Page 1

t(pK

.omisi Pembsrantasan KoruPsl

4

:i

-t*

" UNTUK KEADILAN'

PENDAPAT/TANGGAPANPENUNTUTUMUM TERHADAP NOTA KEBERATAN (EKSEPSI) TIM PENASIHAT HUKUM TERDAKWA H.M. RUSLI ZAINAL ATAS SURAT DAKWAAN NOMOR: DAK-2912411A;NU3

pekanbaru,

Nmvrn]qr./u

B Affi+

2013


KPK

KOMISI PEMBEMNTASAN KORUPSI REPUBLIK INDONESIA

"Llntuk Keadilanl' PENDAPAT / TANGGAPAN PENUNTUT UMUM TERHADAP NOTA KEBERATAN (EKSELS.llTIM PENASIHAT HUKUM TERDAKWA HM. RUSLIZAINAL lrns SURAT DAKWAAN NoMoR : DAK.29/2411012013

Majelis Hakim Yang kami muliakan, hormati' saudara Tim Penasihat Hukum dan Terdakwa yang kami kepada Majelis Terlebih dahulu kami menyampaikan ucapan terima kasih untuk menyampaikan Hakim yang telah memberikan kesempatan kepada kami Terdakwa pendapat / tanggapan atas nota keberatan (eksepsi) penasihat'hukum Rabu' tanggal 13 HM. RUSLI ZAINAL yang dibacakan pada persidangan hari Nopember 2013.

/

tanggapan atas keberatan yang mengatur tentang dimaksud, terlebih dahulu kami akan mengutip ketentuan Undang-Undang materi pokok keberatan / eksepsi sebagaimana diatur dalam yaitu Pasaf iSO ayat (1) yang Nomor 8 Tahun 1981 tentang Hukum Acara Pidana,

sebelum kami menguraikan pendapat

berbunyi sebagai berikut

'.

"Dalam hat terdat<wa atau penasihat hukum mengaiukan

keberatan bahwa

maka setelah diberi pendapatnya' Hakim kesempatan kepada Penuntut lJmum untuk menyatakan mengambil keputusan"' mempertimbangkan keberatan tersebut untuk selaniutnya pasal 156 ayat (1) KUHAP tersebut, dapat

Berdasarkan ketentuan

dipahami bahwa materi pokok keberatan meliputi tiga hal, Yaitu

/ eksepsi terah ditentukan

secara limitatif

:

a)KewenanganPengadilandalammengadiliperkara;

b) Dakwaan tidak daPat diterima c) Surat dakwaan harus dibatalkan ;

dan M. YahYa HarahaP, dalam bukunya : Pembahasan Permasalahan Kasasi dan PeneraPan KUHAP : Pemeriksaan Sidang Pengadilan, Banding,


7

Peninjauan Kembali,

penerbit Sinar Grafika, Jakarta, halaman 123 s/d

menguraikan tentang Materi Eksepsi rneliputi a. EksePsi Kewenangan Mengadili

133'

:

b. Eksepsi Kewenangan Menuntut Gugur; yaitu c. Eksepsi Tuntutan Penuntut umum Tidak Dapat Diterima,

:

1.

Eksepsi pemeriksaan penyidikan tidak memenuhi syarat ketentuan

Z.

Ekrupri

Pasal 56 aYat (1) KUHAP'

ptt"ii(t.an

tidak memenuhi syarat klacht delict'

dalam bentuk d. Eksepsi Lepas dari segala tuntutan hukum' Putusannya memutuskan putusan akhir, tentu saja setelah memeriksa pokok perkara dan on stagh van rechtsvervolging'

e. Eksepsi Dakwaan tidak dapat diterima' meliputi

:

l.Eksepsisubiudice,tindakpidanayangdidakwakansedangdalam

2. 3.

terg antung Pemeri ksaannYa;

grcepiio in'prrtonun, dakm dal<waan terkandung enor in persona' yaitu dakwaan *sepii xetiru sistematika da4waan subsidiaritas, nerneituk subsidiaritas yang yt9t.9nooa.r sistimatika : Menempatkan ancaman dakwatan tindak pidana'yanA lebih serius atau lebih berat pidananya padaposlsi dakwaan Primer' . ,- ^,^...^ , ,^,,!, lebih tepat M.v"ivu-iuiunip aaii hat ini menyatakan bahwa Hakim error' menafsirkan keketiruui ,,rturan dakwaan ini sebagai 'clerical persidangan' (Xesaliinan pengetikan). Hakim dapat meluruskan dalam p,ertim bangan putu san me ntgen ai letak a u, iiiuiir[nia- dije t aikan d at am posrs titriun sistimatika dal<waan lang s.emestinya' Dengan

demikian sekiranya Hakim menemukan sistimatika

4.

dakwaan legal 'formalistic suOsiiritas yang ieliru, tidak pertu bersikap terlampau / thinking', tetapi cukup

meluruskannya'

yang diaiikan, yaitu d9l<w1an.Y'g me7tirya diajukan berbentuk t<umitasl tetapi aiaiuXan dalam bentuk subsidiaritas bahwa atuu'ielnZii;i" M. yahya Hara-hap datam hat ini menyata4anberbiaya demi menegakkan asas peradilan yang sederhana, cepat dan ringan, htaxli* tiaaX patut bersikap itrict law dan formalistic legalthinking untukmenlatuhkanputusanyangmenyatakandal<tuaantidakdapat diterima. tebih tepat dan Oilahiana apabita kekeliruan itu disikapi Ketiru-nentuk

dal<waan

deng;; jui",n

'imelenturkai" penafsiran bahwa dakwaan itu

didekonstruksi. f

. Eksepsi Batal Demi Hukum, dimana dakwaan tidak memenuhi ketentuan pasall43ayat(2)KUHAPdianggapobscuurlibeti(kabur)atauconfuse (membingungkan) atau misleading (menyesatkan), yaitu meliputi beberapa bentuk:

1)Dakwaantidakmemuat.tanggaldantandatangan';

2)

Dakwaan tidak menyebut secara lengkap identitas terdakwa;


a

3) 4)

Tidak menyebut locus delictidan atau tempus delicti; Tidak cermat, jelas dan lengkap uraian mengenai tindak pidana yang didakwakan.

