of this was a significant amount to maintain and improve existing infrastructure. “We’ve seen the return of ‘normal’ rainfall after the long drought,” he said. “The rains of winter and autumn soaked the ground and now much of the rain that falls is running off.” He said the shire had ramped up its drain inspection and cleaning program over the past 12 months. “We’ve been doing computer flood modelling for the whole shire and our first flood maps have proved accurate.” How water had moved during and after recent storms had confirmed the predictions of the flood modelling, he said. Detailed maps for the entire shire would be ready in about 6-8 weeks. Mr Atkins said the Mornington Peninsula had many small water catchments and any flood damage was often localised. “We’re expecting more higher density rainstorms that have the capacity to overwhelm existing drainage systems.” The flash flooding could be caused by the build up of silt and debris in drains. “No amount of pre-servicing can

avoid these kinds of problems so we have teams that get in quickly and clear any blocked drains.” The shire had identified problem areas and was using its six weather stations that fed real-time data to cope with flooding. “It’s a matter of adaptation and mitigation, with our focus on adaptation at the moment,” he said. There had been big changes in the way councils dealt with drainage and stormwater management in the past 15 to 20 years. Rather than installing pipes and spoon drains, there was a greater emphasis on slowing down, storing and redirecting water using swales and wetlands. Water sensitive urban design was far more important, he said. The shire encouraged feedback and reports from residents about flooding or potential flood problems, and Mr Atkins encouraged people to call the shire’s 24-hour customer service phone number – 1300 850 600. Flash(flood) back: The first day of summer, 1 December 2010, and a wild rainstorm lashed Mornington Mt Eliza and Frankston. In Mornington the path between Mothers and Scout beaches, which once led to the Mornington baths, becomes a torrent. Picture: Paul “Tracker” Pingiaro

WE JOSEPH’S WE ST THE NEW STSCHOOL JOSEPH’S SCHOOL SORRENTO SORRENTO! WE WE WE WE WE WE St Joseph’s School. Constitution Hill Road Sorrento 3943. Tel: (03) 5984 1291 Fax: (03) 5984 3230 Web: www.sjsorrento.catholic.edu.au Email: principal@sjsorrento.catholic.edu.au

PAGE 6

Southern Peninsula News 22 February 2011

WE

THAT IT’S THE ONLY DESIGNATED PADUA FEEDER SCHOOL FOR RYE, TOOTGAROOK, BONEO, BLAIRGOWRIE, PORTSEA & SORRENTO... THE SMALL CLASS SIZES... THE NEW LIBRARY AND COMPUTER LAB WITH 26 NEW PC’S! LOVE THE SUPPORTIVE, NURTURING ENVIRONMENT WITH A NO BULLYING POLICY THE MIX OF BOTH MALE AND FEMALE TEACHERS... THE NEW SOFT FALL PLAYGROUND AND SYNTHETIC GRASSED TOP OVAL THE FREE ST JOSEPH’S BUSES FROM TOOTGAROOK

If you would like your children to be a part of the St Joseph’s School community please contact the Principal for further information or to book a school tour.


Playground time at Rye RYE citizen lobby group Rye’s Up! is holding a community day at Rye Primary School library from 9-11am on Friday 25 February to gather ideas for a “Leathers” adventure playground on the foreshore. There will be a visit to the existing foreshore playground near the pier in Lions Park at 8am. Design ideas and preliminary drawings will be displayed at Rye Hotel at 6.30pm. Rye’s Up! spokeswoman Katrina Humphrey said residents could discuss the plans and “the beginning of our new playground adventure can be celebrated”. “We’re lucky to have an amazingly experienced playground designer from the US company Leathers & Associates to help us on our way to a new foreshore playground.” The company was started by architect Bob Leathers in 1971 and is now run by his son Marc. Mr Leathers aimed to specialise in residential design and construction when he set up practice, but was asked to organise a group of people to build a playground at his children’s primary school. He based his design on their ideas, and the playground became famous, leading to the company specialising in community-built projects, with almost 2000 in all 50 US states as well as overseas being constructed. The company has guided the building of 14 projects in Australia since 1989, including a playground in Sorrento Historic Park, which area councillor Tim Rodgers described as “one

Wonderland: A Rye community group wants to build an adventure playground like the one constructed by the community at Sorrento Historic Park in the 1990s.

of the great community-led building projects of its time”. Ms Humphrey said the group wanted community input. “Whether you are a parent or grandparent wishing to visit with your children or simply an interested resident wanting to help shape our town, everyone can help. “The playground will allow our kids to use their imagination, undertake cooperative and physical play, spend time outdoors by our wonderful beaches and, most importantly, have a

great time.” Rye’s Up! was formed in April 2009 to oppose fast food chains setting up in Rye and now campaigns to improve the town generally. “We are passionate locals who want to preserve Rye as a healthy seaside community and develop its potential,” Ms Humphrey said. People who cannot attend on Friday can email ideas to Ms Humphrey at dixonkatrina@hotmail.com or call her on 0409 533 046.

Nepean benefit to repair historic Charlton theatre THE southern peninsula community is again coming to the aid of Victorians affected by disaster. Two years ago a benefit concert at Sorrento football ground raised more than $70,000 to help devastated communities after the tragic Black Saturday fires. Last month’s floods affected 51 communities, inundated more than 1700 properties, devastated 52,000 hectares of pasture and 41,000 hectares of field crops flooded and killed 6000. The Nepean Flood Benefit Concert will be held on Sunday 13 March, Labour Day long weekend. The organisers are aiming to raise $120,000 for the town of Charlton, one of the first towns to be flooded, the second flood within four months. Co-organiser John Prentice said the town “really needs assistance and we’ve decided to help contribute to the rebuilding of the Rex Theatre, an historic Art Deco building that is more a community meeting place”. The not-for-profit theatre is a hub for the town of just over 1000 people on the Avoca River. It is almost halfway between Melbourne and Mildura, and a popular stop for tourists. “The theatre is a prized showpiece of the town, the only one for 100km and services surrounding towns. It is a place to congregate. “The rebuilding will be a great boost to morale for the area. It is run by the community for the community.” He said support for the flood benefit had been outstanding. “Almost all par-

ties involved in the bushfire concert have joined forces again.” They included the Portsea Camp, Sorrento-Portsea RSL, Hotel Sorrento, Sorrento Football Club, Sorrento Golf Club, Sorrento police and Rotary. “Event planning is continuing but already performers such as Russell Morris, Wendy Stapleton and Paul Norton, Tony Byrne, The Love Stars featuring Lisa Bade, Coxy, Mick Pealing, Ron Martini and band, and Big and Horny (a 13-piece high energy band) had signed up. “Young groups Stray Love and San Fran Disco are on board and popular peninsula rock band Munster Terrace would perform. Chris Doe, an X Factor finalist, is joining with his brother Peter.” MC will be Molly Meldrum, and bands will play from 2- 8pm. There will be children’s activities run by Portsea Camp staff. “Bring your own picnic rugs, chairs and food but no alcohol. Alcohol, soft drinks and food will be available at the oval. Tickets at the gate, but prepurchasing at Hotel Sorrento or the Rye and Blairgowrie newsagencies will help our catering arrangements,” Mr Prentice said. Donations are tax deductible. “To Charlton With Love” is at Sorrento football ground, David MacFarlan Reserve, Hotham Rd, Sorrento. Ground opens 1pm. Tickets: $30 adults, $10 teenagers and under12s free. Details: Hotel Sorrento, phone 5984 8000.

Southern Peninsula News 22 February 2011

PAGE 7


NEWS DESK

No stage fright for ‘Worrythoughts’ PUPPETS are being used to show primary school children that they can tap into their own “superpowers” to overcome anxiety. The anxiety that can haunt children - causing distress, loss of sleep, eating problems and an inability to enjoy themselves - is portrayed by puppets representing Mr Worrythoughts. The two puppets – one large, one small – represent how anxiety can be lessened and placed in a more manageable context. The Frankston Arts Centre-produced performance touring schools this year is based on the acclaimed children’s book “Go Away, Mr Worrythoughts!”. It is the first time the centre has taken on a production role and there are already plans to take it interstate. Langwarrin teacher Nicky Johnston wrote “Go Away, Mr Worrythoughts!” to help her son Bailey who, at five, was diagnosed with generalised anxiety disorder (GAD). The book details the ‘externalisation’ technique Ms Johnston used for her son to overcome the fears that were affecting his life in so many ways – loss of sleep, inability to eat properly, unable to laugh with other children. He worried about how he appeared to others and what the future held. The book’s narrative traces Bailey’s six-year struggle and carries the message of hope and self-help for other anxiety-ridden youngsters. The cognitive behaviour therapy (CBT) technique that helped Bailey and that is “taught” through the book and stage performance comes from Melbourne-based child thera-

BRIEFS

Looking to roster JPs A CALL has gone out to JPs who are retired from the workforce to help staff at signing centres in Frankston and on the Mornington Peninsula. Signing centres for documents which need to be witnessed or certified by authorised personnel can be found at police stations in Frankston, Mornington, Rosebud, Hastings and Carrum Downs. Days and times at signing centres will be able to be extended if more JPs are able to be rostered on for three to four hours a month. Any JP who can help should call administration officer Cathy Owens on 95257099.

Flood money

pist, Charmaine Holmes. Nicky Johnston and her family watched one of the final rehearsals for the production last December. The three-person performance by Heath Miller (Bayden), Stephanie Evison-Williams (friend Tanya, school teacher and mum) and puppeteer Frank Italinao played to 12 schools in December and already has another 13 bookings in Frankston,

the Mornington Peninsula, Gippsland and Geelong. The 40-minute stage production of 'Go Away, Mr Worrythoughts!' is suitable for all ages. The performers stay for questions after the show, provide teacher resources and follow-up workshops are available. For details or to book a school tour call 784 1705.

No worries: Bailey Johnston, left, meets the puppet version of Mr Worrythoughts with puppeteer Frank Italiano and Stephanie EvisonWilliams who plays various roles in the stage version of “Go Away, Mr Worrythoughts!”.

THE Navy is dipping in to help Victorian and Queensland flood victims. Money is being raised at HMAS Cerberus through a charity golf competition and a uniform-free day. The golf day is already sold out with 68 players signed up for a four-person Ambrose event. Businesses are backing the day and the golf club is donating green fees. The two events are expected to raise about $5000 for the flood appeals.

TOP QUALITY MATTRESSES Clean Ocean alerted media

Red Hot Deals on:

‡Mattresses ‡Mattress Protectors ‡Pillows ‡Pillow Protectors ‡Quilts

Continued from Page 1 “On 10 February, six days after the floods, the EPA website stated: ‘Water quality testing has shown unacceptable water quality due to elevated bacterial levels at Carrum, Aspendale North, Mordialloc, Mentone, St Kilda, Middle Park, Port Melbourne, Altona and Werribee South beaches. As a result of these levels, EPA advises against swimming at these beaches until further notice’.” The Clean Ocean boss said this was unacceptable: “The public should have been told about this pollution. It’s not good enough for the EPA to say people should avoid swimming in Port Phillip for 48 hours after heavy rain. “Beaches should be closed to swimming and warning signs in multiple languages erected.” He said more than 300 stormwater drains empty into Port Phillip and the EPA should have teams testing the water every day when such big rain events occurred. Melbourne Water was “quite happy in recent years to spend sizeable budgets on half page ads in newspapers telling us all how to be water wise while they’ve wasted billions of litres” by not

treating waste water to class A. Coincidentally, the EPA on 15 February released a report of an internal review that found it had been inadequate in its performance as a regulator. “The Clean Ocean Foundation wholeheartedly agrees,” Mr Clark-Kennedy said. “The EPA would appear to be writing more get-out-of-jail free tickets to industrial polluters to discharge chemicals and heavy metals into the sewerage system than playing any real ‘watchdog role’ for the environment. “At lieutenant level, the EPA would appear far too cosy with Melbourne Water in particular, as evidenced by their quiet surrounding discharge of millions of litres of raw sewage into drains, waterways and the bay. “The Baillieu government would do well to take the cane to both Melbourne Water and the EPA, directing both to give up corporate-style window dressing and focus on providing real answers and real solutions to Melbourne’s inadequate sewerage system.”

SAVE 20-40% WE ARE CHEAPER THAN THE LARGER RETAIL STORES *FREE DELIVERY on mattress purchase over $299 *Conditions Apply

Don’t Pay RETAIL - Buy DIRECT & SAVE big $$$$$

Mattresses Direct 1175 Point Nepean Road, Rosebud (corner Fifth Avenue)

5986 2008 Shop 7/1 Tyabb Rd, Mornington

5977 1444 www.mattresses-direct.com.au PAGE 8

Southern Peninsula News 22 February 2011

(opp McDonalds)

QUALITY AUSTRALIAN MADE MATTRESSES

Warning: Clean Ocean’s James Clark-Kennedy alerted Melbourne media to sewage going into waterways after the deluge in early February that swamped large parts of Melbourne south-east.


(Conditions apply. Valid until 31/3/11).

Southern Peninsula News 22 February 2011

PAGE 9


NEWS DESK

A tale of two artists in Bald Archy contention HASTINGS artist Fran Henke and Seaford artist Tony Sowersby are finalists in this yearâ&#x20AC;&#x2122;s Bald Archy Awards, the art contest parody of the Archibald Prize, an important portraiture award. Mrs Henke has two entries. One is a portrait of WikiLeaks founder Julian Assange entitled Leak Inquiry, created with acrylics and collaged newsprint, which shows a pallid Assange being swamped in a W-shape by newspaper stories based on his organisationâ&#x20AC;&#x2122;s leaks. Her second entry is an acrylic painting of the late Australian opera singer Dame Joan Sutherland entitled Our Joan. The life of â&#x20AC;&#x153;La Stupendaâ&#x20AC;?, who died last October aged 83, was celebrated in London last week at a memorial service in Westminster Abbey. Another tribute will be held in New York on 17 May. This is the second year Mrs Henkeâ&#x20AC;&#x2122;s work has been accepted, the first being a portrait of controversial photographer Bill Henson.

