Page 1

Catherine Zeta-Jones’ brave step forward

21

Catherine Zeta-Jones’ brave public acknowledgement of her mental health problems, including appearing on the cover of People Magazine, invited people all over the world to identify with her problem and recognize they or their loved ones are not alone if they are suffering with emotional problems. “This is a disorder that affects millions of people and I am one of them” and “if my revelation of having bipolar II has encouraged just one person to seek help, then it is worth it.” Her announcement is a landmark in public health awareness. That someone as beautiful and successful as Katherine Zeta-Jones

CATHERINE ZETA-JONES’ public revelation of her recent diagnosis has brought needed public awareness to mental health issues. can struggle with a serious mental health issue and feel comfortable enough to share it with the world will certainly motivate others to emulate her strength and intelligence, “there’s no need to suffer silently and there is no shame in seeking help.” Very fortunately, because of people in the limelight who share their struggles, the stigma once attached to seeking therapy has greatly diminished. No doubt, if your throat hurts, you break a bone, suffer any aches and pains or show signs of illness that require medical attention, you’re on it. You make an appointment with your doctor, get a diagnosis, and ultimately fill the prescription that will heal you. The responsible adult takes great pains to stay healthy by eating well, exercising, taking supplements and recommended medications and making sure to have a complete physical every year. But, taking care of your emotional health is often last on your list, until like Catherine Zeta-Jones, you realize you have no choice. Neither fame, wealth, nor talent immunizes anyone against the vicissitudes of physical and mental illness.

aging, dealing with troubled children or other family members, addictions, abuse, bereavement or anything that gets in the way of your emotional health and happiness. However, many people resist seeking help. If you have a weak heart, you control

Issues that can stop you in your tracks and prohibit everyday function as a parent, a partner or on the job include panic attacks, depression, unemployment, marital discord, eating disorders, coping with

your diet, exercise more, take prescribed medication and follow doctor’s orders. If you have a broken heart, there’s more to it. Sometimes, making that first call and findContinued on GOOD HEALTH page 2

“I use the latest techniques to fight cancer in the operating room … and answer every question a patient may have before we get here.” Dr. Datta is a board-certified, fellowship-trained cancer surgeon who’s known for his skills in the operating room and for taking the time to sit with a patient while providing support before and after surgery. A specialist in tumors of the head and neck, breast, endocrine system, colon and soft tissue as well as melanoma, he’s also a Castle Connolly top doctor, so you can be confident you’re getting quality, compassionate care every step of the way.

Rajiv Datta, MD, FACS, FRCS, FICS Chair, Department of Surgery Medical Director, South Nassau’s Cancer Center Director, Surgical Oncology/Head & Neck Castle Connolly “Top Doctor” since 2006

To schedule an appointment with Dr. Datta, call 516.632.3350 or visit www.southnassau.org for more information.

SOUTH NASSAU COMMUNITIES HOSPITAL

|

ONE HEALTHY WAY, OCEANSIDE, NY 11572

|

877-SOUTH-NASSAU

|

WWW.SOUTHNASSAU.ORG 467687

By JOHN KASTAN, Ph.D & AUDREY GOODMAN

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

Overcoming the stigma of dealing with emotional issues


Welcome Oceanside Providing nuturing, exceptional rehabilitation & nursing care for over 40 years

SERVICES: • Short-Term Rehabilitation • Long-Term Care • Subacute Care • Wound Care • Alzheimer’s and Dementia Care • Hospice

Continued from GOOD HEALTH page 1

“We don’t provide cookie-cutter theapy here at Oceanside Care Center� 2914 Lincoln Avenue Oceanside, New York

516.536.2300

www.oceansidecarecenter.com

1250$16$))5$0')$&6 :28/'/,.(72$11281&(

(;3$1'('/21*,6/$1'2)),&(+2856

'LUHFWRURI2SKWKDOPRORJ\0DLPRQLGHV0HGLFDO&HQWHU &OLQLFDO3URIHVVRURI2SKWKDOPRORJ\ 0W6LQDL6FKRRO2I0HGLFLQH   $OVR$IÂżOLDWHGZLWK

7KH1HZ<RUN(\H (DU,QÂżUPDU\ 1<80HGLFDO&HQWHU/HQR[+LOO+RVSLWDO /,2IÂżFH %D\EHUU\5RDG /DZUHQFH1< 7

%URRNO\Q2IÂżFH WK6W %URRNO\Q1< 7

2IÂżFHKRXUVE\DSSRLQWPHQWRQO\ Both the Long Island and Brooklyn offices participate with the following insurance plans: 0HGLFDUH8QLWHG+HDOWK&DUH2[IRUG$HWQD+HDOWKQHW&LJQD *+,+,3(PEOHP%&%6+HDOWKÂżUVW+HDOWKSOXV(OGHUSODQ

ing the right resource is the most difficult. We race to heal our bodies why do we hesitate to heal our minds? One out of five families living on Long Island is affected by mental health or substance abuse issues. Talking with a skilled professional can make all the difference. A huge burden is lifted when you have a structured plan of advice to follow, someone to guide you, and evidence that when utilizing the many tools available, things will work out. A better life starts with you. John Kastan, Ph.D., is executive director of Peninsula Counseling Center, a non-profit community mental health center in Valley Stream, licensed by the New York State Office of Mental Health and Alcoholism and Substance Abuse. Audrey Goodman is community relations coordinator.



Embrace wellness:

May is Mental Health Month  *RRGPHQWDOKHDOWKLVPXFKPRUHWKDQPXVWWKHDEVHQFHRILOO QHVV²LW¡VDERXWEHLQJDEOHWRKDQGOHOLIH¡VFKDOOHQJHVDQGHYHQIORXU LVK 'LG \RX NQRZ WKDW  PLOOLRQ$PHULFDQV DUH GLDJQRVHG ZLWK D PHQWDOKHDOWKFRQGLWLRQLQDQ\JLYHQ\HDU²WKDW¡VLQ"  .QRZ WKH VLJQV RI VWUHVV DQG KRZ LW DIIHFWV \RXU RYHUDOO KHDOWK DQG ZHOOEHLQJ$QG NQRZ ZKHQ LW¡V QRW MXVW VWUHVV WKDW¡V ERWKHULQJ \RX EXW VRPHWKLQJ PRUH DQG ZKHQ WR VHHN SURIHVVLRQDO KHOS (YHU\RQHJHWVGRZQIURPWLPHWRWLPHEXWVRPHWLPHVLW¡VPRUHWKDQ ´WKH EOXHV¾ &OLQLFDO GHSUHVVLRQ LV D UHDO LOOQHVV WKDW FDQ EH WUHDWHG HIIHFWLYHO\8QIRUWXQDWHO\WRRPDQ\SHRSOHEHOLHYHWKDWGHSUHVVLRQLV DQRUPDOSDUWRIOLIH¡VXSVDQGGRZQVUDWKHUWKDQDUHDOKHDOWKSURE OHP$VDUHVXOWWKH\PD\GHOD\VHHNLQJKHOSRUQRWVHHNKHOSDWDOO

Tools for living well:

 â&#x2013; &RQQHFWZLWKRWKHUV5HVHDUFKVXJJHVWVWKDWSHRSOHZKRIHHO FRQQHFWHGDUHKDSSLHUDQGKHDOWKLHUDQGPD\HYHQOLYHORQJHU  â&#x2013;  *HW SK\VLFDOO\ DFWLYH ([HUFLVH UHOLHYHV WHQVH PXVFOHV LPSURYHVPRRGDQGVOHHSDQGLQFUHDVHVHQHUJ\DQGVWUHQJWK +HOS RWKHUV 5HVHDUFK VXJJHVWV WKDW WKRVH ZKR FRQVLVWHQWO\ KHOS RWKHU SHRSOH H[SHULHQFH OHVV GHSUHVVLRQ JUHDWHU FDOP DQG IHZHU SDLQV  â&#x2013;  *HW HQRXJK UHVW 3HRSOH ZKR GRQ¡W JHW HQRXJK VOHHS IDFH DQXPEHURISRVVLEOHKHDOWKULVNVLQFOXGLQJZHLJKWJDLQGHFUHDVHG PHPRU\LPSDLUHGGULYLQJDQGKHDUWSUREOHPV  â&#x2013;  &UHDWH MR\ DQG VDWLVIDFWLRQ 3RVLWLYH HPRWLRQV FDQ ERRVW D SHUVRQ¡VDELOLW\WRERXQFHEDFNIURPVWUHVV  â&#x2013;  (DWZHOO(DWLQJKHDOWK\IRRGDQGUHJXODUPHDOVFDQLQFUHDVH HQHUJ\ ORZHU WKH ULVN RI GHYHORSLQJ FHUWDLQ GLVHDVHV DQG LQIOXHQFHPRRG

Norman Saffra, MD, FACS, is one of the nationâ&#x20AC;&#x2122;s leading ophthalmic laser and micro surgeons. Dr. Saffra is known for his expertise in diseases of the Retina and Vitreous such as; diabetic retinopathy, macular degeneration, and retinal tears and detachments. He is also experienced in caring for patients with uveitis and Neuro-Ophthalmic disorders. Dr. Saffra is a Fellow of: The American College of Surgeons and The American Academy of Ophthalmology. He is a member of the American Society of Retina Specialists and the North American Association of Neuro-Ophthalmology. Dr. Saffra frequently lectures in medical schools and to physicians throughout the country. Dr. Saffra is actively involved in clinical and surgical research. He has contributed over 25 scholarly papers to peer review journals and assisted in the design of two different surgical instruments. Under Dr. Saffraâ&#x20AC;&#x2122;s leadership, The Eye Institute at Maimonides is at the forefront of advancing medical science by pursuing research into diseases that cause permanent vision loss. He has been consistently listed in the â&#x20AC;&#x153;Castle Connolly Guide: How to find the Best Doctors (New York Metro area)â&#x20AC;? and has been listed in New York Magazine â&#x20AC;&#x153;Best Doctorsâ&#x20AC;? issue 12 times. He continues to be quoted by all major television networks and newspapers in regards to ophthalmology issues. Dr. Saffra resides in Nassau County with his family, and is looking forward to bringing state of the art retinal care to our area.

467809

CARE CENTER

Dealing with emotional issues

For over 40 years, Oceanside Care Center has been welcoming residents from our community and providing personalized care to meet their individual needs. Residents donâ&#x20AC;&#x2122;t get lost at Oceanside. Because of the small size of our facility, we are able to know each resident, cater to their individuality and provide more one to one service. We invite you to come and tour our facility and meet our staff and the residents and families we serve. We look forward to welcoming you.

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

22


23

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

St. John’s Episcopal Hospital Vascular Disease Screening Program WHY SHOULD YOU BE SCREENED FOR PERIPHERAL ARTERIAL DISEASE (P.A.D.)

Are You at Risk?

• Are you over age 50? One in every 20 Americans over the age of 50 has P.A.D. • Do you smoke, or used to smoke? • Do you have diabetes? • Do you have high blood pressure? • Do you have abnormal blood cholesterol levels? Are you of African American ethnicity? African Americans are more than twice as • likely to have P.A.D. than their white counterparts. • Have you had heart disease, a heart attack or stroke? What is It? Peripheral arterial disease (P.A.D.) develops when arteries become clogged with plaque. These are fatty deposits that limit blood flow to your limbs, especially your legs. You may experience chronic ulcers, pain or a weak or tired feeling in your legs during activity like walking. Clogged arteries in the legs may mean you are at risk for a heart attack or stroke.

What Can You Do? GET SCREENED. One of the key ways to diagnose P.A.D. is through a painless screening called an ankle-brachial index (ABI) in which a health care professional uses an ordinary blood pressure cuff and Doppler ultrasound to compare the blood pressure in your arms with the pressure in your legs. The two numbers form a ratio that determines your ABI.

Vascular Surgery Office St. John’s Episcopal Hospital 327 Beach 19th Street, 9th Floor Far Rockaway, New York 11691

466673

PLEASE CALL 718-869-7138 TODAY TO SCHEDULE YOUR FREE SCREENING AT THE VASCULAR SURGERY OFFICE.


May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

24

Diet Goofs Food For Life

I’m sure most of you How come we are “always” think you are “on track”. on a diet? How can we eventuYes, the marketing of what’s ally maintain our weight loss healthy has been re-defined successfully? What are the so often that even when we common mistakes that interfere do try to make better choicwith our progress and perhaps es, they aren’t necessarily ruin the results? better. And remember, Going on a diet creates obseshealthy eating is not always sions with food – even healthy the same as weight-loss food. Eventually we wind up eating. focusing on what’s less in fat or Many us simply eat too calories, and of course, fixating much. Yes, some foods are on which foods will give will unlimited, but that doesn’t give us the fastest weight loss. INDA mean you have to gorge I’ve always thought that “too yourself until your stomach IVESON much” of anything such as is so stuffed with vegetables hard-core dieting, becoming a that you can’t breathe! “gym-rat” and certainly striving for “perEveryone is different so comparing your fection,” will lead to some level of disapresults with others will only stress you out, pointment. It has been my experience that and some of us are “stress eaters”! unrealistic expectations will lead to big letSkipping meals, thinking less is better downs. Once that happens, the “why” queswill not lead to better results. You might tions begin to multiply in our minds: find yourself eating more at the next meal “Why aren’t I losing faster?” “Why are or picking mindlessly because you are my abs not more defined?” “Why doesn’t “entitled” to the calories you have banked my stomach look flatter?” “Why is it that for the day. The handfuls, bites, licks and when I look in the mirror I still don’t like tastes during the day “add up” and can what I see?” These are all challenging quesnegate the best of diet intentions. tions. Everyone is different and comparing To avoid the mindless munchies, plan your results with others will only stress your snacks and keep cut-up vegetables or you out, and some of us are “stress-eaters!” extra protein available to avoid making the Our brains have no connection with our wrong choices. (“Just One” of anything bodies. It’s the “this isn’t working fast wrong counts!) Even four bites a day worth enough” mentality that will cause us to 100 calories add up to a pound of added throw in the towel. weight per month.

L F

Keeping a journal of what you eat is a great tool and if you are completely honest with yourself this will help you become mindful of everything that goes in your mouth. Weekend warriors are the most common offenders. You can very easily un-do a week of good eating on the weekend. You should plan to eat in restaurants that have the proper choices for you. Steakhouses, Italian, Japanese (no rice) and Chinese (steamed) always have options. Check out the menu before you go to the restaurant to have a plan of what you may choose to order. Being prepared is your best defense! Dipping: A carrot stick is “not” a carrot stick if it’s dunked into blue cheese dip. Nuts (about 7 pieces) and peanut butter are fattening; they have 180 calories per ounce! They are a fat, not a protein. And who decided that sweet potato fries are a healthier version of the French fry? Besides the beta-carotene, vitamin C, folic acid, potassium and fiber, you have just skyrocketed the fat and calories to compare to the white potato version. What about hard cheese? It’s a bad saturated fat. I call it a “glue stick” running through your veins and arteries! Barbecue sauce and ketchup must be counted. Read the labels on these products and check the ingredients to find one that lists sugar (or sugar derivatives) as the 4th or higher item. A skinless piece of protein smothered in these condiments can add a lot of sugar which equates to adding calo-

ries. The closer to the top of the ingredient list, the more it has! You can dilute the sauce with water or use salsa or hot sauce instead. Olive oil is considered a healthy fat, but rubbing your grill or food with the oil instead of pouring it in will save a lot of calories and still give you the same results. At 120 calories a tablespoon, winding up with 6-7 tablespoons can make your meal fattening. And finally, salads! What happened? Dried fruit, cheese, nuts, seeds, candied walnuts, pecans, beans, chic peas and croutons have just turned this meal into a 1,200 calorie disaster and yes, we ask for “light” dressing (on the side.) LOL! Now we come to liquid calories such as fancy coffees, juices and creamy soups just to name a few. Just because you didn’t chew it doesn’t mean it doesn’t count. So, it’s pretty clear that everything counts when it comes to losing weight. When we make up our minds to truly commit to a healthy and “make-sense” program of nutrition and weight loss we have to commit to giving up the unhealthy categories of food. Then, it’s about “thinking before you eat!” Linda Fiveson is a nutritionist in Syosset. In addition to counseling she sells her own line of foods which are all free of flour, sugar, gluten and refined carbohydrates. For more information, call (516) 496-2300 or visit her website at www.lindafiveson.com.

Is it just a ‘bad mood’ or something else? A parents guide to understanding stress and depression in adolescents By JOHN KASTAN, Ph.D & AUDREY GOODMAN As a parent, you want to do what’s best for your child. No one knows your child better than you and with that in mind, you are usually the first to recognize when your child is experiencing an emotional difficulty. Is your child eating less? Sleeping poorly? Not keeping up in school? In a bad mood all the time? Not getting along with friends or family? Adolescent mental health problems are real, common and treatable. Over 15 million children and teens have mental health or substance abuse issues – only one in five get professional help. Stress is a normal part of life and growing up: all families experience stress or crisis at some time or another. However, some of us may be particularly vulnerable to the negative effects of stress, for various biological and social reasons, at particular times in our life. Depression in adolescents is often a temporary response to stress and is common because of the normal process of maturing, the influence of sex hormones, and conflicts with authority figures. It can also occur upon the death of a friend or relative, a break-up with a boyfriend or girlfriend, failure at school, or as the result of being bullied. In the past few years, the staff at Peninsula Counseling Center in Valley Stream, has seen an increase in the numbers of children and adolescents seeking help. And, that’s a good thing, because in a world where information is just a click away, it’s the crucial next step – accepting support and guidance from a qualified,

professional source – that starts the process towards a healthier childhood. Periods of depressed mood are common in most adolescents. They tend to view things more negatively and are unable to imagine that personal problems or interpersonal situations can be resolved successfully. When low mood, irritability and anxiety persist, it’s important that a parent seeks professional guidance and support, both for the parent and the child. Early identification of problems can avert more serious problems and episodes of depression, and learning healthy coping skills can be very empowering. Sometimes a parent will not notice signs of depression or sadness but will see changes in a child’s behavior. Each child is unique and each develops different ways of dealing with stress, anxiety and feelings of sadness. Almost all adolescents with depression benefit from some type of talk therapy, sometimes in groups and sometimes in individual therapy. Some benefit from medication, as well. They realize that this is a good place to talk about their feelings and concerns and learn how to deal with them. Supportive relationships and developing healthy coping skills can help. Getting help early can make all the difference. Peninsula Counseling Center has a qualified staff of psychiatrists, psychologists, and social workers to help families with issues that require professional assistance. To make an appointment call 516-569-6600.

STRESS IS A NORMAL PART OF GROWING UP, however some children may be particularly vulnerable to its negative effects.


25

OCLI’s Dr. Eric Donnenfeld brings new procedure to L.I. An important advancement in cataract surgery is welcome news to the many people in the area who suffer from cataracts. Long Island’s first laser enhanced and customized cataract surgery was performed by Dr. Eric Donnenfeld at Island Eye Surgicenter in Carle Place on April 19, using the Alcon LenSx® Femtosecond Laser. Dr. Donnenfeld, a founding partner of Ophthalmic Consultants of Long Island (OCLI) and clinical professor of ophthalmology at NYU, is one of only a handful of surgeons in the U.S. experienced with this laser. Island Eye Surgicenter is only the fourth surgical facility in the US to acquire this advanced technology. Cataract surgery is the most commonly performed operation in the United States with over 3 million cases performed annually. Today, visual rehabilitation following cataract surgery may be significantly enhanced with the implantation of a lens designed to correct refractive error. The addition of this exciting laser technology adds a new level of precision and predictability to the procedure that simply was not possible with conventional manual surgery. Each human eye is different in terms of size, depth, curvature of the cornea and other key features. Before cataract surgery, every eye is carefully measured and mapped. The LenSx laser uses a combination of highly advanced technologies to capture incredibly precise, high-resolution digital images of the eye. These images and the measurements and data they provide are then used to plan and perform a surgery to exacting specifications that were previously unachievable with traditional (manual) cataract surgery.

DR. ERIC DONNENFELD PERFORMED the first case on Long Island using the new laser for customized refractive cataract surgery. In addition, the LenSx laser adds computer-control to key steps of cataract surgery, ensuring highly precise surgical incisions. The unique software analyzes high-resolution images of the eye which then enables the surgeon

to design a customized, image-guided procedure for every patient and then execute the laser procedure on command. “Laser refractive cataract surgery is without a doubt the most technologically advanced option for cataract patients,” said Dr. Donnenfeld. “Before this technology was available, many of the most challenging steps during cataract surgery were performed manually with a blade. With the LenSx laser, we can offer our patients a truly premium experience with the precision and reliability of a laser for refractive cataract surgery. “Island Eye has invested significant resources integrating this sophisticated technology and in training our staff” said Robert Nelson, PA-C, Executive Director at the center. “We are thrilled to once again bring our patients the absolute latest innovations in ophthalmic surgical care.” The LenSx laser is the first FDA approved femtosecond laser for cataract surgery, which can very accurately perform anterior capsulotomies, corneal incisions and lens disruption. Prior to the introduction of this breakthrough technology, all of these steps were performed manually with handheld blades or ultrasound energy.

To learn more about customized laser cataract surgery and refractive surgical options using the LenSx laser technology, visit www.ocli.net. To schedule an appointment with Dr. Eric Donnenfeld or another OCLI cataract surgeon, please contact 1-866-SEE-OCLI (1-866-733-6254). For more information about Island Eye Surgicenter, call 516-877-2400.