M. Yahya Harahap dalam hal ini menyatakan bahwa dakwaan memuat: Semua unsur delik harus disebut satu persatu;

a.

Pengertian cermat, lengkap dan jelas dalam unsur yang bersifat alternate: tidak mutlak mesti. menyebut keseluruhan, bisa satu saja asal jelas. Sekiranya penuntut umum lalai tentang hal itu, tidak berakibat surat

b.

dakwaan menjadi kabur atau menyesatkan kepada terdakwa garis besamya Cara terdakwa melakukan tindak pidana cukup disebutkan

saja, asal dari uraian itu terang dan jelas mengungkapkan begaimana cara tindak pidana pidana dilakukan;

c.

pidana. Menyebut keadaan (circumstances) yang melekat pada tindak

oleh Menurut Buku pedoman Pembuatan Surat Dakwaan yang diterbitkan jelas dan Kejaksaan Agung Republik lndonesia, 'hal 14-16, pengertian cermat,

lengkap dirumuskan sebagai berikut : ,,yang dimaksud dengan cermat adalah

ketetitian Jaksa Penuntut lJmum dalam yang mempersiapkan surat dakwaan yang didasarkan kepada undang-undang serta tidak terdapat kekurangan dan atau kekeliruan yang

:

bertaku bagi terdakwa, antara dapat mengakibatkan batalnya surat dakwaan atau tidak dapat dibuftikan lain misatnya : Apakah ada pengaduan datam hat delik aduan, apakah penerapan hukum / ketentuan pidananya sudah tepat, apakah terdakwa dapat

dipertanggungiawabkan melakukan tindak pidana tersebut, apakah tindak pidana tersebut sudah atau belum kadatuwarsa dan apakah tindak pidana yang didakwakan ltu nebis in idem.

yang diniaksud dengan jetas

adal1h

:

Jaksa Penuntut lJmum harus mampu

merumuskan unsur-unsur detik yang didakwakan sekaligus mempadukan dalam dengan uraian perbuatan materiit (takta) yang dilakukan oleh terdakwa surat dakwaan.

yang dimaksud dengan tengkap adalah : uraian surat dakwaan harus mencakup semua unsur-unsur yang ditentukan undang-undang secara lengkap"'


7

Surat Edaran Jaksa Agung Republik lndonesia Nomor: SEoo4lJ.N11l1ggg tanggal 16 Nopember ',1993 pada intinya menyatakan secara materiil surat dakwaan dipandang telah memenuhi syarat apabila telah memberikan gambaran secara bulat dan utuh tentang

1.

:

Tindak pidana Yang didakwakan; Siapa yang melakukan tindak pidana tersebut;

2. 3. Dimana tindak Pidana dilakukan; 4. Bilamana/kapan tindak pidana dilakukan: 5. Bagaimana tindak pidana tersebut dilakukan; 6. Akibat yang ditimbulkan tindak pidana tersebut; 7. Apakah yang mendorong Terdakwa melakukan

tindak pidana tersebut (delik-

delik tertentu);

S.Ketentuan-ketentuantindakpidanayangditerapkan. Dengan mempedomani ketentuan sebagaimana tersebut di atas, maka kami Penuntut Umum dalam kesempatan ini memberikan pendapal I tanggapan

atas nota keberatan yang diajukan Tim Penasihat Hukum terdakwa sepanjang dalam Pasal materi keberatan masih merupakan lingkup sebagaimana ditentukan di 156 ayat (1 ) Undang-undang Nomor I Tahun 1981 tersebut di atas'

Majelis Hakim Yang kami muliakan, Saudara Terdakwa dan Tim Penasihat Hukum yang kami hormati' I

setelah kami mendengar dan mempelajari secara seksama

nota

pokoknya sebagai keberatanieksepsi Tim penasihat Hukum Terdakwa, yang pada berikut: I

l.

PENDAHULUAN yang menguraikan bahwa:

-

Terdakwa retatif betum lama meniabat Gubernur Riau pada saat menandatangani Keputusan pengesahan BKUPHHK-HT, di Krininatisasi pengesahan BKUPHHK-HT oteh KPK hanya dikhususkan PloPinsi Riau,

-

Haphat yang sifatnya teknis terkait pengesahan BKIJPHHK-HT adalah domain peiabat teknis bukan domain Terdakwa,


7

tr.

suhada Tasman sebagai peiabat teknis menyeret Terdakwa selaku

Gubernur untuk terlibat dalam pengesahan BKUPHHK'HT'

yang Pengesahan BKTJPHHK-HT oleh Terdakwa merupakan persoalan berkaitan dengan Beteid yang termasuk dalam tingkup hukum administrasi negara,

KPK tidak mengkriminatisasi perusahaan-perusahaan yang menurut KPK diperkaya oleh Para terPidana, Terdakwa telah memberikan rambu-rambu melalui sK Gubernur, sehingga petanggaran administrasi dan pidana terhadap isi SK Gubernur adalah tanggung iawab si Pelanggar.

