Page 1


staff SEGUNDA ÉPOCA (AÑO 5) NÚMERO 34

Nos desalambró Queríamos escucharlo. Aquel 22 de febrero de 1981, nadie ignoraba –entre los periodistas– que se venían tiempos distintos. Los patéticos relatos de José María Muñoz y sus imitadores eran algo así como “el realismo nacionalista”. Todo patriotismo, todo oficialismo, todo oscuridad. Cero vanguardia, cero libertades, cero poesía, cero imaginación. Descubrir al otro relator, el que venía de Uruguay, con fama de “enemigo” nuestro, era una obligación para los jóvenes cronistas que asomábamos a una prensa que parecía extraída de la edad de piedra. El relato (Boca-Talleres) nos llegaba con un sabor misterioso. No sólo era la voz, también huían las frases hechas. No sólo era la voz, también se encontraban por primera vez lenguaje y literatura. No sólo era la voz, también las metáforas parecían inagotables. No sólo era la voz, también la alegría recobraba su coraje. De pronto, un gol de Brindisi (Boca ganaría 4 a 1, con dos goles del ex Huracán). La radio traía un gol. No lo veíamos a Brindisi. Sólo arribaban palabras y palabras del relator uruguayo. Palabras que, de pronto, nos concedieron la imagen que no estaba en nuestras retinas. Brindisi y sus brazos en alto en esa extraña posición de ángel que tomaba. Brindisi y la búsqueda de una tribuna enloquecida, porque era un Boca distinto, era el Boca de Diego Maradona, por primera vez. Entre Brindisi y la gente, el alambre. Una escena propicia para el reflejo talentoso. Y Víctor Hugo invoca la letra de una canción, “a desalambrar, a desalambrar”. El joven cronista no entiende. No sabe de Viglietti. No sabe de la canción prohibida. Un redactor con más años, y troyana militancia comunista, desasna: “este tipo es un capo, está relatando con canciones censuradas de Viglietti”. Pasaron treinta años. El relator es compañero después de haber sido colega; pasaron algunos momentos desgarrados, pero muchos más al lado del mismo fuego y la misma vereda, peleando por libertades, justicias, vientos de igualdad. Quizás cuando nos crucemos con él podamos buscar, entre los abrazos por sus treinta años, la mejor manera de agradecerle el bendito día en que vino a desalambrarnos. Pablo Llonto

CONSEJO DE DIRECCIÓN Alejandro Caravario Christian Colonna Pablo Cheb Terrab Mariano Hamilton Pablo Llonto Matías Martin Fabián Mauri Víctor Hugo Morales Ralph Rothschild Ariel Senosiain Adrián Soria SECRETARIO DE REDACCIÓN Pablo Llonto DIRECCIÓN DE ARTE Alicia Sliwkin EDITOR DE FOTOGRAFÍA Fabián Mauri CORRECCIÓN Alejandro Lingenti COLABORAN EN ESTE NÚMERO Ezequiel Acuña, Rolando Andrade, Pablo de Biase, Diego Bonadeo, Damián Cáceres, Carlos Carpaneto, Diego Corpacho, Pablo Dondero, Alejandro Fabbri, Germán Ferrari, Ignacio Fusco, Francisco Giovanoni, Luciana Gutierrez, Luis Herr, Guillermo Herrero, María Fernanda Mainelli, Ezequiel Fernández Moores, Edgardo Imas, Román Iucht, Julián Lichene, Alejandro Lingenti, Gustavo Lombardi, Hernan López, José Mendez, Fernando Pacini, Sebastián Prats, Juan Ignacio Provéndola, Hugo Ramos, Hernán Tainovich, Gustavo Veiga, Fernando Vergara, Leandro Vila, Alejandro Wall, Osvaldo Alfredo Wehbe, Photogamma.com DEPARTAMENTO COMERCIAL info@sentidos.com - 5983.2700 www.revistauncaño.com.ar www.facebook.com/revistauncanio correodelectores@revistauncanio.com.ar IMPRESIÓN Kollor Press S.A. Uruguay 124 -Bs.As-4116-3598/3599/3601. DISTRIBUCIÓN EN CAP.FED Y GRAN BS.AS Sanabria S.R.L Baigorri 103. Capital Federal. 4304-3510. DISTRIBUCIÓN EN INTERIOR Distribuidora Austral de Publicaciones S.A. Isabel la Cátolica 1371, Cap.Fed. 4301-0701. Esta publicación es propiedad de EAMP S.A, Uruguay 1037 7º Piso. Prohibida su reproducción parcial o total. Registro de la propiedad intelectual, en trámite.

ILUSTRACIÓN DE TAPA Sebastián Domenech

MARZO 2011 | UN CAÑO 3


Blas larga vida

Dentro de un fútbol cada vez más impaciente (en Huracán, a Miguel Brindisi no le dieron ni tres fechas de chance), Blas Armando Giunta acumula una marca peculiar. El hombre que entusiasmaba tanto con su entrega a los hinchas de Boca se ha convertido hoy en el DT con mayor permanencia ininterrumpida en una institución del fútbol argentino. Por HERNÁN LÓPEZ Foto HUGO RAMOS

“En Europa se manejan de otra manera, el técnico es prácticamente el presidente del club. Allá se les tiene otro respeto por los entrenadores. Acá, ese tema está deteriorado; echan a uno y al otro día meten a otro en la cancha. El fútbol argentino es así, le hicieron creer a la gente que lo más importante son los resultados”, afirma Blas Giunta, DT de Almirante Brown (Primera B Nacional) mientras no dejamos de pensar en las referencias obligadas del escocés Sir Alex Ferguson, al frente del poderoso Manchester United desde noviembre de 1986, o del holandés Johan Cruyff, quien se mantuvo ocho años consecutivos como entrenador del Barcelona entre 1988 y 1996. Ni el propio Giunta se imaginó que aquel sábado 17 de septiembre de 2005, cuando Almirante derrotaba 2 a 1 a Atlanta en cancha de Ferro, marcaría el comienzo de un vínculo tan largo. “Me siento un privilegiado, porque en Almirante Brown siempre respaldaron todo el trabajo que hicimos”. Y no es para menos. Con el club de La Matanza, Giunta ascendió al Nacional B en la temporada 2006/2007, luego de ser campeón de la Primera B Metropolitana. Descendió al año siguiente, producto de un descuento de 18 puntos debido a los graves incidentes durante la final ante Estudiantes de Buenos Aires, a pesar de realizar una excelente campaña que lo hubiese depositado en una de las dos promociones para ascender a Primera División. No obstante, y fiel a su estilo aguerrido y tenaz, Giunta fue por más y devolvió al club a la segunda categoría del fútbol argentino tras arrebatarle el título a Sarmiento de Junín. Si de números se trata, durante marzo Giunta llegará a los 250 partidos al frente de Almirante, disputados a lo largo de cinco años y medio sin ningún tipo de interrupciones. Más números: el 10 de marzo cumplirá dos mil días como entrenador del mismo equipo. Récord difícilmente de igualar en los tiempos que corren. Un verdadero ejemplo deportivo-institucional para la totalidad del fútbol nacional.

4 UN CAÑO | MARZO 2011

Para Giunta, la fórmula parece sencilla: “hay que apoyar más allá de los resultados. Acá en Brown, si en algún momento tambaleamos, yo no me sentí de esa manera, porque siempre sentí el apoyo de la dirigencia. Conozco lo que es el club, a los jugadores, lo que es el hincha... Eso te va llevando a perdurar”. Si bien Almirante Brown lucha hoy por no perder la categoría, desde hace rato los hinchas del Mirasol se acostumbraron a modificar el tradicional: “Giunta/ Giunta/ Giunta/ huevo/ huevo/ huevo”, que lo acompañaba desde la época en la que supo vestir la azul y oro, por el más gratificante “que de la mano/ de Blas Armando…”, teniendo en cuenta que, desde su arribo, la institución siempre se mantuvo en los puestos de vanguardia. “Seguir unido a Brown es muy hermoso. Porque yo también soy del barrio (vive en Lomas del Mirador), y para mí es una satisfacción muy grande poder disfrutar con toda la gente este logro personal de estar hace tanto tiempo ligado al club. Los vecinos y la gente del barrio me demuestran su afecto permanentemente, y eso también me da más fuerzas para seguir adelante y, por qué no, para soñar con ver algún día a Almirante en Primera”. Durante el último receso de verano, fue su propio nombre el que sonó como candidato a sentarse por primera vez en su carrera en el banco de un equipo de Primera. “Estoy esperando una oportunidad así”, afirmó en más de una ocasión. Sin embargo, cada vez que se cayó una posibilidad, Giunta no se desvió de su camino: “tal vez sea ahora, mañana o pasado, no lo sé, pero sí sé que el momento va a llegar. No estoy desesperado. Yo sigo trabajando… En algún momento se van a ir abriendo puertas. Sigo caminando despacio, tranquilo, y sabiendo que alguna oportunidad voy a tener. Yo sé que puedo dirigir tranquilamente a cualquier equipo de Primera. En el Ascenso es mucho más difícil: aprendés a lidiar con muchas cosas que en la A te las sirven en bandeja. Acá tenés que pelearla... Igual, ahora estoy en Almirante y lo respeto mucho por todo lo que me dio”.


Te mata en el alargue

En la tercera división de Gales, hay un equipo que se llama –¿estás preparado?– Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. Y todo porque, según cuenta la leyenda, los autores del nombre del pueblo querían que su estación de trenes se destacara por tener el nombre más largo de toda la red ferroviaria del Reino Unido. Lo lograron. Por GUILLERMO HERRERO

P

ara que nadie se atreva a sugerir que Un Caño es una revista de cabotaje, en este número expandimos las fronteras y decidimos investigar sobre el origen del nombre de un club de la tercera división de Gales. Un club que se llama… Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. Sí, el nombre más largo del mundo, dale campeón, dale campeón. Una frondosa sucesión de vocales y consonantes, una sopa de letras. Fundado en 1899, y como sucede en otros lugares, el nombre del club fue tomado del nombre del pueblo, cuya traducción al español significa “la iglesia de Santa María ubicada en el hueco del avellano blanco, cerca del torbellino rápido y de la figura de San Tisilio de la gruta roja”. Un vaso de agua a la derecha. O, por qué no, una ambulancia. ¡Qué desafío extremo para las hinchadas! ¿Cómo se hace para cantar “sí, sí, señores, yo soy de la iglesia de Santa María ubicada en el hueco del avellano blanco...”? Digo: ¿cómo se hace para cantar y que no termine el partido antes de llegar a la segunda estrofa? Así como cualquiera podría pensar que este maratón fonético salió de una mente proclive a los discursos infinitos como la de Marcelo Bielsa, la leyenda dice que los autores del nombre de este pueblo galés de 3.000 habitantes pretendían que el cartel de su estación de trenes se destacara por tener “el nombre más largo de toda la red ferroviaria del Reino Unido”. La historia de la humanidad: a ver quién la tiene más larga. Claro, para evitar que el Víctor Hugo galés se descompense al decir “la lleva Terry Williams, barrilete cósmico del Llanfairpwllgwyng…”, los dirigentes decidieron abreviar el nombre y lo que eran cincuenta y ocho caracteres se redujeron a doce. Así,

el club también se conoce como el Llanfairpwll FC. Imaginemos este diálogo con un movilero de radio: –Sí, muy buenas tardes a toda la audiencia, acá estamos con Denis Stracqualursi, capitán del Llanfairpwll FC. ¿Por qué no vas a jugar el domingo? –Vengo de hacerme un electroencefalograma y me han detectado un esternocleidomastoideo en la zona del cuello por exceso de ciclopentanoperhidrofenantreno. –¡Qué mala noticia! ¿Dónde estará la clave del partido, entonces? –En que a mis compañeros no se les ocurra hacer dos cortas y una larga. ¡Son todas largas o nos vamos al descenso! –Gracias, Stracqualursi. Muy amable. –Gracia a vo’, y hasta siempre. Además de jugar con camiseta naranja, como si fuera la Holanda de Robben, el Llanfairpwll FC se caracteriza por disputar un torneo en otro ámbito, el de la actualización permanente en el libro Guinness de los Records. Allí aparecen nombres tan o más extensos que el del club galés. En Nueva Zelanda, por ejemplo, y en lengua maorí, existe una montaña que se llama “Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu”. Es record mundial: ochenta y siete letras. También, y si bien no está incluido en el Guinness porque ya dejó de usarse, el nombre original de Bangkok, en Tailandia, era más largo todavía, de ciento sesenta y tres caracteres: “Krungthepmahanakornamornratanakosinmahintrayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit”. Larga, la bocha. En la literatura también se consigue, diría el Ratón Ayala. En el 392 a. C., en su comedia Las Asambleístas, Aristófanes inventó una palabra de 183 letras para referirse a un plato de comida que incluía “todos los ingredientes”. Y que en este caso no lo vamos a transcribir por cuestiones de espacio. En fin, minucias que nos sirven para acompañar el relato sobre el Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. Un equipo imbatible si se define en el alargue.


Una promesa y un suspirar

A los 33 años, David Trezeguet, el delantero francés criado en la Argentina y que nos regaló la sensación de ser parte del campeón mundial ‘98, anda por Alicante. Juega en el Hércules y aún tiene aspiraciones de volver a ponerse la camiseta azul. Para responder a esas inquietudes acerca de dónde están algunos jugadores a los que les perdimos la pista, van estas líneas. Por FERNANDO VERGARA

–¿Hace mucho que no vas a Villa Martelli? –Mis amistades y mi familia están ahí. Cuando voy, lo primero que hago es caminar, ver a la gente que me vio crecer, ir a Platense… Me da placer visitar Argentina. Hace dos años que no puedo ir, por mis tiempos. Quiero llevar a mis hijos para que vean dónde creció su padre. David Trezeguet nació en Francia, y se enorgullece de “estar entre las veinte personas más amadas” del país que lo vio Campeón del Mundo en 1998 y de la Eurocopa en 2000. Pero no olvida que vivió su infancia y buena parte de la adolescencia en Martelli. Vertiginosamente, debutó en Primera a los 16 años, y con 17 emigró al Mónaco. “Ahora estoy jugando en Hércules, el Platense de España. Cuando viajo, me encanta ir a ver al Calamar. Pero me apena, porque yo conocí a un club organizado, disciplinado, con su historia, y la última vez que fui la cancha estaba destrozada, el estadio vacío. Incluso tengo amigos que no van mas a verlo, porque no les gusta el futbol que practica”, le cuenta el delantero a Un Caño. –¿Sentís Argentina como tu casa o tu hogar es en Francia? –Mi manera de pensar, de ver las cosas y mi mentalidad es 100% argentina, y no tengo dudas de que seguirá siendo así. Conocí todo tipo de puntos de vista, me casé en Europa, mis dos hijos nacieron en Francia, claro que la adaptación fue importante… Pero todo lo que aprendí fue en Argentina. –¿Qué te llevó a jugar en España? –Después de diez años en Juventus, tenía ganas de conocer el torneo español. Necesitaba cambiar, y pasar de un gran club a otro con ambiciones diferentes: es todo más familiar y tranquilo, sumado a que mi esposa Beatriz nació acá, en Alicante. Me va bien, metí varios goles. El objetivo principal era tratar de jugar, y en Italia no lo hacía. Elogia a Messi: “es el mejor, tiene ese toque sudamericano especial”, y afirma que Barcelona es un equipo único. “Pero la Liga es

8 UN CAÑO | MARZO 2011

despareja, sólo acá el campeón termina con 105 puntos”, resalta. –¿Entraste en la curva final de tu carrera como jugador? –Todavía tengo ganas de seguir, estoy bien física y mentalmente. En Hércules, la presión que conocí en otros lugares no existe. Necesitaba volver a sentirme importante, marcar goles nuevamente, demostrarme que podía adaptarme a esta Liga, y lo estoy haciendo; logrando eso, mis objetivos empezarán a crecer: antes de retirarme deseo regresar a un equipo que pelee arriba. –¿Te gustaría volver a Argentina? –No me siento en deuda, pero volver sería la frutilla del postre. Es un sueño por cumplir, porque allá nunca pude mostrarme a un cierto nivel. Pero quiero ganar un título, y me da igual con quién sea. Antes debo saber qué objetivo tiene ese club. Si River me brinda eso, tendrá la prioridad, porque es el equipo del cual soy hincha. Pero no le cierro la puerta a nadie. Mi amigo Camoranesi volvió a Lanús y le dieron un discurso claro: quieren ganar algo. Yo pienso lo mismo. Y es un sueño, más que una realidad. Porque a veces los contratos pertenecen a las entidades y no a los jugadores, y en ese caso debo decidir junto con el Hércules. Verón, Ronaldinho, Roberto Carlos son ejemplos de futbolistas consagrados en el Viejo Continente con posterior retorno a Sudamérica. “Es que en los últimos años cambió la mentalidad. Lo que hizo Verón es único. Y no vuelven a su país de vacaciones, eh”, avisa. Pero hace hincapié en algo que –en un potencial regreso– lo diferenciaría de los demás: “en Argentina, paso desapercibido, camino tranquilo, soy uno más. No tengo una imagen de lo que represento, porque me fui de chico y no me conocían”. –¿Tu ciclo en la Selección francesa está terminado? –Lo estuvo con Domenech, pero no me gustó irme así. Ahora está Blanc, que me conoce: si necesita a uno con experiencia, como pasó con Palermo en Argentina, estoy disponible. ¿Brasil 2014? Je, sería increíble. Pero pongo objetivos más cortos: la Eurocopa 2012 podría ser.


s a b r e y s a r t O

TI INGEN DRO L N A J E Por AL

TEATRO/ GRUPO KRAPP

Variaciones sobre la muerte “La muerte siempre estuvo presente en nuestros trabajos anteriores. Siempre hablamos de eso y pensamos en función de eso, aunque nunca tan directamente. Esta vez nos hicimos cargo de manera más contundente y clara. Quizás porque estamos más grandes, quizás por la baja de uno de nuestros integrantes el año pasado, quizás por una sucesión de hechos desafortunados que tenían en primer plano a la muerte, o por todo a la vez”, dice Luciana Acuña, una de las integrantes del Grupo Krapp, un colectivo de bailarines, actores y músicos (Acuña, Luis Biasotto, Gabriel Almendros, Edgardo Castro, Fernando Tur) que viene trabajando desde el año 2000 en lo que ellos definen como “nuevas formas de expresión”. Adonde van los muertos (lado B), el espectáculo que acaban de estrenar, empieza con una serie de testimonios sobre la muerte. Hablan unas cuantas personas, hombres, mujeres y chicos de diferentes edades. Esos testimonios tienen diferentes matices, pero el efecto que produce su acumulación es de una leve angustia. De repente, la obra cambia de rumbo y aparece una serie de escenas que combinan la destreza física, el ingenio y el humor, lo que descomprime un poco la asfixia inicial. “No hay en esta obra menos humor que en las anteriores. Pero hay otras cosas que hacen que el humor no esté en primer plano todo el tiempo. La muerte es solemne y el exceso de solemnidad también es gracioso” agrega Acuña, que cita al grupo La Pista 4 como influencia importante para los Krapp. Biasotto, que dirige la obra con Luciana, dice que “Krapp tiene varias etapas; en sus inicios, fueron importantes los trabajos de la alemana Pina Bausch y del grupo argentino La Pista 4. No creo que tengamos nada muy parecido al trabajo de ellos, pero sí los admirábamos. Puede sonar pretensioso, pero también creo que los trabajos de gente como Andy Warhol y Marcel Duchamp son importantes para nosotros. Son herramientas de estudio, no sólo por lo que hicieron, sino también por el entorno que se generó a su alrededor. Igual, yo soy de la idea de que todo te influye, desde artistas importantes como esos hasta una señora que vende flores. Todo el tiempo nos estamos contaminando”.

10 UN CAÑO | MARZO 2011

Alejo Moguillansky, director de la película Castro, ganadora del premio mayor en la competencia argentina del Bafici 2009 y responsable del notable montaje de los testimonios sobre la muerte en la obra, cuenta que “las entrevistas se hicieron en un solo día. Un grupo muy grande de gente, alrededor de unas treinta personas, contestaron preguntas muy parecidas que giraban en torno a la relación de ellos con la muerte, con muertes cercanas, con su propia muerte. Duró varias horas. Fue un día tristísimo. Como casi todo proceso documental, no teníamos idea de cuál sería el resultado. Yo los veo como retratos de gente, alrededor de un único tema. No es exactamente el contenido de lo que dicen lo que le da precisión o ritmo a ese mini-relato audiovisual que inaugura la obra, sino la cadencia de cada persona, los silencios de algunos, la manera en que otros afrontan el asunto con humor, o las preguntas más raras e infrecuentes que suscita en cada uno eso tan abstracto y al mismo tiempo tan concreto que es morir. Todos los entrevistados saben que se van a morir, como todos nosotros. A partir de ahí, es una estructura sencilla de variaciones melódicas sobre ese fondo inerte y blanco que se muestra casi como un destino”. Todos los miércoles de marzo y el 6 de abril a las 21 en Espacio callejón (Humahuaca 3759)


MÚSICA

El bocón ataca de nuevo Pocos bocones están a la altura de lo que alardean. Mohammed Ali fue una de esas excepciones: un ego enorme, sí, pero a la altura de su impresionante talento. Kanye West es, claramente, lel sucesor de Ali en el mundo de la música. Con My Berautiful Dark Twisted Fantasy, este personaje que increpó a George W. Bush, se hizo implantes dentales con diamantes, armó un gran revuelo en la entrega de los MTV Awards y decidió comunicarse con los demás sólo por twitter y mail (¡no usa celular!) demuestra que tiene todo para ocupar el trono del rey del pop que dejó vacante su venerado Michael Jackson. El disco, de reciente aparición en Argentina, es un batido inflamable de soul, rock sinfónico, heavy, sonido FM, R&B y hasta música clásica. De algún modo, condensa sonora y líricamente lo que Kanye produjo en sus cuatro discos anteriores, todos excelentes, a la vez que ensancha los límites estilísticos y de género. La pregunta ahora es si podrá superar este paso de gigante.

LIBROS

Una vida peligrosa Suele ocurrir. Así como nuestro Andrés Calamaro brilla cada vez que se pone en la piel de cronista, el inoxidable Keith Richards la rompe en su autobiografía, que escribió con la colaboración de James Fox, periodista británico que trabajó durante años para el Sunday Times. En Vida, que ya se consigue en librería argentinas por 90 pesos (un precio bastante razonable teniendo en cuenta que son 500 páginas y que la calidad del material es alta), el guitarrista de los Rolling Stones contradice a la mayor parte de las memorias del rock and roll: en lugar de arrepentirse de su larga carrera como yonqui irredimible, la celebra con enorme gracia. Según Fox, quien escuchó a Richards y convirtió a sus relatos en este libro, el violero es un excelente narrador. Los pasajes dedicados a hablar estrictamente de música son imperdibles, así como el veneno volcado sobre la figura de Jagger, y todo con un humor irresistible. “El movimiento rastafari era una religión, pero una de fumadores de hierba”, cuenta Richards en el pasaje dedicado al viaje que los Stones hicieron a Jamaica para grabar Goats Head Soup. Imperdible.

MARZO 2011 | UN CAÑO 11


POLÉMICA EN EL BAR Por PABLO CHEB TERRAB

Fotos PHOTOGAMMA.COM

Messistas vs. tevistas

La elección de uno u otro de los grandes héroes futbolísticos argentinos del presente puede parecer una mera dicotomía deportiva, pero resulta devenir en algo más. Desde las elecciones recientes de Batista hasta la formación mundialista de Maradona, atrás de esos dos nombres aparecen dos maneras de entender la vida.

H

ace unos diez años, encerrado entre estudiantes de periodismo y volcado ligeramente hacia el tenis, creí haberme encontrado con la madre de todas las dicotomías deportivas. Me refiero a la división entre los hinchas de Gastón Gaudio (a partir de ahora, gaudistas) y los fanáticos de Guillermo Coria (coristas, lógicamente). Para encolumnarse detrás de una u otra corriente, no bastaba con apoyar una idea de juego. La identificación tenía que ver con una estética y hasta con un estilo de vida. Gaudio, descontracturado, algo canchero, talentoso y volátil, agrupaba a los bohemios y a los cazadores de fantasías. Coria, comprometido, laburante, exigente, con mentalidad de campeón, reclutaba a los pragmáticos. Los coristas eran ganadores naturales y recriminaban a los gaudistas: “perdedores”, les decían. La verdad, los daudistas lo llevaban con cierto orgullo. La actitud de los tenistas implicados acentuaba las distancias: su manera de vestir, de hablar, de comportarse fuera de la cancha, todo los iba separando. Para colmo, se llevaban mal. La línea que separaba a los partidarios era tan clara, tan precisa, que discutirla resultaba prácticamente absurdo. La antinomia llegó a su pico en la final de Roland Garros 2004, un partido que trascendía ese momento y

12 UN CAÑO | MARZO 2011

que, en retrospectiva, parece definir la carrera de ambos jugadores. Irónicamente, acaso, ganaron los perdedores para condimentar una revuelta de algo que ya no volvería a ser tan claro. Los bandos se mantuvieron, claro, pero el declive progresivo de los dos héroes de entonces hizo que se apagara aquel fogonazo. Desde ese momento hasta hoy no había existido una rivalidad que despertara ese tamaño de pasiones. Sin embargo, algunos acontecimientos recientes, futboleros y de Selección, revelaron un nuevo par de grupo partidarios cuya diferencia es tan sutil y tan magnífica que invita a estirarla al resto de los ámbitos de la vida. Se trata, nada menos, de los hombres que sostienen a muerte una pasión inagotable por Lionel Messi, y de aquellos otros que adoran hasta el cansancio a Carlos Tevez. Se trata de los messistas y los tevistas. TÉRMINOS Y CONDICIONES Algunas diferencias entre Messi y Tevez son evidentes. La cicatriz, Fuerte Apache, All Boys y La Boca identifican la infancia de un guapo criado entre codazos en los potreros: “el jugador del pueblo”. La Masía, Cataluña y un cóctel para las hormonas del crecimiento parecen definir mejor que Rosario, Newell’s

o Grandoli la experiencia científica para lograr que no se desperdicie un genio: “el mejor futbolista del mundo”. Uno es extrovertido, canta cumbia y sale en los diarios con la chiquita de Patito Feo. El otro, tímido, se clava los auriculares del iPod mientras mantiene cierta reserva en su vida privada. Uno confronta con declaraciones picantes, el otro elige frases de ocasión. Uno jura que nunca dejaría su club, el otro pasa al clásico rival sin ponerse colorado. Uno rinde como individualidad, desde el propio desorden que genera en las defensas. El otro se acopla como elemento de mayor valor en el juego ordenado de un conjunto superador. También parece claro que les cuesta complementarse futbolísticamente cuando comparten la cancha. Excepto en el buen amistoso ante España, Tevez siempre pareció incomodar a Messi. La sensación general es que se roban espacios mutuamente, que chocan más de lo que se asocian y que se entienden poco. Es lógico, porque entienden el juego (y la vida) de maneras distintas. Y esa noción alimenta la tentación de confrontarlos. Es necesario aclarar que no existe una pelea, una confrontación real ni nada por el estilo entre estos dos jugadores. Lo mejor de cada uno es la estela que dejan en un ámbito social que


en el peso individual y en el genio luchador, en las agallas, en el temple, en el liderazgo y en el carisma. Un hombre que profesa el culto a lo revulsivo. Diego es, quizás, el tevista máximo. Pero durante su época de DT en Argentina nunca lo pudo confesar. Lo dejó entrever, y con eso se ganó a parte del pueblo. Pero debía ser messista para ganarse a una mayoría y a un establishment inclinados hacia ese lugar. DOS HOMBRES, DOS ESTILOS

los idolatra: la diferencia entre ellos no parece ser tan insalvable como la que existe entre sus seguidores. Sin embargo, allí están, cada uno con un séquito a rastra. Los dos despertando idolatrías dispares. Uno por carisma y empuje y gol. El otro por su zurda maravillosa. La noción de estos dos bandos divergentes se la debemos al cachetazo reciente de Sergio Batista en una convocatoria a la Selección. Para jugar con Portugal, Tevez quedó marginado a pesar de un presente goleador de alto nivel en el Manchester City: ahí está, evidencia. Si uno mira un poquito para atrás, verá que Carlitos tampoco apareció en el duelo con Brasil. ¿Por qué? Simple: en la cabeza del cuerpo técnico argentino hay un hombre fanático del Barça, admirador de España, cultor del toque, que hace primar

14 UN CAÑO | MARZO 2011

al conjunto y que ama la genialidad sin esfuerzo. El Checho, señores, es un messista por excelencia. Del otro lado se para alguien como Maradona. Sí, claro. Para Diego, Tevez era titular, incluso cuando todas las evidencias señalaban otros planes. El diez: un hombre sanguíneo, popular, que cree

A partir de allí, uno puede entender mucho mejor quién estará de cada lado. Es casi obvio que Guardiola es messista, pero quizá no esté tan claro que Mourinho es tevista. Arsene Wenger, por ejemplo, debe ser messista. También Van Gaal, Cappa y el Flaco Menotti. En cambio, Queiroz, Scolari, Capello, Ancelotti y hasta Carlos Bianchi tienen toda la pinta de ser tevistas. Entre los futbolistas esto también corre la distinción. Dentro de la misma delantera, por ejemplo, el Burrito Martínez debe ser messista mientras Santiago Silva, de lejos, parece tevista. David Ramírez tiene estampa de messista, como Lamela, Erviti, Valeri o Menseguez. En cambio, Camoranesi, Pavone y Verón son tevistas. Estudiantes, en general es un equipo muy tevista, y diría que Boca también. Independiente es históricamente messista. Y no es sólo una cuestión de practicidad o estética. Explicarlo mejor resulta complicado. Los extremistas de uno y otro lado suelen generar su empatía con los dos modelos a partir del éxito. Está claro que ambos, Messi y Tevez, son efectivos

Excepto en el buen amistoso ante España, Tevez siempre pareció incomodar a Messi. La sensación general es que se roban espacios mutuamente.


y encuentran la génesis del fanatismo al encarnar un cierto costado de lujo. Además, es un error quedarse en el fútbol para evaluar el messismo y el tevismo. Incluso es un error reducirlo a un interés por Messi o por Tevez. La característica intrínseca trasciende con creces a los jugadores. Digo, por ejemplo, un hombre que le compra flores a su mujer y la lleva a pasear en el descapotable es tevista, más allá de sus filiaciones deportivas. El messista prefiere pedir comida, quedarse en casa y mirar una película. El tevista hace un asado para veinte (y probablemente invita él), y el messista cocina con receta para un reducido grupo de amigos cercanos. El messista toma vino, el tevista, cerveza. El tevista va al telo, el messista se siente más cómodo en su departamento. Hay profesiones tevistas, como la actuación, el management y la especia-

lización en cirugía de medicina; y otras messistas, como la ingeniería electrónica, la carpintería o el traductorado de una lengua muerta. Hay políticos tevistas y messistas. Películas messistas y tevistas. Canciones, programas de TV, ciudades… Las categorías son infinitas. Lo mismo pasa en la historia de la humanidad. Las grandes mentes han sido tevistas y messistas por siglos. Freud, Newton, Locke, Beethoven, Sócrates, Galileo, Monet: todos tevistas. Lacan, Einstein, Mozart, Baudrillard, Copérnico y Picasso: messistas. El periodismo también está lleno de messistas y tevistas. Por ejemplo, los que hacemos esta revista, sin preferencias por uno u otro futbolista, acarreamos con nuestra etiqueta. Puede apostar lo que quiera a que Pablo Llonto es tevista. También Mariano Hamilton. Alejandro Caravario es un messista a ultranza (aunque

él no lo sabe), casi tanto como Pablo De Biase. Christian Colonna y Fabián Mauri tienen elementos híbridos, pero diría que el primero tiende hacia el tevismo y el segundo hacia el messismo. Pacini, Wainraich, Fernández Moores: messistas. Veiga: tevista. Y yo… Bueno, creo que soy un messista con culpa. Es decir, sé que soy messista, pero me encantaría no serlo. Es como una especie de culpa de clase, algo así. La realidad es que es imposible ser un messista o un tevista puro. Uno puede reconocer aspectos de ambos estilos en diferentes aspectos de su existencia. Esta revista seguramente se incline hacia el tevismo. No podría explicar por qué. Es una sensación, un sentimiento genérico, un convencimiento finísimo. Me interesa muy poco, porque ahí reside lo mejor. Los invito a seguir categorizando desde esta subjetividad sin pruebas.

