Page 1

Pontianak Post Eceran Pontianak Rp.2.500

P er t a m a da n Ter ut a m a di Kal im an t an Barat

Sabtu 31 Maret 2012 M / 8 Jumadil Awal 1433 H

Harga BBM Batal Naik 1 April JAKARTA - Rencana pemerintah menaikkan harga BBM bersubsidi 1 April 2011, tampaknya, sulit direalisasikan. Sebab, berdasar perkembangan terbaru dalam sidang paripurna tadi malam pukul 23.45, Fraksi Partai Demokrat, Fraksi PPP, Fraksi PAN, dan Fraksi PKB mengikuti Fraksi Partai Golkar. Golkar sebelumnya mengusulkan syarat kenaikan harga BBM ketika harga minyak mentah Indonesia (ICP) naik 15 persen dari asumsi harga ICP sebesar USD105 per barel. Harga itu merujuk kepada harga enam bulan terakhir. Dengan demikian, jika harga minyak dalam enam bulan terakhir menembus USD 120,75 per barel, pemerintah sudah berwenang menaikkan harga BBM. Padahal, per Maret ini, posisi ICP rata-rata enam bulan baru USD 113,75 per barel. FPKS –semula mendukung kenaikan dengan syarat harga ICP naik 20 persen dari rata-rata 3 bulan– bergabung dengan kelompok Fraksi PDIP, Fraksi Partai Gerindra, dan Fraksi Hanura. Mereka tegas menolak memberikan kewenangan kepada pemerintah menaikkan harga BBM. Sebelum pemungutan suara (voting), u

Ke Halaman 6 Kolom 1

Sikap Fraksi dalam Paripurna DPR RAKA DENNY/JAWAPOS

BENTROK: Demo menolak kenaikan BBM di depan gedung DPR/MPR. Massa akhirnya berhasil memblokir dan membuat lumpuh tol dalam kota, Jumat, 30 Maret 2012. Bentrok antara massa dan polisi tak terhindarkan.

Bukan Berarti Pecah Kongsi


PONTIANAK - Sikap mendua partai mitra koalisi pemerintah dalam menyikapi rencana kebijakan bahan bakar minyak dipandang bukan bentuk perpecahan atau kekalahan Partai Demokrat. Karena koalisi yang dibangun bukan untuk menyetujui kebijakan. Demikian pandangan Pengamat Politik dari Universitas Tanjungpura Zulkarnain di Pontianak, kemarin.

PONTIANAK - Naik atau tidaknya harga BBM tidak berpengaruh banyak pada pengusaha. Pasalnya selama ini pengusaha menggunakan BBM nonsubsidi atau khusus industri. “Bagi pengusaha yang penting ada kepastian. Kalau menggantung akan menimbulkan banyak dampak yang sulit diperhitungkan,” kata Ketua Asosiasi Pengusaha In-

“Saya pikir tentu ada hal yang tertulis. Tidak ada satu pun butir yang berkenaan dengan kebijakan harus disetujui dalam kesepakatan mitra koalisi. Cerdiknya partai mitra koalisi yang memungkinkan untuk bermain,” kata Zulkarnain. Menurut dia, dinamika politik dalam paripurna memang ikut u

Ke Halaman 6 Kolom 5

Acui Simanjaya

donesia Kalbar Andreas Acui Simanjaya, Jumat (30/3). BBM, kata Acui, bukan satusatunya komponen produksi. Banyak unsur yang menyebabkan terbentuknya harga sebuah produk. Kenaikan BBM memang menaikan biaya produksi, namun semua bisa dihitung dengan kalkulasi yang jelas u

Ke Halaman 6 Kolom 1

Nikita Mirzani

Selingkuhi Indra Birowo Nikita dan Indra putus setelah kepergok istri Indra. Tapi Nikita tak menyesal dan buka peluang balikan lagi. Waduh. u

Ke Halaman 6 Kolom 5



Ke Halaman 6 Kolom 5

u Setuju

Kenaikan Harga BBM (memasukkan pasal tentang persyaratan untuk menaikkan harga BBM) :* 1. Demokrat (5 % dari rata-rata harga 1 bulan) 2. Partai Golkar (15 % dari rata-rata harga 6 bulan) 3. PKS (20 % dari rata-rata harga 3 bulan) 4) PPP (10 % dari rata-rata harga 1 bulan) 5) PAN (15 % dari rata-rata harga 1 bulan) 6) PKB (17,5 % dari rata-rata harga 1 bulan) Keterangan : * asumsi harga minyak mentah Indonesia (ICP) USD 105/barel di APBNP 2012. *Posisi ICP Maret : - Rata-rata 1 bulan USD 126/barel - Rata-rata 2 bulan USD 119,04/barel - Rata-rata 3 bulan USD 116,5/barel - Rata-rata 6 bulan USD 113,75/barel


SIAP TEMPUR : Tim putra putri SMA St Petrus siap menantang SMK Immanuel dan

JAKARTA – Tim penyergap Detasemen Khusus 88 Mabes Polri menewaskan dua orang terduga teroris di Jalan Al Ikhlas, RT 06, RW 01, Pondok Kacang Timur, Kota Tangerang Selatan, dini hari kemarin (30/3). Dua orang yang tewas itu diketahui bernama Hendra Saputra dan Dede. Keduanya tercatat sebagai warga Tasikmalaya, Jawa Barat. ’’Jenazah masih kami identifikasi di RS Polri,’’ ujar Kepala Divisi Humas Polri Irjen Pol Saud Usman Nasution di Mabes Polri siang kemarin. Penyergap merupakan tim gabungan Densus 88 Mabes Polri dan Densus 88 Polda Metro Jaya yang bergerak mulai pukul 01.00 dini hari hingga pukul 05.00 kemarin. ’’Anggota yang melakukan penangkapan ditembaki. Karena itu, terpaksa ada penindakan serius,’’ ujar mantan Kadensus 88 Polri itu.

SMA St. Paulus. Dalam talkshow radio, mereka mengungkapkan kesiapannya bermain, dan berharap dukungan penuh dari para supporter.


Ke Halaman 6 Kolom 5

Youk Tanzil; Pengusaha yang Gila Petualangan Alam, Naik Gunung Gunakan Kruk

Kejati Nunggak Kasus KEPALA Kejaksaan Tinggi Kalbar, Jasman Panjaitan meminta Gubernur Kalbar memerintahkan Dinas Pekerjaan Umum melakukan audit teknis, jika terdapat tindak pidana korupsi yang disidik Kejati maupuan Polda. Ia menilai instansi tersebut selama dilema dalam Ke Halaman 6 Kolom 1

PONTIANAK - Genderang final perhelatan akbar Honda DBL 2012 West Kalimantan Series siap ditabuh Sabtu (31/3) siang ini. Tahun lalu, SMA Santu Petrus Pontianak berhasil mengawinkan kampiun putra dan putri Honda DBL West Kalimantan Series. Tahun ini pun hal yang sama bisa terulang, sepasang tim Petrus berhasil lolos ke babak final. Namun lawan-lawan mereka bukannya tak ingin juara. Tim Putra Petrus akan bertemu SMK Immanuel 1 Kubu Raya yang merupakan juara Honda DBL tahun 2010. Tentu saja Immanuel sudah tak sabar untuk mendapatkan kembali titel juara.

Kenaikan Harga BBM (tolak penambahan pasal persyaratan menaikkan harga BBM): PDIP, Gerindra, dan Hanura

Dua Terduga Teroris Tewas

Hari ini, Final Spektakuler



Tak Pengaruhi Pengusaha

u Menolak

Dokumentasinya jadi Promo Pariwisata ke Seratus Negara Youk Tanzil, 59, punya cara tersendiri untuk mengekspresikan rasa cintanya kepada alam Indonesia. Dia berkeliling Indonesia naik sepeda motor dan hasil dokumentasinya dijual ke seratus negara di dunia. Petualangan penuh risiko, tapi menyenangkan dan menguntungkan. SUGENG SULAKSONO, Jakarta

Jasman Panjaitan

Subuh Dzuhur Ashar Maghrib Isya 04:29 11:49 14:56 17:53 19:01 Sumber : Kanwil Kemenag Kalbar


PAGI itu cuaca masih dingin di Kefamenanu, Timor Tengah Utara, Nusa Tenggara Timur. Tim ekspedisi Ring of Fire Indonesia (RoFI) yang terdiri atas lima sepeda motor besar dan dua mobil pendukung kembali melanjutkan perjalanan di tengah cuaca gerimis untuk menyelesaikan fase


PERSIAPAN : Primasari Andini VP Marketing (kanan) AIA dan Youk

pertama dengan rute Kupang–Jakarta. Menyadari melintas di jalanan basah yang tidak terlalu lebar, rombongan yang dipimpin Youk Tanzil membatasi kecepatan di kisaran 30–40 km/jam. Namun, malang tak dapat ditolak, sepeda motor bebek muncul secara tibatiba dari arah berlawanan, menyerempet motor paling depan, lalu menabrak motor kedua yang dikendarai Youk. Meski tabrakannya tak begitu keras, tas motor Youk sampai terpental dan menghantam setang motor ketiga yang ditunggangi anaknya, Banyu, 32. Semua terjatuh mencium aspal. Dalam kecelakaan itu, kondisi Youk paling parah. Saat terjatuh, kaki kirinya terjepit engine guard motor Kawasaki jenis off road 600 cc yang dikendarai pengusaha dan kontraktor itu.

Tanzil (kiri) berbincang jelang ekspedisi tahap kedua Ring of Fire di Jakarta.

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 3.000 *Ketapang & KKU Rp 4.000 *Kapuas Hulu Rp 3.000 C





Ke Halaman 6 Kolom 1

Jawa Pos Group Media



Pontianak Post Sabtu 31 Maret 2012

Menjadi Anggota Masyarakat Intelektual Akhir Maret 2012 Universitas Tanjungpura (Untan) mewisuda lebih dari 1000 orang sarjana. Ketika mereka memasuki kampus Untan pertama kali 4-5 tahun yang lalu tentu ingat ada sepanduk yang membentang dengan tulisan ”Selamat datang para intelektual muda”. Bulan ini, tahun 2012, saat di seluruh Indonesia berlangsung demonstrasi menentang kenaikan harga BBM, mereka itu oleh Rektor, prof. Dr. Thamrin Usman, disyahkan sebagai penyandang gelar akademis baik Sarjana, Magister maupun Doktor. Pertanyaan yang muncul adalah apakah mereka itu otomatis telah menjadi kaum intelektual?

oleh Leo Sutrisno

Banyak orang berpendapat bahwa intelektual adalah para penyandang gelar akademis dari pendidikan tinggi. Peran mereka dalam kemaslahatan umat

manusia sangat diharapkan. Sering juga para intelektual itu desebut juga sebagai kaum cendikiawan. Dalam Ensiklopedia Bebas Wikipedia dituliskan “Cendekiawan atau intelektual ialah orang yang menggunakan kecerdasan untuk bekerja, belajar, membayangkan, mengagas, atau menyoal dan menjawab persoalan tentang berbagai gagasan” Secara lebih rinci disebutkan, ada tiga kelompok cendekiawan. Kelompok pertama adalah mereka yang amat terlibat dalam idea-idea dan buku-buku. Kelompok kedua adalah mereka yang mempunyai keahlian dalam budaya dan seni yang memberikan mereka kewibawaan kebudayaan, dan yang kemudian mempergunakan kewibawaan itu untuk mendiskusikan perkara-perkara lain di khalayak ramai. Dan. kelompok ketiga adalah mereka yang tergolong dalam para professional. Tampaknya, secara sederhana, para wisudawan dari perguruan tinggi itu secara otomatis dapat dimasukkan sebagai orang intelektual atau cendekiawan kelompok ketiga, orang-orang professional, seperti guru, dosen, pengacara, dokter, akuntan, dsb. Karena, mereka di perguruan tinggi dengan tujuan yang hapir sama yaitu unutk memperoleh suatu keahlian dan ketrampilan sehingga dapat digunakan untuk bekerja dan mendapatkan imbalan yang layan untuk menopang hidupnya. Namun, dalam tulisan yang sama disajikan pernyataan Sharif Shaary, dramawan Malaysia “Belajar di universitas bukan jaminan seseorang dapat menjadi cendekiawan... seorang cendekiawan adalah pemikir yang sentiasa berpikir dan mengembangkan serta menyumbangkan gagasannya untuk kesejahteraan masyarakat.” Seorang intelektual adalah seseorang yang mengenali kebenaran dan juga berani memperjuangkan kebenaran itu, meskipun menghadapi tekanan dan ancaman. Dengan kuat, Julien Benda menuliskan seorang cendekiawan adalah seseorang yang berani berkata: ”Kerajaanku bukan di dunia ini”. Mereka tidak mengejar tujuan-tujuan praktis, tetapi mencari kegembiraannya dalam mengolah seni, ilmu pengetahuan, atau renungan matefisik. Karena tujuannya mencari kebenaran, maka kaum cendekiawan sering berhadapan dengan anggota kelompok dominant, para pemegang kekuasaan. Ada kalanya, mera

eka harus mempertaruhkan hidupnya sendiri demi kebenaran yang dijunjungnya. Dengan demikian, seorang cendekiawan adalah orang sekuler yang dapat membebaskan diri dari loyalitas kekuasaan atau loyalitas politik. Akibatnya, ia ‘harus’ berani berdiri sendirian di tengah pasar. Jika pengertian ini yang digunakan, maka memang tidak serta merta mereka yang telah menyandang gelar akademis dari perguruan tinggi dapat dianggap sebagai kaun intelektual atau kaum cendekiawan. Sebaliknya, sebaian dari mereka ini menempatkan diri sebagai ‘alat’ dari kelompok tertentu demi mempertahankan ‘keselamatan’ hidupnya. Sejumlah ahli menamai kelompok ini sebagai intelektual organic, intelektual yang menjadi ‘organ’ kepentingan tertentu. Mungkin juga ada kelompok lain lagi, yang disebut intelektual bisu. Mereka ini tidak berbuat sesuatu walaupun dalam situasi kebenaran yang telah diputarbalikkan. Mana yang mesti dimasuki? Lepas dari kebebasan seseorang untuk melakukan pilihan, apakah ingin menjadi seorang cendekiawan, seorang intelektual organis, atau inteletual bisu ada baiknya sebelum pilihan ditetapkan yang berangkutan mengembangkan pertanyaan: ”Apakah misi hidupku di dunia ini?” lebih dahulu. Apakah hidup ini hanya sebuah kebetulan, saat ini di Kalimantan Barat? Jika hidup ini sebuah kebetulan, maka tidak menjadi masalah jika kita membiarkan hidup itu mengalir apa adanya. Kita membiarkan diri terbawa oleh arus besar perubahan pola hidup. Tidak menjadi masalah apakah akan menjadi intelektual bisu atau intelektual organis. Atau sebaliknya, apakah, kebaradaanku di sini bukan sebuah kebetulan? Tetapi, merupakan bagian dari ’cetak biru’ Si Pemberi Hidup. Ia mengirimkanku ke sini dengan ’tugas khusus’. Tugas khusus inilah yang menjadi misi hidupku. Jika ini yang menjadi jawaban, maka kita dapat memilih hidup seperti seorang cendekiawan, seseorang yang selalu menyuarakan kebenaran, seseorang yang menyerahkan seluruh hidupnya untuk kemaslahatan manusia. Dalam posisi seperti ini, seorang cendekiawan akan menempatkan diri untuk menyuarakan kebenaran di hadapan para pemegang kekuasaan. Tentu, kecendikiawannya tidak berakibat ’mati konyol’. Semoga!


Si Tomcat di Mana-Mana TOMCAT mendadak terkenal dan menghebohkan. Meski hanya berukuran seujung jari kelingking, hewan yang tergolong kumbang ini meresahkan. Anak-anak, remaja, hingga lansia bisa menjadi korbannya. Surabaya, Sidoarjo, Gresik, Blitar, hingga Situbondo tidak luput dari serangan hewan bernama latin Paederus Littorarius (rove bettle) ini. Kabar mengenai dampak serangan tomcat bahkan sudah sampai di Jakarta dan Bandung. Ada saja yang mengirimkan pesan singkat mengenai si tomcat. Mulai link bentuk hewan hingga pertolongan pertama korban serangan tomcat. Tak urung, Direktur Jenderal Pengendalian Penyakit dan Penyehatan Lingkungan (P2PL) Kementerian Kesehatan Tjandra Yoga Aditama ikut sibuk memantau perkembangan terkini kor-

ban serangan tomcat di Jawa Timur. Mungkin, bila tempat tinggal tetap memadai, tomcat akan tenang di alamnya. Kita tidak mungkin hanya mengandalkan pemerintah melalui dinas kesehatan dan dinas pertanian setempat saja. Kita tidak mungkin tinggal diam menghadapi serangan tomcat yang membabi buta ini. Perlu dicari penyebab serangga secara bergantian mendadak muncul dalam jumlah banyak, selain menuduh perubahan cuaca secara global. Perlu ada perubahan mendasar yang melibatkan semua pihak. Di antaranya, penataan untuk hunian, lahan pertanian, maupun lahan hijau yang benarbenar hijau. Kita tetap nyaman, hewan liar pun tetap aman di ’’rumah’’-nya. Tentu, tujuannya rantai makanan kembali pada keseimbangannya. (*)

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Per­setujuan Peru­bahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11­September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redak­si: (0561) 735070.Telepon Iklan/Pema­saran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: redaksi@pon­ Penerbit: PT.Akcaya PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Utama Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Re­daksi/Penang­gung Jawab: B Salman. Redaktur Pelaksana: Khairul­rahman, Muslim Minhard, Donatus Budiono, Basilius Sidang Redaksi: Abu Sofian, Surhan Sani, Mela Danisari, Yulfi Asmadi, Andre Januardi, Mursalin, Robert Iskandar, Efprizan. Sekre­taris Redaksi: Silvina. Staf Redaksi: Marius AP, U Ronald, Deny Hamdani, Budianto, Chairunnisya, M Kusdharmadi, Hari KurniJawa Pos Group atama, Hendy Irwandi, Pracetak/Artistik: A Riyanto (Koordinator), Grafis: Sigit Prasetyo, Ilustrator: Kessusanto. Fotografer: Timbul Mudjadi, Sando Shafella. Biro Singkawang: Zulkarnaen Fauzi (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: (Jl P Anom Telp (0562) 392683) Biro Sanggau: Anto Winarno (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Achmad Fachrozi, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Wahyu Ismir. Pema­saran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie. Harga Lang­ganan per 1 Bulan dalam kota Rp 65.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 40.000,- spot colour Rp 45.000,- full colour Rp 50.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, mak­­si­mal 10 baris) pem­bayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No.4 Pasar Ming­gu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.

Pontianak Post

Pontianak bisnis Lokomotif Kemajuan Ekonomi Kalbar

Pontianak Post



Sabtu 31 Maret 2012

Beban Meningkat, Laba Produsen Ban Kempes JAKARTA—Emiten produsen ban sepanjang 2011 mencatatkan kinerja kurang menggembirakan. Meski rata-rata pendapatan mengalami kenaikan namun laba bersih justru tercatat turun. Sebagian digunakan untuk ekspansi.Penurunan paling dalam dialami PT Goodyear Indonesia Tbk (GDYR) yang laba bersihnya tergerus hingga 70,92 persen. Hingga Desember 2011, perseroan membukukan laba bersih sebesar USD 2,16 juta dibandingkan USD 7,42 juta pada 2010. Penurunan laba bersih buah dari pembengkakan beban penjualan hingga 10,9 persen. Total beban penjualanper31Desember2011mencapaiUSD193,29 juta dibandingkan tahun sebelumnya sebesar USD 174,15 juta. Padahal, penjualan mengalami kenaikan 7,21 persen menjadi USD 207,31 juta pada 2011. Begitu juga laba bersih PT Gajah Tunggal Tbk (GJTL) yang mengalami penurunan 17,7 persen dari Rp830 miliar pada 2010 menjadi Rp683,63 miliar pada 2011. Perseroan mencatat pertumbuhan beban pendapatan yang lebih besar naik 28,51 persen dari Rp7,92 triliun pada 2010 menjadi Rp10,17 triliun pada 2011. Pembengkakan beban GJTL melampaui pertumbuhan pendapatannya di level 20,17 persen menjadi Rp11,84 triliun pada 2011 dibandingkan Rp9,85 triliun pada 2010. Sementara itu, PT Multistrada Arah Sarana Tbk (MASA) mencatatkan penurunan laba bersih hingga 18,7 persen menjadi Rp143,13 miliar. Beban pendapatanmencapaiRp2,33triliunataumelonjak48,24persen dibandingkan Rp1,57 triliun pada 2010. Persentase pembengkakan beban pendapatan tersebut melampaui pertumbuhan penjualan MASA sebesar 42,61 persen menjadi Rp2,86 triliun pada 2011. (gen/kim)

Investor Asing Belanja Beruntun

Green Bay Pluit


INVESTASI MENGIURKAN: Hunian vertikal menjadi pilihan investasi menggiurkan.

Nilai Investasi Terus Naik PONTIANAK—Perkembangan properti di Indonesia sepertinya tidak pernah mati. Pada kota-kota besar, pengembangan properti sudah mengarah pada bangunan hunian vertikal, seperti apartemen dan kondominium. Penjualan hunian vertikal ini sudah sejak lama menyasar pasar Pontianak. Hunian vertikal telah menjadi salah satu pilihan utama produk investasibagiwargaPontianak.Nilai investasi hunian vertikal memang terus melambung tinggi. Agus Lay,

Supervisor Green Bay Pluit mencontohkan produk apartmen dan kondominum yang dipasarkannya di Pontianak. Sekitar satu tahun lalu, waktu pertamakaliiamelakukanpameran di Pontianak, apartemen Green Bay Pluit mereka tawarkan mulai Rp200 jutaan. Nilainya terus merangkak naik, hingga pada pameran ke-4, 24 Maret – 1 April 2012, apartemen Green Bay Pluit ditawarkan mulai Rp290 jutaan. Harga apartemen yang mereka





tawarkanterusnaik,seiringperkembangan progres pembangunan, serta Green Bay Pluit yang berada dilokasi sangat strategis. Cepatnya perkembangan nilai investasi properti vertikal tentunya mengiurkan. “Nilai investasi ini bisa naik lagi ke depannya. Kami hadir di Ayani Megamal Pontianak hingga hari Minggu. Hari itu kesempatan terakhir bagi warga Pontianak untuk dapat promo khusus kami,” pungkasnya. (*/r)

JAKARTA—IndeksHargaSaham Gabungan (IHSG) terus merangkak naik. IHSG kembali ke zona hijau lewat kenaikan 16.384 poin (0.399 persen) ke level 4,121.551 dan indeks LQ45 naik 4.02 poin (0.57 persen) ke level 712.55 pada penutupan perdagangan kemarin. Research Analyst PT Panin Sekuritas Purwoko Sartono, mengatakan, indeks berhasil ditutup menguat di tengah pecahnya konsentrasi investor menyusul maraknya aksi penolakan kenaikan harga BBM bersubsidi serta ricuhnya rapat paripurna DPR. “Sentimen positif dari pengumuman kinerja emiten tampaknya menjadi katalis positif bagi indeks,” ujarnya, kemarin. Transaksi tercatat cukup ramai sementara investor asing masih mencatatkan net buy yang cukup besar mencapai Rp1,189 triliun. Berdasarkan pantauan Purwoko, asing mencatat net buy sebanyak 16 hari berturut-turut. “Hal ini bisa diindikasikan bagaimana optimisme investor terhadap prospek perekonomian kita,” paparnya. Frekuensi transaksi perdagangan kemarin mencapai 126.451 kali

pada volume 7,57 juta lot saham senilai Rp4,887 triliun. Sebanyak 122 saham naik, sisanya 124 saham turun, dan 109 saham stagnan. Saham-saham yang naik signifikan (top gainers) pada perdagangan kemarin di antaranya Astra Internasional (ASII) naik Rp1.000 ke Rp73.950, Lionmetal (LION) naik Rp1.000 ke Rp6.200, Gudang garam (GGRM) naik Rp700 ke Rp55.050, dan United Tractor (UNTR) naik Rp600 ke Rp33.000. Saham-saham yang turun cukup dalam(toplosers)antaralainTaisho (SQBI) turun Rp8.000 ke Rp130.000, Hero Supermarket (HERO) turun Rp2.250 ke Rp21.000, Surya Citra (SCMA) turun Rp450 ke Rp8.050, dan Indocement (INTP) turun Rp250 ke Rp18.450. Bursa di Asia pada penutupan perdagangan kemarin; Indeks Komposit Shanghai naik 10,63 poin (0,47 persen) ke level 2.262,79. Indeks Hang Seng turun 53,81 poin (0,26 persen) ke level 20.555,58. Indeks Nikkei 225 turun 31,23 poin (0,31 persen) ke level 10.083,56. Indeks Straits Times naik 7,30 poin (0,24 persen) ke level 3.001,39. (gen/kim)

Pontianak Post


• Sabtu 31 Maret 2012

Saat putus cinta tentunya kita ingin melupakan kenangan yang

pernah tercipta. Proses ini berhubungan langsung dengan memori, dimana semua kenangan yang pernah dilalui seseorang akan tersimpan rapi di long memorinya. Hal inilah yang membuat salah satu alasan di dalam suatu hubungan, kenapa banyak orang sulit untuk melupakan sang mantan kekasih. Anggita Anggriana, Pontianak

i dalam memori manusia terjadi suatu kombinasi hubungan, dimana fungsi emosi dan rasa cinta membuat suatu hubungan menjadi lebih berwarna saat dijalani. Sehingga tanpa kita sadari, kombinasi yang tercipta karena dua fungsi ini tersimpan dengan rapi di long memory seseorang. Tak heranlah jika orang putus cinta membutuhkan waktu yang cukup lama untuk melupakan tentang apa yang pernah dialaminya ketika bersama sang (mantan) pacar. Sedangkan jika melihat dari fungsi otak manusia, pada dasarnya otak manusia tidak mengenal kata melupakan! Otak hanya memerlukan pengalihan. Jadi ungkapan yang mengatakan, “mati satu tumbuh seribu” adalah benar. Artinya ada hal yang sedang kita coba untuk alihkan dari pasca putus cinta. Bisa itu melampiaskannya dengan bekerja, ataupun mencoba untuk belajar membuka hati kepada orang lain. Pengalihan ini harus ada, karena jika pengalihan ini tidak dilakukan, hanya akan membuat kita kembali


dibayang-bayangi masa lalu. “Proses pasca putus cinta memang akan tetap membutuhkan masa pengalihan. Karena jika kita tidak berusaha mengalihkannya, akan sulit untuk melepaskan bayang-bayang yang akan terus kembali dan membuat kita terus mengingat

kebersamaan yang pernah terjadi dengannya,” demikian jelas Agus Handini, M.Psi, Psikolog. Karena bagaimanapun di dalam suatu hubungan, mau kita yang sebagai wanita ataupun mereka sebagai prianya yang membuat hubungan menjadi putus suatu saat akan teringat dimana adanya kenangan atas momen-momen indah yang pernah terjalin saat bersama. “Melupakan seseorang harus dimulai dengan mengingat yang negatif tentang orang tersebut. Kalau kita terus saja mengingat orang tersebut hanya pada sisi baiknya saja, itu hanya akan membuat kita akan terus mencintainya dan memikirkannya,” jelasnya. Dan yang pasti saat kita mengingat orang tersebut dengan fungsi memori dan emosi yang dimiliki itu bisa tambah memperkuat kita untuk terus mengingatnya karena otak tidak akan pernah melupakan. Bahkan wanita yang akrab disapa bunda ini memberikan contoh kejadian yang sering dialami seseorang ketika dia berusaha untuk melupakan mantannya dan berkata, “Saya tak pernah bisa melupakannya,” maka menurutnya itu bukan tidak bisa melupakan, namun karena dia tak mau melupakan kenangan yang ada. “Pada dasarnya kita bisa kalau kita mau mencoba melupakannya dan terus mencoba dengan memberikan berbagai pengalihan,” beber Dosen STAIN Pontianak ini.