T*rh"dap materi keberatan I eksepsi ini kami berpendaPat sebaoai berikut: Bahwa dari poin-poin keberatan yang diuraikan oleh Tim Penasihat Hukum Terdakwa secara panjang" lebar dalam Bab I Pendahuluan dari dan halaman 1 s/d 10 Nota Keberatan, dengan tidak mengurangi rasa hormat penghargaan atas upaya Tim Penasehat Hukum untuk melakukan pembelaan atas terhadap terdakwa, kami tidak akan menanggapi secara keseluruhan tepat materi keberatan tersebut. Menurut kami materi keberatan tersebut tidak disampaikan dalam materi keberatan, karena hal tersebut tidak termasuk keberatan sebagaimana dimaksud Pasal 156 Syat (1) KUHAP,

materi

yang melainkan materi keberatan tersebut merupakan bentuk pembelaan pledoi prematur dan lebih tepat disampaikan sebagai materi pembelaan atau asumsi setelah pemeriksaan pokok perkara karena materi tersebut hanyalah dan pendapat sepihak Tim Penasehat Hukum, sehingga untuk membuktikan suatu apakah yang disampaikan Tim Penasehat Hukum tersebut merupakan demikian kebenaran perlu diuji dalam perneriksaan pokok perkara' Dengan BAB keberatan Tim Penasihat Hukum Terdakwa yang disampaikan dalam I

Pendahuluan sudah selayak untuk dikesampingkan'


7

il.

KEBERATAN YURI.DIS

1.

(halaman 2'40 Pasal yang didakwakan dalam surat Dakwaan Kesatu

suratdakwaan)adalahmerusakBangunanTeoriHukum. pada halaman 1 1 s,d 13 Nota Keberatan Tim penasehat Hukum umum telah terdakwa menyatakan pada pokoknya bahwa: Penuntut dengan menganggap menyusun kesalahan Terdakwa dengan formulasi Pasal tJndang'undang korupsi tetah terjadi kesesuaian pemenuhan unsur 2 ayat (1) jo. Pasal pada pokoknya adalah: Kesatu - Primair: Pasal

yang

lsUtJRlNomor3lTahunlgggsebagaimanatetahdiubahdanditambah

denganUURtNomor20Tahun200ldanSubsidair:Pasal3jo.PasallS UlJRtNomorSlTahunlgggsebagaimanatetahdiubahdanditambah penyusunan dan dengan uLJ Rt Nomor 20 Tahun 2001. Walaupun umum' Tim pemitihan bentuk surat dakwaan ini adatah domain Penuntut penyusunan surat dakwaan yang Penasehat Hukum keberatan dengan pada dirinya karena terdakwa sebagai pejabat yang melekat

demikian,

dan sarana, tentu setelah melalui sarana adan benar secara teori hukum, iika dakwaan kepada

kewenangan, kesempatan pembuktian,

TerdakwatersebutdibuatdatambentukAlternatifyangdiawalidengan adalah Pasal 2, dakwaan Kesatu Primair adatah Pasa: 3 ATAU Subsidair quo penuntut umum tetah ketiru memahami esensi pasal 2 dan Pasal 3, a penyalahgunaan wewenang sehingga merusak bangunan teori mengenai bestanddeel delict (pasat 3) dan mtelawan hukum (pasat 2) terkait dengan

(delik

inti)'

Terdakwasebagaipejabattidakseharusnyadalamperkaraini undang' menggunakan Pasal 2 baru kemudian Pasal 3

didakwa dengan

pendapat ahli hukum unaaig korupsi, sebagaimana beberapa teori dan ahli terdahulu Nur Basuki yang mengembangkan pendapat dari beberapa

(Moetyatno,AndiHamzah,lndriyantoSenoAdji),membedakanrumusan dalam perbuatan penyatahgunaan wewenang (species) adatah termasuk melawan hukum (genus)"' dst'


Terhadap materi keberatan

/ eksepsi ini kami berpgndapat sebagai

berikut: Bahwa kami menghargai sudut pandang, teori dan pendapat hukum yang dijadikan argumen dalam materi keberatan yang diajukan oleh Tim

Fenasihat Hukum, namun kami tidak sependapat dengan dalil keberatan serta landasan teori yang dikemukakan Tim Penasehat Hukum, karena menurut kami keberatan tersebut dilandasi dengan teori penyusunan surat dakwaan yang benar mengenai bentuk-bentuk surat dakwaan antara lain dakwaan Subsidiaritas, dakwaan Kumulatif, dakwaan Alternatif, maupun dakwaan Kombinasi atau CamPuran.

Bentuk surat dakwaan Kesatu yang disusun oleh Penuntut Umum adalah berbentuk subsidiaritas, dimana berdasarkan pendapat Selamat Purba, SH dalam bukunya Mencegah Batalnya $urat Dakwaan Demi

Hukum, Penerbit CV Sumber llmu Jaya, Jakarta, Hal. 14 maupun buku Pedoman Pembuatan Surat Dakwaan Kejaksaan Rl (Jakarta : April 1985)'

dinyatakan bahwa ...Dalam surat dakwaan, didakwakan beberapa perumusan tindak pidana, dan perumusan itu disusun secara bertingkat dari dafuvaan yang pating berat sampai daktaan yang paling ringan. Jadi pada hakekatnya, dalam bentuk surat dakwaan subsidiair ini, hanya satu tindak pidana saia yang sebenarnya akan didakwakan kepada

terdakwa. Berdasarkan doktrin tersebut menurut kami penyusunan surat dakwaan Kesatu yaitu Primair: melanggar Pasal 2 ayat (1) dan Subsidair: melanggar Pasal 3 tersebut sudah tepat karena perbuatan yang didakwakan hakekatnya adalah satu perbuatan namun dapat diterapkan dua pasal yang berbeda dan ancaman yang berbeda pula. Dengan mengacu pada aspek berat ringannya ancaman hukuman antara pasal 2 ayat (1)dan Pasal 3 UU No 31 Tahun 1999 jo UU No 20

tentang Pemberantasan Tindak Pidana Korupsi, maka penerapan Pasal 2 ayat (1) sebagai dakwaan Primair dan pasal 3 sebagai

Tahun

2OO1

dakwaan Subsidiair sudah tepat mengingat ancaman pidana dalam Pasal

2

ayat (1) lebih berat.