MARZO 2011 | UN CAÑO 15


De aquí y de allá

Los argentinos conocimos a Iturbe durante el último Sudamericano Juvenil. Cuando todos señalaban que debutaría en Quilmes, un fallo lo devolvió a Cerro Porteño. Sólo por unos meses… A mitad de año, se irá al Porto de Portugal. ¿Es paraguayo? ¿Es argentino? ¿Es un avión? ¿Es el Messi guaraní? Por LEANDRO VILA

E

l caso de Juan Manuel Iturbe es sólo un botón de muestra del entramado compuesto por representantes, padres, intermediarios y clubes que se ocultan detrás de las precoces gambetas de talentos adolescentes. En un año, 2010, y lo que va del 2011, el chico creció de golpe. Quienes lo conocen dicen que, pese a tener sólo 17 años, sabe demasiado de asuntos legales. Se instruyó sobre incisos y leyes más que el futbolista promedio. Y no es para menos. Los últimos seis meses los vivió más pendiente de una resolución del Tribunal Arbitral del Deporte (TAS) que le permitiera ponerse los cortos que de perfeccionarse técnicamente. Su peculiar historia esta plagada de idas y venidas. En cuestión de meses, jugó para las selecciones juveniles paraguaya y argentina, y hasta disputó un amistoso con la blanca y roja del Tata Martino, en noviembre de 2009. No tuvo impedimentos legales para hacerlo. Su doble nacionalidad (nació en Argentina, sus padres son paraguayos y se crió allá, en Paraguay) y el tiempo escaso que transitó en anteriores convocatorias a selecciones paraguayas se lo permitía. Sus buenos rendimientos obligaron a la dirigencia de Cerro Porteño a plantearse alternativas para retenerlo. El miedo a que alguna sociedad anónima deportiva de Europa se lo llevase los alarmaba. Por eso le pidieron a Iturbe que firmase un contrato que dejaba en manos del club sus derechos de formación. El chico, asesorado por su padre, se negó. La rebeldía fue castigada. Los dirigentes lo separaron del plantel. De entrada, Marcelo Betnaza, su antiguo representante, le aconsejó que no firmara nada. Luego se desdijo. Ahí la relación hizo un click, y al poco tiempo dejó de representarlo.

16 UN CAÑO | MARZO 2011

En simultáneo un nuevo actor entró en escena. Nada menos que José Luís Chilavert, quien le recomendó al volante que buscara club en Argentina. El pibe, según dijo Betnaza en abril pasado, estuvo entrenando en Vélez. Su entorno lo desmiente. Afirman que se trata de una falacia construida por algunos medios. En Liniers, obviamente, opinan lo mismo. De un día para el otro se lo vio entrenándose en el predio de Ezeiza con el seleccionado juvenil de Batista. Al poco tiempo, el Checho lo llevó al Mundial de Sudáfrica como sparring de la Mayor. Su carrera empezaba a tomar dimensiones inesperadas. Fue ahí cuando Gustavo Mascardi comenzó a representarlo. Algunos dicen que Chilavert le marcó el negocio. Otros lo niegan. Hasta ese momento, el pibe era un crack sin equipo. Los oficios del procesado ex gerenciador de Ferro le consiguieron club. No casualmente fue a parar a Quilmes, que es presidido por José Luís Meiszner, siempre proclive a cumplir los deseos de Julio Grondona, de buena relación con Mascardi. El volante sólo se entrenó dos meses en el cervecero. Nunca pudo jugar en Primera. El recurso presentado por Cerro Porteño ante el Tribunal Arbitral del Deporte (TAS) se lo impidió. Los hinchas de Quilmes no entendían qué había pasado y cómo su dirigencia había perdido la posibilidad de contar con una joya importante. Lo que sigue es la parte más conocida de la historia. La rompió en el Sudamericano Sub–20 jugado en Perú y fue comprado, a futuro, por el Porto portugués en 4 millones de euros. Seducido por jugar la Copa Libertadores, volvió al Cerro Porteño y debutó haciéndole dos goles al Colo Colo en la goleada por 5 a 2. En junio, nuevamente deberá abandonar Asunción. Esta vez no partirá rumbo a Ezeiza, sino con destino a Oporto, mientras espera ser citado a la Selección mayor (“ya decidí, jugaré para la Argentina. Los dirigentes paraguayos, cuando los necesité, se portaron mal”, declaró). De a poco, Juan Manuel Iturbe vuelve a pensar más en el fútbol y bastante menos en asuntos leguleyos.


El abuelo pone y saca

Aunque usted no lo crea, el hombre vive y tiene 95 años. Su palabra vale tanto en la FIFA que ya podemos ir asegurando quién será el próximo presidente de la máxima conducción del fútbol en el mundo. Preferimos no escribir su apellido. Total, es otro de los dinosaurios que emergen solitos de la memoria. Sí, volvió Joao... Por EZEQUIEL FERNÁNDEZ MOORES

E

l Mundial de Qatar, con el Golfo Pérsico en llamas, podría no ser el gran negocio que soñó Joseph Blatter cuando impulsó al reino como sede de la Copa de 2022. Nadie objetaba entonces a Qatar, ni siquiera Pep Guardiola o Zinedine Zidane, algunas de las figuras que cobraron millones a cambio de hacer campaña para apoyar la candidatura. Para Blatter, igualmente, el negocio ya está hecho: al fin y al cabo, él cumplió y fue clave para que Qatar ganara la sede. Blatter sabe que no será presidente de la FIFA en 2022. Sí tiene garantizada su nueva reelección para este año, aún cuando los clubes poderosos de Europa están cada vez más furiosos con él. Sucede que el eventual competidor, Mohamed Bin Hammam, es qatarí. Y todos saben que la imagen de los millonarios del Golfo Pérsico comienza a decaer ahora que los habitantes de la región reclaman democracia. Hasta 2015, Blatter completará diecisiete años en el trono. Garantizada la reelección, ahora quiere hacer lo mismo con su sucesión. Joao Havelange, quien precedió a Blatter de 1974 a 1998 (veinticuatro años), confirmó hace unas semanas que su ex yerno, Ricardo Teixeira, es “apto, correcto, culto y dedicado” y que es el gran candidato a reemplazar a Blatter. Además de yerno de Havelange, Teixeira es presidente de la Confederación Brasileña de Fútbol (CBF) desde 1989. Lo puso el suegro. Seguirá por lo menos hasta 2016, es decir, cumplirá veintisiete años en el cargo. Su eventual designación como presidente de la FIFA en 2015 dependerá seguramente del éxito o del fiasco del Mundial que se celebrará en Brasil un año antes. Para que todo salga bien, Teixeira no sólo será presidente de la CBF hasta 2016. También ya es presidente del Comité Organizador Local (COL) del Mundial 2014. La CBF, es decir Teixeira presidente, tiene el 99,99% del paquete accionario del COL. El

0,01 restante pertenece a Teixeira ciudadano. Situación de privilegio para un dirigente que está inhabilitado para firmar contratos con el poder público. La inhabilitación llegó a fines de 2010, después de catorce años de proceso judicial. En 1994, Teixeira había hecho pasar diecisiete toneladas de equipaje sin control aduanero cuando volvió de Estados Unidos, dándole a Brasil un Mundial después de veinticuatro años, el primero de la era post Pelé. La condena, que Teixeira sigue apelando en los tribunales, no es obstáculo para su promoción como patrón del fútbol de Brasil –golpeada hace unos días por una rebelión de los clubes que renegocian contratos de TV–, patrón del Mundial 2014 y posible futuro patrón de la FIFA. Tampoco son obstáculo las 2.400 páginas de dos Comisiones Parlamentarias Investigadoras (CPI) que elaboró el Congreso brasileño tras el Mundial de Francia ‘98, con graves denuncias de corrupción, que quedaron relegadas porque en la Copa siguiente, Corea-Japón 2002, Brasil volvió a salir campeón. Tampoco importó que el nombre de Teixeira fuera denunciado a fines de 2010 por la BBC como uno de los dirigentes FIFA supuestamente sobornados en la quiebra escandalosa de ISL. Los documentos de la quiebra exhibidos por la BBC evidenciaron numerosos pagos de ISL a las firmas Sicuretta y Sanud. Ambas aparecen en la CPI del Senado brasileño que había investigado unos años antes a Teixeira. “Es dinero de coimas”, me ratifica desde Inglaterra el periodista Andrew Jennings, principal investigador de la FIFA. Jennings todavía se refriega los ojos tras las últimas declaraciones de Havelange. “Blatter –dijo el brasileño– será reelecto en 2011, pero en 2015, si Dios quiere, será Ricardo (Teixeira). Si yo estoy vivo y con fuerzas, lo ayudaré”. Havelange, “el dirigente deportivo del siglo XX” –como lo anuncia un flamante libro autobiográfico en Brasil–, tiene 95 años. Nadie tiene dudas de que, aún muerto, estará haciendo fuerza por su querido ex suegro. MARZO 2011 | UN CAÑO 17


La usina de las infamias

La lucha contra los monopolios, y en especial contra el gran monopolio de prensa, ha enloquecido a los dueños del poder mediático. En su desesperación, contratan batallones de mercenarios dispuestos a lo peor. ¿Qué es lo que se viene contra quienes han dado pelea por la libertad de expresión? Por VÍCTOR HUGO MORALES

E

n las oficinas que el Grupo Clarín tiene en el barrio de San Telmo, jóvenes adherentes y soñadores de un trabajo que supere la estafa de las pasantías son la energía infantil con la que ese Grupo mantiene la usina de la infamia. Sin firma, aprovechando los tiempos informáticos de la época, se preparan allí los videos y los mensajes que intentan destrozar la credibilidad de los enemigos de la banda de Magnetto. Alguno consigue otro trabajo y, al cabo de un tiempo, avergonzado, hace la catarsis de los arrepentidos. Los videos son puestos sin firma o se recurre a personas ligadas al Grupo que los exhibe con el argumento de la curiosidad que los mismos conllevan. “Miren este video”, como diciendo qué cosas raras hay en este mundo, ¿no?; y ahí lo cuelgan, con la esperanza de la repetición que multiplica a los lectores. Otros andan a la búsqueda de cámaras ocultas, desvíos sexuales y contratación de prostitutas para “encarajinar” vidas y, de paso, chantajear a los desprevenidos o excesivamente confiados en sus dotes de seductor. Al principio, la agencia de la infamia funcionaba como una buena agencia de publicidad, pero ahora prepara mails de gente comprada por diez millones de dólares, denuncia compras de inmuebles en negro, insinúa delitos sexuales, amenaza con denuncias judiciales, escribe a los basurales de los lectores de los portales para denostar o defender, según los casos, al pie de las notas y comentarios que los mismos producen. Hay un aprendizaje que todos estamos haciendo. Este cronista suele decir, repetitivo, que si hubiese muerto hace cinco años –o hace dos, también–, habría dejado de existir una persona distinta a la actual. La Ley de Medios desquició a la sociedad y la pelea por Papel Prensa agudizo el enfrentamiento. La Ley de Medios produjo una síntesis en los pensamientos inevitablemente dispersos y cambiantes de otrora. Un asunto es discutir por la famosa 125, las candidaturas testimoniales, los

18 UN CAÑO | MARZO 2011

errores y aciertos del Gobierno, la corrupción siempre latente; y otra muy distinta es pelear por ese nuevo mundo que impulsa la ley pero que afecta posiciones dominantes, amenaza con la pérdida de cientos de canales robados gracias al fútbol, con la cárcel a quienes, nadando en sangre derramada, se quedaron con el papel de todos. Que no se culpe a nadie era el titulo de un cuento de Cortazar. Que no se queje nadie de los que se lanzaron a nadar con tiburones. A todos, no les queda otra que huir hacia adelante, entrenarse en la pelea en el barro, engrosar la piel para que le afecte menos cada embestida del adversario. Quizás el final del cuento de Julio (el hombre que se asfixia quitándose un pullover) sea el destino de estos medios que se han encerrado en sus propias mentiras. Cuando, en estos días, pretendiendo afectar al gobierno, se ponen del lado de la embajada estadounidense y su Departamento de Estado en el caso del avión, nadie puede menos que asombrarse por el daño que ellos mismos se provocan. Puede ocurrir también que como en el cuento Continuidad en los parques, este periodista no advierta que es a él a quien viene a matar el cuento que lee. Puede ser. La suerte está echada y si alguien se anima a cruzar el Rubicón, así sea con modestas armas, sabe que lo que el Grupo emperador castiga es eso. La osadía de pasar al otro lado del río, al territorio vedado de la discusión con los medios se paga con algún tipo de muerte, salvo que se tenga la suerte del César. Lo que puede celebrarse es el contexto diferente que tenemos hoy (contexto que deriva en otorgar subsidios y dinero) es que cuando se anuncia Deporte Para Todos, el escriba siente que algunos esfuerzos valieron la pena. Verlos ahora “consensuando” con el Gobierno a los que antes despreciaban las leyes tiene el sabor de un gol de media cancha. Por más que el partido esté muy lejos del final.


¿QUIÉN SE VA DE LA CASA AMARILLA?

Teatro de operaciones

De este lado, Riquelme, réplica gardeliana que se agigantada con la ausencia. Del otro, un entrenador con pinta de duro y vocación restauradora, asistido por su escudero con rodete. En torno a esta puja de titanes se alinean plantel, público y dirigentes, en un combate que enfrenta idolatría y meritocracia. Con el cabaret estábamos mejor. Por ALEJANDRO CARAVARIO Fotos PHOTOGAMMA.COM

“La poesía era un bello país”, dice uno de los títulos del gran Jorge Aulicino. Julio César Falcioni podría referirse de igual modo a Colombia, donde ejerció la juventud, peinaba una copiosa cabellera y volaba de palo a palo. No debieron faltarle groupies a aquel arquero de América de Cali. Esta remota versión de Falcioni puede corroborarse con un simple click en el buscador de Internet amigo, gesto que, inexorablemente, irá acompañado de una profunda perplejidad. ¿Qué le pasó?, se preguntaría el periodista Ernesto Tenembaum, que, como todo converso, se dedica a escudriñar cambios ajenos. Porque algo le pasó que precipitó su vejez con la saña de la revancha. Ojo, suele suceder: hay quienes renuncian ostentosa, rencorosamente a la mocedad. Inducen la andropausia , se dejan crecer un vientre de patriarca siciliano, pierden los dientes y se sitúan más allá, a salvo de las responsabilidades que conlleva la juventud. Se ganan el permiso a no querer, a no poder, a no desear ni a poner el cuerpo que, como se ve, es un escracho. Falcioni no es así, me dirán. Sin embargo, su máscara adulta, esa cara de perro que ladra y muerde, que torna fiereza el derrumbe, pone un mundo de distancia con cualquier licencia juve-

nil. Es también un rostro que renuncia en forma violenta al pasado (de hecho, es irreconocible en sus antiguas fotos). Nadie elige la cara (y menos esa), de acuerdo, pero sí se le puede dar un sentido. Sí se puede convertir la necesidad en virtud y proyectar una imagen que sintonice con ciertas demandas del mercado. Quiero decir, ¿quién osaría negar que Falcioni tiene voz de mando, que es serio, que incurre incluso en la obstinación solitaria de los hombres con firmes convicciones? Tan seguro está el DT de su perfil –debidamente acompañado por algún campeonato aquí, algún fracaso por incomprensión allá– que se permite el buen humor. Falcioni es un tipo con un desarrollado sentido del humor, aunque ahora no se note demasiado. Metódico, inclinado a las tácticas conservadoras, el entrenador es un esclavo de la realidad que percibe. En el revés de la ensoñación y la magia (preferencias juveniles), se yergue la racionalidad aguafiestas del padre que sólo confía en las razones fundadas y el trabajo.

ORDEN Y PROGRESO Un gran personaje, en suma, para abordar la coquetería salvaje que cam-


pea en los vestuarios famosos como el de Boca. Allí donde las internas son reglamentarias, aunque no por eso menos sangrientas. Donde, como en los suburbios pesados, los líderes arrían a los más jóvenes. Pues bien, luego del laxo y melancólico Borghi, cuyo legajo ganador se evaporó en unas pocas fechas (como si en Boca obrara un maleficio que licúa los méritos, que exige un pacto esotérico para lograr el éxito), hizo su entrada el sheriff, bendecido, se dijo, por su campaña en Banfield y la portación de cara. Suficiente garantía para una dirigencia partida igual que el plantel y cuyo máximo exponente ha confesado su ignorancia en la materia fútbol. Boca podría ser (no digo que lo sea) tierra fértil para los operarios del marketing más vacuo, los verdaderos abuelos de la nada, vendedores de humo que colocan y retiran jugadores y técnicos apoyados en antecedentes ficticios y talentos inexistentes de sus representados. Pero Falcioni, el hombre del orden y el progreso, tuvo que entender rápido (todavía está en ese trance) que no conduce un grupo de escolares. Acabado el verano dichoso, en la primera de cambio, Riquelme le hizo conocer el poder de un fetiche de la tribuna. Impedido de jugar por una larga sucesión de infortunios físicos que tienden a instalarse como crónicos, a Riquelme sólo le queda hacer política. Usufructuar los micrófonos amigos. De ese modo presionó al DT para que lo incluyera en el equipo cuando estaba lesionado. Lo hizo de forma sutil, destacando, por encima de cualquier consideración técnica, táctica o filosófica, su indestructible amor por la camiseta azul y oro.

Su deseo de permanecer el en club hasta el día del ocaso. Su voluntad de hacer feliz al hincha. Las cálidas semejanzas entre la Bombonera y su propia casa de Don Torcuato. El discurso caló profundo. Y cuando Falcioni, con ánimo de marcar la cancha, lo borró para el partido con All Boys, Román quedó como víctima sacrificial. Un Don Nadie, que ni siquiera saca grandes resultados, está matando a un ídolo. YO SOY AQUEL Desde que Riquelme empezó a hablar de sí mismo en tercera persona (es decir, a desdoblarse para observarse mejor, sopesarse, cuantificar su valía, admirarse desde una perspectiva panorámica), en sus palabras resuena el acento mesiánico. Es mucho más que un fanfarrón, ¿no? La gente bien intencionada sostiene que Falcioni debería hablar con él, aclarar los tantos, seducirlo y todo eso. Pero sospecho que Román es como los vampiros: hay que clavarle una estaca en el pecho para que te deje vivir. Pellegrini, ¿se acuerdan? La alternativa, claro, es consentir sus privilegios y no estimular el disenso, aun cuando sus opiniones se refieran a ámbitos ajenos a su incumbencia. De todos modos –y en contra del estilo frontal que propone el rictus de

Falcioni–, todo hace pensar que la guerra será sorda, subrepticia, desbordante de conspiraciones, declaraciones hipócritas y zancadillas. De emboscadas mutuas. Al parecer, Boca será una especie de laboratorio del chisme y la vendetta. Como la casa de Gran Hermano, esa tertulia de bobos en la que la traición es la única esperanza de superar el tedio, la inanidad de esos chicos y chicas reales. La rodilla líquida de Riquelme entró en escena de modo muy oportuno para el falcionismo. Lo que podría haber sonado como un capricho autoritario se reveló como una verdad indiscutible: el diez de Boca no está en condiciones de jugar. Gustavo Otero, el preparador físico de Boca, reputado como un profesional estricto, sumó una palada a la fosa de Román, aunque con la neutralidad de un anatomista. “Todos saben que si sufrís una lesión así, quedás condenado a ir al gimnasio todos los días de por vida. Riquelme sabe que tiene que ir y va; después, las respuestas que ese trabajo le está dando no son óptimas. Sí lo fueron con Palermo, Battaglia y Calvo. Sin ninguna duda, en cuanto a la condición física, no está al nivel de sus compañeros”. Seguramente, Riquelme entiende y comparte que su cuerpo tiene algunos achaques que, por el momento, lo alejan de un rendimiento óptimo. Lo que no está dispuesto a conceder es que le apliquen las generales de la ley. Porque él es mejor, porque tiene antecedentes gloriosos que

Nadie elige la cara (y menos esa), de acuerdo, pero sí se le puede dar un sentido. Sí se puede convertir la necesidad en virtud y proyectar una imagen que sintonice con ciertas demandas del mercado.


justifican cualquier prerrogativa, porque su influencia en el equipo, aun en desventaja física, es mucho más benéfica que la de cualquier otro mortal en plenitud. Las decisiones que, según el cuerpo técnico, garantizan la igualdad de derechos y oportunidades en el plantel (un principio democrático muy noble), para Riquelme (y la mayoría de los hinchas de Boca) significan cagarse en la historia y en un ídolo.

LA CAUTIVA Así como Juan Román se apoya en la tribuna, sobre la que, cada tanto, deja caer su mensaje de amor y compromiso, el DT tiene a Walter Erviti. Falcioni luchó y suplicó para que llegara al club como quien se empeña en recuperar a su amada

cautiva del malón. Si bien los estilistas le han diseñado un rodete llamativo, Erviti es de los que prefieren jugar y callar. No alzar la voz, no adherirse al conventillo. Por eso salió a cruzar a los que describen un enfrentamiento con Riquelme, quien le habría enrostrado su condición de “alcahuete”. “Riquelme me recibió muy bien”, señaló, sucinto, el zurdo. Sin embargo, su sola presencia –por características de juego y por la dimensión estelar de sus ingresos– lo coloca en el andarivel de competidor directo. Sobre todo si les hacemos caso a los expertos del pizarrón, que aseguran que jamás Falcioni los haría compartir equipo. Sería duplicar inútilmente una función. Y, puesto a escoger, sin dudas se inclinaría por su leal escudero, que no sólo parece ejecutar las ideas tácticas del entrenador como ningún otro,

sino que eventualmente oficia de exégeta de sus determinaciones polémicas. Hace poco, nos hizo saber que Falcioni es incapaz de actuar por imperio del capricho. El duelo implícito se refleja en la comisión directiva, donde son menos civilizados que en el vestuario y se han ido a las manos para zanjar diferencias. El vicepresidente segundo de Boca, Juan Carlos Crespi, reconoció que la exorbitante renovación de contrato de Román generó una división en el club. Hombre dado a fomentar la polarización –por usar un verbo a la moda–, el número diez tiene una fila de opositores en la comisión directiva. “El gasto por Erviti es el mismo o más que para renovarle a Riquelme, y los dos tienen la misma edad, pero esta vez nadie dijo nada”. El diario Olé pone esta frase en boca de un

MARZO 2011 | UN CAÑO 23


dirigente, aunque no precisa su identidad. La queja sotto voce se produjo luego de una de los calientes encuentros de la CD, que, por lo que se comenta, parecen más interesantes que los partidos. Por los servicios de Erviti hasta 2014, Boca pagará cerca de 6 millones de dólares. No se equivocaría Riquelme (y ninguno de sus compañeros) si leyera en la conducta del ex futbolista de Banfield una elocuente gratitud hacia el técnico que le permitió dar el salto a un equipo grande. En esta comedia, Crespi no ahorra declaraciones de corrección política (para el termómetro del hincha) y jura que nunca echarán a Román (como River despachó a Ortega) y que se retirará en su segundo hogar, la gloriosa Bombonera. La resonancia épica (el líder exilado regresa para morir en su patria) no

24 UN CAÑO | MARZO 2011

La gente bien intencionada sostiene que Falcioni debería hablar con Riquelme, aclarar los tantos, seducirlo y todo eso. Pero sospecho que Román es como los vampiros: hay que clavarle una estaca en el pecho para que te deje vivir. concuerda con la mirada torcida que le dispensan algunos, que lo ven lustrando un pedestal pretérito (que se ha ganado en buena ley), pero muy poco dispuesto a remar en tiempo presente aunque se incendie el rancho. La rodilla maltrecha lo obliga a prolongar la recuperación y, a esta altura, después de tantas deserciones forzosas,

lo consolida como un líder in absentia, con todas las connotaciones melancólicas e idealistas del caso. Sin jugar, y con un Boca inestable, Riquelme será cada día mejor. Igual que Gardel, pero sin los labios pintados. Y habrá ganado la mitad de la batalla. Falcioni está, como dijo un estadista liliputiense, condenado al éxito. Es decir, cerca del horno.


¿QUIÉN SE VA DE LA CASA AMARILLA?

Boca de urna

En un año electoral que se presume más caliente que ninguno, Amor Ameal y compañía no aciertan una decisión futbolística ni de casualidad. Un Caño se hace las mismas preguntas que los hinchas. Por CHRISTIAN COLONNA Foto PHOTOGAMMA.COM

B

oca está como está por culpa de un puñado de dirigentes inútiles, que de tan mal que hacen las cosas parece que patearan para el otro lado. No es necesario irse muy atrás para empezar a enumerar los disparates que permiten reavivar, a catorce años, la célebre frase de Diego Latorre: “Boca es un cabaret”. Los dirigentes le renovaron hace nada el contrato a Riquelme por una cifra millonaria. Por supuesto, para no perder la costumbre, fue una negociación escandalosa, con acusaciones cruzadas entre las partes y también entre los propios dirigentes. La duración y el monto de un contrato millonario ameritaban varias charlas, eso no se discute, pero no de la forma en la que lo hicieron. Para resumirlo, una frase de Borghi en su conferencia de prensa de despedida: “estar en Boca es como hacer el amor con la ventana abierta”. El Bichi pudo haber pecado de ingenuo, de novato, pero los dirigentes ya conocen el paño como para no comerse todos los amagues. El tema es que cada uno tiraba para su lado y ventilaba lo que le convenía. Cada bando aprovechó a su prensa amiga y así se fue armando la que se armó. Si lo que le pagan a Riquelme es un absurdo o más de lo que se merece, es relativo. Lo curioso es que sea el único jugador de Boca sobre el que se hacen estos planteos. ¿Acaso no habría que preguntarse si a Clemente Rodríguez no le pagan una fortuna por correr y correr y tirar los centros a la tribuna o no saber cerrar cuando tiene que defender? ¿Y está bien que Somoza cobre lo que cobra si dos de cada tres pelotas que recupera se las vuelve a dar a los rivales? En fin... Con Román confirmado en Boca por cuatro años, habría sido lógico que los dirigentes buscaran un entrenador capaz de potenciar a un equipo sin necesidad de pelearse con su estrella a los quince días. Pero, perdón por la reiteración, hace rato que Ameal y compañía vienen dando manotazos sin sentido. Con respecto a los técnicos, haber confiado en Alves fue el primer gran error, pero mucho peores fueron los siguientes. Porque demostraron ser unos improvisados. Hicieron lo simple, sin el menor esfuerzo por evaluar qué era lo apropiado para el club. Fueron a buscar a Borghi porque venía de salir campeón con

Beraldi y Ameal en la presentación de Erviti, lujito de tres millones de dólares.

Argentinos. Y el Bichi no encontró nunca la manera de poner un equipo en cancha que fuera confiable. Un triunfo contra Vélez es lo único que podrá recordar el hincha, pero enseguida se le enturbia la memoria porque ese día Vélez jugó como un equipito. ¿Evaluaron cómo le había ido a Borghi cuando estuvo en Independiente, por ejemplo? Como para comparar grande contra grande, ¿no? Muerto Borghi, y después de que le trajeran una defensa completa (arquero incluido) para que se sintiera a gusto, fueron a buscar al campeón anterior (y también volvieron a darle varios lujitos, como pagar más de tres millones de dólares por Erviti, un jugador de más de 30 años). Para estos dirigentes, Banfield y Boca son lo mismo. Como ahí salió campeón, acá también puede lograrlo. Puede, claro que puede, como pueden ser campeones Olimpo, River, Godoy Cruz o Racing, si aprovechan un buen envión. Porque en un torneo de apenas 19 fechas y tan parejo, se sabe que no es necesario tener un plan para llegar primero a la meta. ¿Le dijeron los dirigentes a Falcioni que el 9 y el 10 del equipo no se hablan, por ejemplo? ¿Y Falcioni creía que podía solucionarlo? ¿Y cómo, prescindiendo de Riquelme? Tal vez la solución sea prescindir de los dirigentes. MARZO 2011 | UN CAÑO 25


¿QUIÉN SE VA DE LA CASA AMARILLA?

El último disparate (por ahora)

Dos dirigentes se insultaron y estuvieron a punto de golpearse, como si estuvieran en la casa de Gran Hermano, pero no: estaban en una reunión de Comisión Directiva. Y Ameal por fin tomó una decisión: la suspendió. ¿Quiénes son los que buscan quedarse con el manejo del club? Por HERNÁN TAINOVICH

C

uentan quienes frecuentan con asiduidad el segundo piso de La Bombonera que rara vez a Jorge Amor Ameal se le escucha elevar la voz. Sin embargo, el viernes 18 de febrero de 2011, el endeble presidente de Boca tomó una de las pocas decisiones firmes en sus más de dos años de gestión: suspendió la reunión de Comisión Directiva porque dos dirigentes se tiraron golpes de puño al aire que, según testigos,no llegaron a impactar. Marcelo London y Fabián Beraldi, el hermano menor del vicepresidente José, se insultaron hasta que sus gargantas quedaron roncas y hasta que Big Brother intervino y frenó la pelea. Orden institucional que le dicen... Desplazado del Fútbol Profesional para privilegiar “un pacto de gobernabilidad” con Beraldi y Juan Carlos Crespi, Ameal había enviado a London (íntimo de Carlos Bianchi) al departamento de Fútbol Amateur. Fabián Beraldi, ex número uno del sector, quiso saber el curso de algunas determinaciones tomadas por London, quien se enojo porque sintió un tono inquisitorio, y así se dio rienda suelta a la pelea. Algunos analistas boquenses intuyen que el trasfondo de la gresca es el intento de quitarle aún más protagonismo a London, por el temor a que su relación con Bianchi pueda postularlo como futuro candidato a presidente. De postre, a fin de mes, lo excluyeron también del Fútbol Amateur y lo dejaron solamente como vocal suplente, un cargo prácticamente irrelevante. Con la interna del vestuario algo adormecida por la intención de Palermo de vivir en cierta armonía los últimos meses de su carrera, el cabaret abrió en las oficinas. Los dirigentes se prostituyen por el poder. La patética escena sucedida en la última reunión de CD es apenas un botón de muestra del descalabro dirigencial que

26 UN CAÑO | MARZO 2011

se percibe en el club a diez meses de las elecciones. “Acá manejan todo los Beraldi” es la nueva frase que se oye en los pasillos. Admitida la exageración de la sentencia, varios empleados consultados por Un Caño coinciden en el diagnóstico sobre el poder actual de los hermanos. José, dueño de una empresa de transportes, retomó el manejo del fútbol profesional y posicionó a su hermano Fabián como uno de los hombres más influyentes en el día a día. Y no son pocos los que dicen que “Ameal se entera de la mitad de las cosas que pasan”. La ausencia de un liderazgo fuerte es uno de los grandes problemas. Hay una torta muy importante de poder en disputa, y todos quieren comerse el pedazo más grande. Mientras tanto, Mauricio Macri sigue disciplinando a su gente para embarrarle la cancha a los no alineados. Todavía quedan muchos dirigentes del más puro riñón macrista. Un ejemplo: en la mencionada reunión suspendida, los Macri ‘s Boys no dieron quórum porque se iba a tratar la aprobación de la agrupación de Crespi como aspirante a presidente. Las candidaturas jugarán fuerte en un año en el que se necesitan logros deportivos, luego de dos temporadas secas. Ameal, Beraldi, Crespi, Roberto Digón (viejo directivo enfrentado con Macri), Orlando Salvestrini (aliado de Macri, ex tesorero) y Daniel Angelici tienen intenciones de presentarse. Curioso es el caso de Angelici. Se hizo famoso por ser el directivo que más se opuso a la renovación del contrato de Riquelme. Luego, abandonó la tesorería y empezó la campaña proselitista, enviando un DVD con propuestas a socios y periodistas. Delfín de Mauricio, es un acaudalado empresario que usa chofer y que los martes trabaja hasta al mediodía: se pasa la tarde en relax con amigos.