Tony Sowersby won the award in 2005 with The Cardinal With His Abbott, which featured Cardinal George Pell and nowOpposition leader Tony Abbott. This year he has two works vying for the $5000 prize: a portrait of retailer Gerry Harvey, Support Your Local Billionaire, and A Tale of Two Jules. Mr Sowersby says this about his two entries: â&#x20AC;&#x153;Australians have recently shown that they will take to the streets to protest against the government victimising our billionaires. Witness the backlash to the mining tax. â&#x20AC;&#x153;However an essential element in gaining the publicâ&#x20AC;&#x2122;s support was a slick advertising campaign that highlighted the billionairesâ&#x20AC;&#x2122; plight. Gerry Harvey shot himself in the foot with his ill-timed and poorly conceived pitch aimed at his new on-line rivals who may send him broke. But he is one of our own Aussie billionaires. He desperately needs our support. So from now on, buy your stuff

from a shop, not on a computer. â&#x20AC;&#x153;Ah, in what strange directions life can take us. Julia Gillard and Julian Assange were both young radicals, but they have taken very different paths. Julia was quick to brand WikiLeaks â&#x20AC;&#x2DC;illegalâ&#x20AC;&#x2122; and has remained mute in response to calls by prominent Americans (such as Sarah Palin) for Julianâ&#x20AC;&#x2122;s rendition and worse. â&#x20AC;&#x153;I have set this painting in the French Revolution era, not only because of the similarities in rhetoric, but also because with his tall, slim figure and tied-back silver hair, Julian could have been standing behind Leslie Howard or Ronald Coleman in a Hollywood version of the revolution. â&#x20AC;&#x153;I must apologise to Julia though, I am sure she has never knitted.â&#x20AC;? The Bald Archy usually includes cartoons or humorous works making fun of Australian celebrities. The award is supposedly judged by Bald Archy founder Peter Bateyâ&#x20AC;&#x2122;s white cockatoo, Maud. The winner will be announced in Sydney in March. More information look up: www. baldarchy.com.au Mike Hast Right: A wounded Gerry Harvey as seen by Tony Sowersby in his Bald Archy submission Support Your Local Billionaire. Below: Sowersbyâ&#x20AC;&#x2122;s A Tale of Two Jules has US conservative Sarah Palin dominant but not named in the imageâ&#x20AC;&#x2122;s title. Left: Fran Henkeâ&#x20AC;&#x2122;s Leak Inquiry depicts Julian Assange crowded out by headlines generated by his WikiLeaks.

ROTARY OPPORTUNITY WAREHOUSE USE

THE ROTARY SHOP

15 Newington Avenue, Rosebud (Rosebud Industrial Estate) Telephone: 5986 8896

Cnr McDowell St & Rosebud Parade, Rosebud Telephone: 5986 7000

The only newspaper solely dedicated to the Southern Peninsula

Selling good, clean donated items: WAREHOUSE - from Indoor & Outdoor Household )XUQLWXUH :KLWHJRRGV&HUWLÂżHGVDIH(OHFWULFDO*RRGV 6WHUHRV5DGLRJUDPV%RRNV&ROOHFWDEOHVÂąWRHYHQ IURPWLPHWRWLPHWKHNLWFKHQVLQN7KHUDQJHLV+8*(

ROTARY SHOP&ROOHFWDEOHV&ORWKLQJ 1HZ 4XDOLW\6HFRQGKDQG 0DQFKHVWHU %ULFD%UDF-HZHOOHU\%RRNV

Volunteers are always made most welcome â&#x20AC;&#x201C; Why not join our happy teams & enjoy the company of other community-spirited men and women. For Warehouse enquiries, telephone Doug on 5986 8896 (Monday-Saturday) For Rotary Shop, speak to Sue or Betty on 5986 7000 (Tuesday mornings) All Funds Returned to Community â&#x20AC;&#x201C; Wholly Staffed by Volunteers. Donations to Community now exceed $1,000,000 over past 10 Years. A JOINT FUNDRAISING PROJECT OF THE ROTARY CLUB OF ROSEBUD-RYE Inc.

PAGE 10

Southern Peninsula News 22 February 2011

Southern S o utthe hern Peninsula Peni Pe en niin nsula sula


Southern Peninsula

FREE

A magnificent Sorrento limestone Victorian

> Page 3

SOUTHERN PENINSULA

realestate

22nd February 2011


Page 2

Southern Peninsula Real Estate 22nd February 2011

SOUTHERN PENINSULA

realestate The people to call for your real estate needs... Joshua Callaghan Mobile: 0418 595 719

Paul Basso Mobile: 0428 107 867

Fletchers SORRENTO 136 Ocean Beach Road, Sorrento PHONE: 03 5984 2600

Basso Real Estate

EMAIL: joshua.callaghan@fletchers.net.au

EMAIL: paul@bassorealestate.com.au

1087 Point Nepean Rd, Tootgarook

PHONE: 03 5985 9000

John Kennedy Mobile: 0401 984 842 John Kennedy Real Estate 2327 Point Nepean Road, Rye PHONE: 03 5985 8800 EMAIL: jkre@bigpond.net.au

Jon Perrett Mobile: 0405 123 921

Troy Daly Mobile: 0418 397 771

Ian Oldstein Mobile: 0408 994 705

Stockdale & Leggo Rosebud 1089 Point Nepean Rd, Rosebud PHONE: 03 5986 8600

JP Dixon Portsea Sorrento 109 Ocean Beach Rd, Sorrento PHONE: 03 5984 4388

Email: jon@stockdaleleggo.com.au

Email: troy@jpdixonportseasorrento.com.au

Jacobs & Lowe-Bennetts Rye 2115 Point Nepean Road, Rye PHONE: 03 5987 9000 EMAIL: rye@jlbre.com.au

Diane & Phil Key Mobile: 0419 324 515

Robert Magnano Mobile: 0425 772 073

Jordon Hendrix Mobile: 0415 346 866

Stockdale & Leggo Rye 2271 Point Nepean Rd, Rye PHONE: 03 5985 6555

YPA Estate Agents Shop 3, 2255 Pt Nepean Rd, RYE PHONE: 03 5985 2600

Email: dianekey@stockdaleleggo.com.au

EMAIL: robertm@ypa.com.au

Zentori Real Estate La Marina Plaza, 154 Marine Drive, Safety Beach PHONE: 03 5977 3747 EMAIL: sales@zentori.com.au

Southern Peninsula

Thinking of selling? List your house with an agent that advertises in the only paper dedicated to the Southern Peninsula!


Southern Peninsula Real Estate. 22nd February 2011

Sorrento

Page 3

$1.2 million buyers

Magnificent sorrento limestone victorian Eastcliff is one of Sorrentoâ&#x20AC;&#x2122;s most beautiful limestone Victorian houses. Overlooking the Sorrento township just minutes walk to the Village is this superb, beautifully renovated and appointed home. Eastcliff boasts the most exquisite period detail; cornicing, Baltic boards, fireplaces and high ceilings. Add a gorgeous country kitchen with stainless steel appliances, 3 bedrooms and 3 bathrooms each with toilet and spa bath and you have

the most beautiful holiday / permanent home....or simply continue the holiday rental success returning around $100,000 pa. Sitting amongst a beautiful bore fed cottage garden on 726 sqm approx., thereâ&#x20AC;&#x2122;s gas heating, central laundry, internal feature limestone walls, a formal entry hall and off street parking for 2 or more cars. This is your opportunity to secure an iconic Sorrento lifestyle property.

Agency: J.P. Dixon Sorrento. Phone (03) 5984 4388 Agent: Troy Daly 0418 397 771

No.1 in Sales Portsea to Sorrento

A RECORD JANUARY IN SALES! r #.'54'57.65#0NMg744'06FNEE

WHILST THE COMPETITION ARE PASSING IN PROPERTIES... - WEâ&#x20AC;&#x2122;RE SELLING THEM... IN PORTSEA, SORRENTO, BLAIRGOWRIE + RYE! As your agents of choiceâ&#x20AC;Śwhy is JP Dixon Portsea Sorrento getting record results month after month? Â&#x2DC;74(#/175$7;'4&#6#$#5' Â&#x2DC; :2'460')16+#6+105-+..5 Â&#x2DC;41('55+10#.#&8+%'(41/6*'/156 ':2'4+'0%'&.1%#.5#.'56'#/

Â&#x2DC; +)*':21574'144'061/#+0 564''6.1%#6+10122T1.'5 Â&#x2DC;746#4)'6'&1((+%'0'6914-+0 4+)*610X114#-X #0&4+0)*#/#0&'#7/#4+5

Â&#x2DC; 0018#6+8'/#4-'6+0)%#/2#+)05 Â&#x2DC;1%#.1((+%'h.1%#.2'12.' Â&#x2DC;.75W,7562.#+0*10'56*#4&914-X 241('55+10#.+5/#0&'06*75+#5/

CALL TROY DALY (PRICIPAL) NOW ON 0418 397 771 FOR A FREE APPRAISAL AND MARKET REPORT

109 OCEAN BEACH ROAD SORRENTO 5984 4388

www.jpdixon.com.au www.jpdixonportseasorrento.com.au


Page 4

Southern Peninsula Real Estate 22nd February 2011

Blairgowrie

Reduced to $749,500

Vibrant and modern bayside entertainer Set in a quiet locale amongst the Ti-Trees of leafy Blairgowrie is this fully landscaped, modern and vibrant home featuring brand new polished hardwood floors and a lively open feel. Open plan in design, the brand new kitchen overlooks large living and defined dining areas opening to huge undercover outdoor

decking area fitted with downlights. 4 bedrooms. 2 bathrooms. Master with full ensuite, walk-in robe and features private outdoor decking with spa. Features: Double carport, large private rear yard, brand new gas ducted heating, s/ steel cooking appliances, carpet and septic system.

Agency: Fletchers. 136 Ocean Beach Road, Sorrento. PH: 03 5984 2600 Agent: Joshua Callaghan 0418 595 719

Rye

Auction: Sat 12-Mar-11 12:00PM

“Seaside cottage” - 450 meters to beach Walk to the beach in minutes or pop down to town for a coffee or a meal in one of the many cafes, it will all be at your fingertips when you’re residing at this charming peninsula property. Located just 450m or so from the family friendly Rye Forshore the home occupies a delightful corner block with very pretty garden setting including an absolutely fabulous feature palm tree. There is a garage, carport and even an outdoor loo. The cottage is very pretty indeed with

wonderful polished floorboards, 2 nice big bedrooms, light filled lounge, country kitchen with adjacent meals area, rear sunroom and bathroom/toilet facilities. The property would attract interest from 1st home buyers, investors or holiday home buyers and is sure to get the blood surging with each person that inspects. Highly recommended bayside property at its very best. Rye, a safe environment for your family.

Agency: Stockdale & Leggo Rye, 2271 Pt Nepean Rd. Phone (03) 5985 6555 Agents: Glenn Key 0402 445 208

3URXGO\OHDVLQJWKH0RUQLQJWRQ3HQLQVXOD

Welcome Samantha Christmas to Fletchers With more than 12 years Property Management experience exclusively on the Mornington Peninsula, Fletchers Sorrento are privileged to welcome Samantha Christmas as our Senior Portfolio Manager.

Experience the Fletchers Way difference with your valuable investment property today.

Contact: Samantha Christmas

Senior Portfolio Manager

Office: 136 Ocean Beach Road, Sorrento

fletchers.net.au

5984 2600


ROSEBUD

ROSEBUD WEST

Paul Basso 03 5985 9000

Gary Barrett 0415 479 896

Tootgarook 1807 Pt Nepean Rd 5985 9000

Inspection is a must of this outstanding three bedroom plus study townhouse, one of only three on the block. Ideally located a hop, skip and jump to shops, beach, services and transport. Downstairs the open plan lounge & dining, kitchen is bright and spacious and opens onto a generous outdoor entertainment area with access through the garage. The kitchen boasts S/S appliances and overlooks the lounge, dining and study, with a powder room for convenience. Upstairs there is three generous bedrooms all with built in robes, master with ensuite and WIR.ments the home.

Walking distance to the bay beach and close to everything (Shops, Plaza, Schools, Hospital etc). Completely renovated to a high standard low maintenance home with a new large kitchen s/s appliances & tiled meals area, neutral tones and quality finishes throughout. 2 large living areas, 3 large BRs (BIRs) ensuite, sep bathroom & toilet. Additional 2 rooms at the front of the property with own access ideal Parent’s or teenager’s retreat or home office. Heating, ducted vacuum system,dbl garage, fully paved courtyard, large grassed rear yard and plenty of room for off road parking for cars and boat. Interested?

$400,000 - $440,000

Paul Basso 03 5985 9000

Roy Thompson 0419 304 650

$440,000-$480,000

This two bedroom home is a great opportunity for first home buyers looking to enter the market, or for investors looking to grow their portfolio. Situated on a 535m2 allotment, in one of the much improved growth areas on the Peninsula, close to schools, beach and shops. Currently tenanted with a huge potential to renovate and achieve a good return in the future. This property will not last.

Enjoy the simple pleasures of beach style living.Located on a block of 758m2 in a peaceful street and an ultra convenient location within easy walking distance to everything. This 4 bedroom house awaits your personal touch and put BIG plans into place. Large front verandah across the entire front of the property making an ideal place to enjoy your morning coffee. An open plan kitchen, lounge/meals area set in the centre of the house allowing plenty of room for a large family gathering. Features electric cooking, gas HWS, polished floorboards, A/C, ceiling fans. Large undercover entertaining area, shed & plenty of backyard to enjoy!

$310,000-$340,000

ROSEBUD WEST

RYE

$370,000-$400,000

Paul Basso 03 5985 9000

$149,950

Ryan Deutrom 0406 426 766

DROMANA

This two bedroom cabin partly furnished with built in bunks and double bed, kitchen with fridge, gas upright stove, table and chairs, bathroom, and lounge. This could be the chance for someone to have a cheap holiday/investment or live in permanently with all the facilities a caravan park has to offer; Swimming pool, games room, BBQ facilities and kid’s playground. Great opportunity for a carefree lifestyle and a only short drive to one of the Peninsula’s best beaches, cosmopolitan cafe and restaurants strips. Act quickly for a private Inspection and start your holiday today.

$420,000 - $460,000

This timeless 4 bedroom home has been built with recycled bricks. Upon entering the property is a huge open plan living area incorporating lounge, dining and central kitchen with ample bench space for informal gatherings. The property has been well designed with bedrooms at each end of the house and two completely separate bathrooms. The more you explore the property you will see the way modern and bygone years blend beautifully with some stunning leadlight features and all of today’s essential mod cons, making it a perfect family home. Set on a beautiful block of 742m2 with immaculate gardens, plenty of space for cars boats etc.