Pendapat Tim Penasehat Hukum, Terdakwa yang menyatakan dalam penyusunan surat dakwaan didasarkan pada sudut pandang Genus


7

dan Spesies suatu tindak pidana adalah pendapat yang tidak berasalan karena tidak didasari teori penyusunan surat dakwaan. Mengenai apakah perbuatan terdakwa yang didakwakan merupakan suatu perbuatan

melawan hukum sebagai genus atau perbuatan penyalahgunaan Wewenang karena Jabatan selaku gubernur sebagai spesies, masih memerlukan pembuktian berdasarkan alat bukti yang akan diajukan di persidangan dalam pemeriksaan pokok perkara, Berdasarkan uraian kami

di atas maka keberatan Tim

Penasihat

Hukum Terdakwa haruslah ditolak.

2.

Penulisan Singkatan BKUHPHHK'HT yang salah. pada halaman 14 Nota Keberatan Tim Penasehat Hukum Terdakwa ...Dalam dakwaan Kesatu Primair halaman 4 dan Subsidair halaman 24 misatnya, ditulis BKT-UPHHKHT, kemudian pada dahuaan Kesatu Primair Hat. 10 dan Subsidair hal. 38 misalnya ditulis mendalilkan bahwa

:

UBKT U7HHKHT, dan pada halaman berikutnya kedua singkatan ini sering ditulis dalam surat dakwaan, walaupun kadang'kadang Penuntut Umum menulis singkatannya BK UPHHKHT. Kamiferus terang tidak memahami

maksud kepaniangan dari BKT-IJPHHKHT dan UBKT UPHHKHT? Mengapa Penuntut tJmum tidak konsisten saia menuliskan BK UPHHKHT?

apa

Kpts 151/2003 tidak menyingkat Bagan Keria Usaha Pemanfaatan Hasil Hutan pada hutan tanaman dengan singkatan BKT'UPHIIKHT dan UBKT UPH H KHT melainkan disingkat dengan BKUPHHK-HT.

Penulisan singkatan BKUHPHHK-HT yang salah tersebut di atas menjadikan surat dakwaan tidak cermat sehingga surat dakwaan harus dinyatakan batal demi hukum.

berikut: Bahwa masalah penulisan istilah BKT - UPHHKHT dan UBKT UPHHKHT di dalam surat dakwaan oleh Penuntut Umum yang dinyatakan

Tim Penasehat Hukum menyebabkan dakwaan disusun secara tidak cermat adalah tidak tepat. Pengertian istilah cermat dalam penyusunan


7

surat dakwaan adalah: ketelitian Jaksa Penuntut Umum

dalam

mempersiapkan surat dakwaan yang didasarkan kepada undang-undang

yang bertaku bagi terdakwa, serta tidak terdapat kekurang?n dan atau keketiruan yang dapat mengakibatkan batalnya surat dakwaan atau tidak dapat dibuktikan.... (vide Buku Pedoman Pembuatan Surat Dakwaan yang diterbitkan oleh Kejaksaan Agung Republik lndonesia, hal 14-16).

Menurut kami Penulisan istilah BKT

-

UPHHKHT dan UBKT

-

UPHHKHT di dalam surat dakwaan bukanlah masalah cermat atau tidak

dalam penyusunan surat dakwaan. Yang terpenting adalah apakah perbuatan terdakwa yang didakwakan adalah perbuatan yang dilarang oleh

Undang-undang. Sedangkan mengenai produk perbuatan terdakwa yang dirumuskan dalam surat dakwaan oleh Penuntut Umum dengan istilah BKT

UPHHKHT

dan UBKT

UPHHKHT

tidak signifikan

untuk

dipermasalahkan sebagai alasan dakwaan disusun secara tidak cermat. Terlebih lagi berdasarkan dokumen-dokumen alat bukti yang akan diajukan dipersidangan berupa Pertimbangan teknis dan Nota dinas Kadishut terkait permohonan Bagan Kerja Tahunan Usaha Pemanfaatan Hasil Hutan Kayu

Hutan Tanaman (BKT-UPHHKHT) juga ditemukan istilah UPHHKHT dan UBKT

BKT

- UPHHKHT.

Berdasarkan uraian kami

di atas maka menurut kami alasan

keberatan Tim Penasehat Hiukum tidak termasuk materi keberatan sebagaimana dimaksud dalam pasal 156 ayat (1) sehlngga tidak perlu dipertimbangkan dan harus dinyatakan ditolak.

3.

Penulisan RKT-UPHHKHT yang tidak cermat. Masih pada halaman 14-15 Nota Keberatan Tim Penasehat Hukum Terdakwa mendalilkan bahwa Dalam dakwaan Kesatu Primair halaman 17

dan subsidair halaman 36 ditulis dan menyebutkan Pengesahan RKTUPHHKHT perusahaan-perusahaan yang lokasi areat kerjanya di wilayah

Kabupaten Siak, padahal dalam perkara ini terdakwa didakwa telah mengesahkan BKUPHHK-HT bukan RKT-UPHHKHT. Kpts 15112003 membedakan antara BKUPHHK-HT dengan RKT-UPHHKHT. Menurut ketentuan di atas pembedaannya sangat jelas yaitu kalau BKUPHHK-HT

disahkan atau diberikan jika pemegang IUPHHKHT belum memiliki


RKUPHHK

dan latau

RKLUPHHK

I

(pertama), sedangkan untuk

RKTUPHHK-HT disahkan atau diberikan jika pemegang IUPHHK-HT telah memiliki RKTUPHHK-HT.