Patients choose Mercy Medical Center—in Rockville Centre—more than 100,000 times a year— for top-quality, state-of-the-art health care, in a healing, faith-based environment. • 24-Hour Emergency and Trauma Care – For Both Adults and Children • New York State-designated Stroke Center • Best Ranked on Long Island in 2010 for Joint-Replacement Surgery* • Highest Ranked Weight-Loss Surgery for 2010/2011 in downstate New York* • Dedicated Inpatient Rehabilitation Program – Largest on Nassau County’s South Shore • Level III Neonatal Intensive Care Unit – Specialists in High-Risk Pregnancy • Newly Renovated Women’s Imaging Center – Latest Technology, Spa-Like Atmosphere, Next-Day Appointments *As ranked by HealthGrades®, the leading healthcare ratings organization

Physician Referrals:

Convenient Free Parking 1000 N. Village Ave., Rockville Centre • www.MercyMedicalCenter.info • A Safe Haven For Newborns—Legal Option To Abandonment

468044

516-62MERCY

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

Advanced laser surgery helps cataract patients


The mind-body connection Improve your emotional health for a more well-balanced life

People who are emotionally healthy are in control of their emotions and their behavior. They are able to handle life’s inevitable challenges, build strong relationships, and lead productive, fulfilling lives. When bad things happen, they’re able to bounce back and move on. Unfortunately, too many people take their mental and emotional health for granted – focusing on it only when they develop problems. But just as it requires effort to build or maintain physical health, so it is with mental and emotional health. The more time and energy you invest in your emotional health, the stronger it will be. The good news is that there are many things you can do to boost your mood, build resilience, and get more enjoyment out of life. Mental or emotional health refers to your overall psychological well-being. It includes

the way you feel about yourself, the quality of your relationships, and your ability to manage your feelings and deal with difficulties. Good mental health isn’t just the absence of mental health problems. Being mentally or emotionally healthy is much more than being free of depression, anxiety, or other psychological issues. Rather than the absence of mental illness, mental and emotional health refers to the presence of positive characteristics. Similarly, not feeling bad is not the same as feeling good. While some people may not have negative feelings, they still need to do things that make them feel positive in order to achieve mental and emotional health. People who are mentally and emotionally healthy have: ■ A sense of contentment. ■ A zest for living and the ability to laugh

and have fun. ■ The ability to deal with stress and bounce back from adversity. ■ A sense of meaning and purpose, in both their activities and their relationships. ■ The flexibility to learn new things and adapt to change. ■ A balance between work and play, rest and activity, etc. ■ The ability to build and maintain fulfilling relationships. ■ Self-confidence and high self-esteem. These positive characteristics of mental and emotional health allow you to participate in life to the fullest extent possible through productive, meaningful activities and strong relationships. These positive characteristics also help you cope when faced with life’s challenges and stresses.

The role of resilience in mental and emotional health

468541

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

26

Being emotionally and mentally healthy doesn’t mean never going through bad times or experiencing emotional problems. We all go through disappointments, loss, and change. And while these are normal parts of life, they can still cause sadness, anxiety, and stress. The difference is that people with good emotional health have an ability to bounce back from adversity, trauma, and stress. This ability is called resilience. People who are emotionally and mentally healthy have the tools for coping with difficult situations and maintaining a positive outlook. They remain focused, flexible, and creative in bad times as well as good. One of the key factors in resilience is the ability to balance your emotions. The capacity to recognize your emotions and express them appropriately helps you avoid getting stuck in depression, anxiety, or other negative mood states. Another key factor is having a strong support network. Having trusted people you can turn to for encouragement and support will boost your resilience in tough times. Resilience involves maintaining flexibility and balance in your life as you deal with stressful circumstances and traumatic events. This happens in several ways, according to the American Psychological Association, including: ■ Letting yourself experience strong emotions, and also realizing when you may need to avoid experiencing them at times in order to continue functioning.

■ Stepping forward and taking action to deal with your problems and meet the demands of daily living, and also stepping back to rest and reenergize yourself. ■ Spending time with loved ones to gain support and encouragement, and also nurturing yourself. ■ Relying on others, and also relying on yourself.

Physical health is connected to mental and emotional health

Taking care of your body is a powerful first step towards mental and emotional health. The mind and the body are linked. When you improve your physical health, you’ll automatically experience greater mental and emotional well-being. For example, exercise not only strengthens our heart and lungs, but also releases endorphins, powerful chemicals that energize us and lift our mood. The activities you engage in and the daily choices you make affect the way you feel physically and emotionally. Get enough rest. To have good mental and emotional health, it’s important to take care of your body. That includes getting enough sleep. Most people need seven to eight hours of sleep each night in order to function optimally. Learn about good nutrition and practice it. The subject of nutrition is complicated and not always easy to put into practice. But the more you learn about what you eat and how it affects your energy and mood, the better you can feel. Exercise to relieve stress and lift your mood. Exercise is a powerful antidote to stress, anxiety, and depression. Look for small ways to add activity to your day, like taking the stairs instead of the elevator or going on a short walk. To get the most mental health benefits, aim for 30 minutes or more of exercise per day. Sunlight lifts your mood, so try to get at least 10 to 15 minutes of sun per day. This can be done while exercising, gardening, or socializing. Limit alcohol and avoid cigarettes and other drugs. These are stimulants that may unnaturally make you feel good in the short term, but have long-term negative consequences for mood and emotional health. © Helpguide.org 2001-2010. All rights reserved.


to your health

27

Health news prepared by HERALD advertisers

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

6W-RKQ·V(SLVFRSDO+RVSLWDO$GGV3RZHUIXO1HZ7RRO,Q

)LJKW$JDLQVW%UHDVW&DQFHU &KDQJLQJ%UHDVW&DUH)RUHYHU

VWURQJIDPLO\KLVWRU\RIEUHDVWFDQFHUµVDLG0RKDQ 0DKDGNDU0'&KDLUPDQRI2EVWHWULFV*\QHFRO RJ\ DW 6W -RKQ·V ´:H DUH YHU\ SOHDVHG WR RIIHU VWDWHRIWKHDUW GLJLWDO PDPPRJUDPV JLYHQ E\ H[FHOOHQWDQGFDULQJWHFKQRORJLVWVFRQYHQLHQWO\LQ RXUFRPPXQLW\µKHDGGHG  ´7KLV QHZ GLJLWDO WHFKQRORJ\ ZLOO SURYLGH ERWK DFFXUDF\ DQG LQFUHDVHG HDVH RI XVH IRU RXU SDWLHQWVµ VDLG 'U 6FKZDUW] ´3URYLGLQJ RXWVWDQG LQJGLDJQRVWLFHTXLSPHQWIRUSDWLHQWVLVDYLWDOVWHS WR JRRG SUHYHQWLYH KHDOWK DQG RQH ZH WDNH YHU\ VHULRXVO\µ

There are many advantages to a digital system including:  â&#x2013;  7KH LPDJHV DUH FOHDU DQG HDV\ WR UHDG DQG LW RIIHUV DQ H[FHOOHQW YLHZ RI WKH EUHDVW HVSHFLDOO\ QHDU WKH VNLQ OLQH FKHVW ZDOO DQG LQ ZRPHQZLWKGLYHUVHEUHDVWWLVVXHW\SHV  â&#x2013;  $ GLJLWDO PDPPRJUDSK\ H[DP XVXDOO\ WDNHVOHVVWKDQKDOIWKHWLPHRIDWUDGLWLRQDOILOP EDVHG H[DP DQG WKHUH·V OHVV RI D FKDQFH \RX ZLOOEHFDOOHGEDFNWRUHWDNH\RXULPDJHV  â&#x2013;   <RXU SK\VLFLDQ ZLOO JDLQ YLHZLQJ RSWLRQV ZLWKWKHXQLTXHDELOLW\WRHQKDQFHFHUWDLQDUHDV WRJHWDPRUHSUHFLVHSLFWXUHRI\RXUFRQGLWLRQ

%ULVWDO$VVLVWHG/LYLQJ2IIHUV 7LSV)RU2OGHU$GXOWV7R6SULQJ,QWR6KDSH

 :KLOHPDQ\ROGHUSHRSOHWHQGWRVORZGRZQ LQ ZLQWHU$ODQ 3DUNHU ([HFXWLYH 'LUHFWRU RI WKH %ULVWDO$VVLVWHG /LYLQJ &RPPXQLW\ LQ /\QEURRN VD\VWKDWNHHSLQJDFWLYHDOO \HDULVDNH\WR JRRGKHDOWK3DUNHU RIIHUV VRPH VLPSOH WLSV

WRWDNHDGYDQWDJHRIVSULQJDV\RXJHWEDFNLQWR VKDSH â&#x2013; :DONDWWKHPDOO&OLPDWHFRQWURODQGHYHQ VXUIDFHVPDNHPDOOZDONLQJDJUHDWZD\WRVWD\ LQVKDSH â&#x2013;  7DNHWKHVWDLUV6WDLUFOLPELQJH[HUFLVHVWKH VDPHPXVFOHVQHFHVVDU\IRUNHHSLQJ\RXUEDO DQFHZKLOHULVLQJIURPDFKDLUVRLWLVLPSRUWDQWWR NHHSWKHVH PXVFOHVVWURQJ â&#x2013;  /LWWOH FKDQJHV WKDW DGG XS 3DUN IDUWKHU DZD\ IURP D VWRUH HQWUDQFH ZDONLQJ WKH H[WUD GLVWDQFHZLOOSURYLGHFDUGLRYDVFXODUH[HUFLVH   3DUNHU DOVR DGYLVHV WKDW VHQLRUV ZDUP XS EHIRUH DQG FRRO GRZQ DQG VWUHWFK DIWHU DQ\ H[HUFLVHDFWLYLW\WRORZHUULVNIRULQMXU\GULQN ZDWHU WR VWD\ K\GUDWHG DQG VHW DQ H[HU FLVH JRDO RI  KRXUV HDFK ZHHN RI PRGHUDWHWRYLJRURXVDFWLYLW\IRUFDU GLRYDVFXODU ILWQHVV DQG VWUHQJWKHQ LQJH[HUFLVH  5IF#SJTUBM"TTJTUFE-JWJOHDPN NVOJUJFT IBT GBDJMJUJFT JO &BTU .FBEPX &BTU/PSUIQPSU -ZOCSPPL  /PSUI)JMMT /PSUI8PPENFSF 8FTU CVSZBOE.BTTBQFRVB'PSJOGPS NBUJPO PO 5IF #SJTUBM "TTJTUFE -JWJOH $PNNVOJUJFT  WJTJU XXXUIFCSJTUBMDPN The Bristal Assisted Living Communities 631-580-6420

STATE-OF-THE-ART DIGITAL MAMMOGRAPHY is now available at St. Johnâ&#x20AC;&#x2122;s Episcopal Hospital. Digital mammography offers the latest technology and clearer images, and an improved diagnostic tool in the detection of breast cancer.  â&#x2013; <RXU EUHDVW LPDJHV FDQ EH ]RRPHG LQ DQG RXW DQG WKH FRQWUDVW FDQ EH OLJKWHQHG RU GDUN HQHG$OVRWKURXJKDQLQYHUWLQJIHDWXUHEODFNDQG UHYHUVH WR ZKLWH DQG ZKLWH WR EODFN7KLV IHDWXUH KHOSVGHWHFWPLFURFDOFLILFDWLRQVZKLFKLVOLNHUHYHDO LQJDJUDLQRIVDOWLQDEDOORIFOD\$OOWKHVHLPDJH HQKDQFHPHQWV KHOS DLG LQ SURSHU GLDJQRVLV

 â&#x2013; 'LJLWDOLPDJHVFDQEHYLHZHGRQZRUNVWDWLRQV DQ\ZKHUHLQWKHZRUOGDOORZLQJSK\VLFLDQVWRFRP SDUHFXUUHQWLPDJHVWRSDVWLPDJHV  )RUDQDSSRLQWPHQWIRUGLJLWDOPDPPRJUDSK\DW 6W-RKQ·V(SLVFRSDO+RVSLWDOFDOO

St. Johnâ&#x20AC;&#x2122;s Episcopal Hospital 327 Beach 19th St., Far Rockaway â&#x20AC;¢ 718-869-7780

Edward M. Stroh, M.D. Retina Consultants of Long Island Specializing in Diseases and Surgery of the Retina and Vitreous: Macular Degeneration Diabetic Retinopathy Macular Pucker and Macular Holes Retinal Vascular Occlusions Flashes and Floaters Laser Surgery and Phototherapy Retinal Detachment and Vitreoretinopathy Retina, Vitreous and Macular Surgery Uveitis Penetrating Eye Injuries Ocular Trauma

165 North Village Avenue, Suite 203 Rockville Centre, NY 11570

536-9525 Affiliated with: Mercy Medical Center, Long Island Jewish-North Shore Health System, Winthrop University Hospital, South Nassau Communities Hospital, and Manhattan Eye, Ear and Throat Hospital

468034

 7KLV \HDU LQ$PHULFD PRUH WKDQ  ZRPHQ ZLOO EH GLDJQRVHG ZLWK EUHDVW FDQFHU 7RGD\ 6W -RKQ·V (SLVFRSDO +RVSLWDO DGYDQFHG WKHILJKWDJDLQVWWKLVSHUYDVLYHGLVHDVHE\LQVWDOO LQJDQHZFXWWLQJHGJHGLJLWDOPDPPRJUDSK\V\V WHPIRULWVSDWLHQWV  7KLV V\VWHP D *( +HDOWKFDUH 6HQRJUDSKH 'LJLWDO 0DPPRJUDSK\ V\VWHP SURYLGHV SK\VL FLDQV ZLWK FOHDU DQG SUHFLVH DOOGLJLWDO LPDJHV UDWKHUWKDQLPDJHVRQ;UD\ILOP:KDW·VPRUHWKH V\VWHPSURYLGHVWKHODUJHVWILHOGRIYLHZFXUUHQWO\ DYDLODEOHZKLFKFDQEHH[WUHPHO\KHOSIXOIRUSUHFL VLRQLPDJLQJRISDWLHQWVZLWKGLYHUVHVKDSHVDQG VL]HV  7KLVLVDQHZDQGSRZHUIXOWHFKQRORJ\IRUWKH GHWHFWLRQ DQG ILJKW DJDLQVW EUHDVW FDQFHUµ VDLG .HQQHWK6FKZDUW]0'´'LJLWDOV\VWHPVVXFKDV WKH QHZ *( GLJLWDO PDPPRJUDSK\ V\VWHP DOORZ XV WR RIIHU RXU SDWLHQWV VWDWHRIWKHDUW PDPPR JUDPV WKDW DUH IDVW DQG HDV\$QG LW JLYHV RXU UHIHUULQJ SK\VLFLDQV DFFXUDWH LPDJHV WR XVH LQ GLDJQRVLVµ  0DPPRJUDPV DUH DPRQJ WKH EHVW HDUO\ GHWHFWLRQPHWKRGV\HWPLOOLRQ86ZRPHQ \HDUVRIDJHRUROGHUKDYHQHYHUKDGDPDPPR JUDP DFFRUGLQJ WR WKH 1DWLRQDO %UHDVW &DQFHU )RXQGDWLRQ,QF  ´$V D J\QHFRORJLVW ZH HQFRXUDJH DOO ZRPHQ RYHU WKH DJH RI  WR KDYH DQ DQQXDO PDPPR JUDPDQGLQVRPHFDVHVHDUOLHUZKHUHWKHUHLVD


to your health

Health news prepared by HERALD advertisers

'LDEHWHV6HOI0DQDJHPHQW(GXFDWLRQ3URJUDP

$W0HUF\0HGLFDO&HQWHU

0DFXODU'HJHQHUDWLRQ

&DQ$Q\WKLQJ%H'RQH7R+HOS" 0DFXODU GHJHQHUDWLRQ LV WKH QXPEHU RQH FDXVHRIVHYHUHYLVXDOORVVLQROGHU$PHULFDQV,W LVDYHU\IUXVWUDWLQJFRQGLWLRQIRUDIIOLFWHGSDWLHQWV DV LW FDQ FDXVH D ORVV RI FHQWUDOYLVLRQ WKRXJK SHULSKHUDORUVLGHYLVLRQUHPDLQVLQWDFW :KLOHWKH H[DFW FDXVH RI WKLV FRQGLWLRQ LV XQFOHDU ZH GR NQRZWKDWFLJDUHWWHVPRNLQJLVDULVNIDFWRU6RWKLV LVDQRWKHUUHDVRQWRVWRSVPRNLQJLPPHGLDWHO\ 3HRSOHZLWKPDFXODUGHJHQHUDWLRQFDQKDYH GLIILFXOWLHVZLWKPDQ\WDVNVUHDGLQJEDQNLQJGULY LQJ LGHQWLI\LQJ WKHLU PHGLFDWLRQV HWF &XUUHQWO\ WKHUHDUHPDQ\ORZYLVLRQDLGVLHPDJQLILHUVWHOH VFRSHVHWFWKDWFDQDVVLVWSDWLHQWVLQWKHLUDFWLYLWLHV RIGDLO\OLIHDQGDOORZWKHPWRPDLQWDLQWKHLULQGH SHQGHQFH :KLOH WKHVH GHYLFHV GR QRW WUHDW WKHFRQGLWLRQWKH\FHUWDLQO\FDQPDNHLWPRUHPDQ DJHDEOH 7KHUH LV DFWLYH UHVHDUFK WKDW LV RQJRLQJ IRU GHYHORSLQJQHZWUHDWPHQWVIRUERWKWKH´GU\µDQG ´ZHW·IRUPVRIWKLVFRQGLWLRQ2QHDUHDRIDFWLYH VWXG\LVWKHUROHRIYLWDPLQVLQVORZLQJGRZQRUSUH YHQWLQJPDFXODUGHJHQHUDWLRQ&XUUHQWVWXGLHVDUH FRPSDULQJ GLIIHUHQW GRVDJHV DQG IRUPXOD WLRQV8QOHVVWKHUHLVDVSHFLILFPHGL FDOUHDVRQQRWWRWDNHDYLWDPLQ VXSSOHPHQWDOOSDWLHQWV Z L W K  P D F X O D U GHJHQHUD WLRQ

VKRXOGFRQVLGHUWDNLQJRQH /XFHQWLVDQGLWVFRXVLQ$YDVWLQDUHWKHQDPHV RI WZR PHGLFDWLRQV WKDW KDYH UHYROXWLRQL]HG WKH WUHDWPHQW RI ¶ZHW· PDFXODU GHJHQHUDWLRQ7KHVH VSHFLDOO\GHVLJQHGDQWLERGLHVFDQEHDGPLQLVWHUHG LQWRWKHH\HDQGVWRSWKHJURZWKRIQHZEORRGYHV VHOV FDXVLQJ OHDNDJH DQG YLVXDO ORVV LQ WKLV FRQGLWLRQ 1HZWUHDWPHQWVIRUPDFXODUGHJHQHUDWLRQDUH RQWKHKRUL]RQ,IWKHSDVWWZR\HDUVDUHDQ\LQGLFD WLRQWKHQH[FLWLQJQHZWKHUDSLHVPD\EHDYDLODEOH VRRQ 6R HYHQ LI \RX DUH QRW D FDQGLGDWH IRU WRGD\·VDYDLODEOHWUHDWPHQWVGRQRWJLYHXSKRSH FDXVHKHOSLVRQWKHZD\ Brooklyn Office: 902 49th St., Brooklyn 718-283-8000

Dr. Norman Saffra 22 Bayberry Rd., Lawrence 516-239-6789

7R DGGUHVV RQH RI WKHPRVWSUHVVLQJSXE OLFKHDOWKFRQFHUQVIDF LQJ /RQJ ,VODQG DQG WKHQDWLRQ0HUF\0HG LFDO &HQWHU RIIHUV DQ RXWSDWLHQW 'LDEHWHV 6HOI0DQDJHPHQW(GX FDWLRQ  3URJUDP IRU GLDEHWLFV DQG WKHLU IDPLOLHV 7 K H  S U R J U D P HPSKDVL]HV NQRZO HGJH WUHDWPHQW DQG VHOIPDQDJHPHQW RI WKH GLVHDVH VR WKDW SDWLHQWV FDQ LGHQWLI\ DQG SUHYHQW SRVVLEOH FRPSOLFDWLRQV&ODVVHVLQFOXGHVHOIPDQDJHPHQW WHFKQLTXHV RQ GLHW EORRG JOXFRVH PRQLWRULQJ IRRW FDUH PHGLFDWLRQV H[HUFLVH H\H FDUH DQG OLIHVW\OH FKDQJHV 7KH SURJUDP LV GHVLJQHG WR RIIHUWKHEHVWVHOIPDQDJHPHQWLQIRUPDWLRQZLWK VPDOOJURXS LQVWUXFWLRQ IRU D XQLTXH SHUVRQDO OHDUQLQJHQYLURQPHQW 7KH IRXUVHVVLRQ SURJUDP LV FRQGXFWHG PRQWKO\ EHJLQQLQJ ZLWK DQ KRXUORQJ LQGLYLGXDO DVVHVVPHQW IRU HDFK SDUWLFLSDQW IROORZHG E\ WKUHH ZHHNO\ JURXS ZRUNVKRSV FRQGXFWHG :HGQHVGD\HYHQLQJVIURPSP(DFKSDUWLF LSDQW DOVR UHFHLYHV D JURXS IROORZXS VHVVLRQ

DSSUR[LPDWHO\ VL[ ZHHNV DIWHUWKHSURJUDPHQGV &ODVVHV DUH WDXJKW E\ WZR H[SHULHQFHG 'LDEHWHV (GXFDWRUVFHUWLILHGE\WKH $PHULFDQ 'LDEHWHV$VVR FLDWLRQ $'$  7KH SUR JUDPSURYLGHVSDUWLFLSDQWV ZLWK WKH VNLOOV UHTXLUHG IRU GD\WRGD\ PDQDJHPHQW RI GLDEHWHV DQG VWUDWHJLHV IRU SHRSOH OLYLQJ ZLWK GLD EHWHV WR PDLQWDLQ DQG PD[LPL]HOLIHDFWLYLWLHV 0HUF\·VSURJUDPTXDOL ILHV IRU UHLPEXUVHPHQW IURPPRVWLQVXUDQFHSODQV DQGLVUHFRJQL]HGE\ERWK WKH$PHULFDQ 'LDEHWHV$VV RFLDWLRQ $'$  DQG WKH$PHULFDQ$VVRFLDWLRQRI'LDEHWHV(GXFDWRUV $$'( ,WVFXUULFXOXPLVDUHFRJQL]HGHGXFDWLRQ DOSURJUDPRIERWKWKHVHDVVRFLDWLRQVDQGPHHWV WKH 1DWLRQDO 6WDQGDUGV IRU 'LDEHWHV 6HOI0DQ DJHPHQW(GXFDWLRQ 3DWLHQWV VHHNLQJ LQIRUPDWLRQ RU ZLVKLQJ WR UHJLVWHUVKRXOGFDOO0(5&< Mercy Medical Center, Rockville Centre 516-62MERCY

2YHUFRPH'HSUHVVLRQ7R

5HDFK<RXU )XOO3RWHQWLDO

Excitin Low Pricge !

$2,195

based on a 30 day mon th

but our selection was clear.

OUR DECISION WASN’T EASY....