¿QUIÉN SE VA DE LA CASA AMARILLA?

¿Técnico de equipo chico?

Los números indican que a Julio César Falcioni le fue mucho mejor cuando dirigió equipos chicos que cuando estuvo en los grandes (Vélez, Independiente y ahora Boca). Tal vez su mayor desafío en Boca es demostrar que está en condiciones de manejar planteles complejos y que puede adaptar su estilo de juego a las necesidades de un conjunto importante. Por MARIANO HAMILTON

J

ulio César Falcioni, muy a pesar de haber dirigido sólo en 42 ocasiones a equipos de los considerados grandes (38 partidos con Independiente y 4 con Boca, hasta el choque con Vélez), es el tercer técnico más ganador de los 16 que están actualmente en Primera, sólo superado por Ramón Díaz (tiene un 62,28% de efectividad) y Roberto Sensini (52,10%). No contamos, claro, al Vasco Arruabarrena, Gabriel Schurrer, el Polilla Da Silva y Eduardo Berizzo, quienes recién están comenzando sus carreras en el futbol argentino como entrenadores, lo que hace que sus porcentajes no marquen variables que se puedan considerar una tendencia. Falcioni tiene un 48,88%, de efectividad fruto de haber dirigido en 314 ocasiones y de haber cosechado 121 triunfos, 96 empates y 97 derrotas, con 399 goles a favor y 337 en contra. Muy cerca lo sigue Pedro Troglio, con el 48,83% de puntos obtenidos. El técnico de Boca es también uno de los más veteranos en este asunto de dirigir en torneos cortos: llega, como dijimos, a 314 partidos y sólo es superado por Miguel Ángel Russo, quien lo hizo en 471 ocasiones. Detrás de Falcioni se encolumnan Ramón Díaz (289 partidos), Gustavo Alfaro (221), Ricardo Gareca (206) y, para sorpresa de muchos, J. J. López (137).

28 UN CAÑO | MARZO 2011

En su carrera como entrenador, Falcioni hizo campaña de todos los colores. Como para dar una idea de la inestabilidad de su trayectoria, digamos que de los 20 puestos posibles sólo no terminó 8°, 10°, 14°, 16°, 19° y último. El resto, los otros 14, los visitó todos. Sus primeras armas como DT las hizo en Vélez, como entrenador interino. Su debut fue en el Apertura ‘97, en la primera fecha, mientras el equipo de Liniers esperaba que asumiera Marcelo Bielsa tras la renuncia de Osvaldo Piazza. Bielsa culminó 4° en esa temporada y consiguió el título en el certamen siguiente. En aquel debut de Falcioni como técnico, Vélez igualó 1-1 con Racing como visitante. Recién regresó a Primera en el Apertura ‘98, para reemplazar a Eduardo Solari, quien también dejó la dirección técnica de Vélez. Dirigió cuatro partido, con dos triunfos y dos derrotas. Su último interinato fue tras la salida de Eduardo Luján Manera en el Clausura ’99, y estuvo al frente

del equipo las dos últimas fechas, con un triunfo y un empate. Ahí sí fue confirmado como entrenador títular. Dirigió a Vélez en tres torneos: Apertura 99 (terminó 7°), Clausura 2000 (6°) y Apertura 2000 (6°). El Apertura 2000 no lo terminó en Liniers, ya que se alejó de la dirección técnica del club en la sexta fecha. De ahí en más, Falcioni empezó su periplo por diferentes instituciones. Recaló en Olimpo en la temporada 2002/03 y quedó 17° en el Apertura 2002 y 6° en el Clausura 2003. Luego pasó a Banfield (su primera administración) y cosechó muy buenos resultados: 3° en el Apertura 2003, 4° en el Clausura 2004, 9° en el Apertura 2004 y subcampeón en el Clausura 2005. Además, llevó a al club del Sur hasta los cuartos de final de la Copa Libertadores 2005. Se fue de Banfield porque tuvo una buena oferta de Independiente, algo parecido a lo que ocurrió los últimos meses

Su forma de plantar a los equipos en la cancha tiene bastante que ver con lo que proponía Carlos Timoteo Griguol en aquel Ferro histórico.


cuando lo llamaron de Boca. Pero los dos campeonatos que completó en Avellaneda no fueron gran cosa: 4° en el Apertura 2005 (con Agüero en el equipo, lo que deja en claro que estaba para pelear más arriba) y 12° en el Clasurua 2006. La carrera, hasta ese momento en crecimiento, de Falcioni sufrió un paréntesis, ya que en los tres torneos siguientes quedó 17° y 7° con Colón, en el Apertura 2006 y en el Clausura 2007, respectivamente, y 18° con Gimnasia y Esgrima La Plata en el Apertura 2007. Estuvo un año y medio sin dirigir, y Banfield lo volvió a convocar tres el frustrado paso de Jorge Burruchaga por el club. Asumió en la 8a. fecha del Clausura 2009 y terminó 12°. El año siguiente marcó su consagración: fue campeón con Banfield en el Apertura 2009. Sus dos torneos siguientes no fueron extraordinarios ni mucho menos, pero a su favor hay que decir que estaba jugando al mismo tiempo el torneo local y las copas internacionales, por lo que culminó 5° en el Clausura 2010 y 15° en el Apertura 2010. Si embargo, aquel título con Banfield le sirvió como catapulta para pasar a Boca en el Clausura 2011. Como detalle, digamos que Falcioni fue el único ex arquero que salió campeón en el fútbol argentino como entrenador, ratificando las palabras de Maradona, quien siempre sostuvo que los arqueros saben poco y nada de fútbol. Y desmitificando también que desde el arco se aprende mucho porque se tiene una visión integral del campo de juego... Falcioni puede ser considerado un entrenador enrolado en la tercera posición. No es menottista ni bilardista. Su forma de plantar a los equipos en la cancha tiene bastante que ver con lo que proponía Carlos Timoteo Griguol en aquel Ferro histórico de la década del ‘80 y en el Gimnasia de los ‘90. Es decir, orden en defensa, con línea de cuatro, prolijidad para manejar la pelota, escalonamiento ofensivo basado en el despliegue de los

30 UN CAÑO | MARZO 2011

Clubes - Como entrenador Club Vélez Sarsfield Olimpo de Bahía Blanca Banfield Independiente Colón de Santa Fe Gimnasia y Esgrima La Plata Banfield Boca Juniors

País

Año

Argentina Argentina Argentina Argentina Argentina Argentina Argentina Argentina

1997-2000 2002-2003 2003-2005 2005-2006 2006-2007 2007 2009-2010 2010

Clubes - Como jugador Club Vélez Sarsfield América de Cali Gimnasia y Esgrima La Plata Vélez Sarsfield Once Caldas

País

Año

Argentina Colombia Argentina Argentina Colombia

1976-1980 1981-1989 1990 1991 1992

Títulos - Como futbolista

Títulos - Como entrenador Título Torneo Apertura

Club Banfield

País

Año

Argentina

2009

marcadores de punta y de los carrileros, sumado el talento natural de los delanteros y el aprovechamiento integral de los errores ajenos. Falcioni –como Griguol en aquel equipo– no descarta tener jugadores con características de enganche, pero no tiene entre sus planes armar un equipo con un 10 clásico. Prioriza la velocidad por sobre la pausa, el vértigo antes que la reflexión y el contraataque a imponer un dominio territorial marcado y sostenido. También como Girguol, parece condenado al éxito en equipos chicos, ya que su idea de juego no está relacionada con las

ambiciones y estrategias habituales de los equipos más poderosos, que por historia y por presión deben salir a buscar los partidos desde el minuto 0. Sintetizando y sin caer en un reduccionismo, es verdad que hay entrenadores para equipos grandes y otros para equipos chicos. Falcioni parece estar enrolado en el segundo lote. Y esto no significa una falta de reconocimiento en su capacidad, que la tiene, por supuesto. Apenas es una realidad que podrá ser desmentida o ratificada cuando sepamos como termina su campaña en Boca, seguramente el mayor desafío de su carrera.


¿QUIÉN SE VA DE LA CASA AMARILLA?

Agítese antes de usar

El Boca que se mueve por impulsos nerviosos, de acuerdo a lo que pasa cada fin de semana, es el que hoy entra en el análisis de nuestro comentarista. En el intento por responder las mil y un preguntas que se hacen los hinchas, ha elaborado estas páginas, dedicadas a enumerar las características del estilo Falcioni. O, si usted quiere, destinadas a interrogarnos: ¿hay un estilo Falcioni? Por FERNANDO PACINI Fotos PHOTOGAMMA.COM

E

l liderazgo, la gestión, las técnicas para conducir son elementos consagrados, también en el fútbol. Básicamente, Boca ha cometido dos errores de conducción. Uno de ellos está vinculado a la esfera político-institucional y a las decisiones tomadas en la planificación deportiva. La interna política que sacude al club, que queda expuesta en cada reunión de Comisión, afecta al fútbol. Cada paso se da en función de un cálculo aproximado de las consecuencias electorales que pueda tener. Encuestas, valoración de imagen, concepto de autoridad, todo está en juego. Quienes ejercen el poder disponen de herramientas inmediatas para mover la aguja: si toman una decisión correcta, se acercan al triunfo; si fallan, se alejan. En esa convulsión, las actuales autoridades de Boca firmaron un contrato por cuatro años con Riquelme y pasaron de Borghi a Falcioni. Traducido: se aseguraron a Riquelme, pero contrataron a un entrenador poco funcional a las aptitudes de la estrella y antagónico a su predecesor. Claramente, en alguna de las tres cosas fallaron. O es que no se hacen este tipo de

32 UN CAÑO | MARZO 2011

evaluaciones y la capacidad de selección queda reducida a impulsos, a los espasmos que provocan dos o tres triunfos, tres o cuatro derrotas. El otro error de conducción se le puede adjudicar a Falcioni. Sacar a Riquelme en la tercera fecha, sin evidencias que respalden públicamente su maniobra, es meterse en un laberinto. Contaba un experimentado entrenador que hay situaciones en las que un conductor debe sostener a un futbolista emblemático en el equipo, aunque no esté en su mejor nivel, porque su exclusión produce daños superiores a su presencia disminuida en la cancha. El medio instaló que el Boca del verano había sido un equipo que no tenía otro destino que la solidez. Cuando se rompe ese molde versión marplatense, con los ingresos de

Erviti y Riquelme, entonces Boca pierde 4 a 1 en La Bombonera. Dos falacias: el Boca del verano, como todos los equipos que andan bien en las olas, no necesariamente iba a reproducir en la competencia verdadera ese rendimiento. Y tampoco es cierto que las presencias de Riquelme y Erviti hayan descompuesto nada. Era un debate atrapante y vendedor: imponer la idea de que aquellos que mejor juegan con la pelota pueden desmejorar a un equipo. Los antecedentes de Falcioni en otros clubes eran, además, una coartada ideal: él podía decantarse por un mediocampo que no incluyera a Riquelme para sumar músculo. Resulta que lo hizo, agitó el vestuario, el club, las redacciones… Y el equipo tampoco funcionó. Claro que el entrenador, como él mismo dijo, está para tomar decisiones y que lo más aconsejable es que vayan en el

Con el tiempo sabremos si lo que Falcioni hizo con Riquelme lo hizo en el momento adecuado, y si su liderazgo quedó dañado para siempre o no.


sentido de lo que cree, sin vacilaciones. Por supuesto. Sucede que también había dicho que Riquelme era un valor importante en el diseño de su equipo, y esa percepción le duró sólo dos semanas. En todo caso, lo que con el tiempo sabremos es si lo que hizo lo hizo en el momento adecuado, y si su liderazgo quedó dañado para siempre o no. Hay una lista importante de ideas respecto del funcionamiento de este nuevo Boca. Pueden tener enfoques distintos, pero no resuenan como sentencias. Es curioso como los enunciados cautelosos tienen más prestigio que los osados. Algunos ejemplos: –Luego de los intensos debates que produjo la línea de tres de Borghi, Boca estaba seguro de volver a su confiable línea de cuatro. Y se sabe, la línea de tres era culpable de todas las derrotas, mientras que la línea de cuatro nunca es culpable de nada. –Se dice que dos creativos, conspiran contra el equilibrio. Riquelme y Erviti, juntos, no hacen más que descompensar defensivamente al equipo. Pero no se dis-

cute jamás si Battaglia y Somoza, juntos, descompensan ofensivamente. –El doble pivote provee al 10 de un blindaje defensivo para que pueda jugar tranquilo. Pero nunca un jugador creativo blinda ofensivamente a los que trabajan en la contención para que puedan descargar rápido. –Sin un mediocampista ofensivo, la responsabilidad del pase final del ataque recae en los mediocampistas exteriores, que tienen más dinámica que calidad de pase. –Jugar con dos volantes centrales definidamente de contención trae algunos contratiempos. La posesión no será tan fluida, y la distancia entre ellos y los atacantes precisará de valiosos segundos para que puedan acercarse, o de pases más largos, que exigirán mayor precisión. En ese caso, es probable que el receptor no se encuentre bien perfilado con la pelota y deba comenzar la aventura de espaldas al arco. –Si una línea defensiva achica espacios hacia delante, con un cinco es suficiente. El respaldo de la defensa alcanza para poblar esa zona sensible a sus es-

paldas y a los costados. En cambio, si un equipo achica retrocediendo y juntando líneas en su campo, los dos volantes centrales garantizan que no haya filtraciones. El Boca de hoy se afilia a esta última tendencia. –Jugar con más delanteros no garantiza ser más ofensivo, se dice siempre. Tampoco jugar con más futbolistas de corte defensivo asegura defender mejor; sin embargo, eso no se debate. –La densidad defensiva (arquero, 4 defensas, 2 contenciones, 2 volantes abiertos que descienden) es un modo de asegurar que se ocupen todos los espacios del campo sin la posesión. Claro que esa certeza determina otra: la tenencia será escasa, de baja calidad y lejos del arco rival. La acción ofensiva por excelencia es, entonces, el tiro largo y frontal, y el desplazamiento hacia adelante para tomar el rebote y atacar en 25 metros. La elaboración no se corresponde con este plan, más vinculado a explotar el error ajeno. Boca va en esta dirección. El que quiera ver otra cosa tendrá que cambiar de canal.

MARZO 2011 | UN CAÑO 33


PERFUME DE VARÓN

Por MARÍA FERNANDA MAINELLI

Fotos PABLO DONDERO

“En la cancha no hay democracia” Los lectores de Un Caño ya están acostumbrados a esta sección, en la que una periodista con pocos conocimientos del fútbol, por decirlo generosamente, dialoga con un entrevistado que la alecciona. Esta vez, se encontró con Alejandro Dolina. Y la pobre quedó deslumbrada por sus razonamientos.

A

lejandro Dolina es más alto de lo que una podría imaginar. Camina, como suele suceder con los flacos, con torpeza. Es difícil pensar que este hombre desgarbado se mueva con sutileza dentro de la cancha, aunque, como leerán en esta entrevista, él asegura que sí. Un rato antes de la salida al aire de su programa radial La venganza será terrible, que se transmite en vivo y con público en el Multiteatro, el escritor y músico se metió con un tema que le gusta: el fútbol, despojándolo de cualquier sentido pasional e irracional y centrándolo en su valor esencial, el juego. –¿Cuáles son los primeros recuerdos que se te vienen a la mente si digo la palabra fútbol? –Las revistas deportivas de mi viejo y las imágenes de los jugadores. Él las compraba y yo las miraba siendo muy chiquito. Ese es el recuerdo más antiguo, ayuno de todo contenido. –¿Fueron suficientes esas imágenes para que te interese el fútbol? –No, no. –¿Qué tuvo que pasar? –Tuve que verlo en televisión porque, por aquel entonces, alguna vez pasaban un partido por televisión. O esperar que mi viejo me llevase a la cancha. Pero no

34 UN CAÑO | MARZO 2011

fue memorable mi comienzo futbolístico. –¿Tu papá era de Boca? –Sí, pero no era un hincha fanático y jugaba muy bien. Mis recuerdos de fútbol tienen que ver más con jugar que con verlo, y todavía es así. A mí me interesa mucho jugar y bastante menos verlo y comentarlo. –¿De qué jugás? –Ahora juego fútbol de salón o papi fútbol, y juego adelante. Pero yo jugaba de volante en las canchas grandes. Siempre del medio hacia adelante. –¿Se podría decir que sos bueno? –Se podría, si uno quisiera… (Dolina se ríe por primera vez, como lo hará cada vez que siente que le sale una buena ocurrencia). –¿Entonces? Tu desempeño en la cancha es… –Correcto, tengo alguna técnica. –¿A quién te parecés? –A uno que ya no juega y que fue muy conocido como técnico: Menotti. Menotti era un tipo que se movía muy poco, pero tenía mucha precisión para jugar y le pegaba fuerte a la pelota. Yo juego algo así, pero, claro, me gustaría jugar mejor. Si es que tengo algunas virtudes, son más estratégicas que dinámicas. –¿Alguna de tus cualidades como

amigo, pareja o padre las demostrás en una cancha? –No. Yo no creo que se juegue como se vive. Probablemente, se juegue como no se vive. El chiquito desposeído que era Maradona se convertía en un rey dentro de la cancha. Probablemente, necesitara entrar a la cancha para abandonar sus rémoras, sus falencias, sus carencias… Entonces, salía de una vida dura, en la que no era nadie, y entraba a un cuadrado en donde era el mejor de todos y era reverenciado. Quiere decir que en este caso, como en mil otros que conozco, se juega justamente como no se vive. Uno va a jugar a la cancha a buscar lo que no encuentra en la vida cotidiana o a descargar, por decirlo banalmente en un sentido psicológico, agresividades que en la vida cotidiana nos conducirían a la cárcel. El fútbol nos conduce a menudo a la expulsión, pero no más allá. A menudo, muchas personas aprovechan ese momento de agresividad para ser competitivos o para buscar el triunfo a toda costa. Y eso puede estar bien en la cancha, pero no está bien afuera. Cuando escucho a un tipo decir que no quiere perder ni a las bolitas, pienso que está loco. ¡A mí qué me importa perder a las bolitas! ¿Qué es eso? ¿Querés ganar a todo? ¿Dónde vivís?


¿Qué clase de persona sos? Si sos un jugador profesional, supongo que querrás ganar siempre. Pero ese querer mucho, segunda superstición, no quiere decir poder mucho. No creo que sea tan fácil como dicen los muchachos de las pizzerías de la new age: que basta con querer mucho una cosa para lograrla. He visto adentro de la cancha a tipos que por más que querían no podían. Lo que sí, hay que saber y aprender mucho y estar muy dotado. –Nos desviamos del tema. –Nos desviamos, sí. Volvamos: no creo que haya un paralelismo en forma directa entre la persona que uno es y el jugador que uno es. –¿Qué pasa a la inversa? Albert Camus decía que el fútbol le había enseñado todo lo que sabía de la vida. –Sí, claro, él era arquero… Era arquero… (Dolina vuelve a reír con picardía, mientras se mofa de ese puesto con poco prestigio y sigue…). Vaya uno a saber uno cuánto era de bueno. Vaya a saber uno cómo jugaba. Creo que exageraba. Esa frase no se la enseño el fútbol. –¿Te enseñó algo de la vida el fútbol? –No creo. A mí me gusta mucho el fútbol y, en todo caso, si uno sabe pensar es más fácil jugar. En general, los buenos jugadores no son cultos ni preparados, pero piensan bastante bien. Se los nota complejos de pensamientos, aunque no tanto de idioma. El caso paradigmático es Riquelme, que no tiene una riqueza de

cipal de la predilección. –¿Nunca pensaste en rebelarte contra el mandato? –No, no. Pero tampoco he sido ni soy fanático. Sí, claro, siempre quiero que gane Boca y que pierda River. Pero no soy tan estúpido como para odiar. –¿No te daría placer que River, por ejemplo, se fuese al descenso? Sí, claro, pero sería un placer que no relaciono con el odio personal, como le sucede a mucha gente. –¿Qué tipo de placer te daría? –Y… Un placer casi teatral. Un halago de esa naturaleza, pero nunca un placer relacionado con la venganza ni la justicia. No me tomo esas cuestiones muy en serio. Yo no elijo a mis amigos ni a mis novias según sean o no hinchas de Boca. –Es muy factible que las personas cambien de ideas políticas, de religión o de patria, pero no es tan frecuente que cambien de equipo de fútbol. ¿Cómo explicás este fenómeno? –Ser hincha de un equipo no responde a ningún tipo de realidad. No está relacionado con una evaluación del universo como, por ejemplo, la religión, que requiere creer o no creer. Uno puede encontrarse con alguna cosa que le haga perder la fe. En cambio, el fútbol es una decisión sencilla, personal, y no admite refutación. Uno puede desengañarse de un político y dejar de ser demócrata progresista, una vez que descubre que Lisandro de la Torre

expresión muy grande pero, sin embargo, no dice lo que dicen todos. Algunas veces se pone en entredicho él mismo, o pone en entredicho las grandes verdades del fútbol. Tiene capacidad para relativizar. –¿Por qué sos de Boca? –No lo se. Fue un poco inevitable, en mi familia eran todos del club. Supongo que la presión familiar fue la causa prin-

hizo algo que a uno no le gusta. Pero lo del equipo de fútbol, diría Karl Popper, no tiene falsación (N. de la R.: se refiere a la corriente del refutacionismo fundada por el filósofo austríaco). Entonces no importa lo que ocurra, no importa que perdamos y, como ocurre con algunas otras cuestiones que son mágicas, como el psicoanálisis, cualquier cosa que ocurra viene a darnos

36 UN CAÑO | MARZO 2011

la razón. Si Boca pierde, seguimos siendo de Boca para demostrar la fortaleza que tenemos en la derrota, y si gana porque gana… Hay disciplinas en las que cualquier suceso viene a demostrar algo. –¿Por ejemplo? –Se anuncia un plan quinquenal de Stalin. Si se cumplen los objetivos, Stalin tenía la razón, y si no se cumplen, también tenía razón porque había adelantado que los enemigos del plan iban a conspirar y entonces iba a ser difícil. No hay manera de refutar eso. Lo mismo pasa con el fútbol o la religión, aunque admito que en la religión puede haber algún desengaño. –¿Por qué comparás al fútbol con el totalitarismo? Porque el fútbol es totalitario, no hay mucha democracia en la cancha. Existe la autoridad del referí, curiosamente auspiciada por los relatores, incluso por los bienpensantes. Un jugador comete una infracción y se lo echa, entonces el relator dice: “¡qué bien el referí!”. No hay garantistas en el fútbol. Al contrario, son todos muy rigurosos a la hora de castigar. Por otra parte, está el entorno: las hinchadas son muy intolerantes entre sí. –¿Cómo sos como hincha cuando vas a la cancha? –Me hago mucha mala sangre, hablo todo el tiempo, señalo los errores, me entusiasmo y aplaudo. Pero no me enojo, no me da por insultar. Sufro tristezas deportivas que no son lo mismo que las tristezas de amor, las filosóficas o las existenciales. Boca no es lo mismo que lo que me dejó el amor de mi vida. Pero para otras personas es al revés, porque no les interesan mucho los amores de sus vidas. No digo que una cosa sea mejor que otra. Digo que hay maneras de vivir complejas y otras que no lo son tanto. Y que a falta de estímulos, por nuestro entorno, nuestras actividades y vivencias, uno se apropia de una divisa, toma como propios los triunfos de esa divisa y encuentra la emoción ahí. Pero, repito, por la falta de otras emociones. –¿Por qué parece que en este país los hinchas hablan con la autoridad de directores técnicos? –Sí, hasta que los hacés entrar a una


cancha… (Larga unas carcajadas como espasmos). –¿Qué significa para vos que veintidós tipos corran detrás de una pelota? –No sé si contestar esa pregunta, porque ésa es una manera cínica e insuficiente de describir el fútbol. Es como decir que el Quijote es un kilo de papel y cien gramos de tinta. O que las matemáticas son garabatos en un papel… Es una definición insuficiente y peyorativa. A mí, el idioma chino me parece una serie de firuletes... Un día, Sábato me dijo que le habían traído una traducción al chino de un libro suyo para que la mirara y que no sabía qué decir. Los que no saben qué es el fútbol, ven a esos veintidós tipos y piensan que son unos enfermos. –Entonces, ¿qué más es el fútbol? –Se suele decir que es una pasión. Creo que los que dicen eso, lo hacen sin saber lo que significa. La pasión, en su primera acepción, es un padecimiento, algo enfermo que indica que algo no está bien. Creo que, evidentemente, cuando uno está loco como para hacer desparramar sus cenizas en la cancha de su cancha, hay algo de patológico. Yo, más que pensar en el fútbol como pasión, prefiero hablar del fútbol como deporte, que quiere decir competir y hacerse cada tanto un poquito de mala sangre porque perdés. Lo demás, no lo acepto. A esa pasión que implica llorar, como hacen algunos, jactándose incluso, no la entiendo. Habrán llorado cuando tenían 11 años, no cuando tienen 40. –Pero muchos hinchas lo viven así. –En algunos casos, no es verdad eso que dicen. Es un poco actuado. Como a algunos actores les gusta fingir que son supersticiosos porque escucharon que los actores son supersticiosos. Entonces, a algunos hinchas les gusta fingir que son más fanáticos de lo que son porque de este modo toman contacto con lo popular, o les debe parecer que terminan siendo simpáticos. –¿Qué cosas no te gustan del fútbol? –Esto mismo que te digo. O cuando pasa de ser un jueguito deportivo, incluso de cargadas, y termina en violencia. Eso no me gusta nada. Y tampoco me gusta la futbolización del universo. Que esta futbolización sea inevitable no me gusta. Que

MARZO 2011 | UN CAÑO 37


la colección de metáforas del fútbol haya invadido el discurso, también me molesta. Y me molesta que haya un maridaje tan frecuente entre la literatura y el fútbol. Lo digo que yo, que soy culpable de algunas historias. Pero vea usted, me arrepiento, porque sale perdiendo la literatura. –¿Por qué? –Porque el escritor que escribe sobre fútbol se parece más, en general, a un periodista deportivo que resolvió escribir un cuento que a un escritor que toma al fútbol como tema. No digo que el fútbol no sea un tema, pero que se haya convertido en el tema principal de la literatura argentina me parece raro. Hay grandes escritores, sí, pero después existe una raza que narra historias del tipo “iban cuarenta y cinco minutos del segundo tiempo, yo estaba en la tribuna y el referí cobra penal…”. Y de ahí, tres páginas de

vez que algo es exitoso, es imposible que no se convierta en un negocio. Si no se hubiera convertido en un negocio, habría que hacerlo ya mismo. Vive mucha gente de eso... Por otro lado, la política ha usado al fútbol, al básquet, a los deportistas exitosos en general, pero también ha usado a los escritores exitosos, a los médicos exitosos… Todos han estado al servido de alguna política. Siempre ha sido así, y no me parece ni malo ni bueno. –¿Y la cuestión de que en cada partido se reedite la noción de ganadores y perdedores? Esta son chicanas del pensamiento. Son cuestiones inevitables, hay que aceptarlas como cosas que pasan y no utilizarlas como arsenal del pensamiento propio. Qué sentido tiene decir que se diga que ser de Lanús es de izquierda y ser de Boca es de derecha. Es al revés, diría yo, porque

un supuesto suspenso… ¿Qué va a pasar? O lo va a meter o lo va a errar. No puede pasar nada más. No es así como se escribe, o no es para eso que alguien escribe. Se escribe para hacer un juicio sobre la condición humana. Si podés hacer eso a partir de un cuento de fútbol, fenómeno. Ahora, si el asunto es ver cuánto puede importar que una jugada termine en gol o no, es lo contrario de la literatura, porque la literatura debería descubrir –justamente, y ya que estamos indagando en la cuestión humana– que no importa si fue gol o no. Son otros los objetivos de la literatura, no crear un suspenso acerca de una jugada. ¿Por qué no se hace lo mismo con el ajedrez? Sería aburridísimo… –¿Tenés en cuenta otras cuestiones que son intrínsecas al fútbol, como el negocio, o la utilización que hace de él la política, por ejemplo? Lo del negocio es inevitable. Cada

hay muchos más hinchas de Boca que de Lanús. Pero bueno… En realidad, lo que sucede es que la metáfora no sirve para el fútbol. No se puede decir que tal forma de jugar es de izquierda o de derecha. –Boca tuvo un presidente de derecha. –Eso no es ninguna metáfora. –Para esta serie de entrevistas me puse a mirar fútbol por televisión… –Pero, caramba… –Y debo confesar que no logro ver un partido entero porque me aburro. –Justo hiciste todo ese movimiento para encontrarte conmigo, que tampoco tengo al fútbol como un tema de conversación predilecto. Es curioso que vos y yo estemos hablando de esto, porque, de poder elegir, estaríamos hablando de otras cosas. Es más, es posible que no estemos hablando de fútbol y que tu editor te lo haga notar cuando le entregues la entrevista.