Penulisan dan penyebutan RKT-UPHHKHT dalam surat dakwaan adalah tidak cermat, oleh karena itu suiat dakwaan harus dinyatakan batal demi hukum.

berikut: Bahwa dalam hal ini perlu kiranya Tim Penasihat Hukum Terdakwa membaca secara utuh dan menyeluruh surat dakwaan Penuntut Umum,

agar diperoleh pemahaman yang utuh pula. Dimana sejak awal hingga akhir penyusunan surat dakwaan, penuntut umum telah secara konsisten mendakwakan bahwa perbuatan terdakwa terkait dengan pengesahan BKUPHHKHT sebagaimana ketentuan Keputusan Menteri Kehutanan No.

terkait dengan adanya penulisan RKT-UPHHKHT dalam surat dakwaan, menurut kami hal 151/Kpts-lll2OO3 tanggal 02 Mei 2003" Kalaupun

tersebut sebenarnya mempunyai arah yang sama dengan pengertian dan makna BKUPHHKHT karena sebagaimana diuraikan dalam surat dakwaan primair halaman 19 dan surat dakwaan subsidiair halaman 39 dinyatakan

...terdakwa menerbitkan Surat Keputusan Gubbrnur Riau

No.

KPTS,324N/2004 tanggal 10 Mei 2004 tentang Pengesahan Bagan Keria lJsaha Pemanfaatan Hasil Hutan Kayu Hutan Tanaman (BKUPHHKHT)...'

selain itu RKT dan BK-UPHHKHT memiliki fungsi yang sama sebagai dasar untuk melakukan kegiatan operasional di areal IUPHHKHT dalam tahun yang dimohonkan, sehingga hal tersebut hanya merupakan clerical error dan tidak mempunyai implikasi yuridis dalam pembuktian perkara a

quo. Dengan demikian kami berpendapat bahwa materi keberatan Tim penasihat Huku,m Terdakwa terlalu berlebihan, sehingga haruslah ditolak.


4.

Ketentuan

di

Bidang Kehutanan yang didalrwakan tidak relevan

dengan perbuatan terdakwa. Mengacu pada surat dakwaan Kesatu Primair halaman 2 sld 23 dan

subsidair halaman 23, maka Tim Penasehat Hukum Terdakwa pada halaman 16-17, mendalikan bahwa Dakwaan dalam perkara ini adalah tentang pengesahan BKUPHHKHT, yang mana hanya berkaitan dengan Keputusan Menteri Kehutanan No. 151/Kpts-ll/2003 tanggal 02 Mei 2003

tentang Rencana kerja, Rencana Kerja lima Tahun, Rencana Kerja Tahunan dan Bagan Kerja Usaha Pemanfaatan Hasil Hutan Kayu pada

Hutan Tanaman (Kpts 15112003), sebagaimana diakui sendiri oleh Penuntut Umum dalam Dakwaan Kesatu Primair hal18 s/d 19 dan Subsidair hal. 38.

Adapun Keptusan Menteri Kehutanan lainnya juga Peraturan pemerintah No. 34 Tahun ZOf{Ouaa pokoknya adalah berkaitan dengan penerbitan IUPHHKHT, sehingga tidak relevan untuk didakwakan karena

dalam perkara ini Terdakwa Selaku Gubernur Riau tidak menerbitkan IUPHHK-HT.

Disamping itu Tim Penasehat Hukum terdakwa juga mendalilkan bahwa Penuntut Umum mendakwa Terdakwa dengan peraturan Menteri Kehutanan No. P.43/Menhut-ll/2005 tanggal 26 Desember 2005 adalah lnkonstitusional, karena Peraturan Menteri Kehutanan tersebut tidak dapat diberlakukan retroaktif terhadap peristiwa yang berlr,{grrng pada bulan Pebruari s/d April 2004 dan bulan Mei 2004 ketika terdakwa, selaku

Gubernur Riau mengesahkan BKUPHHK-HT atas nama 8 (delapan) perusahaan yang areal kerjanya berada di wilayah Kabupaten Pelelawan dan 1 (satu) perusahaan yang berada di Kabupaten Siak. Dengan demikian, sebagai akibat dari dakwaan yang mendasarkan pada ketentuan di bidang kehutanan yang tidak relevan dengan perbuatan terdakwa adalah surat dakwaan harus batal demi hukum'

t1


7 H' & &l Fi

F *,

Terhadap materi keberatan

/ eksepsi ini kami herpendapat sebasai

berikut: Bahwa menurut Tim Penasihat Hukum Terdakwa kurang memahami konstruksi surat dakwaan yang dibangun oleh Penuntut Umum. Dalam hal ini, perlu kami sampaikan bahwa Terdakwa didakwa sebagai pihak

pengesah atas BKUPHHKHT, dimana pengesahan BKUPHHKHT tidak dapat dilakukan tanpa mendasarkan pada adanya ljin Usaha Pemanfaatan

Hasil Hutan Kayu Hutan Tanaman (IUPHHKHT) yang diterbitkan oleh Bupati. Sementara IUPHHKHT yang diterbitkan oleh H. Tengku Asmun Jafar selaku Bupati Pelelawan dan Arwin AS selaku Bupati Siak telah

melanggar ketentuan-ketentuan kehutanan diantaranya Kepmenhut 21lKpts-|l1r2001 dan Peraturan Pemerintah 1 0.1/Kpts-all2}O}, ffiRmenhut

No. 34 Tahun

2W/

(perkaranya telah diputus oleh pengadilan dan putusan

telah memperoleh kekuatan hukum tetap). Dengan demikian berlaku teori conditio sine quanon (syarat tanpa mana tidak), aftinya bahwa perbuatan terdakwa selaku pengesah BKUPHHKHT tidak akan terjadi tanpa adanya perbuatan Bupati selaku penerbit IUPHHKHT. Dan peraturan-peraturan

tersebut tidak ditujukan kepada perbuatan Terdakwa melainkan kepada perbuatan para Bupati yang telah menerbitkan IUPHHKHT. Dan dalam dakwaan perkara a quo, Terdakwa didakwa secara bersama-sama dengan para Bupati melakukan tindak pidana a quo. Sehingga sudah seharusnya peraturan-peraturan tersebut dicantumkan dalam surat dakwaan.