Solusi terbaik yang bisa dilakukan seseorang untuk bisa melupakan orang yang disayangnya adalah dengan cara mencari penggantinya. Mencari seseorang yang bisa memberikan rasa care dan perhatian yang sama ketika kita berada dalam posisi berusaha untuk melupakan. Lama kelamaan ini akan sangat membantu kita untuk bisa melupakan mantan. “Selain itu ingatlah tentang apa kejelekan dia terhadap kita. Kalau otak kita berada dalam posisi yang seimbang, maka kita bisa berpikir secara objektif bagaimana penilaian kita terhadap dia dan ini dinamakan analisis untung rugi,” papar wanita yang menyelesaikan pendidikan S2 psikologinya di Universitas Islam Bandung ini. Di sini kita bisa melihat baik dan jeleknya sikap dia terhadap kita. Namun, tetap dengan satu syarat kita harus objektif. “Ajak teman dekat kita yang tahu bagaimana hubungan kita dengan sang mantan untuk sama-sama menganalisisnya, lalu setelah itu jawaban kita dan teman dicocokkan,” ucapnya. Jika kita benar-benar objektif dalam memberikan jawabannya, maka jawaban kita dan teman garis besarnya akan sama. Tapi sering kali di pihak kita sebagai mantannya susah sekali untuk berpikir objektif karena kita akan cenderung memberikan jawaban yang subjektif. “Jika ini terjadi lebih baik kita jangan menganalisis karena jawaban yang akan diberikan tidak akan benar,” pungkas psikolog kelahiran tahun 1973 ini. **

Ingatlah Kejelekan Mantan Memutuskan komunikasi dengan sang mantan atau apapun yang membuat kita mengingatnya kembali, lebih baik putuskan atau lenyapkan itu. Karena hanya akan membuat usaha yang kita lakukan terasa sia-sia. Tapi jika ada barang yang pernah diberikan kepada kita dan memiliki manfaat, kenapatidakdipergunakan?Tapikalauuntuk berkata seperti itu, diri kita juga harus terus mensugestidiri.“Ooohtidakapa-apa,barang ini memang dari dia tapi kan sudah dikasih untuk kita dan saya mau menggunakannya. Tapi bukan berarti saya masih mencintainya.” Dalam suatu hubungan, apalagi jika hubungan ini sudah bertahan bertahun-tahun, pastinya akan sulit bagi kita kaum wanita melupakannya, karena ini menyangkut masalah perasaan. “Tapi dengan belajar untuk mengingat kejelekannya pelan-pelan, kita pasti bisa dan tentunya terus memberikan sugesti pada diri sendiri berapa banyak waktu yang terbuang jika kita terus mengingatnya?” bebernya mensupport. Kenapa kita tidak melakukan hal yang positif untuk diri kita sendiri? Apalagi kalau putusnya hubungan dikarenakan pengkhianatan dia terhadap cinta kita, tentu itu akan menyiksa jiwa dan raga diri sendiri karena memikirkannya melulu. Meski begitu, ketika cinta sudah berakhir, janganlah berniat untuk membalas dendam terhadap perlakuannya. “Biasakan berbuat baik kepada orang yang telah menyakiti kita, akan jauh lebih menyakitkan untuk dia ketimbang kita berbuat hal yang sama hanya untuk membalasnya,” beritahunya. “Berbuat





baik ini bukan berarti merendahkan diri kita kepadanya loh ya, tapi karena kita sebagai makhluk sosial tetap menjaga hubungan silahturahmi,” katanya. Kecuali ada hal-hal tertentu yang tak bisa ditolerir lagi kesalahannya, lebih baik memang menjauh darinya, daripada Anda masih berhubungan dengannya, tapi membuat diri tersiksa. SebenarnyaungkapAgus,yangditakutkan bukanlah dengan siapa kita putus. Karena

Putus cinta adalah salah satu proses tahap pendewasaan seseorang untuk bisa lebih baik lagi dalam mengendalikan perasaan dan pikirannya. Putus cinta diperbolehkan bila sudah tak ada kecocokan lagi, tapi tidak untuk depresi!” Agus Handini, M.Psi Psikolog

ketika kita masih pacaran, yang terpenting bahwasanya hubungan yang kita jalani adalah hubungan yang sehat. Yang sering terjadi perempuan tidak bisa melupakan mantannya karena dari pihak wanita telah kehilangan keperawanannya yang telah direnggut oleh sang kekasih. Tapi jika ada alasan putus karena masalah virginitas, ini akanmenjadisuatumasalah.Biasanyaalasan ini banyak membuat wanita memilih tidak menikah karena rasa penyesalan yang selalu timbul di dalam batinnya. “Rasa bersalah ini akan terus menghinggapi mereka. Karena itulah saat berpacaran, hindari hal-hal yang kebablasan. Jangan sampai ada penyesalan teramat dalam begitu putus nantinya,” ujarnya mengingatkan. (ang)


Pontianak Post Sabtu 31 Maret 2012

Cerita tentang makhluk kecil yang tercipta karena rekayasa genetika dan dipenjara bersama penciptanya. Stitch kabur menuju bumi dan akhirnya diadopsi Lilo kecil. (*)

06.45 Hati ke Hati Bersama Mamah Dedeh 08.30 Dink, The Little Dinosaurus 11.30 Topik Siang 14.00 Mantap 16.30 Behind The Scene: Samudra Karya 20.30 Pilih-Pilih Mantu Malam Penolakan 22.30 God of Gamblers 2

My Name Is Khan

08.05 Jendela Rumah 10.05 Untuk Buah Hati 12.05 Metro Siang

14.30 19.05 20.05

Travelista Idenesia Face To Face: Sadao Watanabe


Rizwan Khan, pemuda muslim asal India, menderita Asperger”s syndrome, kelainan yang membuat dia menjadi sulit berinteraksi dengan orang. Dia menjadi korban efek samping serangan terorisme. (*)

Metro TV

Global TV Pukul 09.30 WIB

Lilo and Stitch

Apa Kabar Indonesia Pagi Mutumanikam Nostalgia Bukan Jalan-Jalan Biasa Nama dan Peristiwa Prediksi




TV One 06.30 10.00 15.00 19.00 20.00 23.00


SCTV Pukul 12.30 WIB

06.00 Bintang Arena 08.30 Karjo 12.00 Stasiun Dangdut 17.00 Dolanan Sitole 19.00 Kuis Flexi Cengli 20.00 Grand Final Raka Raki 2012


05.00 Obat Hati: Ustazd Syahrul Syah 08:30 Suka Duka Cinta di Ubud 14:00 Galaxy Superstar 16.30 Roro Jongrang 20.00 Sinetron Ungggulan: Tutur Tinular 22.00 Gelar Tinju Profesional Indosiar

MNCTV 06.00 09.00 12.00

Sehat Wanita Akibat Kawin dan Hamil Muda Kisah Nyata Aku Tidak Gila

16.00 Friends 20.00 Tendangan Si Madun 22.30 Monas I’m In Love

Trans TV Pukul 21.15 WIB

The Taking of Pelham 123 Walter Garber menerima kabar bahwa sebuah gerombolan bersenjata berat telah membajak kereta bawah tanah dan menahan semua penumpang sebagai sandera. (*)


Kembali Banjir Job NAMANYA melambung saat kasus video mesumnya sama Ariel ‘Peterpan’ meledak. Kariernya pun meredup, ibu satu anak ini jarang dapat kerjaan. Tapi itu semua tinggal masa lalu karena Cut Tari sekarang mulai eksis lagi di entertainment. “Dulu aku lebih memilih menutup diri. Nggak usah ngomongin kemarin (video porno). Alhamdulillah, kini ada beberapa tawaran job dan aku mulai membuka diri lagi,” kata Tari. “Aku nggak bakal milih. Tapi tetap harus sesuai suasana hati. Pengen banget milih striping sinetron asal jamnya bisa diatur,” imbuhnya. Ia ingin masyarakat tak terus menghukum dia dengan kejadian masa lalunya. Karena selama 20 tahun perjalanan kariernya, Tari merasa punya karya yang bisa dibanggakan. ”Aku minta lihat karya seseorang nggak hanya sisi problem yang itu-itu saja,” tandasnya. Selain jadi presenter, si cantik asal Aceh ini baru didapuk jadi reporter di sebuah program televisi. Katanya, dia penasaran ingin mewawancarai Presiden SBY secara langsung. “Karena dia kan presiden, dia bertanggung jawab terhadap rakyatnya. Jadi, wajar kan kalau aku bertanya sama dia,” ucapnya Namun, menjadi reporter bukan perkara gampang. Terutama menembus narasumber yang ingin diwawancarainya. Mereka harus punya kesabaran untuk menunggu. “Jadi reporter nggak mudah yah. Kerjaannya ada waktu yang terbuang, menunggu gitu yah. Kesabaran juga perlu. Terus yang paling penting adalah kita harus berusaha menyukai menjadi seorang reporter itu seperti apa,” terangnya. (ins)

Cut Tari



Album Baru Tiga Bulan lagi LOS ANGELES - Tahun ini benar-benar akan menjadi momen comeback untuk band rock legendaris, Aerosmith. Selain mengumumkan konser lewat Global Warming Tour, band yang telah menjual 150 juta kopi album itu menjanjikan materi baru dalam waktu dekat. Steven Tyler (vokal), Joe Perry (gitar), Tom Hamilton (bass), Joey Kramer (drum), dan Brad Whitford (gitar) tengah melakukan finishing rilisan terbaru. Tyler menyatakan bahwa bandnya merampungkan dua lagu terakhir untuk album terbaru. Ayah aktris Liv Tyler tersebut menargetkan, semua proses selesai kurang dari tiga bulan. Tetapi, dia masih tutup mulut tentang judul yang akan dipakai untuk rilisan ke-15 Aerosmith itu. Rabu lalu (28/3) empat personel Aerosmith (tanpa gitaris Brad Whitford) berkumpul di Los Angeles Mall untuk menemui fans mereka. Dalam acara tersebut, band yang terbentuk pada 1970 tersebut mengumumkan tiga track terbaru. Beberapa judul yang dibocorkan adalah Legendary Child, Beautiful, dan Out Go the Lights. ”Kami tidak akan mengecewakan kalian,” ujar Tyler dengan disambut teriakan para fans, seperti dikutip Associated Press. Beberapa elemen dari album sebelumnya akan dipakai dengan senC





SUASANA BERBEDA: Joe Perry (kiri ke kanan), Steven Tyler, Joey Kramer, dan Tom Hamilton saat berkumpul di Los Angeles Mall untuk menemui fans mereka, 28 Maret 2012.

tuhan aransemen baru. Sang bassist, Hamilton, menyatakan bahwa 2012 merupakan saat yang tepat untuk menghasilkan karya yang lebih fresh. Mereka optimistis memberikan suasana yang berbeda kepada para pendengarnya. “Kami punya banyak lagu berharga yang ditulis dalam beberapa tahun. Saat ini merupakan momen yang sempurna untuk mengeluarkannya,”

paparnya. Keikutsertaan Tyler sebagai juri American Idol diakui memberikan dampak positif bagi Aerosmith. Menurut sang gitaris, Perry, hal tersebut membuat percaya diri Tyler semakin tinggi. Selain itu, rating tinggi kontes pencarian bakat tersebut berpotensi untuk mendongkrak popularitas dan menambah fans baru bandnya.

Global Warming Tour akan dimulai pada 16 Juni 2012 di Minneapolis, Minnesota, dan berakhir pada 8 Agustus 2012 di Tacoma, Washington, Amerika Serikat (AS). Total Aerosmith akan mengadakan 21 show di seantero AS dan Kanada. Band yang telah berumur 40 tahun tersebut akan menggandeng Cheap Trick sebagai band pembuka. (kkn/ c12/any)


6 Harga BBM Batal Naik 1 April Sambungan dari halaman 1

agenda pengesahan RAPBN Perubahan 2012 kemarin ditempuh dengan lobi yang berlarutlarut. Forum lobi yang dibuka mulai pukul 16.30 tersebut ditempuh setelah fraksi-fraksi koalisi pemerintahan menyampaikan variasi usul yang cukup beragam dalam klausul pasal 7 ayat 6a. Pasal tersebut memuat klausul persyaratan pemberian kewenangan pemerintah untuk menaikkan harga BBM. Sedangkan tiga fraksi oposisi, yakni FPDIP, Fraksi Gerindra, dan Fraksi Hanura, tegas menolak dimasukkannya tambahan ayat tersebut. Legislator Fraksi PDIP Maruarar Sirait mengatakan, ayat tambahan tersebut hanya siasat untuk tetap menaikkan harga BBM. ”Itu pasal siluman,” kata Maruarar. Menurut dia, harga minyak mentah Indonesia (ICP) sepanjang Maret telah mencapai USD 126 per barel. Karena itu, dengan deviasi 20 persen sekalipun, pemerintah masih bisa menaikkan harga BBM. Asumsi ICP dalam RAPBNP 2012 ditetapkan USD 105 per barel. Sebelum forum lobi dibuka, fraksi koalisi pendukung pemerintah masih memiliki banyak varian usul terkait dengan deviasi harga ICP yang menjadi syarat menaikkan harga BBM bersubsidi. Fraksi Partai Demokrat (FPD) masih tetap berpegang pada kesepakatan di Banggar DPR, yakni jika rata-rata harga minyak mentah Indonesia (ICP) dalam sebulan terakhir meleset 5 persen dari asumsi, pemerintah berwenang menyesuaikan harga BBM. Sementara itu, Fraksi Partai Golkar (FPG) menginginkan persentasenya lebih ketat, yakni 15 persen, dengan pertimbangan rata-rata rentang harga ICP

Sambungan dari halaman 1

sehingga kenaikan BBM tidak serta-merta harus diiringi kenaikan harga barang. “Banyak komponen yang memengaruhi harga suatu barang. BBM bukan satu-satunya instrumen harga,” tegasnya. Acui menilai, sewajarnya harga BBM dinaikan. Sebab selama ini subsidi BBM membebani keuangan negara sampai Rp57 triliun per tahunnya. Sedangkan masyarakat tetap antre dan pertamina sering kekurangan stok. Tidak tersedia dalam jumlah yg cukup di SPBU. “Dan hal ini menyebabkan masyarakat terpaksa beli di kios dengan harga paling rendah Rp6.000 per liter,” ucapnya. Menurut Acui, subsidi BBM

per barel dengan rentang waktu 30 hari terakhir. Namun, FPKS mengubah usulnya menjadi lebih ketat, yakni 20 persen dengan rentang 90 hari. Sikap FPKS yang dibacakan Eki tersebut langsung diprotes sejumlah anggota fraksi lainnya, terutama dari partai koalisi. Menkeu Agus Martowardojo juga berang dengan sikap fraksi yang menyebut dirinya ”partai dakwah” itu. Sebab, FPKS dianggap telah mengubah hasil asli pembahasan dari tim perumus. ”Ini menurut saya, secara etika tidak baik,” kata Agus. Dinilai tidak etis, FPKS balik menyerang Menkeu. Eki meminta Menkeu mencabut pernyataannya. Namun, Menkeu tetap tidak mau menarik perkataannya dan tetap menyebut FPKS tidak memiliki etika. Banggar akhirnya sepakat untuk memurnikan hasil pembahasan di tim perumus dengan tidak mengindahkan perubahan sikap FPKS. Usul FPKS tetap dimasukkan ke opsi, namun dianggap baru disampaikan dalam rapat kerja pengambilan keputusan tingkat pertama. Tidak kalah panas dengan rapat paripurna, diluar Gedung DPR juga terjadi ketegangan antara aparat dan demonstran. Ujungujungnya, memasuki pukul 18.15 bentrokan fisik antar keduanya tidak terelakkan. Massa yang sebelumnya berhasil merobohkan pagar DPR dan ingin mendekat ruang sidang dibubarkan paksa oleh Polisi. Ketegangan itu seakan menjadi puncak dari seluruh aktivitas di siang hari. Sebelumnya, memang sempat terjadi ketegangan kecil namun berhasil di redam. Suasana kondusif makin terlihat saat mendekati maghrib beberapa demonstran memilih untuk pulang. Terutama, perempuan dari unsur buruh atau mahasiswi. Suasana yang sebelumnya

adem-ayem berubah saat sisa demonstran memaksa untuk masuk lebih dalam ke gedung DPR. Padahal, posisi mereka saat itu sudah di dalam kompleks DPR setelah dua gerbang utama dibuka. Tentu saja keinginan demonstran untuk mendekati ruang sidang dihalau. “Kalau anda pembela rakyat, tunjukkan kepada kami. Jangan halangi kami,” teriak seorang mahasiswa. Seperti yang sudahsudah, beberapa batu lantas melayang ke arah aparat. Aparat yang dilengkapi tameng dengan sigap menghalau lemparan batu. Berulang kali aparat memukulkan rotan ke tamengnya untuk menggertak.Suara keras yang dihasilkan tidak membuat massa gentar. Mereka tetap memaksa masuk ke gedung parlemen. Akhirnya, korps Bhayangkara memilih menggunakan Water Cannon untuk menghalau massa. “Jangan memaksa masuk. Bubar!,” teriak petugas lantas menyemprot air berkekuatan tinggi itu ke arah demonstran. Di Pontianak, pengamanan ekstraketat tidak hanya dalam mengantisipasi aksi unjuk rasa menolak kenaikan harga bahan bakar minyak. Objek vital seperti kantor pemasaran Pertamina di Jalan Sutoyo dan Depot ikut dijaga ketat pihak kepolisian. Kabid Humas Polda Kalbar AKBP Mukson Munandar, Jumat (30/3) di Pontianak, mengatakan pengamanan diberikan sepenuhnya dalam mengantisipasi gejolak kenaikan BBM. Misal jika kantor pemasaran Pertamina didatangi kelompok unjuk rasa. ‘’Kemarin Pertamina ikut jadi sasaran unjuk rasa. Maka kita menaruh perhatian terhadap pengamanan (Pertamina) yang termasuk kategori objek vital,’’ kata mantan Kabag Bin Ops DitNarkoba Polda Kalbar, ini. (stm/jpnn)

hanya menguntungkan segelintir orang terutama para penyelundup minyak ke luar negeri dan yang membeli ke SPBU kemudian dijual ke industri dengan harga tinggi. “Sedangkan masyarakat luas tetap susah mendapatkan dan menghabiskan banyak waktu untuk antre,” ungkapnya. Kenaikan hanya membebani masyarakat penikmat BBM bersubsidi sekitar Rp 3-4 ribu setiap kali mengisi bensin untuk sepeda motor dan mobil sekitar Rp 20-40 ribu. “Dengan demikian subsidi sebesar Rp 57 triliun bisa digunakan negara untuk membangun infrastruktur jalan, kesehatan, pendidikan di pedalaman perbatasan dan serana lain,” papar Acui. Kepada para pendemo yang menolak kenaikan harga BBM,

Acui berharap, penyampaian aspirasi dengan mengutamakan intelektual. “Jangan anarkis dan merusak fasilitas umum,” ingatnya. Sementara itu, Jumat sore Tim Pengendali Inflasi Daerah Kota Pontianak menggelar rapat untuk mencermati rencana kenaikan BBM.Wakil Wali Kota Pontianak Paryadi yang memimpin rapat tersebut mengatakan, ada beberapa hal yang mesti dilakukan dalam menghadapi kenaikan harga BBM. Terutama informasi kepada masyarakat tentang ketersediaan stok sembako dan bahan bakar bersubsidi. “Informasi dari Pertamina bahwa stok BBM masih banyak dan tersedia untuk masyarakat. Menurut agen dan distributor stok kebutuhan pokok beras dan barang-barang lainnya

masih memadai,” jelasnya. Paryadi meminta masyarakat tidak panik terhadap kenaikan BBM, berbondong antre di SPBU takut BBM langka. “Pertamina menyiapkan cukup BBM untuk beberapa hari ke depan,” ujarnya. Selain memastikan raskin 13 akan disalurkan April, Pemkot juga sudah berkoordinasi dengan stakeholder dari perusahaan BUMN yang bisa terlibat menggelar bazar sembako. “Beberapa BUMN yang bersedia membantu menggelar bazar masih di inventarisir. Sembako yang dibazarkan bisa saja beras, gula, minyak goreng, telur. Rencananya akan dilakukan di disetiap kecamatan masingmasing dua kelurahan,” papar Paryadi. (hen)

sama-sama. Walaupun tidak satu atap, kita bisa melakukan seperti yang dilakukan KPK,” ujar Jasman, yang juga memerintahkan stafnya segera berkoordinasi dengan BPKP, jika terbit surat perintah penyidikan. Wakil Gubernur Kalbar, Christiandy Sanjaya mengatakan dengan adanya Nota Kesepahaman antara Gubernur Kalbar dengan Kejati, Dinas PU Kalbar harus ikut melaksanakannya. ”Dinas PU harus mengikuti. Instansi tersebut siap (melakukan audit teknis),” ujar Christiandy, kemarin. Christiandy menjelaskan tunggakan kasus yang ada pada Kejati merupakan kasus tertentu saja. Dalam menangani kasus tersebut, diperlukan penghitungan

kerugian negara sehingga harus jelas sebelum diputuskan. Ia meminta semua pihak tidak menafsirkan catatan temuan sebagai tindak penyimpangan atau korupsi. Temuan itu juga bisa disebabkan kesalahan administrasi. ”Misalnya aset. Saat otonomi menjadi punya daerah. Tetapi belum ada serah terima dari pemerintah pusat ke daerah, padahal digunakan oleh daerah sebagai gedung pemerintahan,” katanya. Sekretaris Utama BPKP, Suwartomo mengapreasiasi adanya nota kesepahaman antara Pemprov Kalbar dengan Kejati Kalbar. Ia berharap nota kesepahaman itu dapat mengatasi kendala teknis yang terjadi dalam penanganan kasus penyimpangan keuangan daerah.(uni)

Kejati Nunggak Kasus Sambungan dari halaman 1

melakukan audit tersebut sehingga menjadi tunggakan kasus. ”Selama ini Dinas PU gamang. Di satu sisi pelaku adalah temannya atau ada kaitan pekerjaan sehingga enggan melakukan audit teknis,” ujar Jasman, saat serah terima jabatan Kepala Perwakilan Badan Pengawasan Keuangan dan Pembangunan (BPKP), serta Penandatanganan MoU Kerjasama Perhitungan Teknis Kerugian Negara, Jumat (30/3) di Balai Petitih Kantor Gubernur Kalbar. Jasman menuturkan saat ini terdapat 21 tunggakan kasus lama. Salah satu penyebabnya berkaitan dengan keputusan hakim di Semarang bahwa

kerugian negara harus dihitung lembaga berwenang dan terukur secara riil. Berkaitan dengan itu, lanjut Jasman, di Kejati Kalbar banyak tunggakan perkara. Hal ini disebabkan belum adanya perhitungan kerugian negara dari Perwakilan BPKP Kalbar. ”Dan untuk perhitungan kerugian negara ini harus ada audit teknis dari Dinas PU,” katanya. Jasman berharap dengan adanya penandatanganan Nota Kesepahaman Kerjasama Perhitungan Teknis Kerugian Negara, kendala tersebut bisa diselesaikan. Ia mencontohkan Komisi Pemberantasan Korupsi di Jakarta. Di sana, penyidik KPK sebenarnya penyidik Polri. Ada jaksa dan BPKP. ”KPK bisa cepat menyelesaikan kasus karena ber-

Dokumentasinya jadi Promo Pariwisata ke Seratus Negara Sambungan dari halaman 1

Akibatnya fatal. Tulang kering kaki kiri Youk patah. Bapak tiga anak itu pun terkapar di pinggir jalan sambil menunggu pertolongan medis lebih lanjut. Begitu ambulans datang, 30 menit kemudian, Youk dikirim ke RSUD setempat. Setelah menginap semalam di RS itu, dia kemudian dibawa ke Kupang melalui Atambua dengan menggunakan pesawat kecil. Dari Kupang dilanjutkan terbang ke Jakarta untuk menjalani operasi kakinya yang patah. Youk adalah pengusaha yang ’’gila’’ petualangan. Karena itu, setelah lima hari tergeletak di rumah sakit untuk proses recovery operasi kakinya yang patah, dia sudah tidak tahan untuk turun melanjutkan petualangannya bersama tim Ring of Fire Adventure yang kala itu sudah berada di Maumere. Maka, meski harus dibantu tongkat penyangga (kruk), Youk tetap nekat terbang ke NTT. ’’Dokter bilang sudah boleh dilatih jalan, tapi harus pakai kruk,’’ ucap Youk saat ditemui di Rolling Stone Cafe, Jakarta, pekan lalu. Saat itu tim yang berjumlah 12

orang tersebut bersiap mendaki Gunung Kalimutu yang berketinggian 2.000 meter. Youk tak mau tertinggal oleh teman-temannya. Dia tetap nekat mendaki meski harus mengenakan dua kruk. Tak bisa dibayangkan betapa susahnya dia mendaki dengan kondisi kaki yang masih dibalut gips. Tapi, kenyataannya dia mampu sampai ke puncak. Tidak sampai di situ. Youk melanjutkan ’’kegilaan’’-nya dengan mendaki Gunung Rinjani yang tingginya 2.800 meter. Namun, lantaran medan yang berat, Youk tidak bisa sampai puncak. Dia hanya sampai di pelawangan atau posisi satu step di bawah puncak gunung berapi itu. ’’Medan Rinjani lebih berat ketimbang Kelimutu. Tapi, saya tak boleh melanjutkan ke puncak karena cuaca sudah malam dan ada zat beracun yang berbahaya pada luka kaki saya,’’ tutur suami Sasa tersebut. Meski tak sampai puncak, prestasi Youk mendaki Gunung Rinjani mendapat apresiasi dari Museum Rekor-Dunia Indonesia (Muri) sebagai orang pertama dengan kaki patah yang naik Rinjani. ’’Kami harus selesaikan komit-


Sabtu 31 Maret 2012

Bukan Berarti Pecah Kongsi

dalam enam bulan terakhir. FPKS meminta rentang lebih ketat lagi, yakni deviasi 20 persen dengan rentang rata-rata harga 3 bulan. Namun, sekitar pukul 23.30, FPKS berubah sikap dengan menolak kenaikan harga BBM. Sedangkan FPPP mengusulkan 10 persen, FPAN 15 persen, dan FPKB 17,5 persen. Ketiganya menggunakan rentang waktu rata-rata ICP dalam sebulan terakhir. Ambang batas persentase diskresi sangat menentukan boleh tidaknya pemerintah menaikkan harga BBM. Dengan asumsi ICP USD 105 per barel, jika menggunakan versi FPD, pemerintah sudah bisa menaikkan harga BBM. Sebab, harga ICP rata-rata Maret sudah menembus USD 126 per barel dan pada Februari USD 122 per barel. Jika hitungan FPG yang menggunakan rentang ratarata harga ICP enam bulan, posisi harga minyak mentah baru USD 116 per barel. Dengan diskresi 15 persen, pemerintah belum bisa menaikkan harga BBM. Alotnya pembahasan di rapat paripurna sudah tecermin dalam rapat pada tingkat pertama di Banggar DPR dengan pemerintah yang dimulai Kamis (29/3) pukul 22.30 dan rampung Jumat (30/3) pukul 05.00. Rapat mulai memanas setelah tim perumus menyampaikan hasil pembahasan yang dibacakan legislator dari FPKS Eki Awal Muharam. FPKS tiba-tiba memasukkan klausul baru dalam pasal 7 ayat 6a yang memberikan diskresi atau keleluasaan pemerintah untuk menaikkan harga BBM dengan syarat tertentu. Dalam rapat tim perumus, FPKS masih satu suara dengan FPD, FPG, FPPP, FPAN, dan FPKB. Dalam kesepakatan sebelumnya, diskresi diberikan jika harga ICP meleset 5 persen jika dibandingkan dengan asumsi dalam APBNP sebesar USD 105