TOOTGAROOK

$300,000-$330,000

$440,000-$480,000

$395,000-$435,000

Gary Barrett 0415 479 896

An exceptional opportunity to secure an excellent 4 Bedroom (all with BIR’s), 2 bathroom, brick family home set high on the block in a great Rosebud location. Extended (5 years ago with builder’s warranty still in place) to include an extra-large master suite (possible parents retreat) with 2 walls of built ins and an ensuite adjacent. Outside areas include a very functional workshop and pleasant BBQ area. Galley style kitchen is functional, modern and overlooks the lounge and is positioned adjacent to a larger than normal dining area as a result of the extension. Call for an inspection today!

ROSEBUD WEST

Roy Thompson 0419 304 650

This home has dual living with 3 large bedrooms with BIRs upstairs, entertainer’s delightful kitchen, spacious dining/ living area,bathroom with a bath and sep. toilet.This home is quality throughout and added benefits of ducted heating, electric security shutters, & merbu decking. There is spacious under house storage, with another bedroom, bathroom and kitchen area all timber lined. External features of the property are bore water and an established veggie garden. An immaculate home sure to please. Please phone for an inspection.

TOOTGAROOK

Paul Basso 03 5985 9000

Often sought but seldom found is this beautiful Vacant Building Block which measures an incredible 1164 sqm (approx). Overlooking Port Phillip Bay and located in a quiet area amongst beautiful homes, this property has GREAT BAY VIEWS. First to see will buy.

Views, Views, Glorious Views.

DROMANA

$410,000

$409,000-$449,000

$470,000-$495,000

Roy Thompson 0419 304 650

Great investment current tenant has lease until 2/2/2012. This 2 storey home has a lot to offer. Upstairs 6 bedrooms YES 6 large bedrooms. Fully carpeted including stairs.The house sits high on the block with fabulous rural views from the expansive timber deck. Downstairs is an open plan, kitchen, lounge & dining, vinyl floor coverings. Single car garage plus a carport. Buy now for the future.

RYE

Nicky Hunt 0402 982 583

From the moment you enter, you are instantly welcomed. This immaculate home will suit a diverse number of buyers from holiday, permanent or investors. Features include 3 bedrooms, master with ensuite, tiled entry area leads to a separate formal lounge then through to a large tiled kitchen & dining room opening out to the covered outdoor entertaining area. Beautiful private yard with manicured garden, also including double carport & double garage, with plenty of room for all your toys, all situated with in close proximity to shops, schools & transport.

TOOTGAROOK

Paul Basso 03 5985 9000

This property is ideal for the investor, developer or renovator. With a healthy $255.00 P/W rental return and good reliable tenants that are more than happy to stay this property is a secure investment. Comprising 3 lge BRs, 2 living areas, with a family, kitchen meals area that has a lovely private outlook to the garden and deck. The old saying ‘never judge a book by its cover’ applies to this property, whilst needing some TLC on the exterior the interior of the property is very neat and tidy as well as having a very practical floor plan. Located within a klm to the beach on 724m2 of land, in an area that is improving in value all the time.

ROSEBUD WEST

WINNER of the 2010 Australian Achiever Awards “Excellence in Customer Service”

Southern Peninsula Real Estate. 22nd February 2011 Page 5


Page 6

Southern Peninsula Real Estate 22nd February 2011

Tootgarook

Tootgarook

2011s Star Buy

Ready When You Are

The perfect property for 1st home buyers or Investors alike. A lovely home in the bowl of a quiet court it is in excellent condition and ready to move into. The brick veneer home is complimented by a carport, lock-up garage, gazebo and even a VPDOOVKHG7KHEORFNRIIHUVDZLGHH[SDQVHRIODZQDWWKHIURQW2YHUDOOWKHKRPHORRNVJUHDWDQGLVLQDĂ&#x20AC;UVWFODVVORFDWLRQ Step inside to reveal 3 lovely big bedrooms, a well appointed kitchen and a vast open plan living area. The home offers plenty of room for living and entertaining.This area is extremely popular with young families and offers a safe & friendly environment without missing the pleasures of the beach, shops, golf courses etc that are only a short drive away. Price: $379,000 Inspect: Call for details Agent: Alana Balog 0412 536 624

Immediate vacant possession is available on this wonderful property. Spotless both inside and out with 3 bedrooms, well appointed kitchen with adjacent meals area and lounge as well as ducted heating, split system A/C and tasteful brick and timber features throughout. Situated on a good sizes corner block in popular family location it offers a private enclosed rear \DUGODUJHJDUDJHZRUNVKRSDQGRULJLQDOFDUSRUW,GHDOKRPHIRULQYHVWPHQWSXUSRVHVRUZRXOGVXLWIXVV\Ă&#x20AC;UVWKRPHEX\HUV :HOOORFDWHGDQGYHU\ZHOOSULFHG,QVSHFWZLWKFRQĂ&#x20AC;GHQFH Address: 66-68 Bass Meadows Price: $350,000 - $370,000 Inspect: Call for details Agent: Alana Balog 0412 536 624

Tootgarook

Rye

Delightfully Complete Package

Like A Needle In A Haystack

This is a beauty. Built around 1998 and pampered from day 1 this lovely 3 bedroom cedar home is ready to enjoy. Step behind the picket fence to reveal a pristine home with front verandah, double lock-up garage, veggie garden, a wide variety of fruit WUHHVLQFOXGLQJVRPHEHDXWLIXOO\HVWDEOLVKHGROLYHV%RDVWLQJDYHU\XVHDEOHĂ RRUSODQZLWKDFHQWUDOOLYLQJURRPZHOODSSRLQWHG kitchen, 3 good sized bedrooms, bathroom and laundry. There is gas heating and an air conditioner, Fully fenced the property offers a safe haven for family holidays or permanent living. Nothing to spend, simply buy and enjoy. Address: 66-68 Bass Meadows Price: $379,000 Inspect: Call for details Agent: Phil Key 0418 516 470

The most sought after property on the Peninsula is the 3 bedroom brickie in good condition not too far from the beach on DOHYHOEORFN6XIĂ&#x20AC;FHWRVD\WKH\DUHIHZDQGIDUEHWZHHQ7KLVSDUWLFXODUKRPHLVVWLOODUHDVRQDEOHZDONWRWKHEHDFKRIIHUV the highly sought 3 bedrooms has a good sized living area and all required facilities. There is a carport plus a garage and there is tons of room for kids or pets. Currently let to reliable Tenants it can be sold as an investment or with vacant possession if UHTXLUHG,WPDNHVDQLGHDOLQYHVWPHQWRUĂ&#x20AC;UVWFODVVĂ&#x20AC;UVWKRPH'HĂ&#x20AC;QLWHO\NHHQO\SULFHGIRUSURSHUW\LQWKLVDUHD Address: 66-68 Bass Meadows Price: $379,000 Inspect: Call for details Agent: Alana Balog 0412 536 624

Rye

Rye

Brilliant In Every Respect

This home is guaranteed to please even the fussiest buyers. First impressions will put a smile on your face and it gets better with every step. Behind the picket fence is a nicely tended easy care garden. The home itself has 2 lovely big living areas and a YHU\ZHOODSSRLQWHGNLWFKHQEHGURRPVDQGH[FHOOHQWEDWKURRPIDFLOLWLHV7KHĂ&#x20AC;WWLQJVĂ&#x20AC;[WXUHVDQGGFRUDUHDOOĂ&#x20AC;UVWFODVV2II the larger family living area you can step onto the wonderful entertaining deck for those balmy evening BBQs and family get togethers. Thereâ&#x20AC;&#x2122;s no denying the fun you will have with your very own alfresco dining area. A fully fenced family sized block Ă&#x20AC;QLVKHVRIIDQRXWVWDQGLQJSDFNDJH)XQLQHYHU\GLUHFWLRQDQGSULFHGWRSOHDVH$JHQXLQHPXVWVHHSURSHUW\ Auction: Saturday 26th February at 12noon Inspect: Call for details Agent: Diane & Phil Key 0419 324 515

Tootgarook

Finally Itâ&#x20AC;&#x2122;s Available After decades in the one family this classic old beach house is for sale. Probably built in the 50â&#x20AC;&#x2122;s very little has changed since then. It totally retains the retro look and feel. Situated in one of the most sought after cul-de-sacs, literally on the Blairgowrie ERUGHU7KHEORFNLVVXSHUEDQGPHDVXUHVDSSUR[VTPWV7KHKRXVHLVW\SLFDORIWKHHUDZLWKDUDPEOLQJĂ RRUSODQWKDWFDQ accommodate plenty of happy holiday makers.There is a carport and extra sheds.With such a top location you are only a few minutes from both bay an ocean beaches, the Blairgowrie Village and a wide variety of golf courses and fun things to do. Address: 66-68 Bass Meadows Price: $390,000 - $410,000 Inspect: Call for details Agent: Phil Key 0418 516 470

Rye

Room For The Biggest Family

Beachside Living

A fabulous family home with room for everyone. The home looks great with a high picket fence offering privacy and security. Boasts 4 bedrooms plus a study, 2 massive bathrooms plus extra shower, full family sized lounge, country style kitchen with room to dine plus a marvellous front decked outdoor entertaining area. There is ducted heating, air conditioner and the entire property is loaded with user friendly features. Other attributes include long lock up garage with remote door and drive through access, tons of storage, bore water and a easy care garden. Address: 66-68 Bass Meadows Price: $420,000 - $450,000 Inspect: Call for details Agent: Glenn Key 0402 445 208

The quintessential beach house just as you would like it. High side of the road in a large usable block it really looks the part. Huge area for parking underneath plus a bedroom, toilet & shower. Wouldnt the kids love this! Step upstairs to discover 3 good sized bedrooms, open plan living, very good kitchen, cozy bathroom and loo.Thereâ&#x20AC;&#x2122;s a front deck for a quiet drink and a ponder. You will love the location as it is really quite a reasonable stroll to the beach yet far enough back to escape the retrace and hustle & bustle. Whilst it would equally suit 1st home buyers and investors, it really is just a bloody good beach house. Address: 66-68 Bass Meadows Price: $380,000 - $410,000 Inspect: Call for details Agent: Diane & Phil Key 0419 324 515

2397 Point Nepean Road, Rye

5985 6555

stockdaleleggo.com.au/rye


Southern Peninsula Real Estate. 22nd February 2011

McCrae

Page 7

86 Flinders Street

Huge Family Home :LWKVRPDQ\IHDWXUHVWKLVÀYHVL[EHGURRPKRXVHZRXOGVXUHO\EH\RXUKRPHIRUHYHU,WLVKXJHDQGQRWVXLWDEOHIRUWKRVHVHHNLQJVRPHWKLQJPRGHVW7KLVLVDKRPHWREUDJDERXWDQGEHSURXGRI :LWKIRXUOLYLQJDUHDVWKUHHEDWKURRPVÀYHEHGURRPVSOXVRIÀFHUHDGLQJDOFRYHGRXEOHLQWHJUDOJDUDJHEULFNEXLOWZRUNVKRSVHFXUHERDWSDUNLQJFDUSRUWJDUGHQVKHGJDVGXFWHGKHDWLQJFRROLQJGXFWHG YDFXXPLQWHUFRPV\VWHPKXJHGHFNRIIHULQJVXSHUEED\YLHZV 2XWWKHEDFNDQGEHKLQGWKHEULFNEXLOWZRUNVKRSDUHWZRKXJHOLWUH OWUWRWDO UDLQZDWHUWDQNVZKLFKVHUYLFHWKHJDUGHQVDQGODXQGU\7KLVWUXO\LVRQHRIDNLQGDQGKDVWREHYLHZHGWR EHDSSUHFLDWHG7KHUHLVVWLOOVRPXFKPRUHWRWKLVKRPHVRFRPHDQGWDNHDORRN,GHDOIRUWKRVHZLWKERDWVFDUDYDQVDQGIRUWKRVHUHTXLULQJVHFXUHVSDFHWRVWRUHWRROVMHWVNLVRUDQ\WKLQJRIYDOXH 3HUIHFWIRUDQ\RQHZKRZDQWVVRPHWKLQJPRUH

Auction: Inspect: Contact:

6DWXUGD\)HEUXDU\DWSP 6DWXUGD\)HEUXDU\IURP²SP 5RVHEXG2IÀFH

Look who is at Stockdale & Leggo Rosebud

Rosebud

0DUNZDVERUQLQ5RVHEXGDQGKDVOLYHGKHUHDOOKLV OLIH+HKDVDQH[WHQVLYHNQRZOHGJHRIWKHDUHDDQG KDVVHHQPDQ\FKDQJHVRQWKH3HQLQVXOD +HKDVWZRFKLOGUHQWKDWJRWR5RVHEXG6HFRQGDU\ &ROOHJH DQG LV LQYROYHG LQ PDQ\ DFWLYLWLHV RQ WKH 3HQLQVXOD+HLVDNHHQÀVKHUPDQEXWVWUXJJOHVZLWK FOHDQLQJWKHPZHOO

Mark Morssinkhof 6DOHV&RQVXOWDQW 0RELOH PDUNP#VWRFNGDOHOHJJRFRDX

+HORYHVUHDOHVWDWHDQGKDVEHHQRQHRI5RVHEXG·V WRS DJHQWV IRU PDQ\ \HDUV DQG LW VKRZV ZLWK KLV GHGLFDWLRQDQGFRPSDVVLRQWRKLVYHQGRUVKHLVDEOH WRPDNHWKHVDOHRI\RXUKRPHDVHDV\IRU\RXDV SRVVLEOH +HLVKLJKO\SURIHVVLRQDODQGZLOOJRRXWRIKLVZD\WR JHW\RXWKHUHVXOW\RXZDQWDQGQHHG

Luxury double storey townhouse

/X[XU\ GRXEOH VWRUH\ WRZQKRXVH IHDWXULQJ  EHGURRPV UG EHGURRP FDQ EH XVHG DV VLWWLQJ URRP RU EHGURRP   EDWKURRPV XSVWDLUVDQGSRZGHUURRPGRZQVWDLUV6SDFLRXVOLYLQJDUHDVDQGNLWFKHQZLWKTXDOLW\VWDLQOHVVVWHHODSSOLDQFHV6WXG\DUHDOHDGLQJRQWR XSVWDLUVGHFN Available: Rental: Inspect: Contact:

1RZ SHUZHHN %\$SSRLQWPHQW 5RVHEXG2IÀFH

McCrae

Tootgarook

Building? Renovating?

Peace and quiet!