WE WENT WITH THE BEST - THE BRISTAL. When you visit

The Bristal – no other community compares. It’s more than luxury living &

dining. More than delightful activities. It’s devoted attention, a sterling staff and simply outstanding care. Wrestling with your decision? Call to schedule your tour today! Ask about our Veterans Program!

NORTH WOODMERE 477 HUNGRY HARBOR RD 516.336.2600

LYNBROOK Care Beyond Compare

blog.thebristal.com

8 FREER STREET 516.593.2424

thebristal.com

find us on

facebook

LICENSED BY THE NYS DEPT OF HEALTH. ELIGIBLE FOR MOST LONG TERM CARE POLICIES.

8<(30;@*644<50;0,:)@;/,,5.,3)<94(5.96<7

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

28

 %RDUG&HUWLILHG3V\FKLDWULVW'U(GZDUG)UXLW PDQLVSURXGWRDQQRXQFHWKHRQH\HDUDQQLYHU VDU\RI6RXWK6KRUH1HXURSV\FKLDWULF&HQWHU'U )UXLWPDQLVWKHILUVWWREULQJ7UDQVFUDQLDO0DJQHWLF 6WLPXODWLRQ 706  DQ DOWHUQDWLYH WUHDWPHQW IRU GHSUHVVLRQWRWKH)LYH7RZQVFRPPXQLW\8VLQJ KLJKO\ IRFXVHG 05, VWUHQJWK PDJQHWLF SXOVHV WKH1HXUR6WDUŠ7067KHUDS\6\VWHPDFWLYDWHVD VSHFLILFUHJLRQRIWKHEUDLQLQYROYHGLQGHSUHVVLRQ  7KH GHYLFH LV HVSHFLDOO\ GHVLJQHG IRU FOLQLFDO XVHRQDQRXWSDWLHQWEDVLV3DWLHQWVFDQUHWXUQWR QRUPDO DFWLYLW\ LPPHGLDWHO\ DIWHU HDFK WUHDWPHQW EHFDXVH XQOLNH LWV SUHGHFHVVRU HOHFWUR FRQYXO VLYHWKHUDS\RU(&7706LVFRPSOHWHO\QRQLQYD VLYHDQGQRVHGDWLRQLVUHTXLUHGQRUGRSDWLHQWV H[SHULHQFH WKH FRJQLWLYH VLGH HIIHFWV RU PHPRU\ ORVVH[SHULHQFHGSRVW(&76LPLODUO\706RIIHUV DQDOWHUQDWLYHVROXWLRQWRWKHDGYHUVHVLGHHIIHFWV FDXVHGE\PRVWWUDGLWLRQDODQWLGHSUHVVDQWV  2YHUWKHODVWWZR\HDUV706KDVGHPRQVWUDW HG D YHU\ KLJK VXFFHVV UDWH LQ WKH WUHDWPHQW RI GHSUHVVLRQQDWLRQZLGHDQGDQDQDO\VLVRI6RXWK 6KRUH 1HXURSV\FKLDWULF &HQWHU·V WUHDWPHQW UHVXOWV VKRZV D VXFFHVV UDWH VXUSDVVLQJ WKH QDWLRQDO DYHUDJH$ FRXUVH RI706 WUHDWPHQW DW RXUFHQWHUDOZD\VRIIHUVSDWLHQWVWKHRSWLRQRIDQ LQGLYLGXDOL]HG UHJLPHQ LQFOXGLQJ VXSSOHPHQWV PHGLFDWLRQDQGFRXQVHOLQJ  $V SDUW RI KLV FRPSUHKHQVLYH DSSURDFK WR WUHDWPHQW 'U )UXLWPDQ FRQWLQXHV WR RIIHU WUDGL

WLRQDO&RJQLWLYH%HKDYLRUDO7KHUDS\ .&/HYLWDQ /0+& DVZHOODVLQQRYDWLYHPRGDOLWLHVOLNH'LD OHFWLFDO %HKDYLRU 7KHUDS\ )LDQD .RVKHYDWVN\ /&6: 'LDOHFWLFDO%HKDYLRU7KHUDS\LVDXQLTXH IRUPRISV\FKRWKHUDS\LQGLFDWHGIRUWKHWUHDWPHQW RI SDWLHQWV ZLWK VSHFWUXP PRRG DQG FKDUDFWHU GLVRUGHUV 5HFHQW UHVHDUFK DOVR VXJJHVWV LWV HIIHFWLYHQHVVZLWKVXUYLYRUVRISV\FKRORJLFDOWUDX PDDQGVXEVWDQFHDEXVH  3OHDVHYLVLWRXUZHEVLWHZZZVRXWKVKRUHWPV FRPIRUPRUHLQIRUPDWLRQ South Shore Neuropsychiatric Center 1451 Broadway, Hewlett 516-295-4867


to your health

29 Health news prepared by HERALD advertisers May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

)UHH6FUHHQLQJ)RU+HDG$QG1HFN&DQFHUV$W

6RXWK1DVVDX&RPPXQLWLHV+RVSLWDO

 7KLV\HDUDORQHQHDUO\RIWKH $PHULFDQVGLDJQRVHGZLWKDKHDGRUQHFNFDQ FHU ZLOO GLH )RUWXQDWHO\ LI KHDG RU QHFN FDQ FHUVDUHGHWHFWHGLQWKHHDUO\VWDJHVWKH\DUH KLJKO\WUHDWDEOHDQGWKHFXUHUDWHLVJRRG  $FFRUGLQJ WR WKH 3UHYHQWLRQ &RPPLWWHH RI WKH $PHULFDQ +HDG DQG 1HFN 6RFLHW\ DQ DQQXDO VFUHHQLQJ IRU KHDG DQG QHFN FDQFHUV DVVLVWVLQHDUO\GLDJQRVLVDQGVXFFHVVIXOWUHDW PHQW  6RXWK 1DVVDX &RPPXQLWLHV +RVSLWDO ZLOO KROG D )UHH +HDG DQG 1HFN &DQFHU 6FUHHQLQJ 'D\ )ULGD\ 0D\   DP SP LQ WKH KRVSLWDO·V &RQIHUHQFH &HQWHU$ 6FUHHQLQJV ZLOO EH FRQGXFWHG E\ 5DMLY 'DWWD 0' PHGLFDO GLUHFWRU RI WKH &DQFHU &HQWHU DQG FKDLUPDQ RI WKH 'HSDUWPHQW RI 6XUJHU\ /RXLV5RVQHU0'FKLHIRIRWRUKLQRODU\QJROR J\ HDU QRVH DQG WKURDW  DQG 9LQFHQW 5HLG 0'VXUJLFDORQFRORJLVW  5LVN IDFWRUV IRU KHDG DQG QHFN FDQFHUV LQFOXGHKDELWXDOVPRNLQJRUXVHRIVPRNHOHVV WREDFFR IUHTXHQW DOFRKRO FRQVXPSWLRQ RU H[FHVVLYHH[SRVXUHWRWKHVXQ7XPRUVPRVW RIWHQRFFXULQWKHQDVDOSDVVDJHVVLQXV HV PRXWK WKURDW ODU\Q[ YRLFH ER[  VZDOORZLQJ SDVVDJHV VDOLYDU\ JODQGV DQG WKH

WK\URLG JODQG7KHLU V\PSWRPV LQFOXGH SHUVLV WHQW VRUHV LQ WKH PRXWK D OXPSRUVRUHLQWKH PRXWKWKDWGRHVQRWKHDODOXPSLQWKHQHFND FKURQLF VRUH WKURDW GLIILFXOW\ VZDOORZLQJ DQG D FKDQJHRUKRDUVHQHVVLQWKHYRLFH  )RU PRUH LQIRUPDWLRQ FDOO 6RXWK 1DVVDX·V 2QFRORJ\3URJUDPDW,QIRUPDWLRQ PD\ DOVR EH REWDLQHG E\ VHQGLQJ DQ HPDLO WR RQFRORJ\#VQFKRUJ

'LDEHWLF

GLDJQRVLV RI GLDEHWLF H\H GLVHDVH LV PDGH E\ H[DPLQDWLRQDQGPD\UHTXLUHSKRWRJUDSKVIOX RUHVFHLQ DQJLRJUDSK\ DQGRU 2&7 WR GHWHFW GLDEHWLFUHWLQRSDWK\ 7KHUHDUHQHZDGYDQFHVIRUWUHDWLQJGLDEHW LFUHWLQRSDWK\LQFOXGLQJODVHUWHFKQLTXHVPHG LFDWLRQ LQMHFWLRQV RU HYHQ VXUJHU\ IRU VHYHUH FDVHV %OLQGQHVV GXH WR GLDEHWLF H\H GLVHDVH FDQ EH SUHYHQWDEOH 6WUDWHJLHV IRU SUHYHQWLQJ GLDEHWLF UHWLQRSDWK\ LQFOXGH FRQWURO RI EORRG VXJDU DQG EORRG SUHVVXUH DYRLGLQJ VPRNLQJ HDUO\GHWHFWLRQDQGHDUO\WUHDWPHQWDVZHOODV PDLQWDLQLQJUHJXODUO\VFKHGXOHGYLVLWV 'U 6WURK LV D UHWLQD VSHFLDOLVW LQ 5RFNYLOOH &HQWUHZKRVSHFLDOL]HVLQ'LDEHWHVDQG5HWLQDO 'LVRUGHUV+HKDVSXEOLVKHGQXPHURXVDUWLFOHV DQG IUHTXHQWO\ OHFWXUHV DW QDWLRQDO PHHWLQJV 'U6WURKLVDPHPEHURIPDQ\RUJDQL]DWLRQV LQFOXGLQJ 7KH $PHULFDQ $FDGHP\ RI 2SKWKDOPROR J\ 9LWUHRXV 6RFLHW\ DQG $VVRFLDWLRQ IRU UHVHDUFK LQ 9LVLRQ DQG 2SKWKDOPRORJ\ +HFDQEHUHDFKHGDW  IRU DSSRLQW PHQWV FRQVXOWDWLRQV DQG VHFRQGRSLQLRQV

$SSUR[LPDWHO\  PLOOLRQ$PHULFDQV KDYH GLDEHWHVPHOOLWXVEXWPDQ\GRQ·WNQRZWKH\DUH DIIHFWHG'LDEHWHVLVRQHRIWKHOHDGLQJFDXVHVRI EOLQGQHVVDPRQJ$PHULFDQV0DQ\SDWLHQWVZLWK GLDEHWLFH\HSUREOHPVKDYHQRV\PSWRPVEXWLI OHIWXQWUHDWHGGLDEHWHVFDQOHDGWRVHULRXVYLVXDO ORVVH[SODLQV'U(GZDUG6WURK 0DQ\ GLDEHWLFV QRWLFH EOXUUHG YLVLRQ ZKHQ WKHLUEORRGVXJDUIOXFWXDWHVHLWKHUKLJKRUORZ 'LDEHWHV FDQ DOVR GDPDJH WKH VPDOO EORRG YHVVHOVWKURXJKRXWWKHUHWLQDUHVXOWLQJLQODFN RI R[\JHQ WR WKH UHWLQD 7KH GDPDJHG EORRG YHVVHOVOHDNSURGXFLQJIOXLGLQWKHUHWLQD7KH

South Nassau Communities Hospital, Oceanside 516-632-3350

The Place For Caring

Dr. Edward Stroh Retina Consultants of Long Island 165 N. Village Ave., Suite 203, Rockville Centre 516-536-9525

All material in To Your Health is contributed by advertisers.

Specialized Services â&#x20AC;¢ Short Term Rehabilitation â&#x20AC;&#x201D; Physical, Occupational and Speech Therapies â&#x20AC;¢ Certified Ventilator Unit â&#x20AC;¢ Hemodialysis â&#x20AC;&#x201D; In-Patient and Out-Patient â&#x20AC;¢ Amputation Recovery Program â&#x20AC;¢ IV Therapy â&#x20AC;&#x201D; Hydration, Nutrition and Medication Administration â&#x20AC;¢Wound Management â&#x20AC;¢ Alzheimerâ&#x20AC;&#x2122;s Disease/Dementia Care â&#x20AC;¢ Social Work/Discharge Planning â&#x20AC;¢ Long Term Care â&#x20AC;¢ Hospice Care â&#x20AC;¢ Glatt Kosher â&#x20AC;¢ Daily Minyan

E-mail: woodmererehab@aol.com Website: www.woodmererehab.com Most Insurances Accepted.

121 Franklin Place Woodmere, NY 11598 For exceptional care, call (516) 374-9300

(\H'LVHDVH

WOODMERE REHABILITATION & HEALTH CARE CENTER


Catherine Zeta-Jones’ brave step forward

17

Catherine Zeta-Jones’ brave public acknowledgement of her mental health problems, including appearing on the cover of People Magazine, invited people all over the world to identify with her problem and recognize they or their loved ones are not alone if they are suffering with emotional problems. “This is a disorder that affects millions of people and I am one of them” and “if my revelation of having bipolar II has encouraged just one person to seek help, then it is worth it.” Her announcement is a landmark in public health awareness. That someone as beautiful and successful as Katherine ZetaJones can struggle with a serious mental health issue and feel comfortable enough to share it with the world will certainly motivate others to CATHERINE emulate her ZETA-JONES strength and intelligence, “there’s no need to suffer silently and there is no shame in seeking help.” Very fortunately, because of people in the limelight who share their struggles, the stigma once attached to seeking therapy has greatly diminished. No doubt, if your throat hurts, you break a bone, suffer any aches and pains or show signs of illness that require medical attention, you’re on it. You make an appointment with your doctor, get a diagnosis, and ultimately fill the prescription that will heal you. The responsible adult takes great pains to stay healthy by eating well, exercising, taking supplements and recommended medications and making sure to have a complete physical every year. But, taking care of your emotional health is often last on your list, until like Catherine Zeta-Jones, you realize you have no choice. Neither fame, wealth, nor talent immunizes anyone against the vicissitudes of physical and mental illness. Issues that can stop you in your tracks and prohibit everyday function as a parent, a partner or on the job include panic attacks, depression, unemployment, marital discord, eating disorders, coping with aging, dealing with troubled children or other family members, addictions, abuse, bereavement or anything that gets in the way of your emotional health and happiness. However, many people resist seeking help. If you have a weak heart, you control your diet, exercise more, take prescribed medication and follow doctor’s orders. If you have a broken heart, there’s more to it.

professional can make all the difference. A huge burden is lifted when you have a structured plan of advice to follow, someone to guide you, and evidence that when utilizing the many tools available, things will work out. A better life starts with you.

Sometimes, making that first call and finding the right resource is the most difficult. We race to heal our bodies why do we hesitate to heal our minds? One out of five families living on Long Island is affected by mental health or substance abuse issues. Talking with a skilled

John Kastan, Ph.D., is executive director of Peninsula Counseling Center, a non-profit community mental health center in Valley Stream, licensed by the New York State Office of Mental Health and Alcoholism and Substance Abuse. Audrey Goodman is community relations coordinator.

“I use the latest techniques to fight cancer in the operating room … and answer every question a patient may have before we get here.” Dr. Datta is a board-certified, fellowship-trained cancer surgeon who’s known for his skills in the operating room and for taking the time to sit with a patient while providing support before and after surgery. A specialist in tumors of the head and neck, breast, endocrine system, colon and soft tissue as well as melanoma, he’s also a Castle Connolly top doctor, so you can be confident you’re getting quality, compassionate care every step of the way.

Rajiv Datta, MD, FACS, FRCS, FICS Chair, Department of Surgery Medical Director, South Nassau’s Cancer Center Director, Surgical Oncology/Head & Neck Castle Connolly “Top Doctor” since 2006

To schedule an appointment with Dr. Datta, call 516.632.3350 or visit www.southnassau.org for more information.

SOUTH NASSAU COMMUNITIES HOSPITAL

|

ONE HEALTHY WAY, OCEANSIDE, NY 11572

|

877-SOUTH-NASSAU

|

WWW.SOUTHNASSAU.ORG 467687

By JOHN KASTAN, Ph.D & AUDREY GOODMAN

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

Overcoming the stigma of dealing with emotional issues


The mind-body connection Improve your emotional health for a more well-balanced life

People who are emotionally healthy are in control of their emotions and their behavior. They are able to handle life’s inevitable challenges, build strong relationships, and lead productive, fulfilling lives. When bad things happen, they’re able to bounce back and move on. Unfortunately, too many people take their mental and emotional health for granted – focusing on it only when they develop problems. But just as it requires effort to build or maintain physical health, so it is with mental and emotional health. The more time and energy you invest in your emotional health, the stronger it will be. The good news is that there are many things you can do to boost your mood, build resilience, and get more enjoyment out of life. Mental or emotional health refers to your overall psychological well-being. It includes

the way you feel about yourself, the quality of your relationships, and your ability to manage your feelings and deal with difficulties. Good mental health isn’t just the absence of mental health problems. Being mentally or emotionally healthy is much more than being free of depression, anxiety, or other psychological issues. Rather than the absence of mental illness, mental and emotional health refers to the presence of positive characteristics. Similarly, not feeling bad is not the same as feeling good. While some people may not have negative feelings, they still need to do things that make them feel positive in order to achieve mental and emotional health. People who are mentally and emotionally healthy have: ■ A sense of contentment. ■ A zest for living and the ability to laugh

GRAND OPENING! Bellmore Village Chiropractic & Wellness “Life Is Better When You’re Well Adjusted” Dr. Dana Weissman Timmins Dr. Dana utilizes gentle and effective techniques to treat the following conditions, as well as many more:

• Low Back Pain • Neck Pain • Headaches • Fibromyalgia • Arthritis

• Carpal Tunnel • Sciatica • TMJ • Scoliosis

• Hip, Shoulder and Knee Pain • Allergies • Asthma

• Boost Your Immune System Naturally • Decrease Stress • Maximize Your Child’s Health the Drug-Free, Natural Way • No-Fault Auto Accidents & Workers’ Compensation Accepted

Call (516) 809-9191 today for a FREE consultation! Please visit our website for more information.

Mention this ad for a free sample of BIOFREEZE, a natural, pain relieving topical gel!

and have fun. ■ The ability to deal with stress and bounce back from adversity. ■ A sense of meaning and purpose, in both their activities and their relationships. ■ The flexibility to learn new things and adapt to change. ■ A balance between work and play, rest and activity, etc. ■ The ability to build and maintain fulfilling relationships. ■ Self-confidence and high self-esteem. These positive characteristics of mental and emotional health allow you to participate in life to the fullest extent possible through productive, meaningful activities and strong relationships. These positive characteristics also help you cope when faced with life’s challenges and stresses.

The role of resilience in mental and emotional health

Located in the Heart of Bellmore Village

Chiropractic Care Family Wellness Pediatrics & Maternity Care Sports Injuries Nutritional Counseling Rehabilitative Exercise & Ergonomic Counseling Massage Therapy Custom Molded Orthotics Electrical Muscle Stimulation and Ultrasound Therapies JuicePlus+ Supplements

110 Bedford Avenue • Bellmore, NY 11710 (516) 809-9191 website: www.bellmorechiropractic.com e-mail: drdana@bellmorechiropractic.com

468467

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

18

Being emotionally and mentally healthy doesn’t mean never going through bad times or experiencing emotional problems. We all go through disappointments, loss, and change. And while these are normal parts of life, they can still cause sadness, anxiety, and stress. The difference is that people with good emotional health have an ability to bounce back from adversity, trauma, and stress. This ability is called resilience. People who are emotionally and mentally healthy have the tools for coping with difficult situations and maintaining a positive outlook. They remain focused, flexible, and creative in bad times as well as good. One of the key factors in resilience is the ability to balance your emotions. The capacity to recognize your emotions and express them appropriately helps you avoid getting stuck in depression, anxiety, or other negative mood states. Another key factor is having a strong support network. Having trusted people you can turn to for encouragement and support will boost your resilience in tough times. Resilience involves maintaining flexibility and balance in your life as you deal with stressful circumstances and traumatic events. This happens in several ways, according to the American Psychological Association, including: ■ Letting yourself experience strong emotions, and also realizing when you may need to avoid experiencing them at times in order to continue functioning.

■ Stepping forward and taking action to deal with your problems and meet the demands of daily living, and also stepping back to rest and reenergize yourself. ■ Spending time with loved ones to gain support and encouragement, and also nurturing yourself. ■ Relying on others, and also relying on yourself.

Physical health is connected to mental and emotional health

Taking care of your body is a powerful first step towards mental and emotional health. The mind and the body are linked. When you improve your physical health, you’ll automatically experience greater mental and emotional well-being. For example, exercise not only strengthens our heart and lungs, but also releases endorphins, powerful chemicals that energize us and lift our mood. The activities you engage in and the daily choices you make affect the way you feel physically and emotionally. Get enough rest. To have good mental and emotional health, it’s important to take care of your body. That includes getting enough sleep. Most people need seven to eight hours of sleep each night in order to function optimally. Learn about good nutrition and practice it. The subject of nutrition is complicated and not always easy to put into practice. But the more you learn about what you eat and how it affects your energy and mood, the better you can feel. Exercise to relieve stress and lift your mood. Exercise is a powerful antidote to stress, anxiety, and depression. Look for small ways to add activity to your day, like taking the stairs instead of the elevator or going on a short walk. To get the most mental health benefits, aim for 30 minutes or more of exercise per day. Sunlight lifts your mood, so try to get at least 10 to 15 minutes of sun per day. This can be done while exercising, gardening, or socializing. Limit alcohol and avoid cigarettes and other drugs. These are stimulants that may unnaturally make you feel good in the short term, but have long-term negative consequences for mood and emotional health. © Helpguide.org 2001-2010. All rights reserved.