Tak Pengaruhi Pengusaha

Pontianak Post

men. Tadinya saya pikir juga tidak akan sanggup. Tapi, kita harus belajar di atas situasi, jangan situasi yang di atas kita. Kalau berani start, harus bisa finis,’’ tekad pria kelahiran Surabaya, 13 Maret 1953, itu lantas tertawa. Youk akhirnya bisa menyelesaikan fase pertama dari total lima fase yang akan dia lakoni mengelilingi Indonesia dengan menggunakan sepeda motor. Fase pertama dari Kupang ke Jakarta ditempuh 60 hari dengan sepuluh kali penyeberangan laut. Fase kedua akan start pada 8 April mendatang. Youk menyiapkan Yamaha Tenere XT660Z sebagai tunggangan. Petualangannya itu masih bersama tim yang sama. Perjalanan kedua bakal melintasi puluhan kota dari Makassar menuju Maluku, lalu menyeberang ke Surabaya dan kembali ke Jakarta. Belajar dari pengalaman pada fase pertama, Youk menggandeng perusahaan asuransi AIA Financial sebagai penjamin bila terjadi apa-apa kepada anggota tim. Turut dalam tim, tiga anak Youk. Yakni, Banyu, 32; Chintara Diva, 23; dan Geovani, 20. ’’Saya

berpikir bahwa warisan negeri ini lebih indah jika dibandingkan dengan warisan lainnya. Karena itu, saya mengajak anak-anak saya agar mereka mengenal langsung warisan negeri yang indah ini. Sebab, selama ini anak saya mungkin lebih tahu Sao Paulo, misalnya, ketimbang Magelang atau Muntilan,’’ ungkapnya. Yang tak kalah penting, melalui PT Ring of Fire Adventures Indonesia yang didirikan pada 2010, dia juga mengabadikan keindahan alam pedesaan dalam tur keliling itu untuk program promosi Indonesia kepada dunia. Dalam ekspedisi tersebut, Youk memang membawa peralatan dokumentasi canggih, kamera fotografi hingga kamera film. Setelah satu fase perjalanan selesai, biasanya Youk mengedit dokumnetasinya itu sendiri menjadi sebuah film dalam potongan berdurasi 5–8 menit untuk dijual ke seratus negara melalui iTunes.’’Di sinilah sisi bisnis saya muncul. Jadi, selain kepuasan batin dalam petualangan yang menantang, saya harus bisa mendapat keuntungan dari situ,’’ ujar pemilik sebuah PH (production house) C di Jakarta m yitu. (*) k

Sambungan dari halaman 1

dimainkan partai mitra koalisi. Seperti partai Golkar mengambil sikap mengambang, yang mengarah menolak, meski tidak mengungkapkan secara jelas. Padahal sebelumnya jelas mengambil sikap cenderung mendukung pemerintah. Zulkarnain mengatakan sikap demikian bisa saja dipengaruhi akibat tekanan demonstrasi merata di seluruh wilayah Indonesia. Membuat partai tidak ingin kehilangan simpati rakyat. Tetapi enggan melepaskan diri dari lingkaran kekuasaan. Maka alternatifnya mengambil sikap seolah kebijakan kenaikan BBM sepenuhnya menjadi domain

pemerintah. Sementara Partai Keadilan Sejahtera, menurut Zulkarnain, sebagai bagian mitra koalisi sudah mengambil sikap untuk menolak kebijakan kenaikan BBM. Hal demikian tentunya dapat terjadi dengan berbagai faktor yang melatarbelakangi. Misal dengan alasan kenaikan BBM dapat membebani rakyat. “Secara konteks politik hal yang paling memungkinkan partai tetap tidak ingin kehilangan pendukung terkait kebijakan publik yang dikeluarkan pemerintah. Maka mengambil sikap mendua meski tercatat sebagai partai mitra koalisi, menjadi hal yang memungkinkan,” kata Doktor lulusan Universitas Pad-

jajaran ini. Dia menambahkan dengan sikap mendua tentunya memposisikan partai tetap bisa memainkan dinamika politik, sekalipun kebijakan kenaikan BBM dilakukan pemerintah maupun sebaliknya. “Sikap mendua tidak menjadikan mitra koalisi pecah kongsi, karena tidak ada pengaturan,” kata Zulkarnain. Sementara partai politik yang secara tegas menolak kenaikan harga BBM dalam pandangan paripurna di DPR meliputi PDI Perjuangan, Gerindra, Hanura, dan PKS. Kemudian Demokrat mendukung penuh langkah pemerintah menaikan harga BBM. Sedang Golkar dan PAN cenderung memilih sikap mendua. (stm)

Hari ini, Final Spektakuler Sambungan dari halaman 1

Penampilan ngotot yang mereka peragakan saat semifinal melawan SMA Negeri 1 Pontianak menyiratkan hal itu. Sementara di final level putri, para srikandi SMA Santo Paulus Pontianak siap menantang pasukan Petrus. Skor mencolok yang selalu ada di akhir laga Petrus, tak membuat nyali anak-anak Paulus ciut. Mereka malah sangat bersemangat untuk segera melakoni pertandingan. Apapun itu, partai final jelasjelas menawarkan tensi yang tinggi. Suasana tegang tidak hanya akan tersaji di dalam lapangan. Dukungan dari para supporter para finalis pastinya akan semakin menambah persaingan dan aroma pertandingan Final Party hari ini. Para pendukung Petrus sudah pasti akan memenuhi tribun GOR Pangsuma. Tahun lalu pendukung Petrus bisa tembus seribuan orang. Tribun Pangsuma mendadak hijau karena kostum kebesaran Petrus. Apalagi hari ini jagoan cowok dan ceweknya kembali maju bersama. Namun tim lain bukannya tak punya suporter. Kepala SMA St Paulus, Valensius Ngardi misalnya, berjanji akan memboyong minimal 400 orang siswanya. Sebagai informasi, sekolah ini hanya memiliki 600 orang murid. Begitu juga dengan SMK Immanuel 1 yang juga tidak mau tampil tanpa dukungan penuh dari para supporter fanatiknya. Final Party pada hari ini bukan hanya menjadi Final biasa, karena berbeda dari tahun-tahun sebelumnya, laga puncak di GOR Pangsuma akan dibuat spektakuler mungkin dengan perpaduan lighting dan dua screen besar. Permainan lampu-lampu akan menjadi tontonan yang memanjakan mata bagi para penonton, karena sangat jarang terjadi event basket di daerah ini dikemas sedemikian megah. Dan event Honda DBL 2012 memberikan hal itu kepada para penonton

yang datang pada hari ini. Tak hanya menonton pertandingan Final saja, tapi lebih dari itu, penonton akan mendapatkan perpaduan antara konsep olahraga dan entertainment. Final hari ini juga tidak akan selalu menguras energi karena tegangnya pertandingan. Adapula final lain yang mendinginkan suasana, yaitu Dance Competition. Lima finalis dancer competition yang tidak diragukan lagi kualitasnya akan tampil. Tim dancer yang akan bertanding pada hari ini adalah SMA Negeri 1 Pontianak, SMAN 4 Pontianak, SMAN 10 Pontianak dan SMAN 7 Pontianak serta SMA Santu Petrus Pontianak. Dipastikan mereka akan menyuguhkan pertunjukan berbeda, yang lebih indah dari babak-babak awal. Selain itu akan ada pula Flash Mob persembahan dari Tahapan Xpresi BCA dan berbagai event pendukung seperti games-games untuk para penonton dengan beragam hadiah menarik. Yang tak kalah seru adalah Final Supporting Event yang dipersembahkan oleh para sponsor Honda DBL 2012. Akan ada pula penarikan undian yang berhadiah satu unit Honda BeAt untuk penonton yang beruntung. Final Dua Saudara Masing-masing kapten tim basket yang masuk ke partai final Honda DBL 2012 West Kalimantan Series, melakukan talkshow di Radio Vista, kemarin (30/3). Masing-masing kapten bercerita dan memberikan komentarnya mengenai kekuatan dan persiapan untuk menghadapi tim lawan. Tak disangka, kapten tim basket SMK Immanuel 1 Pontianak, Hutomo Rio Pangesthio ternyata mempunyai adik kandung yang bermain di tim SMA Santu Petrus Pontianak yang akan dilawannya di final, Rivaldo. Hutomo yang menjadi kapten tim basket SMK Immanuel 1, bercerita mengenai kemampuan tim lawan yang akan dihadapinya di partai final hari ini, Sabtu

(31/3). Di sela-sela komentarnya mengenai kekuatan tim Petrus, dia mengatakan kalau salah satu pemain Putra Petrus adalah adik kandungnya. “Saya dan kawankawan ingin bermain semaksimal mungkin pada pertandingan besok (hari ini). Karena Petrus merupakan tim yang kuat, dan pemain Petrus ada adik saya juga yang bermain di sana,” ungkap Hutomo. Lebih lanjut dia juga mengatakan, kalau pertandingannya melawan tim Petrus bukan berarti dia harus bermain setengah hati karena melawan adik sendiri. Dia mengaku akan bermain secara profesional sebagaimana dia melawan tim lainnya. Begitu juga sebaliknya, dia berharap saudara kandung yang membela tim lawan di partai final agar bisa bermain profesional. ”Orangtua tetap mendukung. Mendukung saya dan juga mendukung adik saya,” tambah Hutomo. Selain itu, ketiga kapten yang hadir pada cara talkshow di Radio Vista itu juga memberikan komentarnya. Syelna, sebagai kapten tim Putri Petrus, tidak ingin menyepelekan kemampuan tim Putri Paulus yang baru pertma kali masuk di final ini. “Kekuatan paulus juga perlu diperhitungkan,” kata Syelna. Sedangkan kapten tim Putri Paulus, Herawati Claudia juga mengatakan, Petrus juga sangat kuat. Namun, dia dengan kawan-kawannya tidak ingin ciut sebelum bertanding. “Banyak orang yang ciut sebelum bertanding saat mendengar nama Petrus, namun kami tidak akan ciut sebelum bertanding,” ungkap Herawati. Kapten tim Putra Petrus, Erwin juga mengatakan, SMK Immanuel 1 merupakan salah satu tim yang kuat. Karena kedua tim ini sudah sering bertemu, baik di ajang resmi maupun ujicoba. “Lawan juga kuat, namun kami sudah mempersiapkan dari jauhjauh hari. Seperti kekompakan konsenterasi, kerja keras dan dukungan dari suporter,” ungkap Erwin. (ars/afi)

Selingkuhi Indra Birowo Sambungan dari halaman 1

Penggemar tayangan malam dewasa, Kakek-Kakek Narsis kehilangan Nikita Mirzani. Tibatiba tubuh seksinya lenyap dari program TV swasta itu. Tak lama berhembus kabar, Nikita mundur dari KKN karena perselingkuhannya dengan salah satu host KKN, Indra Birowo. “Iya sekarang sudah nggak di KKN lagi,” ucap Nikita. Benarkah karena ketahuan selingkuh? “Wah, no comment gue nih,” jawabnya saat ditemui, wartawan kemarin siang. Setelah dirayu, akhirnya Nikita mau juga bicara. Ia memang pacaran, selingkuh dengan Indra! “Gue memang punya hubungan sama Indra,” jelasnya. Namun, setelah satu tahun menjalin kasih, Nikita akhirnya memutuskan hubungannya dengan ayah dua anak itu. “Tapi tanggal

1 Januari kemarin sudah putus,” tukas Nikita santai. Indra Birowo dikenal sebagai komedian. Dia berstatus suami Noella Adrianty dan dikaruniai dua orang anak bernama Arkananta Putra Birowo dan Mahija Shafiq Birowo. Pahitnya, alasan Nikita dan Indra putus karena cinta terlarang keduanya itu diketahui istri Indra. “Karena dia, gue enggak mau, bininya sudah tahu dan nangisnangis,” ungkap Nikita. Nikita tahu betul bahwa Indra sudah beristri bahkan memiliki dua anak buah cinta pernikahannya. Tapi, hal itu tak menyurutkan niat Nikita untuk tetap menjalin hubungan dengan Indra saat itu. “Begini ya, karena jodoh, mati, karier, kan di tangan Tuhan, jadi mungkin saat itu jodoh saya sama Indra,” ucap Nikita, “Satu tahun sama dia. Belum tahu balikan apa nggak.”

Status Nikita saat ini adalah janda anak satu. Ia menikah dengan seorang pengusaha pada 2006. Kemudian, dia melahirkan seorang putri, Laura Meizani Nasseru Asry pada 2007. “Seminggu pasca kelahiran anak, gue gugat cerai suami,” beber Nikita santai. Namun Nikita tidak mau menyebutkan nama suaminya. “Dalam waktu dekat ini gue belum bisa membocorkan ya,” tukasnya. Artis yang pernah dikabarkan merebut Olga Syahputra dari Jessica Iskandar ini, benar-benar tak memikirkan soal jodoh untuk beberapa waktu ke depan. Ia masih belum puas dengan kariernya. “Pokoknya kalau masalah jodoh, gue nggak pernah yang bagaimana-bagaimana ya. Sedapatnya aja. Dapatnya ustad ya sudah. Dapatnya pengusaha ya syukur, alhamdulillah,” pungkasnya. (BCG)

Dua Terduga Teroris Tewas Sambungan dari halaman 1

Setelah melakukan olah tempat kejadian perkara (TKP), tim penjinak bahan peledak (jihandak) menemukan serbuk belerang, buku bertema jihad, dan sepucuk senjata api jenis revolver. Menurut Saud, dua orang yang tewas tersebut diduga terlibat dalam peristiwa pembacokan dua anggota Polres Bekasi beberapa hari lalu. ’’Sekarang masih kami kejar empat orang lagi, ada kaitannya dengan yang telah dilumpuhkan ini,’’ katanya. Polisi juga menemukan dokumen-dokumen cara merampok bank, dua sepeda motor, lima unit handphone, dan tiga pisau belati. ’’Penyelidikan ini berdasar laporan warga karena ada orang mencurigakan. Kami menginvestigasi dan ada bukti permulaan yang cukup,’’ kata jenderal bintang satu itu. Peristiwa pembacokan polisi

terjadi di Desa Burangkeng, Kecamatan Setu, Minggu lalu (25/3). Saat itu, dua anggota Polres Bekasi, Brigadir Jaka dan Brigadir Ery Sasongko, sedang menjalankan tugas rutin. Mereka merapat ke lokasi dengan menggunakan kendaraan patroli 4413-VII 10102. Belum sempat memeriksa, dari belakang ada yang menyabet dengan menggunakan sangkur. Eri terkena sabetan di mata –lukanya tidak dalam karena sempat menghindar. Melihat rekannya dianiaya, Jaka keluar untuk menolong. Namun, baru keluar dari kendaraan, dia ditabrak. Jaka juga dibacok di kepalanya. Dalam keadaan terluka, dia mencabut senjata, memberikan tembakan, dan bergumul dengan empat orang. Tembakan yang dilepaskan Jaka mengenai seorang pelaku. Namun, pelaku yang terluka itu diselamatkan teman sekomplo-

tannya, kemudian melarikan diri. Warga sekitar yang mencoba menangkap pelaku malah ditodong dengan menggunakan senjata api. ’’Dari investigasi peristiwa itu, kami mendapat informasi valid bahwa target berada di Tangerang,’’ katanya. Dua tersangka sehari-hari berjualan jus di sekitar tempat tinggalnya. Istri mereka yang mengenakan cadar sering membantu dengan berjualan kue. Mereka mengontrak rumah di tempat itu sejak setahun terakhir. Secara terpisah, Musthofa Nahrawardaya, peneliti terorisme dari Indonesian Crime Analyst Forum, menyesalkan penembakan yang dilakukan anggota Densus 88 itu. ’’Dalam sebulan, sudah ada dua penembakan dengan total korban tujuh tewas tanpa ada klarifikasi detail apa kesalahan mereka sebenarnya,’’ katanya. (rdl/c4/nw)


Pontianak Post

Pontianak Post

Sabtu 31 Maret 2012


Sabtu 17 Maret 2012

gor pangsuma PONTIANAK, 24-31 maret 2012



Tekad Rebut Juara FINAL

SABTU 31 Maret 2012


gor pangSUma

Sma Santu Petrus Pontianak Vs Sma Santo Paulus Pontianak (Pi)


nOMINASI LEAGUE Tetap Optimis dengan DBL FIRST team (PUTRA) Persiapan Minim BERIKUT ini nominasi League DBL First

PONTIANAK—KomTeam Honda DBL 2012 West Kalimantanjadwal jan, perubahan petisi Honda DBL 2012 secara mendadak Smk Immanuel 1 Pontianak Vs Series untuk tim putra. Dari nominasi ini juga DANCE SMAN 10 PONTIANAK West Kalimantan Series membuat anggota tim tiSma Santu Petrus Pontianak (Pa) akan dipilih lima pemain putra dan satu sudah tinggal beberapa dak bisa berlatih dengan pelatih punya kesemPONTIANAK—Kompetisi Honda Development Bashari lagi (Sabtu, 24 Maretputra terbaik, yang maksimal. Karena dari ketball League 2012 West Kalimantan Series, akan segera 2012) . Persiapan demi sebagian patan berlatih dengan pemain danmereka pelatih tidak bergulir beberapa hari lagi. Tidak hanya panitia yang persiapan sedang dilakubisa hadir karena bersifat kelas dunia dalam DBL Camp di Surabaya, disibukkan menjelang kompetisi tahunan ini, namun kan, mulai dari panitia mendadak. juga bisa mengikuti seleksiMeskipun menjadi DBL kesibukan juga sedang tengah dijalani para peserta. Salah hingga peserta. Namun, sering jasatunya tim dance SMAN 10 Pontianak yang juga akan Indonesia All-Star, lalu dikirim bertanding persiapan terkadang rang latihan karena dilanmeramaikan Honda DBL 2012. sering terkendalan oleh hujan seringnya ke luar negeri. Siapa akanda jadi Firstdan Team? Pada kompetisi Honda Dance Banget 2012 ini, tim hal-hal yang tidak terduga, salah terjadi perubahan jadwal, tim Saksikan penobatan League DBL First dancer SMAN 10 bertekad untuk merebut tahta juara yang satunya cuaca. basket sekolah ini mengaku siap Team di Final DBL 2012 West Kalisebelumnya dipegang oleh tim dancer SMAN 1 Pontianak. Sekolah Menengah Atas San-Honda untuk berkompetisi di Honda Untuk mewujudkan target itu, tim dance sekolah ini to Fransiskus Asisi Pontianak DBLpada 2012.hari Menurut Romeo, mantan Series ini sedang mempersiapkan segalanya mulai dari beberapa marupakan salah satu sekolah persiapan tidak hanya dapat Sabtu 31 Maret 2012 bulan yang lalu. Mulai dari latihan yang intensif, hingga yang merasakan hambatan kar- dilihat dari latihan saja, namun GOR Pangsuma Pontianak. kepada teknik dan strategi baru. ena cuaca yang tidak di menentu. juga dari mental dan kesiapan “Tahun lalu tim dance kami meraih juara II hanya Cuaca yang tidak menentu ser- timnya. “Tapi, meskpun jarang kalah dari tim dancer SMAN 1 Pontianak. Namun pada ingkali membuat sekolah ini latihan, anak-anak siap untuk kompetisi pada tahun ini, tim dance kami bertekad untuk terhambat dalam menjalankan bertanding pada Honda DBL merebut juara dari SMAN 1 Pontianak,” kata pelatih tim latihan basket menjelang Honda nanti,” lanjut Romeo. G G dancer SMAN 10 Pontianak, Tasim saat ditanya mengenai DBL 2012. Kompetisi basket terbesar U U kesiapan tim dancenya. Hujan yang turun tidak tahun ini, sekolah ini ikut amA Tasim yang juga menjabat sebagai guru seni di sekolah menentu dianggap menjadi A bil bagian dengan membawa R itu menjelaskan, dia menambahkan bahkan merombak hambatan utama ketika akan R materi pemain baru. Pemilihan D unkoreografi lama dan mengganti dengan koreo yang baru. melakukan latihan. “Hambatan Dpemain muda dilakukan “Yang pastinya menggunakan pola baru,” lanjutnya. Tidak utamanya kurangnya latihan, tuk memberikan kesempatan hanya itu, dia juga memberikan tambahan jam latihan dua karena setiap mau latihan sering kepada yang muda untuk ikut jam. “Jika hari biasa hanya satu jam saja, namun menjelang Hendra turun hujan. Sehingga latihan andilAndre dalamJovian pertandingan. Tidak SMKbahkan Immanuel 1tidak Pontianak hanya SMA Santo Ignasius Singkawang kompetsi ini, saya menambah jam latihan menjadi dua sering ditunda mengandalkan pemain Pontianak, 3 ungkap April 1996 4 Januari 1995Romeo, sampai dua jam setengah setiap kali latihan,” lanjutnya. melakukan latihan,” yangSingkawang, senior. Menurut SHANDO/PONTIANAK POST HARYADI/PONTIANAK POST Sejauh ini, latihan yang diterapkan Tasim kepada tim pelatih tim basket SMA Santo meskipun bermaterikan pemain JURUS Siap memberikan kepada tim juara bertahan. OPTIMIS: SMA Petrus optimis gelar jawara DBL akan mereka raih kembali.Fransiskus Asisi Pontianak, Ro- baru, tim ini optimis bisa memdance,KHUSUS: diakui masih berjalan seperti perlawanan yang diharapkan. Tidak ada keluhan dari para anggota tim dance. Karena meo Iskandar, kemarin (15/3). berikan perlawanan kepada G menurut Tasim, pola baru yang diusung bukan untuk Menurunya, sekolah ini mela- Glawan-lawannya. Immanuel 1 Pontianak SMA Santu Petrus Pontianak membuat paraSMK anggota merasa berat, melainkan mencoba U kukan latihan basket tiga kali da- U Honda DBL 2012, sekolah meringankan, namun dengan catatan tidak menyepelekan A lam sepekan. Tiga hari ini mereka A ini menargetkan bisa kembali latihan. usahakan agar bisa maksimal, R menembus semi final, Rseperti Bagi Tasim, latihan merupakan hal yang sangat perlu karena sekolah ini tidak menam- Dpada Honda DBL 2008. Saat D itu, dilakukan menjelang kompetisi ini. Terlebih kompetisi bah waktu lagi untuk melakukan sekolah ini membawa materi ini sudah ada di ambang mata. “Jam latihan memang latihan. Tapi sayangnya, waktu pemain yang dianggap kurang ditambah, namun tidak memberatkan kepada anak-anak, tiga hari ini dianggap efek- berpengalaman dalam basHutomotidak Rio Pangesthio Erwin TAK mau kalah dengan rival mengingatkan pikiran anak-anak SEBAGAI juara bertahan Honda berusaha bagaimana agar ‘kelebihan’ malah anak-anak suka dengan pola latihan baru yang saya SMKbreak Immanuellatihan 1 Pontianak ket. Namun, SMA St. Petruskarena Pontianak mereka tif, karena harus abadinya, tim basket putra SMKperubahan agar bisa menjalankan instruksi dari DBL 2011, tim putra SMA Santu Petrus lawan diantisipasi agar tak berkembang terapkan. Selain tidak memberatkan, dan penBekasi,hujan. 1 November 1994 mempunyai Pontianak, 12 September 1995 karena sering turun semangat tanding Kristen Immanuel Pontianak, siap Serta agar Pontianak tak mau jumawa bahwa saat pertandingan hari ini. Kita lihat saja ingkatan juga bisa 1sangat dirasakan olehpelatih. para anak-anak, ” mereka lebih Pertandingan uji coba dengan dan mental yang kuat, mereka bertanding mati-matian untuk mere- siap lagi,” lanjut Andre. tahun ini menjadi milik mereka lagi. nanti!” ujar Abun, ia akrab disapa, beracerita Tasim. sekolah lain juga sering tertunda mampu mengalahkan lawanbut gelar juara Honda DBL 2012 West Kapten tim basket SMK KrisNamun mereka juga optimis bahwa hasia tentang strategi lainnya. Nur Fitriani selaku ketua tim dancer SMAN 10 Pontikarena faktor turunnya hujan. lawannya dan bisa menembus Kalimantan Series dari tangan Santu bisa ten Immanuel gelar itu akan diraih kembali, tenIa sendiri cukup optimis anak asuhnya F F anak, merasa optimis kalau timnya merebut tahta 1 Pontianak, Tidak hanya terkendala hu- Osemi final.(afi) O Petrus. Hal itu diungkapkan oleh Hutomo Rio Pangesthio juga tunya dengan perjuangan yang bisa memberikan penampilan terbaijuara dari SMAN 1 Pontianak. “Saya yakin bisa meraih juara R R pelatih tim basket Putra Immanuel semuanya menegaskan, cukup berat, mengingat kekuatan knya di babak final. “Mereka mengalami satu, karena kami telah mempersiapkan dengankalau dia berW W sehari menjelang final. “Besok sama tim lawan yang tak bisa dipandang perkembangankemajuandalampermainbenar-benar danpartai dari jauh-jauh hari. Kami jugadengan menam- pemain yang A A adalah pertandingan terakhir. Kamitelahlain siap memberikan perlawaremeh. “Secara umum saya sudah an di babak Semifinal kemarin. Sudah bisa R R bah jam latihan di laur jadwal yang ditetapkan oleh siap bermain mati-matian. Karena nan kepada tim juara bertahan. mengetahui kemampuan lawan, bermain lebih lepas, dan menerapkan apa D D sekolah, sehingga hal ini bisa lebih mematangkan gerakan akhir segala latihan yang telah “Kami akan mengeluarkan jukarena kami sudah sering bertemu. yang saya instruksikan,” ujarnya. Dan iniPONTIANAK – Komitmen saingannya tahun ini pasti akan dandari kekompakan kawan-kawan, ” kata siswa kelas XI itu. Honda Development Basketball berbeda dengan tahun lalu. Dia kami Pada lakukan selama ini adalah partai rus khusus pada pertandingan Karenanya perlu strategi khusus tentu mempermudah dalam menjalanksaat technical meeting kemarin, tim dance SMAN Reza Hadi Dwi Nuari Julius Caesar Wongso League (DBL), mencari pemain- menganggap, tahun ini pasti puncak ini,” ungkap Andre Lim. nanti,” kata Hutomo. Selain itu, untuk mengalahkan mereka, salah an pola permainan. Hal itu diiyakan oleh SMAN 3 Pontianak SMA Santu Petrus Pontianak 10 Pontianak semakin bertambah optimis bisa meraih pemain terbaik untuk bergabung banyak saingan baru yang dia Sehari menjelang final kemarin, ia dukungan suporter yang juga tidak satunya menghadapi kelebihan tim laErwin selaku Kapten Tim Petrus, bahwa ia Pontianak, 3 Juni 1995 Pontianak, 1 Juli 1994 gelar yang sangat didambakan itu. Menurut salah seorang dalam DBL Indonesia All-Star belum tahu kemampuannya. takanggota ingin membuang dengankalau kalah wan, dalam hal tembakan,” jelas Hendry dan teman-temannya siap menerapkan dance, Septiwaktu mengatakan, tim banyaknya dancenya dengan suporter sambutan hangat oleh “Dari Pontianak juga ada yang percuma. Para pemain masihpanitia digebersedikit Petrus akan menjadi motivasi sendiri Bonardi, kemarin.Karenanya, ia telah strategi khusus saat menghadapi lawanmendapat di DOKUMEN lebih optimis lagi. Karena memberikan para pemain basket Kalbar. Salah berat,” lanjutnya. dengan latihan, untuk memantapkan bagi Immanuel. “Kami juga banyak menginstruksikan kepada para pemain final hari ini. “Kami akan bermain sebaik KOREO BARU: Penampilan atraktif Dance SMAN 10 Pontianak pada DBL tahun lalu. bocoran mengenai penilaian. F sebasatunya Julius Caesar Wongso. F Daerah yang dianggap kekompakan tim. “Sengaja memang memiliki suporter yang siap menduuntuk tampil habis-habisan saat menghmungkin dan bertekad meraih kembali “Tambah optimis, karena panitia telah memberikan O O Pada tahun 2011, Julius berhasil gai saingan berat adalah, Jatim, saya suruhmengenai mereka berlatih, kungmengurangi kami,” tegas Hutomo. (afi) Deden Dikmat adapiChaidar. tim PutraKepada Immanuel bisa 1. “Kami akanjuaragelar tandasnya. (afi) Pontianak, meraih dua.juara, Tapi”untuk mewujudbocoran penilaian.untuk Panitia akan R R terpilih menjadi DBL Selection Jabar, dan kemungkinan tahun anak didiknya, dia menghimbau agar terus kan itu, kami menghimbau kepada anak-anak W W nilai jika peserta masing menggunakan koreo yang lama, dan terbang ke Australia. A ini Jakarta juga akan ikut Abersasemamgat dan berlatih dengan keras. Karena agar berlatih dengan serius. Kalau pun tidak sedangkan koreo yang kami usung tahun ini seluruhnya Kesempatan terbang dan R ing. Namun, dia tetap optimis R dengan demikian, impian itu dapat diraih. bisa meraih juara I, paling tidak tetap memkoreo baru,” tegas Septi. D bisa menjadi pemain yang D terbertanding di Asutralia ini diberi“Tahun ini kami menargetkan bisa meraih pertahankan juara pada tahun lalu,” kata Terget untuk merebut tahta juara dari SMAN 1 Pontianak kan oleh Honda DBL setiap pilih sebagai DBL Selection. juara satu, karena pada tahun lalu kami hanya Deden. (afi) mendapat dukungan penuh dari Kepala sekolah SMAN 10 tahunnya. Tahun ini, Honda LebihKelvin dariYohanes itu, dia ingin sekali Hilman Taris DBL kembali memberikan menjadi salahPetrus satuPontianak pemain yang SMAN 1 Pontianak peSMA Santu 9 April 1995 Jakarta, 19 Juli 1995 luang tersebut.Pontianak, Namun, untuk berkesempatan menjadi DBL menjadi salah satu yang berhak All-Star. mengecap kesempatan itu, tentu “Tidak hanya ke Australia, bukan hal mudah. Hal itu diakui namun saya ingin sekali ke C Amerika. Karena prestasi C oleh Julius. ini E baik “Untuk bisa terpilih menjadi E sangat membanggakan, N mendapatkan hadiah. salah satu yang terbaik sangat N bagi diri saya sendiri, keluarga, T T Syaratnya sangat mudah. Datang sulit, karena harus berhadapan E sekolah, lebih-lebih Kalimantan E rame-rame ke arena, lalu dukung tim dengan seluruh daerah di Indo- R Barat. Karena bisa mengalahkan R favoritmu dengan gaya paling kompak, nesia. Terlebih ada juga pemain kompetitor dari daerah-daerah heboh, dan disiplin! Suporter yang tampil dari timnas,” ungkap Julius ke- se Indonesia,” tegasnya. paling habis-habisan ini bakal mendapat pada Pontianak Post, kemarin Tahapan penyeleksian Andy Santoso Rivaldo Tandra Pangesthio ini SMA Santo Ignasius Singkawang SMA Santu Petrussetiap Pontianakpenye(16/3). dilakukan pada Singkawang, 16untuk April 1995 lenggaraan BEKASI, 3 APRIL 1996 DBL. SetDia menceritakan, Honda HEBOH: Suporter DBL di Semamenjadi yang terbaik sudah iap tahunnya, akan mencari rang (kanan) dan Jogja tampil menjadi keinginan semua pe- pemain-pemain serta pelatihatraktif saat mendukung timnya. Gaya paling kompak, heboh, dan main, apalagi berkesempatan pelatih terbaik dari setiap disiplinbakal diganjar award. terbang ke Australia. Oleh kar- C provinsi. Sebanyak 10 pemain C O dan ena itu, dia berkeinginan untuk O(lima putra, lima putri) gelar Honda Supporter Award dan berhak kembali terbang ke Australian A dua pelatih terbaik dariA setiap SHANDO/PONTIANAK POST HARYADI/PONTIANAK POST bawa pulang hadiah uang tunai. dengan menjadi DBL Selection. C seri akan masuk dalam CLeague H H TEKAD KUAT: Bermain bagus tanpa beban, serta mengembalikan kejayaan basMAHKOTA JUARA: SMA Santu Petrus Pontianak optimis bisa memenangSelain Honda Supporter Award, “Saya berharap bisa terpilih lagi,” DBL First Team. Selain itu, DBL suporter favorit. Pemenang bakal diumumkan di akhir KOMPETISI basket pelajar terbesar di Indonesia, ket yang dulu pernah dirangkul SMA Santu Paulus, menjadi tekaduang kuat tunai mereka. kandiberikan pertandingan ini dan tetap meraih kembali mahkota juara. hadiah juga bakal harap Julius. Indonesia juga akan mencari penyelenggaraan seri. Honda Development Basketball League (DBL) 2012, tidak Untuk mewujudkan itu, siswa pemain putra dan putri terbaik Ayo hebohkan Honda DBL 2012. Datang ke arena, dukung hanya menganugerahkan beragam hadiah untuk para pada suporter favorit pilihan pengunAndre Lim Hendry Bonardi kelas XI ini mengaku akan ber- untuk menjadi Honda Most tim kesayanganmu gaya paling seru, dan peserta basket. Datang arena dan Paulus mendukung tim kes- jung. Di arena pertandingan nanti, SMA SMAkeSantu Pontianak Santubertanding Petrusdengan Pontianak SMK Immanuel 1 Pontianak Valuable SMA Santu Petrus(afi) Pontianak setiap pengunjung akan mengisi balot latih lebih keras lagi. Karena Player. raih kesempatan bawa pulang hadiah uang tunai. (*) ayangan yang tengah bertanding pun bisa berkesempatan