$PDQGDKDVZRUNHGIRUWKHSDVWIRXU\HDUVLQ5HDO (VWDWH LQ DQG DURXQG WKH 5RVHEXG DUHD $PDQGD KDV ZRUNHG KHU ZD\ WR EHLQJ RQH RI 5RVHEXG·V PRVWVRXJKWDIWHUDJHQWVZLWKDSURYHQUHFRUGDQG DQ KRQHVW DQG IULHQGO\ DSSURDFK $PDQGD DOZD\V GHOLYHUVDKLJKOHYHORIVHUYLFH $IWHU PRYLQJ IURP 0HOERXUQH VL[ \HDUV DJR DQG KROLGD\LQJ LQ 5RVHEXG IRU WKLUW\ \HDUV SULRU WR PRYLQJ$PDQGD KDV VHHQ D ORW RI FKDQJHV WR WKH 3HQLQVXOD6KHKDVDYDVWNQRZOHGJHRIWKHDUHD

Amanda Kaye 6DOHV&RQVXOWDQW 0RELOH DPDQGD#VWRFNGDOHOHJJRFRPDX

:KHQLW·VWLPHWRVHHRUEX\$PDQGDZRXOGEHWKH ULJKWDJHQWIRU\RX

$VQHZOX[XU\WKUHHEHGURRPEHDFKVLGHWRZQKRXVHWDVWHIXOO\ SUHVHQWHG ZLWK FRPIRUW LQ PLQG )XOO\ HTXLSSHG NLWFKHQ ZLWK GLVKZDVKHU DQG JDVHOHFWULF FRRNLQJ 9HU\ OLYDEOH ZLWK HDV\ WR FOHDQ WLOHG ÁRRULQJ 3HDFHIXO GHFNLQJ SDUNLQJ IRU WZR FDUV ZLWK IXUWKHU SDUNLQJ DYDLODEOH RQ VWUHHW &ORVH WR WKH FRQYHQLHQW IDFLOLWLHVDW0F&UDH%HDFKLVMXVWDFURVVWKHURDG Available: 1RZ Price SHUZHHN Address :DWWOH5RDG0F&UDH

2IIHULQJEHGURRPVEDWKURRP/VKDSHGORXQJHNLWFKHQGLQLQJ DUHD 6LWXDWHG RQ WKH XSSHU OHYHO RI WKH KRPH 6SDFLRXV IHQFHG DOORWPHQWSDUNLQJIRUIRXUFDUVJDUGHQVKHGDQGZDWHUWDQN1R SHWVSOHDVH3OHDVHQRWHVWRUDJHDUHDXQGHUKRXVHLVQRWLQFOXGHG LQWHQDQF\ Available: Price Address

WK0DUFK SHUZHHN .XULQJDL5RDG7RRWJDURRN

5986 8600

1089 Point Nepean Road, Rosebud


Page 8

Southern Peninsula Real Estate 22nd February 2011

Tootgarook

$399,000 - $429,000

McCrae

$480,000 - $528,000

Follow the ships from Vendor bought elsewhere! Sorrento to Melbourne

Stop looking, you have found it!

From the moment you step inside this immaculately presented brick property you will feel right at home. The large master bedroom has ensuite & WIRs, 2 large living areas, modern kitchen with 900mm SS gas

cooker, 2 additional bedrooms each with BIRs, bathroom, separate toilet, gas heating & HWS, airconditioning. Outside boasts a magnificent alfresco dining area paved and beautifully presented for relaxed living. This property oozes charm and ambiance.

Agency: Basso Real Estate. 1807 Point Nepean Road, Tootgarook. Ph 03 5985 9000. Agent: Roy Thompson 0419 304 650

Rosebud

generational living with bathroom facilities on both levels. New deck, pull down sun blinds, good shed, plenty of parking for cars, boats and caravan, good fencing etc. Price reduced for a quick sale.

Agency: Stockdale & Leggo Rosebud. 1089 Pt Nepean Road, Rosebud. Ph (03) 5986 8600 Agent: Barry Sanders 0423 100 925

$649,000

Magnificent family home Itâ&#x20AC;&#x2122;s hard not to be impressed by this stylish home comprising four bedrooms plus study, the main with beautiful bay views, ensuite and huge WIR. Featuring two large living areas, a further two bathrooms and entertainerâ&#x20AC;&#x2122;s deck, double carport and

This well-built McCrae property offers views of the shipping channels and the specially toughened, tinted Pilkington glass acts as a sun and a sound barrier. The two storey brick veneer home has great potential for 2

double lock-up garage. Polished floorboards, granite benchtops and 9ft ceilings add a sense of space and quality. Plenty of room for the boat, caravan and pool with the land measuring approx 1200sqm.

Agency: John Kennedy Real Estate - RYE. Phone: (03) 5985 8800 Agent: Sam Crowder 0403 893 724


Southern Peninsula Real Estate. 22nd February 2011

Page 9

7/30 Weir St, Rye $379,000 â&#x20AC;&#x153;CENTRAL AND SPACIOUS TOWNHOUSEâ&#x20AC;?

46 Preston St, Rye $459,000 â&#x20AC;&#x153;AWESOME POSITION AND AWESOME PRICEâ&#x20AC;?

A fantastic opportunity to get yourself into a great area of â&#x20AC;&#x2DC;Tyroneâ&#x20AC;&#x2122; with this versatile DQGOLJKWĂ&#x20AC;OOHGKRPH:LWKPRGHUQĂ&#x20AC;QLVKHV and open living areas, this weatherboard home will not disappoint. Consisting of three bedrooms, the main with ensuite, WZROLJKWĂ&#x20AC;OOHGOLYLQJDUHDVODUJHGHFNLQJ leading to outdoor entertaining area, WLPEHU Ă RRUV WKURXJKRXW DQG P approx of land.

Contact: Sam Crowder 0403 893 724

2/1889 Point Nepean Rd, Tootgarook $580,000 - $600,000

Only 300 metres to the beach and the shopping strip sits this low maintenance and open plan townhouse. Featuring large lounge/living area leading to lush north facing courtyard, air-conditioning/ heating, semi-ensuite to both bedrooms, single lock-up garage and low Body Corp fees. These units are often sort but seldom found.

Contact: Sam Crowder 0403 893 724

175 Eighth Ave, Rosebud $345,000 â&#x20AC;&#x153;ENTRY LEVEL INVESTORS/ RETIREESâ&#x20AC;? Great scope to improve further on this already neat andtidy home and enjoy great capital growth. Comprising two large bedrooms, open plan living/kitchen, separate toilet, lock-up garage and double carport. Floorboards under existing carpet would add style and value. Great opportunity.

â&#x20AC;&#x153;BEACH BUMZâ&#x20AC;? Fully renovated as new three bedroom KRPH ZLWK RSHQ SODQ NLWFKHQ Ă RZLQJ RXW to north facing undercover deck. New bathroom, European laundry, exposed Agg, driveway plus paths. Huge double garage/workshop and carport screened behind private brush panel fence with electric remote gate, minutes walk to cafĂŠ/milk bar. Call now to inspect.

Contact: Sam Crowder 0403 893 724

20 Goolgowie St, Rosebud $589,000 â&#x20AC;&#x153;BAYVIEWSâ&#x20AC;?

Contact: Sam Crowder 0403 893 724

24 Recreation Road, Rye $698,000

WOW! Approx 24sqs of living topped off with a huge 50 square metre deck and fantastic bay views. Home comprises: four bedrooms, two kitchens, two bathrooms, three living areas all freshly painted and ready to move in. Ideal family home or two family holiday/ investment. An absolute must to inspect, call now!

â&#x20AC;&#x153;WELCOME STRANGERâ&#x20AC;? Just like a gold nugget, homes like this in prime township position are so hard WR Ă&#x20AC;QG 2QO\ WKUHH KXQGUHG PHWUHV WR Whitecliffs beach and 5 minutes walk to Rye shops. Home comprises: four bedrooms, large open plan living leading to north facing deck and BBQ zone, two bathrooms, separate toilet, large laundry, double garage plus room for caravan or boat. Low maintenance gardens, ideal retirement, holiday or investment. Call to inspect.

Contact: Sam Crowder 0403 893 724

7 Romney Ave, Tootgarook $500,000 - $540,000 â&#x20AC;&#x153;COTTAGE BY THE BEACHâ&#x20AC;? Prime position holiday and investment opportunity. Four bedroom home situated on a corner block with access from both side street and rear laneway. Just a two minute walk to safe bay beach and opposite park. Gas cooking in kitchen, living area, two toilets, laundry and more. So much potential.

Contact: Sam Crowder 0403 893 724

Contact: Sam Crowder 0403 893 724

42 Pasadena Street, Rye Offers Over $580,000 â&#x20AC;&#x153;THE WOW FACTORâ&#x20AC;? Certainly something special this immaculate BV residence of generous proportions will absolutely take your breath away from the moment you enter the home with itâ&#x20AC;&#x2122;s open plan living comprising lounge, dining and casual family rooms, functional kitchen with ample cupboard and bench space, 4 good size bedrooms (BIRâ&#x20AC;&#x2122;S) and WIR and full ensuite to the master. WOW is what youâ&#x20AC;&#x2122;ll say when you see this property and our very realistic vendors will consider all genuine offers.

Contact: Sam Crowder 0403 893 724

2327 PT NEPEAN RD RYE

03 5985 8800 www.johnkennedyrealestate.com.au


Page 10

Southern Peninsula Real Estate 22nd February 2011

Rye

Auction: Sat 26-Feb-11 1:00PM

When it’s all about position When you think about Rye there are a few things you picture; the sun, the beach, the shops! This property has it all! Ideally located within minutes walk to the bay beach and main shopping precinct of Rye, you just can’t go wrong! Located one street in from the main road and set on a picturesque level allotment of over 960 m2, there is very little to fault on this marvellous property. It has been

meticulously maintained over the years and looks as if it were only just built. This fantastic property comprises polished floor-boards and carpet throughout, 4 bedrooms with built in robes, 2 bathrooms, open plan living, kitchen with plenty of cupboard space and a separate laundry. Other features include a back deck & a lock up garage. Why compromise with the location?

Agency: YPA Estate Agents. Shop 3, 2255 Pt Nepean Rd, RYE Phone: 03 5985 2600 Agent: Robert Magnano 0425 772 073

Southern Peninsula

With an annual circulation of 600,000 copies, can you afford for your property not to be the Southern Peninsula News? List with an agent that advertises here!

St Andrews Beach

$620,000

St Andrews Beach living on 3/4 of an Acre ! Who knows what the future holds for this area but one thing EVERY agent and homeowner in St Andrews knows is that this area is one of the fastest growing on the whole Peninsula with huge land holdings and multimillion dollar investments already built here. An opportunity to own your very own piece of St Andrews right now, close enough to hear the waves crashing and a short walk to the rugged beaches. Recently extended 2 bedroom holiday home

with a huge family room with plenty of potential to continue adding rooms and space to your own design. Fabulous, large outdoor entertainment decking at rear with absolute privacy for your summer BBQ’s. Perfect holiday rental, permanent rental or year round living. No garage (at the moment) but plenty of room to build one and still have heaps of parking room for the beach toys.

Agency: Jacobs & Lowe-Bennetts. 2115 Point Nepean Road, RYE. Phone: 5987 9000 Agent: Brendan Adams 0419 566 944


Page 11

Southern Peninsula Real Estate. 22nd February 2011

ypa.com.au

Summer is nearly over but the property market is sizzling! For a free market appraisal on your home, call Robert Magnano today on 0425 772 073

Rye 3 Bruce Street

3

1

- Rye 47 Bella Vista Parade

Outdoor Living Just Got Better! Love entertaining? Love the great outdoors? Then you’ll love this property with an abundance of amazing features from the gorgeous gardens to the delightful outdoor entertaining area, this home is sure to impress the most fastidious buyer.

$560,000 - $595,000

Inspect

By Appointment

Contact

Robert Magnano 0425 772 073 Wendy Ross 0403 596 466

3

2

$490,000-$550,000

Inspect

By Appointment

Contact

Robert Magnano 0425 772 073 Wendy Ross 0403 596 466

3

2

$489,000 By Appointment Robert Magnano 0425 772 073 Wendy Ross 0403 596 466

3

This property is in prime location on Boneo Road walking distance to the beach, the Rosebud Plaza, and plenty of local cafes. The property itself has three bedrooms and two living areas, the framework is there for an amazing home, it just needs some cosmetic work. Priced at this level it’s a real bargain.

1

1

Price

$350,000

Inspect

By Appointment

Contact

Robert Magnano 0425 772 073 Wendy Ross 0403 596 466

2 Tootgarook 41 Russell Street

Summer getaway so close to the beach!

4

3

4

Lifestyle meets location!

Ideally situated on a generous flat block of approximately Price 720m2 is this perfect beach style home. With a recently Inspect renovated sparkling kitchen and bathroom to match, this gorgeous property is ready to use – no work needed. Contact This double storey property consists of an upstairs kitchen, fully tiled bathrooms and three bedrooms.

Rye 41 Heyfield Road

A family entertainment paradise awaits... Just a 10 Price minute stroll from the beach is this large 4 bedInspect room solid home.  The extensive open plan hostess Contact style kitchen is excellent for entertaining, complete with a huge walk in pantry - so big it’s currently being used as a fifth bedroom! 

$450,000 By Appointment Wendy Ross 0403 596 466

4

2

5 Saftey Beach 272 Dromana Parade

Do You Have Class?

Shop 3, 2255 Point Nepean Road, Rye

3

Position and Potential! Price

Tootgarook 87 Raymond Street

5985 2600

You will fall in love with this extremely well maintained Price three bedroom home that boasts bay glimpses from Inspect the balcony and the upper living area. Built over four levels, this homely property will relax you as soon as you Contact step through the front door, and with the private back garden with in ground spa, you’ll never want to leave!

1 Rosebud 72 Boneo Road

Breathtaking Views

If so, then come and have a look at this beautiful traditional home. So much thought has gone into the designing of this home to ensure that modern living merges with traditional aspects so nothing is compromised. Enjoy drinks on the verandah, spend an evening playing pool, or even a late night spa.

1

Peace And Beauty Price

Rye 59 Grandview Avenue From the moment you step inside you can see that this magnificent home was built to take advantage of some of the best treetop views Rye has to offer. Generous in every aspect, this great family home has been well looked after and will be someone’s home for many happy years to come.