38 UN CAÑO | MARZO 2011

–Pero no, esto es Un Caño, así que corresponde que ahora te pregunte, ya que hablamos de los relatores, si no te parece que hablan de otra cosa que la que está sucediendo en un partido. Es algo que noté mirando fútbol por TV… –Eso sucede. Los señores de la televisión relatan poco y conversan mucho, porque relatar es un trabajo que obliga a un continuo estado de concentración. En cambio, conversar a la bartola permite ablandar el espíritu y navegar con el piloto automático. Entonces, se dejan tentar por la conversación. Y nunca sabrás quién acaba de cometer una macana en la cancha, porque los tipos están conversando con estadísticas que revelan un pensamiento mágico cuya norma sería esta: “lo que acostumbra a suceder debe suceder”. Y eso no está bien… Dicen, por ejemplo, “de nueve partidos jugados un 25 de mayo, Boca ganó ocho”. Entonces uno dirá: “caramba, si jugamos el 25 de mayo tenemos ocho posibilidades sobre nueve de triunfar”. Y está claro que no es así, que es un dato que no señala absolutamente nada. –¿Podés ver al fútbol como otra cosa que no sea un juego, como arte, por ejemplo? –No, el fútbol no tiene nada de artístico. Es un juego. Despierta interés por ver la inteligencia en acción. Como otros deportes, también privilegia la fortaleza, la velocidad, la preparación física… Pero el principal interés por el fútbol es notar la inteligencia en acción. –¿Entusiasmaste a tus hijos para que les guste el fútbol? –Mis dos hijos son muy buenos jugadores, y a los tres nos gusta pensar la naturaleza del fútbol y las cuestiones técnicas, tácticas y estratégicas. Discutimos mucho sobre eso, más allá de lo que se discute en las pizzerías. Nos gusta más eso que lo pasional. –¿Hablan más de fútbol que de mujeres? –Sí, hablamos más de fútbol, pero porque son mis hijos… Hablamos mucho menos de fútbol que de cuestiones artísticas, y cuando lo hacemos, no es tanto para comentar sucesos, sino ideas relacionadas con lo táctico.


–¿Podés demostrar en la cancha la táctica en la que pensás? –Claro que sí. Nosotros jugamos todos los martes desde hace muchos años, en partidos de los que han participado muchos ex jugadores. No son partidos extraordinarios, pero son muy ordenados. Lo que hace que disfrutemos del fútbol es ese orden. No vamos a divertirnos y a ver qué pasa, sino que vamos a jugar en su versión seria. –¿Te referís a no hacer trampa? –Por ejemplo, eso primero… Además, no jugamos a la bartola ni divirtiéndonos, sino pensando qué hacemos: si decidimos esperarlos, los esperamos; pensamos en qué momentos nos damos vuelta, en quién va sobre fulano, si te la paso por el costado o busco profundidad... Tenemos mínimos acuerdos, tácitos o expresos. Cuando se logra un entendimiento colectivo, hay tanto placer o más que cuando uno logra una jornada individual. –¿Alguna vez hiciste en la cancha algo de lo que te hayas arrepentido? Siempre. Lo que menos me gusta es enojarme, y me enojo mucho más en la cancha que afuera. Y discuto mucho. –¿Qué te enoja? –Los desacuerdos con mis propios compañeros, más que con los rivales. “¡Tendrías que haber venido, yo te lo vengo diciendo, y no lo hacés!”. Y el otro te responde: “pero vos, ¿qué querés?”. Y uno se enoja: “te lo estoy diciendo…”. Son cosas que me fastidian, y después me pregunto para qué me fastidié. –¿Alguna vez te fuiste a las manos? –Alguna vez cobré dentro de la cancha, pero no por mis compañeros ni por mi comportamiento, sino por circunstancias que no vale la pena recordar. –Dale… ¿Qué hiciste? –¿Yo? Nada… Pero recuerdo un campeonato universitario en el que agarraron a un compañero entre siete y le pegaron en el piso. Entonces fui con otro a cubrirlo, para que no ligase todas las piñas él solo. Se armó una pelea grande que ni yo ni nadie tenía ganas de armar, porque estaba lejana a nuestra naturaleza. Pero ligué de lo lindo. Son cosas que pasan…

MARZO 2011 | UN CAÑO 39


Como un viejo lobo de mar

Mientras el equipo se acomoda y en La Plata discuten sobre los principios de Ángel Cappa, quisimos ver cuánto de cierto había en la referencia que hizo el entrenador de Gimnasia sobre el tikitiki y el “el estilo y la tradición futbolística de Gimnasia” de los que habló. Parece que la cosa no era tan así… Por ALEJANDRO FABBRI

M

uchas veces, las buenas intenciones, las palabras inteligentemente dichas para motivar, para juntar voluntades y unirlas detrás de un objetivo, cumplen su misión y lo consiguen. En algunas circunstancias, quien las pronuncia peca de voluntarismo, ya que poco le importa lo que pasó, lo que realmente pasó; la cuestión es apelar al sentimiento, a la pasión. Algo así debe haber pasado por la cabeza a Ángel Cappa, quien llegó cargado de ilusiones a su nuevo puesto de entrenador en Gimnasia y Esgrima La Plata y soltó una serie de conceptos que apuntaron a recuperar “el estilo y la tradición futbolística de Gimnasia”, anunciando una revalorización de la manera de jugar del Lobo y un “reencuentro” con el publicitado tiki-tiki. En realidad, Cappa intentó diferenciar ese juego de Gimnasia con el de su archirrival Estudiantes, cultor de otro tipo de fútbol desde la aparición de Osvaldo Zubeldía como DT hasta nuestros días, por más que en el cuadro pincharrata hayan pasado una larguísima lista de futbolistas de buen pie y se hay notado más de una vez una devoción por la pelota que algunos todavía niegan.

Cuando escuchamos la frase, nos empezó a repiquetear la pregunta en la cabeza: ¿cuál es el estilo histórico de Gimnasia? ¿Alguna vez jugó al tiki-tiki? Hay escasos antecedentes en equipos del club del Bosque de ese juego, o por lo menos de una manera emparentada con un fútbol prolijo, muy dotado técnicamente y claramente ofensivo. Removamos el archivo y busquemos. Gimnasia consiguió ganar el torneo de 1929 de Primera División, en la etapa final del amateurismo. Fue un torneo de una sola rueda, con los 35 equipos (sí, ¡35 equipos en Primera!) divididos en dos zonas. El Lobo ganó su grupo, superando por un punto a River, apuntalado por el cacique marplatense José María Minella, el eje medio que distribuía y ordenaba todo. Adelante, un muy joven Francisco Pancho Varallo, con 19 años, hacía estragos acompañado de los atacantes Malianni y Morgada. Gimnasia iba al frente, atacaba permanentemente, con delanteros que señalaron 33 goles en 17 partidos, sólo superados por San Lorenzo. En la final, jugada en la vieja cancha que River tenía en avenida Alvear y Tagle, venció a Boca por 2-1, dando muestras de

oportunismo, convicción y potencia física, según lo consignaron los diarios de la época. Se jugó el 9 de febrero de 1930, con 40.000 personas en las tribunas. Gimnasia era claramente visitante, había amplia mayoría de boquenses. Terminó el primer tiempo perdiendo 1-0 y, con dos apariciones de Malianni en ataque, lo dio vuelta, ganando el partido y el campeonato. Heredero de aquel campeón de 1929 fue El Expreso de 1933, el real ganador del tercer campeonato profesional, claramente perjudicado por arbitrajes que le impidieron ser el rey. Lo apodaron El Expreso, porque su juego tenía una velocidad inusitada para la época. Aquí sí había una clara diferencia de estilos con el más lujoso y técnico Estudiantes de Los Profesores, que venían impresionando con aquella fabulosa delantera que comandaban Scopelli, Zozaya y Nolo Ferreira. Aquel Gimnasia de 1933 tuvo a Arturo Torito Naón como su máximo goleador, con 33 conquistas. Hizo 90 goles, 9 más que el campeón, San Lorenzo. Demolió a los poderosos a fuerza de desbordes de sus wings, Tomás González e Ismael Morgada. Con éste y otros sobrevivientes del ’29,

Lo más cercano a lo que pretende Cappa fue aquel formidable equipo que armó Griguol en 1996 y que juntó a varios talentosos: el Beto Márcico, Guillermo Barros Schelotto, el Pepe Albornoz y el uruguayo Sanguinetti. 40 UN CAÑO | MARZO 2011


como Delovo, Minella y Belli, construyó una máquina potente y arrolladora en su cancha del Bosque. Ahí ganó 16 partidos y empató solamente uno (1-1 con Racing). Como ya es sabido, cuando saboreaba el título, le tocó padecer los arbitrajes tendenciosos pro Boca y San Lorenzo y se quedó afuera de la lucha por el campeonato. Su juego profundo y veloz fue frenado con innumerables posiciones adelantadas sancionadas por los asistentes y un par de penales, y varios goles anulados completaron el combo que lo marginó. Fue tal la vergüenza que cuando los arruinaron en el Gasómetro, los jugadores de Gimnasia decidieron sentarse en el campo de juego en señal de protesta. Distinto al tiki-tiki, su juego los había encumbrado y los bajaron de un tiro los poderosos de siempre. Después, los registros históricos muestran una decadencia deportiva con algunas excepciones, pero sin llegar nunca a repetir esas dos campañas casi prehistóricas. Vinieron varios descensos –en 1943, 1943 y 1951– con sus rápidos retornos a la A. Conducido técnicamente por Adolfo Pedernera, el equipo que jugó el torneo de 1962 se convirtió en la revelación del año. Armado con la base de 1961, cuando fue noveno, Gimnasia se reforzó apenas con el Tanque Alfredo Rojas, que llegó desde River, y con el veterano Héctor Antonio, de larga campaña en Estudiantes. Finalizó cuarto en la primera rueda a cuatro puntos del líder, Boca. Con un juego rápido y práctico, afirmado en la velocidad de Ciaccia y del peruano Gómez Sánchez, la calidad de Antonio y de Prado, la lucidez de Diego Bayo y la potencia demoledora del Tanque Rojas, con el fondo de la libertad y el apego por el buen fútbol que pregonaba Pedernera, Gimnasia hizo una segunda rueda arrasadora. Ganó siete partidos consecutivos y se encaramó en la punta. Lo consiguió el 21 de octubre, cuando bailó a Boca en el Bosque y le quedó definitivamente pegado el apodo de Lobo, por la ubicación de su cancha, su astucia y su eficacia. Enhebró otro éxito ante Estudiantes en la cancha pincharrata, le ganó a Chacarita y consiguió empatar con Independiente en Avellaneda. Faltaban cinco fechas y llevaba dos puntos de diferencia, parecía encaminarse al título. Una inesperada derrota ante Vélez en La Plata y un demoledor 0-4 ante Atlanta en Villa Crespo le hicieron perder

Montañez, Minella y Miguenz línea media del Lobo de 1933.

la punta. Finalmente, llegó tercero, con la lógica decepción de sus hinchas. Desde ese lejano 1962 hasta hoy, ocurrió un descenso en 1979, con cinco años de lucha sabatina, la vuelta en 1984 y una serie de campañas que lo pusieron a tiro del título esquivo que no pudo conseguir. Fue en tres ocasiones con Carlos Timoteo Griguol, en una con Carlos Ramacciotti y en otra con Pedro Troglio. Lo más cercano a lo que pretende Cappa fue aquel formidable equipo que armó Griguol en 1996, el que juntó a varios talentosos: el Beto Márcico, Guillermo Barros Schelotto, el Pepe Albornoz y el uruguayo Sanguinetti formaron el grupo más exquisito, acompañado por el otro mellizo, Yllana y Guglielminpietro. Ahí sí Gimnasia disfrutó del buen juego y la contundencia ofensiva. Sólo un equipo excelente, como el Vélez de Bianchi y Piazza, le cerró el paso. Aquel cuadro velezano que ganó todo, lo su-

peró por un único y lamentado punto. Para frotarse los ojos entonces: lo más aproximado al tiki-tiki fueron varios de los equipos que plantó Griguol, con consignas distintas, es cierto, pero una idea básica: tener la pelota, usarla lo mejor posible, tocar y buscar al compañero mejor ubicado, atacar por los costados y llegar al gol sobre todo con centros aéreos, aunque Márcico, Albornoz y Guillermo hicieron delicias en el Bosque. Encima, sin golpear, sin desbalancearse defensivamente, arriesgando y con pleno conocimiento de sus limitaciones. Muchas menos, sin duda, de las que hoy tiene el plantel de Gimnasia, más allá del esfuerzo del grupo, de la sabiduría y experiencia del retornado Guillermo y de todo lo que aporte Cappa con su teoría y su práctica. En realidad, la historia del Lobo es grande, pero tiene un vínculo estrecho con la pasión, el orgullo y el esfuerzo, más que con otra cosa. MARZO 2011 | UN CAÑO 41


“Por revolearla, ya jugamos dos promociones” Cada semana, con todo Gimnasia, inicia la búsqueda de oxígeno que lo aleje del descenso. Así es hoy la vida de Guillermo Barros Schelotto. Y así será hasta el fin de un campeonato que, además, marcará su retiro del fútbol. Con la gloria o, tal vez, con alguna desconsideración. En el mundo de los interesados y especuladores, es bueno escuchar cierta dosis de generosidad. Por ARIEL SENOSIAIN Fotos PHOTOGAMMA.COM

E

l lector no tiene por qué leer sobre los riesgos de presentar una entrevista anacrónica. Pero sí puede considerar las diferencias de ánimo que podría tener Guillermo Barros Schelotto al momento de ser leídas sus reflexiones. Podría estar atravesando un período de relativa tranquilidad, luego de algunas victorias que lo separen de los últimos puestos en el promedio; relativa, porque bien saben en Gimnasia que la historia se resolverá no antes del final del torneo. O podría estar preguntándose qué lo llevó a volver. Como aquel viernes 25 de febrero, en la cancha de Colón de Santa Fe, sumergido en el banco de suplentes, reemplazado minutos antes, con su equipo 2-1 pero siendo atacado y preguntándose: “¿Por qué? ¿Por qué dije que sí?” De una u otra manera, tendrá tranquilidad de conciencia. Guillermo volvió porque el que no puede decir que no. Dice que sí. Volvió en el peor de los varios peores momentos que atravesó el club en los últimos años: otra vez con riesgos de descenso, otra vez en crisis económica, la idea de que “alguna vez tendrá que ser”. Volvió sin detenerse en la burocracia de un contrato y el derecho de un sueldo. Podrán decir que acumuló suficiente como para comprar parte del plantel, pero ¿cómo era aquello de la ambición? Aquello de que “el que más tiene, más quiere”... Guillermo dijo: “yo a

42 UN CAÑO | MARZO 2011

Gimnasia no le puedo cobrar, Cacho”. Se lo dijo a Héctor Delmar, quien también volvió en el tobogán de su carrera: presidente a los 83 años. –¿Hay lugar para el hincha en el jugador? –A veces sí. En mi caso, por lo menos. Igualmente, hay que ser profesional. Se puede responder jugando como hincha, pero para algunos es una carga muy grande. Ser hincha trae compromiso. Esa es la clave, considero. En el fútbol y en la vida. El compromiso. Podemos comprometernos con la camiseta, con una persona o con la forma de jugar que pide el técnico. Mi mujer, la mayoría de mis familiares y todos mis amigos me empujaron a que volviera. Estaban convencidos de que sería positivo. Para mis hijos, sonaba lindo. Son hinchas de Gimnasia, obviamente, y verme en vivo con la camiseta les gustaba. Pero otros familiares me frenaban. Me recordaban que los últimos jugadores que habían vuelto a Gimnasia, como Guglielminpietro, el Pampa Sosa, Noce, mi hermano Gustavo, Chirola Romero, Messera y Cufré se habían ido mal. Entonces me preguntaban qué pasaría si no me iba bien. Conjeturaban sobre qué iban a decir los hinchas, que se iban a quedar con una última mala imagen en vez de la de mis inicios y mis siete años en el club antes de ir a Boca, que no me iba a resultar fácil el día después porque yo vivo en La

Plata... Pero privilegié otras cosas. Privilegié devolverle algo a un club que me había dado todo. –¿Considerás que en estos años hubo incapacidad o corrupción en el manejo del club? –Prefiero no contestar. Necesito tener la mente libre para pensar en la actualidad. –¿Y qué pasó para que Estudiantes haya llegado a una situación de privilegio y ustedes vivan en crisis permanente? –Pasa por muchas decisiones equivocadas de nuestro lado y positivas del lado de ellos. Son años, una cadena de decisiones. No pasó sólo por la vuelta de Verón, que obviamente fue muy importante. Contrataciones, técnicos, de todo... Lo que pasó en el club seguramente ha influido para que, en un futuro, quiera ser dirigente. Después de junio tengo ganas de descansar, acomodar la vida personal después de dos décadas en el fútbol profesional y luego ser técnico. Más adelante sí, volvería a Gimnasia pero dentro de una comisión. Primero tiene que terminar el suplicio de este campeonato y quedarnos en Primera. Puede salir bien o mal, pero no estaré arrepentido. Me quedará la tranquilidad de haberme entregado y no la duda de qué podría haber pasado si jugaba. Repasada la tranquilidad de conciencia, entonces, vale mirar a futuro. Matías Almeyda ya postergó su fecha de retiro: embalado porque sigue corriendo, anun-


MARZO 2010 | UN CAテ前 55


ció que puede seguir jugando. Martín Palermo le agregó suspenso: una copa internacional puede ser un nuevo desafío. Esteban Fuertes o Rolando Schiavi tienen el último partido del otro lado del horizonte. Al Mellizo Guillermo, en cambio, no lo mueven: “soy el único jugador del fútbol argentino que se quiere retirar. El 30 de junio dejo de ser futbolista. Está totalmente asumido. Llegué por este tiempo, lo anuncié y no me van a quedar más objetivos”. –¿Tu vuelta, la de Almeyda, la presencia de varios contemporáneos son posibles porque es más fácil jugar en el fútbol argentino hoy que hace unos años? –No creo. Los que seguimos vigentes estamos bien preparados. En lo que a mí respecta, me entreno con mis compañeros y de manera particular. El fútbol argentino se hizo más friccionado y menos técnico, pero no significa que se haya hecho peor. Ojo, yo sé que ya no marco diferencia. Y por eso tampoco quiero seguir después de este torneo. No tengo la velocidad con la cual podría hacer esa diferencia. Y no puedo estar ocupando el lugar que tendría que estar ocupando otro jugador. Ya no me saco un jugador de encima con la facilidad de antes. Gané en otras cuestiones: más panorama, por ejemplo; pero

44 UN CAÑO | MARZO 2011

“Comulgo con Cappa. Un fútbol ofensivo, de cuidado por la pelota, sin tantas obligaciones tácticas”. eso es insuficiente. Sé que en el inicio del campeonato aprobé, pero me tienen que analizar después de las diecinueve fechas. Ojalá que el balance sea auspicioso; por lo pronto, soy realista. –¿Ser dirigido por Cappa compensa una de tus cuentas pendientes, como no haber trabajado con Menotti? –Puede ser. Son muy parecidos. Es cierto, me hubiese gustado que me dirigiera Menotti. Tenerlo todos los días, escucharlo como más de una vez lo escuché pero con relación de técnico a jugador. Cappa tiene su misma forma de ser. Es distinto a todos los técnicos que había tenido en el trato. Después está el fútbol que predica, con el que comulgo. Un fútbol ofensivo, de cuidado por la pelota, sin tantas obligaciones tácticas. Suelen preguntarme si es un técnico para salvarse del descenso. Y yo contesto: ¿cómo se llama el técnico para salvarse? O el que te asegura ser campeón. Hasta Bianchi alguna vez perdió… Por otro lado, por no jugar con un estilo,

Gimnasia lleva tres años peleando por no descender. Como dije cuando cuestionaban que queremos salir jugando: por revolearla, ya jugamos dos promociones. –Hace un año, dijiste en Un Caño que “los técnicos son como los gobernantes: ni unos ni otros hacen pensar a los jugadores y al pueblo”. ¿Cappa sí promueve que piensen? –A veces sí y a veces no. Trata de que tengamos más desgaste mental que físico, que nos comprometamos con una idea que nos lleve al triunfo. Tener que ganar, sacar puntos “como sea”, tal cual se dice últimamente, sin pensar qué se está diciendo, lleva a los técnicos a elegir una táctica por sobre la idea y la forma de juego, y a meter a los jugadores en ese sistema táctico. Y el jugador se acomoda rápidamente, le basta con cumplir las órdenes. Hay pocos que tienen la posibilidad de debatir algo con el entrenador. Porque hay técnicos que obligan, no dialogan. En eso, Cappa es distinto.


Cortar el cordón

Estudiantes de la Plata buscó renovación en las entrañas del bielsismo. Recurrió a Eduardo Berizzo, y a pocas semanas del debut del nuevo entrenador, diversas campanas repican sobre su estilo. ¿Será Estudiantes una nueva muestra de esa cuestión extraña llamada “cultura del trabajo”? Le pedimos la nota y algunas respuestas a un especialista. Por ROMÁN IUCHT Fotos PHOTOGAMMA.COM

C

uando Marcelo Bielsa construyó, a principios de los años ‘90, esa criatura que dejó su sello en el fútbol argentino (Newell´s), lo hizo sobre la base de un grupo de muchachos jóvenes a los cuales conocía desde su adolescencia y fue moldeando a lo largo de varios años, desde la famosa “Cuarta especial”. Eduardo Berizzo fue uno de los lugartenientes con rango dentro de aquella estructura y luego, gracias a la recepción de cada uno de los conceptos medulares que el entrenador tenía de su visión del fútbol, se transformó casi en un jugador fetiche. El Toto participó en aquellos dos años cumpliendo funciones como lateral izquierdo, central recostado sobre el mismo sector y hasta mediocentro. Su notable inteligencia táctica, su aplicación y su lectura del partido y el rival le permitieron desarrollar esa plasticidad y salir airoso en cada uno de esos roles.

Bielsa lo comparaba con el alemán Brehme, pieza vital de la Alemania campeona en Italia ’90, por la versatilidad que el zurdo tenia en su juego. Si por lo general se dice que el “el tipo que juega de todo, al final no juega de nada”, Berizzo fue un buen ejemplo de lo contrario. La continuidad tuvo nuevos capítulos en el Atlas de México y en la primera etapa del ciclo del Loco en la Selección argentina, en donde, para ilustrar con un ejemplo, Berizzo fue capitán en el debut del técnico en Maracaibo ante Venezuela. La ligazón siempre fue intensa y, a diferencia de cualquiera del resto de los desprendimientos de Bielsa, ninguno de los discípulos jugó tanto y mamó con semejante identidad la filosofía del técnico, aplicada no sólo al fútbol, sino también a lo cotidiano. Cuando Berizzo decidió cortar el cordón, luego de Sudáfrica 2010, Bielsa la-

Trabajar durante tres años al lado de Bielsa es como hacer un master en la NASA al lado del científico más importante del planeta.

46 UN CAÑO | MARZO 2011

mentó perder de su lado a un alumno querido, pero entendió y alentó esa independencia como una consecuencia natural de la evolución de los hijos en la vida. El llamado de Estudiantes de La Plata fue lo suficientemente tentador como emprender la aventura de calzarse el buzo, tomar la pizarra y hacer sonar el silbato desde el lugar de líder. Llegó en un momento delicado, luego de la sorprendente salida de Alejandro Sabella, para tomar el mando del último campeón y ponerlo nuevamente fuera del área de tormentas. Trabajar durante tres años al lado de Bielsa es como hacer un master en la NASA al lado del científico más importante del planeta, pero ahora es Berizzo en persona, con los riesgos que esto conlleva, el encargado de tomar las decisiones. El aprendizaje ha sido enriquecedor, pero es sólo desde el ensayo y el error, desde la prueba y el cálculo, desde donde el Toto logrará construir su propia espalda a partir de las experiencias personales. En ese aspecto, el plantel le saca una ventaja, ya que hay muchos episodios que los jugadores ya vivieron y que el entrenador deberá andar haciendo el camino. La buena química que puedan lograr ayudará en la tarea. Aprenderá que algunas cosas son distintas a lo que estaba acostumbrado. En una Selección con recambio –la chilena lo era–, el universo de cada elección era tan grande como la cantidad de jugadores


trasandinos desperdigados por el mundo. Ahora deberá acomodarse a la fuerza a un plantel con limitaciones y asimetría en su composición, con superpoblación en algunos sectores, como en el mediocampo (Verón, Braña, Matías Sánchez, Leandro y Nelson Benitez, Stefanattto, Mercado, Nuñez, Peñalba, Pereyra, Hoyos, Pérez), y escasez en otros, como el ataque (Fernández, López, González). En un ambiente salvaje y cruel como el del fútbol argentino, pagará un derecho de piso extra por ser “hijo de”. Ya lo experimentó luego de la derrota –con goleada– que sufrió ante Cruzeiro por la Copa Libertadores, por aquellos detractores carroñeros que pululan por cuanto medio de comunicación se les aparece. Tendrá que demostrar, aunque parezca obvio, que si bien es un alumno aventajado de Bielsa, no es él. Las expectativas pueden elevarlo o denostarlo de acuerdo al prisma con el que se considere a su maestro, pero su gestión personal dependerá de sus resultados y de su trabajo. Las vivencias de Claudio Vivas, Gerardo Martino, Javier Torrente y Darío Franco son un buen ejemplo para entender el fenómeno. Producto de su capacidad e inteligencia, se encargó de aclarar en su primera conferencia de prensa (ésa será su forma “bielsista” de comunicarse con los medios) que sus cambios serán progresivos debido a que si algunas cosas funcionaban bien, no es aconsejable modificarlas en el corto plazo. Con tiempo y trabajo buscará el desafío de enseñarle nuevas formas de ganar a un plantel que lo logró todo. Presión en campo rival, protagonismo en todos lados e intransigencia a la hora de negociar el esfuerzo serán sus postulados básicos. Algunas postales permanecerán inmodificables. Desde Rosario, Máximo Paz o algún lugar del mundo, vestido de jogging y con los anteojos de largos cordones, el maestro seguro lo estará mirando. Otras se encargarán de demostrar el inexorable paso del tiempo. Ahora es a Eduardo Berizzo al que le toca escribir su propia historia.

Presión en campo rival, protagonismo en todos lados e intransigencia a la hora de negociar el esfuerzo serán los postulados básicos del equipo de Berizzo.

MARZO 2011 | UN CAÑO 47


Los padres del Paco

Éramos pocos y llegó Casal, el dueño del monopolio uruguayo. ¿Qué está tramando el millonario empresario socio de Francescoli con los derechos de TV del fútbol argentino? Nuestro investigador nos cuenta las sospechosas reuniones sobre asuntos varios. A ver si aprendemos el trabalenguas: compró Paco pocas copas, y como pocas copas compró Paco...

48 UN CAÑO | MARZO 2011


UN CAÑO INVESTIGA

Por GUSTAVO VEIGA

U

n nuevo escenario se levanta sobre las cenizas del Grupo Clarín despojado del fútbol televisado. El gobierno nacional le abrió el telón a Gol TV, la compañía del discutido empresario uruguayo-brasileño Francisco Paco Casal, que ya tiene oficinas en Buenos Aires. En la AFA temen lo peor. La cláusula sexta del Programa Fútbol Para Todos autoriza a la Jefatura de Gabinete que ocupa Aníbal Fernández –hoy acotado en su poder político– a comercializar con terceros los derechos que valen 600 millones de pesos, unos 150 millones de dólares. Ésa es la puerta por la que entró el intermediario –socio de los inseparables Enzo Francescoli y Nelson Gutiérrez–, al mercado argentino. Llegó para quedarse, a pesar de la resistencia de Julio Grondona. Por ahora lo promociona Gabriel Mariotto, el presidente de la Autoridad Federal de Servicios de Comunicación Audiovisual (AFSCA), quien ya lo sentó a una mesa con el viejo dirigente. No hubo trato posible y sí reproches. “La comida resultó negativa, hubo una situación enojosa, innecesaria”, comentó Guillermo Tofoni, agente FIFA de partidos que participó del encuentro. El nuevo actor de esta pieza de enredos lo emplazó al dirigente para que intercediera ante sus pares de la Conmebol con el objetivo de permitirle transmitir las Copas Libertadores y Sudamericana. Pero recibió una negativa. José Luis Meiszner, el

presidente del Comité Organizador de la Copa América y número dos de la asociación, ratificó esa posición días después: “No podemos ni queremos hacer negocios con Casal”. ¿Será posible evitarlo? No está claro aún si el empresario pretende tanto los derechos de TV cedidos al Estado hasta el 19 de agosto de 2019, o si el gobierno se los quiere sacar de encima, ofreciéndoselos. Es poco probable que, con el torneo Néstor Kirchner ya comenzado, se dé un cambio de manos. Un informe que circula internamente en la AFA detalla que “según trascendidos firmes, hay una oferta de Gol TV para comercializar la publicidad de FPT (Fútbol Para Todos) a un costo asegurado de 8 millones de pesos anuales y una comisión sobre lo que supere dicha cifra del 50 por ciento para cada una de las partes”. Es la primera señal de un negocio que provoca recelo en Grondona. La cláusula sexta del Programa es clarita. Por ella se autoriza la venta, entre otros derechos, de imágenes que vayan “al interior y exterior del país, con las reservas que para

goles y/o jugadas relevantes decida JGM (Jefatura de Gabinete de Ministros), transmisión de partidos e imágenes por telefonía celular, contenidos exclusivos para programas deportivos…” En la AFA se oponen a la embestida de Casal con dos argumentos: cualquier operación que haga el gobierno con los derechos debe tener la aprobación de su Comité Ejecutivo y un espíritu asociativo que permita “mejorar los 600 millones de pesos de ingresos”. Así lo sintetizó una fuente cercana a Grondona ante la consulta de Un Caño. Mientras tanto, Gol TV ofrece a sus televidentes “una programación impresionante que incluye toda la emoción de los partidos en vivo, compactos repletos de acción, programas informativos, noticieros diarios, resúmenes de los momentos más resaltantes del mundo del fútbol, además de especiales históricos, programas conmemorativos y mucho, mucho más…” ¿Se agregará el campeonato argentino a la Bundesliga alemana y los torneos de Brasil y Portugal que ya emite Gol TV para Estados Unidos?

Un informe que circula internamente en la AFA detalla que “según trascendidos firmes, hay una oferta de Gol TV para comercializar la publicidad de FPT (Fútbol Para Todos)”.