19

OCLIâ&#x20AC;&#x2122;s Dr. Eric Donnenfeld brings new procedure to L.I.

to your health

DR. ERIC DONNENFELD PERFORMED the first case on Long Island using the new laser for customized refractive cataract surgery. In addition, the LenSx laser adds computer-control to key steps of cataract surgery, ensuring highly precise surgical incisions. The unique software analyzes high-resolution images of the eye which then enables the surgeon to design a cus-

Health news prepared by HERALD advertisers

%ULVWDO$VVLVWHG/LYLQJ2IIHUV 7LSV)RU2OGHU$GXOWV7R6SULQJ,QWR6KDSH  :KLOHPDQ\ROGHUSHRSOHWHQGWRVORZGRZQ LQ ZLQWHU$ODQ 3DUNHU ([HFXWLYH 'LUHFWRU RI WKH %ULVWDO$VVLVWHG /LYLQJ &RPPXQLW\ LQ /\QEURRN VD\VWKDWNHHSLQJDFWLYHDOO\HDULVDNH\WRJRRG KHDOWK 3DUNHU RIIHUV VRPH VLPSOH WLSV WR WDNH DGYDQWDJHRIVSULQJDV\RXJHWEDFNLQWRVKDSH â&#x2013; :DONDWWKHPDOO&OLPDWHFRQWURODQGHYHQ VXUIDFHVPDNHPDOOZDONLQJDJUHDWZD\WRVWD\ LQVKDSH â&#x2013;  7DNHWKHVWDLUV6WDLUFOLPELQJH[HUFLVHVWKH VDPHPXVFOHVQHFHVVDU\IRUNHHSLQJ\RXUEDO DQFHZKLOHULVLQJIURPDFKDLUVRLWLVLPSRUWDQWWR NHHSWKHVHPXVFOHVVWURQJ â&#x2013; /LWWOHFKDQJHVWKDWDGGXS3DUNIDUWKHU DZD\ IURP D VWRUH HQWUDQFH ZDONLQJ WKH H[WUD GLVWDQFH  ZLOO SURYLGH FDUGLRYDVFXODU H[HUFLVH   3DUNHUDOVRDGYLVHVWKDWVHQLRUVZDUP XS EHIRUH DQG FRRO GRZQ DQG VWUHWFK DIWHUDQ\H[HUFLVHDFWLYLW\WRORZHUULVN IRULQMXU\GULQNZDWHUWRVWD\K\GUDWHG DQGVHWDQH[HUFLVHJRDORIKRXUV HDFKZHHNRIPRGHUDWHWRYLJRURXV DFWLYLW\ IRU FDUGLRYDVFXODU ILWQHVV DQGVWUHQJWKHQLQJH[HUFLVH   5IF#SJTUBM"TTJTUFE-JWJOHDPNNV OJUJFT IBT GBDJMJUJFT JO &BTU .FBEPX  &BTU /PSUIQPSU  -ZOCSPPL  /PSUI )JMMT  /PSUI 8PPENFSF  8FTUCVSZ BOE .BTTBQFRVB 'PS JOGPSNBUJPO PO

tomized, image-guided procedure for every patient and then execute the laser procedure on command. â&#x20AC;&#x153;Laser refractive cataract surgery is without a doubt the most technologically advanced option for cataract patients,â&#x20AC;? said Dr. Donnenfeld. â&#x20AC;&#x153;Before this technology was available, many of the most challenging steps during cataract surgery were performed manually with a blade. With the LenSx laser, we can offer our patients a truly premium experience with the precision and reliability of a laser for refractive cataract surgery. â&#x20AC;&#x153;Island Eye has invested significant resources integrating this sophisticated technology and in training our staffâ&#x20AC;? said Robert Nelson, PA-C, Executive Director at the center. â&#x20AC;&#x153;We are thrilled to once again bring our patients the absolute latest innovations in ophthalmic surgical care.â&#x20AC;? The LenSx laser is the first FDA approved femtosecond laser for cataract surgery, which can very accurately perform anterior capsulotomies, corneal incisions and lens disruption. Prior to the introduction of this breakthrough technology, all of these steps were performed manually with handheld blades or ultrasound energy.

5IF #SJTUBM "TTJTUFE -JWJOH $PNNVOJUJFT  WJTJUXXXUIFCSJTUBMDPN The Bristal Assisted Living Communities 631-580-6420

To learn more about customized laser cataract surgery and refractive surgical options using the LenSx laser technology, visit www.ocli.net. To schedule an appointment with Dr. Eric Donnenfeld or another OCLI cataract surgeon, please contact 1-866-SEEOCLI (1-866-733-6254). For more information about Island Eye Surgicenter, call 516-877-2400.

Do You Need A

Health Coach? A Doctor Who Will: â&#x20AC;˘ Make Lifestyle Recommendations To Im prove Your Health â&#x20AC;˘ Make Specific Diet & Supplement Recommendations To Treat Conditions â&#x20AC;˘ Provide Personalized Exercise Perscription That Will Translate To Better Health â&#x20AC;˘ Coordinate Your Diet & Exercise Plan For Maximal Weight Loss & Improved Body Composition

Go With A Pro! Dr. Richard Seibert

1991 Merrick Avenue â&#x20AC;˘ Merrick, NY 11566 516-867-8585 â&#x20AC;˘ www.seibertdc.com

As seen in Newsday

An important advancement in cataract surgery is welcome news to the many people in the area who suffer from cataracts. Long Islandâ&#x20AC;&#x2122;s first laser enhanced and customized cataract surgery was performed by Dr. Eric Donnenfeld at Island Eye Surgicenter in Carle Place on April 19, using the Alcon LenSxÂŽ Femtosecond Laser. Dr. Donnenfeld, a founding partner of Ophthalmic Consultants of Long Island (OCLI) and clinical professor of ophthalmology at NYU, is one of only a handful of surgeons in the U.S. experienced with this laser. Island Eye Surgicenter is only the fourth surgical facility in the US to acquire this advanced technology. Cataract surgery is the most commonly performed operation in the United States with over 3 million cases performed annually. Today, visual rehabilitation following cataract surgery may be significantly enhanced with the implantation of a lens designed to correct refractive error. The addition of this exciting laser technology adds a new level of precision and predictability to the procedure that simply was not possible with conventional manual surgery. Each human eye is different in terms of size, depth, curvature of the cornea and other key features. Before cataract surgery, every eye is carefully measured and mapped. The LenSx laser uses a combination of highly advanced technologies to capture incredibly precise, high-resolution digital images of the eye. These images and the measurements and data they provide are then used to plan and perform a surgery to exacting specifications that were previously unachievable with traditional (manual) cataract surgery.

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

Advanced laser surgery helps cataract patients


to your health

'R<RX1HHG$

Health news prepared by HERALD advertisers

+HDOWK&RDFK"

)UHH6FUHHQLQJ)RU+HDG$QG1HFN&DQFHUV$W

6RXWK1DVVDX&RPPXQLWLHV+RVSLWDO

 7KLV\HDUDORQHQHDUO\RIWKH $PHULFDQVGLDJQRVHGZLWKDKHDGRUQHFNFDQ FHU ZLOO GLH )RUWXQDWHO\ LI KHDG RU QHFN FDQ FHUVDUHGHWHFWHGLQWKHHDUO\VWDJHVWKH\DUH KLJKO\WUHDWDEOHDQGWKHFXUHUDWHLVJRRG  $FFRUGLQJ WR WKH 3UHYHQWLRQ &RPPLWWHH RI WKH $PHULFDQ +HDG DQG 1HFN 6RFLHW\ DQ DQQXDO VFUHHQLQJ IRU KHDG DQG QHFN FDQFHUV DVVLVWVLQHDUO\GLDJQRVLVDQGVXFFHVVIXOWUHDW PHQW  6RXWK 1DVVDX &RPPXQLWLHV +RVSLWDO ZLOO KROG D )UHH +HDG DQG 1HFN &DQFHU 6FUHHQLQJ'D\)ULGD\0D\DPSP LQ WKH KRVSLWDO·V &RQIHUHQFH &HQWHU $ 6FUHHQLQJV ZLOO EH FRQGXFWHG E\ 5DMLY 'DWWD 0' PHGLFDO GLUHFWRU RI WKH &DQFHU &HQWHU DQG FKDLUPDQ RI WKH 'HSDUWPHQW RI 6XUJHU\ /RXLV5RVQHU0'FKLHIRIRWRUKLQRODU\QJROR J\ HDU QRVH DQG WKURDW  DQG 9LQFHQW 5HLG 0'VXUJLFDORQFRORJLVW  5LVN IDFWRUV IRU KHDG DQG QHFN FDQFHUV LQFOXGHKDELWXDOVPRNLQJRUXVHRIVPRNHOHVV WREDFFR IUHTXHQW DOFRKRO FRQVXPSWLRQ RU H[FHVVLYHH[SRVXUHWRWKHVXQ7XPRUVPRVW RIWHQ RFFXU LQ WKH QDVDO SDVVDJHV VLQXVHV PRXWK WKURDW ODU\Q[ YRLFH ER[  VZDOORZLQJ SDV

VDJHVVDOLYDU\JODQGVDQGWKHWK\URLGJODQG  7KHLUV\PSWRPVLQFOXGHSHUVLVWHQWVRUHVLQ WKH PRXWK D OXPS RU VRUH LQ WKH PRXWK WKDW GRHVQRWKHDODOXPSLQWKHQHFNDFKURQLFVRUH WKURDW GLIILFXOW\ VZDOORZLQJ DQG D FKDQJH RU KRDUVHQHVVLQWKHYRLFH  )RU PRUH LQIRUPDWLRQ FDOO 6RXWK 1DVVDX·V 2QFRORJ\3URJUDPDW,QIRUPDWLRQ PD\ DOVR EH REWDLQHG E\ VHQGLQJ DQ HPDLO WR RQFRORJ\#VQFKRUJ South Nassau Communities Hospital, Oceanside 516-632-3350

'R \RX ZDQW WR JHW LQ EHWWHU VKDSH" 'R \RX ZDQW WR NQRZ KRZ WR GLHW DQG H[HUFLVH" $UH\RXXQVXUHZKRWRDVN" 3HUKDSV \RXU SULPDU\ FDUH SURYLGHU GRHV QRW KDYH WKH WLPH WR DQVZHU \RXU TXHVWLRQV DERXW GLHW DQGRU H[HUFLVH 0D\EH \RXU SHU VRQDOWUDLQHUGRHVQ·WKDYHHQRXJKNQRZOHGJH RI LQMXULHV DQG UHKDELOLWDWLRQ <RXU QXWULWLRQLVW PD\QRWKDYHNQRZOHGJHRIH[HUFLVHURXWLQHV WKDWZRXOGZRUNZHOOZLWK\RXUGLHWSODQ :K\ QRW UROO DOO WKHVH SURIHVVLRQDOV LQWR RQH"$WUXH«+($/7+&2$&+ 'U 5LFKDUG 6HLEHUW RIIHUV WKHVH TXDOLWLHV +HLVDOLIHORQJFRPSHWLWLYH2O\PSLFZHLJKWOLIW HU ZLWK VL[ QDWLRQDO WLWOHV DQG H[SHULHQFH RQ IRXULQWHUQDWLRQDOWHDPV+HKROGVDGRFWRUDWH GHJUHH LQ FKLURSUDFWLF PHGLFLQH DV ZHOO DV SRVWJUDGXDWH FHUWLILFDWHV LQ VSRUWV LQMXULHV DQGQXWULWLRQ 'U 6HLEHUW XVHV DGYDQFHG GLDJQRVWLF LPDJLQJ LQFOXGLQJ [UD\ &7 DQG 05, DORQJ ZLWKODEGLDJQRVWLFZRUNVXFKDVEORRGZRUNWR YHULI\ WKDW \RXU GLHW DQG H[HUFLVH SURJUDP LV REWDLQLQJWKHGHVLUHGUHVXOWV ORZHUHGFKROHV WHURO DQG WULJO\FHULGHV DV ZHOO DV LPSURYHG JOXFRVHOHYHOV  +DYLQJ WDXJKW FOLQLFDO QXWULWLRQ DW WKH FRO OHJH OHYHO IRU  \HDUV 'U 6HLEHUW LV NQRZO HGJHDEOHDERXWFKDQJHVLQQXWULWLRQDOHYDOXD WLRQWKDWLVLQWHJUDWHGLQWRDSODQZLWKSUHVFULS

3XW$/LWWOH´6SULQJµ

,Q<RXU6WHS

 $V WKLV VSULQJ ZHDWKHU FRQWLQXHV WR VXU SULVHXVVLPSOHWDVNVVXFKDVEHQGLQJOLIWLQJ DQGHYHQZDONLQJEHFRPHGLIILFXOWDQGSDLQIXO +RZHYHU GLG \RX NQRZ WKDW WKH UDLQ LWVHOI FRXOG EH RQH RI WKH FDXVHV RI \RXUEDFNSDLQ"  :KHQUDLQVWDUWVWRIDOOWKH DLU SUHVVXUH DURXQG XV ORZHUV7KH GHFUHDVHG SUHVVXUH VZHOOV RXU MRLQWV DQG WKH WLV VXHV DURXQG WKH MRLQWV EDFN QHFN VKRXOGHU NQHH HWF  LQVWDQWO\ EHFRPH LUULWDW H G   <R X Q J SDWLHQWVQHHG WRWDFNOHWKH L V V X H EHIRUH LW EHFRPHV D ODUJHU SURE O H P  DQG

Excitin Low Pricge !

$2,195

based on a 30 day mon th

but our selection was clear.

OUR DECISION WASNâ&#x20AC;&#x2122;T EASY....

WE WENT WITH THE BEST - THE BRISTAL. When you visit

The Bristal â&#x20AC;&#x201C; no other community compares. Itâ&#x20AC;&#x2122;s more than luxury living &

dining. More than delightful activities. Itâ&#x20AC;&#x2122;s devoted attention, a sterling staff and simply outstanding care. Wrestling with your decision? Call to schedule your tour today! Ask about our Veterans Program!

WLRQ H[HUFLVH H[HUFLVH JHDUHG WR FKDQJLQJ ERG\FRPSRVLWLRQDQGLPSURYLQJKHDOWK  )RU PRUH LQIRUPDWLRQ FDOO  RUYLVLWZZZVHLEHUWGFFRP  Dr. Richard Seibert 1991 Merrick Ave., Merrick 516-867-8585

ROGHUSDWLHQWVQHHGWRXWLOL]HFKLURSUDFWLFWUHDW PHQWVWRUHSDLUWKHLUSDLQ  2QFHDQ\W\SHRIWUDXPDVWULNHVRXUMRLQWV GHWHULRUDWLRQEHJLQV7KLVFDQEHGXHWRDFFL GHQWV VSRUWV LQMXULHV RU HYHQ WHQVLRQ IURP FDUU\LQJ \RXQJ FKLOGUHQ 7KH LUULWDWLRQ DW WKH MRLQWVOHDGVWRLQIODPPDWLRQDQGHYHQWXDOVFDU WLVVXH WKDW OLPLWV MRLQW PRWLRQ DQG FDQ FDXVH FKURQLFSDLQDQGVWLIIQHVV  0DQ\ SHRSOH EHJLQ FKLURSUDFWLF FDUH EHFDXVH RI DQ DFKH RU D SDLQ 3DLQ FDQ EH GLVWUDFWLQJ GHELOLWDWLQJ LUULWDWLQJ RU DQQR\LQJ 3DLQFDQEHVKDUSRUGXOO3DLQPD\EHDSDLQ EXW SDLQ LV QRW WKH SUREOHP 3DLQ LV D V\PS WRPDZDUQLQJVLJQWKDWVRPHWKLQJLVZURQJ ,QVWHDG RI OHWWLQJ WKH UDLQ VWRS \RX IURP JHW WLQJ WUHDWPHQW WKLQN RI LW DV D VLJQ WKDW LW LV WLPHWRPDNHDQDSSRLQWPHQW6SULQJLVKHUH DQGWKLVWHQGVWREHDWLPHWKDWZHFRPHRXW RIKLEHUQDWLRQDQGEHJLQRXURXWGRRUDFWLYL WLHV VXFK DV UXQQLQJ RU ZDONLQJ SOD\LQJ VSRUWVDQGJDUGHQLQJ5HJXODUFKLURSUDF WLF WUHDWPHQWV LQFUHDVH MRLQW IOH[LELOLW\ DQG GHFUHDVHSDLQ6RSXWDOLWWOHVSULQJLQ\RXU VWHS DQG VFKHGXOH DQ DSSRLQWPHQW WR WDNH DGYDQWDJHRIRXUQDWXUDOJHQWOHSDLQUHOLHY LQJWUHDWPHQWPHWKRGV:HRIIHUFKLURSUDF WLFFDUHIRUWKHZKROHIDPLO\PDVVDJHWKHU DS\ DFXSXQFWXUH QXWULWLRQDO FRXQVHOLQJ DQGUHKDELOLWDWLYHH[HUFLVHV Dr. Dana Weissman Timmins Bellmore Village Chiropractic & Wellness 110 Bedford Ave., Bellmore 516-809-9191 or www.bellmorechiropractic.com

NORTH WOODMERE 477 HUNGRY HARBOR RD 516.336.2600

LYNBROOK Care Beyond Compare

blog.thebristal.com

8 FREER STREET 516.593.2424

thebristal.com

find us on

facebook

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

20

LICENSED BY THE NYS DEPT OF HEALTH. ELIGIBLE FOR MOST LONG TERM CARE POLICIES.

8<(30;@*644<50;0,:)@;/,,5.,3)<94(5.96<7

All material in To Your Health is contributed by advertisers.


Catherine Zeta-Jones’ brave step forward

17

Catherine Zeta-Jones’ brave public acknowledgement of her mental health problems, including appearing on the cover of People Magazine, invited people all over the world to identify with her problem and recognize they or their loved ones are not alone if they are suffering with emotional problems. “This is a disorder that affects millions of people and I am one of them” and “if my revelation of having bipolar II has encouraged just one person to seek help, then it is worth it.” Her announcement is a landmark in public health awareness. That someone as beautiful and successful as Katherine ZetaJones can struggle with a serious mental health issue and feel comfortable enough to share it with the world will certainly motivate others to CATHERINE emulate her ZETA-JONES strength and intelligence, “there’s no need to suffer silently and there is no shame in seeking help.” Very fortunately, because of people in the limelight who share their struggles, the stigma once attached to seeking therapy has greatly diminished. No doubt, if your throat hurts, you break a bone, suffer any aches and pains or show signs of illness that require medical attention, you’re on it. You make an appointment with your doctor, get a diagnosis, and ultimately fill the prescription that will heal you. The responsible adult takes great pains to stay healthy by eating well, exercising, taking supplements and recommended medications and making sure to have a complete physical every year. But, taking care of your emotional health is often last on your list, until like Catherine Zeta-Jones, you realize you have no choice. Neither fame, wealth, nor talent immunizes anyone against the vicissitudes of physical and mental illness. Issues that can stop you in your tracks and prohibit everyday function as a parent, a partner or on the job include panic attacks, depression, unemployment, marital discord, eating disorders, coping with aging, dealing with troubled children or other family members, addictions, abuse, bereavement or anything that gets in the way of your emotional health and happiness. However, many people resist seeking help. If you have a weak heart, you control your diet, exercise more, take prescribed medication and follow doctor’s orders. If you have a broken heart, there’s more to it.

professional can make all the difference. A huge burden is lifted when you have a structured plan of advice to follow, someone to guide you, and evidence that when utilizing the many tools available, things will work out. A better life starts with you.

Sometimes, making that first call and finding the right resource is the most difficult. We race to heal our bodies why do we hesitate to heal our minds? One out of five families living on Long Island is affected by mental health or substance abuse issues. Talking with a skilled

John Kastan, Ph.D., is executive director of Peninsula Counseling Center, a non-profit community mental health center in Valley Stream, licensed by the New York State Office of Mental Health and Alcoholism and Substance Abuse. Audrey Goodman is community relations coordinator.

“I use the latest techniques to fight cancer in the operating room … and answer every question a patient may have before we get here.” Dr. Datta is a board-certified, fellowship-trained cancer surgeon who’s known for his skills in the operating room and for taking the time to sit with a patient while providing support before and after surgery. A specialist in tumors of the head and neck, breast, endocrine system, colon and soft tissue as well as melanoma, he’s also a Castle Connolly top doctor, so you can be confident you’re getting quality, compassionate care every step of the way.

Rajiv Datta, MD, FACS, FRCS, FICS Chair, Department of Surgery Medical Director, South Nassau’s Cancer Center Director, Surgical Oncology/Head & Neck Castle Connolly “Top Doctor” since 2006

To schedule an appointment with Dr. Datta, call 516.632.3350 or visit www.southnassau.org for more information.

SOUTH NASSAU COMMUNITIES HOSPITAL

|

ONE HEALTHY WAY, OCEANSIDE, NY 11572

|

877-SOUTH-NASSAU

|

WWW.SOUTHNASSAU.ORG 467687

By JOHN KASTAN, Ph.D & AUDREY GOODMAN

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

Overcoming the stigma of dealing with emotional issues


Advanced laser surgery helps cataract patients OCLIâ&#x20AC;&#x2122;s Dr. Eric Donnenfeld brings new procedure to L.I. An important advancement in cataract surgery is welcome news to the many people in the area who suffer from cataracts. Long Islandâ&#x20AC;&#x2122;s first laser enhanced and customized cataract surgery was performed by Dr. Eric Donnenfeld at Island Eye Surgicenter in Carle Place on April 19, using the Alcon LenSxÂŽ Femtosecond Laser. Dr. Donnenfeld, a founding partner of Ophthalmic Consultants of Long Island (OCLI) and clinical professor of ophthalmology at NYU, is one of only a handful of surgeons in the U.S. experienced with this laser. Island Eye Surgicenter is only the fourth surgical facility in the US to acquire this advanced technology. Cataract surgery is the most commonly performed operation in the United States with over 3 million cases performed annually. Today, visual rehabilitation following cataract surgery may be significantly enhanced with the implantation of a lens designed to correct refractive error. The addition of this exciting laser technology adds a new level of precision and predictability to the procedure that simply was not possible with conventional manual surgery. Each human eye is different in terms of size, depth, curvature of the cornea and other key features. Before cataract surgery, every eye is carefully measured and mapped. The LenSx laser uses a combination of highly advanced technologies to capture incredibly precise, high-resolution digital images of the eye. These images and the measurements and data they provide are then used to plan and perform a surgery to exacting specifications that were previously unachievable with traditional (manual) cataract surgery.