Siap ‘Mati-matian’

Tak Mau Jumawa

Berusaha jadi Pemain Terbaik

Suporter Seru Dapat Award vs

Kembalikan Kejayaan ‘Wariskan’ Kemenangan Kesempatan Langka bila Menjadi DBL Indonesia All-Star Pontianak, 6 Mei 1964

Sintang, 3 Desember 1976

Ikut Camp Internasional, Belajar dan Bertanding di Amerika

PONTIANAK – Pertemuan final di Santu Petrus di final, hari ini. Mereka PONTIANAK – Keyakinan tinggi tim yang sedang dirasakannya juga Honda DBL 2012 menjadi final pertama menyadari bahwa ini bukan hal yang untuk bisa meraih kembali mahkota diharapkan bisa dirasakan oleh para bagi tim putri Santu Paulus selama lima mudah, namun dibutuhkan perjuangan juara, diungkapkan oleh tim putri penerusnya nanti. “Kami berharap tahun mengikuti ajang bergengsi ini. Per- yang ekstra keras untuk menaklukkan Santu Petrus, Syelna. “Kami optimis seandainya kami bisa mempertahjalanan yang mereka lalui hingga sampai sang juara bertahan. bisa memenangkan pertandingan ini ankan gelar Honda DBL tahun ini, SEJAK 2008,sesuatu kompetisi yangluar berhak mengecap terpilih sebagai kan lebih lanjut mengenai detil mudah-mudahan Amerika Serikat. Dan,depan kami gelar dalam DBL Indonesia Selecke final,tahun dianggap hal yang “Saya selalukesmenanamkan seman-DBL Indonesia dan tetap memegang gelar,” tegasnya. tahun basket di In- bukan empatan bukan halpara All-Star dan pergi ke Amerika DBL Camp. Yang pasti, peserta inisangat senang karena mereka tion, tim pilihan Honda DBL biasapelajar karenaterbesar perjuangannya hal itu, gattentu optimis kepada pemain bahwa Meski sudah yakin menang, namun kembali dipertahankan. Serta para donesia, HondaPenuh Development mudah. setiap penyelengSerikat,” kembali. ujar Donny Rahardian, camp akan mendapat banyak adik-adik bisa bertanding dan belajar di yang berangkat ke Malaysia yang mudah. tantangan dan kerjaPada kejayaan itu dapat dirangkul ia tak ingin membuat kesalahan kelas kami bisa memiliki Basketball League (DBL), selalu garaannya, Honda DBL akanproses events senior managerdengan PT DBL menyepelekan ilmu bertaraf internasional, ” ujar semangat negara seperti asal olahraga basket.Syelna untuk mengikuti kompetisi inkeras, namun cukup memuaskan karena Memang bukan yang instan, kemampuan kami,” harap berkomitmen mencari mencari pemain-pemain Donny. Ketika pulang, kami berharap, ternasional Malaysia Internaakhirnya tiba juga dipemainbabak puncak. tapi saya yakinserta merekaIndonesia. akan berusaha lawan, yang tentunya juga bakal berapi-api. pemain terbaik bergabung pelatih-pelatih terbaik dari setiap dari Dari seluruh peserta DBL cerita-cerita yang tional High School Basketball “Ini suatuuntuk kebanggaan bagi kami putri keras mewujudkannya, ” Pemain-pemain papar pelatih terbaik mempersiapkan diri jauh lebih Ditambahkan menarik oleh Hendry Bonardi dalam DBL Indonesia All-Star. provinsi. 10 pemain setiap Lesmana. provinsi pesertabaik. Honda Camp, para internasiomereka dapat di sanatahu bisapersis Tournament. Paulus karena bisa sampai di final. Meski Sebanyak SMA Santu Paulus, Ongky “Kekuatan putripelatih Paulus juga sebagai pelatih, pihaknya Mereka terpilih putra, lima putri) dan dengan DBL 2012 itu akan diterbangkan nal tersebutTapi kemudian akan memang menjaditentang inspirasikemampuan bagi teman- tim “Tergabung dalam DBL Alllawanyang yang harusakan kamipunya hadapi itu(lima Petrus, Hal ini dibuktikan masihnya perlu diperhitungkan. saya dan kesempatan langka mengikuti duakami pelatihmereka terbaik dari setiap latihan ke Surabaya, mengikuti DBL memilih satubisa tim putra, satu tim lawan. temannya Indonesia, ” katasebelStar dan terbang ke Amerika tapi kami tak gentar. Persiapan yang melakukan intensif kawan-kawan optimis menang,” “Kamidisudah bertemu perjalanan Pada lama, seri” akan dalam League Di campiabasketkatanya. terbesar putri, dan dua pelatih terbaik umnya Azruldan Ananda, adalah pengalaman berharga lakukan internasional. juga sudah cukup ujar masuk menjelang final hariCamp. ini. Namun sudahcommissioner tahu apa saja yang 2008 dan 2009, tim DBL DBL First Team. Selain itu, DBLtidak di mau Indonesia itu, merekaJika akan dari ratusanberhasil yang terbaik DBL. kelemahan dan kelebihan buat saya. Di sana, saya banyak Herawati, kapten timAll-Star putri Paulus. sendiri mengaku membetahun ini timnya mem-itu menjadi diajakBermain belajar dan bertanding Indonesia akananak-anak mencari asuhnya. mendapat“Meski pelatihan daripertahankan pelatih- untuk bergabung DBL lawan.Salah pemain yangmakin mendapatkan pelajaran yang bagus tanpake beban, serta juga bankan gelar, dia dandalam temanKamisatu tak gentar, justru Australia. Pada 2010kejayaan dan 2011,basket pemain daningin putrimeraih terbaik juara, pelatih kelaskami dunia. Tahun lalu, Indonesia Mereka inilah bersemangat pernah merasakan kesempabelum tentu bisa saya dapatkan mengembalikan yangputra kami namun temannya satu timAll-Star. berharap gelar untuk bisa segera mengmereka terpilih dibawa ke untuk Honda Most salah satu pelatihnyaitumeruyang akan terbang ke Amerika tan langka terpilih Amedi sini. Terutama pengetahuan dulu yang pernah dirangkul sekolah ini,menjadi tak ingin membebani anak-anak. dapat dipertahankan lagi pada hadapi pertandingan inike dan menyabet Amerika Serikat. Valuable pakan pemain legendaris dari tahun Serikat, belajaroleh dan adik-adik bertanding di kembali rika Serikat adalah Jan Misael tentang basket melalui berbamenjadi tekad kuat tim basket putri SMA Player. Biarkan mereka bermain lepas tanpa kompetisi depan gelar juara, ” beber Abun, denTahunPaulus ini, Honda DBL kem”Terpilihnya pemain sebagai sejarah Semangat negeri asalyang basket tersebut. DBL (afi) All-Star 2011 gai coaching clinic,” ungkap Jan. Santu dalam menghadapi SMA beban, ” lanjut Ongky. salah (afi) satu negara dengan kelasnya. dimiliki oleh ganPanagan, nada optimis. bali memberikan peluang terse- League DBL First Team adalah basket kuat, Australia. ”Pada 2011 lalu, kami su- asal SMAN 9 Bandung. Tahun “Tapi, pengalaman yang saya but. Untuk menjadi salah satu langkah awal mereka untuk bisa ”Kami akan mengumum- dah mengirim tim ke Seattle, sebelumnya, Jan tergabung dapat nggak melulu soal teori

c c

m m

y y

k k

basket. Pengalaman bertanding dengan tim-tim kuat di sana juga memberi ilmu yang berharga. Belum lagi pembelajaran budaya dan teman-teman baru yang saya dapatkan. Pokoknya, nggak terlupakan,” terangnya. Nantinya, tidak hanya pemain-pemain terbaik yang akan dikirim ke Amerika. Empat penonton beruntung juga bakal berkesempatan terbang ke Negeri Paman Sam. Program ini terselenggara berkat dukungan PT KAO Indonesia bersama Men’s Biore dan Laurier selaku official partners Honda DBL. (*)


Pontianak Post

Sabtu 31 Maret 2012

Calo Pol PP jadi Buronan PONTIANAK - Kasus penipuan dengan iming-iming lulus menjadi Pegawai Negeri Sipil asal membayarkan sejumlah uang kembali terungkap. Kini pelaku kabur setelah meraup uang setoran senilai Rp435 juta dari korban. Polisi sudah menetapkannya sebagai daftar pencarian orang. Kasat Reskrim Polresta Pontianak Komisaris Puji Prayitno menyebutkan pelakunya bernama Mulyadi, warga Sungai Raya Dalam. Modus operandinya menjanjikan korban segera lulus PNS untuk formasi Satuan polisi Pamong Praja di Pemerintah Provinsi Kalimantan Barat. Dalam aksinya, pelaku


meminta bantuan kepada Alusius Bobo untuk mencarikan peminat formasi yang ditawarkan. Sementara lowongan dikabarkan buat 17 orang. Hingga kemudian Bobo melaporkan Mulyadi ke Polresta Pontianak karena merasa ditipu. Menurut Kasat, modus penipuan dengan janji meluluskan PNS ini mulai berjalan sejak 2010 hingga Desember 2011. Sementara setoran yang harus dibayar korban bervariasi, antara Rp10 juta hingga Rp35 juta. Seluruh uang itu dikumpulkan Bobo, lalu disetorkan ke Mulyadi. Hingga kemudian terkumpul Rp435 juta. “Semua transaksi peny-

erahan uang korban di warung kopi di Kampung Baru Sungai Raya. Setorannya dilakukan secara bertahap,” kata Kasat. Pihak korban mulai curiga. Pasalnya, sejak 2010 hingga 2012 tak kunjung ada kabar dari Mulyadi, sehingga salah satu dari korban menagih ke Bobo. Korban meminta Bobo segera mengembalikan uang yang telah dibayarkan. Maka Bobo berinisiatif mendatangi Satpol PP Kalbar mencari tahu tentang formasi yang dikabarkan Mulyadi. Tapi pihak Pol PP menyatakan tidak ada perekrutan CPNS, apalagi harus menyiapkan uang jaminan untuk lulus. Bobo kemudian sadar

jika telah dibohongi. Maka memutuskan langsung melapor ke pihak berwajib. ”Korban terus menagih uang kepada Bobo. Tapi dia (Bobo) merasa tidak memakan uang. Hanya mengusahakan untuk mencarikan orang mendaftar CPNS, yang dijanjikan Mulyadi,” kata Kasat. Menurut Kasat, atas laporan Bobo, pihaknya melakukan pengejaran terhadap Mulyadi dikediamannya di Sungai Raya. Namun dia sudah tidak berada di rumah. ”Mulyadi kini menjadi DPO atas penipuan CPNS Pol PP. Begitu juga pelapor masih kita mintai keterangan atas kasus penipuan,” kata Kasat. (stm)


Aksi Sosial Rayakan Paskah PONTIANAK-Aksi sosial, donor darah dan perlombaan anak-anak digelar Paroki Santa Sisilia untuk menyambut Paskah 2012. Rangkaian kegiatan itu dimulai dengan kunjungan ke panti asuhan Bunda Pengharapan di Sungai Raya Kabupaten Kubu Raya dan Theresia Bakti di Km 5, Batu Layang Kota Pontianak pada 23 Maret. Kunjungan itu sekaligus untuk menyalurkan, menyerahkan bantuan umat dalam bentuk barang untuk keperluan sekolah dan bahan kebutuhan pokok serta sejumlah dana untuk pendidikan.

Pada Minggu 25 Maret dilakukan kegiatan donor darah di halaman Gereja Santa Sisilia Jalan A Yani, bekerja sama dengan UDDC PMI Kota Pontianak. Kegiatan itu mendapat sambutan antusias dari umat. Ketua Panitia Paskah Paroki Santa Sisilia Frans Zeno bersama Seksi Sosial, Yustina Eka Wibowo dan Pastor Paroki, Josephus Erwin OFM Cap menjelaskan kegiatan seperti ini sebagai wujud gerakan kemanusian dan kepedulian ke sesama manusia. “Kami sangat senang donor darah banyak pesertanya,

dan kami merencanakan kegiatan donor darah menjadi agenda tahunan. Umat juga memberikan respon positif untuk penyaluran bantuan ke panti asuhan. Kami berterima kasih kepada semua pihak yang membantu kelancaran kegiatan ini,” jelas Frans. Selain itu ada kegiatan lainnya untuk anak-anak berupa lomba mencari telur paskah, lomba makan telur, lomba menghias telur, lomba menghias tempat telur dari barang bekas . Perlombaan ini akan digelar pada hari Minggu Paskah selepas misa. Rangkaian kegiatan Pas-

kah dimulai dengan Minggu Palem, 1 April, Kamis Putih 5April, Jumat Agung 6 April, Minggu Paskah 8 April dan Paskah hari Kedua Senin 9 April. Tidak hanya itu kata Frans sebagai wujud kepedulian kepada alam dan lingkungan Panitia Paskah Paroki Santa Sisilia juga akan melakukan p enanaman p ohon di Gunung Banua Sungai Ambawang.”Jadi perayaan Paskah tahun ini bisa menjadi moment untuk semakin meningkatkan kepedulian bagi sesama ummat manusia,” tambahnya.(by)


PANTI: kunjungan ke panti asuhan bunda pengharapan Theresa Bhakti








Pontianak Post


Tiga Bulan Bolos PNS Bakal Dipecat Seluruh PNS Landak saat ini tidak bisa main-main lagi melaksanakan tugasnya. Bupati Landak Adrianus Asia Sidot berjanji akan memeriksa absensi kehadiran PNS. Tiga bulan sekali akan diumumkan tingkat kehadiran.

Selama ini kita masih banyak kekurangan hingga masih kurang. Padahal ada banyak potensi pertambangan yang masih belum tergali


Mawardi Hasibuan Kabid Pertambangan Dinas PU Sekadau


SABTU 31 Maret 2012

Kopma Harus Diaudit

Padamkan Lampu Selama Satu Jam PUNCAK kampanye hemat energi bertajuk Earth Hour di Kota Pontianak dilaksanakan hari ini. Selama satu jam pada pukul 20.30 - 21.30 masyarakat diharapkan memadamkan lampu yang tidak perlu di rumah masing-masing. Koordinator Komunikasi WWF-Indonesia Program Kalbar yang juga Koordinator Panitia Earth Hour Pontianak Syahirsyah mengatakan, • ke halaman 14 kolom 5



Spanduk yang dipasang di Tugu Digulis Untan ini menolak kebijakan pemerintah yang akan menaikkan harga bahan bakar minyak.

Gizi Buruk Belum Tuntas


Tunggu Bantuan SILAWATI, warga Desa Pasak Piang Kecamatan Sungai Ambawang Kabupaten Kubu Raya menderita tumor di bagian kening sebelah kiri selama delapan tahun. Hingga ini belum sembuh karena kekurangan biaya untuk operasi. Melalui program Dompet Simpatik Pontianak Post, kami mengajak pembaca untuk membantu Silawati yang akan menjalani operasi di Jakarta. Bantuan berupa uang, dapat diserahkan langsung ke BagianRedaksiPontianakPost (Lantai 5) pukul 08.00 – 16.00 Silawati atau ke rekening a/n. Dompet Simpatik Pontianak di Bank Kalbar dengan nomor 1025057887 atau via BNI di nomor 0202760053 atas nama Dompet Simpatik. (*) Sumbangan hingga Kamis (29/3)


Sumbangan Jumat (30/3) 1. Ahui dan Mimi 2. NN 3. Ambon 4. PT Agri Expert Jumlah

Rp150.000 Rp100.000 Rp100.000 Rp250.000 Rp600.000




Aktivitas bisnis penangkaran sarang walet sudah menjamur di Kalimantan Barat. Di Sungai Pinyuh, bangunan walet tumbuh subur hingga ke pemukiman warga. Bahkan di komplek pasar dengan cara menambah bangunan bagian atas.


Metropolis HALAMAN

Dikepung Rumah Walet, Perda Tunggu Mendagri


PONTIANAK - Terdapat sebanyak 298 kasus gizi buruk di Kalimantan Barat sepanjang 2011. Dari jumlah tersebut sebanyak 7 orang meninggal dunia. Wakil Ketua Persatuan Ahli Gizi Kalbar, Hendri Hadad menyatakan salah satu penyebab gizi buruk di wilayahnya adalah kemiskinan. ”Paling dominan ada tiga, termasuk kemiskinan sehingga ketersediaan pangan di rumah tangga kurang,” ujar Hendri, yang juga sebagai Kasi Bimbingan dan Pengendalian Perbaikan Gizi Dinas Kesehatan Kalbar ini. Penyebab lain yang dominan yakni sang ibu jarang atau tidak mau ke pos pelayanan terpadu untuk membawa anaknya, serta lingkungan yang kurang baik. Hendri berharap masyarakat miskin terpantau oleh posyandu sehingga status gizinya dapat diketahui. Jika terindikasi mengalami gizi kurang, segera dilakukan Pemberian Makanan Tambahan

(PMT) pemulihan sehingga tidak menjadi gizi buruk. Upaya lainnya, diperlukan koordinasi dari penyelenggara pemerintah lain2006 2007 2008 2009 2010 2011

nya untuk pemberdayaan ekonomi sehingga masyarakat miskin mendapatkan bantuan. ”Mereka bisa meningkatkan penghasilan dan kualitas keluarganya,” kata Hendri. : 646 kasus, 4 meninggal Selamainiadaanggapan : 722 kasus, 6 meninggal yang salah di masyarakat, : 743 kasus, 23 meninggal yakni pemenuhan gizi : 313 kasus, 13 meninggal memerlukan biaya ma: 604 kasus, 10 meninggal hal. Padahal, lanjut : 298 kasus, 7 meninggal Hendri, masyarakat bisa mendapatkan pemenuhan gizi dengan murah dari sumber pangan di rumah

Gizi Buruk di Kalbar Sumber: Dinas Kesehatan Kalbar

• ke halaman 14 kolom 2

PONTIANAK - Kemelut persoalan kegagalan Koperasi Mahasiswa (Kopma) Universitas Tanjungpura menyiapkan toga para wisudawan mendapat pandangan beragam. Namun paling diinginkan segera dilakukan audit terhadap aset Kopma karena dinilai mempunyai keterkaitan secara tidak langsung. “Menyebabkan wisuda tanpa toga merupakan persoalan tidak lazim. Semua dalih yang diungkapkan hanya sebagai bentuk pembelaan diri. Pengurus harus memiliki tanggungjawab atas kepercayaan yang sudah diberikan. Maka harus diaudit biar jelas siapa penyedia toga. Apakah pengurus menyertakan pihak ketiga atau pengurus sendiri yang menjadi penyedia,” kata Sekretaris BEM Untan periode 2007-2008 Andri Froniko, Jumat (30/3) kepada Pontianak Post. • ke halaman 14 kolom 2

Pemkot Beri Bantuan Rehab Rumah Warga PONTIANAK - Pemerintah Kota Pontianak memberikan bantuan perbaikan 266 unit rumah tak layak huni. Satu rumah mendapat bantuan Rp7,5 juta. Dalam acara Penyerahan Bantuan Stimulan Perbaikan Rumah Tidak Layak Huni Pemkot PontianakTahun Anggaran 2012, Wali Kota Pontianak Sutarmidji, kemarin (30/3), mengatakan dana bantuan tersebut murni diambil dari Anggaran Pendapatan Belanja Daerah tahun 2012.


• ke halaman 14 kolom 2

Polisi Sita 1,4 Ton Solar Ilegal PONTIANAK - Kepolisian Sektor Pontianak Timur berhasil membongkar upaya penimbunan 1,4 ton solar di Jalan Tanjung Raya II, Kamis (29/3). Pemilik diketahui berinisial Rh (52) diamankan berikut dua unit truk dan satu unit mobil tangki. Hingga kini, polisi

masih melakukan pemeriksaan secara intensif. “Pemilik kita tetapkan sebagai tersangka dan diamankan untuk menjalani pemeriksaan. Sedangkan barang bukti berupa dua unit truk miliki tangki siluman KB 9017 SA dan KB 8808 SR juga kita amank-

an.Termasuksatuunitmobiltangki KB 9527 AF yang sudah termuat sebanyak 1,4 ton solar disita untuk kepentingan penyelidikan,” kata Kasat Reskrim Polresta Pontianak Kompol Puji Prayitno, kemarin. • ke halaman 14 kolom 2

Rumah Tak Layak Kawasan Kumuh : 2009 : 247,7 Ha 2012 : 143,25 Ha Sumber: Pemkot Pontianak

Rumah Tak Layak Huni : 2010 : 3.723 unit 2011 : 2.771 unit

Pemkot memberikan bantuan Rp7,5 juta untuk 266 unit rumah



Karnaval Unik dari Mahasiswa Fakultas Teknik untuk Wisudawan

Mengusung Tema Jadoel, Hadirkan Kendaraan Antik Unik dan nyentrik, itu yang tampak di acara wisudawan Fakultas Teknik Universitas Tanjungpura. Mereka mengusung konsep ‘jadoel” lewat dekorasi panggung dan ruangan pada saat syukuran pada Selasa lalu. Kemudian dilanjutkan dengan arakarakan dengan ratusan berdandan ala orang jaman dulu pada Kamis (29/3. Kendaraan-kendaraan masa lampau membuat suasana “jadoel” itu semakin kentara. IST

ARISTONO, Pontianak

Arak-arakan mahasiswa Fakultas Teknik Untan menggunakan seragam jadul ini mengundang perhatian dari para pengguna jalan.