MARZO 2011 | UN CAÑO 49


La sociedad inquebrantable de CasalFrancescoli-Gutiérrez, también propietaria de Tenfield en Uruguay, ya emite su programación por Antina TV, un operador de la zona norte y oeste del Gran Buenos Aires. Integra la grilla de la Televisión Digital Terrestre (TDT) y su meta es extender a la Argentina la inserción que ya posee en el mercado yanqui, con 15 millones de suscriptores. Es muy embrionaria su participación en el país, comparada con casi todo el resto de Latinoamérica. El trío uruguayo eligió para representarlo aquí al contador Eduardo Spinosa, ex candidato a presidente de Banfield en las elecciones del 2008 que perdió contra el actual tesorero de la AFA, Carlos Portell, uno de los hombres que le cuida las espaldas a Grondona. La cara local de Gol TV com-

gracias al satélite Amazonas por el sistema TDH (Televisión Directa al Hogar) de Telefónica. Si el Fútbol para Todos llegara a verse por esa vía, afectaría los derechos que aún posee TyC. De ese modo se generaría una situación potencialmente litigiosa. La sociedad de Casal radicada en Miami, fundada en 2003 y cuya sociedad controlante es Tenfield SA Broadcasting Corporation, tuvo que instalarse formalmente en Buenos Aires para aspirar a los derechos del FPT. Así nació Gol TV Latino América, de la que en su página web no hay más referencias que un número telefónico: 4807-5010. En la AFA se tejen habladurías sobre un proyecto de la compañía: la realización de la denominada Copa Unasur, un

parte con Mariotto la pasión por la misma camiseta. De esta relación surge un indicio: la iniciativa para que Casal se interesara en el fútbol televisado. Otro problema que inquieta al viejo dirigente es el perjuicio que podría ocasionarle a la AFA un contrato vigente con Torneos y Competencias (TyC) que todavía retiene para sí los derechos del fútbol nacional hacia el exterior. Cuando se rescindió el 11 de agosto de 2009 el convenio madre con Televisión Satelital Codificada (TSC), que controla el Grupo Clarín, en la asociación omitieron interrumpir el anterior. GOL TV se observa en toda América

torneo del que, por razones obvias, comercializaría los derechos. Después de que el interés de Casal cobrara visibilidad en los medios por su conflictiva reunión con Grondona en el hotel Hilton de Puerto Madero a fines del 2010, le sugirieron dar la cara como posible licenciatario de los derechos del fútbol argentino. Un importante diario nacional le pidió una entrevista a Gol TV, pero uno de los socios se limitó a entregarle un cuestionario prefijado. Hasta el cierre de esta nota, nada se sabía por la empresa de los objetivos comerciales que persigue a este lado del Río de la Plata. A no ser por lo que

50 UN CAÑO | MARZO 2011

cuentan en la AFA, donde defenestran a Paco. Algún hecho debe haber marcado en el pasado su relación con Grondona, quien lo increpó en aquella comida. El poder del empresario, omnipresente en Montevideo desde que pasó a controlar clubes, jugadores, derechos televisivos y directivos, tiene como mojón una relación exitosa con Francescoli. Sus operaciones con River, que se iniciaron con el pase de Enzo en 1983, lo hicieron bastante conocido en la Argentina. Nacido en San Pablo, Brasil, se radicó en Uruguay con su familia al poco tiempo de nacer. Alcanzapelotas, jugador intrascendente, buscavidas impenitente, se iluminó con una beta de oro que transformó su vida: el cuestionado oficio de representante de futbolistas. Ya rico, ya ostentoso en sus atuendos (usa cadenas y anillos de oro), acuñó frases que son de por sí su más auténtico retrato: “Yo soy el tipo más rico de Uruguay. El que me sigue más cerca (…) para alcanzarme le deben faltar 150 o 200 millones”, le dijo al periodista uruguayo Mario Bardanca, quien publicó un libro sobre su vida: “Yo, Paco”. Hoy es un lobista del gobierno uruguayo que le abre puertas en el mundo de los negocios a su país adoptivo. En noviembre pasado, cuando el campechano Pepe Mujica viajó a España se reunió con el presidente del Real Madrid, Florentino Pérez. La intención del encuentro desarrollado en el estadio Santiago Bernabeu era dialogar sobre proyectos del poderoso dirigente y empresario para invertir en el país vecino. Las dos principales compañías energéticas del Uruguay, ANCAP y UTE, serían sus futuras socias. Paco Casal había sido el puente entre las partes aprovechando su relación preexistente con Pérez. Las fotografías oficiales del club español lo con-


firman en su página web: el intermediario aparece en ellas sonriendo junto a Mujica y el anfitrión en la mitad de la cancha. El diario El País de Montevideo precisó: “Antes de su visita a España el presidente José Mujica le pidió al empresario Francisco Paco Casal que gestionara una reunión con el empresario y presidente del Real Madrid, Florentino Pérez”. Cuando presume de su pasar desahogado, Casal presume en grande. “Empecé con un Fitito y hoy ando en una Ferrari. Y si quiero me puedo comprar diez Ferraris”, se pavoneó ante Bardanca. Con sus presuntos logros futbolísticos ocurre otro tanto: “Yo estuve atrás del Peñarol campeón de América 1987, del Nacional campeón 88. Yo armé el River argentino del 86”, dijo una vez. Esos éxitos que se atribuye conviven en su ficha de antecedentes con problemas por presunta evasión tributaria en Uruguay –el fisco de su país llegó a reclamarle 124 millones de dólares–, una temática que otro periodista oriental, Ricardo Gabito Acevedo, aborda en un libro que tituló “Pacomafia vs DGI”. La influencia que trasunta el personaje mantiene a la defensiva a la AFA. La pretensión de Casal que quiere posicionarse en el mercado televisivo argentino y el objetivo del gobierno nacional de recuperar lo que invirtió en Fútbol Para Todos, hicieron posible el acercamiento con este hombre que se jacta de su fortuna. En Uruguay ya tiene los derechos televisivos hasta el 2014. Acá también va por ellos. Los pocos periodistas uruguayos que lo cuestionan se preguntan por qué los de aquí nos quejamos de Grondona. Dicen que allá, Paco manda igual y no lo votó nadie. Incluso manejó hasta el popular carnaval, negociando sobre sus derechos de TV. Su comparsa ya está en Buenos Aires.

MARZO 2011 | UN CAÑO 51


¿Y La Candela?

El poderoso Barcelona desembarcó con su proyecto de buscar pibes símil Messi, sus millones de euros y sus banderas en el legendario lugar de concentración boquense de San Justo. El rumor de una partida acelerada de los catalanes hizo ruido en La Candela. Aquí les contamos qué pretenden y hasta dónde llegaron por ahora. Por ALEJANDRO WALL Foto LUIS HERR

L

a globalización en el fútbol es que eñ Camino de Cintura te lleve a Catalunya. En el cruce con la calle Triunvirato, a la altura de Villa Luzuriaga, San Justo, sucede el milagro: un cartel señala que faltan quinientos metros. Son cinco cuadras hacia adentro, hasta toparnos con el portón de La Candela, mítico refugio bostero, colonizado por el Fútbol Club Barcelona Juniors Luján. Del otro lado del paredón flamean las senyeras, rojas y amarillas. Y, aunque es apenas perceptible, se podría decir que algunos aquí hablan con cierto acento mediterráneo. Forjado, acaso, en las cotidianas conversaciones telefónicas. Al ingresar, hay que recorrer un sendero breve que bordea una cancha de un verde oscuro impecable. Todo está adornado con escuditos azulgranas. El caminito desemboca en la casona donde alguna vez durmieron los rulos de Diego Maradona. Treinta años después, unos pibes apuran el paso hacia los vestuarios. Están vestidos de jugadores de Barcelona. Sueñan con ser Lionel Messi. Acá, en La Matanza.

52 UN CAÑO | MARZO 2011

“El temor del fútbol argentino es que nos llevemos a los chicos. Y eso no pasó. Son muchos más los que se quedan que los que se pueden ir”, dice Daniel Vitali, director general del proyecto y representante legal del Barcelona en la Argentina. Los señores culé llegaron al país hace cinco años. Primero firmaron un acuerdo con Real Arroyo Seco, en Santa Fe, muy cerca de Rosario, una zona donde tiene casa la familia Messi. Pero el convenio no prosperó. Avanzaron, entonces, en una alianza con Arsenal, el club fundado por Julio Grondona y conducido por uno de sus hijos. Y tampoco anduvo: a los catalanes, dicen, no les gustó lo que vieron en Sarandí. Y apareció en escena Jorge Coqui Raffo, un ex jugador de Boca que tenía en

su poder La Candela. Allí funcionaba –y funciona– su criatura, el Centro de Entrenamiento de Futbolistas de Alto Rendimiento, adonde llegan jugadores sin club, libres, para mantenerse en forma ante cualquier urgencia. Joan Laporta, entonces presidente del club catalán, vio todo eso y levantó el pulgar. La unión la consiguió Pablo Forte, un vendedor de zapatos que se había convertido en el detector de talentos del Barcelona en el país. El Atlético de Luján entregó la figura legal y su lugar en la liga local. Así quedó la amalgama: FC Barcelona Juniors Luján, afiliado a la AFA mediante el Consejo Federal. Los catalanes se comprometieron a invertir 7,5 millones de euros en doce años.

“El temor del fútbol argentino es que nos llevemos a los chicos. Y eso no pasó” (Daniel Vitali, representante del Barcelona en la Argentina).


Raffo hizo de La Candela un lugar habitable después de encontrarla en ruinas. Boca, durante la presidencia de Mauricio Macri, había abandonado esas seis hectáreas bonaerenses compradas por Alberto J. Armando a mediados de los ‘60. No la salvaron los títulos conseguidos bajo la batuta de Juan Carlos Lorenzo. Tampoco sus mitos: hasta ahí llegó José Barrita, vecino de San Justo, junto con otros barras de La Doce, para darle una apretada histórica al plantel que después fue campeón, en 1981. “Vi revólveres, revólveres de verdad”, contó Maradona en su libro Yo soy el Diego de la gente. A punta de pistola, El Abuelo amenazó: “mejor que corran, porque si no, los reventamos a todos”. Diego quiso encararlo, pero Barrita lo paró: “con vos no, nene… Vos vas a ser capitán, vos sos nuestro representante, vos quisiste venir a Boca”. Maradona tenía 20 años. “Le hice frente al Abuelo –inflaría el pecho años después–; ése día me gané el respeto de todos”. La Candela tiene historias como ésas. También de penurias. Una foto ochento-

sa de la revista El Gráfico que rescató el blog Imborrable Boca muestra a un grupo de juveniles, todos de las inferiores, rodeando a una mujer y a cuatro churrascos a punto de ser tirados a la plancha. “El sábado al mediodía se comió carne”, decía el epígrafe de la imagen. Un bife era un lujo. Los chicos se lesionaban por la mala alimentación. Eran tiempos terribles para el club. Luego las cosas se fueron acomodando. Cuentan que Macri, cuando llegó hasta la puerta del predio, frunció el bigote y dijo “no me gusta este lugar”. Y lo liquidó. Quedó intacta la pelota azul y oro que hace las veces de tanque de agua, todo un símbolo de La Candela, casi como un monumento fálico de lo que fue este lugar. Barcelona llegó con sus banderas hace cuatro años. Pero no cambió los colores del tanque. Raffo y los suyos calcaron el modelo de trabajo de La Masía, considerada la cuna del fútbol más vistoso. En esa vieja casona rural, la catalana, se regaron los talentos de Messi, Andrés Iniesta, Xavi Hernández y Gerard Piqué, entre muchos otros. Los mejores de estos

tiempos han crecido entre esas paredes del siglo XVIII. En Argentina intentan aplicar la misma fórmula. “Aquí importamos el know how de la cantera de allá. Es una réplica exacta de lo que pasa en Barcelona: los entrenamientos, los ejercicios, todos nuestros chicos juegan igual”, explica Vitali. Y se enumeran los valores: “solidaridad, respeto, democracia, paz, no violencia y libertades individuales y colectivas”. La idea fundacional de La Masía argentina consiste en recolectar las joyas que nacen en este suelo, evitando los problemas de arrancarlas de raíz, como ocurrió con Messi, que pudo cargarse a su familia pero no pudo llevarse Rosario y sufrió el desarraigo. Barcelona pensó entonces que mejor que subir a estos futuros cracks a un avión, era instalar una embajada sobre tierra fértil, hacerlos crecer y, recién ahí, si las condiciones objetivas y subjetivas están dadas, llevárselos. O no. Porque, insiste Vitali, la mayoría se quedará en la Argentina, formándose a la usanza azul-

MARZO 2011 | UN CAÑO 53


grana. El encargado del reclutamiento de pibes es Forte, el ojeador, el que busca cracks por todo el país, sobre todo en las zonas más pobres. Unos doscientos chicos juegan en las distintas categorías del club, mientras que sesenta viven en la pensión de La Candela. Todos van a la escuela Don Bosco, de Ramos Mejía. Maximiliano Rolón es el único que, hasta el momento, se mudó a Barcelona. De La Masía argentina a La Masía catalana. Maxi nació en Rosario, igual que Messi, como si algo uniera a la ciudad santafesina con la española. Es delantero, su pierna hábil es la derecha y puede jugar por ambos costados. Llegó a la ciudad condal hace dos años, junto con otros pibes que entrenaban en La Matanza. Y quedó. Tiene dieciséis años. El resto, en cambio, puede seguir su camino en otros equipos cuando tiene edad de Primera. “Hay ciento cuatro chicos repartidos en diecinueve clubes del país”, explica Vitali. Algunos de ellos juegan en las selecciones juveniles. Los traspasos, en todos los casos, se reali-

54 UN CAÑO | MARZO 2011

Los traspasos se realizan sin cargo, aunque con un acuerdo económico a futuro. ¿El negocio del Barcelona? Las eventuales transferencias. zan sin cargo, aunque con un acuerdo económico a futuro. ¿El negocio del Barcelona? Las eventuales transferencias, un rédito que se verá dentro de algunos años. Mientras tanto, es inversión. Unos 800 mil euros por año. “Es lo mismo que gastan los equipos más grandes en sus inferiores”, aclara el hombre del Barcelona, que es economista. A esto le llaman cantera global, unas divisiones inferiores sin fronteras. En los primeros días de febrero se regó la versión del posible cierre de la cantera argentina. Lo hizo el diario económico Expansión, desde España. La noticia, que se replicó en los medios argentinos, sostenía que el club catalán ya había desem-

bolsado cerca de cinco millones de euros, y que pretendía recortar presupuestos. La retirada, aclaraba la publicación, sería en dos años. Sin embargo, Toni Freixa, vocero de la junta directiva del club, negó que eso fuera a ocurrir. Las versiones y desmentidas parecen parte de la guerra que todavía libran el actual presidente del Barcelona, Sandro Rosell, y su antecesor, Joan Laporta, creador del proyecto de La Candela, que dejó el club luego de varios escándalos, como los casos de espionaje ilegal a dirigentes del club. De cerca, no todo es tan limpio como parece de lejos. Será que eso también es la globalización.


La memoria del autotrol

El tema está como para una canción de Serrat. Es que para los cordobeses, el cartel electrónico del estadio mundialista representaba una de las pequeñas cosas que enternecen la vida futbolera. El hombre se nos puso así, nostálgico, y sus evocaciones forman parte de las nuestras. Por OSVALDO ALFREDO WEHBE

L

a escenografía es la mesa del bar de siempre. Sólo que, más o menos a mediados de febrero, están todos los que están todo el año. La reunión no se detiene jamás. La mesa contra la ventana de la calle atiende todo el año. Aunque quede un solo parroquiano porque los demás están de vacaciones, o se fueron a pescar en grupo, o hay mucha gripe dando vueltas. La cara de desgracia de uno de los históricos fue determinante para el tema de un mediodía completo. Lo que es mucho, porque por lo general la gama de asuntos a tratar es múltiple. El tipo trajo la foto que había sacado con el celular en el momento de ¡la caída del AUTOTROL! Para la mesa no es el Muro de Berlín pero… El Autotrol del Estadio Córdoba se desmoronó, explotó, se fue, no estará más. El Autotrol era un habitante de toda la vida del ahora llamado estadio Mario Kempes, aunque será difícil que no le digamos “Cható”, así, de puro confianzudos nomás. En esa pantalla gigante leímos resultados, pedidos de aliento, publicidades y hasta cargadas. Pero lo más significativo fue pensar todo lo que el Autotrol había visto y se llevaba con él a la basura. El Estadio está siendo hermoseado, y para bien. Es, seguramente, de todos los mundialistas del ’78, el peor construido a la hora de pensar en la gente. Desde las populares jamás se vio el otro arco y todo pareció siempre demasiado lejano. Eso se está corrigiendo con la Copa América a la vista. Nuestro amigo decía que si alguien hallaba la memoria del Autotrol se iba a encontrar con mucha emoción, con gritos y cánticos, con frustraciones y consagraciones. El Autotrol del Chateau Carreras vio los goles de Teófilo Cubillas a Escocia. Tiene en su chip los de Krankl a Alemania en una gran victoria, después de una vida, de Austria frente a los teutones. Tiene un empate épico de germanos y holandeses. Contiene un título de Estudiantes de La Plata en el ’83, cuando jugó en la última fecha del campeonato ante Talleres. Hay ascensos y descensos de equipos cordobeses. Aquella final del ’98, cuando –por penales– Talleres ascendió frente a Belgrano con el último remate del Lute Oste. Y la llegada a Primera de Belgrano frente a Banfield. Hay, además, festejos ajenos a Córdoba para sufrimiento de los de la Docta: Huracán de Corrientes,

PHOTOGAMMA.COM

Gimnasia y Tiro de Salta, Argentinos Juniors, Nueva Chicago y, por supuesto, Independiente. Hay Maradona ante Instituto. Hay Central campeón del ‘80 a pesar de perder contra Racing de Nueva Italia. Hay centro de rabona de Diego para la cabeza de Ramón Díaz ante Suiza. Y tiene el Autotrol el recuerdo de goles difíciles de explicar del Gallego González en el San Lorenzo del Bambino Veira. Sin olvidar las decenas de recitales para todos los gustos musicales. Y un montón de llegadas del Rally argentino. Hay Labruna dirigiendo a la T. Y el Pato Pastoriza, claro. O la primera clasificación de un equipo del interior de Córdoba a un Nacional, cuando Estudiantes de Río Cuarto le ganó a Belgrano con el Hacha Ludueña de bandera. Y goles del Luifa Artime de a montones. Y de Dertycia. Y del Cachi Zelaya. Y un gran baile de Racing de Córdoba a Independiente. Y muchas cosas más que se lleva el Autotrol en el recuerdo. Mientras llega la Copa América, se fue el cartel del “Cható”. Ese mediodía, todos volvimos a casa casi a las dos de la tarde. Y por ahí, todavía, alguno tira algún recuerdo. Aunque todos sabemos que la colección completa la tenía la pantalla gigante: el viejo y querido AUTOTROL. MARZO 2011 | UN CAÑO 55


Corta duración

La mayoría de los futbolistas argentinos que fueron transferidos a Europa en la temporada pasada ya no juegan en el club que los compró. Y hay varios que ya están de vuelta. Pastore, Palacio, Andújar, Spolli y Gaitán son algunas excepciones. Por CARLOS CARPANETO

S

i a esta historia hubiera que incluirle banda de sonido, el tango Volver, de Gardel y Lepera, sería una buena elección. Aunque la versión sufriría algunos retoques: las frentes no están marchitas y eso de los veinte años no describe certeramente a la situación en lo que a tiempos se refiere. Acá hablamos de semestres, de un par de años como mucho… Una Selección mayor que hace rato no gana nada, representativos juveniles que penan en clasificatorios sudamericanos, torneos locales pauperizados… ¿Todo tendrá que ver con todo? La historia en cuestión aporta a esta trama de decadencia: los jugadores del fútbol argentino que son transferidos a las ligas más importantes de Europa juegan poco y cambian de club o se pegan la vuelta cada vez más rápido. Una primera muestra para entrar en calor: de los veintisiete futbolistas de Primera División transferidos en el mercado de verano europeo 2009 (el más fuerte en movimiento de pases) y el de invierno (enero 2010), hoy –dieciocho y doce meses después, respectivamente– sólo nueve

56 UN CAÑO | MARZO 2011

–o sea, el 33%– permanecen en el mismo club que los compró. La paradoja es que esta situación se registra justo cuando la Argentina tiene al mejor jugador del mundo, Lionel Messi, y se acaba de convertir en el principal exportador de futbolistas del planeta: según un estudio presentado en diciembre del año pasado por el abogado francés Michel Pautot, especialista en derecho deportivo, en la temporada 2009/2010 fueron 1.800 los futbolistas nacionales que jugaron fuera de su país, superando por primera vez a Brasil, que contabilizó 1.440. Aunque trillada, la frase es certera: cantidad no es sinónimo de calidad. “Al globalizarse tanto el negocio del fútbol, la demanda por futbolistas argentinos aumentó notablemente. Muchas veces, los jugadores se van a Europa jóvenes y sin completar el proceso de maduración que, en otro tiempo, los Batistuta, los Crespo o los Almeyda realizaban durante años en el país”, sostiene el agente FIFA argentino

Pascual Lezcano. Sin embargo, parece haber algo más que la edad y la inexperiencia como factor determinante en este fenómeno. Es más, hay ejemplos puntuales que invitarían a revisar lo que tenemos aceptado como estándares de jerarquía. Por caso, la situación de Mario Bolatti, indiscutido en nuestro medio y mundialista en Sudáfrica: a los 22 años se fue de Belgrano al Porto (sólo 15 partidos en dos temporadas), pasó a Huracán, jugó un año en el Globo y retornó a Europa, esta vez al calcio, para disputar en 13 meses en la Fiorentina 28 partidos (y apenas la mitad como titular). Ahora, el fino volante central está otra vez en Sudamérica, jugando para el Inter de Porto Alegre.


Mario Bolatti con los colores del Inter de Porto Alegre

Otro caso ilustrativo es el de Mauro Boselli, quien tuvo a los 20 años un poco recordado estreno europeo en el Málaga B. Siempre se le auguró un destino de goleador top que se concretaría cuando tomara la decisión de apartarse de la sombra del Titán Palermo y dejara Boca por Estudiantes. Con el equipo de La Plata fue campeón y goleador de la Copa Libertadores 2009, y máximo anotador del Clausura 2010, lo que le valió el desembarco en el Wigan, de Inglaterra. Pero en este equipo de mitad de tabla (siendo generosos) de la Premier League perdió rápidamente la titularidad y cerró su estadía británica, con apenas un gol en 12 partidos. Al cierre de esta nota, Boselli esperaba debutar en el Genoa de Italia, equipo al que llegó en el mercado invernal y en el que otro indiscutido del fútbol local como Rodrigo Palacio aún la pelea por convertirse en titular. Para cerrar la enumeración de nombres propios con contundencia, hay que tirar sobre la mesa el nombre de Sebastián Prediguer. El de Crespo, Entre Ríos, coterráneo de Gabriel Heinze, debutó con la Selección local de Mara-

Transferidos a mediados de 2010 (temporada 2010/2011) JUGADOR

CLUB

Mauro Boselli Marcos Angeleri Franco Jara Nicolás Gaitán James Rodríguez Facundo Bertoglio Ismael Sosa Cristian Villagra Facundo Coria Alejandro Gómez José Sosa Ignacio Piatti Leonel Núñez Matías Fritzler Damián Steinert Alejandro Cabral Nicolás Otamendi Marco Torsiglieri Andrés Ríos Federico Insúa Ezequiel Muñoz Gabriel Paletta Facundo Pérez Castro

Wigan Sunderland Benfica Benfica Porto Dynamo Kiev Gaziantepspor Metalist Kharkiv Villarreal B Catania Napoli Lecce Bursaspor Hércules Bursaspor Legia Varsovia Porto Sporting Lisboa Wisla Cracovia Bursaspor Palermo Parma Olympiakos Volou

SITUACIÓN pasó al Genoa (suplente) suplente suplente titular titular suplente titular titular pasó al Pachuca (suplente) titular suplente suplente pasó a Independiente suplente suplente suplente titular titular suplente suplente titular titular suplente

MARZO 2011 | UN CAÑO 57


Transferidos a mediados 2009 y principios 2010 (temporada 2009/2010) JUGADOR Eduardo Salvio Diego Valeri Javier Pastore Augusto Fernández Gonzalo Bergessio Sebastián Prediguer Gabriel Peñalba Nicolás Bertolo Juan Forlín Rodrigo Palacio Facundo Roncaglia Mariano Andújar Leandro Caruso Fabián Assman Hernán Fredes Leandro Gioda Hernán Bernardello Iván Pillud Nicolás Spolli José Shaffer Franco Sosa Franco Zucculini Radamel Falcao Mateo Mussachio Pablo Fontanello Gustavo Alustiza Mario Bolatti

dona en 2009, fue transferido al Porto, donde nunca llegó a jugar oficialmente, regresó a Boca en el primer semestre de 2010 y participó de tres partidos; luego pasó al Cruzeiro de Brasil, donde tampoco se lo llegó a ver en cancha, y ahora, en este Clausura, ha retornado a Colón. Para Gamboa, es titular indiscutido… El repaso por los distintos libros de pases es muy ilustrativo. Darío Cvitanich y Lautaro Acosta, los dos pases más caros del fútbol argentino (ventas superiores a los diez millones de dólares) en el mercado estival europeo de 2008 hoy son suplentes en sus clubes. Lo dicho: de los transferidos a mediados de 2009 y principios de 2010, sólo Pastore, Forlín, Palacio, Andújar, Bernardello, Spolli, Franco Sosa, Radamel Falcao (colombiano formado en la Argentina) y Mussachio permanecen en los clubes compradores. Y del último mercado importante, el de mediados del 2010, hace poco más

58 UN CAÑO | MARZO 2011

DESTINO ORIGINAL Atlético Madrid Porto Palermo St. Etienne St. Etienne Porto Lorient Palermo Espanyol Genoa Espanyol Catania Udinese Las Palmas Metalist Kharkiv Xerez Almería Espanyol Catania Benfica Lorient Hoffenheim Porto Villarreal Parma Xerez Fiorentina

de un semestre, sólo 9 de 23 jugadores –es decir, menos de la mitad– son titulares en sus respectivos equipos... En este grupo, amén del mencionado caso de Boselli, llama la atención la situación de Angeleri, un casi mundialista que en el Sunderland inglés suma 76 minutos de juego repartidos en tres partidos o el caso de Leonel Núñez, quien ya volvió, tras media temporada nomás, del Bursaspor turco, donde el Pocho Insúa arranca los partidos desde el banco. Con un panorama semejante, cuesta encontrar ejemplos de futbolistas de nuestro medio que en los últimos tiempos hayan cumplido el requisito de llegar a Europa a plazas top y se mantengan en lo más alto de la marquesina.

EN LA ACTUALIDAD Benfica Lanús (pasó por Almería) Palermo Vélez Catania Colón (pasó por Boca y Cruzeiro) Estudiantes Zaragoza Espanyol Genoa Estudiantes Catania River (pasó por Vélez) Independiente Independiente Xerez * (tras pasar por Quilmes) Almería Racing Catania Central (tras pasar por Banfield) Lorient Racing (tras pasar por Genoa) Porto Villarreal Gimnasia LP (tras pasar por Tigre) Arsenal Inter de Porto Alegre

Uno de ellos es, indudablemente, Angel Di María, pieza clave para Mourinho en el Real Madrid, al que llegó proveniente del Benfica. Otro es Javier Pastore, quien combina su lujoso talento y una prestación siempre confiable en el exigente calcio con el Palermo. Y podría mencionarse, como para completar al menos un trío, a Lucas Barrios, hombre-gol del Borussia Dortmund (y de la Selección paraguaya), que marcha cómodo hacia la obtención de la Bundesliga. Aunque, claro, Barrios pasó por el fútbol argentino como un desconocido, jugando apenas 16 partidos en Primera División entre Argentinos y Tiro Federal, antes de tener que irse a Chile a reflotar su carrera. ¿Así andamos?

Darío Cvitanich y Lautaro Acosta, los dos pases más caros del fútbol argentino en el mercado estival europeo de 2008 hoy son suplentes en sus clubes.


ME FUI A LOS CAÑOS

Por DIEGO CORPACHE Producción SEBASTIÁN PRATS

Nostalgias donde aprieta el frío

Cerca de Helsinki, en Finlandia, Diego Corpache, ex jugador de Deportivo Español, pasó de marcador central a ayudante de campo. Desde allí, relata la vida bajo cero, entre necesidades muy satisfechas y el aburrimiento a flor de piel.

T

urku es la segunda ciudad de Finlandia, o alguna vez fue la segunda ciudad, pero sigue siendo la más futbolera de todas. Aunque hace un año y medio que dejé de jugar por una lesión, sigo aquí como ayudante de campo del club TPS, mientras hago el curso de entrenador. En realidad, jugué mucho tiempo en la contra, el Inter. Llegué en el 2000, y compartíamos esta locura con otros muchachos de Español: Pertot y Peralta. También estuvo un tiempito Bazán Vera. Los pibes me decían que yo era la última persona que podían esperar que se quedara tanto tiempo: “sos el de más barrio”, argumentaban. Y es verdad. Viví siempre en Lugano. Debuté en Español en 1996, cuando el club pasaba por un mal momento. Después de tres temporadas me fui. Pertot y Peralta ya estaban por acá, y entonces me mandé. Jugué en el Inter hasta 2009. En 2008 salimos campeones. Fue una hazaña, porque el club era relativamente nuevo. En 2009 cambié de club y ciudad: me fui a Haka. Ahí me rompí los ligamentos cruzados y abandoné. Volví a Turku y cambié de vereda. Me fui al TPS, donde también soy el entrenador de la Academia de Jugadores. La historia del Inter era increíble: el hijo de un tipo millonario era fanático del fútbol y quería jugar. Pero no le daba el nivel. Se había ido a probar a TPS y lo rechazaron. Entonces, el padre fundó un club para todos los que no podían entrar, el Inter. Les copiaron el nombre y los colores a los italianos. Y querían tener argentinos en el equipo. El primer año la pasé mal con el frío, no me podía adaptar. Contaba los días para volverme. El día que llegué hacía 24 grados bajo cero. Y yo no venía preparado. No tenía botas especiales ni camperas térmicas, nada. Bajé en el aeropuerto haciéndome el facha con una camperita de cuero y unos zapatitos. Y de ahí me tenía que ir a firmar el contrato con el presidente. ¡No podía agarrar la lapicera del frío! Tenía los dedos congelados. El presidente me miraba y seguramente pensaba “este indio no sabe escribir”. Cuando estalló la crisis de 2001 en la Argentina, me dije “me quedo un año más”. Le fui agarrando la mano y

acá estoy: ¡pasaron diez años ya! Hablo inglés y finlandés –un poco– con los jugadores, cuando doy las indicaciones. A mi novia, finlandesa, la conocí porque hablaba español. Los finlandeses no son muy sociables. La gente trabaja y se va para su casa. Tampoco te queda otra, por el frío. Te tenés que encerrar. Y como económicamente están bien, no necesitan de nadie y eso lleva a que la gente no tenga que salir a conversar. Por eso se dan tantos problemas asociados con la soledad y la depresión. Creo que en la Argentina hay más gente feliz que en Finlandia. Acá no les falta nada, pero hay mucha gente que no le encuentra la vuelta. Es un país en el que parece que todo funciona. La gente es muy educada. Pero en un punto te aburre, porque no pasa nada. Una vez llegó a publicarse en un diario local la foto de un perro que tenía rabia. “Un perro sarnoso en Finlandia”, decía el titular. Cuando algún finlandés va a la Argentina, luego me dice que no puede creer la cantidad de perros callejeros que vio ahí. Y ni hablar de la pobreza. Acá los sistemas sociales son impresionantes y abarcan a mucha gente. Eso es buenísimo. Pero la política de inmigración es bastante dura: no entra nadie. Futbolísticamente, el nivel es bajo. Mejor dicho, es raro. Por ejemplo, nosotros en Argentina no cabeceamos, somos más de usar el cuerpo. Pero acá tenés que cabecear, porque hay muchas situaciones de uno contra uno y se definen de cabeza. Otra diferencia es que acá no hay muchas coberturas. Si yo como defensor central no ganaba, en la Argentina venía el otro central y me cubría. Acá, si no ganaste el mano a mano es una situación de gol. Yo tuve que empezar a cabecear. Se juega con una línea de cuatro y con wings que te tiran bochazos de todos lados. Por eso cabecear bien es clave. Lo que siempre me pregunto es cómo hacían sin Internet, hace veinte años. Yo sin Internet no podría estar acá. Chateo, leo el diario… Es como estar en la Argentina. Ojo, igual hay momentos distintos. A veces pienso en cambiar, pero para eso necesitás opciones mejores. Y no aparecen. Aparte, yo acá firmo un contrato y se cumple.