3

Offers Invited By Appointment Robert Magnano 0425 772 073 Wendy Ross 0403 596 466 Steve Lo Casto 0423 363 872

-

-

-

Don’t miss out on this perfect block! Price

$950,000

Inspect

By Appointment

Contact

Robert Magnano 0425 772 073 Wendy Ross 0403 596 466

Located approximately 200 metres from the Marina, Price you could build the home of your dreams! With Inspect generous dimensions in approx total of 1382 m2, with already drawn up plans and potential 4 unit site Contact for development, what more could you possibly ask for! Land is in short supply don’t waste any time!

$729,000 By Appointment Robert Magnano 0425 772 073 Wendy Ross 0403 596 466 Steve Lo Casto 0423 363 872

your property agent™


Page 12

Southern Peninsula Real Estate 22nd February 2011

Rosebud Expose Yourself!!! Absolute Point Nepean Rd Frontage.

4

2

3

Rye Retail Store Freehold - Rye Foreshore. A Rare Opportunity!

3

1

2

Stand out from the crowd in this huge showroom style retail premises. Customer parking at rear plus plenty of public parking close $W[GTURNGCUGPQVGVJGTGKUCPWRUVCKTUFYGNNKPIQPCUGRCTCVGVKVNGCNUQQHHGTUHQTCWEVKQPQPVJGUCOGFC[DWVCUCUGRCTCVG D[%QPUVCPVVTCHĹżEĆ&#x20AC;QYRCUV[QWTHTQPVFQQTU4KIJVPGZVUVQTGKUVJGJWIG(QTFFGCNGTUJKRQPVJGQVJGTUKFG[QWJCXGKPVGTKQT KVGO5KVWCVGFKPVJGCDUQNWVGDGUVNQECVKQPQPVJG4[G(QTGUJQTGUJQRRKPIUVTKR.QQMKPIQWVQXGTVJGDGCEJHQTGUJQTGCPF design specialists and few steps further down is a whole range of assorted stores including a Meat wholesales and Liquor store. DG[QPFVQ2QTV2JKNNKR$C[(GYYQWNFCTIWGVJCVVJKUUVQTGKUVJGCDUQNWVGDGUVRQUKVKQPHQTCP[TGVCKNUVQTGKPCNNQH4[G

For Lease Commercial- $36,000 P/A 823-825 Point Nepean road

Auction 12th March at 2pm 2299 Point Nepean Road

Contact Ian Oldstein 0408 994 705

Contact Brendan Adams 0419 566 944

Sorrento Vacant Land In Sorrento!

4

2

3

Rye Vacant Land with plans & permits. Fantastic bay views!

3

1

2

5GK\GVJGQRRQTVWPKV[VQRWTEJCUGQPGQHVJGNCUVCXCKNCDNGDWKNFKPIUKVGUKPVJGGZENWUKXG2GPKPUWNC8KNNCIGQH5QTTGPVQ.QECVGFQPN[ 9KVJCRRTQXGFRNCPUCPFRGTOKVUTGCF[IQHQTCOWNVKUVQTG[NWZWT[DGFTQQOFYGNNKPIVJKUXCECPVDNQEMKUNQECVGFLWUVQPG CUJQTVYCNMVQVJGRTKUVKPGHTQPVDGCEJCPFVJGRQRWNCT5QTTGPVQ5CKNKPICPF%QWVC$QCV%NWDVJKUITGCVDNQEMQHCRRTQZUSO UVTGGVDCEMHTQOVJGRQRWNCT6[TQPG$GCEJHQTGUJQTG6JGJQOGKUFGUKIPGFVQOCZKOKUGVJGWUGQHVJGNCPFCPFCEJKGXGVJG YQWNFOCMGCPKFGCNUKVGHQTCRGTOCPGPVTGUKFGPEGQTJQNKFC[IGVCYC[VQDGGPXKGF DGUVRQUUKDNGDC[XKGYUCPFYQWNFUWKVVJGCUVWVGJQOGDW[GTQTSWCNKV[DWKNFGTYKVJCPCRRTGEKCVKQPQHGZEGNNGPEG

Auction 16 April 2pm 25 Collins Parade

$420,000 16 Johnson Avenue

Contact Ian Oldstein 0408 994 705

Contact Brendan Adams 0419 566 944

Rosebud One of only two on the block.

3

1

2

Tootgarook Dual income investment property!

4

2

3

#ITGCVUVCTVHQTĹżTUVJQOGDW[GTUQTCPGZEGNNGPVDW[HQTRTQRGTV[KPXGUVQTUCUKVKUEWTTGPVN[NGCUGFWPFGTQWTOCPCIGOGPV 6YQEQORNGVGN[UGRCTCVGNKXKPICTGCUCPFVYQTGPVCNKPEQOGUQHGXGT[VJKPI9JCVOQTGEQWNF[QWCUMHQT7RUVCKTUTGUKFGPEG 6JKUJQOGKUCIQQFFGCNNCTIGTVJCP[QWOKIJVKOCIKPG(GCVWTKPIIQQFUK\GFECTRGVGFDGFTQQOUCNNYKVJDWKNVKPTQDGU EQPUKUVUQHDGFTQQOUOCKPYKVJGPUWKVGCPFCNNYKVJDWKNVKPTQDGUUGRCTCVGDCVJTQQOCPFNCWPFT[4GEGPVN[EQORNGVGF VJGRTKXCVGWPKVFQYPUVCKTUQHHGTUDGFTQQOOQFGTPVKNGFDCVJTQQOQRGPECTRGVGFNKXKPITQQOMKVEJGPYKVJGNGEVTKEUVQXG UGRCTCVGDCVJTQQOUGRCTCVGVQKNGVCPFNCWPFT[YKVJCEEGUUVQDCEMEQWTV[CTF

$375,000 1/137 Eastbourne Road

$390,000-$430,000 83 Highbury Road

Contact Brendan Adams 0419 566 944

Contact Brendan Adams 0419 566 944

4Rye Bright, Big & Beautiful!

2-

-1

Rye Beach Side Get Away

2

1

-

Rye Hidden Gem

3

1

-

3 1 Rye Amazing Yard With Huge Sheds

-

&GNKIJVHWNOQFGTPJQOGYKVJRQNKUJGFĆ&#x20AC;QQTDQCTFUEQORTKUKPI 5KVWCVGFQPCSWKGVUVTGGVVJKUEQU[DGFJQWUGYKVJGNGVKTE 5KVWCVGFQPCSWKGVUVTGGVVJKUNKIJVCPFDTKIJVJQWUGJCU 6JKU JQOG HGCVWTGU  IQQF UK\G DGFTQQOU NCTIG DCVJTQQO HQWT DGFTQQOU DCVJTQQO CPF GPUWKVG CPF RNGPV[ QH HCOKN[ CRRNKCPEGUECTRGVGFKPNKXKPICTGCUCPFDGFTQQO.CTIGUKPING DGFTQQOUCPFDCVJTQQOYKVJCNCTIGFGEMGFCTGCVJCVQXGT YKVJ DCVJ CPF UJQYGT QRGP RNCP NKXKPI CTGC QXGTNQQMKPI NKXKPIURCEG5KVWCVGFKPCRTKXCVGUVTGGVCPFKPENWFGUFGEMKPI garage and large backyard. NQQMUVJGHTQPV[CTFYJKEJKUHWNN[HGPEGF2TKEGKPENWFGUCNN beautiful low maintenance yard. This property is fully fenced ECTRQTVGVE5GGKPIĹ?UDGNKGXKPI garden maintance. and has great security. It also incudes a double carport.

$380 p/w 6 Eugiena Street

$240 p/w 99 Marshall Street

$300 p/w 6 Jacquelyn Avenue

$295.00 p/w 50 Landra Street

%QPVCEVQHĹżEG

%QPVCEVQHĹżEG

%QPVCEVQHĹżEG

%QPVCEVQHĹżEG

RYE@JLBRE.COM.AU

2115 Point Nepean Road, Rye

5987 9000


Facing down a cruel disease By Mike Hast IAN Aitken had experienced problems with his eyes for several years. Amazingly, it did not stop him playing cricket, even though he had what you might call tunnel vision courtesy of what turned out to be advancing glaucoma; his captain put him in the slips where the ball comes straight toward you. He was still making runs, as he had been for more than 50 years since starting out as a teenager in Bendigo. In the end it was his legs rather than poor vision that made him pull up stumps. “I turned 60 and was too slow to run the singles; batting with young blokes in C grade, well, I’d always be looking for fours and you really need to be turning the strike over with those quick singles,” he said. He said farewell to Red Hill Cricket Club where he’d had an illustrious career, playing and coaching since 1980, and before that with Rye CC after moving from Kyneton to the peninsula with his family in 1977. At home in Rosebud West, the retired primary school teacher – who arrived at Rye Primary School in 1978, moved to Eastbourne primary in the late 1980s and retired from teaching in 1996 – started falling over furniture. He was 62. His wife Juanita, who was awarded Mornington Peninsula Shire’s citizen of the year on Australia Day, was puzzled. “Ian doesn’t fall. He was a good sportsman who had played football for South Bendigo as well as competition basketball, tennis and, of course, cricket. He had great balance and was a fit man. I was very concerned,” she said. A visit to the doctor confirmed Ian had advancing glaucoma, damage to the optic nerve. The doctor asked: “You didn’t drive here, did you?” When Ian said yes, the doctor said: “Well, I’m afraid you won’t be doing that anymore” and told him he needed urgent treatment. Juanita took over driving duties. They went to Vision Australia in Mt Eliza, at the George Vowell Centre, now an aged care centre. A surgeon drained his eye and he was put on medication.

He continued to take tumbles; it was getting worse. Their doctor continued to insist it was because of his eyes. Juanita knew it must be something else. “Ian’s father had Parkinson’s and maybe Ian was getting it, too.” After five frustrating years of doctors, tests, eye checks and more doctors, Ian was diagnosed with motor neurone disease – almost a year ago this month.

With no nerves to activate them, muscles gradually weaken and waste, and paralysis ensues. Like many MND sufferers, Ian has good and bad days. Walking is becoming very difficult so he’s in a wheelchair now. The Aitkens have spent thousands of dollars to adapt parts of their home – a new main bathroom that required changing the adjacent toilet and laundry, hand rails in the couple’s

Battling on: Ian and Juanita Aitken in their Rosebud West garden. It has been a bitter– sweet 12 months for the couple with Ian being diagnosed with motor neurone disease and Juanita being named the shire’s citizen of the year 2010.

Ian, his family and friends were devastated – there’s no cure for MND. Well, not yet anyway. He’s going public and bravely talking about his condition to raise public awareness of the disease and call for financial support for MND research. It’s a cruel disease. Motor neurones are nerve cells that control the muscles of the torso, arms and legs as well as muscles that enable us to speak, swallow and breathe.

To advertise in the next Southern Peninsula News please contact Carolyn Wagener on 0407 030 761

Southern Peninsula

en suite, and ramps at front and back doors for the wheelchair. Their daughter Vikki’s partner Mark Goodrem, son of Rye area shire councillor Bill, built the big bathroom with some of his mates, saving the Aitkens thousands. They’ve had help from the shire council via the HACC program (Health and Community Care, which enables frail older people and those with disabilities to stay at home) and

Brotherhood Community Care, a division of the Brotherhood of St Laurence, which pays for physio, podiatry and lawn mowing. Juanita, a retired nurse, is Ian’s fulltime carer. Somehow she manages to combine this with her 30-year plus career as an active member of the Rosebud and Rosebud West communities – the community renewal project, the shire’s Communities That Care program, raising money for Cancer Council Victoria and her Probus club. Great support has come from MND Australia. Over cups of tea and sandwiches in the Aitkens’ garden last week, the organisation’s regional adviser for outer southern and Gippsland, Jenny Waites, talked about how they help sufferers. “We look after about 250 people in Victoria. I look after 40 people in my region, including 10 in Frankston and on the peninsula,” she said. “It’s a rare disease; a GP might come across only one case in their career.” Juanita said Jenny had been a lifesaver. “She liaises with many agencies to help us get services. MND supplied Ian’s $2500 electric lift chair in the family room and a $1000 wheelchair that I can dismantle when we travel. It has moveable armrests so Ian can use it at tables.” Juanita says Ian’s MND may have been triggered by exposure to heavy metals. “As a child, he played on gold mining mullock heaps in Bendigo, which contain mercury, cadmium, lead and other metals. So did many other children, but Ian might have a gene that is affected by heavy metals.” The scientific community is beginning to unravel some of the molecular events that occur during MND. Motor neurones are not lost gradually, but in a sudden cascade of events. It is likely that environmental factors play a role in triggering the disease. It has long been suspected that complex interactions between genetic and environmental risk factors cause MND. Much work is still to be done. Ian gave blood this month for an MND Australia research program. Juanita is optimistic a cure will be found one day.

At Rye and Dromana Community Bank® branches it starts with U.