Kemudian terkait dengan pencantuman peraturan Menteri Kehutanan No. P.43/Menhut-ll/2005 tanggal 26 Desember 2005 dalam surat dakwaan, Penuntut Umum hanya bertujuan untuk menjelaskan bahwa Permenhut tersebut merupakan perubahan Keputusan Menteri Kehutanan No. 151/Kpts-lltz}Og tanggal 02 Mei 2003, bukan bertujuan untuk mendalilkan sebagai dasar hukum perbuatan Terdakwa berte.ntangan dengan peraturan tersebut dalam surat dakwaan

a quo.

Apabila Tim Penasihat Hukum Terdakwa mencermati uraian fakta perbuatan dalam surat dakwaan, tidak ada satupun uraian fakta perbuatan Terdakwa yang bertentangan dengan dasar aturan dimaksud, selain

daripada Keputusan Menteri Kehutanan No. lStifpts-lt/2003 tanggal 02


7

Mei 2003 (tihat surat dakwaan hal 12, hal 19, hal 31, hal 39). Sehingga

menurut kami keberatan Tim Penasihat Hukum Terdakwa yang menyatakan Penuntut Umum telah menerapkan aturan secara inkonstitusional dan retroaktif tidak beralasan

dan

mengada-ada, dengan

demikian sudah seharusnya alasan keberatan tersebut dinyatakan ditolak.

Penuntut Umum Mengaburkan Peristiwa yang berkaitan dengan surat Kepala Dinas Kehutanan Prop, Riau, Syuhada Tasman kepada Menteri Kehutanan.

Pada halaman 17 s/d 18 Tim Penasehat Hukum terdakwa mendalilkan bahwa dalam surat dakwaan Kesatu Primair halaman 18 dan

Subsidiair halaman 37 s/d 38, yang pada pokoknya menyatakan: lr. Syuhada Tasman atas permohonan penilaian dan pengesahan UBKT UPHHKHT.....Kemudian meminta petunjuk ke Departemen Kehutanan Rl mengenai sah atau tidaknya perizinan IUPHHKHT di Propinsi Riau, yang kemudian dibalas oleh Menteri Kehutanan yang intinya Surat Keputusan (SK) IUPHHKHT yang ada di Propinsi Riau dinyatakan tidak sesuai dengan ketentuan yang berlaku......dst." Kami meragukan bahwa surat dimaksud

benar-benar ada, karena identitasnya yaitu Nomor, tanggal surat dan perihalnya tidak disebutkan dalam dakwaan. Apa masalahnya, jika penuntut umum secara terbuka menyebutkan secara jelas identitas surat dimaksud

Menguraikan dakwaan sebagaimana tersebut di atas adalah sama saja dengan mengaburkan peristiwa yang sesungguhnya terjadi, atau surat

dakwaan disusun secara tidak jelas dan kabur sehingga mengakibatkan surat dakwaan harus batal demi hukum.

Terhadap materi keberatan

/ eksepsi ini kami berpendapat

sebaqai

berikut:

. Bahwa alasan keberatan yang meragukan adanya surat Menteri Kehutanan yang intinya Surat Keputusan (SK) IUPHHKHT yang ada di

Propinsi Riau dinyatakan tidak sesuai dengan ketentuan

yang

berlaku......dst, menurut kami tidak tepat sebagai'alasan keberatan atas I3


7

d'aru'-7.'4 iq5-

l@

Penuntut Umum karena hal tersebut merupakan ranah pembuktian berdasarkan alat bukti dalam pemeriksaan pokok perkara. Dengan demikian alasan keberatan Tim Penasehat Hukum Terdakwa tersebut harus ditolak.

6.

Penyebutan tempat keJadian perkara yang tidak cermat.

Pada halaman 19 Tim Penasehat Hukum terdakwa mendalilkan bahwa Penuntut Umum secara jelas telah bertindak tidak cermat dalam menyebutkan tempat kejadian perkara di Loby Hotel Sultan Jakarta Pusat,

yang notabene tidak ada sangkut pautnya dengan perkara

ini.

Ketidakcermatan dalam dakwaan yang menyebutkan tempat kejadian perkara padahal sebenarnya tempat kejadian perkara tersebut tidak ada relevansinya dengan perkara ini mengakibatkan surat dakwaan harus batal demi hukum.

Terhadap maleri keberatan /. ekpepsi ,i,rli kami berpendapat sebaqai berikut: Berkenaan dengan nota keberatan

ini, kami Penuntut

Umum

berpendapat bahwa Tim Penasihat Hukum Terdakwa kurang cermat dalam memahami konstruksi surat dakwaan yang dibangun oleh Penuntut Umum

terkait dengan penerimaan uang US $ 200.000,- (dua rratus US dollar). Dalam hal ini, perlu kami sampaikan bahwa berdasarkan rangkaian fakta hukum yang nantinya lebih detail akan dibuktikan di persidangan bahwa

Lobby Hotel Sultan Jakarta adalah tempat pertemuan Lukman Abbas dengan Judhi Priyadi hendak menerima penyerahan uang US $ 200.000,-

(dua'ratus US dollar), sebelum akhirnya uang tersebut diserahkan kapada Kahar Muzakir melalui Asistennya yakni Wihaji alias Aji. Dengan adanya fakta hukum yang demikian tidak berarti bahwa pencatuman Lobby Hotel Sultan Jakarta dalam surat dakwaan tidak ada sangkut pautnya dengan perbuatan Terdakwa Rusli Zaenal yang berakibat surat dakwaan batal demi hukum sebagaimana dalil Tim Penasehat Hukum Terdakwa, karena ada tidaknya sangkut paut Lobby Hotel Sultan Jakarta dengan perbuatan Terdakwa akan dibuktikan dalam pemeriksaan pokok perkara.

t4


7

Berdasarkan uraian kami di atas, materi keberatan Tim Penasihat Hukum Terdakwa sudah seharusnya ditolak.

7.