DR. ERIC DONNENFELD PERFORMED the first case on Long Island using the new laser for customized refractive cataract surgery. In addition, the LenSx laser adds computer-control to key steps of cataract surgery, ensuring highly precise surgical incisions. The unique software analyzes high-resolution images of the eye which then enables the surgeon

1250$16$))5$0')$&6 :28/'/,.(72$11281&(

(;3$1'('/21*,6/$1'2)),&(+2856

'LUHFWRURI2SKWKDOPRORJ\0DLPRQLGHV0HGLFDO&HQWHU &OLQLFDO3URIHVVRURI2SKWKDOPRORJ\ 0W6LQDL6FKRRO2I0HGLFLQH   $OVR$IÂżOLDWHGZLWK

7KH1HZ<RUN(\H (DU,QÂżUPDU\ 1<80HGLFDO&HQWHU/HQR[+LOO+RVSLWDO /,2IÂżFH %D\EHUU\5RDG /DZUHQFH1< 7

%URRNO\Q2IÂżFH WK6W %URRNO\Q1< 7

2IÂżFHKRXUVE\DSSRLQWPHQWRQO\ Both the Long Island and Brooklyn offices participate with the following insurance plans: 0HGLFDUH8QLWHG+HDOWK&DUH2[IRUG$HWQD+HDOWKQHW&LJQD *+,+,3(PEOHP%&%6+HDOWKÂżUVW+HDOWKSOXV(OGHUSODQ

to design a customized, image-guided procedure for every patient and then execute the laser procedure on command. â&#x20AC;&#x153;Laser refractive cataract surgery is without a doubt the most technologically advanced option for cataract patients,â&#x20AC;? said Dr. Donnenfeld. â&#x20AC;&#x153;Before this technology was available, many of the most challenging steps during cataract surgery were performed manually with a blade. With the LenSx laser, we can offer our patients a truly premium experience with the precision and reliability of a laser for refractive cataract surgery. â&#x20AC;&#x153;Island Eye has invested significant resources integrating this sophisticated technology and in training our staffâ&#x20AC;? said Robert Nelson, PA-C, Executive Director at the center. â&#x20AC;&#x153;We are thrilled to once again bring our patients the absolute latest innovations in ophthalmic surgical care.â&#x20AC;? The LenSx laser is the first FDA approved femtosecond laser for cataract surgery, which can very accurately perform anterior capsulotomies, corneal incisions and lens disruption. Prior to the introduction of this breakthrough technology, all of these steps were performed manually with handheld blades or ultrasound energy.

To learn more about customized laser cataract surgery and refractive surgical options using the LenSx laser technology, visit www.ocli.net. To schedule an appointment with Dr. Eric Donnenfeld or another OCLI cataract surgeon, please contact 1-866-SEE-OCLI (1-866-733-6254). For more information about Island Eye Surgicenter, call 516-877-2400.

Norman Saffra, MD, FACS, is one of the nationâ&#x20AC;&#x2122;s leading ophthalmic laser and micro surgeons. Dr. Saffra is known for his expertise in diseases of the Retina and Vitreous such as; diabetic retinopathy, macular degeneration, and retinal tears and detachments. He is also experienced in caring for patients with uveitis and Neuro-Ophthalmic disorders. Dr. Saffra is a Fellow of: The American College of Surgeons and The American Academy of Ophthalmology. He is a member of the American Society of Retina Specialists and the North American Association of Neuro-Ophthalmology. Dr. Saffra frequently lectures in medical schools and to physicians throughout the country. Dr. Saffra is actively involved in clinical and surgical research. He has contributed over 25 scholarly papers to peer review journals and assisted in the design of two different surgical instruments. Under Dr. Saffraâ&#x20AC;&#x2122;s leadership, The Eye Institute at Maimonides is at the forefront of advancing medical science by pursuing research into diseases that cause permanent vision loss. He has been consistently listed in the â&#x20AC;&#x153;Castle Connolly Guide: How to find the Best Doctors (New York Metro area)â&#x20AC;? and has been listed in New York Magazine â&#x20AC;&#x153;Best Doctorsâ&#x20AC;? issue 12 times. He continues to be quoted by all major television networks and newspapers in regards to ophthalmology issues. Dr. Saffra resides in Nassau County with his family, and is looking forward to bringing state of the art retinal care to our area.

467809

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

18


2VWHRDUWKULWLV

Health news prepared by HERALD advertisers

%H'LIIHUHQW

 $UWKULWLVRIWKHNQHHLVDFRPPRQSUREOHP HVSHFLDOO\ LQ SHRSOH  \UV DQG ROGHU ,W FDQ EH D YHU\ SDLQIXO DQG IXQFWLRQDOO\ GLVDEOLQJ FRQGLWLRQ  7KHFDXVHRIWKHDUWKULWLVRIWKHNQHHFDQ EHGLYLGHGLQWRWZRPDMRUJURXSV²LQIODPPD WRU\ DQG QRQLQIODPPDWRU\7KH LQIODPPDWRU\ JURXSLQFOXGHVUKHXPDWRLG$UWKULWLVJRXWDQG SVRULDWLF DUWKULWLV 7KH RWKHU DQG PRUH FRP PRQFDXVHLVGHJHQHUDWLYHRVWHRDUWKULWLV7KLV ´ZHDU DQG WHDU¾ DUWKULWLV RFFXUV DV ZH JURZ ROGHU HVSHFLDOO\ ZLWK D IDPLO\ KLVWRU\ RI RVWHRDUWKULWLV  &RPPRQWUHDWPHQWVUHFRPPHQGHG LQFOXGH 7\OHQRO$GYLO$OHYH DQG RWKHU DQWLLQIODPPDWRU\ GUXJV JLYHQE\\RXUSK\VLFLDQ 3K\VLFDO WKHUDS\ DWWLPHVSUR GXFHV DQ H[FHOOHQW

%H'DULQJ%H'HFLVLYH  $W$XGLRORJ\RI1DVVDX&RXQW\ZHYDOXHWKH FRPSUHKHQVLYH VHUYLFHV ZH RIIHU RXU SDWLHQWV %XW LQ WKLV GLIILFXOW HFRQRPLF FOLPDWH VRPH SDWLHQWVQHHGWRKDYHPRUHIOH[LELOLW\LQIDFWRULQJ LQWKHFRVWVIRUJUHDWVHUYLFHFRXQVHOLQJDQGIRO ORZXSV :H QRZ RIIHU IRXU RSWLRQV LQ KHDULQJ WHFKQRORJ\DQGIRXURSWLRQVLQKHDULQJDLGVHU YLFHDQGVRWKHFKRLFHVEHFRPHPRUH SDWLHQWGULYHQ2XUXQLTXHGHOLYHU\V\V WHP VLJQLILFDQWO\ DIIHFWV WKH FRVW RI KHDULQJDLGV  2XUQHZ$VVXUDQFH3URJUDPLV GHVLJQHG WR HQVXUH LQFRPSDUDEOH QHZ KHDULQJ DLG WHFKQRORJ\ DQG DIIRUGDEOH KHDULQJ VHUYLFH ZKLOH FRQWLQXLQJ RXU WUDGHPDUN ´JHQWOH FRPSDVVLRQDWH DQG XQKXUULHG FDUH¾ ZLWK D UHVSHFW IRU ILQDQFLDO FRQFHUQV :KHQ SDLULQJ D KHDULQJ DLG ZLWK DQ\ RI RXU IRXU DVVXUDQFH SODQV ZH QRQHWKHOHVV FRQWLQXH WR SURYLGH RXU XQSDUDOOHOHG H[SHULHQFH DQGDWWHQWLRQWRGHWDLO  <RX\RXUIDPLO\RUSHUVRQ DOSK\VLFLDQDUHHQFRXUDJHG WRFDOOIRUIXUWKHUGHWDLOV  2Q -XQH VW DQG QG $XGLRORJ\ RI 1DVVDX ZLOO VSRQVRU DQ RSHQ KRXVH HYHQWWRLQWURGXFHVRPH RI WKH LQGXVWU\¡V ODWHVW KHDULQJ WHFKQRORJ\

WKDWFDQDOVRSDLUZLWKDPRELOHODQGOLQHSKRQH FRPSXWHU,3RGDQGWHOHYLVLRQHWFDQGVWLOOSUR YLGHEHWWHUKHDULQJLQEDFNJURXQGQRLVH  &DOO IRU \RXU SHUVRQDO DSSRLQWPHQW DW  Dr. Barbara L. Rosen, Au.D. 165 North Village Ave. Suite 119, Rockville Centre 516-764-2094

Dr. Sandeep Gupta Long Beach Rheumatology, PC 759 Lincoln Blvd., Long Beach 516-897-3885

Welcome Oceanside Providing nuturing, exceptional rehabilitation & nursing care for over 40 years

SERVICES: â&#x20AC;˘ Short-Term Rehabilitation â&#x20AC;˘ Long-Term Care â&#x20AC;˘ Subacute Care â&#x20AC;˘ Wound Care â&#x20AC;˘ Alzheimerâ&#x20AC;&#x2122;s and Dementia Care â&#x20AC;˘ Hospice â&#x20AC;&#x153;We donâ&#x20AC;&#x2122;t provide cookie-cutter theapy here at Oceanside Care Centerâ&#x20AC;? 2914 Lincoln Avenue Oceanside, New York

516.536.2300

www.oceansidecarecenter.com

7HYR(]LU\L,_[LUKLK*HYL-HJPSP[` 'S CA RI Y E AM S B OF OME E N H S F S O NG R' IL O N A URSI UME NC E NS OU OS N CH TOP CO CH C RICA R E A SE AM RE

For over 40 years, Oceanside Care Center has been welcoming residents from our community and providing personalized care to meet their individual needs. Residents donâ&#x20AC;&#x2122;t get lost at Oceanside. Because of the small size of our facility, we are able to know each resident, cater to their individuality and provide more one to one service. We invite you to come and tour our facility and meet our staff and the residents and families we serve. We look forward to welcoming you.

Wh wh y not ile loo recup Oc king a erate ean t th ? e

,?*,33,5*,055<9:05.*(9,(5+9,/()030;(;065

CARE CENTER

UHVSRQVH:HLJKWORVVLVKLJKO\UHFRPPHQGHG HYHQ D IHZ SRXQGV PDWWHU   6XUJHU\ HLWKHU GRQHDUWKURVFRSLFDOO\ ZKLFKLVXVXDOO\WHPSR UDU\DQGPD\OHDGWRLQFUHDVLQJWKHDUWKULWLVLQ WKH IXWXUH  RU NQHH UHSODFHPHQWV HDFK KDV D SODFHIRUWKHVHYHUHDUWKULWLFSDWLHQW  $QRIWHQRYHUORRNHGEXWTXLWHHIIHFWLYHIRUP RIWKHUDS\HQWDLOVLQMHFWLQJWKHHIIHFWHGNQHHZLWK D´JHOµ SUHYLRXVO\GHULYHGRQO\IURPFKLFNHQV QRZDOVRPDGHV\QWKHWLFDOO\ $VHULHVRILQMHF WLRQV EUDQGQDPHVLQFOXGH(XIOH[[D6\QYLVF DQG2UWKRYLVF OHDGWRVLJQLILFDQWSDLQUHOLHILQ DERXWSHUFHQWRISHRSOHIRUVL[PRQWKVRU PRUH7KHLQMHFWLRQVDUHGRQHLQWKHRIILFHDQG EDUHO\WDNHDIHZPLQXWHVWRGR7KHVHLQMHF WLRQV VKRXOG RQO\ EH JLYHQ LQ D QRQLQIODPHG NQHH DV LW QRW HIIHFWLYH DQG ZLOO EH ZDVWHG LI JLYHQLQDVZROOHQNQHH  6RUHPHPEHUWRNHHSZDONLQJDQGVWULYHWR ORRVHZHLJKW,ISDLQSHUVLVWVFDOORXURIILFHDW 

6Y[OVWLKPJ9LOHIPSP[H[PVU 4(::9LOHI9HPS:`Z[LT 0U[LUZP]L:OVY[[LYT  9LOHIPSP[H[PVU:LY]PJLZ )HYPH[YPJ9LOHIPSP[H[PVU  HUK>LSSULZZ :[YVRL7H[PLU[  9LOHIPSP[H[PVU (K]HUJLK>V\UK*HYL

  



9LZWPYH[VY`HUK ;YHJOLVZ[VT`*HYL (SaOLPTLYÂťZ+LTLU[PH 7YVNYHT 3VUN;LYT:RPSSLK5\YZPUN *HYL /VZWPJLHUK7HSSPH[P]L*HYL 9LZWP[L*HYL 4LKPJHS4VKLS(K\S[ +H`*HYL

Welcome Dr. Germano of Orlin & Cohen Orthopedics 5H[PVUHS)V\SL]HYK3VUN)LHJO5L^@VYR -H_ 

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

2I7KHNQHH

465962

WR\RXUKHDOWK

19


WR\RXUKHDOWK

Edward M. Stroh, M.D. Retina Consultants of Long Island

Health news prepared by HERALD advertisers

)UHH6FUHHQLQJ)RU+HDG$QG1HFN&DQFHUV$W

6RXWK1DVVDX&RPPXQLWLHV+RVSLWDO

Specializing in Diseases and Surgery of the Retina and Vitreous:

 7KLV\HDUDORQHQHDUO\RIWKH $PHULFDQVGLDJQRVHGZLWKDKHDGRUQHFNFDQ FHU ZLOO GLH )RUWXQDWHO\ LI KHDG RU QHFN FDQ FHUVDUHGHWHFWHGLQWKHHDUO\VWDJHVWKH\DUH KLJKO\WUHDWDEOHDQGWKHFXUHUDWHLVJRRG  $FFRUGLQJ WR WKH 3UHYHQWLRQ &RPPLWWHH RI WKH $PHULFDQ +HDG DQG 1HFN 6RFLHW\ DQ DQQXDO VFUHHQLQJ IRU KHDG DQG QHFN FDQFHUV DVVLVWVLQHDUO\GLDJQRVLVDQGVXFFHVVIXOWUHDW PHQW  6RXWK 1DVVDX &RPPXQLWLHV +RVSLWDO ZLOO KROG D )UHH +HDG DQG 1HFN &DQFHU 6FUHHQLQJ 'D\ )ULGD\ 0D\   DP SP LQ WKH KRVSLWDO·V &RQIHUHQFH &HQWHU$ 6FUHHQLQJV ZLOO EH FRQGXFWHG E\ 5DMLY 'DWWD 0' PHGLFDO GLUHFWRU RI WKH &DQFHU &HQWHU DQG FKDLUPDQ RI WKH 'HSDUWPHQW RI 6XUJHU\ /RXLV5RVQHU0'FKLHIRIRWRUKLQRODU\QJROR J\ HDU QRVH DQG WKURDW  DQG 9LQFHQW 5HLG 0'VXUJLFDORQFRORJLVW  5LVN IDFWRUV IRU KHDG DQG QHFN FDQFHUV LQFOXGHKDELWXDOVPRNLQJRUXVHRIVPRNHOHVV WREDFFR IUHTXHQW DOFRKRO FRQVXPSWLRQ RU H[FHVVLYH H[SRVXUH WR WKH VXQ 7XPRUV PRVW RIWHQ RFFXU LQ WKH QDVDO SDV VDJHV VLQXVHV PRXWK WKURDW ODU\Q[ YRLFH ER[  VZDO ORZLQJ SDVVDJHV VDOLYDU\JODQGV DQGWKH

Macular Degeneration Diabetic Retinopathy Macular Pucker and Macular Holes Retinal Vascular Occlusions Flashes and Floaters Laser Surgery and Phototherapy Retinal Detachment and Vitreoretinopathy Retina, Vitreous and Macular Surgery Uveitis Penetrating Eye Injuries Ocular Trauma

165 North Village Avenue, Suite 203 Rockville Centre, NY 11570

536-9525

WK\URLGJODQG  7KHLUV\PSWRPVLQFOXGHSHUVLVWHQWVRUHVLQ WKH PRXWK D OXPS RU VRUH LQ WKH PRXWK WKDW GRHVQRWKHDODOXPSLQWKHQHFNDFKURQLFVRUH WKURDW GLIILFXOW\ VZDOORZLQJ DQG D FKDQJH RU KRDUVHQHVVLQWKHYRLFH  )RU PRUH LQIRUPDWLRQ FDOO 6RXWK 1DVVDX·V 2QFRORJ\3URJUDPDW,QIRUPDWLRQ PD\ DOVR EH REWDLQHG E\ VHQGLQJ DQ HPDLO WR RQFRORJ\#VQFKRUJ South Nassau Communities Hospital, Oceanside 516-632-3350

468034

Affiliated with: Mercy Medical Center, Long Island Jewish-North Shore Health System, Winthrop University Hospital, South Nassau Communities Hospital, and Manhattan Eye, Ear and Throat Hospital

:K\6KRXOG<RX&RQVLGHU3DUN$YHQXH([WHQGHG&DUH

Hypnosis Can Help!

)DFLOLW\)RU5HKDELOLWDWLRQ"

3RISR3RI,]TRSWMWJSV%HYPXWERH'LMPHVIR MRE7EJI 'SQJSVXEFPI)RZMVSRQIRX ;IMKLXÂ&#x2C6;7QSOMRKÂ&#x2C6;7XVIWWÂ&#x2C6; %R\MIXMIWÂ&#x2C6; *IEVW 4LSFMEWÂ&#x2C6;+VMIZMRKÂ&#x2C6;9R[ERXIH,EFMXW 7IPJ)WXIIQÂ&#x2C6;'SRJMHIRGIÂ&#x2C6;7XEVXMRK3ZIV (EXMRKÂ&#x2C6;'PYXXIVÂ&#x2C6;7XYH],EFMXW 1IQSV]Â&#x2C6;'SRGIRXVEXMSRÂ&#x2C6;1IRSTEYWI 7PIIT-WWYIWÂ&#x2C6;7TSVXW-QTVSZIQIRXERH1SVI

Terry Biener, CCH

Certified Clinical Hypnotist in practice since 1992

Easy Changes Hypnosis 516-791-6174 HypnoShe@aol.com www.easychanges.com Located in Valley Stream

*PI\MFPI,SYVWÂ&#x2C6;&]%TTSMRXQIRX3RP] 'EPPJSVE*6))4LSRI'SRWYPXEXMSR

438387

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

20

,QWKLVWLPHRIHFRQRPLFUHFHVVLRQ\RXPD\ QRWEHDZDUHWKDWLQVXUDQFHFRPSDQLHVDUHQRORQ JHUSD\LQJIRUOHQJWK\KRVSLWDOVWD\VZKLFKDOORZ IRUWRWDOSDWLHQWUHFRYHU\0DQ\SDWLHQWVDQG IDPLOLHVDUHIDFHGZLWKVHULRXVFKRLFHV IRUWKRVHVWLOOLQQHHGRIWKHUDS\VXS SRUWDQGDVVLVWDQFH:KHUHWRJRWR UHFHLYHRSWLPDOFDUHDQGUHKDELOLWDWLRQ EHFRPHVDTXHVWLRQIUHTXHQWO\DVNHG E\IDPLOLHVLQQHHG 8SRQSUHSDUDWLRQ IRU GLVFKDUJH IURP WKHKRVSLWDOSDWLHQWVDUHXVXDOO\JLYHQD OLVWRIQXPHURXVIDFLOLWLHVWRFKRRVHIURP IRU UHFRYHU\7U\LQJ WR PDNH DQ HGX FDWHG GHFLVLRQ XQGHU GXUHVV FDQ EHFRPH VWUHVVIXO DQG FRQIXVLQJ 7KHOLVWVGRQRWJLYHDEUHDNGRZQ RIWKHGHWDLOVRIHDFKIDFLOL W\DQGZKDWWKH\KDYHWR RIIHU 3DUN $YHQXH ([WHQGHG &DUH )DFLOLW\ RIIHUV D VXEDFXWH UHKDELOLWDWLRQ SUR JUDP WKDW EULGJHV WKH JDS EHWZHHQ SURORQJHG KRVSLWDO VWD\V DQG JRLQJ KRPH XQSUHSDUHG IRU WKH URDG WR UHFRYHU\6RPDQ\RI XV ZLOO GLUHFWO\ RU LQGL UHFWO\ EH LQ QHHG RI UHKDELOLWDWLRQVHUYLFHVDW VRPHSRLQW,WLVSUXGHQWWR HGXFDWH RXU VHOYHVDVWRWKHSRVVLELOLWLHVWKDWDUHDYDLODEOH IRU XV DQG RXU ORYHG RQHV :LWK WKDW LQ PLQG 3DUN$YHQXH ZHOFRPHV WRXUV RI WKH IDFLOLW\ IRU WKRVHZKRPD\EHLQQHHGRIWKHVHVHUYLFHV 2XU SK\VLFDO WKHUDSLVWV RFFXSDWLRQDO WKHUD

SLVWV DQG VSHHFK ODQJXDJH SDWKRORJLVW·V ZRUN WRJHWKHUWRLPSOHPHQWDSODQWRRSWLPL]HSDWLHQW UHFRYHU\ 2XU WKHUDSLHVSURYLGHFDUHDQGWUHDW PHQW IRU D YDULHW\ RI FRQGLWLRQV VXFK DV MRLQW UHSODFHPHQWDQGDPSXWDWLRQRUWKRSHGLFFRQGL WLRQV VWURNH DQG QHXURORJLFDO UHKDELOLWDWLRQ DQG UHFRQGLWLRQLQJ GXH WR VXU JHU\LOOQHVVRULQMXU\ 3DUN$YHQXHZDVFKR VHQDVRQHRI$PHULFD·V 7RS 1XUVLQJ +RPHV E\ WKH &RQVXPHU·V 5HVHDUFK &RXQFLO RI $PHULFD 2XU VNLOOHG VWDII SURYLGHV TXDOLW\ FDUH LQ DQ HOHJDQWO\ GHVLJQHG HQYLURQ PHQW 3DWLHQWV DQG IDPLOLHV HQMR\ WKH KRWHOOLNH OREE\ SOD\ HU SLDQR JDUGHQ SDWLR DQG SDQRUDPLF YLHZV RI WKH$WODQWLF 2FHDQ 5H\Q ROG·V &KDQQHO DQG WKH 1HZ <RUN &LW\ VN\OLQH 2XU QHZO\ GHFRUDWHG IDFLOLW\ JLYHV D WDVWH RI0DQKDWWDQLQ/RQJ%HDFK 3DUN$YHQXH·V FHQWUDO ORFD WLRQ SURYLGHV UHVLGHQWV DQG WKHLU IDPLOLHV HDV\ DFFHVV WR WKH /RQJ ,VODQG 5DLOURDG UHVWDXUDQWV VKRSV DQG WKH ZRUOG IDPRXV %RDUGZDON Park Avenue Extended Care Facility 425 National Blvd., Long Beach 516-431-2600