Ian’s former “boss” at Rye primary appears at the Aitkens’ garden gate. Bill Williamson was principal at Rye 1976-82 and later at Eastbourne Primary School 1983-87. “Ian and I became great mates when teaching and I drop in on Nita and Ian as often as possible, usually about every three weeks,” he said. “Another mate of mine, Gus North, had MND. He was in the navy, including in Japan when they surrendered in August 1945. Gus and his son came to our club Rye Probus before he passed away about two years ago. He told our members about this awful disease.” Bill told a few stories about Ian’s cricketing prowess with Ian providing the statistical details. “He played in a Victorian country team against the Poms in 1963,” Bill said. “He was a very good cricketer.” Bill is talking about the touring England Test cricket team, which often played matches in the bush in those days. “Ian was a top fast bowler and claimed the wickets of offspinner Ray Illingworth and their keeper John Murray.” Ian says with a broad smile: “Then I made seven runs. We lost but gave them a good workout.” Bill says his mate has always been a positive person. “At school, if we had any kind of problem, Ian always had a solution. ‘Let’s do this and then get on with it’, he’d say.” Bill asked Ian how he coped. Ian said: “It’s a frustrating disease; you lose the abilities you’ve always taken for granted. Sometimes I feel very sad when I see couples our age walking down the street holding hands. “But you get on with life. My family and especially Juanita are wonderful support.” Juanita has enough positive energy to light a town and an unbridled optimism that’s inspiring. “Perhaps there’s a millionaire out there who will call MND Australia and say: ‘Take this and find a cure’.” Information: MND Victoria, PO Box 23, Canterbury 3126, free call 1800 777 175. Email: info@mnd.asn.au and on the internet: www.mnd.asn.au

Senior Manager Gary Sanford, phone 0409 194 314 Dromana Community Bank®Branch, Branch Manager Bronwyn Ralph, phone 5981 0106 Rye & District Community Bank®Branch, Branch Manager Julie Toward, phone 5985 9755

Bendigo and Adelaide Bank Limited ABN 11 068 049 178 AFSL 237879. (S29417) (06/10)

www.bendigobank.com.au Southern Peninsula News 22 February 2011

PAGE 23


Healthy Living

Remove the â&#x20AC;&#x2DC;residueâ&#x20AC;&#x2122; and feel better By Lyndy Saltmarsh RESIDUE or toxins can accumulate in our bodies as a result of our diet, environment, wounds or injuries, and emotional scarring. This residue arises from our bodyâ&#x20AC;&#x2122;s inability to completely detoxify the modern chemical additives to most processed foods, the agricultural chemicals used in the production of the raw materials and of course the impurities we breathe, drink in our water, and absorb through our skin. These toxic residues remain and accumulate in our bodies unless we clean them out from time to time. Residue can also accumulate in our bodies after injuries and traumas that fail to be completely healed. Quite often the pain or discomfort of an injury will cause us to go into protective spasm around the site. This limits our experience of pain and immobilise the joint. This protective spasm can lead to compression and altered biomechanics in the joint, delaying its healing and possibly leaving a residue of compression and altered patterns of use into the future. Over time, this residue can weaken the joint, organ or muscle and either leave it prone to further discomfort or make it more difficult to completely

heal. In dealing with injuries, unless the pain, weakness or lack of connective biomechanics is completely resolved, then a residue remains. The inability to completely relax or loosen an area is tell-tail symptom of â&#x20AC;&#x153;chronic residual controlâ&#x20AC;? remaining after stress or trauma. This is where massage can help, as massage helps mobilise any residue making it ready for excretion. Emotional wounds can also leave lasting effects in the body. We are all familiar with the tension that can accumulate in our shoulders or in our stomach when we are under too much stress or we have to face an unpleasant situation. If this response becomes frequent or chronic and the body does not have time to unravel completely, then the familiarity of this muscular tension becomes â&#x20AC;&#x153;the norm.â&#x20AC;? The increased compression ratios in nearby joints eventually produces early wear and tear of the joints and muscular fatigue and aching. This condition is sometimes known as fibro-myalgia. The search for clear answers to these questions can be a vital part of any healing process. By helping you to discover these answers, we will equip you with the information and educa-

tion to create and maintain your own wellness. Creating wellness is a process of understanding how you have created your discomfort or disease thus far. With the combination of Kinesiology and Naturopathy Weâ&#x20AC;&#x2122;ll discover where you are at present and what you need to do to be completely well in the future. Complete wellness is not attainable unless youâ&#x20AC;&#x2122;re able to remove the residues or toxins. Imagine a bucket and on the bottom of the bucket is mud and slush. The rest of the bucket is filled with water. Once settled one can easily drink the water but if you stir the bucket no one would probably drink the water. Residue is exactly like this. The body in its wisdom settles toxins /residue into portals (like the layer of mud on the bottom of the bucket.) These portals house toxins or residues but unfortunately with time they can create serious disease. To eliminate these toxins/ residues is of extreme importance. Hopefully this has added another layer of important information to your expanding knowledge base. Call renewyou wellness centre on 5984 5772.

Turning teal to help can cancer cer cure STAFF at a Rye business are encouraging southern peninsula residents to embrace a Touch of Teal and support an important cause this month. The team at Rye Beach Chemmart Pharmacy is raising funds for Ovarian Cancer Australia by conducting a raffle with the prize of a new 60 centimetre Sanyo LCD TV. All proceeds will go to Ovarian Cancer Australia, which has adopted teal as itâ&#x20AC;&#x2122;s signature colour. There will also be a jelly bean guessing competition and organisers are also seeking sponsors for the pharmacy girlsâ&#x20AC;&#x2122; bike ride along the Portsea foreshore. Pharmacy owner Theo Messinis said the store was thrilled to be able to help Ovarian Cancer Australia in its bid to raise awareness of the symptoms of ovarian cancer as well as offer invaluable support to women and families affected by the disease. â&#x20AC;&#x153;February is Ovarian Cancer Australiaâ&#x20AC;&#x2122;s national awareness month and we thought it was a great opportunity to help educate people and raise funds for this important cause,â&#x20AC;? Mr Messinis said. â&#x20AC;?There is no early detection test for ovarian cancer, so itâ&#x20AC;&#x2122;s important that every woman knows the symptoms to look out for. â&#x20AC;&#x153;The month will also be a great chance to come in and have a chat to our staff who will be striving to raise

awareness of the early symptoms. Weâ&#x20AC;&#x2122;re encouraging everyone to get involved.â&#x20AC;? Chair of Ovarian Cancer Australia, Paula Benson, welcomed the support of the pharmacy. â&#x20AC;&#x153;Chemmart Pharmacy is a wonderful supporter and we are grateful that they continue to support Ovarian Cancer Australia with fundraising but, most importantly, that they are taking our message of â&#x20AC;&#x2DC;learn the symptomsâ&#x20AC;&#x2122; to women in the community, which can help to save lives,â&#x20AC;? Ms Benson said. Chemmart Pharmacyâ&#x20AC;&#x2122;s executive director Jonathan Layton said the pharmacy group was proud to be a supporter of Ovarian Cancer Australia and its annual campaign. â&#x20AC;&#x153;Recent studies have shown that public awareness campaigns have greatly raised the profile of breast cancer, but women are comparatively less aware of ovarian cancer,â&#x20AC;? Mr Layton said. â&#x20AC;&#x153;It is more difficult to detect and has no screening test. â&#x20AC;&#x153;Ovarian Cancer Australia exists not only to increase this awareness and save womenâ&#x20AC;&#x2122;s lives, but also to support and be the voice of ovarian cancer survivors across Australia. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a fantastic organisation doing great things and Chemmart Pharmacy is proud to be a supporter.â&#x20AC;?

Quickly Regain Your Health If your pain or symptoms havenâ&#x20AC;&#x2122;t been replaced by a feeling of wellbeing and vitality after one month of following our suggestions we will; 1. Give you a complete no questions asked refund on services 2. Treat you for free until it is OR 3. Book and pay for your next treatment with a competitor. Reviewed by Lyndy Saltmarsh This is a guaranteed way to make the right decision when choosing a caring and compassionate Naturopath/ Kinesiologist, so you can sleep easy knowing youâ&#x20AC;&#x2122;ve picked the right person whose skills can reverse ill health and serious disease, eliminate harmful toxins and protect you and your familyâ&#x20AC;&#x2122;s health and wellbeing.

Hereâ&#x20AC;&#x2122;s 14 great reasons why you need to call us Now.

5HQHZ\RX:HOOQHVV&HQWUH

*HRUJH6WUHHW6RUUHQWR3K

An Amazing Special Offer to you

Gift &HUWLÂżFDWH

Ć&#x201D;$OOJXWSUREOHPVWUHDWHGQDWXUDOO\DQGVDIHO\ Ć&#x201D;6KHGNJLQZHHNVQDWXUDOO\ Ć&#x201D;%DQLVKKHDGDFKHV 0LJUDLQHV Ć&#x201D;5HOLHYHDUWKULWLFSDLQZLWKRXWGUXJV Ć&#x201D;5HOLHIIRUDQ[LHW\SDQLFDWWDFNV GHSUHVVLRQ Ć&#x201D;$OOHUJLHV VNLQGLVRUGHUV treated naturally. Ć&#x201D;1HFNVKRXOGHUEDFN VFLDWLFD pain all treated with our Âł5DSLG3DLQ5HOLHI3URJUDP´ Ć&#x201D;$GYLFHLQWUHDWLQJ0HQRSDXVH 307 EDODQFLQJRIKRUPRQHV Ć&#x201D;6XFFHVVIXOPDQDJHPHQWRIVWURNH asthma, heart disease, diabetes, FKURQLFIDWLJXH EORRGSUHVVXUH

/\QG\6DOWPDUVKLVD4XDOL¿HG+HDOWK&DUH3URIHVVLRQDO who uses Kinesiology, Neuro-Training, homeopathy, 1DWXURSDWK\DQG&KLQHVH0HGLFLQHLQKHUFRQVXOWDWLRQV She is also a Nurse and Kinesiology Instructor, and is WKH'LUHFWRURI7KH&ROOHJHRI.LQHVLRORJ\0HOERXUQH +HUZHOOQHVVFHQWUHVLQ6RUUHQWRDQG0W(OL]DKDYH KHOSHGœVRIFOLHQWVWRUHFODLPWKHLUKHDOWK³6R, ZRQœWEH³3UDFWLVLQJ´ZLWK\RXU+HDOWK´

Ć&#x201D;)HUWLOLW\SUHFRQFHSWLRQDQGSUHJQDQF\FDUH Ć&#x201D;6SHFLDOLVLQJLQKHDY\PHWDOGHWR[LQJ Ć&#x201D;&KLOGUHQÂśVKHDOWK)URPWKHVLPSOHWRWKHFRPSOH[OLNH FROLFUHĂ&#x20AC;X[DOOHUJLHVZHDNLPPXQHV\VWHPOHDUQLQJ GLIÂżFXOWLHV$''$'+'RU$XWLVP Ć&#x201D;6SHFLDOLVLQJLQ0HQÂśVKHDOWK SURVWDWHLPSRWHQFH

Ć&#x201D;5HOHDVH\RXULQWHUQDOVDERWHXUWROLYH\RXUGUHDPV 7DNHDGYDQWDJHRIRXUJUHDWRIIHUEHORZ%XWKXUU\DVLW LVWLPHVHQVLWLYH\RXPXVWFDOOEHIRUH)ULGD\VW0DUFK DQGRQO\IRUWKHÂżUVWZKRSKRQH12:RQ

-Gift CertificateThis certificate entitles you to: Â&#x2026; $7DLORUHG1DWXURSDWKLF.LQHVLRORJ\&RQVXOWDWLRQ Â&#x2026; $*XW7R[LFLW\7HVWWRGHWHUPLQHJRRGDQGEDGEDFWHULD Â&#x2026; $+HDOWK$VVHVVPHQW&KHFNLQJĂ&#x20AC;XLGOHYHOVPXVFOHWRQH

and blood pressure Â&#x2026; 7HVWLQJ\RXU]LQFDQG3K/HYHOV

9DOLGXQWLO)ULGD\VW0DUFKIRUWKHÂżUVWFDOOHUVZKRSKRQH

Call NOW on 5984 5772!

ONLY $67 Valued at $160

renewyou wellness centre 5 George Street, Sorrento 3943 03 5984 5772 PAGE 24

Southern Peninsula News 22 February 2011

www.renewyousorrento.com.au


Healthy Living

Is your child

WATER SAFE?

Pelican Park offers: - Swimming lessons 7 days per week - Private Swimming Lessons (for all ages and abilities from 6 months to adults)

- Qualified & Experienced Instructors - Water Confidence & Safety

- Recreational swimming for students before and after lessons for practice *conditions apply

- Small Class Sizes

ENRO L

NOW

!

Trail blazer: Judy Reekie of Peninsula Studio Trail in her Moorooduc studio.

A chance to meet peninsula artists in their ‘natural habitat’ ON the Mornington Peninsula, you can discover a largely unspoilt natural environment that has inspired some of Australia’s finest artists, past and present. This artistic tradition is alive and well today, with many artists choosing to live and work on the peninsula. The Peninsula Studio Trail (PST) offers the public the op-

portunity to meet artist members of the trail as they work in their studios. Visitors are invited to visit a number of studios at an open weekend on 12-14 March, talk with the artists about their work and purchase artwork. The weekend offers an opportunity to experience first-hand the inner workings of an artist’s

Pop into Rye Beach Chemmart® Pharmacy today and buy a $5 raffle ticket for your chance to win a new SANYO 60cm Full HD LCD TV. All the proceeds are going to OCA, so you”ll feel even better about winning.

studio. People can see paintings in all mediums as well as sculptures and photographs. A spokesperson for the group said PST members were grateful to the Bendigo Bank’s Balnarring branch, the Grand Hotel in Mornington and the Mornington Peninsula Coastal Art Trail for their support of the annual event.

WATER EDUCATION TRAINING Present this flyer when you purchase an Adult Swim to receive a complimentary Child Swim. *Conditions apply. Offer valid upon presentation of original flyer. Valid until 15 March 2011, one redemption per visit. PELICAN PARK RECREATION CENTRE 2 Marine Parade, Hastings 3915. Postal: Private Bag 1000 Rosebud, 3939 Phone: 1300 850 197 Fax: (03) 5950 1754

WIN an LCD TV and support Ovarian Cancer Australia. Buy a raffle ticket in store.

clmHcDmD 0 6 F6ul0Full H

Competition closes noon 31 March.

Promotion starts 9am 1 Feb 2011, and closes noon 31 March 2011. Winner will be drawn at Rye Beach Chemmart® Pharmacy Rye Beach at 12.05pm 31 March 2011. Winner will be notified by phone. See in store for full terms and conditions.