SEJUMLAH 62 wisudawan, baik S2 dan S1 mengikuti kegiatan tersebut. Karnaval yang dimulai pada pagi hari Kamis tersebut tentu saja memancing perhatian khalayak umum, terlebih lagi adanya isu demo dari mahasiswa tentang BBM. Namun tentu saja ini bukanlah ramai-ramai untuk mengikuti demo, tetapi kemeriahan suasana arak-arakan. Suasana karnaval ini menjadi sangat meriah karena menggunakan mobil kodok Volkswagen dari Polda, pemadam kebakaran dari Panca Bhakti, mobil baja water cannon dari Sabhara, mobil gress dari PU Kota, mobil dalmas dari Polresta, hingga scooter dari Borneo Scooter Club dan sepeda ontel dari Komunitas Ontel Siantan. Terlebih lagi juga • ke halaman 14 kolom 2



Pontianak Post

Jual Bensin Diatas HET Bisa Disanksi


Kelemahan Keuangan Pemda SEKRETARIS Utama Badan Pengawasan Keuangan dan Pembangunan RI, Suwartomo menyatakan terdapat kelemahan yang menyebabkan hasil audit keuangan pemerintah daerah belum baik. Salah satunya kelemahan pada sistem pengendalian interen. ”Sistem pengendalian interen pemda masih lemah. Kelemahan lain adalah adanya ketidaksesuaian dalam akuntansi dan pembukuan terhadap standar akuntasi yang berlaku, serta adanya ketidaktaatan terhadap peraturan perundang-undangan,” ujar Suwartomo saat serah terima jabatan Kepala Perwakilan BPKP Kalbar kepada Panijo, dari pejabat sebelumnya, Bambang Wahyudi Basuki, di Balai Petitih Kantor Gubernur Kalbar, kemarin. Suwartomo berharap mekanisme kerja dari pihak terkait dan pemerintah daerah lebih pada peningkatan kualitas, sehingga hal-hal yang berdampak pada masalah hukum bisa dicegah secara dini. Saat ini, Suwartomo menilai komitmen Pemprov Kalbar cukup tinggi dalam mewujudkan tata kelola keuangan yang baik dan bersih. ”Selama ini BPKP sendiri telah melakukan berbagai upaya dalam membantu pengelolaan keuangan yang baik,” katanya. Bambang juga meminta Kepala Perwakilan BPKP Kalbar proaktif merespon isu yang ada di pemda maupun masyarakat. Salah satunya kenaikan harga bahan bakar minyak dan pengurangan subsidi. ”Karena ini berimplikasi terhadap pengurangan kemiskinan yang menjadi program strategis,” timpalnya. (uni)


Cadangan Gas Melimpah KEPALA BP Migas R Priyono mengaku meskipun trend gas Indonesia terus mengalami peningkatan, namun BP Migas terkendala dalam penyaluran gas karena minimnya infrastruktur. “Trend gas terus naik, sangat-sangat bagus naiknya, jadi jangan khawatir apabila beralih ke gas, semua daerah pengahasil siap gunakan gas. Tapi memang ada masalah soal infrastruktur,” kata R Priyono disela sela seminar Hulu Migas, Jumat (30/3) di hotel Kempinski. Menurut Kepala BP Migas itu, kendala infrastruktur gas tersebut terutama gas yang berasal dari pulau Sumatera. “Kita belum ada terminal khusus, sehingga kapal-kapal Indonesia pembawa gas tidak bisa merapat. Kita sangat tergantung pada infrastaruktur, kalau gasnya sangat melimpah,” kata R Priyono. Rencana pemerintah mengalihkan penggunaan BBM ke BBG terutama untuk dunia transoprtasi menurut R Priyono akan merubah rona industri.”Kita siap menyuplai gas pada masyarakat, tapi pemerintah siap tidak dengan infrastarukturnya. Karena kewenangan soal infrastruktur ada pada pemerintah,” tutupnya.(fat/jpnn)

Sabtu 31 Maret 2012


TULUS, SERIUS: Anggota Polisi ini terlihat begitu tulus dan serius membantu warga yang motornya mogok. Dengan sekuat tenaga, terus mendorong angkutan sarat motor tersebut.

150 Satlantas Atur Lalulintas PONTIANAK—Mengantisipasi lonjakan massa yang melakukan unjuk rasa penolakkan BBM di wilayah konsentrasi. Jajaran satlantas Polda Kalimantan Barat turun ke lapangan demi menetralisir arus lalulintas di wilayah sekitar. Direktur Lalulintas Polda Kalbar, Komisaris Besar Lhotaria Latif mengatakan, sekitar 150 personil yang tergabung dari Polda dan Polresta telah menjaga dan mengatur lalulintas di titik yang telah ditentukan. Kegiatan ini demi menangkal penumpukkan kendaraan di wilayah rawan demonstran. “Ada beberapa jalan yang kita anggap sebagai sumber kemacetan, yaitu, Imam Bonjol dan Ayani. Begitu juga di Jalan Sutoyo, karena di sana terdapat Kantor

Pertamina,” ujarnya kepada Pontianak Post, Jumat (30/3). Dia mengatakan, sistem buka tutup jalan akan terus dilakukan, hingga kondisi dianggap kondusif dari para pengunjuk rasa. Seperti pada pengamanan lalulintas Kamis (29/3), aparat kepolisian dengan sigap menetralisir arus lalulintas yang sempat macet akan aksi pendemo. “Petugas terus melakukan pengawalan terhadap para pendemo ini. Tadi, jajaran dipusatkan di Kantor Pertamina, dan terus mengontrol arus lalulintas,” terangnya. Tidak hanya itu, anggota lalu lintas juga ditempatkan setiap jalan persimpangan di kota Pontianak serta di pintu masuk Stasiun Pengisian Bahan Bakar Umum. “Anggota sebagian ditempatkan di persimpangan

pintu masuk SPBU. Ada juga yang melakukan patroli untuk memantau jalan yang rawan dari kemacetan,”ungkap Latif. Dia berharap, agar para pengguna jalan tetap sabar dalam mengendarai kendaraannya. Jangan bertindak melawan aturan yang telah ditentukan. Seperti halnya melanggar rambu-rambu lalulintas yang ada. Terutama, memberikan simpatik akan aksi para pengunjuk rasa ini. “Kitajugaharusmerasamaklum terhadap aksi massa yang berorasi memperjuangkan hak mereka. Untuk itu, kepada para pengemudi kendaraan, mohon maaf jika perjalanannya terganggu. Kami juga akan siap mengayomi dan memberikan arahan agar arus lalulintas tidak terjadi kemacetan,” pungkasnya. (rmn)

PONTIANAK – Beberapa hari terakhir harga bensin eceran di beberapa kios naik. Ada kios yang menjual Rp 7.000 bahkan ada Rp 8.000 per liternya. Itu dimanfaatkan karena terjadi antrean panjang kendaraan di hampir semua stasiun pengisian bahan bakar umum (SPBU). Wali Kota Pontianak Sutarmidji menegaskan, tidak ada perubahan pengaturan harga eceran tertinggi untuk bensin eceran di kios. Jika ada yang melampaui HET, dia meminta polisi menindak tegas. “HET sudah kita atur. Kalau lebih dari itu termasuk spekulan, boleh ditindak polisi dengan pidana umum,” ujarnya, kemarin. Tahun lalu Sutarmidji mengeluarkan Surat Edaran Nomor SE/16/TU.UMUM tentang penetapan harga eceran tertinggi bahan bakar minyak premium di tingkat pengecer/kios di wilayah Kota Pontianak. Surat edaran itu mengisyaratkan HET di tingkat kios pengecer tidak boleh lebih dari Rp6.500 per liter. Namun harga itu bakal diturunkan lagi setelah kondisi BBM di Pontianak dan Kalbar umumnya kembali normal. Jika melanggar aturan tersebut dapat dijerat UndangUndang Nomor 8 Tahun 1999 tentang Perlindungan Konsumen. Ancaman hukuman pidana penjara maksimal lima tahun atau denda dua miliar. Sutarmidji mengapresiasi Polresta Pontianak dan Polda Kalbar yang selama ini terus mengungkap penimbunan BBM di berbagai daerah termasuk Kota Pontianak. “Saya apresiasi kepada polda dan polresta banyak di Indonesia amankan penimbunan BBM. Solar yang kita atur saja waktunya masih banyak spekulan, apalagi kalau buka 24 jam,” ungkap Sutarmidji. Anggota DPRD Kota Pontianak Herman Hofi Munawar meminta penjual bensin di kios tidak menaikan sebelum ada kepastian kenaikan harga BBM oleh Pemerintah Pusat. “Sebelum ada kepastian dari Pemerintah Pusat jangan ada yang memanfaatkan situasi menaikan harga bensin di kios,” ucapnya. Penjual bensin di kios, kata Herman Hofi, jangan berspekulasi. Jika itu dilakukan jelas melanggar aturan pemerintah dan dapat ditindak. Menurutnya, yang mesti terdepan menindak penjual bensin eceran dengan harga melebihi HET adalah Sat Pol PP. “Karena Sat Pol PP wajib mengamankan peraturan daerah termasuk surat edaran wali kota agar tetap berjalan. Jika ada pelanggaran Sat Pol PP wajib menindak,” ujarnya. (hen)

STKIP Pontianak Ajak Perguruan Tinggi se-Kalbar Berpartisipasi di Ajang Ekspedisi Khatulistiwa 2012

hingga April ini. Menurutnya, keterlibatan perguruan tinggi begitu besar dalam kegiatan nasional ini, sebab melalui kegiatan ini pula perguruan tinggi dapat merealisasikan salah satu dari Tri Dharma Perguruan tinggi yakni, pengabdian kepada masyarakat. Dimana masyarakat perbatasan perlu kita ubah mindsetnya menjadi masyarakat yang tangguh dan peduli akan pendidikannya sebagai upaya meningkatkan Indeks Pembangunan Manusianya (IPM). Mudayat juga mengungkapkan, Ekspedisi Khatulistiwa 2012 ini akan diikuti berbagai elemen bangsa dan profesi, bahkan sembilan menteri direncanakan hadir dalam perjalanan selama 3,5 bulan mendatang. Adapun menteri yang direncanakan datang, diantaranya; Menteri Kehutanan, Menteri Pertahanan, Menteri Energi dan Sumber Daya Mineral, Menteri Pembangunan Daerah Tertinggal, Menteri Dalam Negeri, Menteri Luar Negeri, Menteri Pertanian, Menteri Sosial dan Menteri Bidang Politik, Hukum, dan Keamanan.

STKIP-PGRI Pontianak sebagai perguruan tinggi pertama di Kalbar yang digandeng Komando Pasukan Khusus (Kopassus) TNI Angkatan Darat dalam penyelenggara Ekspedisi Khatulistiwa 2012 ini, mengajak perguruan Tinggi negeri maupun swsata se Kalbar untuk mengikuti ajang Nasional tersebut, Hal ini disampaikan Kepala Unit Hubungan Masyarakat STKIP-PGRI Pontianak, Mudayat MPd saat di temui Pontianak Post Rabu, (28/3) lalu diruang kerjanya. Mudayat mengungkapkan, pelaksanaan Ekspedisi Khatulistiwa ini sendiri akan dilaksanakan pada 3 April hingga 17 juli mendatang, namun jika masih ada perguruan tinggi negeri maupun swasta yang ingin mendaftar. Lembaga pendidikan tinggi STKIP-PGRI Pontianak masih membuka pendaftaran





DIKUNJUNGI KOPASSUS : Ketua STKIPPGRI Pontianak (tengah) saat dikunjungi anggota Kopassus dalam rangka kesiapan Ekspedisi Khatulistiwa 2012.

Tidakhanyaitu,menurutMudayat,beberapa perguruan tinggi dari pulau jawa juga turut berpartisipasi dalam ekspedisi ini, antara lain; Universitas Diponegoro, Universitas Indonesia, Universitas Brawijaya, Institut Teknologi Bandung serta Institut Pertanian Bogor guna melakukan penelitian seputar Geologi, Potensi Bencana Alam dan Perbatasan. Sedangkan, tim lainnya seperti SKPD maupun STKIP-PGRI Pontianak akan melakukan bhakti sosial, penghijauan tanaman serta seminar kebangsaan yang bertajub pembentukan karakter bangsa

demi peningkatan sikap bela Negara generasi penerus Bangsa. Ditambahkannya, untuk Tim Ekspedisi yang akan melakukan pendataan mengenai patok-patok perbatasan mulai dari Tanjung Datu Kalbar sampai Tanjung Harapan Kaltim. Tim ekspedisi ini telah dipersiapakan jauhjauh hari serta yang memiliki keahlian khusus, mengingat medan yang dilalui cukup berat. Selain itu, tim ini akan diperkuat dengan personil khusus dari TNI AD, AU, AL maupun Satuan Brimob Polri. (d3/ser)

Pontianak Post


halo publik

Sabtu 31 Maret 2012


Ikomei Rayakan Ceng Beng IKATAN Koko Mei Mei (Ikomei) Kalimantan Barat menggelar perayaan Ceng Beng di Alunalun Sungai Kapuas Pontianak, Minggu (25/3) sore. Pelaksanaan tradisi ritual ini dihadiri anggota Ikomei dan beberapa warga Pontianak yang datang menyaksikan. Anggota Ikomei membawa he-

wan-hewan yang akan dilepas di alam bebas seperti ikan, burung, bahkan kura-kura. Setelah berdoa bersama untuk para leluhur, ikan dan kura-kura dilepaskan ke sungai. Mereka pun melepas burung yang terbang bebas ke udara. Perayaan tersebut sengaja

dibuat untuk melestarikan tradisi etnis Tionghoa. Kegiatan tersebut mengusung tema: ‘menuju pribadi yang lebih baik tanpa melupakan budi jasa leluhur’. Mereka bersyukur pada Tuhan karena masih dikaruniai kesempatan berharga untuk melakukan perbuatan baik semasa hidup. Dan berharap se-

moga hewan yang dilepas bisa jadi lambang pengiring doa pada leluhur, saudara, dan teman-teman yang telah kembali ke sisi Tuhan. Perayaan Ceng Beng sengaja dibuat untuk mengumpulkan seluruh anggota dalam kebersamaan. Perayaan tersebut juga dijadikan media pengenalan budaya

Suwignyo Diaspal Mohon perhatian bapak walikota atau Kepala PU Kota, tolong dong di Jalan HM Suwignyo. Jalan sudah banyak kerikil, mohon untuk ditimpa aspal biar rata. Kiranya bisa ditindaklanjuti. (081345433946)

Derita BBM Naik Kalau BBM naik rakyat akan menderita. Segalanya akan naik mulai transportasi sampai sembako. Kalau begitu Pemerintah dan DPR sebagai wakil rakyat gagal mengayomi rakyatnya. Jadi harus dihukum dengan pemotongan gaji mulai dari Presiden dan Pegawainya sampai ke daerah ditambah DPRnya. Karena banyak menyedot anggaran negara. Ayo para Pejabat Eksekutif dan Legeslatif yang katanya selalu berjuang demi rakyat untuk berani bersuara agar gajinya dipotong. Rakyat kecil yang hanya punya uang recehan mampu ngumpul miliaran rupiah. (081345221989)

Harga BBM Kios Melambung Rencananya BBM akan naik bulan depan tapi harga eceran di kios-kios di Sambas sudah naik duluan. Harganya mencapai Rp 7000-8000 perliter, bagaimana kalau sudah naik mungkin akan lebih tinggi lagi. Tolong dong dinas yang bersangkutan untuk disigapi jangan hanya di SPBU saja yang dimonitori. (081352051230)

Optimis Dahlan Iskan Semangat ketulusan dan optimisme Dahlan Iskan ‘si putra petir’ patut kita contoh. Masalah bbm, listrik, air dll tak akan pernah selesai jika kita hanya mengeluh kosong. Ingat, jika ada demo, yang sering dirugikan malah rakyat kecil, pejabatnya sudah kebal dan akan tenang-tenang saja. Kita harapkan demo mahasiswa juga benar-benar terarah dan betul-betul membawa dampak positif. Dulu kita bersatu untuk mendapat kemerdekaan yang tak ternilai harganya. Tapi sekarang kita bercerai hanya karena kepentingan segelintir orang. Harusnya kita malu tak hanya kepada nenek moyang kita tapi juga kepada anak cucu kita kelak. Jangan biarkan mereka merekam sejarah kelam kita. Mari kita berbangga diri sebagai bangsa Indonesia yang majemuk namun dengan tidak mengedepankan golongan, suku, agama tertentu. Bapak Cornelis bilang, ‘orang sudah pada ke bulan, kita masih kelahi satu sama lain’. Jangan sampai kita ketinggalan zaman karena ego dan kebodohan kita. (085750623178)

pada generasi muda Tionghoa. Melalui pengenalan ini, sangat diharapkan tentunya kebudayaan yang sudah dijaga sekian lama bisa terus dilestari pada generasi berikutnya. Melyanti Theresia Ketua Ikomei.

Kecewa Layanan Soedarso Seperti inikah pelayanan yang diberikan di RS Soedarso kepada para pasien yang ingin berobat. Haruskah seorang dokter membentak-bentak pasien & menertawakannya karena surat rujukan untuk tes darah dari puskesmas tidak diterima? Lalu untuk apa dokter di puskesmas memberi surat rujukan untuk tes darah ke Soedarso tapi ditolak. Apakah para dokter tidak diajarkan untuk sopan santun? Apa gunanya jadi dokter kalau tidak melayani pasien. (085750595761)

Prihatin Taman Alun Jika benar-benar pemerintah ingin menyetop TKI pembantu rumah tangga, kenapa harus tunggu tahun 2017? Kenapa tidak sekarang, apa tunggu ada korban lagi? Jika tahun 2017 baru distop, bukankah malah memberi ruang para agen untuk makin berkeliaran. Pemerintah tidak tegas dalam hal ini, ada apa sebenarnya? (081522863799)

Buat Akta Lahir Saya setuju dengan pak H. Laswardi Firman soal akte kelahiran, sebagai pemerintah bukannya mengeluarkan peraturan yang meringankan masyarakat, malah s elalu memberatkan, apalagi masyarakat Hulu tidak begitu paham administrasi apalagi sampai Siding. Kalau memang pemerintah pro rakyat, sampai kapan pun pembuatan akta lahir tidak dipungut biaya apapun, bukannya menetapkan harga mahal, apalagi BBM mau naik kayak gini, semoga ada orang yang bisa berpikir. (081352010582)

PAD dari Hotel Wah, bagus tuh rencana membangun hotel atau perwakilan di Jakarta. Lumayan bagi pemasukan daerah, asal biaya inap di situ di bawah harga hotel pasaran. Masyarakat pasti mau daripada di luar. Selain ekonomis, membantu PAD juga. Berapa banyak warga kita yang bepergian tiap tahun ke sana, bayangkan! (085245906158)

Bilang ke Indonesia Pak Presiden, BBM jangan dinaikkan dong. Potong saja gaji seluruh pegawainya demi menghemat anggaran. Kepada Bapak Dewan, jangan setuju atas kenaikan itu. Kalau mau dipilih kembali ayo bilang kepada rakyat “ Demi rakyat saya rela gaji dipotong asal BBM tidak dinaikkan. “ Ayo bilang pada Indonesia. (085387322929)





komunikasi bisnis



Pontianak Post

Sabtu 31 Maret 2012

Sekolah Tunas Bangsa Benjolan di Mata Sembuh Dengan Sarang Semut & Gami

sebelah pojok kanan atas yang sebagai NAMA saya Jessica, umur saya 9 tahun, pioneer Sarang Semut di Indonesia, tinggal di Bali. Saya adik dari Christina ketiga, terdapat nomot seri izin resmi dan juga anak kedua dari ibu Dewi. Saya dari badan POM. Keempat, diproduksi mengenal obat Sarang Semut baru-baru dengan standar cara pembuatan obat traini dan saya sangat tertarik untuk mendisional yang baik. Kelima, tidak semua coba mengkonsumsi, karena saya pernah jenis Sarang Semut mengandung obat, dengar Sarang Semut adalah obat yang bahkan sebagian mengandung bakteri. bisa menghilangkan segala penyakit. Dapat diperoleh di TO Jamu Segar Jl. Derita yang saya alami semenjak 6 Nusa Indah III Pontianak, Apt Amelia bulan yang lalu, benjolan di mata saya (Sei Raya), Apt Antara Jl. Adisucipto, Apt tak kunjung sembuh, hingga akhirnya Bersama (Jeruju), Apt Gajah Mada Jl. Gauntuk terakhir kali saya mulai mencoba jahmada, Apt Kharias Bakti Jl. Siam, Apt untuk minum obat Sarang Semut dan Makmur II Jl. Gajahmada, Apt Mandiri I sekarang ini benjolan di mata saya sudah (depan RS. Antonius). Apt Mandiri II Jl. mulai kempes dan akan membaik. Jadi Penjara, Apt Mega Sari Farma Jl. Veteran, saya tidak malu mempunyai mata yang Apt Merdeka Timur Jl. Hos Cokroamiada benjolannya, karna semua itu sudah noto, Apt Sejahtera (Tanjung Hulu), Apt diatasi oleh Sarang Semut. Terima kasih Siantan Jaya (Siantan), Apt Sui Raya DaSarang Semut. lam, Apt Therapy Jl. Danau Sentarum. TO Sarang Semut secara empiris dan Jessica 168 (Jeruju), TO Asia Jl. Gajahmada, TO tradisional dapat digunakan untuk membantu mencegah dan mengatasi berbagai jenis kanker Batara (Sei Raya Dalam), TO Ericia (Kobar), TO Hidup dan tumor, jantung koroner dan berbagai gangguan Sehat (Flambooyan), TO Jenaka Jl. Penjara, TO Kapuas jantung, stroke, menghilangkan benjolan pada payu- (Seroja), TO Labora Jl. Husin Hamzah, TO Semi Abadi dara, gangguan ginjal dan prostate, TBC/paru-paru, Jl. Batanghari, TO Sinar Abadi I Jl. Gajahmada, TO Sinar ambeien (wasir) baru maupun lama, melancarkan dan Abadi II Jl. Gajahmada. Info produk: 082111548616 meningkatkan Air Susu Ibu (ASI). Tidak disarankan (Jakarta), 085245961665 (Pontianak).(a2/biz) mengkonsumsi Sarang Semut dalam bentuk lempengan, karena: Tidak terjamin kehigienisannya,dosis yang tidak tepat, tidak disarankan menggodok Sarang Semut berulang kali, tidak jelas jenis Sarang Semut yang dipergunakan, tidak dapat dipertanggung jawabkan siapa produsennya bila terjadi keracunan, pastikan Sarang Semut yang Anda beli adalah hasil produksi PT. Prima Solusi Medika yang memberikan jaminan keaslian dan kualitas produk terbaik. Imbauan dan tips untuk membeli produk Sarang Semut asli: Pertama, pastikan Sarang Semut kapsul yang anda beli adalah produksi PT. Prima Solusi Medika. Kedua, pastikan ada logo Pak Hendro Saputro di kotak

Teh & Kapsul 919 Bantu Obati Diabetes-Pankreas

SAYA, Jujuk (65 th), keluarga saya berketurunan kencing manis. 8 tahun lalu saya terkena kanker pankreas stadium 1, saya diberikan Teh 919 oleh seorang teman. Tidak terasa sudah 8 tahun saya minum Teh 919 tiga kali sehari. Setiap 6 bulan 1X saya check up dan

hasilnya selalu bagus, kadar gula, asam urat, kolestrol, dan darah tinggi saya normal. Diantara kawan-kawan seusia saya, saya paling sehat dan energik, sedangkan saya tidak minum vitamin atau obat lainnya. Teh 919 membantu menyembuhkan dan menyehatkan pankreas saya.