WR\RXUKHDOWK

0DFXODU'HJHQHUDWLRQ

Health news prepared by HERALD advertisers

7LSV)RU2OGHU$GXOWV7R6SULQJ,QWR6KDSH

H[WUD GLVWDQFH  ZLOO SURYLGH FDUGLRYDVFXODU H[HUFLVH 3DUNHU DOVR DGYLVHV WKDW VHQLRUV ZDUP XS EHIRUH DQG FRRO GRZQ DQG VWUHWFK DIWHU DQ\ H[HUFLVH DFWLYLW\ WR ORZHU ULVN IRU LQMXU\GULQNZDWHUWRVWD\K\GUDWHGDQG VHW DQ H[HUFLVH JRDO RI  KRXUV HDFK ZHHN RI PRGHUDWH WR YLJRURXV DFWLYLW\IRUFDUGLRYDVFXODUILWQHVVDQG VWUHQJWKHQLQJH[HUFLVH 5IF#SJTUBM"TTJTUFE-JWJOHDPN NVOJUJFT IBT GBDJMJUJFT JO &BTU .FBEPX  &BTU /PSUIQPSU  -ZO CSPPL  /PSUI )JMMT  /PSUI 8PPENFSF 8FTUCVSZBOE .BTTBQFRVB  'PS JOGPS NBUJPO PO 5IF #SJTUBM " T T J T U F E  - J W J O H $PNNVOJUJFT  WJTJU XXXUIFCSJTUBMDPN The Bristal Assisted Living Communities 631-580-6420

Long Beach Rheumatology & Osteoporosis

0DFXODU GHJHQHUDWLRQ LV WKH QXPEHU RQH FDXVHRIVHYHUHYLVXDOORVVLQROGHU$PHULFDQV,W LV D YHU\ IUXVWUDWLQJ FRQGLWLRQ IRU DIIOLFWHG SDWLHQWVDVLWFDQFDXVHDORVVRIFHQWUDOYLVLRQ WKRXJKSHULSKHUDORUVLGHYLVLRQUHPDLQVLQWDFW  :KLOH WKH H[DFW FDXVH RI WKLV FRQGLWLRQ LV XQFOHDUZHGRNQRZWKDWFLJDUHWWHVPRNLQJLVD ULVN IDFWRU 6R WKLV LV DQRWKHU UHDVRQ WR VWRS VPRNLQJLPPHGLDWHO\ 3HRSOHZLWKPDFXODUGHJHQHUDWLRQFDQKDYH GLIILFXOWLHV ZLWK PDQ\ WDVNV UHDGLQJ EDQNLQJ GULYLQJ LGHQWLI\LQJ WKHLU PHGLFDWLRQV HWF &XU UHQWO\WKHUHDUHPDQ\ORZYLVLRQDLGVLHPDJQLIL HUV WHOHVFRSHV HWF WKDW FDQ DVVLVW SDWLHQWV LQ WKHLU DFWLYLWLHV RI GDLO\ OLIH DQG DOORZ WKHP WR PDLQWDLQWKHLULQGHSHQGHQFH:KLOHWKHVHGHYLF HVGRQRWWUHDWWKHFRQGLWLRQWKH\FHUWDLQO\FDQ PDNHLWPRUHPDQDJHDEOH 7KHUHLVDFWLYHUHVHDUFKWKDWLVRQJRLQJIRU GHYHORSLQJQHZWUHDWPHQWVIRUERWKWKH´GU\µDQG ´ZHW·IRUPVRIWKLVFRQGLWLRQ2QHDUHDRIDFWLYH VWXG\LVWKHUROHRIYLWDPLQVLQVORZLQJGRZQRU SUHYHQWLQJPDFXODUGHJHQHUDWLRQ&XUUHQWVWXG LHVDUHFRPSDULQJGLIIHUHQWGRVDJHVDQGIRUPX ODWLRQV 8QOHVV WKHUH LV D VSHFLILF PHGLFDO UHDVRQ QRW WR WDNH D YLWDPLQ VXSSOH PHQW DOO SDWLHQWV ZLWK PDFXODU GHJHQHUDWLRQ VKRXOG FRQ VLGHUWDNLQJRQH

      /XFHQWLVDQGLWVFRXVLQ$YDVWLQDUHWKHQDPHVRI WZR PHGLFDWLRQV WKDW KDYH UHYROXWLRQL]HG WKH WUHDWPHQW RI ¶ZHW· PDFXODU GHJHQHUDWLRQ7KHVH VSHFLDOO\ GHVLJQHG DQWLERGLHV FDQ EH DGPLQLV WHUHG LQWR WKH H\H DQG VWRS WKH JURZWK RI QHZ EORRGYHVVHOVFDXVLQJOHDNDJHDQGYLVXDOORVVLQ WKLVFRQGLWLRQ 1HZ WUHDWPHQWV IRU PDFXODU GHJHQHUDWLRQ DUHRQWKHKRUL]RQ,IWKHSDVWWZR\HDUVDUHDQ\ LQGLFDWLRQ WKHQ H[FLWLQJ QHZ WKHUDSLHV PD\EH DYDLODEOHVRRQ6RHYHQLI\RXDUHQRWDFDQGL GDWHIRUWRGD\·VDYDLODEOHWUHDWPHQWVGRQRWJLYH XSKRSHFDXVHKHOSLVRQWKHZD\ Dr. Norman Saffra 22 Bayberry Rd., Lawrence 516-239-6789 Brooklyn Office: 902 49th St., Brooklyn 718-283-8000

Hear the difference we can make.

Todayâ&#x20AC;&#x2122;s hearing aids are barely visible, highly effective and easy to afford. Come hear for yourself with a 45 day trial. FREE Consultations earing Aid Checks & Cleanings FREE Hearing WITH TH THIS AD ONLY

NO COUPON NEEDED TO GET THE BEST PRICE!

AUDIOLOGY OF NASSAU COUNTY

Dr. Barbara L. Rosen, Au.D.

165 North Village Avenue, Suite 119 â&#x20AC;¢ Rockville Centre 516-764-2094

759 Lincoln Blvd. Long Beach, NY 11561 516â&#x20AC;¢897â&#x20AC;¢3885

467015

â&#x20AC;¢ State of the Art Treatment of Rheumatoid Arthritis and severe Psoriasis, with drugs in our infusion suite. â&#x20AC;¢ Do you have osteoporosis with heartburn? We have solutions, including intravenous medicines given every 3 months or once a year. â&#x20AC;¢ Do you have knee pain? We have options available, including gel injections. â&#x20AC;¢ We will spend the time needed to make the diagnosis and discuss your options. â&#x20AC;¢ All Commercial Insurance Plans & Medicare Accepted â&#x20AC;¢ Late Hours Available

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

&DQ$Q\WKLQJ%H'RQH7R+HOS"

%ULVWDO$VVLVWHG/LYLQJ2IIHUV  :KLOHPDQ\ROGHUSHRSOHWHQGWRVORZGRZQ LQ ZLQWHU$ODQ 3DUNHU ([HFXWLYH 'LUHFWRU RI WKH %ULVWDO$VVLVWHG /LYLQJ &RPPXQLW\ LQ /\QEURRN VD\V WKDW NHHSLQJ DFWLYH DOO \HDU LV D NH\ WR JRRG KHDOWK 3DUNHURIIHUVVRPHVLPSOHWLSVWR WDNH DGYDQWDJH RI VSULQJ DV \RXJHWEDFNLQWRVKDSH â&#x2013; :DONDWWKHPDOO&OLPDWH FRQWURO DQG HYHQ VXUIDFHV PDNH PDOO ZDONLQJ D JUHDW ZD\ WR VWD\ LQ VKDSH â&#x2013; 7DNHWKHVWDLUV 6WDLU FOLPELQJ H[HU FLVHV WKH VDPH PXVFOHV QHFHVVDU\ IRU NHHSLQJ \RXU EDODQFH ZKLOH ULVLQJ IURP D FKDLU VR LW LV LPSRUWDQW WR NHHS WKHVH P X V F O H V VWURQJ â&#x2013;   /LWWOH FKDQJHVWKDW DGG XS 3DUN IDUWKHU DZD\ IURP D VWRUH H Q W U D Q F H  ZDONLQJ WKH

21


WR\RXUKHDOWK

Health news prepared by HERALD advertisers

'LDEHWHV6HOI0DQDJHPHQW(GXFDWLRQ3URJUDP

$W0HUF\0HGLFDO&HQWHU

Exciting Low Price !

$2,195

based on a 30 day mon th

but our selection was clear.

OUR DECISION WASNâ&#x20AC;&#x2122;T EASY....

WE WENT WITH THE BEST - THE BRISTAL. When you visit

The Bristal â&#x20AC;&#x201C; no other community compares. Itâ&#x20AC;&#x2122;s more than luxury living &

dining. More than delightful activities. Itâ&#x20AC;&#x2122;s devoted attention, a sterling staff and simply outstanding care. Wrestling with your decision? Call to schedule your tour today! Ask about our Veterans Program!

NORTH WOODMERE 477 HUNGRY HARBOR RD 516.336.2600

LYNBROOK

blog.thebristal.com

thebristal.com

find us on

facebook

8 FREER STREET 516.593.2424

Care Beyond Compare

7R DGGUHVV RQH RI WKHPRVWSUHVVLQJSXE OLFKHDOWKFRQFHUQVIDF LQJ/RQJ,VODQGDQGWKH QDWLRQ 0HUF\ 0HGLFDO &HQWHURIIHUVDQRXWSD WLHQW 'LDEHWHV 6HOI 0DQDJHPHQW (GXFD WLRQ  3URJUDP IRU GLDEHWLFV DQG WKHLU IDPLOLHV 7 K H  S U R J U D P HPSKDVL]HV NQRZO HGJH WUHDWPHQW DQG VHOIPDQDJHPHQW RI WKH GLVHDVH VR WKDW SDWLHQWV FDQ LGHQWLI\ DQG SUHYHQW SRVVLEOH FRPSOLFDWLRQV&ODVVHVLQFOXGHVHOIPDQDJHPHQW WHFKQLTXHV RQ GLHW EORRG JOXFRVH PRQLWRULQJ IRRW FDUH PHGLFDWLRQV H[HUFLVH H\H FDUH DQG OLIHVW\OH FKDQJHV 7KH SURJUDP LV GHVLJQHG WR RIIHUWKHEHVWVHOIPDQDJHPHQWLQIRUPDWLRQZLWK VPDOOJURXS LQVWUXFWLRQ IRU D XQLTXH SHUVRQDO OHDUQLQJHQYLURQPHQW 7KH IRXUVHVVLRQ SURJUDP LV FRQGXFWHG PRQWKO\ EHJLQQLQJ ZLWK DQ KRXUORQJ LQGLYLGXDO DVVHVVPHQW IRU HDFK SDUWLFLSDQW IROORZHG E\ WKUHH ZHHNO\ JURXS ZRUNVKRSV FRQGXFWHG :HGQHVGD\HYHQLQJVIURPSP(DFKSDUWLFL SDQW DOVR UHFHLYHV D JURXS IROORZXS VHVVLRQ

DSSUR[LPDWHO\ VL[ ZHHNV DIWHUWKHSURJUDPHQGV &ODVVHV DUH WDXJKW E\ WZRH[SHULHQFHG'LDEHWHV (GXFDWRUVFHUWLILHGE\WKH $PHULFDQ 'LDEHWHV$VVR FLDWLRQ $'$  7KH SUR JUDPSURYLGHVSDUWLFLSDQWV ZLWKWKHVNLOOVUHTXLUHGIRU GD\WRGD\ PDQDJHPHQW RIGLDEHWHVDQGVWUDWHJLHV IRU SHRSOH OLYLQJ ZLWK GLD EHWHV WR PDLQWDLQ DQG PD[LPL]HOLIHDFWLYLWLHV 0HUF\¡VSURJUDPTXDO LILHV IRU UHLPEXUVHPHQW IURP PRVW LQVXUDQFH SODQV DQG LV UHFRJQL]HG E\ ERWK WKH $PHULFDQ 'LDEHWHV $VVRFLDWLRQ $'$ DQGWKH$PHULFDQ$VVRFLDWLRQRI'LDEHWHV (GXFDWRUV $$'( ,WVFXUULFXOXPLVDUHFRJQL]HG HGXFDWLRQDO SURJUDP RI ERWK WKHVH DVVRFLDWLRQV DQG PHHWV WKH 1DWLRQDO 6WDQGDUGV IRU 'LDEHWHV 6HOI0DQDJHPHQW(GXFDWLRQ 3DWLHQWV VHHNLQJ LQIRUPDWLRQ RU ZLVKLQJ WR UHJLVWHUVKRXOGFDOO0(5&<

'LDEHWLF

GLDJQRVLV RI GLDEHWLF H\H GLVHDVH LV PDGH E\ H[DPLQDWLRQDQGPD\UHTXLUHSKRWRJUDSKVIOX RUHVFHLQ DQJLRJUDSK\ DQGRU 2&7 WR GHWHFW GLDEHWLFUHWLQRSDWK\ 7KHUHDUHQHZDGYDQFHVIRUWUHDWLQJGLDEHW LFUHWLQRSDWK\LQFOXGLQJODVHUWHFKQLTXHVPHG LFDWLRQ LQMHFWLRQV RU HYHQ VXUJHU\ IRU VHYHUH FDVHV%OLQGQHVVGXHWRGLDEHWLFH\HGLVHDVH FDQ EH SUHYHQWDEOH 6WUDWHJLHV IRU SUHYHQWLQJ GLDEHWLF UHWLQRSDWK\ LQFOXGH FRQWURO RI EORRG VXJDU DQG EORRG SUHVVXUH DYRLGLQJ VPRNLQJ HDUO\GHWHFWLRQDQGHDUO\WUHDWPHQWDVZHOODV PDLQWDLQLQJUHJXODUO\VFKHGXOHGYLVLWV 'U 6WURK LV D UHWLQD VSHFLDOLVW LQ 5RFNYLOOH &HQWUHZKRVSHFLDOL]HVLQ'LDEHWHVDQG5HWLQDO 'LVRUGHUV  +H KDV SXEOLVKHG QXPHURXV DUWL FOHV DQG IUHTXHQWO\ OHFWXUHV DW QDWLRQDO PHHW LQJV'U6WURKLVDPHPEHURIPDQ\RUJDQL]D WLRQV LQFOXGLQJ 7KH$PHUL FDQ$FDGHP\ RI 2SKWKDO PRORJ\ 9LWUHRXV 6RFLHW\ D Q G  $ V V R F L D W L R Q  I R U UHVHDUFK LQ 9LVLRQ DQG 2SKWKDOPRORJ\+HFDQEH UHDFKHG DW  IRUDSSRLQWPHQWVFRQVXOWD WLRQVDQGVHFRQGRSLQLRQV

Mercy Medical Center, Rockville Centre 516-62MERCY

LICENSED BY THE NYS DEPT OF HEALTH. ELIGIBLE FOR MOST LONG TERM CARE POLICIES.

8<(30;@*644<50;0,:)@;/,,5.,3)<94(5.96<7

COMFORT KEEPERS OF OCEANSIDE

In-Home Care that is Beyond Compare

(\H'LVHDVH $SSUR[LPDWHO\PLOOLRQ$PHULFDQVKDYHGLD EHWHV PHOOLWXV EXW PDQ\ GRQ¡W NQRZ WKH\ DUH DIIHFWHG'LDEHWHVLVRQHRIWKHOHDGLQJFDXVHVRI EOLQGQHVVDPRQJ$PHULFDQV0DQ\SDWLHQWVZLWK GLDEHWLFH\HSUREOHPVKDYHQRV\PSWRPVEXWLI OHIWXQWUHDWHGGLDEHWHVFDQOHDGWRVHULRXVYLVXDO ORVVH[SODLQV'U(GZDUG6WURK 0DQ\ GLDEHWLFV QRWLFH EOXUUHG YLVLRQ ZKHQ WKHLUEORRGVXJDUIOXFWXDWHVHLWKHUKLJKRUORZ 'LDEHWHV FDQ DOVR GDPDJH WKH VPDOO EORRG YHVVHOVWKURXJKRXWWKHUHWLQDUHVXOWLQJLQODFN RI R[\JHQ WR WKH UHWLQD 7KH GDPDJHG EORRG YHVVHOVOHDNSURGXFLQJIOXLGLQWKHUHWLQD7KH

At Comfort KeepersÂŽ we provide in-home care that helps seniors live happy, independent lives in the comfort of their own homes. Our Comfort KeepersÂŽ help keep minds, bodies and lives active, happy and healthy

SERVICES â&#x20AC;˘ Companionship â&#x20AC;˘ Cooking, Light Housekeeping, Laundry

â&#x20AC;˘ Transportation for All Appointments â&#x20AC;˘ Dressing Guidance â&#x20AC;˘ Medication Reminders

â&#x20AC;˘ Alzheimer's and Dementia Care â&#x20AC;˘ Relief Time for Family

Please call for a FREE in-home visit Care Givers Needed Serving Nassau County and Surrounding Areas

516-442-2300

CK786@comfortkeepers.com

Each office independently owned & operated

W W W. C O M F O R T K E E P E R S . C O M

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

22

Dr. Edward Stroh Retina Consultants of Long Island 165 N. Village Ave., Suite 203, Rockville Centre 516-536-9525


WR\RXUKHDOWK

Health news prepared by HERALD advertisers

/,¡V)DPLO\+\SQRVLV6ROXWLRQ  :KLOHWKHFRUHRIKHUK\SQRWKHUDS\SUDFWLFHLV VPRNHFHVVDWLRQZHLJKWFRQWURODQGVWUHVVPDQ DJHPHQW7HUU\%LHQHU¡VWUXHSDVVLRQLVKHOSLQJ SHRSOHZLWKIHDUVDQGSDQLF+DYLQJKDG WKHVH GHYDVWDWLQJ LVVXHV KHUVHOI ZKLFK ZHUH XOWLPDWHO\ KHDOHG WKURXJK K\SQRVLV KHU HPSDWK\ DQG XQGHUVWDQGLQJ UXQV GHHS 2I WKH PDQ\ WHFKQLTXHV VKH KDV XVHG RYHU WKH \HDUV VKH ILQGV 1HXUROLQJXLVWLF 3URJUDP PLQJ 1/3  FRPELQHG ZLWK K\S QRVLV WR EH PRVW VXFFHVVIXO IRU IHDUVDQGDQ[LHW\  ´+RZPDQ\VHVVLRQVQHHGHGGHSHQGVRQ ERWK WKH LQGLYLGXDO DQG WKH SUREOHP¾ VDLG 0V %LHQHU ´6LQFH PRVW KDELWV RU FRQGLWLRQV H[LVW IURP \HDUV RI QHJDWLYH UHHQIRUFHPHQW RQH VKRXOG H[SHFW DW OHDVW D IHZ VHVVLRQV IRU ORQJ ODVWLQJHIIHFW2QHRQRQHK\SQRVLVDVRSSRVHG WRJURXSK\SQRVLVLVYHU\GLIIHUHQWLQWKDWVHVVLRQV FDQEHWDLORUHGH[DFWO\WRWKHSHUVRQ¡VLVVXHVWULJ JHUVDQGSHUVRQDOLW\0RWLYDWLRQDQGWKHGHVLUHWR PDNHWKHFKDQJHDUHLPSRUWDQWLQJUHGLHQWV$QG WUXVW DQG DJRRG UDSSRUW ZLWK WKH K\SQRWKHUDSLVW VKRXOGGHILQLWHO\EHWKHUH¾  0V%LHQHUEHOLHYHVWKDWSHRSOHVKRXOGXQGHU VWDQGK\SQRVLVDQGEHFRPIRUWDEOHZLWKLWEHIRUHWU\ LQJLW´,JQRUHZKDW\RX¡YHVHHQLQPRYLHVDQGRQ VWDJH(YHQLI\RX¡YHQHYHUEHHQIRUPDOO\K\SQR WL]HG\RX¡UHSUREDEO\PRUHIDPLOLDUZLWKK\SQRVLV WKDQ\RXUHDOL]H,QIDFWDK\SQRWLFWUDQFHLVDQDWX UDOVWDWHWKDWPRVWRIXVYLVLWRQDGDLO\EDVLV¾  )RUH[DPSOHPRVWRIXVKDYHGULYHQDGLVWDQFH ZKLOHGD\GUHDPLQJ6XGGHQO\ZHUHDOL]HWKDWZH

GRQ·W UHPHPEHU KDYLQJ SDVVHG FHUWDLQ H[LWV RU VWUHHWV7KDWLVFDOOHG´ZDNLQJK\SQRVLVµ6LQFHWKH FRQVFLRXVSDUWRIWKHPLQGZDVQRWIRFXVHGRQGULY LQJWKHVXEFRQVFLRXVPLQG WKHSDUWSUR JUDPPHGWKURXJKUHSHWLWLRQ WRRNRYHU DQGJRWXVWKHUHVDIHO\2UDYHU\OLJKW K\SQRWLFWUDQFHFRXOGRFFXUZKHQD SHUVRQLVVRHQJURVVHGLQDQRYHORU PRYLHWKDWKHRUVKHLV´WKHUHµDQG UHDO VXUURXQGLQJV GRQ·W VHHP WR H[LVW$ K\SQRWKHUDSLVW LQGXFHV D K\SQRWLFWUDQFHWREHDEOHWR´DGMXVWµ WKH VXEFRQVFLRXV &RQWUDU\ WR P\WKV WKH SHUVRQ EHLQJ K\SQRWL]HG QHYHU ORVHV WKHLUFRQWURO  ´+\SQRVLVFDQEHHIIHFWLYHZLWKMXVWDERXWDQ\ WKLQJFDXVHGE\RUEORFNHGE\WKHVXEFRQVFLRXV PLQG,·YHEHHQDEOHWRKHOSSHRSOHFRSHZLWKD ORVVRUWUDXPDLPSURYHLQDVSRUWFRQFHQWUDWLRQ PHPRU\RYHUFRPHH[DPDQ[LHW\DQGUHOHDVHDOO W\SHV RI KDELWV$V D IRUPHU VFKRRO WHDFKHU ,·P FRPIRUWDEOH KHOSLQJ FKLOGUHQ KHDO VHOIHVWHHP WKDW·VEHHQGDPDJHGWKURXJK$''RU$'+'µ  $FOLQLFDOK\SQRWKHUDSLVWVLQFH0V%LH QHUZRUNVZLWKERWKFKLOGUHQDQGDGXOWVRQDRQH RQRQHEDVLV6KHKROGVDYDULHW\RIFHUWLILFDWLRQV WKRXJKWKH$PHULFDQ%RDUGRI+\SQRWKHUDS\DQG WKH1DWLRQDO*XLOGRI+\SQRWLVWV&OLHQWVDUHVHHQ E\ DSSRLQWPHQW RQO\ 3KRQH FRQVXOWDWLRQV DUH IUHHDQGFRQILGHQWLDO)RUIXUWKHULQIRUPDWLRQFRQ WDFW7HUU\ %LHQHU &&+ DW  RU YLVLW ZZZHDV\FKDQJHVFRP  Terry Biener 516-791-6174