Rye Beach Chemmart® Pharmacy 2345 Point Nepean Road, Rye. Phone 03 5985 2292 Open 7 days 9am-5pm Southern Peninsula News 22 February 2011

PAGE 25


Healthy Living

Life is beautiful without bulges COOLSCULPTING by Zeltiq, is a new non-invasive way to gently reduce fat in targeted areas of the body using advanced cooling technology to eliminate fat pockets, known as bulges! Kewâ&#x20AC;&#x2122;s Instant Laser Clinic is one of the first in Victoria to be equipped with Zeltiq CoolSculpting from USA Clinicians offering this new treatment, claim this cooling treatment results in a noticeable, natural-looking fat reduction in the treated areas, such as Abdomen, flanks ( love handles), inner or outer thighs. The procedure involves no incisions and no anaesthetics. It can reduce the fat layer without harming the skin or other tissues. Experts say the ideal candidate for the CoolS-

culpting Procedure is someone who is relatively fit, but has some modest- size fat bulges that are not easily reduced through diet and exercise. The fat cells in the treated area are eliminated through the bodyâ&#x20AC;&#x2122;s normal metabolic processes resulting in a reduction in fat bulges that is visible in most patients in two to four months. Only a course of 1-3 treatments at 6 weeks interval is required. CoolSculpting is not a way to lose weight or treat obesity and it is not a substitute for invasive methods such as liposuction. Call Instant Laser Clinic on 9205 9430 or visit www.instantlaserclinic.com.au

<HV:H&DQ)5((=(<RXU)DW $ZD\ <RXDUHSK\VLFDOO\ILWDQG\RXUZHLJKWLV VWDEOHEXWQRPDWWHUKRZPXFK\RXH[HUFLVH RU GLHW \RX KDYH OXPSV DQG EXOJHV DURXQG WKH DEGRPHQ ORYH KDQGOHV WKLJKV \RX MXVW FDQœWJHWULGRI ,167$17 /$6(5 &/,1,& LV QRZ HTXLSSHG ZLWK =HOWLT &RRO6FXOSWLQJ WHFKQRORJ\ IURP86$,WLVGHVLJQHGWRGHOLYHUSUHFLVHO\ FRQWUROOHG FRROLQJ WR WDUJHW DQG HOLPLQDWH IDWFHOOVLQVSHFL¿FERG\DUHDVFRPIRUWDEO\ LQOHVVWKDQPRQWKO\VHVVLRQV $OVR VSHFLDOLVHG LQ /DVHU +DLU UHPRYDO 6NLQSLJPHQWDWLRQ)DW &HOOXOLWHUHGXFWLRQ $FQH&KLFNHQSR[DQG$FQHVFDUULQJ6NLQ WLJKWHQLQJDQGWRQLQJWKURXJKODWHVWIUD[HO WHFKQRORJ\ ³H0DWUL[´ 6WUHWFK PDUNV /DVHU 7DWWRR UHPRYDO $QWLZULQNOH LQMHFWLRQV 4XLWVPRNLQJE\ODVHUWKHUDS\KRXU7HHWK :KLWHQLQJHWF

/HYHO6XLWH3ULQFHVV6W.HZ3K PAGE 26

Southern Peninsula News 22 February 2011


Healthy Living

CALL 5978 8657 FOR A FREE NO OBLIGATION QUOTE

Hydrotherapy for improved health THE Medical profession has for many years preached the advantages of wet heat for a variety of complaints. Hydrotherapy increases the ability of your body’s white cells to circulate through affected areas thus reducing inflammation and increasing blood flow. If you are affected by arthritis, joint pain, replacement rehabilitation or current or old sports injuries you will benefit

greatly from the soothing hot water massage you receive in a spa in your own home. It is also of great assistance for those who suffer with rheumatoid arthritis and tendonitis. Just as important is the fun and entertainment you can have with your family and friends all year round. At Seascape Spas we have the largest showroom on the Mornington Peninsula. We represent Spa Industries who have their

manufacturing plant in Hallam Victoria and are the largest spa manufacturer outside North America. You will not only be buying a spa from us but also buying piece of mind knowing you are buying a quality Australian-made spa with total after-sales using only Australian, American and New Zealand components and materials. Contact us on 59788657 for an on site no obligation free quote.

www.justspas.com.au

GUARANTEED BEST PRICES

IM9DALQ9MKLJ9DA9FE9<=KH9K KLGJ= KH=;A9D

-H]jkgfKhY

Your health and wellbeing

By Laura Jones BARIATRIC surgery can help people to lose weight and reduce obesity related diseases, by enabling people to become satisfied from smaller amounts of food. However to achieve the best results, patients must also

aim to work towards living a healthy lifestyle. My role as a bariatric Dietitian includes providing regular follow up, support and education for patients. In particular I help people to develop a non-dieting approach to their weight loss, which is something a lot of bariatric patients have not achieved before. It is also essential that a patient’s diet is assessed for nutritional adequacy to prevent nutritional deficiencies and related ill health. I also offer suggestions for vitamin supplementation, quick healthy meal ideas, meal planning and helping patients to understand food labels. Dietitians don’t just help people with improving their nutritional knowledge; they also focus on eating behavior,

$4900

behavioral change, motivation and more importantly adjusting diet for other health conditions that a patient may have. Only an accredited practicing dietitian can give advice on the nutritional management of chronic diseases such as diabetes or cardiovascular disease. In addition, research has shown that regular follow up with your bariatric team, including the dietitian, can lead to better health and weight loss outcomes in patients. In summary, the dietitian can offer patients with plenty of support, motivation and guidance to help them achieve the best possible health and weight loss outcomes after bariatric surgery. For further information, call Lap Surgery on 9760 2777.

), KLQD=K G>KOAE KH9K

Egjfaf_lgf  H]fafkmdYk  DYj_]klKhY  K`go%jgge

We Specialize In: Complete Spa Installation for both in-ground and portable. We take care of all: Plumbing, Excavation, Electrical, Placement, Decking, Paving, Concreting, Synthetic Grass, Thatched Bali Huts, Gazebos, Pool Fencing and All Accessories

SEASCAPE/JUSTSPAS, Cnr Males Rd & Moorooduc Rd, Moorooduc Phone: 5978 8657 Email: sales@seascapespas.com.au Web: www.seascapespas.com.au

Have hada a Gastric Band Have you you had Gastric Band or or Gastric Stapling ? Gastric Stapling?

Are You a Diabetic? Are you Seriously Overweight ?

ARE UNHAPPY ARE YOU YOU UNHAPPY WITH THE WITH THE OUTCOME ? OUTCOME?

Specialist Weight Loss Clinic

Call us PHPH 9760 2777 2777 Call uson on 9760

Non Surgical and Surgical weight loss solutions

Dietary and lifestyle advice

TOTALK TALKABOUT ABOUTYOUR YOUR OPTIONS OPTIONS TO

&OLQLF/RFDWLRQV 0RUQLQJWRQ %HUZLFN 0XOJUDYH %RURQLD

ZZZODSVXUJHU\DXVWUDOLDFRP (PDLOLQIR#ODSVXUJQHWDX

New purpose built premises, features include: Ample on site parking Easy access Pathology on site Dietitian experienced in Weight Loss and all dietary needs Southern Peninsula News 22 February 2011

PAGE 27


F

D& ENTERTAINMENT ʔʦLȫɏ

Recipes are from The Australian Women’s Weekly, 100 Pasta Favourites, ACP Books. RRP $12.95, available from selected newsagents, supermarkets and online from www.acpbooks.com.au

Confucius says:

If you want a committed man, look in mental hospital

Riddle:

You’re in a mansion and the power’s out. You see a green door and a red door. Pick one. Now you see a purple door and an orange door. Pick one. Now you see a door with a golden handle and a door with a silver handle. Pick one. You finally come to some signs on three doors. One reads “Death by drowning”, another reads “Death by machine guns” and the last one “Death by electric chair”. Then you see a big sign off to the side that reads “Or stay in the mansion and starve to death.”. Which one do you choose and still live? Answer on page 29.

Dino Consalvo Recent Landscapes 12th February - 27th March 2011

NEW MEMBERS HOURS: Thursday 5 - 6pm, Friday 6 - 7pm, Saturday 1 - 2pm, Sunday 2 - 3pm.

Open for Lunch & Dinner 7 days a week Rye RSL offers FREE entertainment every Thursday & Saturday evening

Sorrento morning 2010 Oil on canvas 60.0 x 98.0 cm

Rye RSL Presents:

“Hell Freezes Over” Eagles Tribute Show

Friday 15th April $45 – Dinner & Show Bookings Essential PAGE 28

Southern Peninsula News 22 February 2011

3385 Point Nepean Road, Sorrento Telephone: 5984 4134 www.templegallery.com.au Open Sat & Sun 11.00 am – 4.30 pm and Labour Day (Mon 14 March) and by appointment Contact: Renée Dent on 0429 94 33 64


LIFE & LEISURE

Entertainment

Wildlife warrior: The writer and Damien Mander in Mornington Park on Australia Day.

The News interviewed Damien Mander and Balnarring wildlife warrior and filmmaker Sean Willmore of The Thin Green Line documentary fame last October, “Battle against poachers: peninsula base for foundations helping African rangers”, which told the inspiring story of their individual endeavours to protect park rangers and their plans to work together. Our entertainment writer

met Damien last month. FORMER Padua College student Damien Mander has a passion for the world’s wildlife and his passion has taken him to the wild plains of Zimbabwe. Damien is the founding director of the International Anti-Poaching Foundation set up to protect and preserve wildlife in volatile regions.

I caught up with Damien recently at the Australia Day celebrations in his hometown of Mornington. Damien was in Australia for a short break to visit family and friends, and spread the word about illegal trafficking of wildlife. Damien said: “The illegal trafficking of wildlife is now the third-largest criminal industry in the world. Numerous wildlife species are becoming extinct every year with many more joining the endangered list. “We need to provide clear and relevant conversation training to enhance awareness against poaching and to help implement sustainable alternatives for communities living in regions affected by environmental instability.” Damien had a military career spanning nine years serving as a clearance diver in the Royal Australian Navy before transferring to a Special Operations until in the Australian Army. After three years in Iraq with ADF he worked for a private military organisation in Iraq as project

manager overseeing daily operations of the Iraq Special Police Training Academy in Baghdad. He returned to Australia in 2008 and headed to Africa the following year. Arriving in Africa at the start of 2009, he set out to apply his skills to wildlife protection and conservation, which landed him in Victoria Falls, Zimbabwe. Damien invested his life savings, including four investment properties, to fund the start of the foundation. Back in Mornington, he co-produced the inaugural Raw for Africa music festival in 2010 with Sean Willmore and the second event last month, at Mornington Racing Club, which he says was a huge success. Damien was recently featured on 60 Minutes and viewers were moved by his mission and achievements, which included building a 40-place ranger training academy near Victoria Falls; making multiple arrests, including the smashing of a high-profile rhino poaching syndicate that made national news in Zimbabwe; dozens of wildlife rescues in Botswana’s Chobe National Park by IAPF vet Dr Clay Wilson;

against the rest.

not only communicate with darling (surely a big plus because she will probably assume you are sensitive) but you add the real pleasure of watching and appreciating the beauty of the ducks. Alas, he departed, with a shake of his head, indicating that I was “off with the fairies”. *** “Have you ever been given any honours?” “Yes. I once received the OB, which is the Order of the Boot.” “How magnificent.” “And I was also given an REP, which is, as you know, the Rough End of the Pineapple.” “How glorious. I never knew.” “Yeah, and I got a PEBS, too, which is a Poke in the Eye with a Burnt Stick. So how about that?” “And yet you seem so humble ... so reserved.” “Yes, well, I failed to mention that I was recently made a Companion of the VD.” – Michael Leunig *** Yes, they breed them tough in North Queensland, but no tougher than in Victoria, or way down on the

with Gary Turner attracting 9000 members for the IAPF on social networking website Facebook; and establishing plans to build Africa’s most comprehensive ranger training and wildlife management centre. The foundation currently has no corporate sponsorship. It relies on Damien’s savings, public donations and fundraising events. If you or your organisation wants to get involved, contact the IAPF at damien@iapf.org As we go to press, Damien is heading back to Zimbabwe to continue his mission to protect wildlife. Links: www.iapf.org www.sixtyminutes.com.au

A Grain Of Salt SO a Commonwealth public servant was sacked for accessing a legal porn site (knockers) at home, from his own internet provider, but on his work-provided laptop, which he had approval to take home. The software program Spector360 tells all, including the man’s previous internet history, despite his having deleted it from his browser. Big Brother surrounds us. He should have known, of course, and it’s possible they required an excuse to sack him anyway, but it’s all a bit sad, highlighting the power of the doubtful morality of those without faces (including females) watching in judgement. We can assume that these faceless types “never” access legal porn, just as they “never” selfindulged in years gone by. And pigs might fly. *** I visited Port Melbourne recently, the first time in 30 years. It’s gone! Disappeared, just like Collingwood and Fitzroy. My three favourite suburbs wiped out by the beautiful cappuccino and latte brigade breakfasting downstairs from their million-dollar apartments on eggs benedict, with nary a thought for

all those previous tenants who had to move elsewhere. Good old Port, eh. Not any more. Batten down the hatches, particularly if you’re renting. It’s surely only a matter of time, if it isn’t already upon us, when more and more beautiful people will decide “Rio (the Mornington Peninsula) would be nice”. *** Almost time to think football again; such a beautiful respite from politics, or is it? James Hird and Mark Thompson certainly put the boots into Matthew Knights, not that he was all that flash as a coach. Similar to the Labor Party quartet of right-wing faction bosses – Mark Arbib from NSW, Bill Shorten and David Fenney from Victoria, and Don Farrell in SA – and the exit of my mate Kevvy Rudd. I miss you Kevvy! How are things OS? How come Knights copped everything whereas Dean Bailey (15 wins, 51 losses) leads a charmed life? Then there are the four St Kilda players who each copped a $5000 fine for mixing sleeping pills and alcohol, something I do every night. And super footballer Nick Riewoldt (except in grand finals) with his imaginary complex of “us”

Joke!!!

*** I was chatting to a younger chap at my local RSL, giving him my take on how to charm a female. I’m no expert, but after two or three pots I, like many, have an opinion on everything under the sun, not that there’s a lot of sun in the restricted smoking zone. I talked compliments and how to place them. A bit of subtlety, sincerity. He, of course, was not listening, waiting for me to stop talking (as we all do) to set me straight, favouring instinct as his preferred method. I tried the listening and communication argument, despite never in my life asking a female out. I set a scene in the gardens surrounding the Shrine of Remembrance. Sitting on the grass with his darling looking at the ducks. She would love the ducks, as all females do. She adores the ducks. Aren’t they gorgeous? Instead of you pretending you love the ducks and thinking of other avenues of pleasure, I said, why not relax and take in the beauty of the ducks? Concentrate on their beauty. Let it come to you. Or at least try very hard. And whatever your darling says, listen, without interrupting. What do you gain? You

with Cliff Ellen Mornington Peninsula, or anywhere else for that matter. Whenever a politician says “What matters here is the Australian people” you can be sure that lies will follow. *** Two plays in Melbourne are depicting sex on stage which, frankly, I find disgusting, for two sound reasons. 1: There was none in my day. 2: Sadly, I’m too old for the roles. My retirement (some say forced) came too soon. When George I became King of England in 1714, his wife did not become Queen. He placed her under house arrest for 32 years. George would have been very popular with some husbands on the Mornington Peninsula. cliffie9@bigpond.com

RIddle Solution

Susie’s husband had been slipping in and out of a coma for several months. Things looked grim, but she was by his bedside every single day. One day, as he slipped back into consciousness, he motioned for her to come close to him. She pulled the chair close to the bed and leaned in close to be able to hear him.