Surat ini saya buat untuk mengucapkan terima kasih saya pada penemu Teh 919. Terima kasih sudah membuat saya sehat. Selain dapat menurunkan kadar gula (kencing manis), tumbuhan yang ada di Teh 919 mengandung sangat tinggi zat flavonoid yang dapat mencegah dan mengobati kanker. Cara kerja Teh 919 adalah menyehatkan dan merangsang pankreas agar mengeluarkan hormon insulin, juga membantu tubuh dalam menyimpan energi dari makanan. Pankreas yang sehat dapat menghasilkan enzim yang diperlukan untuk pencernaan makanan. Dapatkan teh dan kapsul diabetes 919 di apotik dan toko obat serta supermarket terdekat di kota Anda. Teh dan kapsul 919 terdaftar Depkes Rl No.TR : 983 295 171 POM TR 043.340.941 POM iklan PO. produk Teh919 telah melalui uji laboratorium oleh Balai Penelitian Tanaman obat dan Aromatik di Bogor no. Adm. 196/T/ Lab/IV/II tertanggal pengujian 9 mei 2011.(d2/biz)

Asam Urat & Nyeri Sendi Menyiksa

Atasi dengan Kapsul & Teh Asam Urat 919

KOKOM, adalah pegusaha warung makan ini hanya tinggal dengan seorang pembantu. Pada suatu hari dia terbangun dengan lutut kanan membengkak. Kokom tidak bisa jalan, kakinya tidak dapat ditekuk, kalau tergoyang atau tersentuh ia bisa menjerit. Pas waktu itu, saat kakinya tersentuh ke tempat tidur, Kokom kesakitan lantas ia memanggil-manggil pembantu rumah bernama Inem, dan yang dipanggil sedang ke pasar belanja. Lalu dia berpikir kenapa dengan kakinya, dengan merangkak Kokom berusaha menuju telepon untuk meminta pertolongan pada saudara-saudaranya. Lantas Kokom dibawa ke rumah sakit terdekat, waktu diperiksa ternyata kadar asam urat darahnya mencapai 10 mg/dl. Padahal idealnya untuk wanita adalah 6 mg/dl. Ahli medis memberikan obat penurun asam urat, sehingga

Kokom harus diet ketat. Sesudah 1 minggu, ia pulang dalam keadaan belum pulih total. Dalam proses penyembuhan, Kokom berjalan dibantu oleh tongkat. Pada suatu hari, Kokom mengunjungi warung makannya dan ada Ahmad yang merupakan langganan warung Kokom, yang terkenal dengan sayur asemnya itu. Ahmad mendekati Kokom yang sedang duduk. “Bu (Kokom, Red) kena asam urat ya kakinya. Iya pak (Ahmad, Red) kok tahu,” ujar Kokom. Lantas Ahamd bilang, dulu ia juga sama terserang asam urat. Tapi, kata Ahmad, dia rajin minum Kapsul dan Teh Uric Acide asam urat 919. “Sekarang saya bisa makan bebas,” ujar Ahmad sembari mengatakan ibu Kokom pasti kebanyakkan makan belinjo yang ada di dalam

sayur asem ibu. Setelah mendengar penjelasan Ahmad, Kokom baru sadar. Dan mulai hari itu, Kokom mengkonsumsi Kapsul dan Teh Uric Acide asam urat 919, sehingga ia juga sudah terbebas dari asam urat. Untuk itu, pengindap asam urat dianjurkan untuk tetap menjaga pola makan dan minum air putih sedikitnya 10 gelas sehari. Kapsul dan Teh Uric Acide asam urat 919 telah terdaftar di POM TR 033.218.651/033.322.511 dan telah melalui uji laboratorium oleh Balai Penelitian Tanaman Obat dan Aromatik di Bogor no. Adm. 196/T/Lab/IV/II tertanggal pengujian 9 mei 2011Dapatkan Kapsul dan Teh Uric Acide asam urat 919 di apotek, toko obat, supermarket, minimarket terdekat di kota Anda.(d2/biz)

SEKOLAH Tunas Bangsa menerima siswa baru untuk program Half-International dengan biaya yang terjangkau. Siswa di Program Half-International akan mendapatkan jumlah jam yang lebih banyak dalam pelajaran bahasa Inggris, dibanding dengan sekolah-sekolah lainnya. Selain itu, siswa di Program HalfInternational akan mendapatkan 3 mata pelajaran yang diajarkan dalam full bahasa Inggris yaitu: English, Mathematics dan Science. Sekolah Tunas Bangsa menerima siswa baru untuk Program HalfInternational bagi siswa yang akan masuk kelas 1 dan siswa pindahan untuk kelas 2 SD, kelas 7 dan 8 SMP dan kelas 10 dan 11 SMA. Siswa Half-International yang memenuhi syarat akan diikutkan diujian international Cambridge. Diprogam Half-International, mengikuti ujian International adalah merupakan optional. Sekolah Tunas Bangsa adalah sekolah yang tidak berpedoman pada agama tertentu. Mayoritas kehidupan beragama siswa diungkapkan melalui doa umum di kelas Early Childhood (Toddler, Playgroup, dan TK). Sedangkan di SD, SMP dan SMA diberikan mata pelajaran agama Katolik, Protestan,

Terima Siswa Baru TA 2012-2013 untuk Program Half-International Gelombang 1: Cashback 25% untuk Pendaftar 1 Februari-31 Maret

Islam, Budha dan Hindu sesuai dengan agama yang dianut oleh siswa. Berdoa di kelas dipanjatkan setiap hari di semua kelas, dan perayaan keagamaan utama di beberapa agama dirayakan, sehingga siswa dapat mengembangkan sikap hormat dan toleransi terhadap berbagai agama. Untuk keterangan lebih lanjut, hubungi Jl. Arteri Supadio, Km.2 Kabupaten Kubu Raya-Pontianak,

SETIAP insan manusia yang sudah menikah, yang pertama direncanakan adalah mempunyai anak berapa. Tidak jarang rencana mereka yang sudah sekian lama belum dikaruniai anak, sehingga sering saling menyalahkan. Sebab, tak lengkap sebuah rumah tangga kalau tidak ada kehadiran seorang anak, karena anak adalah penerus keturunan dan harta yang tidak ternilai. Menurut panduan pemeriksaan laboratorium analisis semen yang diterbitkan oleh badan kesehatan dunia tahun 1999, bahwa volume cairan semen yang normal minimal 2 ml per ejakulasi, dan kekentalannya normal ukurannya tidak lebih dari 3 detik yang dihitung dalam detik. Dari hasil pemeriksaan dokter dan laboratorium dari suami istri, Bahrul dan Yanti, warga Sungai Raya Kabupaten Kubu Raya, ternyata sang suami mempunyai volume cairan semen di bawah normal. Berbagai macam cara yang ditempuh Bahrul, tapi sang istri yang sudah lebih 10 tahun dinikahi belum juga ada tanda-tanda hamil. Disaat Bahrul sudah mulai putus asa, tanpa sengaja di awal September 2011, Bahrul membaca brosur Kapsul Tribulus di apotek. “Kalau saya tidak mencobanya bagaimana saya bisa tahu, kalau Tribulus dapat membantu memberi keturunan,” tuturnya dalam hati. “Kini Yanti istrinya sudah hamil,” ujarnya diwarung kopi, tempat yang sepakati untuk bertemu dengan tim dari Tribulus Hc. Tribulus Hc terbuat dari tribulus Terrestris yang diambil dari varietas terbaik dari 3 varietas yaitu vari-

telpon (0561) 725555, Fax (0561) 723333, Toddler/Playgroup/TK (Lili Pulungan: 081522562580), SD Full & Half International (Ronald: 081345231179/Rahmad: 085280091185), SMP/SMA Full International (Tiur Anggreini: 082155494394), SMP/SMA Half international (Lili Djunaidi: 08152220008), Email:, Website: www.

etas tipe Afrika, yang merupakan tanaman asing dan langka yang hanya tumbuh di daerah Afrika. Tribulus Terrestris sudah diakui kehebatannya oleh badan kesehatan dunia (WHO), maka sering diresepkan untuk gangguan seksual dan yang sah mendapat keturunan, karenadapatmembantumeningkatkanvolumecairan semun dan kualitasnya. Kapsul Tribulus Hc boleh diadu dengan obat kuat laki-laki lainnya, Tribulus Hc membuat tahan lama dan selalu bergairah, mampu berulang-ulang. Sekali diminum langsung terasa, jika di minum sesuai aturan. Satu botol dapat menjaga gangguan seksual selama 3 bulan, aman dan justru baik bagi penderita darah tinggi. Kami memberikan bukti bukan janji. Kapsul Tribulus Hc terdaftar di POM. No.TR.103312931 dan sudah beredar di kota Anda. Pontianak: Apt Gajah Mada, Apt Makmur 1 dan 2, Apt Merdeka Timur, Apt Mulia, Apt Mandiri 1 dan 2, Apt Agung, Apt SR Dalam, Apt Amelia, Apt Imam Bonjol, Apt Sehat, Apt Bersama, Apt Abadi, Apt Pretty, Apt Sejahtera, Apt Utama, Apt Bintang, Apt MS Farma, Apt Siantan Jaya. Apt Anugerah, TO Batara, TO Paris, TO Murni, TO Fajar, TO S Lestari, TO Jenaka, TO Sinar Abadi 1 dan 2, TO Timur. Sambas: TO Santos. Singkawang: Apt Singkawang, Apt Merdeka, Apt Ganesa, Apt Asean dan Apt Sari Farma. Ketapang: Apt Mulia, Apt Lestari Farma. Sanggau: Apt Yoga. Mempawah: Apt Mempawah. Dicari agen untuk daerah. Informasi hubungi 081352022980.(d2/bn)

Pertama Kali Merasakan Hamil

Ambeien-Wasir Sirna WASIR atau ambeien adalah suatu penyakit yang terjadi pada anus, biasanya bengkak dan kadang disertai pendarahan. Selain rasa sakit, yang didapat dari ambeien juga memberikan rasa malu dan merasa minder. Setiap tidur dan duduk harus dalam posisi miring, buang air besar terasa sakit, karena bibir anus mendapat tekanan. Wasir yang sudah parah harus diadakan tindakan operasi pengangkatan wasir. Ramli tidak menyadari kalau ia terkena ambeien. Awalnya, ia hanya megalami pendarahan di dubur warna merah muda, yang menetes dan mengalir lewat dubur/anus. Ramli juga merasakan ada ganjalan pada anus di waktu buang air besar, yang menyebabkan ia harus mengejan yang bisa memperparah wasirnya. Anus Ramli sering digaruk karena gatal yang menyebabkan anusnya inpeksi. Hal ini dibiarkan hingga anusnya mulai keluar, dan ia mulai malu dan minder sebab kalau duduk harus dalam posisi miring. Dari pengakuan Ramli selama mengkomsumsi kapsul WM dari kulit manggis. Anusnya yang sudah mulai membesar keluar semakin hari samakin mengecil, dan rasa sakit

yang biasa dirasakan juga sudah mulai berkurang. Ramli dianjurkan mengonsumsi terus sesuai aturan dari kapsul WM isi 80 kapsul untuk mendapatkan kesembuhan total. Kini Ramli yang berdomisili di Poso Sulawesi Tengah benar-benar sudah mersakan terbebas dari ambeien. Trimakasih kapsul WM, semoga semakin banyak orang yang sembuh seperti saya. Khasiat akan kapsul WM isi 80 kapsul dari kulit manggis, bukan hanya antioksidan, namun juga untuk kanker. Kulit manggis sangat mujarab, karena bersifat antipoliferasi, dalam menghambat pertumbuhan sel kanker. Ekstrak juga bersifat apoptosis penghancur sel kanker. Kapsul WM isi 80 kapsul dari kulit manggis mampu mengatasi jenis penyakit, kanker, jantung stroke, diabetes, asam urat, hipertensi dan jenis penyakit lainnya.Kapsul WM dari kulit manggis sudah terdaftar di sp Depkes 600.13.26 2002, dan sudah beredar di kota Anda. Pontianak: Apt Bintang, Apt Mandiri 1 dan 2, Apt Agung, Apt Mulia, Apt Merdeka Timur, Apt Gajah Mada, Apt Makmur 1 dan 2, Apt Utama, Apt Matahari, Apt Sehat, Apt Abadi, Apt Imam Bonjol, Apt MS Farma, Apt Amelia, Apt SR


Dalam, Apt Pretty, Apt Sejahtera, Apt Siantan Jaya. Apt Anugerah dan Apt Bersama, TO Jenaka, TO Batara, TO Sinar Abadi 1 dan 2, TO Fajar, TO S Lestari, TO Kapuas, TO Murni dan TO Timur. Singkawang: Apt Singkawang, Apt Merdeka, Apt Ganesa, Apt Asean dan Apt Sari Farma. Ketapang: Apt Mulia, Apt Lestari Farma dan TO Sumber Sehat. Sambas: TO Santos Jl. Keramat. Mempawah: Apt Mempawah Jl. GM Taupik. Informasi lebih lanjut dan yang ingin menjadi sub distributor di daerah hubungi: 081 352 645 353.(d2/bn)

Cokelat Justru Ampuh Melangsingkan PARA pecinta cokelat tak tak perlu lagi merasa bersalah. Cokelat justru dianjurkan untuk dikonsumsi dengan tujuan menurunkan berat badan, meskipun jumlahnya tidak banyak. Sebuah studi di AS menyebutkan bahwa orang sehat yang berolahraga dan juga meng konsumsi cokelat secara teratur cenderung memiliki indeks massa tubuh lebih rendah daripada mereka yang jarang ma-

kan coklat. Dari survei terhadap 1.000 orang dewasa, seperti yang dimuat dalam Archives of Internal Medicine, muncul fakta bahwa cokelat kemasan meyehatkan jantung, meskipun tinggi akan kalori dan gula. Orang-orang dalam studi, yang usianya berkisar 20-85 tahun, dilaporkan mengonsumsi cokelat rata-rata dua kali seminggu dan berolahraga rata-rata 3,6 kali sem-

inggu. Mereka yang mengatakan sering makan cokelat memiliki rasio indeks massa tubuh yang lebih rendah. “Orang dewasa yang sering mengonsumsi cokelat memiliki indeks massa tubuh yang lebih rendah daripada mereka yang jarang makan cokelat,” kata sebuah studi yang dipimpin oleh Beatrice Golomb dan rekan-rekannya di Universitas California San Diego. (*/mi)

Pontianak Post

komunikasi bisnis

Sabtu 31 Maret 2012



Malam Ini Motor Tangguh Segala Medan Mio Jet Resmi Hadir di Ketapang Kawasaki KLX 150S

KAWASAKI KLX 150S adalah motor trail 4 Tak berkapasitas 150cc pertama di Indonesia, dan sangat cocok untuk semua lapisan masyarakat Indonesia. Motor ini didesain untuk dapat melintasi medan aspal maupun tanah. Dilengkapi dengan performa mesin handal membuat KLX 150S mampu melintasi segala medan, dengan desain body yang aerodinamis memudahkan KLX 150S untuk melakukan maneuver. Dengan konsep Aggressive Styling membuat Kawasaki KLX 150S tampil beda. Tidak berlebihan jika KLX 150S menjadi tren baru sepeda motor masa kini. Sistem suspensi modern dan sasis dari baja perimeter yang punya daya tahan tinggi sangat menentukan keandalan di medan off road, yang terkadang harus ditempuh dengan jumping demi mengejar waktu. Dukungan suspensi belakang yang menerap-

kan sistem uni-trak plus monoshock yang memiliki 5 tingkat penyetelan sangat mendukung, karena menjamin kenyamanan, keamanan dan kestabilan saat melintasi trek ekstrem. Stang lebar dengan sudut 43 derajat membuat mekanisme memutar ringan untuk bergerak cepat di daerah bahaya, karena pengendaranya leluasa mengendalikan Kawasaki KLX 150S di kondisi jalan raya dan off road. Tanpa persiapan khusus, Kawasaki KLX 150S terbukti bisa digunakan untuk keperluan sehari-hari. Basis mesin Single 4 tak, 150cc Tangguh dan Ekonomis / irit, karena dibekali oleh Karburator KEIHIN NCV24. Dengan konfigurasi mesin tegak maka didapat daya maksimum=8,60KW/8000 rpm dan torsi Maksimum = 12Nm/6500 rpm. Dengan dibekali tekhnologi

KSAI (Kawasaki High Secondary Air Injection System) membuat KLX 150S Ramah lingkungan dari sisi emisi gas buang sesuai dengan standar EURO 2, serta membuat pembakaran gas Ekonomis/irit. Untuk kenyamanan berkendara, KLX 150S menggunakan Shockbreker depan Telescopic dengan tabung fork yang berdiameter 33 mm memberikan kenyamanan berkendara disegala kondisi jalan. Sedangkan Shockbreker belakang mengadopsi Unitrak single shock dengan 5 tingkat penyetelan/setting kekerasan yang akan memberikan kenyamanan berkendara disegala medan/kondisi jalan, serta dapat disesuaikan dengan bobpt pengendara. Sedangkan untuk sistem pengereman, KLX 150 menggunakan desain Brake yang kuat dan kokoh sehingga performa pengereman yang stabil dan sangat cocok untuk motor trail. KLX 150 juga dilengkapi dengan Head lamp (lampu depan) dengan desain Diamond Crystal Lamp, sehingga pencahayaan lebih terang dan berpenampilan Sporty. Disamping itu, dilengkapi juga dengan speedometer Stylish dan Compack mengikuti gaya panel instrument yang lebih Gaya dan mudah dibaca pada siang atau malam hari. Informasi mengenai produk Kawasaki KLX 150, dapat langsung menghubungi dealer resmi Kawasaki terdekat diseluruh kabupaten di Kalimantan Barat.(d6/biz)

di lokasi start touring, yaitu Showroom Multi Motor Yamaha Ketapang. Bertolak dari posisi start, peserta touring melewati rute Jl Gt Subroto, Jl Transito, Jl Gajahmada, Jl Sisingamangaraja, Jl WR Suprapto, Jl Kayong, Jl Tuan-Tuan, Jl Bintang Musir, Jl KH Tapa, Jl MT Haryono, Jl Merdeka, Jl Suharso, Jl Sudirman, Jl S Parman, Jl DI Panjaitan, dan Jl WR Suprapto. Peserta touring finish di halaman Hotel Aston Ketapang. Pada pukul 10.40 – 13.00, Yamaha memberikan kesempatan bagi warga untuk mencoba motor Yamaha Mio Jet dalam test drive. Kegiatan ini diselingi kuis, serta pembuktian bersama-sama keiritan Mio Jet. Pembuktian itu dilakukan dengan mencopot tangki bensin Mio Jet dan motor kompetitor yang telah dibawa touring uji irit. Pada pukul 19.30, acara puncak baru dimulai di Lapangan Sepakat. Kegiatan diawali pemutaran video My Way dan It’s Magic, dilanjutkan persembahan empat lagu oleh band lokal. Setelahnya pihak Polres Ketapang memberikan pemaparan safety riding dan persembahan lagu dari band lokal lagi. Sekitar pukul 20.20, MC Beben dan Ria, menyapa pengunjung dan memberikan info seputar produk terbaru Yamaha, yaitu Mio Jet. Setelahnya, ada penampilan Mandala Modern Dancer dan games seputar pengetahuan Yamaha Mio Jet. Mandala Dancer pun tampil saat Yamaha Mio Jet hadir resmi di atas panggung, sekitar pukul 21.03. Dancer merobek box kertas yang menutupi Mio Jet dan Boyband Ibukota Hitz telah ada di atas motor, diringi suara sirine, phuro, dan converty. Hitz menghibur pengunjung sekitar pukul 40 menit hingga penutupan. Selama kegiatan Yamaha pun memberikan kondisi khusus, subsidi Rp500 ribu dan diskon angsuran Rp20 ribu/bulan untuk kredit pembelian Mio Jet dan Mio Fino, serta hadiah langsung jaket dan sarung tangan Mio Suka-Suka untuk pembelian tunai. (d1/biz)

MALAM ini, 31 Maret 2012, Yamaha Mio Jet hadir secara resmi di Kabupaten Ketapang dalam launching di Lapangan Sepakat. Launching digelar dalam panggung hiburan rakyat yang diperuntukan secara gratis untuk seluruh masyarakat Ketapang. Rangkaian acara launching ini sendiri telah dimulai sejak pagi hari. Pada pukul 10.30, Yamaha mulai menggelar touring adu irit konsumsi BBM Mio Jet dengan motor matic kompetitor. Satu jam sebelumnya para peserta telah diminta berkumpul

Pusat Pengobatan Penyakit Kronis

Tim Balap TVS Unjuk Gigi

Sinshe TCM Manjur, Satu-satunya di Pontianak HONGKONG Medistra TCM yang beralamat di Jl. Agus Salim No. 126, Pontianak, merupakan satu-satunya pusat pengobatan berbagai penyakit kronis dengan metode eksklusif TCM (Traditional Chinese Medicine), menerapkan resep rahasia turun temurun yang sudah memiliki sejarah 2.000 tahun lebih. Resep kuno kekaisaran, resep pengobatan modern, sangat efektif mengatasi berbagai penyakit kronis. Konsultan sinshe ahli TCM ternama yang sudah memiliki banyak pengalaman hadir di Hongkong Medistra TCM Pontianak, membantu Anda mengobati berbagai penyakit yang sudah lama diobati tetapi belum sembuh juga, bisa diatasi hingga keakar-akarnya, antara lain: Pertama, penyakit kanker/ tumor; kanker paru-paru, kanker liver, kanker getah bening, kanker usus, kanker payudara, kanker leher rahim, kanker saluran pencernaan dan kanker lainnya. Kedua, rematik/nyeri sendi: radang dan pembengkakan sendi, sakit pinggang, radang bahu, sakit ruas tulang leher dan sakit nyeri lainnya. Ketiga, diabetes (kencing manis), hipertensi, stroke, lumpuh setengah badan, bronchitis, asma,radang hidung & tenggorokan, telinga mendengung, pendengaran kurang, penyakit mata, radang ginjal, batu ginjal, wasir/ ambeiyen, epilepsy

Motoprix Seri 1 Region 4 Kalimantan & Kejurda Gubernur Cup

(ayan), penyakit usus & lambung, kulit. Keempat, penyakit reproduksi pria & wanita (herpes, sipilis, gonorrhea), kemandulan, gangguan fungsi seksual pria (impotensi, ejakulasi dini, fungsi seksual menurun, sperma mati, tidak bersperma). Radang prostat yang berakibat sering kencing, kencing terburu-buru, kesulitan kencing, kencing tidak tuntas. Kelima, hepatitis (peradangan tipe A, B, C). Keenam, penyakit kewanitaan; radang organ reproduksi, pembesaran kelenjar susu, radang leher rahim, haid tidak lancar, haid terasa sakit. Ketujuh, migrain, pening/pusing, sakit kepala, dan lainnya. Hongkong Medistra TCM menggunakan obat herbal TCM Tiongkok eksklusif, sekitar 60-an jenis metode/resep pengobatan khusus yang sangat efektif mengatasi ber-

bagai penyakit kronis, tidak peduli kondisi penyakit parah/ringan, usia penderita tua/muda, riwayat penyakit panjang/pendek, rata-rata setelah diobati 2-7 hari, berbagai gejala penyakit akan berangsur menghilang, setelah diatasi tidak mudah kambuh. Dengan menggabungkan obat herbal TCM mujarab, akupuntur, tuina dan lainnya sebagian pasien penyakitnya semakin lama makin cepat membaik. Hari itu konsumsi obat hari itu juga terasa khasiatnya, rata-rata setelah 2-3 tahap pengobatan bisa diatasi. Hongkong Medistra TCM mengadakan promosi khusus untuk masyarakat, yaitu diskon khusus untuk obat herbal 30%. Untuk konsultasi dan pengobatan, hubungi: Hongkong Medistra TCM Jl. Agus Salim No. 126, Pontianak, telpon (0561) 733268, 0821 52797 888, (Hari Minggu & libur tetap buka).(a2/biz)

Kisah Nyata Lenny Deswila

Tumor di Payudara Sembuh Tanpa Operasi Lewat Shinse Husein AWAL Maret 2003, Lenny Deswita (32 tahun) memeriksakan benjolan di payudara kanannya ke sebuh rumah sakil cukup terkenal di Semarang Jawa Tengah. Dokter ahli yang menangani memastikan benjolan 7x6x7 cm itu adalah, tumor dan harus segera dioperasi. Dua minggu kemudian benjolan tersebut diangkat. Namun, setelah itu timbul masalah baru. Karena rasa sakitnya rak reda juga, pertengahan April 2003 saya periksakan lagi ke rumah sakit semula. Saat itulah diketahui, ternyata tumbuh benjolan-benjolan baru, tidak saja di payudara, tapi sudah menjalar ke payudara kiri. Jumlahnya banyak, sehingga dokter tak bisa menghitung. Salah satu ukuran terbesarnya 15 mm x 6.5 mm x 155 mm. “Saat itulah saya benar-benar membayangkan kematian, apalagi ketika dokter bilang sulit dioperasi, karena jumlahnya banyak kecuali kedua payudara saya dipotong semua. Itu pun tak menjamin kesembuhan, lantaran dikuatirkan sudah menjalar kebagian lain di dalam tubuh,” kata ibu satu anak, warga Jl. Hayamwuruk 61 Purwodadi Jateng. Sembuh Lewat Shinse Husen Bagai air penyejuk di tengah dahaga. Seminggu setelah mengonsumsi obat sobuckthom langsung ada perubahan. Rasa sakitnya berkurang pikiran mulai tenang, bisa tidur dan bisa makan. “Sebulan kemudian, tepatnya Mei 2003 saya periksakan ke rumah

sakit jumlah benjolannya berkurang banyak. Sejak itulah saya makin yakin obat Shinse Husein ini, dan saya lanjutkan mengonsumsi obatnya tanpa mencampur obat-obat lain,” katanya. Terakhir 16 September 2003, Lenny Deswila, kontrol lagi. Saat itulah dokter yang memeriksa menyatakan, kekagumannya atas kondisi kesehatannya. “Alhamdulillah, saya bersyukur kepada Allah yang telah menyembuhkan saya lewat pengobatan Pak Husein,” kata istri pengusaha perbengkelan sepeda motor cukup terkenal di Purwodadi, Joko Edi

Prastowo ini bahagia. Alamat praktik Shinse Husein: Perumahan Muara Karang blok B-4 Barat, No.45 Jakarta Utara, telp (021) 6678649. Konsultasi gratis hubungi: 0816903378 dan obat bisa didapat di Sinar Mutiara Jl. Gajahmada (seberang pemadam kebakaran Budi Pekerti), telp (0561) 738566-7061088 Pontianak. Penyalur: TO Mulia Jl. A Yani, Sanggau Kapuas. TO Tiara Jl. Jend. Sudirman, Sintang. TO Swallow Jl. Koper Makmur, Singkawang. TO Aman Jl. Mohamad Hambal Pemangkat, Singkawang. TO Ceria Jl. Pasar Baru, Sei Pinyuh. TO Duri Jl. Raya, Sei Duri. TO Tulus Budi Jl. A Yani Ketapang, TO Sinar Abadi Jaya Jl. Gajahmada, Pontianak. Ijin praktik Depkes No. 1.3.01,3175.091.(e3/biz)

TIM balap TVS Motor di Kalimantan Barat dan Kalimantan Selatan berhasil unjuk gigi dalam dua kejuaraan balap berbeda pada hari yang sama. TVS Fast Racing Team KalBar bentukan Regional Distributor TVS Motor wilayah Kalbar, PT Gemilang Surya Motorindo, tampil dalam Motoprix Seri 1 Region 4 di Sirkuit Taman Pasir Panjang Indah Singkawang, 24-25 Maret 2012. TVS Fast RT mampu memberikan pertarungan sengit pada tim lain dalam kelas MP 5, MP 6, dan kelas bebek s/d 150 cc STD Open. Pada kelas MP 5 Bebek 4 Tak Tune Up 125 cc, Zaky Fuady berhasil bercokol di posisi 5. Pada kelas MP 6 Bebek 4 Tak Tune Up 110 cc, pembalap TVS Fast RT berhasil meraih dua posisi. Lian Herdiana (Teten) pada posisi ke-3 dan Jhontra William pada posisi ke-4. Sementara pada kelas Bebek s/d 150 cc STD Open, Uray Anan salah satu pembalap TVS Fast RT berhasil meraih posisi ke-2 (runner up) dan Edi Dihardi meraih posisi ke-3.


JUARA: TVS Fast RT Kalbar berhasil membuktikan diri.