MARZO 2011 | UN CAÑO 59


lea el próximo número de Un Caño. Saludos cordiales, Víctor Raffo Archivo Roberto Santoro TEA y DeporTEA

Respuesta de Ignacio Fusco al consejo editorial de Un Caño: NACHO SE DEFIENDE Asunto: RAFFO ACUSA De Víctor Raffo Sres. del Consejo de Dirección, Sr. Secretario de Redacción, Sr. Pablo Llonto. De mi mayor consideración, Leyendo la última edición de la revista Un Caño (número 33, enero-febrero 2011), una gran sorpresa me causó encontrarme con la nota titulada “Crónicas de un origen”, firmada por Ignacio Fusco (pág. 36) y hecha, de principio a fin, en base a extractos de mi libro El origen británico del deporte argentino (2004) e incluso ilustrada por una imagen extraída de mi blog (http://victorraffo.blogspot.com). Pero la sorpresa, propiamente dicha, específica, me la provocó que en ningún momento del artículo escrito por Fusco se citara la fuente, el origen de toda esa información. La frutilla del postre la encontré en el copete, donde dice que aquellos pioneros dejaban constancia de sus vivencias en “los diarios de la época –sin asentar resultados, claro– para que un arqueólogo deportivo lo encontrara 140 años después”. Me pregunto: ¿quién es el arqueólogo? ¿Ignacio Fusco? ¿Fusco se arroga el hallazgo de los manuscritos de Walter Heald en los archivos de una universidad en Inglaterra? Si de hallazgos se trata, el gran hallazgo fue, después de meses de trabajo con documentos del siglo XIX (que nada tenían que ver con el fútbol), descubrir que el nombre de pila de Heald era Walter y no William como lo bautizó Ernesto Escobar Bavio en sus libros, lo que fue repetido de manera sistemática en todos los medios durante 70 años. Con este dato llegué a su Journal of my Exile, su diario de viaje, en los archivos de una universidad inglesa. Y lo tuve que pagar en libras esterlinas, traducirlo, etc., para volcarlo luego en las páginas de mi libro El origen británico del deporte argentino. Todo este trabajo lo hice allá por los años 2002, 2003, cuando el supuesto arqueólogo todavía era un estudiante de periodismo deportivo. Yo les pregunto, de periodista a periodista, ¿cuál es el problema de citar la fuente? ¿Se puede ser tan miserable de subirse con tanto descaro al trabajo de los demás? ¿Qué hacían el editor o Secretario de Redacción que no le preguntaron a Fusco de donde sacó estos testimonios? ¿No era, como dice el editorial de Mariano Hamilton del número 18 (octubre 2009), que para escribir en Un Caño “los únicos requisitos son la responsabilidad y la honestidad intelectual”? Lo que hizo Ignacio Fusco no es “arqueología”, tiene otro nombre: PLAGIO. Espero encontrar una rectificación y/o aclaración cuando

60 UN CAÑO | MARZO 2011

“Entiendo al señor Raffo. Mi explicación será frágil pero sincera, acaso inofensiva para apagar su enojo. Me hubiera gustado contestarle a su casilla de mail o hablarlo personalmente, pero prefirió dirigirse a la dirección de la revista, así que le escribo por este medio. Extraje los diarios de Heald de su libro El origen británico del deporte argentino, hace algunos años ya, a raíz de una caprichosa búsqueda sobre historias del fútbol amateur. Los archivé en mi computadora, los olvidé, un día me los volví a encontrar, y entonces creí, acaso equivocado, que los diarios se valían por sí mismos, que ésa era la única bibliografía, desentendiéndome u olvidándome totalmente de la fuente. Es más: desconozco si el único libro en el que han sido publicados fue en el de Raffo. Me entusiasmé con la historia por la historia misma, ansioso de contarla, contextualizada con las remanidas crónicas del primer partido en el país. Me parecía -aunque recién ahora lo pienso- que era algo así como transcribir un diario de Bartolomé de las Casas, renovar o recordar una historia ya contada por otro. Que el único cronista, aquí, era Heald. Al comienzo de estos párrafos podría haber escrito la palabra disculpas, pero preferí explicarme antes. Ahora sí, señor Raffo: perdón. Fue un error de entusiasmado, de amateur, que podría haber evitado con una sincera mención, y la historia no perdía ni ganaba nada. Entiendo su enojo. Y una cosa más: verá que elegí evitar la palabra plagio, que usted escribe tantas veces. El plagio, sospecho, siempre esconde una intención. Intuyo insuficiente, sin embargo, mis disculpas. Siempre es así. Y le agradezco por recordarme que hace apenas ocho años era “todavía un estudiante de periodismo deportivo”. Escribir, ahora, en esta tremenda revista, me recuerda el orgullo que debo sentir. Disculpas, en serio. Lo saluda respetuosamente, Ignacio Fusco.

Respuesta de Pablo Llonto a Raffo: PABLO PIDE AMOR Y PAZ Estimado Raffo: El compañero Fusco ya le ha pedido disculpas a usted. Nos ha quedado claro que la mala fe no ha sido la compañera del periodista cañero en los aciagos días en que escribió una historia de la historia. Solamente le queríamos dar un consejo. No con los ánimos de Sabina, ni para que usted pueda vivir cien años, pero eso de andar diciendo plagio y recontraplagio no le hará bien a su salud. Primero porque el plagio, según los códigos penales


que defienden la propiedad privada capitalista, es el delito de “apropiación ilegítima de la paternidad de la obra de otro”. Y que sepamos, don Nacho Fusco no se apropió de nada que a usted le pertenezca. Tomar citas de un diario, de un libro que tomó citas de un diario, a lo sumo es cometer la torpeza de no citar fuentes. Lo contrario sería como escribir sobre Machu Picchu y tener que pedirle autorización, siempre, al primer hombre del siglo XX que se encontró con las ruinas. Por otro lado, no le queda bien andar jactándose de “gran hallazgo” y de gastar “libras esterlinas” en la investigación de su libro, basado en búsquedas laboriosas en bibliotecas y archivos. No somos más, a veces, que roedores de bibliotecas en la búsqueda de supuestas verdades y, en estos tiempos, roedores de Google con los mismos objetivos. Los diarios y libros escritos por otros no son más que materiales de consulta, que están... para ser consultados. Como editor, le pido disculpas por haber calificado de arqueólogo a nuestro compañero Fusco. Las exageraciones, cada tanto, son desviaciones capitalistas que no hemos logrado sacarnos de encima. Se trataba, sépalo, de ponerle una sonrisa a un copete. Aclarado los tantos, nos despedimos, no sin antes decirle, con el corazón, que hace mucho dejamos de creer en la propiedad intelectual. Fue cuando leímos las palabras del poeta Roberto Santoro en un reportaje: “soy un escritor surrealista, es decir, realista del Sur. Lo que digo es lo que digo. Como soy un tipo sin tácticas ni estrategias, no escribo para los que escriben, sino que trato de escribir para los que hablan. No me importa el premio municipal, ni la obra papel biblia, ni el estatus de la calle Santa Fe, ni el barrio de San Telmo a la hora en que se enciende el whisky. Lo más importante es ser uno cuando se vive y ser el mismo cuando se escribe”.

Asunto: TARDE PERO SEGURO De Fernando Jimenez Esta carta va destinada al Señor José Carlos Isern, quién en su carta de lectores de la edición enero-febrero dijo entre otras cosas: “Clap, clap, aplaudo hasta enrojecer mis manos a John Carlin y Carlos Pierini, hace rato que no leía una descripción tan perfecta, tan clara sobretodo y tan justa de por qué mi querida Argentina se convirtió en lo que es hoy e inevitablemente será mañana…” También va destinada a la gente de Un Caño, que no recibió respaldo por la nota de Mocca: a ustedes y a Mocca, mis disculpas por no haber escrito antes. La nota que publicó El País es un bochorno llena de insultos a Maradona, insultos de los que no toma responsabilidad porque siempre aclara que “nadie lo acusa ni lo maltrata por su triste enfermedad”. Se nota, ¿eh? Todos los argentinos deberíamos haber repudiado dicha nota, no por atacar a Maradona sino porque un diario español y un señor inglés se ponen a opinar de nosotros, desvergonzada, impune, arbitraria y descaradamente. Mejor no decir mis opiniones del psicólogo argentino, todavía me queda caballerosidad para no insultarlo. En segundo término, la nota es una falacia. Si somos lo que somos es por los millones de malos manejos que ha habido en nuestro país, además de los golpes militares que respondieron a una clase determinada de la sociedad y no a la “manada fan-

toche que Maradona representa en caricatura payasesca”. Si somos lo que somos es también por un sistema neoliberalista que nos vació en 25 años -desde el golpe militar funesto de 1976 hasta 2001-, en donde entre otras cosas se siguieron los consejos de los países más avanzados que formaban el FMI (¿avanzados? ¿En qué?) En tercer lugar, estoy podrido de que se utilice a Maradona para ponerlo de ejemplo de lo que está bien o mal… pero podrido de verdad. Maradona fue el más grade jugador de fútbol. Nada más ni nada menos. El siempre lo dijo, no es ejemplo de nada ni para nadie, solo para sus hijas y que ellas guarden el veredicto. Yo nunca escuché a alguien que se droga: “Me drogo porque el Diego se droga…”, así que no me jodan. Si a Carlin, Pierini e Isern les molesta algo de la vida de Diego o que se drogue, búsquenlo en Segurola y La Habana, aunque creo que ya no vive por esos pagos. Y por último, adhiero al mensaje final de Un Caño hacia la nota: “Por qué no se van al carajo y se miran el ombligo. ¿O acaso Franco y Aznar eran argentinos?” A lo que agrego: ¿Por qué John no escribe nada de la piratería histórica de su país, de la usurpación de Malvinas, etc. etc.? ¿Por qué no juntan todo en una nota y hablan del genocidio aborigen en América, del robo de nuestro oro, de la constante discriminación hacia “los sudacas” o de la última crisis vivida por España? ¿Eso también los convierte en una manada que sólo responde a sentimientos populistas, también los convierte en ignorantes? Lamento si hiero a alguien. Solo quiero dar mi opinión del caso, no me gusta que nos tilden desde afuera de ignorantes o de ser un manada y no solo por orgullo, sino porque los que nos lo dicen no son precisamente unos ejemplos de caballerosidad y buena conducta. Gracias a Un Caño por dejarnos expresar a todas y todos, aunque por ahí no estemos calificados por nuestra idolatría a Diego (¿quién dijo que para escribir o expresarse uno debe despojar los sentimientos? Ah sí, el mismo que dijo que hay que ser objetivo al opinar. Otra falacia más y van…)

Asunto: MÁS PALOS De: Ángel Belmartino He comprado todos los números de la revista y les he escrito muchas veces. Los últimos números me gustan, pero creo que han perdido el espíritu de los primeros. Me parece que la línea editorial tan marcada la volvió predecible y densa. Muchos artículos reiterativos que son sólo continuaciones uno del otro (léase Gobierno K vs Clarín por Víctor Hugo, Capital vs. Interior por

MARZO 2011 | UN CAÑO 61


Wehbe, la debacle de River, etc.) Me parece que el atractivo de la revista son los artículos “de Color” que han incluido a lo largo que estos años. Léase la nota de Lombardi sobre Paul Gascoine, la nota a Asprilla, los cuentos de Symns, etc. Son realmente de colección. Por otro lado, creo que el dossier por el fallecimiento de Kirchner estuvo de más. A todos nos afecta la muerte de una persona de tanta influencia, pero creo que su relación con el deporte argentino fue más bien indiferente. El número de la gestión de Passarella está muy manchado de cierto revanchismo con una persona que está poniendo su nombre en la guillotina y solo dice: “No voy a malvender, no voy a gastar más de lo que puedo”. Ojalá todos los clubes tuvieran como cara visible gente pública que no se lleve de arriba si mete la mano en la lata. (Ejemplos: Usandizaga, Aguilar, Comparada) Todos dejan clubes en llamas, desaparecen y nadie los conoce. En fin, si me tomo la molestia de escribirles es porque quiero seguir leyéndolos. Yo los banco, ¡banquen a los lectores! Un abrazo. PD: De pedigüeño. Hagan una nota acerca del Sestao River, club vasco que tiene su nombre en honor a la Banda. Hagan una nota acerca de la selección de la unión soviética, pintoresca si las hubo. Háganle una nota al Lobo Cordone, el Axl Rose del futbol. Hagan una nota acerca del Linfield de Irlanda del Norte, el club con mas títulos del mundo. Hagan un nota de Jari Litmanen, el Maradona de Finlandia. Un Caño: Tomamos nota de tus pedidos y de tus recomendaciones. Gracias.

Asunto: SOMOS LAS MIERDA OFICIALISTA De Hernán Sottini Primero quiero manifestar que soy lector de Un caño desde su nacimiento, allá por el año 2005. Esto lo aclaro dado que antes me consideraba un fanático mientras que ahora me considero un lector más del montón. Quiero compartir con ustedes –y con otros lectores– una duda que fue surgiendo con el correr de los años y los números, con esta adolescencia (¿tal vez?) de Un caño (espero sigan muchos años más a pesar de la duda que seguidamente compartiré). Me llama la atención la actual tendencia de la revista, no por las notas de sus escritores públicamente declarados kirchneristas (Morales, Llonto, Hamilton, etc.) sino porque antes parecían “censurados” o “apolíticos” o “anti-K” y ahora parecen ser soldados dispuestos a mandarse morfina en litros varios con tal de seguir batallando en pos de este gobierno y su continuidad. Esa es la duda: ¿por qué se pasó de una revista de deportes con contenido político a una revista de deportes con contenido político y propaganda? ¿Cómo se “convencieron” los que antes parecían “no convencidos”? ¿O es otra cosa la que sucedió? Más me llama la atención si a las pruebas me remito: leer notas “La irresistible tentación de la Rosada” –Alejandro Wall, número 3–; “Saca la mano Alberto” –Alejandro Guerrero, número 7–; “Me pareció ver un lindo pingüinito en la (barra brava)” –Gustavo Veiga, número 9– y “Pingüino al ataque (misión: tomar Viamonte)” –Mingo Rogers, número 11–. Aunque, desde otra óptica, se aprecia que en tres de esos cuatro números la revista contenía publicidad de Fibertel (publicidad que dejó de existir para darle paso a esas que cierran con un “Presidencia de la Nación”); algo que me desconcierta aún más (admito que quizás soy algo ingenuo). Ahora abundan las notas a favor de lo que, al menos en esas notas, se criticaba (¡encima firmadas por algunos de los mismos autores!) cuando podrían seguir escribiendo notas críticas (no sólo de Macri y cía.) como bien lo hace el grandioso Diego Bonadeo (quien supongo sigue escribiendo, 62 UN CAÑO | MARZO 2011

tomando en cuenta su crítica K y su cortocircuito con Víctor Hugo Morales, como para que puedan zafarla con eso de que son mera “propaganda K”). Simplemente esto era lo que quería transmitirles. Esperando una respuesta me despido. ¡Hasta el próximo número! Un Caño: Respuesta de Hamilton: Firmo la respuesta porque en tu carta hacés mención de varias personas y no me parece apropiado responder por ellos pero sí en algunas cuestiones que hacen a la revista y a mi persona. 1) La postura ideológica de algunos de los que escribimos en la revista no tiene nada que ver con pauta alguna de Nación. Nosotros decimos lo que pensamos. Puede gustar o no, pero lo hacemos desde la honestidad intelectual. También nos puso publicidad durante varios meses el Gobierno de la Ciudad y nosotros no cambiamos nuestro parecer sobre la administración de Macri. Es más, un par de oportunidades nos dieron de baja con el consiguiente perjuicio económico que esa situación le produjo a los dueños de la revista y no recibimos ningún consejo ni sugerencia de atenuar nuestro discurso. 2) Nosotros convidamos a escribir en la revista a quien lo desee y no nos fijamos si es de derecha, de centro o de izquierda. La pluralidad es una de nuestras banderas, pero no podemos forzar a escribir a los que no quieren hacerlo. 3) Te aclaro que yo estoy afiliado a Nuevo Encuentro, que soy peronista y que respaldo al Gobierno de Cristina Fernández. Si eso me convierte en kirchnerista para algunas personas, será así. Igual debo decirte que no es la valoración que hago de mi mismo. Y lo mismo me pasa con Víctor Hugo y con Llonto, a quienes conozco bien y no definiría ni por asomo como kirchneristas. 4) Diego Bonadeo sigue escribiendo porque él lo desea. 5) Sólo hago una reflexión en forma de pregunta sobre una frase que dejas en el aire sin querer involucrar a mis compañeros de ruta en Un Caño (“¿Cómo se “convencieron” los que antes parecían “no convencidos”?): ¿No te parece que en estos siete años pasaron cosas que tranquilamente puedan haber cambiado la opinión de la gente? Te dejo un abrazo y gracias por compartir tus dudas.

Asunto: EL SANTO HABLA DEL ÁNGEL De: Pablo Ariel Bresci Quiero felicitar a Ariel Senosiain por la entrevista a Cappa y Pablo de Biase por la nota en la página siguiente en Un Caño 32. Cappa seguramente no está esperando la opinión que este lector (y menos aún siendo hincha de San Lorenzo de Almagro) tiene sobre él, pero quiero expresar mi solidaridad con su salida de River Plate. A pesar de que éste Ángel no es santo de mi devoción, y que creo que el menottismo se terminó cuando Menotti dejó de dirigir, estoy de acuerdo con él en que hay que cambiar, que este fútbol es demencial, alterado e insoportable, y que es el peor del mundo (ayudado en gran medida por la organización y los torneos de medio año). Pero por sobre todas las cosas quiero subrayar lo que declaró sobre el periodismo televisivo y lo que marcó sobre sus desbordes emocionales (“sólo dos, que repetidos ciento cincuenta veces cada uno parecieron trescientos”) que mostraban mientras le hacían una entrevista. Cappa está muy acertado en lo que dijo. Es más el día que lo fueron del Millo, en el canal de noticias TN (con una basta experiencia en hacer parecer lo que no es), pasadas las 19, mientras informaban de su salida (y desinformaban con la posible llegada de Bielsa) mostraban las primeras imágenes de archivo que pudieron encontrar en la urgencia por lograr el color amarillo en la pantalla tan buscado. En la imagen se observaba a un Cappa desencajado, desbordado y exacerbado en el banco de suplentes del Tomás Ducó y con un Globito en el pecho, donde se notaba a la legua que Cappa era entrenador de Huracán. P.D.: Juro que estaba mirando TN porque estaba en el consultorio del dentista. Y todavía me sigo riendo por la mención de Bielsa como su reemplazante. Ah, esa tarde tomé dos decisiones muy importantes: 1-Jamás creer lo que dice TN y 2- Cambié de dentista.


Ya pagarán Durante marzo, miles de argentinos correrán por Miguel Sánchez, el maratonista secuestrado por los represores de la última dictadura, en enero de 1978. Pocos saben que un grupo de los asesinos está a punto de ser condenado por los crímenes cometidos en el centro clandestino El Vesubio, el lugar donde torturaron y desaparecieron al atleta. Conozcamos algunas caras, algunos nombres. Por PABLO LLONTO Fotos ROLANDO ANDRADE

A

veces tienen la mirada huidiza. A veces ríen, mientras en la Sala de Audiencias, siempre alguien se pregunta, o nos pregunta, ¿es que las bestias tienen de qué reír? Son esos momentos en que uno se avergüenza de la humanidad. Porque al final de cuentas, estos fulanos son parte de la humanidad. Disfrazados con trajes que intentan simular decencia, van y vienen de los Tribunales de la avenida Comodoro Py, como quien va una misa un domingo. A tres de ellos, usted se los puede cruzar cualquier día, en la parada de un colectivo o de un taxi, aguardando el momento de camuflarse impunemente entre hombres y mujeres de trabajo, luego de culminada cada audiencia. Sus nombres: Alberto Durán Sáenz (Callao 1307, 1er piso, Capital), Héctor Humberto Gamen (Rawson 2729 piso 10° A de Olivos, provincia de Buenos Aires) y Hugo Idelbrando Pascarelli (Echeverría 2143, piso 11 de Capital). Están libres. En sus casas. Fueron militares del Ejército que gobernaban en la zona de Ricchieri y Camino de Cintura, camino al aeropuerto de Ezeiza. Allí impusieron un lugar de horror y muerte al que llamaban La Ponderosa o El Vesubio. Allí se entremezclaron con otras basuras cuyos nombres aún permanecen ocultos tras los cobardes apodos de El Francés o Fresco y Batata. Los tres están libres porque la relajada mano de la justicia argentina, después de tenerlos en prisión domiciliaria, les aplicó el beneficio de la excarcelación, teniendo en cuenta su ancianidad. Otros cinco, todos ex penitenciarios (Ramón Antonio Erlán, José Néstor Maidana, Roberto Carlos Zeolitti, Diego Salvador Chemes y Ricardo Néstor Martínez), se encuentran encarcelados. Unos y otros tenían el grosero poder –entre 1976 y 1978– de formar parte de los elencos de la picana y la capucha, cuando se

creyeron dioses, en El Vesubio. Allí donde fue a parar, golpeado, vendado, atado, el atleta que fue poeta y militante. Miguel Sánchez, tucumano, 25 años, empleado del Banco de la provincia de Buenos Aires, maratonista y orgulloso joven de la generación peronista y montonera que soñaba la Argentina de las utopías. Llegaba de correr la San Silvestre en Brasil, con la humildad de quienes día y noche persiguen la meta de ser algo más que un número en una carrera. Lo fueron a buscar a Villa España, el barrio obrero de Berazategui donde aquellas semanas hundían sus garras las patotas. Delegados sindicales, empleados, estudiantes, embarazadas, niños... Se llevaron a todos. La prensa nada decía sobre una masacre desatada contra los barrios humildes. El atleta fue visto en El Vesubio, pero nunca se supo de sus restos, ni hay fecha determinada para su muerte. Hoy el juicio oral contra ocho de los victimarios del centro clandestino entra a su etapa final. El Tribunal Oral Federal 4 resolverá –en otros casos, no en el de Miguel (los juicios se llevan adelante por grupos de víctimas, y no por la totalidad)– si ocho miserables pagan sus delitos con la cárcel. La memoria de Miguel Sánchez tendrá que esperar por su caso, quizás uno o dos años más, pero al menos está llegando el momento de poner fin a la miserable rutina de ver a estos ocho carniceros deambulando como si nada. El 27 de marzo próximo, se correrá nuevamente en la ciudad de Buenos Aires por Miguel. Luego vendrán las maratones en su memoria en Tucumán, en Berazategui, en Mar del Plata y en Bariloche. ¿Será el 27 la última vez en que correremos mientras algunos de los asesinos de Miguel permanecen sin condenas? ¿Será entonces que en breve podremos decir que algunas cosas empiezan a estar en su justo sitio?

MARZO 2011 | UN CAÑO 63


Correr, desde el fondo

Referente del atletismo nacional, Daniel Simbrón es un fondista que, como tantos otros compatriotas, tuvo una infancia que transcurrió entre la humildad y las necesidades. Luego desarrolló una carrera cargada de sacrificios y perseverancia. Hoy vive un presente de reconocimiento. En el medio, historias de la pesada mano del terrorismo de Estado. Por DAMIÁN CÁCERES Foto FABIÁN MAURI

C

orrer para vivir y superarse. Correr para modificar el destino. Correr para ser alguien y sentirse pleno. Por todo eso corre Daniel Jorge Simbrón, quien no olvida su pasado, aunque una herida lacerante todavía brote de su interior. De chico, careció de comodidades y lujos, y esas penurias que enfundaron su infancia lo fortalecieron. Por eso, con orgullo, cuenta su historia. Desde aquella vez en que por falta de dinero se decidió a correr durante una noche más de 34 kilómetros, desde Salsipuedes a La Falda, para tomar, en la madrugada, un colectivo hacia Capilla del Monte. Allí lo aguardaban otros 28 kilómetros de montes y colinas, en una desigual competencia que, a pesar del cansancio acumulado, lo vio ganador. Al poco tiempo de nacer, en junio de 1973, en Córdoba, Daniel y su familia se fueron a Salsipuedes, a unos 30 kilómetros de la capital. Anteúltimo de una familia numerosa, se crió con sus seis hermanos “en el campo y a la buena de Dios”. En El Talita, la parte más pobre del pueblo, donde no sabían de gas ni de electricidad. Apenas una lámpara de kerosene cuando sobraban unos centavos. Si no, había que arreglárselas como se podía o esperar a que la luna iluminara por las hendijas de la casilla. Casi de casualidad conoció el atletismo en 1985. Su pasión, como la de todo niño, pasaba por el fútbol. Soñaba con imitar los goles de Mario El Pastor Bevilacqua, ícono del Talleres de Córdoba. Una tarde, como casi siempre, vagaba por el pueblo con Fabián Sánchez, su inseparable compinche de entonces. La

64 UN CAÑO | MARZO 2011

fisonomía del lugar y su gente se notaban cambiados. El domingo se festejaba el Día del Niño. Sin embargo, para Daniel y su amigo sería un día más. Nada de regalos. Con suerte, un buen pedazo de carne. Como parte de los festejos, se corría una prueba de 2 kilómetros sólo para chicos. Daniel no lo dudó y se inscribió. El espíritu de aventura y el deseo de enfrentar nuevos desafíos lo impulsaron a asumir el reto. Ese día correría como nunca: “fui ganando toda la carrera, pero en la parte final me pasaron dos chicos que me llevaban tres o cuatro años. En el fondo, me sentí ganador”, recuerda. Y agrega: “a partir de ahí empecé a correr más seguido, hasta que el secretario de Deportes de Salsipuedes me invitó a otra carrera en Saldán”. Otra vez, Daniel lideró toda la carrera, pero en el sprint final volvió a quedar tercero. A partir de entonces comenzó a correr en cuanta carrera hubiera en los alrededores. Por supuesto, sin entrenador. A veces, ni zapatillas para correr. Pero sobraban ganas, tiempo y verde, mucho verde. Su método era sencillo. Después del colegio, con la tarde completamente libre, corría sin rumbo. El dinero en la casa de los Simbrón provenía del trabajo de Antonio, su padre. Changarín bajo el sol cordobés, en

los cortaderos de ladrillos. Albañil y fumador empedernido, pudo disfrutar muy poco de sus hijos. En 1982, cuando tenía 50 años, falleció de un paro, cuando la dictadura daba sus últimos manotazos. Su madre, Juana Campos, cuando podía, se empleaba como doméstica. Y los hijos, los siete hermanos, de vez en cuando trabajaban en un criadero de pollos recolectando huevos. “Todo sumaba para comer en esos días”, explica. Su recuerdo, quizás el más triste, lo ubica a los cinco años. En una jornada invernal de 1978. En pleno fervor de un Mundial fabricado para intentar convencer al mundo que éramos derechos y humanos, anochecía en Salsipuedes. De pronto, frenadas y una patada en la puerta ensombrecen la tranquilidad familiar. “Un grupo comando, vestido de civil, entró a la noche en nuestra casa y se llevó a mi viejo. Le pegaron mucho. Revolvieron todo. Gritaban, insultaban, se reían… Hasta el pan casero que había hecho mi vieja se comieron”, masculla con rabia. Al padre se lo llevaron arrastrando y lo metieron en un auto. “No sabíamos que hacer. Mi viejo era un laburante. Cuando no trabajaba, estaba todo el día con nosotros”, dice con los ojos brillosos. Se hace fuerte, toma un sorbo de café y

“Un grupo comando, vestido de civil, entró en nuestra casa y se llevó a mi viejo. Le pegaron mucho. Revolvieron todo. Gritaban, insultaban, se reían…”.


“estuvo casi una semana desaparecido. Lo largaron, pero fue un tema del que mi viejo nunca más habló. Creo que ni él entendía por qué se lo habían llevado, porque él sólo se dedicaba a laburar… cuando había algo de trabajo. Lo tiraron destrozado al costado del Camino Real del pueblo, a unos 200 metros de nuestra casa. Siempre me quedó la indignación de que vengan desconocidos, lo golpeen, lo lastimen sin ningún motivo. Lo tuvimos que arrastrar a la cama y mi vieja lo curó durante días”. Con el fallecimiento de su padre, la situación familiar se tornó más apremiante. Su mamá era el único sustento. De repente, hace un silencio y, como con culpa, lanza una confesión: “una vez tenía tanto hambre que agarré un hacha y fui a matar un ternero para poder comer. Hacía días que comíamos pan duro con mate. Estaba decidido a hacerlo. Por suerte, en el camino vi una planta de higos. Eran higos maduros, y comí tantos que se me fue esa horrible idea que, en otras circunstancias, jamás se me hubiese ocurrido. Era una situación extrema, era hambre. A veces el hambre te lleva a hacer cosas que no pensás o pensar cosas que no harías”. Como una escapatoria, pensó en probar suerte en Buenos Aires. Tenía 15 años. El temor a enfrentarse con la “gran ciudad” era un condicionante. Pero la falta de recursos y algún trabajo estable desentrañaron todas las dudas. Llegó a Villa Lugano. Una heladería, en Murguiondo y Riestra, lo esperaba. Soñaba con un trabajo que le permitiera no pasar más hambre y, al menos, dos horas para entrenar. Pero nada sucedió como lo había planificado. Las jornadas eran extensas: de diez de la mañana a dos de la madrugada. Terminaba y se tiraba a dormir en el depósito. Así aguantó dos meses. Frustrado y con la cabeza gacha, quería regresar a Salsipuedes. “Me explotaban tanto que un día agarré el bolso y me fui. Me volvía al pueblo, pero antes de ir a Retiro pasé por la casa de mi hermana Teresa, en Pompeya. Esa noche me quedé a dormir. Al otro día, ella habló con un conocido y me consiguió un trabajo en otra heladería. Bajo otras condiciones. Tenía un horario normal y un mejor sueldo. Entrenaba por la mañana en par-

que Centenario y a la tarde trabajaba”. Por primera vez, Simbrón se sentía más cerca del sueño. Correr profesionalmente. “Me causaba admiración los que hacían podios. Lo único que quería era correr y superarme. Logré algo que alguna vez admiré: ser un corredor de elite. Quería ser el mejor en lo mío. Sólo contaba con mis condiciones físicas porque la situación en mi casa era complicada”, dice. La otra cuenta pendiente, el colegio secundario, la saldó concurriendo de manera intermitente a una escuela nocturna. Los resultados deportivos empezaban a darse. Pasó a entrenarse con Daniel Barboza, quien lo alojó en su casa. Barboza sabía de sus condiciones y le propuso dejar de trabajar para dedicarse al entrenamiento. Recién en 1995 llegaron

los primeros réditos económicos. Época en la que le pagaban por competir. Tenía 22 años y la vida le devolvía algo de lo mucho que le había negado. Iría por más: un curso en preparación física, válido para la Federación Internacional. Pasaron los años y Simbrón logró su gran propósito. Ser uno de los mejores en lo suyo. Consiguió dos campeonatos nacionales de maratón (2003 y 2004) y variados títulos que lo mantienen en el pedestal de los grandes fondistas y mediofondistas del país. Se casó con Laura y tuvo dos hijos, Aramis y Camila, y la posibilidad de construir, a principios de 2002, una casa para su madre en Salsipuedes. Historia de alguien que logró transformar sus utopías en realidades. De alguien que, burlando adversidades, se construyó a sí mismo.

MARZO 2011 | UN CAÑO 65


Nacional, popular, pero un poco olvidado Desde hace siete años, el Ascenso más postergado y profundo tiene una cita: el más federal de los torneos, el del interior del país. La edición 2011 arrancó el 21 de enero, con récord de equipos (319) que compiten por tres ascensos al Argentino B. Pongamos atención, que aquí no hay lugar para unitarios. Por EDGARDO IMAS Foto GENTILEZA JOSE MÉNDEZ.