&RPIRUW.HHSHUV

2I2FHDQVLGH

&RPIRUW .HHSHUV LV D IUDQFKLVH RZQHG E\ 2FHDQVLGHUHVLGHQW-XG\*HLHUVHUYLFLQJ1DVVDX &RXQW\DQGVXUURXQGLQJDUHDV 7KHFRPSDQ\ZDVVWDUWHGDERXWD\HDUDQGD KDOI DJR ZLWK WKH JRDO RI HQDEOLQJ LQGHSHQGHQW OLYLQJDWKRPHZLWKUHVSHFWDQGGLJQLW\  &RPIRUW .HHSHUV DLPV WR NHHS VHQLRUV LQ WKHLU RZQ KRPHV ZKLOH SURYLGLQJ QRQPHGLFDO FDUHDQGFRPSDQLRQVKLS$OWKRXJKHOGHUVDUHWKH PDLQ IRFXV DOO DGXOWV DUH VHUYLFHG WKLV LQFOXGHVSUHJQDQWZRPHQ 7KH PDQ\ VHUYLFHV SURYLGHG E\ &RPIRUW.HHSHUVLQFOXGHVFRQYHUVD WLRQFRPSDQLRQVKLSPHDOSUHSDUD WLRQ OLJKW KRXVHNHHSLQJ HUUDQG VHUYLFHV JURFHU\ VKRSSLQJ UHVSLWHRUUHOLHIIRUWKHIDPLO\PHG LFDWLRQ UHPLQGHUV JURRPLQJ DQG GUHVVLQJJXLGDQFHLQFLGHQWDOWUDQV SRUWDWLRQODXQGU\DQGOLQHQZDVKLQJ UHFUHDWLRQDO DFWLYLWLHV DQG FUDIWV PDLO DVVLVWDQFHDQGRUJDQL]DWLRQSHULRG LF UHYLHZ DQG FRPPXQLFD WLRQ HPHUJHQF\ PRQLWRU V\VWHPV$O]KHLPHU¡V DQG GHPHQWLD VXSSRUW (DFK FDUHJLYHU LV WUDLQHG LQ DVVLVWLQJ FOLHQWV$OO FDUH JLYHUVKDYHFDUVDQGKDYH EHHQ VXEMHFW WR FULPLQDO

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

(DV\&KDQJHV+\SQRVLV

23

DQG '09 EDFN JURXQG FKHFNV ,Q DGGLWLRQ DOO HPSOR\HHV DUH E R Q G H G  D Q G LQVXUHG

Comfort Keepers of Oceanside 3355 Lawson Blvd., Oceanside 516-442-2300

$OOPDWHULDOLQ7R<RXU+HDOWKLVFRQWULEXWHGE\DGYHUWLVHUV

Patients choose Mercy Medical Centerâ&#x20AC;&#x201D;in Rockville Centreâ&#x20AC;&#x201D;more than 100,000 times a yearâ&#x20AC;&#x201D; for top-quality, state-of-the-art health care, in a healing, faith-based environment. â&#x20AC;˘ 24-Hour Emergency and Trauma Care â&#x20AC;&#x201C; For Both Adults and Children â&#x20AC;˘ New York State-designated Stroke Center â&#x20AC;˘ Best Ranked on Long Island in 2010 for Joint-Replacement Surgery* â&#x20AC;˘ Highest Ranked Weight-Loss Surgery for 2010/2011 in downstate New York* â&#x20AC;˘ Dedicated Inpatient Rehabilitation Program â&#x20AC;&#x201C; Largest on Nassau Countyâ&#x20AC;&#x2122;s South Shore â&#x20AC;˘ Level III Neonatal Intensive Care Unit â&#x20AC;&#x201C; Specialists in High-Risk Pregnancy â&#x20AC;˘ Newly Renovated Womenâ&#x20AC;&#x2122;s Imaging Center â&#x20AC;&#x201C; Latest Technology, Spa-Like Atmosphere, Next-Day Appointments *As ranked by HealthGradesÂŽ, the leading healthcare ratings organization

Physician Referrals:

Convenient Free Parking 1000 N. Village Ave., Rockville Centre â&#x20AC;˘ www.MercyMedicalCenter.info â&#x20AC;˘ A Safe Haven For Newbornsâ&#x20AC;&#x201D;Legal Option To Abandonment

516-62MERCY


Catherine Zeta-Jones’ brave step forward

17

Catherine Zeta-Jones’ brave public acknowledgement of her mental health problems, including appearing on the cover of People Magazine, invited people all over the world to identify with her problem and recognize they or their loved ones are not alone if they are suffering with emotional problems. “This is a disorder that affects millions of people and I am one of them” and “if my revelation of having bipolar II has encouraged just one person to seek help, then it is worth it.” Her announcement is a landmark in public health awareness. That someone as beautiful and successful as Katherine Zeta-Jones

CATHERINE ZETA-JONES’ public revelation of her recent diagnosis has brought needed public awareness to mental health issues. can struggle with a serious mental health issue and feel comfortable enough to share it with the world will certainly motivate others to emulate her strength and intelligence, “there’s no need to suffer silently and there is no shame in seeking help.” Very fortunately, because of people in the limelight who share their struggles, the stigma once attached to seeking therapy has greatly diminished. No doubt, if your throat hurts, you break a bone, suffer any aches and pains or show signs of illness that require medical attention, you’re on it. You make an appointment with your doctor, get a diagnosis, and ultimately fill the prescription that will heal you. The responsible adult takes great pains to stay healthy by eating well, exercising, taking supplements and recommended medications and making sure to have a complete physical every year. But, taking care of your emotional health is often last on your list, until like Catherine Zeta-Jones, you realize you have no choice. Neither fame, wealth, nor talent immunizes anyone against the vicissitudes of physical and mental illness.

aging, dealing with troubled children or other family members, addictions, abuse, bereavement or anything that gets in the way of your emotional health and happiness. However, many people resist seeking help. If you have a weak heart, you control

Issues that can stop you in your tracks and prohibit everyday function as a parent, a partner or on the job include panic attacks, depression, unemployment, marital discord, eating disorders, coping with

your diet, exercise more, take prescribed medication and follow doctor’s orders. If you have a broken heart, there’s more to it. Sometimes, making that first call and findContinued on GOOD HEALTH page 3

“I use the latest techniques to fight cancer in the operating room … and answer every question a patient may have before we get here.” Dr. Datta is a board-certified, fellowship-trained cancer surgeon who’s known for his skills in the operating room and for taking the time to sit with a patient while providing support before and after surgery. A specialist in tumors of the head and neck, breast, endocrine system, colon and soft tissue as well as melanoma, he’s also a Castle Connolly top doctor, so you can be confident you’re getting quality, compassionate care every step of the way.

Rajiv Datta, MD, FACS, FRCS, FICS Chair, Department of Surgery Medical Director, South Nassau’s Cancer Center Director, Surgical Oncology/Head & Neck Castle Connolly “Top Doctor” since 2006

To schedule an appointment with Dr. Datta, call 516.632.3350 or visit www.southnassau.org for more information.

SOUTH NASSAU COMMUNITIES HOSPITAL

|

ONE HEALTHY WAY, OCEANSIDE, NY 11572

|

877-SOUTH-NASSAU

|

WWW.SOUTHNASSAU.ORG 467687

By JOHN KASTAN, Ph.D & AUDREY GOODMAN

May 5, 2011 — HERALD COMMUNITY NEWSPAPERS — GOOD HEALTH

Overcoming the stigma of dealing with emotional issues


Advanced laser surgery helps cataract patients OCLIâ&#x20AC;&#x2122;s Dr. Eric Donnenfeld brings new procedure to L.I. An important advancement in cataract surgery is welcome news to the many people in the area who suffer from cataracts. Long Islandâ&#x20AC;&#x2122;s first laser enhanced and customized cataract surgery was performed by Dr. Eric Donnenfeld at Island Eye Surgicenter in Carle Place on April 19, using the Alcon LenSxÂŽ Femtosecond Laser. Dr. Donnenfeld, a founding partner of Ophthalmic Consultants of Long Island (OCLI) and clinical professor of ophthalmology at NYU, is one of only a handful of surgeons in the U.S. experienced with this laser. Island Eye Surgicenter is only the fourth surgical facility in the US to acquire this advanced technology. Cataract surgery is the most commonly performed operation in the United States with over 3 million cases performed annually. Today, visual rehabilitation following cataract surgery may be significantly enhanced with the implantation of a lens designed to correct refractive error. The addition of this exciting laser technology adds a new level of precision and predictability to the procedure that simply was not possible with conventional manual surgery. Each human eye is different in terms of size, depth, curvature of the cornea and other key features. Before cataract surgery, every eye is carefully measured and mapped. The LenSx laser uses a combination of highly advanced technologies to capture incredibly precise, high-resolution digital images of the eye. These images and the measurements and data they provide are then used to plan and perform a surgery to exacting specifications that were previously unachievable with traditional (manual) cataract surgery.

DR. ERIC DONNENFELD PERFORMED the first case on Long Island using the new laser for customized refractive cataract surgery. In addition, the LenSx laser adds computer-control to key steps of cataract surgery, ensuring highly precise surgical incisions. The unique software analyzes highresolution images of the eye which then enables the surgeon to design a customized, image-guided proce-

1250$16$))5$0')$&6 :28/'/,.(72$11281&(

(;3$1'('/21*,6/$1'2)),&(+2856

'LUHFWRURI2SKWKDOPRORJ\0DLPRQLGHV0HGLFDO&HQWHU &OLQLFDO3URIHVVRURI2SKWKDOPRORJ\ 0W6LQDL6FKRRO2I0HGLFLQH   $OVR$IÂżOLDWHGZLWK

7KH1HZ<RUN(\H (DU,QÂżUPDU\ 1<80HGLFDO&HQWHU/HQR[+LOO+RVSLWDO /,2IÂżFH %D\EHUU\5RDG /DZUHQFH1< 7

%URRNO\Q2IÂżFH WK6W %URRNO\Q1< 7

2IÂżFHKRXUVE\DSSRLQWPHQWRQO\ Both the Long Island and Brooklyn offices participate with the following insurance plans: 0HGLFDUH8QLWHG+HDOWK&DUH2[IRUG$HWQD+HDOWKQHW&LJQD *+,+,3(PEOHP%&%6+HDOWKÂżUVW+HDOWKSOXV(OGHUSODQ

dure for every patient and then execute the laser procedure on command. â&#x20AC;&#x153;Laser refractive cataract surgery is without a doubt the most technologically advanced option for cataract patients,â&#x20AC;? said Dr. Donnenfeld. â&#x20AC;&#x153;Before this technology was available, many of the most challenging steps during cataract surgery were performed manually with a blade. With the LenSx laser, we can offer our patients a truly premium experience with the precision and reliability of a laser for refractive cataract surgery. â&#x20AC;&#x153;Island Eye has invested significant resources integrating this sophisticated technology and in training our staffâ&#x20AC;? said Robert Nelson, PA-C, Executive Director at the center. â&#x20AC;&#x153;We are thrilled to once again bring our patients the absolute latest innovations in ophthalmic surgical care.â&#x20AC;? The LenSx laser is the first FDA approved femtosecond laser for cataract surgery, which can very accurately perform anterior capsulotomies, corneal incisions and lens disruption. Prior to the introduction of this breakthrough technology, all of these steps were performed manually with handheld blades or ultrasound energy. To learn more about customized laser cataract surgery and refractive surgical options using the LenSx laser technology, visit www.ocli.net. To schedule an appointment with Dr. Eric Donnenfeld or another OCLI cataract surgeon, please contact 1-866-SEE-OCLI (1-866-733-6254).

Norman Saffra, MD, FACS, is one of the nationâ&#x20AC;&#x2122;s leading ophthalmic laser and micro surgeons. Dr. Saffra is known for his expertise in diseases of the Retina and Vitreous such as; diabetic retinopathy, macular degeneration, and retinal tears and detachments. He is also experienced in caring for patients with uveitis and Neuro-Ophthalmic disorders. Dr. Saffra is a Fellow of: The American College of Surgeons and The American Academy of Ophthalmology. He is a member of the American Society of Retina Specialists and the North American Association of Neuro-Ophthalmology. Dr. Saffra frequently lectures in medical schools and to physicians throughout the country. Dr. Saffra is actively involved in clinical and surgical research. He has contributed over 25 scholarly papers to peer review journals and assisted in the design of two different surgical instruments. Under Dr. Saffraâ&#x20AC;&#x2122;s leadership, The Eye Institute at Maimonides is at the forefront of advancing medical science by pursuing research into diseases that cause permanent vision loss. He has been consistently listed in the â&#x20AC;&#x153;Castle Connolly Guide: How to find the Best Doctors (New York Metro area)â&#x20AC;? and has been listed in New York Magazine â&#x20AC;&#x153;Best Doctorsâ&#x20AC;? issue 12 times. He continues to be quoted by all major television networks and newspapers in regards to ophthalmology issues. Dr. Saffra resides in Nassau County with his family, and is looking forward to bringing state of the art retinal care to our area.

467809

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

18


19

Food For Life

L F

Dealing with emotional issues Continued from GOOD HEALTH page 1

ing the right resource is the most difficult. We race to heal our bodies why do we hesitate to heal our minds? One out of five families living on Long Island is affected by mental health or substance abuse issues. Talking with a skilled professional can make all the difference. A huge burden is lifted when you have a structured plan of advice to follow, someone to guide you, and evidence that when utilizing the many tools available, things will work out. A better life starts with you. John Kastan, Ph.D., is executive director of Peninsula Counseling Center, a non-profit community mental health center in Valley Stream, licensed by the New York State Office of Mental Health and Alcoholism and Substance Abuse. Audrey Goodman is community relations coordinator.



Embrace wellness:

May is Mental Health Month  *RRGPHQWDOKHDOWKLVPXFKPRUHWKDQPXVWWKHDEVHQFHRILOO QHVV²LW¡VDERXWEHLQJDEOHWRKDQGOHOLIH¡VFKDOOHQJHVDQGHYHQ IORXULVK 'LG \RX NQRZ WKDW  PLOOLRQ$PHULFDQV DUH GLDJQRVHG ZLWKDPHQWDOKHDOWKFRQGLWLRQLQDQ\JLYHQ\HDU²WKDW¡VLQ"  .QRZWKHVLJQVRIVWUHVVDQGKRZLWDIIHFWV\RXURYHUDOOKHDOWK DQGZHOOEHLQJ$QGNQRZZKHQLW¡VQRWMXVWVWUHVVWKDW¡VERWKHULQJ \RX EXW VRPHWKLQJ PRUH DQG ZKHQ WR VHHN SURIHVVLRQDO KHOS (YHU\RQH JHWV GRZQ IURP WLPH WR WLPH EXW VRPHWLPHV LW¡V PRUH WKDQ ´WKH EOXHV¾ &OLQLFDO GHSUHVVLRQ LV D UHDO LOOQHVV WKDW FDQ EH WUHDWHG HIIHFWLYHO\ 8QIRUWXQDWHO\ WRR PDQ\ SHRSOH EHOLHYH WKDW GHSUHVVLRQLVDQRUPDOSDUWRIOLIH¡VXSVDQGGRZQVUDWKHUWKDQD UHDOKHDOWKSUREOHP$VDUHVXOWWKH\PD\GHOD\VHHNLQJKHOSRU QRWVHHNKHOSDWDOO

Tools for living well:

 â&#x2013; &RQQHFW ZLWK RWKHUV 5HVHDUFK VXJJHVWV WKDW SHRSOH ZKR IHHOFRQQHFWHGDUHKDSSLHUDQGKHDOWKLHUDQGPD\HYHQOLYHORQ JHU  â&#x2013;  *HW SK\VLFDOO\ DFWLYH ([HUFLVH UHOLHYHV WHQVH PXVFOHV LPSURYHVPRRGDQGVOHHSDQGLQFUHDVHVHQHUJ\DQGVWUHQJWK +HOSRWKHUV5HVHDUFKVXJJHVWVWKDWWKRVHZKRFRQVLVWHQWO\KHOS RWKHUSHRSOHH[SHULHQFHOHVVGHSUHVVLRQJUHDWHUFDOPDQGIHZHU SDLQV  â&#x2013;  *HWHQRXJKUHVW3HRSOHZKR GRQ¡WJHWHQRXJKVOHHSIDFH DQXPEHURISRVVLEOHKHDOWKULVNVLQFOXGLQJZHLJKWJDLQGHFUHDVHG PHPRU\LPSDLUHGGULYLQJDQGKHDUWSUREOHPV  â&#x2013;  &UHDWH MR\ DQG VDWLVIDFWLRQ 3RVLWLYH HPRWLRQV FDQ ERRVW D SHUVRQ¡VDELOLW\WRERXQFHEDFNIURPVWUHVV  â&#x2013;  (DWZHOO(DWLQJKHDOWK\IRRGDQGUHJXODUPHDOVFDQLQFUHDVH HQHUJ\ ORZHU WKH ULVN RI GHYHORSLQJ FHUWDLQ GLVHDVHV DQG LQIOXHQFHPRRG â&#x2013; 7DNHFDUHRI\RXUVSLULW3HRSOHZKRKDYHVWURQJVSLULWXDOOLYHV PD\ EH KHDOWKLHU DQG OLYH ORQJHU 6SLULWXDOLW\ VHHPV WR FXW WKH VWUHVVWKDWFDQFRQWULEXWHWRGLVHDVH

Linda Fiveson is a nutritionist in Syosset.

Edward M. Stroh, M.D. Retina Consultants of Long Island Specializing in Diseases and Surgery of the Retina and Vitreous: Macular Degeneration Diabetic Retinopathy Macular Pucker and Macular Holes Retinal Vascular Occlusions Flashes and Floaters Laser Surgery and Phototherapy Retinal Detachment and Vitreoretinopathy Retina, Vitreous and Macular Surgery Uveitis Penetrating Eye Injuries Ocular Trauma

165 North Village Avenue, Suite 203 Rockville Centre, NY 11570

536-9525 Affiliated with: Mercy Medical Center, Long Island Jewish-North Shore Health System, Winthrop University Hospital, South Nassau Communities Hospital, and Manhattan Eye, Ear and Throat Hospital

468034

How come we are â&#x20AC;&#x153;alwaysâ&#x20AC;? Our brains have no connection on a diet? How can we eventuwith our bodies. Itâ&#x20AC;&#x2122;s the â&#x20AC;&#x153;this ally maintain our weight loss isnâ&#x20AC;&#x2122;t working fast enoughâ&#x20AC;? mensuccessfully? What are the tality that will cause us to throw common mistakes that interin the towel. fere with our progress and perIâ&#x20AC;&#x2122;m sure most of you think haps ruin the results? you are â&#x20AC;&#x153;on trackâ&#x20AC;?. Yes, the Going on a diet creates obsesmarketing of whatâ&#x20AC;&#x2122;s healthy sions with food â&#x20AC;&#x201C; even healthy has been re-defined so often that food. Eventually we wind up even when we do try to make focusing on whatâ&#x20AC;&#x2122;s less in fat or better choices, they arenâ&#x20AC;&#x2122;t necescalories, and of course, fixating sarily better. And remember, on which foods will give will healthy eating is not always the INDA give us the fastest weight loss. same as weight-loss Iâ&#x20AC;&#x2122;ve always thought that â&#x20AC;&#x153;too IVESON eating. Many us simply eat too muchâ&#x20AC;? of anything such as much. Yes, some foods are hard-core dieting, becoming a unlimited, but that doesnâ&#x20AC;&#x2122;t mean you have to â&#x20AC;&#x153;gym-ratâ&#x20AC;? and certainly striving for â&#x20AC;&#x153;perfecgorge yourself until your stomach is so tion,â&#x20AC;? will lead to some level of disappointstuffed with vegetables that you canâ&#x20AC;&#x2122;t breathe! ment. It has been my experience that unrealEveryone is different so comparing your istic expectations will lead to big letdowns. Once that happens, the â&#x20AC;&#x153;whyâ&#x20AC;? questions begin results with others will only stress you out, and some of us are â&#x20AC;&#x153;stress eatersâ&#x20AC;?! to multiply in our minds: Skipping meals, thinking less is better will â&#x20AC;&#x153;Why arenâ&#x20AC;&#x2122;t I losing faster?â&#x20AC;? â&#x20AC;&#x153;Why are my not lead to better results. You might find yourabs not more defined?â&#x20AC;? â&#x20AC;&#x153;Why doesnâ&#x20AC;&#x2122;t my self eating more at the next meal or picking stomach look flatter?â&#x20AC;? â&#x20AC;&#x153;Why is it that when I mindlessly because you are â&#x20AC;&#x153;entitledâ&#x20AC;? to the look in the mirror I still donâ&#x20AC;&#x2122;t like what I see?â&#x20AC;? These are all challenging questions. Everyone calories you have banked for the day. The handfuls, bites, licks and tastes during the day is different and comparing your results with others will only stress you out, and some of us â&#x20AC;&#x153;add upâ&#x20AC;? and can negate the best of diet intentions. are â&#x20AC;&#x153;stress-eaters!â&#x20AC;?

counted. Read the labels on these products and check the ingredients to find one that lists sugar (or sugar derivatives) as the 4th or higher item. A skinless piece of protein smothered in these condiments can add a lot of sugar which equates to adding calories. The closer to the top of the ingredient list, the more it has! You can dilute the sauce with water or use salsa or hot sauce instead. Olive oil is considered a healthy fat, but rubbing your grill or food with the oil instead of pouring it in will save a lot of calories and still give you the same results. At 120 calories a tablespoon, winding up with 6-7 tablespoons can make your meal fattening. And finally, salads! What happened? Dried fruit, cheese, nuts, seeds, candied walnuts, pecans, beans, chic peas and croutons have just turned this meal into a 1,200 calorie disaster and yes, we ask for â&#x20AC;&#x153;lightâ&#x20AC;? dressing (on the side.) LOL! Now we come to liquid calories such as fancy coffees, juices and creamy soups just to name a few. Just because you didnâ&#x20AC;&#x2122;t chew it doesnâ&#x20AC;&#x2122;t mean it doesnâ&#x20AC;&#x2122;t count. So, itâ&#x20AC;&#x2122;s pretty clear that everything counts when it comes to losing weight. When we make up our minds to truly commit to a healthy and â&#x20AC;&#x153;make-senseâ&#x20AC;? program of nutrition and weight loss we have to commit to giving up the unhealthy categories of food. Then, itâ&#x20AC;&#x2122;s about â&#x20AC;&#x153;thinking before you eat!â&#x20AC;?