Mereka meraih posisi tersebut mengunakan TVS Tormax. Ini membuktikan ketangguhan dan speed TVS Tormax patut diperhitungkan di ajang balap. Pasarnya, Uray Anan sudah menjuarai kelas ini 3x di even kejurda, 1x di even kejurnas, dan 1x di even club pada 2011. Pada awal even ini, TVS Fast RT melakukan riset ulang pada semua motor balapnya, supaya bisa bersaing di tingkat nasional. Singkatnya waktu persiapan membuat TVS Fast RT belum dapat meraih prestasi tertinggi. “Tapi untuk even selanjutnya, kami yakin dan siap merebut posisi tertinggi,” ujar Asep, Mekanik Balap TVS Fast Racing Team. Sementara itu, TVS BBM Racing Team, tim balap bentukan Regional Distributor TVS Motor

untuk wilayah Kalimantan Selatan, PT Budi Bersaudara Makmur, yang turun dalam Kejurda Gubernur Cup di Sirkuit Mardjani Banjarmasin di beberapa kelas meraih posisi lima besar. Pada kelas MP2 Bebek 110 cc Tune Up Seeded, Rahul bercokol di posisi ke-5. Pada kelas MP4 Bebek 110 cc Tune Up Pemula, Enjin bercokol di posisi ke-4. Sementara itu meski pertama kali turun di Kelas Bebek s/d 150 cc Open, Rahul yang start di nomor 35 mampu bercokol di posisi ke-5. “Balap pertama kali ini, mesin TVS Tormax 150 sebenarnya tidak banyak dimodifikasi. Karena parts Tormax banyak menggunakan komponen aslinya,” pungkas Adul, mekanik TVS BBM Racing Team. (d1/biz)

HUT ke-3 GBI EL Shaddai Meriah Ajak Jemaat Berjalan Sesuai Tuntunan Allah PERINGATAN Hari Ulang Tahun ke-3 Gereja Bethel Indonesia EL Shaddai Pontianak berlangsung meriah dan semarak, yang dilaksanakan pada Selasa (27/3) malam lalu. Ratusan jemaat dari berbagai sektor se-Kota Pontianak dan sekitarnya tampak bersukacita menyambut tahun penuaian bagi orang yang percaya atas kebenaran Tuhan Yesus Kristus. Bahkan sebelum dilaksanakan acara puncak HUT ke-3 GBI EL Shaddai tersebut, ratusan jemaat bersama para anggota keluarganya mendapatkan hidangan makan malam bersama para penggurus gereja berserta Gembala Sidang GBI El Shaddai Pendeta Yehezkiel Wilan dan istri Pendeta Sandra Wilan, baru dilanjutkan ibadah malam bersama dan diakhiri dengan penyerahaan hadiah kepada para pemenang lomba. Dalam khotbahnya, Pdt Wilan yang diwakili Ketua Panitia HUT GBI El Shaddai Jakaria Roni berpesan, agar para jemaat GBI untuk lebih mendekatakan diri kepada suara Bapa yang ada di sorga. Sebab, Yesus memerintahkan kita semua untuk melakukan apa yang dingginkan Allah serta menuruti perintahNya dalam kehidupan sehari-hari. Menurut Jakaria, sesuai missi GBI El Shaddai ditahun ini, kami berkomitmen menjadikan 2012 sebagai tahun penuaian bagi jemaat gereja di seluruh dunia, khususnya di Pontianak kami menargetkan ada 1.000 orang akan dilawati Tuhan Yesus Kritus dan menjadi jemaat yang setia akan perintah Tuhan, dan mampu menjadi garam dan terang dunia. Jakaria juga mengungkapkan, misi ini begitu besar, namun kami percaya tidak ada yang mustahil dihadapaNya. Sebab Allah melakukan penyertaan atas pekerjaan besar yang dilakukan para jemaatnya. Bahkan untuk menyukseskan misi tersebut. Dikatakan Jakaria, pihak

Pdt Yehezkiel Wilan dan Sandra Wilan

GBI EL Shaddai turut mengandeng media cetak dan televisi sebagai patner dalam berbagai pelayanan Gereja sekarang hingga kedepanya. Terkait HUT GBI EL Shaddai ke-3 ini, Jakaria menambahkan, pihak gereja sepanjang tahun 2012 ini turut melakukan bakti sosial dengan membagikan 1000 kotak makanan pada masyarakat kurang mampu di Kota Pontianak setiap Sabtu-Senin. Dan untuk sembako GBI EL Shaddai turut membagikan 150 sembako di rumah yatim piatu, rumah singgah dan lapas anak di kota Singkawang. Jakarius juga turut mengundang masyarakat yang ada di Kota Pontianak dan sekitarnya untuk mengikuti ibadah setiap Minggunya. Untuk Ibadah Raya I dilaksanakan pukul 07.30 WIB, Ibadah II pukul 10.00 WIB dan Ibadah III pukul 18.00 WIB yang dipusatkan di GBI El Shaddai Jl. Prof M Yamin No 1 Kota Baru-Pontianak. Sedangkan untuk ibadah raya di sektor Sungai Raya dilaksanakan pukul 17.00 WIB bertempat di Hotel Harmony Jalan Sungai Raya Dalam Kabupaten Kubu Raya. (d3/ser)

aneka pontianak


Pontianak Post

Sabtu 31 Maret 2012

Pemkot Beri Bantuan Rehab Rumah Warga Sambungan dari halaman 9

“Sampai tahun ini ada 2.771 rumah tak layak huni yang belum mendapat bantuan. Tapi yang dapat kita realisasikan untuk dibantu 266 rumah saja,” ungkap dia. Sutarmidji mengatakan, Pemkot Pontianak masih mengusahakan bantuan dari Kementian Perumahan Rakyat untuk membantu

perbaikan 1.000 unit rumah tak layak huni. “Kalau ini tembus. Berarti tahun depan tugas Pemkot sudah selesai. Semua rumah sudah layak,” ujar Midji. Berdasarkan pendataan Pemkot di 29 kelurahan, pada akhir tahun 2010 ada 3.723 unit rumah tak layak huni. Namun pada tahun 2011 sudah 952 unit yang ditangani. Sementara selama tahun

2009 sampai 2011 sudah ada 2090 unit rumah yang ditingkatkan kualitasnya melalui program Kemenpera, APBD Kota Pontianak, PNPM Mandiri dan Bansos Kemensos. Data lain menyebutkan kawasan kumuh Kota Pontianak yang pada tahun 2009 mencapai 247,7 hektar pada tahun ini tinggal 143,25 Ha saja. Kepada ratusan warga penerima bantuan yang hadir

Mengusung Tema Jadoel, Hadirkan Kendaraan... Sambungan dari halaman 9

disertai dengan iringan marching band dari anakanak SD Negeri 03 Pontianak. “Karnaval yang dilakukan Fakultas Teknik ini dari sejak dulu memang sudah menjadi tradisi setiap kali acara wisudawan,” ungkap Hervian Handika Sugasta, salah seorang panitia kepada Pontianak Post. Fakultas Teknik menjadi yang paling kreatif karena acara ini pula menjadi satu-satunya arak-arakan di Universitas Tanjungpura. Acara ini juga mencerminkan penghormatan dan kebanggaan kepada para senior yang telah menjadi sarjana. Memang, setiap tahun acara ini selalu diamanahkan pada setiap angkatan secara

bergantian. P”ada acara wisuda kali ini yang menjadi panitianya adalah para mahasiswa dari angkatan 2010 atau yang juga disebut Angaradasa,” jelas Hervian selaku ketua panitia. Walaupun mengusung konsep jadoel, dengan tampilan mobil VW, scooter dan sepeda ontel, tetapi tema yang mereka usung justru sangat menunjukkan visi masa depan, yaitu Ciptakan Wisudawan/Wisudawati Fakultas Teknik Universitas Tanjungpura Berorientasi Internasional dalam Menghadapi Era Globaliasi untuk Indonesia yang Gemilang. Seperti yang juga disampaikan oleh Dekan Fakultas Teknik, Junaidi, harapan civitas akademika Fakultas Teknik adalah selalu mengharapkan

agar para wisudawan nantinya bisa berkiprah di masyarakat. “Mereka harus siap menghadapi era globalisasi saat ini dan seyogyanya memang memiliki orientasi internasional. Hal ini menjadi penting karena Indonesia akan mencapai masa kegemilangannya dengan kaum muda yang memiliki karakteristik seperti itu,” papar dia. Sementara itu, Pembantu Dekan III Ferry Hadary, yang mendampingi acara ini juga turut bangga dan terharu atas kerja keras mahasiswa untuk para seniornya yang menjadi wisudawan kali ini. Ferry kemudian menambahkan, kegiatan-kegiatan seperti inilah yang membuat persaudaraan dan rasa kebersamaan semakin kental di civitas akademika Fakultas Teknik. (*)

Gizi Buruk Belum Tuntas Sambungan dari halaman 9

atau lingkugannya. Misalnya, dari sayuran yang ditanam di rumah, ikan dari sungai, dan sebagainya. ”Tidak perlu mahal seperti susu. Jika lauknya cukup, sudah bisa memenuhi kebutuhan gizi,” ujarnya. Hendri menyebutkan berdasarkan data yang ada, kasus gizi buruk di Kalbar mengalami penurunan. Pada 2006 terdapat sebanyak 646 kasus dan 4 orang meninggal, 2007 sebanyak 722 kasus dengan

6 orang meninggal, 2008 sebanyak 743 kasus dengan 23 meninggal, 2009 sebanyak 313 kasus dengan 13 meninggal, 2010 sebanyak 604 kasus dengan 10 orang meninggal, dan 2011 sebanyak 298 kasus dengan 7 meninggal. Sepanjang 2011, Ketapang menjadi kabupaten paling banyak gizi buruk yakni 46 kasus dengan satu orang meninggal dunia. Diikuti Kota Pontianak sebanyak 42 kasus dan 1 orang meninggal dunia, Sanggau 28 kasus dan 1 meninggal, serta Landak 26 kasus

dan 1 meninggal dunia. Bengkayang menjadi daerah yang bebas kasus gizi buruk. ”Semua kasus gizi buruk mendapat perawatan. Sekarang tinggal perawatan saja, ada 216 kasus,” kata Hendri. Ia menambahkan saat ini di semua kabupaten terdapat pusat perawatan gizi buruk di puskesmas dengan tenaga terlatih. ”Kalau memang daerah tertentu membutuhkan dan penyuluhan, ada dana Bantuan Operasional Kesehatan,” timpalnya. (uni)

Kopma Harus Diaudit Sambungan dari halaman 9

Menurut Andri seyogya begitu disayangkan kegagalan Kopma Untan dalam soal mengurus toga wisuda. Padahal beberapa tahun sebelumnya tidak pernah terjadi masalah. Dan unit usaha Kopma memang harus mampu berjalan dinamis guna meningkatkan nilai sisa hasil usaha. Kendati demikian Andre turut mempertanyakan soal pembagian mekanisme SHU. Meski dirinya hingga kini masih tercatat sebagai anggota Kopma. Sebab banyak unit usaha Kopma sekarang selain mengurus toga. Antara lain Kantin Digulis dan beberapa outlet usaha yang disewakan. “Bagaimana bentuk kontrak pengelolaan kantin. Apakah keuntungan betul mengalir kepada seluruh anggota, tentu ini perlu audit. Bukan berarti tidak percaya dengan pengurus Kopma. Hanya tidak ingin Kopma dijadikan tameng segelintir oknum untuk mengeruk keuntungan kelompok atau pribadi,” kata mahasiswa asal Kabupaten Bengkayang, ini. Dia menambahkan kega-

galan dalam mengurus toga hendaknya dapat menjadi evaluasi jajaran pengurus. Sekaligus bisa menjelaskan secara rinci mengenai sistim pengelolaan toga. Terutama untuk beberapa tahun terakhir. Bukan justru melemparkan kesalahan kepada tukang jahit. “Meski hanya simbolis, makna toga begitu penting. Yang dipakai ketika hari wisuda. Dan tak jarang keluarga ikut hadir. Apalagi jika datang jauh dari kampung. Pasti kecewa bila mendapati anggota keluarga wisuda tanpa toga, meski sudah bolak balik Kopma hingga dinihari,” kata Andri. Secara terpisah salah satu alumni Untan Muda Mahendrawan yang sekarang menjabat Bupati Kubu Raya, ketika diminta tanggapannya, mengajak semua pihak dapat memandang jernih permasalahan yang dihadapi Kopma. Karena ketiadaan toga tidak mengurangi esensi kesarjanaan seseorang. Namun paling penting yakni lulusan perguruan tinggi mampu mengotimalkan pengabdian terhadap negeri tercinta. “Saya bukan berarti ingin mencampuri permasalahan

Kopma. Hanya pandangan sebagai alumni. Tapi saya yakin Kopma pasti mempunyai itikad baik ketika ingin menyiapkan toga bagi para wisudawan. Kita juga harus melihat kendala yang dihadapi Kopma,” kata Muda. Ia pun dapat memahami kekecewaan para wisudawan yang kebetulan tidak mendapatkan toga. Tetapi diminta tidak larut dengan kekecewaan, tapi mesti sebaliknya. Dapat membaktikan diri dengan segala kemampuan yang dimiliki, untuk membangun daerah. Pantauan Pontianak Post, Jumat (30/3) kemarin beberapa wisudawan menyerahkan kuitansi bukti pembayaran toga di Kopma. Mereka ingin meminta kembali uang yang telah dibayarkan. Karena merasa sudah tidak berguna jika tetap ditukar dengan toga. “Katanya Senin, pengurus bilang masih diinventarisir,” kata salah seorang alumni yang mengembalikan kuitansi. Semula pengurus Kopma berencana menggelar konferensi pers pada Jumat petang. Ingin meluruskan duduk persoalan kisruh toga. Namun batal terlaksana. Alasannya karena masih belum bertemu dengan Rektor. (stm)

Polisi Sita 1,4 Ton Solar Ilegal Sambungan dari halaman 9

Modus dilakukan pelaku terbilang rapi. Dua unit truk menggunakan tangki siluman mengantre solar di stasiun pengisian bahan bakar umum. Kedua truk dilengkapi dua buah drum terletak di dalam bak truk. Kemudian BBM bersubsidi yang diperoleh dipindah dengan diisikan ke dalam mobil tangki. Sedikitnya 1,4 ton solar yang akan diselundupkan telah berhasil mereka kumpulkan. “Hasil penyelidikan sementara, setelah solar berhasil terkumpul rencananya akan dibawa ke luar daerah untuk dijual kembali,” kata Puji. Upaya penyelundupan BBM bersubsidi jenis solar ini terbongkar atas informasi masyarakat. Mensinyalir adanya kegiatan ilegal di sekitar lingkungan mereka. Karena lokasi penangkapan berada di daerah permukiman warga. Kemudian informasi ditindak lanjuti aparat dengan menyatroni lokasi kejadian. Sekitar pukul 22.40,

kegiatan ilegal ini akhirnya terbongkar. “Pemilik diketahui tidak miliki DO minyak atau izin usaha pendistribusian BBM. Namun memang ada mobil tangki, milik pribadi. Barang bukti berupa dua unit truk dan satu unit mobil tangki bermuatan solar sudah diamankan,” kata Kasat. Untuk mengelabui petugas, bak truk ditutupi dengan terpal. Padahal kedua truk telah dipasang tangki tambahan berupa dua buah drum untuk diisi bahan bakar solar. Kemudian BBM bersubsidi ini dipindah untuk ditampung ke mobil tangki. “Ketiga sopir turut diamankan untuk dimintai keterangan akan aktivitas ilegal tersebut. Berbeda dengan pemilik BBM ini, mereka kita tetapkan sebagai saksi,” kata Kasat. Menurut dia, pengisian BBM menggunakan truk yang telah dimodifikasi dengan tangki tambahan seharusnya diketahui pihak SPBU. Maka tidak menutup kemungkinan akan dilakukan pemeriksaan

terkait dugaan keterlibatan para operator SPBU. Turut memanfaatkan situasi ketika sopir mengisi BBM di SPBU. “Kita akan menggelar kasus ini. Guna melihat peran siapa saja yang bermain dalam upaya penimbunan BBM maupun penggunaan tangki siluman,” kata Kasat. Kasat mengimbau, agar masyarakat turut mengawasi pengisian BBM di SPBU. Jika ditemukan hal mencurigakan terkait upaya penyelewengan BBM, segera laporkan ke pihak berwajib. Agar cepat diambil tindakan tegas untuk diproses sesuai hukum.”Kita juga membutuhkan informasi masyarakat untuk mengungkap tindak kejahatan. Terutama upaya penimbunan BBM, guna antisipasi menjelang kenaikan harga BBM. Supaya para pelaku tidak mengambil kesempatan,” kata Puji seraya menegaskan aksi penimbunan BBM melanggar ketentuan UU No.22 tahun 2001 pasal 53 tentang Minyak dan Gas Bumi (Migas) dengan ancaman pidana maksimal empat tahun penjara. (stm)

kemarin, Sutarmidji meminta agar bantuan tersebut dapat digunakan sebaik-baiknya. “Yang jadi masalah, udah bebuih kite jelaskan, kalau tak mau paham sama saja,” katanya. Dia memaparkan dari nilai tujuh juta lima ratus ribu rupiah tersebut, Rp7 juta dialokasikan untuk belanja bahan bangunan, sedangkan Rp 500 ribunya diperuntukan buat upah tukang. “Tujuh juta (rupiah) itu tidak diberkan kepada warga. Tapi

yang pegang keluarahan. Warga harus bersama-sama lurah atau pejabat yang ditunjuk untuk membelanjakannya ke took bangunan. Harus samasama, jangan lurahnya sendiri, atau warganya sendiri,” ucap Midji. Sedangkan Rp 500 ribu diberikan langsung kepada masyarakat untuk dikelola sendiri. Sistem seperti ini dikatakan Midji untuk menghindari terjadinya kecurangan. Selain itu, masyarakat bisa

memilih sendiri bahan-bahan yang mereka butuhkan dengan kualitas terbaik.Wali Kota juga meminta para lurah total dalam menjalankan tugas penyaliran bantuan ini. “Kalau ada apaapa di lapangan, lurahnya yg tanggung jawab. Jangan ade cerite ngambek untung,” sebut dia. Bantuan ini akan cair sepenuhnya dalam beberapa hari kedepan. “Kerjakan cepat supaya Lebaran nanti rumahnya bagus,” pungkas Midji. (ars)

Padamkan Lampu Selama Satu Jam Sambungan dari halaman 9

Earth Hour Pontianak akan dipusatkan di sekitar Bundaran Tugu Digulis Untan. Serangkaian acara selebrasi telah disiapkan oleh panitia yang akan menghadirkan pendukung acara dengan berbagai hiburan maupun atraksi menarik lainnya. “Puncak acaranya akan dilakukan pemadaman lampu selama satu jam dari pukul 20.30 - 21.30,” ujarnya. Suasana Earth Hour juga dirasakan di beberapa titik di Kota Pontianak seperti Hotel Mercure, A Yani Mega Mall, Grand Mahkota Hotel, di lingkungan Untan, dan di sepanjang Jalan Ahmad Yani. Surat imbauan Wali Kota Pontianak juga diberikan kepada toko/ ruko serta perkantoran yang berada di sepanjang Jalan Ahmad Yani. Kata dia. “Akan ada kon-

figurasi 60+ dengan nyala sejumlah lilin di sekitar Bundaran Tugu Digulis Untan. Sebanyak 1.000 orang partisipan diperkirakan akan berkumpul sebagai wujud keikutsertaan dalam Earth Hour 2012.” Laki-laki yang akrab dengan nama Jimmy itu berharap, aksi kecil yang kita lakukan bersama itu akan memberikan dampak signifikan terhadap pengurangan emisi karbondioksida di Pontianak khususnya, dan di Indonesia pada umumnya. “Ini juga bisa berlanjut menjadi gerakan sosial lingkungan yang bermanfaat,” katanya. Waktu 60 menit merupakan simbol penghematan energi melalui pemadaman lampu sebagai bagian dari upaya untuk menekan laju perubahan iklim di bumi. Memadamkan lampu itu hal kecil tapi berdampak sangat besar. “Dengan memadamkan lampu dan

alat elektronik lainnya yang tidak terpakai, kita sudah berpartisipasi untuk menghemat energi dan menyelamatkan lingkungan,” ungkapnya. Syahirsyah juga mengajak masyarakat pengguna jalan yang kebetulan melewati lokasi pelaksanaan Earth Hour malam ini turut bergabung. “Masyarakat yang berada di rumah juga bisa turut memadamkan lampu. Mulai dari diri sendiri, mulai dari hal-hal kecil,” ajaknya. Wa l i K o t a P o n t i a n a k Sutarmidji mengimbau masyarakat untuk menghemat energi. “Semua individu, komunitas, praktisi bisnis, serta aparat pemerintah di Kota Pontianak mari mendukung kegiatan ini. Ayo kita memadamkan sebagian lampu serta peralatan elektronik yang tidak perlu selama satu jam,” ajaknya, kemarin. (hen)

Dorong Integrasi Sapi dengan Sawit Sambungan dari halaman 16

terutama dari aspek teknis. “Bisa kita bicarakan nanti, duduk satu meja. PTPN tentu perlu koordinasi dengan instansi teknis. Kita siap membantu,” ujarnya. Manaf menyebutkan, dalam upaya mengembangkan sektor peternakan, sinergisitas dari tiga komponen yaitu pemerintah, swasta dan masyarakat sangat diperlukan. Seperti diberitakan sebelumnya, PTPN XIII akan mengembangkan usaha penggemukan sapi diintegrasikan dengan

perkebunan sawit. Di areal perkebunan sawit, bahan-bahan untuk pakan ternak sangat melimpah. Pengelolaannya direncanakan akan bekerjasama dengan petani plasma. Pada 2012, perusahaan ini akan mendatangkan sebanyak 10 ribu ekor sapi, yang nantinya diharapkan mampu menutupi kebutuhan nasional. Adapun lokasi tempat penggemukan sapi antara lain di Parindu dan Ketapang. Manaf mengusulkan agar PTPN mengembangkan jenis sapi lokal, bukan sapi dari luar

negeri seperti sapi Australia dan sapi brahman. Sebab, sapi lokal memiliki keunggulan jika dibandingkan dengan sapi dari luar negeri. “Sapi lokal cepat beradaptasi dengan model usaha peternakan di daerah kita,” jelasnya. Sementara, sapi Australia menuntut pemeliharaan serta manajemen pakan yang lebih baik. Sapi Australia tidak akan berkembang secara optimal jika hanya mengandalkan pakan dari sawit. “Apakah petani kita mampu seperti itu,” tanyanya. (ron)

bayar pajak mahal kalau tidak ada batas tertingginya,” kata Sutarmidji. Dengan diubahnya Perda PBB nanti, masyarakat tidak perlu khawatir membayar pajak terlalu mahal. Pasalnya tarif PBB sama dengan sebelumnya, dengan hitungan satu permil. “Satu permil sama dengan tarif lama,” tegasnya. Contoh lainnya, perda tentang HO. Perda ini perlu diubah karena banyak hal yang tidak sesuai keadaan dan member-

atkan masyarakat. Dengan teori yang ada dalam perda saat ini, tarif HO bisa mengalami kenaikan sampai 1.500 persen. Sutarmidji menyebutkan dari 27 perda yang akan dibentuk sesuai dengan prolegda, hanya sebagian kecil belum diterbitkan. Sekitar belasan sudah menjadi perda. “Misalnya dulu bayar Rp 14 juta, sekarang bisa Rp 180 juta, itu buat gejolak. Itu tidak baik bagi dunia usaha di Pontianak, itu nanti dihitung kembali,” tuturnya.(hen)

Revisi Perda Sambungan dari halaman 16

satu kata,” ungkapnya. Dicontohkannya, Perda tentang Pajak Bumi dan Bangunan. Perda tersebut mesti direvisi karena tidak memuat satu kata yang dianggap penting. Dalam perda itu nilai pajak sebesar 0,3 persen, namun tidak mencantumkan kata maksimal seperti pada undang-undang. “Harus kita revisi dengan menambahkan kata maksimal. Kasihan orang

Motivasi Siswa agar Rajin Membaca Sambungan dari halaman 16

Kalimantan Barat. Kepala SD Kristen Sharon Anjongan Franky Mandolang mengatakan sudah lama pihaknya merencanakan untuk membawa siswa-siswinya berkunjung ke Pontianak Post. Lanjut dia, alasan mengapa pihaknya memilih mengunjungi Harian Pontianak Post sebagai media tertua di Kalimantan Barat dan berita yang disajikan juga berisi informasi-informasi yang layak dibaca anak-anak berusia dini. Ia menambahkan, selain itu, kunjungan yang dilakukan adalah untuk mengenalkan

kepada anak-anak didik tentang media komunikasi dan informasi. Sehingga dengan demikan, siswa-siswanya dapat mengetahui apa saja jenis media-media informasi. “Kita ingin memperkenalkan kepada mereka tentang media informasi,” katanya Menurutnya, banyak manfaat yang akan didapat siswanya dalam kegiatan tersebut, selain mendapatkan penjelasan dari Salah satu Redaktur Pontianak Post yakni Khairul Rahman tantang gambaran kerja Pontianak Post. Siswa juga akan mendapatkan motivasi. Pihaknya berharap kegiatan pembelajaran dengan langsung memberikan

praktek yang bersentuhan dengan masyarakat atau dengan orang-orang yang bekerja di media, maka setidaknya akan berdampak kepada keingintahuan siswa. Ia pun berharap dari kunjungan tersebut anak didiknya mendapatkan motivasi untuk membaca dan memiliki citacita yang tinggi. Sehingga kelak menjadi orang yang sukses dan bermanfaat bagi bangsa dan negara. “kita berharap minat bacanya bertambah,” harapnya. Satu diantara siswa SD Kristen Sharon Anjongan, Gracia yang aktif sangat saat senang dengan kegiatan yang diadakan sekolahnya. (*)

Rekening Khusus Sambungan dari halaman 16

mencantumkan identitas yang jelas. Nantinya dana kampanye tersebut akan diaudit oleh Lembaga Akuntan Publik yang ditetapkan KPU Provinsi Kalbar. ” Pe l e l a nga n L e mb aga Akuntan Publik akan diumumkan melalui media na-

sional, sehingga siapa saja yang memenuhi syarat bisa ikut dalam pelelangan untuk melaksanakan audit ini,” ungkap Muzammil. Jika pasangan calon peserta pemilu lebih dari tiga pasang, satu Kantor Akuntan Publik bisa mengaudit dana kampanye dua pasangan calon. Tetapi jika hanya dua pasang, masing-

masing pasangan calon diaudit satu Kantor Akuntan Publik. Muzammil menegaskan pesangan calon peserta pemilu tidak boleh menerima dan kampanye dari pihak asing, mereka yang tidak jelas identitasnya, serta dari pemerintah daerah, BUMN, maupun BUMD. ”Jika ketahuan fiktif, harus dikembalikan ke kas daerah,” katanya. (uni)

Buruh Sawit Lumpuh Sambungan dari halaman 16

lumpuh atas kecelakaan yang menimpanya. Dia bekerja di salah satu perusahaan asing, Malaysia sebagai buruh perkebunan sawit. Pria asal Sulawesi Selatan ini baru bekerja 1 Januari 2012 melalui jalur resmi Pelaksana Penempatan Tenaga Kerja Indonesia Swasta (PPTKIS). Kemudian langsung mengalami kecelakaan kerja tertanggal 1

Februari 2012, akibat tertimpa buah sawit hingga mengalami kelumpuhan. ”Agus termasuk Tenaga Kerja Indonesia yang beruntung, karena dia bekerja melalui jalur resmi. Sehingga semuanya ditanggung oleh perusahaan, tempat dia bekerja. Selama ini, banyak TKI yang menggunakan jalur tidak resmi, jika terjadi kecekaan kerja yang mengancam keselamatannya, tidak bisa

menuntut apa,” ujarnya. Biaya pemulangan Agus dari Malaysia hingga ke Kalimantan Barat pun telah ditanggung oleh pihak perusahaan. Dia sempat mendapat perawaran intensif di Rumah Sakit Sudarso Pontianak. Kemudian langsung diberangkatkan ke Jakarta sekitar pukul 12.25 siang. Rencananya, Agus akan sampai ke kampung halamannya Sabtu (31/3).(rmn)

Pontianak Post




Sabtu 31 Maret 2012

Pencurian Meningkat di Sui Raya


Butuh Penampung Air Bersih MASYARAKAT di daerah pedalaman membutuhkan bantuan penampungan air bersih. Ini untuk menangkal musim kemarau, dimana di desa-desa sering sulit mendapatkannya. Salah satunya warga di Desa Seruat III, Kecamatan Kubu. “Untuk air bersih di Desa Seruat III memang dibutuhkan masyarakat. Air bersih ini menjadi kebutuhan penting ketika musim kemarau tiba,” kata Naweki, Kepala Desa Seruat III berapa waktu lalu. Menurut dia masyarakat di desanya khawatir dan gelisah saat musim kemarau seperti begini, air bersih sulit didapat. Namun ketika musim penghujan tiba, air hujan melimpah, namun tempat penampungan air hujan tidak Makanya Kebutuhan Sarana Air bersih di tersedia. Ia menjelaskan ka- desa sangat penting. Pemerintah Daerah lau Desa Seruat III pudan DPRD Kubu Raya nya jumlah penduduk perlu secara serius sekitar 2.176 jiwa. Jumlah laki-lakinya memperhatikan dan mencapai 1.097 jiwa memberikan bantuan dan perempuan 1.089 sarana Penampungan jiwa. Kemudian jum- Air Hujan kepada Desa Seruat III lah kepala keluarga sebanyak 537 kepala keluarga. Untuk masyarakat di sana, mayoritas beragama Islam dan tersebar di lima dusun dan 14 RT/RW. “Warga desa Seruat III pekerja keras dan mayoritas suku Madura, mata pencarian mereka di bidang kebun, kelapa, karet, jagung, padi dan lain sebagai nelayan,” katanya. Selain di Desa Seruat II, Desa Seruat I dan Desa lainnya juga bernasib serupa. Mereka membutuhkan bantuan penampungan air bersih apabila musim penghujan tiba. Pasalnya musim kemarau yang terjadi biasanya membuat sulit warga dalam mendapatkan air bersih. ”Itu karena penampungan air dalam skala besar memang tidak ada,” ungkap Amir, warga desa setempat. Sebelumnya Sarjana Pendamping Desa I, Musa mengatakan Program Penanggulangan Sarana Air bersih dalam bentuk pengadaan penampungan air bersih harus menjadi agenda prioritas utama. Pasalnya air bersih merupakan salah satu kebutuhan pokok masyarakat. Dengan adanya ketersediannya air bersih secara layak di desa, setidak telah dapat mengurangi salah satu indikator faktor kemiskinan di desa. “Makanya Kebutuhan Sarana Air bersih di desa sangat penting. Pemerintah Daerah dan DPRD Kubu Raya perlu secara serius memperhatikan dan memberikan bantuan sarana Penampungan Air Hujan kepada Desa Seruat III,” ujarnya. (den)


MANDI: Sehabis pulang sekolah anak-anak biasa memanfaatkan media air untuk bermain. Seperti di wilayah Sungai Raya, daerah parit yang muaranya ke Sungai Kapuas menjadi tempat mereka bersenda gurau, meskipun airnya tidak jernih dan terkesan kotor.