R

ecién desde 2010 los argentinos podemos decir que tenemos un torneo que cubre toda la geografía nacional: el Torneo del Interior (TDI). Fue cuando la Liga Puneña, con sede en La Quiaca (Jujuy), debutó en el certamen con dos equipos. En el actual, la representaron los ya eliminados Sportivo Libertad y General Lavalle, que jugaron como locales en el Centro de Alto Rendimiento de La Quiaca. Allí, en 1997, se había preparado la Selección de Passarella para jugar con Bolivia por las Eliminatorias de Francia ‘98. La Patagonia más austral tuvo en el primer TDI (la primera edición se disputó en 2005, con 188 equipos) apenas cuatro representantes, todos de Santa Cruz. Siete años después, compiten siete instituciones santacruceñas y cuatro de Tierra del Fuego: Real Madrid y la Mutual Camioneros, de Río Grande, y los ushuaienses Libertad y Los Cuervos del Fin del Mundo. En Ushuaia, los partidos se juegan en el Estadio Municipal Hugo Lumbreras, que por los rigores del clima tiene césped sintético. Doce equipos que hoy la pelean en la quinta categoría alguna vez conocieron tiempos mejores, entreverados con los grandes del fútbol en los viejos torneos Nacionales de Primera División que se disputaron entre 1967 y 1985. Los más conocidos son Kimberley de Mar del Plata (jugó cinco Nacionales y en 1970 goleó 5 a 0 a Independiente de Avellaneda) y Puerto Comercial de Bahía Blanca (que sufrió la mayor goleada en contra en el profesionalismo: perdió 13 a 1 con Banfield en 1974). Además de ser el más antiguo de los

66 UN CAÑO | MARZO 2011

competidores, con 118 años, el Lobos Athletic Club es el único de los 319 participantes que estuvo afiliado directamente a la AFA y jugó en Primera División. Fue fundado en 1892, y dos años después ya participaba en el tercer campeonato de la historia del fútbol argentino con un equipo conformado por estudiantes provenientes del Buenos Aires English High School, el colegio que en 1901 se transformaría en el mítico Alumni. Pacífico, de Bahía Blanca, es más conocido por su historia basquetbolística. Prueba de ello es que, en 1985, disputó la primera edición de la Liga Nacional de Básquet. Fundado en 1896, debió esperar 114 años para debutar en un torneo de la AFA. En cambio, Pioneros de Campana, el club más goleado en la primera fase, fue fundado en abril de 2009. En el equipo jugaban reclusos y tres guardiacárceles de dos prisiones de Campana. Para los partidos que disputó Pioneros como local -en la cancha de Dálmine- se asignó un operativo de seguridad especial, que se reforzó cada vez que fueron de visitantes. Hay participantes para todos los gustos. Por ejemplo, de colectividades: Náutico

Hacoaj y Deportivo Coreano (Lobos); con alusiones vegetales: Madreselva (Lobos), fundado en un barrio donde crecía mucho esta planta; con nombres de futbolistas: Jorge Gibson Brown (Posadas), en homenaje a quien brilló en Alumni, y Américo Tesoriere (La Rioja), que recuerda al legendario arquero de Boca y la Selección en los años ‘20. También compiten once Independiente y cinco Jorge Newbery. Y varios equipos vinculados con sindicatos, como la Mutual Camioneros y Mutual UTA, afiliados a la Liga Lujanense y con mucho apoyo económico y de público, especialmente el primero. Menos conocidos son la Mutual Camioneros, de Río Grande (Tierra del Fuego); Deportivo Petroleros (Caleta Olivia, Santa Cruz), cuyo presidente es el secretario general de los trabajadores del petróleo y gas privado de la provincia; Empleados Banco Nación (Bragado) y Unión Empleados de Comercio (General Alvear, Buenos Aires). Deportivo Tablita es el único representante de Pirané, una ciudad ubicada 100 kilómetros al oeste de la capital formoseña. Su presidente es Alberto Quintana, quien le contó a Un Caño que el club se fundó

Compiten once Independiente y cinco Jorge Newbery. Y varios equipos vinculados con sindicatos, como la Mutual Camioneros y Mutual UTA.


en 1984 y está ubicado en el barrio Evita, el más pobre de Pirané. “El barrio se llamaba originalmente Tablita, porque había un aserradero y todas las casas de sus habitantes estaban hechas con tablas de madera. En los últimos años, el barrio se modernizó, el aserradero se achicó y muchos habitantes trabajan como ladrilleros”. Mediodía del sábado y el presidente está más tranquilo: “recién pudimos arreglar para que los jugadores concentren en un hotel de acá para el partido de mañana”, dice. Quintana describe los contrastes: “los nuestros son jugadores amateur, que trabajan en aserraderos o en la municipalidad. Nuestro presupuesto está muy lejos del que manejan los equipos de la capital provincial. Acá no hay subsidios y todo se hace a pulmón. El otro equipo de la capital en el torneo es Defensores de Formosa, que es el club de la Policía y recibe dinero de la gobernación”. Otra entidad muy apoyada por el Ejecutivo provincial (Gildo Insfrán) es Atlético Laguna Blanca, que juega en otra zona del TDI y es de la localidad en cuyas cercanías se halla la Colonia La Primavera, donde un sangrienta represión a pobladores qom se cobró hace pocos meses dos vidas. El titular de Tablita vuelve una y otra vez contra los políticos y su ayuda interesada. Como Mario Zaragoza, un caudillo del PJ local y ex diputado provincial, que bancaba al Club 13 de Junio, que llegó a estar varias temporadas en el Argentino A. “Cuando Zaragoza le retiró el apoyo, se fue a pique, y hoy está en la Primera B de la Liga de Pirané”, señala Quintana, y agrega: “ahora Zaragoza puso un premio de 15.000 pesos para quien ganara la Liga. Nosotros salimos campeones y con ese dinero pudimos traer a un DT con experiencia de Formosa”. Los gastos que implica jugar un partido se tornan insostenibles para la gente de Tablita: seguro del espectador, doping, policía, ambulancia y el impuesto al Consejo Federal de la AFA. “¿Para qué nos cobra el Consejo Federal si ni siquiera para la operación de Héctor Galeano tuvimos apoyo?” Galeano es arquero de Tablita, que en el partido de la primera fecha, ante Defensores de Formosa, en la capital, sufrió una fractura doble en una de sus piernas. “Los gastos derivados de la operación los tuvimos que poner nosotros, aunque el intendente ayudó haciéndole un contrato con el municipio para

que tuviera obra social”, dice Quintana. Al noroeste de Resistencia, a unos 100 kilómetros, está la ciudad chaqueña de General San Martín. Los créditos locales en el TDI son Atlético América y el Club Recreativo y Cultural Toba. A este último lo preside Alberto Flea, quien también es el entrenador de la Primera y tiene una pollería. Por eso todos lo conocen como El Rey del Pollo. “En realidad, soy el normalizador del Club Toba, que estaba abandonado. El club se había separado en 2002 de la vieja cooperativa algodonera Toba. Después, las malas gestiones lo vaciaron. Y nos hicimos cargo un grupo de tres personas para reflotarlo”, narra Flea. “Tenemos una cancha

costearon el viaje a Presidencia Sáenz Peña para enfrentar a San Lorenzo, y con el resto afrontan los gastos que demanda la organización de cada partido de la rueda inicial. Yury Kordylas no es un astronauta lituano, sino un correntino de 33 años, de ascendencia ruso-polaca, a quien todos apodan el Griego. Jugó al básquet en varios clubes, es un importante empresario gráfico y toca el bajo en un grupo de rock, La Pequeña Lulú . Y es el DT de Sportivo Ferroviario, el único equipo de Corrientes capital que participa en el TDI. “Soy técnico nacional recibido, pero varios han dicho cómo puede ser que sea DT sin haber jugado nunca en Primera. Yo

de once que es la única por acá que tiene túnel y vestuarios, pero no está habilitada por la AFA para el torneo”. El presidente-entrenador señala que una parte importante de la ciudad tiene ascendencia toba. “Pero están desilusionados con todos los problemas que hubo en el club, y no apoyan al equipo”, aclara. Más aún, ni él ni ninguno de los jugadores son tobas. Flea relata los esfuerzos que realizan para jugar. “Vendimos pollos y rifas para poder comprar la indumentaria del plantel y los botines para cinco jugadores de muy bajos recursos que no los tenían”. La intendencia sólo aportó 9.000 pesos para encarar el TDI. Con los primeros 3.000

les pongo el ejemplo de Bielsa…”, dice Kordylas, confesando su simpatía por el Loco. “Desde muy joven voy a ver los partidos de la Liga Correntina. Me fascinan, así que conozco bien este medio”. Como empresario, aportó dinero y llevó jugadores a los clubes en los que trabajó, gracias a lo cual ha formado equipos competitivos en experiencias anteriores en el TDI con el mismo Ferroviario o con el otrora poderosa Huracán Corrientes. En el actual, Ferroviario ya consiguió cómodamente la clasificación para la segunda fase. Y como éstas, mil historias. Como para mirarnos sorprendidos y preguntarnos: ¿será que aquí está el más puro y limpio fútbol? MARZO 2011 | UN CAÑO 67


Levántate y ataja

Matías Schulz fue uno de los hombres de la hazaña del handball ante Suecia. Desde el arco, sometido a pelotazos interminables, formó parte de las celebraciones de un digno y brillante puesto doce en el Mundial. Lo fuimos a buscar por la hazaña, pero también por los secretos de un puesto que es lo más parecido a colocarse en un paredón de fusilamiento. Por JUAN IGNACIO PROVÉNDOLA

A

veces pareciera que los relatos épicos del deporte actual quedaron definitivamente confinados a desafíos de entrecasa en la PlayStation. Ya no cabe lugar para épicas casi anónimas, impopulares. Las historias se repiten y las vemos en las publicidades de anticaspas o afeitadoras. Nada nos sorprende en tanto no nos conmueve. El alboroto sucedió en pleno reinado del fútbol más previsible y aburrido del año: el de verano. El 18 de enero, no hace mucho, en la cuarta fecha de una primera ronda del Mundial de handball. Suecia, máximo campeón mundial en la historia, se había floreado en todos sus partidos ante la aprobación de los doce mil paisanos que colmaban el Scandinavium de Gotemburgo. Embalados, los muchachos de casa llegaron al partido con la certeza de asegurarse el liderazgo del grupo tan solo venciendo a un equipo que jamás pudo sacarle siquiera un empate. En ese escenario, Argentina necesitaba un triunfo para cristalizar sus deseos de acceder a la segunda fase de un Mundial por primera vez en la historia. De golpe, la tele nos habla de una Selección argentina de handball. La descubre, en verdad. Luego, destaca una victoria sobre el máximo campeón mundial en su propio vecindario. Algunos se extrañaron, y reconocieron en esa gesta inédita viejos tiempos de handball en el colegio, cuando en el colegio también se consideraba enseñar al deporte como una interpretación

68 UN CAÑO | MARZO 2011

moral de la vida misma. Eso de compartir y competir, lo importante de integrar un equipo asumiendo un rol dentro de él, la responsabilidad de respetar al rival (más que rival, compañero) y ser leal a la finitud de las disputas de manera verdadera, o al menos de una manera diferente a la de quienes buscan desventajas desleales y luego cobardemente se desligan, arguyendo que “esas cosas quedaron en la cancha”. Y de aquella gesta quedó, entre otros nombres, el de Matías Schulz, la figura excluyente de esa noche para la historia con paradas decisivas que le permitieron a Argentina mantenerse siempre dos o tres goles arriba de su rival, hasta asestarle un impensado 27-22 final. El handball, luego de mucho tiempo, arriba del escenario mediático. Ese juego que propone un juego de funciones establecidas y posiciones determinadas., en el que en ningún momento se pierde de vista que los horizontes se persiguen con esfuerzos colectivos. Tanto es así que el arquero, por ejemplo, no es “el” arquero, sino uno de los tantos que ocupan circunstancialmente el lugar porque las situaciones del partido

así lo determinan. “Con Fernando García compartimos el arco desde el 2000, y nos entendemos muy bien porque somos de la misma edad y jugamos muchos torneos juntos. En el Mundial me tocó jugar más a mí, pero eso no es determinante. Si en el próximo torneo le toca jugar más a él, lo voy a apoyar desde el banco, como él lo hace cuando juego”, dice Schulz, radicado en España. El hombre ha jugado también en Alemania, es decir, se ha fogueado en dos de las tres ligas más fuertes del mundo (junto a la de Francia). Como aquellos que miraban con nostalgia las duras arremetidas en los perímetros del área y los violentos remates aéreos en la zona capital, aprendió el deporte en el primario. Al fin y al cabo, en Argentina, las historias de handball no son de potreros, sino de colegios. Y la de Matías transcurrió en uno de Los Polvorines, mientras sus dos hermanos mayores ya jugaban en la Sociedad Alemana de Gimnasia, el club de su zona. Ambas circunstancias coincidieron en un nombre y apellido: Ricardo Echeverría, entrenador en el colegio y el club. A los 11 años, entró en infantiles. Se

“Uno se acostumbra de chico a los pelotazos, y lo disfruta, porque es una acción positiva. Estás en tensión permanente para preparar el cuerpo ante el impacto”.


fue a los 24 porque recibió una oferta para jugar profesionalmente en Europa. “Nuestra familia está muy vinculada al SAG Polvorines. Además de mis hermanos, tengo un primo arquero con el que compartí plantel. Y mi padre fue jugador y también presidente, en dos ocasiones. Me mantuve fiel a los colores de mi club y nunca fue una opción jugar en otro del país”, dice Matías, hoy en España. Fueron tiempos en los que se convenció del puesto y le tomó el gusto a ser fusilado una y otra vez con una bocha blanda: “uno se acostumbra de chico a los pelotazos. Y lo disfruta, porque es una acción positiva. Estás en tensión permanente para preparar el cuerpo ante el impacto y para poder llegar a los lanzamientos”, explica. “Siempre me gustó atajar en el fútbol, pero es muy distinto. En el handball hay mucho más trabajo, porque durante un partido te tiran alrededor de cincuenta veces, lo cual también hace que un error no sea determinante. Son lanzamientos más rápidos y más cercanos, aunque también los movimientos de los arqueros son más cortos”, dice, y establece algunas similitudes: “estar bien ubicado, tratar de leer los movimientos del rival, anticiparse en lo posible. Y, sea en el deporte que sea, el arquero tiene que ser fuerte mentalmente, porque un error es un gol”.

La fidelidad entre Matías y SAG dio buenos dividendos para ambos. En 1999, cuando debutó en la primera, vivió el ascenso a la División de Honor. “Fue muy lindo, porque coincidí en el equipo con mis dos hermanos y llevábamos un tiempo intentando ascender”, recuerda. Cinco años después, fue un factor clave para obtener la Supercopa, un título para SAG en la máxima categoría, tras veintitrés años de sequía. Para ese entonces, ya era fija en las convocatorias del seleccionado y su primer Mundial llegó con Túnez 2005. “Comencé a tomarme el handball en serio cuando tuve mi primera convocatoria, a los 18 años”, asume. “Fue para el Sudamericano de Brasil 2000, en junior. A mediados de 2001, debuté en la mayor en otro Sudamericano, también en Brasil, donde le ganamos la final a los propios brasileños”. En 2006, tras terminar Administración de Empresas en la UADE, aceptó una oferta del Dessau de Alemania y se estrenó como jugador profesional en una de las cunas del deporte. Fueron dos años, hasta que torció el rumbo hacia España, primero en el Anaitasuna de Pamplona, luego en el Antequera de Málaga, para finalmente recalar en el Pinés Badajoz, en la División Honor Plata, algo así como la Segunda española. Su debut, ante el Cangas Frigoríficos

de Morrazo, fue una actuación brillante con un remate de guión, atajando en la agonía del partido un franco tiro de gol que le aseguró a su equipo la victoria por la mínima diferencia. Las páginas partidarias lo adoran. De vuelta en competencia local, Suecia 2011 lo deja exultante pero mesurado: “sé que la dirigencia se está moviendo para poder aprovechar este momento al máximo, y nosotros haremos lo posible para seguir creciendo a nivel Selección, para que no sea solo un momento de frenesí. La clasificación a los Juegos Olímpicos de Londres puede ser un paso de gigante para el handball”. El arquero forma parte de una generación que busca capitalizar el impulso en una revigorización del handball. “En las escuelas, creo que se sigue jugando mucho. Pero llega una edad en la que los chicos dejan de interesarse por un deporte que tiene poca difusión y en el que no se pueden ver reflejados en el futuro. Para chicos que juegan en las inferiores de los clubes, es muy importante poder ver partidos en la televisión y sentir que su deporte tiene un espacio, además de aprender de las cosas que puedan llegar a ver. La liga tiene que hacer el deporte más interesante para los espectadores y los que patrocinan”.


El imán de lo nuevo

Argentina cumplió en el Mundial de handball la mejor actuación de la historia. Los Pucará –así fueron bautizados por su entrenador Dady Gallardo– ya se ganaron un lugar en la consideración general del deporte argentino. Ahora, como siempre en estas cuestiones, sólo falta sostener todo lo bueno que se hizo y buscar nuevos horizontes para seguir creciendo. Por EZEQUIEL ACUÑA

E

n un mes donde las novedades deportivas son escasas (sólo el Abierto de Australia, con las rápidas despedidas de Nalbandian y Del Potro), enero posibilitó prestarle atención a un deporte poco popular que tenía su propio Mundial: el handball, que en la Argentina se practica (o se inicia) a nivel escolar, con carácter amateur y en el cual muchas veces el ciclo de un posible “jugador” empieza y termina con la secundaria, es decir, a los 18 años. A muchos colegios –la mayoría privados, con formación católica y con ciertos valores conservadores– no les interesa generar un riesgo respaldando esta actividad, y terminan entonces dándole la espalda al futuro individual, estableciendo una regla clara: si no se juega en el colegio, hay que buscarse un club. Imaginemos que si a veces se hace difícil armar un partido de fútbol cinco, casi es una utopía sería convocar a siete jugadores de cada lado para armar un partido de handball. No es como en otros deportes colectivos, donde hasta se puede reducir el número: el vóley de dos contra dos, el básquet de uno contra uno, o la tocada playera del rugby. La práctica del handball se hace más difícil por la necesidad imperiosa de contar con un arquero. Hacía mucho tiempo que no veía handball de primer nivel. Estoy bastante desinformado con lo que pasa a nivel local, pero igual decidí seguir el Mundial, luego de sorprenderme y entusias-

70 UN CAÑO | MARZO 2011

marme con la jerarquía mostrada por Argentina en un amistoso previo en el que perdió con Francia (equipo que, un par de semanas después, sería el Campeón del Mundo). Practiqué este deporte durante el primario y el secundario, con el fantasma y el cosquilleo de haber visto jugar al colegio en Primera División (en la época que iba a la primaria) y con el karma de jugar en una posición casi suicida para una persona de 1,74 m de altura: la de arquero. A los 17 años, un poco por inconciencia y también por inocencia, no se tiene en cuenta que el tiempo te dejará relegado al tener que competir con aquellos que miden 20 centímetros más. Pero la intuición por haber jugado siempre en arcos chicos, con algo de fútbol (en mi colegio se jugaba de siete), me hacía verme como aquel arquero mexicano, el pequeño Jorge Campos, el de los buzos coloridos, el que a la vez podía ser jugador de campo: pequeño, rápido con los pies y obligado a armar un estilo propio a partir de las limitaciones. Del mismo modo, Argentina armó un estilo con las limitaciones que rodearon siempre a este deporte.

Vuelvo al Mundial: el primer batacazo de Argentina fue frente al local, Suecia; luego empató con Corea, le ganó a Eslovaquia, perdió por uno con la difícil Polonia y clasificó contra Chile, quedando en ese loop que repetía la publicidad de TyC Sports hasta el cansancio: estar entre los doce mejores equipos del mundo (el mayor logro hasta ahí había sido estar entre los quince mejores). Y llegó la segunda ronda, donde todo fue cuesta arriba, muy difícil. Era el precio que había que pagar para subir a un nuevo nivel. Vinieron emociones fuertes. Argentina acumuló cuatro derrotas en cuatro partidos: la tarde negra con Croacia, la lucha con el subcampeón Noruega (25-23 en un momento del segundo tiempo y con la pelota en su poder) y los dos partidos que se escaparon -uno contra Serbia y el otro ante Alemania, el creador de este jueguito, por dos suplementarios-. Y las palabras se repiten armando un nuevo diccionario de handball modelo 2011: fly, espantapájaros, extremo, caderazo, central, pasivo, 9, 7 y 6 metros, junto a nuevos apellidos internacionales –los franceses Gille, Karabatic y su ar-

Gotemburgo fue el primer paso que recordó aquellas viejas hazañas de la “generación dorada” del básquet.


quero Omeyer para sostener al campeón del mundo, el imparable rubio Hansen de Dinamarca, el interminable Marko Vujin de Serbia, o el extremo noruego Haward Tvedten–. También era hora de nombrar a los argentinos y conocerlos. Ya no estaba el feo Gull, sí seguía el noble Kogovsek, y tuvimos la joven aparición de los hermanos Fernández, por un lado, y de Simonet, por otro (aclaración: Diego Simonet tiene una finta estética y un desparpajo para jugar como si estuviera haciéndolo en el patio del colegio). También los más aguerridos Portela, Carou, Querín o Cánepa, los zurdos Vieyra y Migueles, los wines Pizarro y Maxi Ferro, los caderazos de Agustin Vidal, o los arqueros Schulz y el Negro García. Por un rato volvieron a mi mente los inviernos en el patio del San Agustín, que veo desde el balcón de mi casa. No es nostalgia, sino cercanía. Justo el deporte in door jugado en la Argentina muchas veces out door… El patio donde uno caminaba entre arcos pintados a dos colores, los partidos con la Goethe y otros colegios alemanes, o las pequeñas giras por Montevideo y la cantidad de jugadores federados que se mezclaban en esos días, dándole al handball colegial un nivel importante, para algo que después se prohibiría (jugar con federados, es decir, jugadores que representaban a un colegio pero que a la vez jugaban en un club). Argentina hizo ruido en la fría Gotemburgo. Fue el primer paso que recordó aquellas viejas hazañas de la “generación dorada” del básquet, que tuvo un principio silencioso y hoy se acerca a un final. Los Pucará, los bautizó Dady Gallardo, el entrenador argentino. Un avión que si bien recuerda a una guerra perdida, es resaltado por el entrenador por sus características propias (en quechua significa “fortaleza”). Los Pucará lograron lo impensado, y más allá de que los marketineros Pumas

Diego Simonet con el mismo desparpajo que en el patio del colegio.

o Las Leonas se hayan ganado la atención en los últimos tiempos (indiscutible), este equipo empezó a obtener un lugar propio en otro deporte jugado colectivamente. Luego del Mundial, ya en Ezeiza, el mismo Dady, explicaba un poco de qué se trataba este deporte, casi como un profesor de primaria explicándole a un niño

los tres pasos que se permiten realizar en esta actividad. Argentina se puso su camiseta más pesada, la del bajo perfil, la de venir de atrás, en silencio, ganándose un lugar propio, merecido y que genera un nuevo camino para tanto sacrificio, desconocido para casi todos los que nunca practicaron este deporte.

MARZO 2011 | UN CAÑO 71


DEPORTECA

Por JULIÁN LICHENE

Generación dorada...Y borrada Tiempo muerto, película estrenada en el último festival de cine de Mar del Plata, cuenta la historia de los basquetbolistas campeones mundiales del ‘50 que luego serían perseguidos por las dictaduras antiperonistas y por directivos horribles. Dirigida por Baltasar e Iván Tokman, dura 79 minutos y este año recorrerá un circuito por pueblos y provincias donde el básquetbol es fuerte, antes del desembarco en Buenos Aires.

J

orge Canavesi toca la armónica. Tiene 90 años y sonríe para la cámara. Es el entrenador de la Selección argentina de básquet que ganó un Mundial el 3 de noviembre de 1950, cuando sus muchachos vencieron a Estados Unidos por 6450 en el Luna Park. Las luces del estadio, luego de la victoria, se encienden como simbología desplegada cada vez que se consagra allí un campeón mundial. Y luego los presentes cantan el himno para terminar recorriendo la calle Corrientes con los diarios encendidos, hecho que tiempo después se denominó “La Noche de las Antorchas”. Los integrantes de aquel equipo que participan en el documental (Oscar Furlong, Ricardo González, Rubén Menini, Juan Uder, Omar Monza e Ignacio Poletti) reconocen la emoción: “se nos escaparon algunas lagrimitas”. Canavesi muestra sus amarillentas hojas de anotaciones, donde detallaba su trabajo de seguimiento a jugadores por todo el país. Un esfuerzo de meses que tuvo el respaldo del Estado como nunca ocurrió por estas tierras.

“Peronista deportivo” Así se define el sociólogo y entrenador Emilio Gutiérrez, activo participante del film. Él escribió el libro en el que se

72 UN CAÑO | MARZO 2011

apoyaron los directores: 1956, donde habita el olvido. Perón creía que un país con deportistas era mejor. Por aquellos años, Argentina tenía primeras figuras mundiales en varias disciplinas: Delfo Cabrera en atletismo, De Vicenzo en golf, Fangio en automovilismo, Pascual Pérez en boxeo... Deportes individuales. Faltaba un campeón de conjunto. El fútbol no pasaba por un buen momento debido a la huelga que había derivado en el éxodo de figuras a Colombia. Pero en los Juegos Olímpicos del ‘48 en Londres, un hecho despertó la curiosidad presidencial: en básquetbol, el seleccionado nacional perdía por un doble ante Estados Unidos (59-57). A partir de allí, se estableció el plan para que la Argentina fuera protagonista en el Mundial que organizaría más tarde. Como el básquetbol era un deporte amateur, el Estado les consiguió licencias laborales a varios jugadores. Y le dio todo el apoyo al entrenador. Fueron tres meses de concentración y preparación, inéditos. Luego del triunfo, Perón les dijo: “no me preocupan las ideas políticas que tengan. Ustedes han hecho un trabajo mejor al de cien embajadores juntos”. Y

después los invitó a que pidieran lo que quisieran como premio. Los jugadores no tenían un gran pasar económico, excepto Furlong. Pidieron permisos de importación de autos, ya que en esa época las habilitaciones aduaneras estaban restringidas. Con el tiempo, vendieron los autos. “Éramos unos crotos”, sostiene el Chino Monza, para luego aclarar que “tampoco era mucha plata. Casi nadie quiso el auto. Sirvió para que, con un crédito, algunos muchachos se hicieran la casa”. Uder agrega: “lo único que recibí del básquet me lo dio Perón”. Aquellos jugadores también fueron subcampeones panamericanos en Buenos Aires ‘51 y México ‘55, semifinalistas en los Juegos de Helsinski ‘52 y campeones universitarios en Dortmund ‘53. Además, la competencia interna era de gran calidad, con campeonatos argentinos y metropolitanos llenos de gente que presenciaba partidos como Parque-Palermo, River-Boca y Racing-San Lorenzo, por citar algunos ejemplos.

Genocidio deportivo León Najnudel fue el primero en utilizar el término, según Emilio Gutiérrez. Lo hizo para referirse a una época que comenzó con el bombardeo a


Los campeones Ricardo González, Omar Monza, Jorge Canavesi y Oscar Furlong en un pasaje del documental.

la Plaza de Mayo de junio del ‘55 (en las paredes del Ministerio de Economía, aún hoy pueden verse algunas huellas) y culminó con el golpe de septiembre de ese año. De allí en más, entró en vigencia la reglamentación del decreto 4161/56 que prohibía nombrar a Perón. Durante la Revolución Libertadora, representada en las figuras de los dictadores Rojas y Aramburu, se crearon comisiones para investigar “supuestas irregularidades” durante la época peronista. La correspondiente al deporte fue la 49. Y persiguió a muchos, como al maratonista Osvaldo Suárez, el boxeador Gatica, los remeros Guerrero y Capozzo, el bochero Juárez y la tenista Margarita Terán de Weiss, entre otros. La peor parte fue para los campeones de básquetbol. Los suspendieron para jugar en cualquier lugar del país por haber recibido premios de Perón. Los dictadores se ampararon en el Código del Aficionado (en desuso en todo el mundo por entonces) que impedía recibir dinero por jugar. Fue central la complicidad de algunos dirigentes del básquetbol que habían acompañado las conquistas de la Selección pero que no habían sido alcanzados por los beneficios de Perón. Los más nombrados en el film son el interventor Amador Barros Hurtado y Luis Martín, artífices ideológicos de la sanción. La CABB (Confederación Argentina de Básquetbol)

le había mandado el informe prohibitivo a la FIBA (la Federación Internacional), en base a declaraciones de jugadores que fueron citados en Pellegrini 1362, la sede del Comité Olímpico Argentino (COI). Fue el despacho Comisión Profesionalismo, expediente 52/56 el que se emitió para sancionarlos. “Nos preguntaron por qué habíamos desfilado con corbatas negras en los Juegos del ‘52 y le contesté que fue porque había muerto Eva Perón y porque nos las había dado el presidente de la delegación”, afirma González. Las sanciones se levantaron en 1967, cuando la mayoría de los jugadores ya no podía competir. Y el reconocimiento llegó mucho más tarde, ni siquiera cuando Perón volvió al poder: recién el 27 de marzo del 2007, con una reivindicación de la Secretaría de Deportes de la Nación. “Esto fue un genocidio del deporte”, afirma González, que en 2009 entró al salón de la fama de la FIBA por pedido de la CABB. Lo cruel y paradójico es que junto a él ingresó al Salón el fallecido Luis Martín, el ex interventor. Cuando el Negro hizo público su lamento por tener semejante reconocimiento en simultáneo con uno de los tipos que le había cortado su carrera deportiva, Horacio Muratore, hoy en la Federación Internacional, le contestó: “lo de Martín lo manejó la FIBA”.

Con documentos en mano, Emilio Gutiérrez investigó y por eso afirma que fue la CABB la que pidió el ingreso de los dos al Salón de la Fama, en marzo del 2008, cuando el presidente era Muratore. “En la CABB, hay un retrato de Barros Hurtado”, subraya Monza. “El dirigente argentino, con tal de salvarse él, hunde a quien tenga que hundir”, agrega González.

El equipo de los miércoles Desde hace sesenta años, los campeones se juntan en el club Palermo. Siguen siendo un equipo. El capitán González es el hombre que sostuvo el espíritu grupal y el encargado de que todos los miércoles sea el día para encontrarse y brindar. Emocionados, ven la película de Torre Nilsson En cuerpo y alma, donde hay pibes jugando al básquet en un potrero. Cuando habla Canavesi, todos se callan, al igual que cuando lo hace Pillín Furlong. No son todos peronistas, al contrario: los hay radicales, varios socialistas y hasta algún que otro gorila. El grupo sigue unido como cuando jugaba al básquet defendiendo los colores de la Selección. Se nota cuando, todos con copa en mano, enérgicamente cantan: “Los muchachos de Palermo / son unos buenos muchachos / pero tienen un defecto: / que son un poco borrachos”.