Dakwaan Tidak Cermat dalam membuat perincian sehingga mencapai

jumlah US$ 850,000.00. Pada halaman 19 s/d 20 Nota Keberatan, Tim Penasehat Hukum

Terdakwa mendalilkan bahwa dalam surat dakwaan kedua Primair halaman 49 dan subsidair hal. 61 menyebutkan: " Setelah uang terkumpul

seluruhnya sejumlah kurang lebih US$ 850,000.00 selanjutnya Lukman Abbas pada tanggal 24 Pebruari 2012..... dst." Uang tersebut kemudian diserahkan kepada Anggota DPR Kahar Muzakir, Yang hendak ditekankan dalam keberatan ini adlah bagaimana asal muasal sehingga bisa terkumpul uang sejumlah US$ 850,000.00? Bahwa dengan demikian dakwaan perkara ini telah {isusun secara tidak cermat'yaitu tidak memerinci secara benar uang yang telah diterima

oleh Lukman Abbas sehingga bisa mencapai sejumlah US$ 850,000.00, oleh karena itu surat dakwaan harus batal demi hukum.

Terhqdap m?tefi keEe{atan./ eksepsi irli kami berpendapat sebaqai berikut: Berkenaan dengan Nota Keberatan mengenai jumlah uang yang

tidak sesuai dengan uang sejumlah US$ 850,000.00 tersebut,

kami

Penuntut Umum berpendapat bahwa Tim Penasehat Hukum Terdakwa terlalu kaku dan salah dalam memakna kata "senilai uang US$ 850,000.00" yang terdapat dalam surat dakwaan. Makna kata "senilai" menurut Kamus

Besar Bahasa lndonesia Pusat Bahasa Edisi keempat Departemen Pendidikan Nasional, PT Gramedia Pustaka Jakarta, 2008 mempunyai arti (dl arti taksiran harga); sebenarnya tidak ada ukuran yang pasti untuk

menentukan. Dalam hal ini, kalaupun terjadi selisih jumlah adalah merupakan hal yang wajar, sepanjang selisih tersebut tidak begitu jauh dengan jumlah yang telah disebutkan ukurannya yakni US$ 850,000.00.

Dalam menguraikan surat dakwaan atas nama Terdakwa HM. Rusli Zainal ini, angka senilai US$ 850,000.00 diperoldh berdasarkan alat-alat


7

bukti pengeluaran uang dari pihak-pihak yang memberikan uang yang tidak

seluruhnya dalam mata uang Dollar AS, sebagaian lainya dalam mata uang Rupiah yang kemudian ditukarkan dengan mata uang Dollar Amerika

Serikat. Tempat penukaran uang .(money changer) maupun Kurs (nilai mata uang) yang dipergunakan pun berbeda-beda tiap Money Changer. Dalam hal ini kami selaku Penuntut Umum tidak bisa mempergunakan patokan nilai kurs yang pasti sebagaimana yang dipergunakan oleh Tim Penasehat Hukum Terdakwa berapa kurs nilai Dollar pada saat itu. Oleh

sebab itulah Penuntut Umum mempergunakan kata "Senilai" di depan jumlah uang US$ 850,000.00 yang bermakna kurang' lebih US$ 850,000.00.

Pokok dari konstruksi surat dakwaan Penuntut Umum bukanlah Jumlah yang pasti berapa uang yang diterima oleh Terdakwa Rusli Zainal

melalui Lukman Abbas dalam mata uang Dollar AS akan tetapi tentang adanya penerimaan uang itu sendiri. Berkenaan dengan jumlah uang US$ 850,000.00 Penuntut Umum telah mendalilkan secara rinci dalam surat

dakwaan asal-usul uang sehingga mencapai jumlah senilai US$ 850,000.00. Untuk membuktikan berapa Dollar uang yang diterima Terdakwa Rusli Zainal dan asal-usul jumlah uang senilai US$ 850,000.00

akan dibuktikan dalam pemeriksaan pokok perkara. Dengan demikian alasan keberatan Tim Penasehat Hukum Terdakwa tersebut harus f

dinyatakan ditolak.

Ketidakcermatan dalam Dakwaan Terdakwa Rusli Zaenal dikaitkan dengan dakwaan Lukman Abbas. Pada halaman

20 std 21 Nota

Keberatan, Tim Penasehat Flukum

terdakwa mendalilkan bahwa berkaitan dengan dakwaan kedua, perkara

yang didakwakan kepada Terdakwa Rusli Zaenal adalah sama persis dengan yang didakwakan kepada Lukman Abbas, yang terlebih dahulu diputuskan oleh Pengadilan Tindak Pidana Korupsi pada Pengadilan Negeri, Pekanbaru. Kafena sama persis peristiwannya, maka seharusnya

tidak terjadi perbedaan anatar kedua perkara dimaksud. kenyaataannya terd apat perbed aan-perbed aaan.

Pada


7

Ketidakcermatan dalam menyusun Dakwaan terakwa Rusli Zaenal

yang notabene sama persis dengan dakwaan Lukman

Abbas,

mengakibatkan Dakwaan harus dibatalkan.

Terhadap ,materi keberatan berikut:

/ ehsepsi ini kami berpendapat sqbqqai

Berkenaan dengan Nota Keberatan ini, kami Penuntut Umum berpendapat bahwa Tim Penasehat Hukum Terdakwa tidak cermat dalam rnembaca kedua dakwaan baik dakwaan atas nama Terdakwa Rusli Zainal

dan dakwaan atas nama Lukman Abbas. Apabila Tim Penasehat Hukum

Terdakwa cermat dalam membaca dan memahami kedua dakwaan tersebut tentu dapat memahami esensi dari penyusunan dakwaan atas nama Terdakwa Rusli Zainal maupun dakwaan atas nama,Lukman Abbas,

karena memang diantara keduannya tidak ada perbedaan

fakta

sebagaimana yang dikemukakan oleh Tim Penasehat Hukum Terdakwa. Dasar penyusunan surat dakwaan atas nama Terdakwa Rusli Zainal adalah fakta hukum yang sama dengan fakta hukum yang dipergunakan

dalam penyusunan dakwaan atas nama Lukman Abbas. Penuntut Umum

sengaja menyusun tidak sama persis antara dakwaan atas nama Terdakwa Rusli Zainal dengan dakwaan atas nama Lukman Abbas, karena

dalam penyusunan surat dakwaan atas nama Terda{wa Rusli Zainal ini Penuntut Umum harus menekankan uaraian perbuatan-perbuatan tertentu

yang relevan dengan perbuatan Terdakwa, yang terpenting uraian dalam

surat dakwaan atas nama Terdakwa Rusli Zaenal tidak menghilangkan esensi fakta hukum adanya perbuatan bersama-sama antara Terdakwa Rusli Zainal dengan Lukman Abbas.