ANSWER: Pick the door with the electric chair. Remember: the power is out!

“You know,” he whispered, his eyes filling with tears, “you’ve been with me through all the bad times. When I got fired, you stuck right beside me. When my business went under, there you were. When we lost the house, you were there. When I got shot, you stuck with me. When my health started failing, you were still by my side. And you know what?”

Sudoku Solution

“What, dear?” she asked gently, smiling to herself. “I think you’re bad luck.”

Southern Peninsula News 22 February 2011

PAGE 29


LIFE & LEISURE

Let’s get ready to rumble By Stuart McCullough IT’S on – the trash talking has started with a flourish and it’s time to brace yourself for a good old-fashioned, bare-knuckled slap down. The creator of the TV program Glee, Ryan Murphy, has let rip at US rock band Kings of Leon, accusing them of more or less trying to destroy musical education and crushing the hopes and dreams of children everywhere. The term “traditional rivals” is no more meaningful than when the combatants in question are a rock band and a teenage musical comedy show. Clearly, there is no love lost between them. Music thrives on competition: Lennon and McCartney, the Captain & Tennille, Eminem and his mother – there are rivalries everywhere in music. That the protagonists in this latest battle operate in different worlds may lead you to think it might be one-sided. All things being equal, a TV musical has no business picking a fight with a rock band. This is like the cast of The Sound of Music challenging UK metal band Cradle of Filth to a duel. Or the Munchkins from the Wizard of Oz saying to Metallica, ‘You, me, car park, now’, albeit in a very high voice. Leaving aside the difference in genres, feuds between musical acts are a tradition stretching back to Mozart and Salieri. In recent decades we’ve seen The Beatles verses The Stones, Duran

Duran up against Spandau Ballet and Blur going at it with Oasis. Mostly it was good, clean, harmless fun. Rappers took it to another level in the 1990s by introducing firearms, but left it to the black metal bands of Norway to perfect it with a combination of both homicide and church burning. This, however, is as nothing compared to the wrath currently being aimed at Kings of Leon. First things first: exactly how did Kings of Leon manage to get themselves on the wrong side of Glee? Did they run over a cast member in the band bus? Refuse to be in a lamington drive? Sadly, no. Instead, they exhibited the temerity of those who think they have brass for bollocks by refusing permission to use one of their songs. The sheer nerve. The band was diplomatic in it’s refusal, citing concerns about “over-exposure”. They should have been more worried that their song would be “Glee-ified”, a process by which every sharp edge is shorn off and the hardiest of rock anthems is swiftly placed on the express train to Naffville. The band even went so far as to emphasise that it wasn’t personal and that they turn down heaps of licensing requests. It was to no avail. Ryan Murphy accused them of missing the “bigger picture”, which was that “a seven-year-old kid can see someone close to their age singing a Kings of Leon song, which will maybe make them want to

join a glee club or pick up a musical instrument. It’s like, OK, hate on arts education.” That’s right. A simple refusal was elevated to the status of hate crime. As the band members themselves put it, the whole thing had gotten out of hand. While Kings of Leon avoided criticising the show, that doesn’t mean others can’t sink the boots in. If ever there was a TV program that was cruisin’ for a bruisin’, it’s the toned pop moppets on Glee. Consider the numbers: more than five million in album sales. Terrifyingly, in 2009 the cast of Glee had 25 singles on the Billboard Hot 100. Twentyfive! That leaves them second only to The Beatles for most entries in any calendar year. In terms of all-time hits, they’re now second only to Elvis Presley. This is not so much disturbing as it is an affront to humanity. There’s just no way that the list of greatest musical acts should read The Beatles, followed by “the cast of Glee”. Let me be honest: I can’t stand what Glee does to music. It is, in essence, a sober kind of karaoke and has the same air of artificiality that turns junior beauty pageants from cute to creepy. If I had to describe it, I’d say it’s like regular music, only placed on a severe regimen of anti-depressants. It’s a shiny, glossy, sugary confection that may well be fine in small doses but, like fairy floss, should not be considered a

substitute for a proper meal. If Glee was a food, the list of ingredients would include things like hydrolysed protein, flavour enhancer 621 and stacks of trans fats. It would have no nutritional value whatsoever. They must be stopped. It’s my belief that this air-brushed approach to music is forcing more traditional acts to take extreme measures in a desperate attempt to get attention. Just the other week saw Jimmy Buffet’s disastrous attempt to crowd surf go horribly wrong. What could be next? Crosby, Stills and Nash ending their show by forming a human pyramid? Hard rock bands other than AC/DC dressing as schoolkids? It’s time for action. Glee’s creator can say all the nasty things he wants; he just better make sure he can cash the cheque his mouth is writing. If Glee wants to rumble, then so be it. The war begins here. If Kings of Leon are reading this, it’s time to man up. The hour has come to throw down the gauntlet and prepare for battle. The cast of Glee ought to be invited around to the back of the shelter shed where any differences can be sorted out. Normally, such invitations to violence would be abhorrent, but these are exceptional circumstances. The survival of music as we know and love it now depends on you. Who’d have thunk it? www.stuartmccullough.com

VS

Flying high for a colourful day

AWARD WINNING

COLOUR THE SKY KITE FESTIVAL

SUNDAY 13TH MARCH 2011 ROSEBUD FORESHORE JETTY ROAD - 11am to 5pm KITE FLYING KITE MAKING WORKSHOPS KIDS CARNIVAL © ivorydesign.com.au

LIVE ENTERTAINMENT ON STAGE inc. childrens entertainment, jazz, blues and Zumba! 1pm - The Vincent’s, 3pm - Wooley Dog

Charity Partner

Thanks to Rosebud Chamber of Commerce for organising the event For more information 0403 889 559

PAGE 30

Southern Peninsula News 22 February 2011

GIANT bears, dinosaurs, trilobites and an octopus in the sky over Rosebud? Yes, it’s myriad colourful kites of the annual kite festival. The family event will be held beside the pier at Jetty Rd 11am-5pm on Sunday 13 March from. This year sees professional kite-flyers from Tasmania, NSW and South Australia flying some of the country’s biggest kites, some stretching up to 27 metres in length. “The sight will be magnificent,” says Rosebud Chamber of Commerce’s Alison Doherty. “Together with the demonstrations by members of the Australian Kite Association, spectators are in for a real

treat.” Kites, originally made from silk and bamboo, have evolved over the centuries and are now made from a variety of materials, styles and shapes. The festival will showcase many of these, including threedimensional forms, rotating wind socks and massive inflatable designs, while encouraging children to learn the art and skill of kite flying. Bring your own kite or go to the kite-making workshop and then head to the family flying area to test your skills, all ages encouraged. Other activities during the day will include crafts, kids’ karaoke, dance and circus skills, zumba, carnival rides, face

painting, animal farm, Scouts and Guides activities, and a vintage car display. Roving clowns, musicians and characters will keep the family entertained, while on stage the music will include local musos – 11am Bonnie Georgia, 12pm Nowra, 1pm The Vincents and at 3pm Wooly Dog. There will be hot food, ice cream and coffee stalls, and people are invited bring a chair or rug and relax for a few hours in the spectacular colourful surroundings. Admission free and the event is organised by the chamber of commerce. For information call Alison Doherty, 0403 889 559.


SOUTHERN PENINSULA scoreboard

New soccer club is all heart ROSEBUD Heart Junior Soccer Club is the Mornington Peninsula’s new junior soccer club and will soon start its inaugural season. Rosebud Heart offers the opportunity for both boys and girls all over the peninsula from ages 6 to 18 to participate in soccer. The focus is on fun and participation while providing the necessary infrastructure to develop skills at all levels. Rosebud Heart will measure its success as a club by its ability to develop the club into a thriving social centre

for the peninsula community, focusing on giving young people at all levels the opportunity to develop their skills. Rosebud Heart will encourage players to measure their success by the formation of friendships, the development of the characteristics of good sportsmanship, their performance and results on and off the pitch and the value they attribute to healthy living. Rosebud Heart has been created from what was the junior section of Rosebud Soccer Club. The junior club has separated from the senior club to focus on the significant undeveloped potential for junior soccer on the southern peninsula.

It was decided that the best way to achieve this was to create a new junior club with a new culture and objectives. The club has been formed with the blessing of Rosebud Soccer Club. Melbourne Heart Football Club is delighted with the name, Rosebud Heart, and has offered to help with the development of the club where it can. This has included an offer of Melbourne Heart players to participate in the club’s registration day, which is from noon-4pm on Saturday 5 March at the home ground, Truemans Road Recreation Reserve, 146A Truemans Rd, Tootgarook (Melway map 169 E6).

President Lindsay Hyde and vicepresident Royston Bradshaw will present an information session at 1pm. During the presentation, the uniform will be launched. Players from Melbourne Heart FC will conduct clinics and sign autographs. Soccer drills and games will be run during the afternoon. Food and drinks will be available for purchase. Registration for under-6s to under10s is $180 and $200 for players up to under-18s. An early bird discount of $20 will apply to all registrations on or before registration day.

Payment of the fee covers each player for insurance and all training and match play for the 2011 season. Uniforms are provided by the club so all the players need to organise are their soccer boots and shin pads. Training will start mid-March. Matches will start late April or early May. All players will be notified of the times for training and matches before the season starts. For more information or to arrange registration in advance of registration day, call Lindsay Hyde on 0419 822 870, send an email to info@rosebudheart.com.au or visit the website at www.rosebudheart.com.au.

Rosebud Football Club pre-season is halfway By Mark “Hussy” Hustwaite Hello again to all followers of Rosebud Football Club – hope the New Year has started well for you, as it has for our club. The post-Christmas pre-season is about halfway through. We had a good number of players compete in the Australia Day 10km run and have been back at football training since late January. The great news of the recruitment of Cade Egan and Paul Lewis just before the Christmas break has given the senior group a boost. The training being undertaken has focused on improving all parts of our game, but more specifically on creating more run, better use of the ball, creating more space and a few

other ‘technical’ adjustments. Can’t give away too much information. Our most dedicated players have thrived on the programme so far. Some though have made a late start or not started yet – much to the frustration of all coaches, but especially ‘Raph’ who is hoping for far better results in 2011. A stronger Reserves team is one of our broader aims for 2011. The boys did show glimpses of what they might be capable of in 2010 if they put their heads down and train hard. A busy program is ahead for the club to complete its preparation. Before round 1, we will have a weekend training camp in Mt Martha, a practice match against Tyabb on the weekend of 19-20 March, a practice match on the weekend of 26-27 March against Crib Point and an intra-club match or two.

Our first big home game is 16 April versus Rye at Rosebud’s Olympic Park. A date to lock in is 9 April – round 1 vs Red Hill at Red Hill. This is followed by our first big function – “The End of Summer Beach Party” at the clubrooms featuring the Warrains and the draw of the season kick-off raffle. Hawaiian shirts are essential. February and early March are crucial. If the players make a real investment in their training and are super-fit by the practice matches, as individuals and as a team they are in for a strong season. The under-18s are in for a really good season if they can match the enthusiasm of new coach Jeff Barry who he has enlisted the help of an experienced crew – Lincs, Lachie White, Goldy, Glen Mew and Col. ‘Basil’s’ energy and the quality of the

group means they should achieve some great results if they train very hard. Our ship remains steady as our office bearers remain unchanged – Rob Nicholls as president, Pam Nicholls as treasurer and Anthony Matthews as secretary. Our general committee is up and about for another year of local footy and Kerri Gibson, our administrator, keeps the club ticking along. The netballers will be looking for another great year – two seasons so far for one premiership and finals again in 2010. Tracey Snooks will get them all back into action for 2011. They get great support from Dan Giarrusso Plumbing (DRG) and Novatech Controls. Building a court at Olympic Park is our immediate wish for the girls netball. Let’s get community and shire support for this project.

Want to be a part of the Rosebud Football Club? Want to make a difference in a community organisation that provides a sport for young men and women? Then get on board – helpers around the club are always welcomed. And don’t worry about being overburdened; we can give you a task or two that you are comfortable with. We desperately need a willing and energetic person to take over the role of head trainer – applicants welcome, experience required. Thanks again to everyone who supports the RFC. We have a wonderful group of sponsors and generally enjoy good support from the wider Rosebud community. For training details, see the office window at the club or call Hussy on 0439 366 638.

Coterie Membership Ticket:

Family Membership Ticket:

Gold Membership Ticket:

Home game admissions and social room entry

2 Adult and 2 Children entry to all home game admissions and social room entry

Single entry to all home game admissions and social room entry

Numbered members ticket

Numbered members ticket

Rye Football Club Supporters Bumper Sticker

Rye Football Club Supporters Bumper Sticker

Private viewing from the O’Rourke Room Complimentary snacks and drinks at prescribed times and hosted by Coterie Manager Qualify for the weekly members draw Rye Supporters bumper sticker

$1

90

Qualify for the weekly members draw

$1

00

Qualify for the weekly members draw

$7

0

 Silver Membership Ticket:

Past Player Membership Ticket:

Pensioner Membership Ticket:

Single entry to 5 home game admissions and social room entry

Single entry to all home game admissions and social room entry

Single entry to all home game admissions and s cial room entry

Numbered members ticket

Numbered members ticket

Numbered members ticket

Rye Football Club Supporters Bumper Sticker

Rye Football Club Supporters Bumper Sticker

Rye Football Club Supporters Bumper Sticker

$4

5

$6

5

$4











 









Southern Peninsula News 22 February 2011

0

PAGE 31


SELECTED FLOOR STOCK CLEARANCE DINING SUITES OCCASIONAL CHAIRS SOFAS

UP TO

70%OFF

STRESSLESS CHAIRS AND SOFAS BAR STOOLS

FOR 5 DAYS ONLY

PICTURES/MIRRORS

3KRQH

PAGE 32

Southern Peninsula News 22 February 2011

)DFVLPLOH

Y HW

GS

IN

UC

N

HW

NN

BU

BUN

OO D

peninsula lifestyle centre 1128 - 1132 nepean highway, mornington vic 3931 03 5973 4899 03 5973 4988

Y

AN

E EP

GOW

MEL REF 104 K11

ER R

OAD

MO OR

ZKHUHIXUQLWXUHFDQEHPDGHWREHDVLQGLYLGXDODV\RX

February 22nd 2011  

Southern Peninsula News February 22nd 2011

Read more
Read more
Similar to
Popular now
Just for you