MARZO 2011 | UN CAÑO 73


Ahogar las penas

Qué hacer frente a un problema de adicciones de un futbolista es algo de lo que se habla poco en el ambiente. Por lo general se eligen el silencio o las bromas, pero lo cierto es que el alcoholismo, por ejemplo, ha marcado a unas cuantas estrellas del deporte. Nuestro compañero Lombardi, con años de fútbol y vestuarios, nos acercó estas reflexiones. Ojalá que sirvan para los momentos buenos y los malos. Por GUSTAVO LOMBARDI

E

l diálogo tiene lugar en la puerta del vestuario, el único sitio después del campo de juego donde el jugador de fútbol se siente a gusto, protegido. –¿Y? ¿Llegó? –No, todavía no. ¿Esperamos un poco más o salimos? Algunos muchachos ya se están impacientando. –Salgamos, ya no podemos esperarlo más. Entrenador y capitán son los protagonistas de la charla. El motivo: la ausencia (una más) de uno de los muchachos. Y no de uno cualquiera. Entonces el entrenamiento ya no será el mismo. A la hora de juntarse todos en el medio de la cancha, como todos los días, su ausencia será elocuente. Inconscientemente, sus compañeros dejarán un lugar libre, su lugar. Y ese espacio cegará, incomodará, distraerá a todo ese grupo de hombres que ya no sabe cómo manejar la

situación. Una situación que hace rato se transformó en un problema. Un problema de uno que es el problema de todos mientras vistan los mismos ropajes. La puerta del vestuario se abre, el capitán asoma la cabeza y, tratando de ocultar su fastidio y su desazón detrás de una voz siempre firme, alienta a salir finalmente al entrenamiento. Las miradas de los más grandes comienzan a cruzarse en silencio. Sus años de experiencia y tantas batallas compartidas (donde las miradas siempre fueron fundamentales) permite una intimidad que los más jóvenes se pierden. Ellos todavía no saben lo que significa salir hoy por la puerta de ese vestuario. No saben que al salir estaremos todos desnudándonos un poco más frente a la mirada de los de afuera. Que al salir estaremos exponiendo un problema que tenemos como grupo y que esta vez no lo podremos resolver puertas adentro.

Al principio, en las primeras ausencias, su intento fue encubrirlas, maquillarlas, alegando permisos especiales y problemas domésticos.

74 UN CAÑO | MARZO 2011

Uno de nosotros no está. No sabemos si está bien, si se accidentó, si está en cana, en el hospital o si simplemente está durmiendo en su cama y no se pudo levantar. Lo único que sabemos es que hoy nos toca dar la cara a nosotros. Enfrentar a los de afuera, pero también enfrentarnos a nosotros mismos. Y tal vez eso es lo más duro. Mirarnos todos a los ojos, aunque hoy haya más cabezas gachas que lo habitual. Un equipo de fútbol es una estructura piramidal. En el extremo de esa pirámide el entrenador es el vértice, el conductor y desde allí comienza a marcar una tendencia, un estilo… De juego, sí, para eso lo contrataron, pero también deberá ser el primero que dé un paso adelante para resolver estos problemas. ¿Para eso lo contrataron? Y sí, para eso también lo contrataron, aunque la mayoría no se lo imagina a la hora de firmar el contrato. Al principio, en las primeras ausencias, su intento fue encubrirlas, maquillarlas, alegando permisos especiales y problemas domésticos. Intentando, tal vez, proteger así a uno de sus soldados. Intentando, también, protegerse a si mismo. Ilusionado, quizás, en que la tormenta sea pasajera.


Pero hace tiempo que los nubarrones conviven sobre nuestras cabezas. Lejos de disiparse, la atmósfera se tornó demasiado densa. Casi por ósmosis, la reacción del entrenador es la negación del problema. Por lo menos frente a sus dirigidos, porque frente a los medios algo hay que decir, una explicación hay que dar. Enfermo también él, hace como si nada estuviera pasando. Ignorando que asumir el problema es el primer paso para encontrar una salida a ese laberinto. Ante ese panorama, y dentro de esa pirámide, la pelota pasa a los jugadores de mayor experiencia. Pero en ese segundo escalón de mando, las opiniones no son unánimes. Hay distintos puntos de vista. Están los que tienen bronca, los que tienen lástima, los que tienen indiferencia y quienes, aún con intenciones de ayudar, se descubren colmados de ignorancia a la hora de actuar ante una situación que nunca hubieran imaginado tener que enfrentar dentro de este ambiente. Como existen distintos tipos de opiniones, también hay distintos tipos de relaciones entre el protagonista y cada uno de los integrantes del plantel. Están los más cercanos, los que tienen una ver-

dadera relación de amistad, están los que sólo son compañeros de trabajo y también están los que no pueden entender cómo puede ser que se sigan preocupando por este sujeto. Hay de todo, como en toda buena familia. Entonces se vuelve muy difícil poder bajar una línea al resto del plantel. Tomar una resolución como un grupo, como una sola fuerza. Y en esa falta de acuerdo se diluyen las acciones. Mañana, pasado o la semana que viene, nuestro compañero volverá. Sin posibilidad de solución en el corto plazo, todo seguirá como si nada hubiera sucedido. Se sentará silenciosamente en su lugar y se calzará una vez más los botines. Su sola presencia en el vestuario restaurará un precario equilibrio que fácilmente se perderá si alguna de las partes incumple con sus obligaciones. Mientras esto no ocurra se seguirán utilizando mutuamente. Ambas partes. Él y nosotros. Con un cinismo tan cordial como despreciable. Él se engañará. Convenciéndose de que este grupo que lo rodea en el vestuario, de que este ambiente que lo rescató tantas veces, de que este fútbol que tanto ama, es lo más importante de su vida. Y nosotros nos engañaremos, también, convenciéndonos de que es así como mejor lo ayudamos. Así, no haciendo absolutamente nada para rescatarlo realmente. Absorbiéndole, sí, hasta las últimas gotas de talento en beneficio de todos. Con el egoísmo intrínseco del ser humano, que tan bien representado está en

el mundo del fútbol, me tranquilizo pensando que todo esto ocurre porque estoy lejos de los míos. Que ocurre porque estoy en Inglaterra y así es como reaccionan por estas tierras frías y distantes. Que cuando dentro de unos meses regrese de mi exilio y esté una vez más en mi país, todo esto quedará en un mal recuerdo. Porque allá, estoy seguro, esto no ocurriría. Somos tan distintos por allá... Nuestros dirigentes se preocuparían por la persona que hay detrás del jugador. Jamás lo utilizarían políticamente. Al entrenador ni se le ocurriría encubrir tamaño problema, ocultarlo debajo de la alfombra del vestuario para que lo resuelva el próximo en llegar. Ni hablar de sus compañeros: los de mayor experiencia enseguida tomarían la responsabilidad, llamarían a una reunión (hacemos tantas por cuestiones menos importantes que no la vamos a dejar de hacer por la salud de un compañero) y se buscaría una salida, la mejor, pensando en la persona. Y ahí, hasta los más jóvenes se involucrarían, acompañando. Todos juntos, sin egoísmo, como un verdadero grupo. Sí, me quedo tranquilo. Estoy seguro de que esto en Argentina no ocurriría. Somos tan distintos por allá…


HOMBRES DE NEGRO

Por FRANCISCO GIOVANONI Fotos LUCIANA GUTIERREZ

Tu nombre me sabe a árbitro Arturo Ithurralde fue testigo de buena parte de la historia del fútbol argentino. Dirigió en los cinco continentes, en Mundiales y en una pila de clásicos y finales. También a Pelé y a Maradona. Respetado y calentón, repasa anécdotas en esta nota con Un Caño. También se despacha contra el referato actual, la AFA y el Colegio de Árbitros. Y cuenta por primera vez intimidades de aquellos años de uniforme negro. Por supuesto, también habla del famoso cantito.

E

ntre 1968 y 1985, Arturo Andrés Ithurralde pisó nuestras canchas con firmeza. Protagonista de finales y clásicos históricos, mundiales y partidos internacionales, hoy disfruta del retiro en Mar del Plata. Lector de Un Caño (“es risueña y te dice las verdades de una manera que otros no la dicen”), el hombre demuestra que es apasionado de corazón. Por momentos parece un poco fanfarrón, aunque él mismo se ríe de esa pose. –¿Cómo recuerda el famoso cantito….? –“I-thu-rral-de, la concha de tu madre”. A los otros árbitros tenían que acoplarle algo al insulto: “Coerezza, compadre, la concha de tu madre”, por ejemplo. Conmigo no hacía falta… –¿Lo tomaba con naturalidad? –Te acostumbras a todo. Por ahí me encaprichaba, es cierto. Los cantos también influían en algunos jugadores. En un Central-River, en la vuelta de Kempes de Europa, a Mario le cantaban “Kempes, Kempes, corazón, Rosario te saluda la puta que te parió”. En un alto le dije “no les des bola”. Y él me respondió: “Arturo, ¿sabe los goles que hice acá? Mire cómo me tratan”. Dos minutos después, Tarantini tomó la pelota y empezaron con “guarden los bolsos, guarden las carteras, llegó a Rosario la Pata Villanueva”. Era la época que la acusaban de afanar en una tienda en Londres. Lo volvieron loco, y el Conejo le metió una murra al siete. Le

dije: “Escúcheme, Tarantini, ¿qué culpa tiene el 7? Tiene una esposa como usted, se gana la plata como usted, no lo lastime. ¿Cómo le va a dar bola a esta gilada?”. “Tiene razón, Ithurralde”. Después siguieron: “sol y luna, sol y luna, sol y luna, a la Pata Villanueva se la coge hasta Labruna”. Había que estar atentos porque los jugadores se calentaban con razón. Inmediatamente saca la chapa: “no me gusta quedar mal con mis colegas, porque van a pensar: ¿éste quién se piensa que es, Gardel? ¡Sí, fui Gardel! ¡En cinco continentes, dirigí! Cinco torneos FIFA… Fui el único árbitro latinoamericano que dirigió en el viejo Wembley, que fue tres veces contratado en Colombia, que estuvo en tres finales en Ecuador, y en catorce Copa Libertadores. Y todos los años que no jugaba Argentina, iba a Uruguay. Y no era verdurita jugar en ese tiempo, eh. Ahora es cualquier cosa. Yo te estoy hablando de Matosas, de Maneiro, de Ubiña, de Blanco, de todos esos jugadores. A mí me tocó echar a Gatti en cancha de Boca. ¡Trece fechas le dieron! Si vos encontrás un referí que ten-

ga las pelotas para haber hecho eso, te doy un premio”. –¿Cómo fue eso? –En 1978. La final entre Central y Quilmes, que fue campeón. Cobré dos penales a favor de Quilmes. Pero yo no tengo la culpa si los penales los hacen ellos… Entonces pasaron unos meses y dirigí un partido de morondanga entre Boca y un equipo de Mendoza, creo que Gimnasia. Y le cobré dos penales en contra en pocos minutos a Boca. Gatti se reunió con los jugadores y escucho que dice “dejalo, que éste la agarró (a la guita) en Rosario”. Voy al arco y le digo “Gatti, no lo escuché bien, ¿me puede repetir lo que dijo?”. “No porque usted me va a echar”, me dice. “No, ya lo eché: ¡afuera!”, terminé. Y ahí se puso loco, me puteó, provocó desorden, decía que me iba a tirar la gente en contra. Se lo llevaron. Resultado: los mendocinos ganaron 5 a 2. Pobrecitos, tenían un miedo que no sabían ni dónde estaban parados.

MARZO 2010 | UN CAÑO 77


Postal del 81. Alonso, Diego y Don Arturo.

–También lo echó a Mostaza Merlo en el primer tiempo del Boca 3-River 0 del ‘81… –Por una piña a Brindisi, sí. Ellos me decían que no podía haberlo visto, pero yo era desconfiado por naturaleza. Apenas miré al costado lo vi. ¡Afuera! Dos veces lo eché a Merlo, la otra en cancha de San Lorenzo, cuando tuvo un problema con el Panadero Díaz. Pero en la segunda rueda ganó River 3 a 2 con un penal, ¡y eso les gustó a los de River! Los de Boca me querían matar. Porque perdieron por un penal. Y ese día… No te lo tendría que decir pero lo haré: hubo un jugador de Boca… –¿Qué tuvo una conducta extraña? –Exactamente. Y se hacía el bueno… Justamente los superclásicos lo tuvieron de protagonista en partidos históricos: “dirigí cinco superclásicos, pero fui el único que dirigió un partido que fue a suerte y verdad (habla del Boca 1-River 0 de la final del Nacional ´76). En el vestuario me reuní con los capitanes Suñé y Perfumo.

78 UN CAÑO | MARZO 2011

El de River me dijo ‘nosotros queremos jugar la pelota muy rápido’. Le respondí: ‘¿a mí me lo dice, que soy el campeón de dejar jugar? Suñé, ¿usted tiene algún inconveniente?’. Perfumo todo empilchado y el Chapa cabizbajo, en ojotas: “nooo, no hay problema’, dijo el de Boca. Cuando llegó ese tiro libre famoso, el defensor se desligó de la jugada y Suñé tomó la pelota y me dijo detrás de ella –¡para que no lo vieren al hijo de puta!–: ‘Ithurralde, juego rápido yo, eh’. ‘¡Juegue!’, le contesté. Y fue gol. Fillol estaba armando la barrera, y que no hable mucho porque seis meses antes Potente le hizo otro gol igual”. –¿Tuvo problemas durante la dictadura? –Uno sólo, que lo solucioné. El país estaba convulsionado a comienzos de los ‘80 por un hecho que no recuerdo. Dirigí un Boca-Independiente, que era siempre un partidazo. Ma´ que River-Boca… Vinieron unos policías y me dijeron “mire, señor, vengo a verlo en nombre del Poder Ejecutivo. En una palabra, el presiden-

te de la República para decirle que este partido tiene que terminar bien y que al primer inconveniente, usted lo suspende, nosotros entramos a la cancha y sea el jugador que sea el que provoque el desorden, nosotros lo llevamos”. –¿Querían llevarse preso a un jugador? –Sí. Cuando terminó le dije: “hay un detalle que usted pasó por alto: ¡El presidente durante dos horas en esta cancha soy yo!”. Me miraban y me querían matar… “Y le voy a decir una cosa: no se les ocurra tocarme un jugador ni meterse con ellos. Porque mi trabajo es ése: manejar a los jugadores como ustedes manejan a los presos. Ustedes esperan ahí. Si sus servicios son necesarios, los voy a llamar”. Estaban locos. Querían llevarse al primero que meta una mano. ¡Mirá si me iban a sacar de la cancha a Bochini porque discutió con un rival! Tiene dos experiencias en Mundiales de mayores. En Argentina ‘78 participó, aunque no como hubiese querido: “no


fui árbitro principal, aunque al principio se daba por descartado que era yo, finalmente fue Ángel Coerezza, ganaron los militares... La influencia militar tuvo que ver con la designación”. En ese torneo, Ithurralde fue cuarto árbitro y juez de línea en Brasil-España, en Mar del Plata, “el día que el boludo de Cardeñosa se perdió un gol increíble”, recuerda. Hasta que llegó España ‘82. De allí recuerda su paso, siempre con un relato cargado de sinceridad: “la peor mierda me tocó a mí: España-Honduras. Todos, incluido yo, decían ´pan comido´. ¡Pan comido de acá! Empataron los españoles de pedo, con un penal. Me tocó con un juez de línea búlgaro que me terminó odiando. En diez minutos le hice bajar la bandera tres veces. Dos días después me encaró y me dijo: ´escúcheme, a la FIFA no le gusta que los jueces de línea bajen la bandera´. Le respondí: ´a mí tampoco, porque la suben muy mal. Si la subieran bien…´”. Del personaje histriónico que relata toda su historia, Ithurralde pasa al que por primera vez cambia el tono de su voz cuando se le consulta sobre su retiro del referato. “En el ‘84 me sacaron del arbitraje internacional, y un año después me dijeron ´se terminó´”, recuerda con nostalgia. “El último fue un Independiente 1 (gol de Bochini)-San Lorenzo 0, en Avellaneda, en diciembre de 1985. Tomé ese partido con mucha tristeza. Ya sabía que era el final. Los dirigentes ya me venían saludando. En Córdoba vinieron los dos equipos a abrazarme. El presidente de Talleres me dijo ´¿sabés cómo te queremos acá? Quedate tranquilo que acá la gente te aprecia. El de Instituto, lo mismo. Eso te afloja un poco las piernas…”. Jamás se desligó del mundillo arbitral. Entre 1999 y 2002 trabajó en AFA y fue profesor de los árbitros de Primera B Metropolitana, cargo al que renunció “antes de que Grondona me echara, cuando reestructuró todo luego del Mundial de Corea-Japón”. –¿Qué opina de la reestructuración actual? –Comparto en un 90 % esa idea. Hay dos casos (ellos piensan que yo estoy acá en Mar del Plata y no me

entero de nada, pero sí que me entero) de gente que yo hubiese echado antes. Uno por haber mentido en un informe, y el otro porque es el peor árbitro. Es Alejandro Sabino, hijo de un ex referí. En realidad no es árbitro, no sabe nada... En 2002 hice una carta enorme pidiendo que lo echaran y no lo echaron. ¡Y encima lo hicieron juez internacional! Duró un partido. A Furchi, dicen que por ahí lo dan de baja, y éste fue el mejor año que jugó desde que está en Primera... Todo al revés, viste… Bien, bien, bien, no lo vi jugar nunca, igual. Tiene altibajos serios. –¿No es desprolijo que el presidente de la AFA sea el presidente del Colegio de Árbitros? –¿Desprolijo? ¡No! ¡Es antirreglamentario! El reglamento dice que tiene que haber un Colegio de Árbitros con una autoridad y sus vocales. Que Grondona diga “esto lo voy a intervenir porque no funciona” es distinto. Pero si vos tuviste nueve o diez años a un tarado mental como Romo (porque el apellido es exactamente el que le cabe a él), entonces está mal. ¿Pero intervenir la AFA? Yo tengo que pensar que él no confía en ningún dirigente de AFA. ¿No hay ninguno que sea honrado, tranquilo, nada fanático o loquito? Yo conocí un montón de tipos espectaculares como presidentes del Colegio. –Lamolina es el vicepresidente del Colegio. Fue quien lo reemplazó cuando usted se retiró. ¿Está de acuerdo con su puesto? –A Aníbal Hay lo echaron, a Lamolina lo dejaron. No... O los dos, o ninguno. Si echaron a Hay, debían haberlo echado a Lamolina, que estaba todo el día junto con Hay en todas las canchas. ¿Por qué a Hay lo echaron como un infeliz –y aclaro que no lo estoy defendiendo–, pero del otro lado queda uno más sereno que tampoco es

tan bueno? Cuanto menos, es una medida extraña. No existe correlación con la designación de Lamolina. Además, hoy no existe la opinión del Colegio, porque está intervenido por la AFA. Ah, y estoy esperando una explicación pública sobre la situación de Daniel Raffa y Javier Ruiz, que no dirigen más desde comienzos de año. Algo raro pasó… –¿Por qué Jorge Romo (ex presidente del Colegio de Arbitros) tiene aún tanta influencia? –No lo sé. Su relación con Grondona viene de hace tiempo. Yo sé que trabajaba en Acindar y era proveedor del corralón de Grondona. Después, puso un depósito por su cuenta… También me extraña la inclusión de Miguel Scime. No dirigió nada. No fue internacional. Fue un árbitro del montonazo… –¿Se equivoca seguido la AFA? –Hay cosas que no las entiendo. Con Brazenas cometieron el error más grande del mundo. La AFA se equivocó porque tiene malos asesores y malos profesores. En ese torneo, la AFA cometió varios errores y nadie dice nada. A los árbitros, cuando se equivocan, les dan una fecha. Eso pasa porque hay que dejar conformes a los grandes. Brazenas estuvo tres años sin jugar. Tiene una altura y un físico muy fuerte que no le facilitan la gimnasia, el desplazamiento. Tuvo una operación en la columna y, cuando le dieron de alta, él fue a hablar con el médico y Grondona: “miren, yo no puedo dirigir de nuevo”, les dijo. Como tenía contrato, alguien se encaprichó y mandó al médico a decir: “puede jugar”. Así le fue… Brazenas quería dejar la actividad y lo pusieron en cancha de prepo. No podía… La AFA le tenía que pagar. Encima, Brazenas no fue internacional, y para un partido final como fue Vélez-Huracán había que poner un juez internacional. Ahí está el resultado... –¿Baldassi es el mejor?

“Jorge Romo (ex presidente del Colegio de Árbitros) trabajaba en Acindar y era proveedor del corralón de Grondona. Después, puso un depósito por su cuenta…”.

MARZO 2011 | UN CAÑO 79


–Técnicamente, es el que mejor dirige. Aunque a veces no lo designan seguido porque tiene una seria lesión en la rodilla. –¿Es muy conciliador? –Es amiguero. Abraza a los jugadores, sonrisita… –¿Eso está mal? –¡Eso es una cagada! ¿Mirá si yo me le iba a reír a un jugador? ¡Los jugadores entran! Un día, Walter Perazzo hizo un golazo y Loustau fue a felicitarlo. Me preguntó qué me pareció. “Una injusticia, un riesgo y una informalidad que no se debe cumplir –le dije–. El árbitro no está para felicitar a los jugadores. El fútbol es para dedicarse a dirigir”. Los ojos, todos los sentidos tienen que estar puestos en el fútbol. Y lo más importante: la inteligencia. Hay que dirigir con inteligencia. –¿Le debe algo a Grondona? –No. Hay que ver los partidos para distinguir qué le debe Grondona al árbitro, no el árbitro a Grondona… Es al revés. Eso podría decir: los árbitros le demostraron a Grondona que puede salir campeón cualquiera. Por eso los últimos años tuvimos varios campeones chicos.

80 UN CAÑO | MARZO 2011

“Con Brazenas cometieron el error más grande del mundo. La AFA se equivocó porque tiene malos asesores y malos profesores”. –¿Alguna vez Grondona lo presionó a usted? –Con Grondona nunca hablé de una jugada de fútbol. Hay cosas que no le gustan, puede ser. Yo no le otorgué a Independiente un gol, y salió campeón Estudiantes, en el ´83, en Avellaneda. Giusti bajó la pelota con la mano. Vino corriendo Trossero, protestando. “¡Calmaaaa!”, le grité. Porque Trossero se la daba de guapo. “¡Espere un momento, ¿usted es el capitán?”. “Sí, Arturo”, me contestó. Lo llamo a Giusti -mirá lo que me jugué, eh- y le digo: “¿le puede decir a su capitán si usted bajó la pelota con la mano o no?”. Y Giusti respondió: “sí, la bajé con la mano”. Lo que le dijo Trossero a su compañero no lo puedo repetir porque lo

tendría que haber echado cinco veces. –Una anécdota más, por favor. –Jugaban Vélez-Independiente, llegó una jugada podrida –porque el árbitro tiene que tratar de no sobrepasar nunca la línea de avance; si no, se tiene que dar vuelta para mirar–, pero yo venía corriendo… Y se va el wing izquierdo a toda velocidad. Yo dije “pasa como tejo”. Sigue con la pelota, patea y la pelota me viene a mí. Yo me cubrí, me corrí y la pelota pasó, no me tocó. La agarró otro jugador. Pero puso la mano. Hizo “paf”. ¡Prrrr! Cobré penal y no lo había visto. Miré al juez de línea y me dio la derecha. Lo cobré por el ruido... –¿Y si le había pegado en el muslo? –¡Nooo! El ruido de la mano es único.


Nofal no me copa

Últimos latigazos del verano. El periodista sumó enojos durante las transmisiones de enero y febrero al enterarse del nombre de la Copa. Probamos con té de boldo, con una cucharada sopera de aceite y limón y con sopita de alfalfa. Pero no hubo caso. Él prefirió escribir esta columna. Por DIEGO BONADEO

H

ace algunos años –no muchos, por cierto– memoriosos y militantes vecinos porteños de barrios como Flores, Caballito, Floresta y Parque Chacabuco, entre otros, protagonizaron una especie de pueblada incruenta, cambiándole el nombre a la calle Ramón L. Falcón (jefe de policía y represor en los primeros años del siglo XX) por el de Alejandro Olmos, en merecido homenaje a quien, silenciado por todos los regímenes –democracias y tiranías–, estudió en serio la deuda externa y propició no pagar nada hasta discernir la deuda legítima de la ilegítima. Por supuesto, la movida duró poco, y el nombre y el apellido del coronelvigilante-genocida volvió a ser el de la calle que los vecinos querían que sirviera para recuerdo de Olmos. Aparte de la cantidad de “cosas” –diagonales, infinitas calles y avenidas de pueblos, monumentos, escuelas, etc.– que para pesadillas reiteradas del entrañable Osvaldo Bayer llevan el nombre del gran exterminador Julio A. Roca, tiempo atrás apareció la noticia de que la avenida de circunvalación cordobesa dejó de llamarse Agustín Tosco a instancias del legislador Daniel Passerini, que seguramente creerá que el Cordobazo fue algún triple sobre la hora de Marcelo Milanesio jugando para Atenas contra Sport Club de Cañada de Gómez. O aquí nomás, donde el partido bonaerense de San Isidro se mezcla con el de Vicente López, la “revolución fusiladora” dejó su huella con la calle Pedro Eugenio Aramburu. Como para que don Arturo Jauretche se revuelque en su tumba, en Venado Tuerto, Santa Fe, una calle bautizada Runciman recuerda lo que el autor del Manual de Zonceras Argentinas llamó con su habitual puntería “el estatuto legal del coloniaje”, o sea: el pacto que colonizó las exportaciones de carnes argentinas hacia Gran Bretaña y que firmaron justamente Runciman, por

los británicos, y Julio Roca hijo –vástago del gran exterminador– por… no jodamos, también por los británicos. Pero el fútbol no es ajeno a esta historia de homenajes truchos. Así como se entiende que hay reconocimientos merecidos –la cancha renovada de Argentinos Juniors se llama Diego Armando Maradona; la de Newell’s, Marcelo Bielsa; la de Rosario Central, Mario Alberto Kempes, y tantas y tantos más–, hay otros casos que no resisten el más mínimo análisis. Como el del nombre del estadio de Banfield, que recuerda a Florencio Sola, un dirigente involucrado en sobornos allá por la década del ‘40 y que, como consecuencia, tuvo sanciones durísimas y escarnios varios, tan olvidados como los que –Marcelo Araujo mediante– impusieron el nombre de Miele (se llama Francisco, pero se hace llamar Fernando porque es más cajetilla Fer que Fran o Pancho) al estadio de San Lorenzo. Pero el torneo de fútbol de verano de 2011 tuvo otro episodio con características parecidas, cuando se le impuso el nombre de Luis Nofal. La pregunta es qué le dio Nofal al fútbol para que algo vinculado con ese deporte lleve su nombre a título de homenaje. Junto con Carlos Ávila, con quien se asoció en la década del ‘80, fue el corresponsable de la empresa Torneos y Competencias, aunque no su cara visible, y por lo tanto copartícipe del monopolio de la televisación del fútbol, en principio hasta 2014, hasta que el llamado Fútbol Para Todos hizo que el monopolio fuese otro. Además, Nofal fue propietario de un porcentaje de América Medios (América, La Red y América 24), junto al Grupo Uno de Daniel Vila y al grupo de Francisco de Narváez. ¿Qué le dio entonces Nofal al fútbol? Un yerno, un tal Marcelo Grandío, panelista de un esperpento televisivo de Fox Sports, cuya única originalidad pasa por los claritos que ornan su abundante pilosidad.

MARZO 2011 | UN CAÑO 81


La Jihad bilardiana

La conexión entre Kadhafy, la CIA, Al-Qaeda y Bilardo queda evidenciada en esta crónica, surgida de la niebla nocturna de un bolichito del Sur profundo de la ciudad. Más claro, échenle vodka. Por PABLO DE BIASE

Y

a era noche cerrada en De Grin Bar, el irish pub más prominente de Pompeya, en Uspallata y Chiclana. Allí se sirven con profusión antiguos whiskies argentinos –y otros licores de marcas fenecidas– entre su selecta clientela de literatos, filósofos, directores técnicos y espías internacionales, entre otros. Exactamente luego de clavarse el quinto Royal Command, el Fino Chabolas, suboficial retirado de la Provincia, se puso a disertar a propósito de las imágenes que devolvía TN desde un LCD situado en un elevado rincón, donde las botellas de matarratas juntaban telas de araña. “Son pandillas de ratas”, describía Muammar Khadafy, parado sobre el muro de un castillo cerca de Trípoli, a los jóvenes que pretenden acabar con su régimen, “no representan a nadie, son una minoría terrorista, quieren hacer del país un emirato islámico conducido por Osama bin Laden”. “¿Saben quién tiene la culpa de que la CIA haya elaborado un informe secreto asegurando que los jóvenes libios son de Al-Qaeda?”, interrogó retóricamente el Fino a los parroquianos. “Bilardo”, sentenció, y se hizo silencio. Chabolas hizo un relato de cómo la CIA sindicó a un informante sudamericano de uno de los hijos del dictador norafricano, AlSaadi-Khadafy, volante por izquierda y salvaje represor de la sublevación en la ciudad de Benghazi, como la fuente que señaló el alineamiento de los líderes juveniles de la pueblada libia con la organización que se cargó el World Trade Center de Nueva York hace casi diez años. Miguel Ángel Lemme (el mismo que estuvo en el staff de Diego y fue parte del cuerpo técnico del Narigón cuando éste dirigió la Selección de Libia en 2002) le avisó a Bilardo que Libia estaba cayéndose a pedazos. El Narigón lo llamó a Al-Saadi a su teléfono móvil y

82 UN CAÑO | MARZO 2011

así encendió una grabadora en una oscura habitación de uno de los cuarteles de la CIA en Albuquerque, Nuevo Méjico. “Cómo estás, Saadi. Vos, tranquilo, y acordate: computación e inglés. La campaña de difamación contra mí que hizo Clarín fue insoportable, así que cuidate de Clarín, o como se llame ahí, y si lo que leés te produce acidez, Alka-Seltzer. ¿Sabés? Ya tengo más de once mil videos…”. Aquí se interrumpió la señal y la incomunicación se hizo más pronunciada. Cualquier argentino reo, con calle y mucho fútbol encima, tiene serios problemas para entenderle una sola palabra a Bilardo, quien puede deglutir frases enteras, escupiendo una síntesis caprichosa y muy personal de las sílabas que suenan. Augusto Rocamora de la Guardia Vieja, nieto de hondureños y erudito en lengua española, hizo lo mejor que pudo con las grabación defectuosa y el dossier de la Agencia sobre Bilardo. “Carlos Bilardo, agente encubierto del gobierno argentino en la asociación de fútbol, protector del agente castro-chavista Diego Maradona, ex funcionario kirchnerista en la provincia de Buenos Aires y enemigo acérrimo de la Sociedad Interamericana de Prensa (denuncia sistemáticamente complots del diario Clarín contra su persona desde hace veinticinco años) le aseguró a uno de los hijos menores de Khadafy que posee más de diez mil cintas de video sobre la Jihad juvenil en los países árabes y los modos de penetración corrosiva por parte de Al-Qaeda…”, decía parte del informe de inteligencia estadounidense elaborado por Guardia Vieja. “¿Descabellado?”, le espetó el Fino a algún incrédulo que se atrevió a poner en duda su relato. “¡Descabellado! Decime, entonces, ¿de dónde carajo salió este rumor?”, y tiró sobre el mostrador el Clarín del día siguiente. “Las conexiones de Cristina con Al-Qaeda y la crisis en Libia”, decía el título principal.


Revista Un Caño - Número 34 - Marzo 2011  

Yo no sé mañana, quién va estar aquí... - Román R., Walter E., Martín P., Julio César F. compiten por permanecer en la casa amarilla.

Advertisement