Hal demikian ini adalah kewenangan Penuntut Umum

untuk

menguraikan perbuatan mana yang relevan atau tidak relevan dengan perbuatan terdakwa. Selain itu perlu juga dipahami bahwa dakwaan suatu perkara bukan pedoman/ukuran untuk menyusun dakwaan perkara lain

untuk menentukan batal atau tidaknya suatu surat dakwaan. Dengan demikian alasan keberatan Tim Penasehat Hukum Terdakwa harus ditolak.

t7


7 F F $

f

%

r T

i

9.

Kekeliruan dalam Penerapan Pasal 55 KUHP tentang Penyertaan (deelneming).

ffi t.il

Pada halaman 21 sld 22 Nota Keberatan, Tim Penasehat Hukum terdakwa mendalilkan bahwa pen-juncto-an kedua pasal tersebut dengan pasal 55 ayat (1) KUHP adalah penerapan pasal yang keliru dalam surat dakwaan ini, sebab Pasal 55 ayat (1) KUHPidana dengan jelas menyatakan bahwa "Dipidana sebagai pembuat tindak pidana", mereka yang melakukan (plegen), yang menyuruh lakukan (doen plegen), dan

yang turut serta melakukan (medeplegen), sedangkan dalam perkara pidana a quo, baik dalam perkara kehutanan dimana lr. Syuhada Tasman,

dkk dan dalam perkara PON Dimana Lukman Abbas dkk berada dalam kapasitas saksi dan bukan terdakwa, sehingga seluruh dakwaan Penuntut Umum dalam perkara A quo tidak dapat menggambarkan peran-peran dari

para pelaku tindak pidana dalam, kapasitasnnya sebagai orang yang melakukan, yang menyuruh lakukan dan turut serta melakukan.

Berkenaan dengan Materi Keberatan ini, kami Penuntut Umum berpendapat bahwa Tim Penasehat Hukum Terdakwa telah salah dalam menafsirkan penerapan ketentuan Pasal 55 KUHP dalarrrr suatu konstruksi surat dakwaan. Pendapat Tim Penasehat Hukum Terdakwa yang menyatakan dengan penerapan Pasal 55 KUHP, maka para pihak tersebut harus sama-sama sebagai terdakwa adalah pendapat yang keliru dan tidak berdasar.

Pencantuman Pasal 55 KUHP dalam surat dakwaan menunjukan bahwa terdakwa dalam mewujudkan tindak pidananya tidak sendiri-sendiri

melainkan ada kawan peserta, sehingga yang menjadi titik berat adalah

adanya kerjasama dengan orang lain atau kawan peserta dalam mewujudkan tindak pidana dan tidak diharuskan bersama-sama diajukan sebagai terdakwa dalam satu surat dakwaan. Dan hal tersebut sudah lazm dalam praktek peradilan dan dikuatkan dalam berbagai Yuriprudensi.

18

*$

# ffi tr

$

t 'l


Sedangkan mengenai kapasitas Terdakwa apakah selaku orang yang melakukan (pteger), atau menyuruh lakukan (doen pleger) atau Turut serta

melakukan (mede pteger) akan dibuktikan dalam pembuktian pokok perkara.

III.

PERMOHONAN. Berdasarkan keseluruhan uraian di atas, maka sudah sepatutnya Majelis

Hakim yang mulia menolak seluruh keberatan dari Tim Penasihat Hukum Terdakwa

tersebut karena surat dakwaan yang dibuat dan diajukan dalam perkara a quo telah memenuhi syarat formil dan syarat materiil sebagaimana dimaksud dalam Pasal 143 ayat (2) huruf a dan b KUHAP dan tidak ada alasan yuridis yang menghalangi kewenangan penuntut umum untuk mengajukan penuntutan terhadap diri Terdakwa HM. RUSLI ZAINAL..

Majelis Hakim yang Kami Muliakan, Saudara Terdakwa dan Tim Penasihat Hukum yang kami hormati. Berdasarkan uraian-uraian yang telah kami kemukakan tersebut, maka

kami mohon kepada Majelis Hakim yang memerikSa, mengadili dan memutus perkara ini untuk

1.

'

i

Menolak seluruh keberatan yang diajukan Tim Penasehat Hukum Terdakwa.

2.

Menyatakan surat dakwaan telah memenuhi syarat formal dan materiil sebagaimana ditentukan dalam Pasal 143 ayat (2) huruf

a dan huruf

b

KUHAP dan secara hukum surat dakwaan sah untuk dijadikan dasar pemeriksaan perkara ini;

3.

Menetapkan pemeriksaan perkara initetap dilanjutkan

l?

i,.1 on,e

dn

ti

Sahn"l''r

l(Vr'..ur t9

/v(-

TcardPr

Z

'

Profile for Senarai ID

Tanggapan JPU atas Eksepsi Rusli Zainal  

Tanggapan jaksa penuntut umum KPK atas nota keberatan (eksepsi) tim penasehat hukum Rusli Zainal

Tanggapan JPU atas Eksepsi Rusli Zainal  

Tanggapan jaksa penuntut umum KPK atas nota keberatan (eksepsi) tim penasehat hukum Rusli Zainal

Advertisement