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

Diet Goofs

To avoid the mindless munchies, plan your snacks and keep cut-up vegetables or extra protein available to avoid making the wrong choices. (â&#x20AC;&#x153;Just Oneâ&#x20AC;? of anything wrong counts!) Even four bites a day worth 100 calories add up to a pound of added weight per month. Keeping a journal of what you eat is a great tool and if you are completely honest with yourself this will help you become mindful of everything that goes in your mouth. Weekend warriors are the most common offenders. You can very easily un-do a week of good eating on the weekend. You should plan to eat in restaurants that have the proper choices for you. Steakhouses, Italian, Japanese (no rice) and Chinese (steamed) always have options. Check out the menu before you go to the restaurant to have a plan of what you may choose to order. Being prepared is your best defense! Dipping: A carrot stick is â&#x20AC;&#x153;notâ&#x20AC;? a carrot stick if itâ&#x20AC;&#x2122;s dunked into blue cheese dip. Nuts (about 7 pieces) and peanut butter are fattening; they have 180 calories per ounce! They are a fat, not a protein. And who decided that sweet potato fries are a healthier version of the French fry? Besides the beta-carotene, vitamin C, folic acid, potassium and fiber, you have just skyrocketed the fat and calories to compare to the white potato version. What about hard cheese? Itâ&#x20AC;&#x2122;s a bad saturated fat. I call it a â&#x20AC;&#x153;glue stickâ&#x20AC;? running through your veins and arteries! Barbecue sauce and ketchup must be


WR\RXUKHDOWK

0DFXODU'HJHQHUDWLRQ

Health news prepared by HERALD advertisers

&DQ$Q\WKLQJ%H'RQH7R+HOS"

%ULVWDO$VVLVWHG/LYLQJ2IIHUV 7LSV)RU2OGHU$GXOWV7R6SULQJ,QWR6KDSH

 :KLOHPDQ\ROGHUSHRSOHWHQGWRVORZGRZQ LQ ZLQWHU$ODQ 3DUNHU ([HFXWLYH 'LUHFWRU RI WKH %ULVWDO$VVLVWHG /LYLQJ &RPPXQLW\ LQ /\QEURRN VD\V WKDW NHHSLQJ DFWLYH DOO \HDU LV D NH\ WR JRRG KHDOWK 3DUNHURIIHUVVRPHVLPSOHWLSVWR WDNH DGYDQWDJH RI VSULQJ DV \RXJHWEDFNLQWRVKDSH â&#x2013; :DON DW WKH PDOO &OL PDWHFRQWURODQGHYHQVXU IDFHV PDNH PDOO ZDON LQJ D JUHDW ZD\ WR VWD\LQVKDSH â&#x2013;  7D N H  W K H VWDLUV 6WDLU FOLPE LQJ H[HUFLVHV WKH VDPHPXVFOHVQHF HVVDU\IRUNHHSLQJ \RXU EDODQFH ZKLOH ULVLQJ IURP D FKDLU VRLWLVLPSRU WDQWWRNHHS WKHVH P X V F O H V VWURQJ â&#x2013;   /LWWOH FKDQJHV WKDW DGG XS 3DUN IDUWKHU DZD\ IURP D VWRUH HQWUDQFH

ZDONLQJ WKH H[WUD GLVWDQFH  ZLOO SURYLGH FDUGLR YDVFXODUH[HUFLVH 3DUNHU DOVR DGYLVHV WKDW VHQLRUV ZDUP XS EHIRUH DQG FRRO GRZQ DQG VWUHWFK DIWHU DQ\ H[HUFLVH DFWLYLW\ WR ORZHU ULVN IRU LQMXU\GULQNZDWHUWRVWD\K\GUDWHGDQG VHW DQ H[HUFLVH JRDO RI  KRXUV HDFK ZHHN RI PRGHUDWH WR YLJRURXV DFWLYLW\IRUFDUGLRYDVFXODUILWQHVVDQG VWUHQJWKHQLQJH[HUFLVH 

5IF#SJTUBM"TTJTUFE-JWJOH DPNNVOJUJFT IBT GBDJMJUJFT JO &BTU.FBEPX &BTU/PSUIQPSU  -ZOCSPPL /PSUI)JMMT /PSUI 8PPENFSF 8FTUCVSZBOE .BTTBQFRVB  'PS JOGPS NBUJPO PO 5IF #SJTUBM " T T J T U F E  - J W J O H $PNNVOJUJFT  WJTJU XXXUIFCSJTUBMDPN The Bristal Assisted Living Communities 631-580-6420

0DFXODU GHJHQHUDWLRQ LV WKH QXPEHU RQH FDXVHRIVHYHUHYLVXDOORVVLQROGHU$PHULFDQV,W LV D YHU\ IUXVWUDWLQJ FRQGLWLRQ IRU DIIOLFWHG SDWLHQWVDVLWFDQFDXVHDORVVRIFHQWUDOYLVLRQ WKRXJKSHULSKHUDORUVLGHYLVLRQUHPDLQVLQWDFW  :KLOH WKH H[DFW FDXVH RI WKLV FRQGLWLRQ LV XQFOHDUZHGRNQRZWKDWFLJDUHWWHVPRNLQJLVD ULVN IDFWRU 6R WKLV LV DQRWKHU UHDVRQ WR VWRS VPRNLQJLPPHGLDWHO\ 3HRSOHZLWKPDFXODUGHJHQHUDWLRQFDQKDYH GLIILFXOWLHV ZLWK PDQ\ WDVNV UHDGLQJ EDQNLQJ GULYLQJ LGHQWLI\LQJ WKHLU PHGLFDWLRQV HWF &XU UHQWO\WKHUHDUHPDQ\ORZYLVLRQDLGV²LHPDJ QLILHUVWHOHVFRSHVHWF²WKDWFDQDVVLVWSDWLHQWV LQWKHLUDFWLYLWLHVRIGDLO\OLIHDQGDOORZWKHPWR PDLQWDLQWKHLULQGHSHQGHQFH:KLOHWKHVHGHYLF HVGRQRWWUHDWWKHFRQGLWLRQWKH\FHUWDLQO\FDQ PDNHLWPRUHPDQDJHDEOH 7KHUHLVDFWLYHUHVHDUFKWKDWLVRQJRLQJIRU GHYHORSLQJQHZWUHDWPHQWVIRUERWKWKH´GU\µDQG ´ZHW·IRUPVRIWKLVFRQGLWLRQ2QHDUHDRIDFWLYH VWXG\LVWKHUROHRIYLWDPLQVLQVORZLQJGRZQRU SUHYHQWLQJPDFXODUGHJHQHUDWLRQ&XUUHQWVWXG LHVDUHFRPSDULQJGLIIHUHQWGRVDJHVDQGIRUPX ODWLRQV8QOHVVWKHUHLVDVSHFLILFPHGLFDOUHDVRQ QRWWRWDNHDYLWDPLQVXSSOHPHQWDOOSDWLHQWV ZLWK PDFXODU GHJHQHUDWLRQ VKRXOG FRQVLGHUWDNLQJRQH  

 

 /XFHQWLV DQG LWV FRXVLQ $YDVWLQ DUH WKH QDPHVRIWZRPHGLFDWLRQVWKDWKDYHUHYROXWLRQ L]HGWKHWUHDWPHQWRI¶ZHW·PDFXODUGHJHQHUDWLRQ 7KHVH VSHFLDOO\ GHVLJQHG DQWLERGLHV FDQ EH DGPLQLVWHUHGLQWRWKHH\HDQGVWRSWKHJURZWKRI QHZ EORRG YHVVHOV FDXVLQJ OHDNDJH DQG YLVXDO ORVVLQWKLVFRQGLWLRQ 1HZ WUHDWPHQWV IRU PDFXODU GHJHQHUDWLRQ DUHRQWKHKRUL]RQ,IWKHSDVWWZR\HDUVDUHDQ\ LQGLFDWLRQ WKHQ H[FLWLQJ QHZ WKHUDSLHV PD\EH DYDLODEOHVRRQ6RHYHQLI\RXDUHQRWDFDQGL GDWHIRUWRGD\·VDYDLODEOHWUHDWPHQWVGRQRWJLYH XSKRSHEHFDXVHKHOSLVRQWKHZD\ Dr. Norman Saffra 22 Bayberry Rd., Lawrence 516-239-6789 Brooklyn Office: 902 49th St., Brooklyn 718-283-8000



)UHH6FUHHQLQJ)RU+HDG$QG1HFN&DQFHUV$W

6RXWK1DVVDX&RPPXQLWLHV+RVSLWDO

 7KLV\HDUDORQHQHDUO\RIWKH $PHULFDQVGLDJQRVHGZLWKDKHDGRUQHFNFDQ FHU ZLOO GLH )RUWXQDWHO\ LI KHDG RU QHFN FDQ FHUVDUHGHWHFWHGLQWKHHDUO\VWDJHVWKH\DUH KLJKO\WUHDWDEOHDQGWKHFXUHUDWHLVJRRG  $FFRUGLQJ WR WKH 3UHYHQWLRQ &RPPLWWHH RI WKH $PHULFDQ +HDG DQG 1HFN 6RFLHW\ DQ DQQXDO VFUHHQLQJ IRU KHDG DQG QHFN FDQFHUV DVVLVWVLQHDUO\GLDJQRVLVDQGVXFFHVVIXOWUHDW PHQW 6RXWK 1DVVDX &RPPXQLWLHV +RVSLWDO ZLOO KROG D )UHH +HDG DQG 1HFN &DQFHU 6FUHHQLQJ 'D\ )ULGD\ 0D\   DP SP LQ WKH KRVSLWDO·V &RQIHUHQFH &HQWHU$ 6FUHHQLQJV ZLOO EH FRQGXFWHG E\ 5DMLY 'DWWD 0' PHGLFDO GLUHFWRU RI WKH &DQFHU &HQWHU DQG FKDLUPDQ RI WKH 'HSDUWPHQW RI 6XUJHU\ /RXLV5RVQHU0'FKLHIRIRWRUKLQRODU\QJROR J\ HDU QRVH DQG WKURDW  DQG 9LQFHQW 5HLG 0'VXUJLFDORQFRORJLVW  5LVN IDFWRUV IRU KHDG DQG QHFN FDQFHUV LQFOXGHKDELWXDOVPRNLQJRUXVHRIVPRNHOHVV WREDFFR IUHTXHQW DOFRKRO FRQVXPSWLRQ RU H[FHVVLYHH[SRVXUHWRWKHVXQ7XPRUVPRVW RIWHQRFFXULQWKHQDVDOSDVVDJHVVLQXV HV PRXWK WKURDW ODU\Q[ YRLFH ER[  VZDOORZLQJ SDVVDJHV VDOLYDU\ JODQGV DQG WKH WK\URLGJODQG     

Excitin Low Pricge !

$2,195

based on a 30 day mon th

but our selection was clear.

OUR DECISION WASNâ&#x20AC;&#x2122;T EASY....

WE WENT WITH THE BEST - THE BRISTAL. When you visit

The Bristal â&#x20AC;&#x201C; no other community compares. Itâ&#x20AC;&#x2122;s more than luxury living &

dining. More than delightful activities. Itâ&#x20AC;&#x2122;s devoted attention, a sterling staff and simply outstanding care. Wrestling with your decision? Call to schedule your tour today! Ask about our Veterans Program!

NORTH WOODMERE 477 HUNGRY HARBOR RD 516.336.2600

LYNBROOK Care Beyond Compare

blog.thebristal.com

8 FREER STREET 516.593.2424

thebristal.com

find us on

facebook

LICENSED BY THE NYS DEPT OF HEALTH. ELIGIBLE FOR MOST LONG TERM CARE POLICIES.

8<(30;@*644<50;0,:)@;/,,5.,3)<94(5.96<7

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

20

 7KHLUV\PSWRPVLQFOXGHSHUVLVWHQWVRUHVLQ WKH PRXWK D OXPS RU VRUH LQ WKH PRXWK WKDW GRHVQRWKHDODOXPSLQWKHQHFNDFKURQLFVRUH WKURDW GLIILFXOW\ VZDOORZLQJ DQG D FKDQJH RU KRDUVHQHVVLQWKHYRLFH  )RU PRUH LQIRUPDWLRQ FDOO 6RXWK 1DVVDX·V 2QFRORJ\ 3URJUDP DW   ,QIRUPD WLRQPD\DOVREHREWDLQHGE\VHQGLQJDQHPDLO WRRQFRORJ\#VQFKRUJ South Nassau Communities Hospital, Oceanside 516-632-3350


WR\RXUKHDOWK (\H'LVHDVH $SSUR[LPDWHO\PLOOLRQ$PHULFDQVKDYHGLD EHWHV PHOOLWXV EXW PDQ\ GRQ¡W NQRZ WKH\ DUH DIIHFWHG'LDEHWHVLVRQHRIWKHOHDGLQJFDXVHVRI EOLQGQHVVDPRQJ$PHULFDQV0DQ\SDWLHQWVZLWK GLDEHWLFH\HSUREOHPVKDYHQRV\PSWRPVEXWLI OHIWXQWUHDWHGGLDEHWHVFDQOHDGWRVHULRXVYLVXDO ORVVH[SODLQV'U(GZDUG6WURK 0DQ\ GLDEHWLFV QRWLFH EOXUUHG YLVLRQ ZKHQ WKHLUEORRGVXJDUIOXFWXDWHVHLWKHUKLJKRUORZ 'LDEHWHV FDQ DOVR GDPDJH WKH VPDOO EORRG YHVVHOVWKURXJKRXWWKHUHWLQDUHVXOWLQJLQODFN RI R[\JHQ WR WKH UHWLQD 7KH GDPDJHG EORRG YHVVHOVOHDNSURGXFLQJIOXLGLQWKHUHWLQD7KH

Health news prepared by HERALD advertisers GLDJQRVLV RI GLDEHWLF H\H GLVHDVH LV PDGH E\ H[DPLQDWLRQDQGPD\UHTXLUHSKRWRJUDSKVIOX RUHVFHLQ DQJLRJUDSK\ DQGRU 2&7 WR GHWHFW GLDEHWLFUHWLQRSDWK\ 7KHUHDUHQHZDGYDQFHVIRUWUHDWLQJGLDEHW LFUHWLQRSDWK\LQFOXGLQJODVHUWHFKQLTXHVPHG LFDWLRQ LQMHFWLRQV RU HYHQ VXUJHU\ IRU VHYHUH FDVHV %OLQGQHVV GXH WR GLDEHWLF H\H GLVHDVH FDQ EH SUHYHQWDEOH 6WUDWHJLHV IRU SUHYHQWLQJ GLDEHWLF UHWLQRSDWK\ LQFOXGH FRQWURO RI EORRG VXJDU DQG EORRG SUHVVXUH DYRLGLQJ VPRNLQJ HDUO\GHWHFWLRQDQGHDUO\WUHDWPHQWDVZHOODV PDLQWDLQLQJUHJXODUO\VFKHGXOHGYLVLWV 'U 6WURK LV D UHWLQD VSHFLDOLVW LQ 5RFNYLOOH &HQWUHZKRVSHFLDOL]HVLQ'LDEHWHVDQG5HWLQDO 'LVRUGHUV+HKDVSXEOLVKHGQXPHURXVDUWLFOHV DQG IUHTXHQWO\ OHFWXUHV DW QDWLRQDO PHHWLQJV 'U6WURKLVDPHPEHURIPDQ\RUJDQL]DWLRQV LQFOXGLQJ 7KH $PHULFDQ $FDGHP\ RI 2SKWKDOPROR J\ 9LWUHRXV 6RFLHW\ DQG $VVRFLDWLRQIRUUHVHDUFKLQ 9LVLRQDQG2SKWKDOPRORJ\ +HFDQEHUHDFKHGDW  IRU DSSRLQW PHQWV FRQVXOWDWLRQV DQG VHFRQGRSLQLRQV Dr. Edward Stroh Retina Consultants of Long Island 165 N. Village Ave., Suite 203, Rockville Centre 516-536-9525

'LDEHWHV6HOI0DQDJHPHQW(GXFDWLRQ3URJUDP

$W0HUF\0HGLFDO&HQWHU

7RDGGUHVVRQHRIWKHPRVW VW SUHV V L Q J  S X E O L F  K H D O W K FRQFHUQVIDFLQJ/RQJ,VODQG G DQGWKHQDWLRQ0HUF\0HGL FDO &HQWHU RIIHUV DQ RXWSD WLHQW 'LDEHWHV 6HOI0DQDJH PHQW (GXFDWLRQ  3URJUDP P I R U  G L D E H W L F V  D Q G  W K H L UU IDPLOLHV 7KH SURJUDP HPSKDVL] HV NQRZOHGJH WUHDWPHQW W DQGVHOIPDQDJHPHQWRIWKH H GLVHDVH VR WKDW SDWLHQWV V FDQ LGHQWLI\ DQG SUHYHQW W S R V V L E O H  F R P S O L F D W L R Q V  &ODVVHV LQFOXGH VHOIPDQDJHPHQW WHFK QLTXHV RQ GLHW EORRG JOXFRVH PRQLWRULQJ IRRW FDUH PHGLFDWLRQV H[HUFLVH H\H FDUH DQG OLIHVW\OH FKDQJHV 7KH SURJUDP LV GHVLJQHG WR RIIHU WKH EHVW VHOIPDQDJHPHQW LQIRUPDWLRQZLWKVPDOOJURXSLQVWUXFWLRQIRUD XQLTXHSHUVRQDOOHDUQLQJHQYLURQPHQW 7KH IRXUVHVVLRQ SURJUDP LV FRQGXFWHG PRQWKO\EHJLQQLQJZLWKDQKRXUORQJLQGLYLG XDODVVHVVPHQWIRUHDFKSDUWLFLSDQWIROORZHG E\WKUHHZHHNO\JURXSZRUNVKRSVFRQGXFWHG :HGQHVGD\ HYHQLQJV IURP  SP (DFK SDUWLFLSDQW DOVR UHFHLYHV D JURXS IROORZXS VHVVLRQ DSSUR[LPDWHO\ VL[ ZHHNV DIWHU WKH

SURJUDP HQGV &ODVVHV DUH WDXJKW E\ WZR H[SHULHQFHG 'LDEHWHV (GXFDWRUV FHUWL ILHG E\WKH$PHULFDQ 'LDEH WHV $VVRFLDWLRQ $'$  7KH SURJUDP SURYLGHV SDUWLFL SDQWVZLWKWKHVNLOOVUHTXLUHG IRU GD\WRGD\ PDQDJHPHQW RI GLDEHWHV DQG VWUDWHJLHV IRU SHRSOH OLYLQJ ZLWK GLDEH WHV WR PDLQWDLQ DQG PD[L PL]HOLIHDFWLYLWLHV 0HUF\¡V SURJUDP TXDOL ILHV IRU UHLPEXUVHPHQW IURP PRVWLQVXUDQFHSODQVDQGLV UHFRJQL]HG E\ ERWK WKH $PHULFDQ 'LDEHWHV $VVRFLDWLRQ $'$ DQGWKH$PHULFDQ$VVRFL DWLRQRI'LDEHWHV(GXFDWRUV $$'( ,WVFXU ULFXOXPLVDUHFRJQL]HGHGXFDWLRQDOSURJUDP RI ERWK WKHVH DVVRFLDWLRQV DQG PHHWV WKH 1DWLRQDO 6WDQGDUGV IRU 'LDEHWHV 6HOI0DQ DJHPHQW(GXFDWLRQ 3DWLHQWVVHHNLQJLQIRUPDWLRQRUZLVKLQJWR UHJLVWHUVKRXOGFDOO0(5&< Mercy Medical Center, Rockville Centre 516-62MERCY

$OOPDWHULDOLQ7R<RXU+HDOWKLVFRQWULEXWHGE\DGYHUWLVHUV

Patients choose Mercy Medical Centerâ&#x20AC;&#x201D;in Rockville Centreâ&#x20AC;&#x201D;more than 100,000 times a yearâ&#x20AC;&#x201D; for top-quality, state-of-the-art health care, in a healing, faith-based environment. â&#x20AC;˘ 24-Hour Emergency and Trauma Care â&#x20AC;&#x201C; For Both Adults and Children â&#x20AC;˘ New York State-designated Stroke Center â&#x20AC;˘ Best Ranked on Long Island in 2010 for Joint-Replacement Surgery* â&#x20AC;˘ Highest Ranked Weight-Loss Surgery for 2010/2011 in downstate New York* â&#x20AC;˘ Dedicated Inpatient Rehabilitation Program â&#x20AC;&#x201C; Largest on Nassau Countyâ&#x20AC;&#x2122;s South Shore â&#x20AC;˘ Level III Neonatal Intensive Care Unit â&#x20AC;&#x201C; Specialists in High-Risk Pregnancy â&#x20AC;˘ Newly Renovated Womenâ&#x20AC;&#x2122;s Imaging Center â&#x20AC;&#x201C; Latest Technology, Spa-Like Atmosphere, Next-Day Appointments *As ranked by HealthGradesÂŽ, the leading healthcare ratings organization

Physician Referrals:

Convenient Free Parking 1000 N. Village Ave., Rockville Centre â&#x20AC;˘ www.MercyMedicalCenter.info â&#x20AC;˘ A Safe Haven For Newbornsâ&#x20AC;&#x201D;Legal Option To Abandonment

516-62MERCY

May 5, 2011 â&#x20AC;&#x201D; HERALD COMMUNITY NEWSPAPERS â&#x20AC;&#x201D; GOOD HEALTH

'LDEHWLF

21

Good Health May 2011  

Good Health May 2011

Read more
Read more
Similar to
Popular now
Just for you