Muara Kubu Wilayah Strategis Perairan SUNGAI RAYA—Keberadaan Kubu sekarang belum akan daerah-daerah muara dan der- berdampak kepada daerah. maga tempat bersandar ka- ”Muara Kubu muaranya juga pal-kapal di wilayah kepada penstrategis perairan di ingkatan PAD. Kabupaten Kubu Raya Kita berjanji (KKR) bakalan menambakalan menbah daya tarik daerah ertibkan setiap perairan yang dikenal kapal yang lalu Muara Kubu luas ini. Dishub merenmuaranya juga lalang nanti,” canakan meningkatkan ujarnya. status wilayah repre- kepada peningSelain itu, katan PAD. Kita dermaga di Batu sentatif tersebut. Kepala Dinas Per- berjanji bakalan A m p a r j u g a hubungan Kubu Raya, menjadi bidikan menertibkan Zaini Umar mengataPemkab. Kedek a n n ya b e l u m l a ma setiap kapal yang pannya wilayah lalu lalang nanti tersebut akan ini. Kata dia seperti areal dipungut biaya muara Kubu boleh dikatakan sandar akan keberadaan kapal kurang tersentuh pemban- yang menepi di dermaga. Dishub gunan fisik. Makanya akan sendiri juga mengusahakan penditingkatkan dengan dermaga gadaan alat bantu navigasi untuk representative sehingga mem- mengarahkan kapal masuk ke percepat proses pembangunan. lokasi terutama kondisi malam Apalagi kondisi dermaga muara dan hujan. “Kapal mendapatkan

panduan pada malam hari dengan alat navigasi itu” kata Zaini. Selain itu kedepannya di wilayah muara seperti Kubu, Dishub merencanakan bantuan pemerintah pusat melakukan pengerukan supaya dapat dimasuki kapal besar. Sebab, di muara Kubu selama ini menjadi kawasan kapal berbagai rute dan penghubung titik strategis Laut Cina Selatan, Teluk Air, Kabupaten Kayong Utara dan Rasau Jaya. Zaini menjelaskan pembangunan daerah di seberang dermaga dapat memunculkan potensi besar perekonomian baru. Kedepannya untuk mewujudkan sejumlah jajaran instansi terkait mau tidak mau harus terlibat. Dengan demikian kawasan-kawasan tersebut kedepannya akan tertata rapi dan dapat memberikan manfaat bagi masyarakat dan pemerintah daerah. (den)

SUNGAI RAYA—Kasus pencurian mondominasi persoalan yang berada di wilayah hukum jajaran Polsek Sungai Raya. Walaupun demikian beberapa kasus lainnya juga ada namun tidak sedominan kasus pencurian. Kapolsek Sungai Raya, AKP Jajang, S.Kom mengatakannya kepada wartawan. “Pada bulan Februari tahun 2012 saja, kasus di Polsek Sungai Raya ada sekitar 50 kasus. Sementara Maret sekitar 40 kasus. Rata-rata kasusnya ada tindak pidana pencurian. Minggu ini saja, sudah ada 6 kasus pencurian di wilayah hukum Polsek Sungai Raya,” katanya Jumat (29/3). Menurutnya dari kasus-kasus yang terlapor dan terjadi dalam satu bulan terakhir sudah berhasil ditemukan para pelaku. Kemudian dilakukan proses hukum sebagaimana mesti. “Kami juga berhasil mengungkap sedikitnya 6 kasus di bulan ini saja walaupun tidak semua. Namun pengungkapan kasus itu akan terus kita tingkatkan dengan kekuatan yang ada. Dalam seminggu terakhir laporan kasus pencurian selalu ada,” tuturnya. Kapolsek menambahkan pelaku pencurian banyak mengincar rumah-rumah kost kosong akibat ditinggal penghuni pergi kuliah atau sekolah. Kemudian para pelaku beraksi dengan modus merusak pintu dan jendela supaya masuk ke dalam rumah kost. ”Biasanya para pelaku sudah mengincar lama rumah kost kemudian mengambil di waktu tepat. Kita menghimbau sebaiknya para pemilik kost menempatkan seorang penjaga di tempat kost. Ini dimaksudkan supaya pelaku tidak dapat leluasa dalam beraksi,” kata dia. Jajang menjelaskan dalam mengantisipasi dan menekan jumlah tindak kriminal di wilayah hukum Polsek Sungai Raya, jajaran Polsek Sungai Raya terus melakukan patroli rutin di tempat-tempat rawan. “Jajaran reserse kita juga digeser ke lokasi yang cukup rawan kejahatan. Tujuannya sendiri untuk menekan jumlah pencurian di beberapa lokasi,” katanya. Ia meminta masyarakat dapat menghidupkan kembali siskamling dan pam swakarsa di masyarakat. Pasalnya dengan jumlah anggota Polsek yang terbatas perlu bantuan dari masyarakat. Tujuannya memang menjaga keamanan lingkungan masing-masing supaya aman dan terkendali. ”Saya juga mengimbau kepada perusahaan atau perkantoran di bidang pelayanan untuk tidak menyimpan uang dalam jumlah banyak di kantor. Lebih baik jika langsung disimpan di bank supaya tidak terjadi hal yang tidak diinginkan,” ungkap dia. Dari beberapa info masyarakat aksi pencurian lebih banyak lagi terutama di komplek-komplek perumahan. Namun banyak warga yang enggan melapor. Terlebih para mahasiswa atau anak kost karena yang hilang sebagian ada berupa handphone atau laptop. (den)

Dewan: Kelola ADD Wajib Transparan SUNGAI RAYA—Amri SP, Sekretaris Komisi B DPRD Kubu Raya meminta aparatur pemerintah desa mengeloa Alokasi Dana Desa (ADD) tahun 2012 harus lebih baik dari tahun kemarin. ”Banyak kita temuk a n d a l a m p e n g e l o l aa n ADD muncul ketidak transparan. Ada juga beberapa desa kadesnya tersangkut persoalan hukum karena mengelola ADD tidak sesuai arahan,” katanya, Jumat (30/3) di Sungai Raya. Menurut dia yang namanya ADD sudah pasti dikelola kades dan para perangkat

desa. Kalau dikelola dengan baik dan melibatkan struktrur masyarakat dalam skala prioritas maka proses pembangunan desa akan berjalan. ”Minimal tranparansi pengelolaan keuangan dijalankan. Kalau itu dilakukan desa pasti berkembang,” ucapnya. Ia menambahkan pengelolaan transparan juga m e n ja d i p ro g ra m k e r ja DPRD untuk mewujudkan dana ADD. Tidak boleh d a n a t e r s e b u t t e rk e s a n mubajir karena tidak tepat sasaran. Sebab, selama ini persoalan hukum muncul

karena gejolaknya muncul di beberapa desa. “Dan masyarakat tidak memiliki kemampuan melaporkan. Ini juga seharusnya menjadi respon pemdes agar pengelolaan ADD setiap tahunbnya lebih baik,” ungkap dia. Politikus PKS Kubu Raya ini menjelaskan sebetulnya mengelola ADD itu mudah. Sebab, petunjuk teknis pengelolaannya sudah ada. Kedepannya tinggal bagaimana setiap desa melaksanakan petunjuk teknisnya sehingga tidak ada lagi program tidak terarah.

Sebelumnya Badan Pemberdayaan Masyarakat dan Pemerintahan Desa Kabupaten Kubu Raya menuturkan perlu pembenahan dalam pengelolaan Alokasi Dana Desa di kabupaten itu karena masih banyak kepala desa yang belum bisa mengoptimalkannya. “Dari data tahun 2010 ya n g k i t a m i l i k i , ma s i h banyak kepala desa yang belum bisa memberikan laporan pertanggungjawab a n A l o k a s i D a na D e s a tahap pertama secara tepat waktu sehingga tahap kedua tidak bisa dicairkan. Hal itu





dikarenakan kepala desa masih belum bisa melaporkan secara baik pengelolaan ADD,” kata Sarino, Sekretaris Badan Pemberdayaan Masyarakat dan Pemerintahan Desa Kabupaten Kubu Raya saat sosialisasi Peraturan Bupati tentang pengelolaan Alokasi Dana Desa (ADD) di Sungai Raya belum lama ini. Menurutnya untuk tahun 2011 ini kepala desa bisa memahami Peraturan Bupati tentang pengelolaan ADD, agar tidak ada lagi kesalahan mau pun keterlambatan dalam pen-

gelolaannya. Dari realisasi ADD tahun 2010 ada beberapa desa yang tidak bisa mencairkan ADD tahap II, seperti Desa Batu Ampar, Desa Kapuas, Sungai Bemban dan Permata. “Akibat ketidakpahaman kepala desa tentang pengelolaan ADD tersebut, banyak yang tidak bisa menjalankan program pembangunan di desanya dengan baik. Untuk itu sudah seharusnya kades bisa melibatkan seluruh komponen aparatur desa untuk melakukan pembangunan,” ucapnya. (den)

Dari data tahun 2010 yang kita miliki, masih banyak kepala desa yang belum bisa memberikan laporan pertanggungjawaban Alokasi Dana Desa tahap pertama secara tepat waktu sehingga tahap kedua tidak bisa dicairkan.



Pontianak Post

Buruh Sawit Lumpuh


Rekening Khusus KETUA Komisi Pemilihan Umum Provinsi Kalimantan Barat, AR Muzammil menegaskan dana kampanye pemilihan umum Gubernur dan Wakil Gubernur Kalbar harus ditempatkan pada rekening khusus dan dilaporkan ke lembaganya. Pelaporan dilakukan saat pendaftaran pasangan calon. ”Dana kampanye akan diaudit oleh Lembaga Akuntan Publik yang ditetapkan KPU Kalbar,” ujar Muzammil. Iamenjelaskan tiga hari setelah ditetapkan sebagai pasangan calon peserta AR Muzammil pemilu, rekening khusus bisa dibuka. Berdasarkan Peraturan KPU Nomor 69 Tahun 2009 tentang Pedoman Teknis Kampanye Pemilihan Umum Kepala Daerah dan Wakil Kepala Daerah, ada tiga sumber dana kampanye. Pertama, dari pasangan calon. Kedua, dari partai politik atau gabungan partai politik yag mengusung pasangan calon. Ketiga, sumbangan pihak lain yang tidak mengikat. Sumbangan tersebut berasal dari dana perseorangan yang jumlahnya tidak boleh melebihi Rp50 juta. Selain itu, juga bisa berasal dari perusahaan atau kelompok dan jumlahnya tidak boleh melebihi Rp350 juta. Pemberi sumbangan harus jelas. Mereka harus

PONTIANAK - Tenaga Kerja Indonesia semakin meningkat tiap tahunnya. Begitu pula pada masalah dalam pekerjaan yang diemban oleh para TKI ini. Banyak diantaranya tidak melalui jalur resmi. Seiring dengan itu, keselamatan kerja banyak disepelekan oleh mereka. Kepala Bidang Penanggulangan Bencana dan Bantuan sosial (PBBS) Dinas Sosial Provinsi Kalimantan Barat, Nuraini merincikan, ribuan Tenaga Kerja Indonesia banyak bermasalah. Itu berdasar data dari tahun 2009 hingga 2012 ini. ”Tahun 2009 ada 1.022 orang. Tahun 2010 berkisar 1089 orang. Tahun 2011 ada 1.681 orang. Sedangkan awal tahun 2012 dari Januari hingga Maret sudah mencapai 200 orang. Itu semua bermasalah yang dikembalikan oleh pemerintah Negara asing,” terangnya, Jumat (30/3). Seperti pada kecelakaan kerja yang dialami Agus Badda (27). Dia terpaksa dipulangkan ke daerah asal, karena Ke Halaman 14 kolom 5

Dorong Integrasi Sapi dengan Sawit

Ke Halaman 14 kolom 5


Revisi Perda WALI Kota Pontianak dan DPRD menandatangani nota kesepahaman program legislasi daerah, kemarin. Konsekuensinya, akan ada 27 peraturan daerah yang mesti dibuat berdasarkan program legislasi tersebut. Dari 27 perda, sebagian besar sudah diterbitkan, artinya memerlukan revisi. “Sebanyak 21 perda usulan eksekutif dan enam merupakan usulan legislatif,” ujar Ketua DPRD Kota Pontianak Hartono Azaz, kemarin. Prolegda adalah instrumen perencanaan program Hartono Azas pembentukan peraturan daerah yang disusun secara berencana, terpadu dan sistematis. Secara operasional, prolegda memuat daftar rancangan peraturan daerah yang disusun berdasarkan metode dan parameter tertentu sebagai bagian integral dari sistem peraturan perundangundangan secara hierarkis, dalam sistem hukum nasional. Wali Kota Pontianak Sutarmidji mengatakan, tidak semua perda mengalami perubahan menyeluruh akibat adanya prolegda ini. Beberapa perda hanya mengalami sedikit perubahan. “Ada perda yang hanya mengalami perubahan satu pasal, ada yang hanya Ke Halaman 14 kolom 5

Sabtu 31 Maret 2012


NYALI: Pekerjaan seperti ini membutuhkan nyali tinggi. Ada juga yang berani tanpa tali pengaman.

PONTIANAK - Dinas Peternakan dan Kesehatan Hewan (Disnakeswan) Kalimantan Barat merespon positif rencana PTPN XIII mengembangkan peternakan sapi yang diintegrasikan dengan perkebunan sawit. Perusahaanperusahaan lain juga didorong untuk mengambil langkah serupa. “Kita sangat dukung itu,” kata Kepala Disnakeswan, Abdul Manaf Mustafa, kemarin. Menurut Manaf, program pengembangan sapi yang diintegrasi dengan tanaman sawit, jagung atau tanaman lain memang sudah diprogramkan oleh pemerintah pusat maupun daerah. Dalam hal ini, Disnakeswan juga menyatakan siap bekerjasama dan membantu PTPN atau pihak swasta lain,

SD Sharon KunJungi Graha Pena Pontianak Post

Ke Halaman 14 kolom 5

Motivasi Siswa agar Rajin Membaca Banyak cara yang dapat dilakukan pihak sekolah untuk memberi motivasi belajar kepada anak didiknya. Satu diantaranya adalah apa yang dilakukan pengurus Sekolah Dasar Kristen Sharon Anjongan, yakni dengan membawa anak didiknya mengunjungi Gedung Graha Pena Pontianak Post pada Jumat (30/3).

KUNJUNGAN: siswa-siswi SD Kristen Sharon Anjungan tengah­ mendengar­kan penjelasan dari Redaktur Pontianak Post.






PULUHAN siswa-siswi SD Kristen Sharon Anjongan bersama dewan guru datang mengunjungi gedung Graha Pontianak Post. Kedatangan mereka langsung diterima salah satu Redaktur Pelaksana Pontianak Post Khairul Rahman. Mereka duduk rapi di tempat yang telah disediakan dan dengan seksama mendengarkan penjelasan perjalanan panjang Pontianak Post hingga menjadi koran terbesar di Ke Halaman 14 kolom 5

pro-kalbar Pontianak Post

Sabtu 31 Maret 2012

Peringkat Tak Berubah Tak ada perubahan dari susunan calon walikota pilihan pembaca di akhir pecan ini. Hanya prosentasenya yang berbeda. Nusantio, A Muthalib dan Mulyadi masih bertengger di tiga besar. Sedangkan paling buncit masih di tangan Luis Bahiyan. Tingkatkan jumlah kiriman kupon Anda. Tentu yang terbanyak, bakal menduduki posisi teratas. Atau minimal di posisi tiga besar.

Nusantio 16.60

A Muthalib 14.99

Mulyadi Qamal 12.27

Awang Ishak 11.23

Edy R Yacoub 9.11

Iwan Gunawan 9.02

Henoch Thomas 8.19

Tasman 7.47

RE Nyarong 6.35

3 17

Luis Bahiyan 4.77


Siap Back Up

Erwin H. Lubis

PANGLIMA Kodam XII Tanjungpura Mayjen TNI Erwin Hudawi Lubis, Jumat (30/3) saat ditanya terkait pengamanan pilkada gubernur dan wakil gubernur Kalimantan Barat mendatang, mengatakan bahwa pengamanan sepenuhnya merupakan tugas pokok dari Ke Hal 22 kolom 1



HOTEL WALET: Sebagian kawasan Pinyuh yang dipenuhi dengan bangunan walet. Kini, jumlahnya mencapai 200-an bangunan besar dan kecil.

Dikepung Rumah Walet

Perda Tunggu Mendagri


MOTOPRIX: Motoprix kegiatan yang cukup kerap digelar.

PINYUH- Penangkaran sarang walet, awalnya dikenal di kawasan timur Kalbar yang meliputi Kabupaten Sintang hingga Ketapang. Karena lokasinya berada di goa-goa bukit. Kurun waktu 10-15 tahun, bangunan walet kini tumbuh subur di banyak pemukiman termasuk komplek

pasar, dengan cara penambahan bangunan di bagian atas. Bahkan tak sedikit, bangunan rumah toko (ruko) justru dimodifikasi bagian atasnya menjadi penangkaran walet. Khusus di Kabupaten Pontianak, mungkin hanya di kecamatan Sadaniang dan Toho, bangunan walat sulit ditemui. Kecuali yang dibangun oleh warga setempat sebagai upaya coba-coba. “Pinyuh memang punya kawasan

pembangunan perumahan walet, yang jumlahnya hampir seratus buah pada komplek tertentu,” aku Agus Suhaini, Lurah Sui Pinyuh. Jika ditotal secara keseluruhan, jumlahnya bisa mendekati angka 200 unit dalam segala ukuran. Tidak diketahui, apakah maraknya investasi disektor oleh oleh warga setempat maupun warga Pinyuh yang lama bermukim di Jakarta sudah meenghasilkan. Sulit

Pebalap Kecewa PEBALAP asal Kota Singkawang yang baru berusia 13 tahun, Rivaldo Setya kecewa atas pemberitaan di media nasional edisi 28 Maret-03 April 2012. Sebab, dia menyabet tiga kemenangan, namun tidak ada namanya yang dicantumkan. Sebaliknya, orang yang tidak menang, lantas dimuat. “Tentu anak saya kecewa. Saya sebagai

MODIFIKASI: Salah satu jenis kendaraan modifikasi untuk membawa BBM dari SPBU yang diamankan Polres Singkawang.

Ke Halaman 22 kolom 5

Gedung DPRD

Tak Termasuk WAKIL Ketua DPRD Kota Singkawang, Bong Cin Nen terkejut ketika mendengar penjelasan bahwa Kantor DPRD Kota Singkawang belum masuk dalam 162 daftar aset yang akan diserahkan ke kota ini. “Kantor DPRD Kota Singkawang bukan termasuk dari 162 daftar aset yang akan diserahkan dari Kabupaten Sambas ke Singkawang melalui Kabupaten Bengkayang,” Bong Cin Nen Ke Halaman 22 kolom 5


Evi Pimpin Demokrat Mempawah MEMPAWAH – Ermin Elviani akhirnya terpilih sebagai Ketua DPC Partai Demokrat Kabupaten Pontianak periode 2012 – 2017. Ia berhasil menggeser rivalnya, Sabli Awaludin, dalam perolehan suara yang berlangsung pada Muscab II Partai Demokrat, Kamis (29/3)

malam lalu di Gedung Kartini Mempawah. Dalam perebutan suara tersebut, semula, Evi, sapaan akrab Ermin Elviani, sempat bersaing ketat saat suara yang diraihnya sama banyak dengan Sabli. Dari 12 suara yang diperebutkan, mereka sama-sama

mendapat enam suara, hingga voting berlangsung pada putaran kedua. Di putaran inilah, kursi kepemimpinan DPC Partai Demokrat Kabupaten Pontianak langsung didapatnya, setelah suara yang diperolehnya sama sekali tidak bergeser. Sementara Ke Halaman 22 kolom 1

Tersangka Dinilai Pro Aktif SANGGAU - Kasus Dugaan Korupsi pembangunan Dermaga di Sanggau, sejauh ini sudah dilimpahkan kepada Kejaksaan Negeri Sanggau. Hanya saja tersangka berinisial Z dan barang bukti sampai saat ini belum diserahkan kepada kejaksaan. Terkait status tidak ditahannya tersangka Z, menimbukan tanda tanya di kalangan masyarakat. Kapolres Sanggau, AKBP Winarto, Jumat (30/3) ketika dimintai penjelasan mengatakan bahwa tersangka kasus dugaan korupsi Dermaga di Sanggau memang tidak dilakukan penahanan, mempertimbangkan bahwa tsk tidak melarikan diri, tidak akan menghilangkan barang bukti, dan tidak akan mengulangi perbuatanya lagi. “Selain itu tsk juga pro aktif jika diperlukan dalam penyidikan dan pasti datang jika Ke Halaman 22 kolom 1

Belajar Budidaya Gaharu Hingga ke Bangka Tengah

Kapuas Hulu Populasi Terbesar Gaharu

Awang, Kapuas Hulu

TRADISIONAL: Sebagian masyarakat daerah pesisir masih memanfaatkan MCK yang langsung berhubungan ke sungai.

Ke Halaman 22 kolom 1

Ermin Elviani

Selain karet dan sawit, masih ada satu lagi tanaman potensial yang layak dikembangkan di Kapuas Hulu. Bahkan, Kapuas Hulu merupakan populasi kayu gaharu alam terbesar di Indonesia. Karenanya, wajar kalau kemudian komis B DPRD Kapuas Hulu hingga ke kabupaten Bangka Tengah mendalami budidaya kayu ini.


untuk ditebak, lantaran pemailik rumah walet, sarang ataupun hotel walet enggan berterus terang disebabkan, adanya persaingan bisnis sesama pengusaha walet itu sendiri. Komplek bangunan hotel walet itu berada dikawasan eks tanah sawah yang tidak aktif. Oleh pengembang, membebaskan tanah milik tanah warga itu untuk dibangun walat.

PEMKAB Kapuas Hulu mendorong masyarakat melakukan pembidudayaan gaharu. Hasil maksimal memang belum diperoleh. Tak mau saling menyalahkan, belum lama ini (19/3) lalu, Komisi B


GAHARU: Memilah kayu gaharu usai dikeringkan. Harga mahal, permintaan dunia meningkat.





DPRD Kapuas Hulu dan Dinas Perkebunan dan Kehutanan Kapuas Hulu melakukan kunjungan pembelajaran budidaya gaharu. Daerah yang di tuju adalah Kabupaten Bangka Tengah, Provinsi Bangka Belitung. Dipilihnya Bangka Tengah (Banteng) dikarenakan daerah ini telah berhasil dalam pengelolaan budidaya gaharu. Dalam kunjungan pembelajaran itu, Komisi B DPRD Kapuas Hulu menerjunkan kekuatan penuh. Ketua Komisi, A Gupung, S.TP, dan anggota, Baco Maiwa, SE, Baraun, A.Md, Pd, Wan Taufikorahman, SE.M.Ap, Kusfery AC, Razali, Robertus, SH, Budiharjo, SH, Ir Agustinus Kasmayani, MH, turun semua. Bahkan tak kurang Wakil Ketua DPRD M Yusuf Habibi, juga turut serta. Dari jajaran Dinas Perkebunan dan Kehutanan, turun langsung Kepala Dinas, Drs H Hasan, M, Si, Kabid Rehabilitasi dan Perhutanan Sosial, Jumtani, SH, didampingi sejumlah staf. Wakil Ketua Perhimpunan Ke Halaman 22 kolom 1



Romulus Kasi Intel JABATAN Kepala Seksi (Kasi) Intel Kejaksaan Negeri (Kejari) Ngabang Kabupaten Landak, Kamis (29/3) resmi diserahterimakan dari pejabat lama, Novan Sofyan ke pejabat yang baru, Romulus. Serah terima jabatan tersebut ditandai dengan upacara Sertijab yang berlangsung di aula Kejari Ngabang. Bertindak selaku inspekur upacara, Kepala Kejari Ngabang, Rober P Sitinjak. Hadir pada upacara Sertijab tersebut seluruh pejabat dan staf dilingkungan Kejari Ngabang. Romulus sendiri sebelumnya menjabat sebagai Kasi Intel di Kejari Sekadau. Sebelum pindah ke Sekadau, iapun suRomulus dah pernah bertugas di Kejari Ngabang dengan rentang waktu yang cukup lama. Sedangkan Novan Sofyan memegang jabatan barunya di Kejari Kediri Provinsi Jawa Timur. Dengan dilantiknya Romulus sebagai Kasi Intel Kejari Ngabang yang baru, Kajari Robert P Sitinjak mengharapkan supaya bisa memberikan sesuatu yang terbaik bagi institusi Kejari Ngabang sesuai dengan harapan masyarakat. “Apalagi Kasi Intel yang baru ini merupakan putra asli Landak. Jadi kita mau mengkader putra asli Landak supaya bisa memimpin di Kejari Ngabang ini. Di Kejari Ngabang inipun ada dua putra asli Landak yang saat ini menjabat sebaga Kasi Intel dan Kasi Pidsus,” ujar Robert usai sertijab. Ia berharap kepada Kasi Intel yang baru supaya bisa mempelajari dulu tugas-tugas yang berkaitan dengan Intelijen. Robertpun memberi waktu secukupnya bagi Romulus untuk mempelajari tugas-tugas yang akan dilakukannya itu. Namun tambah Robert, tentunya harus ada dukungan dari masyarakat supaya Kasi Intel yang baru tersebut bisa bekerja dengan baik. Sementara itu Kasi Intel yang baru, Romulus berjanji akan melaksanakan tugas-tugas yang belum terselesaikan oleh pejabat yang lama. “Nah, untuk melaksanakan program yang belum terselesaikan maupun yang akan dilakukan, tentunya tidak terlepas dari petunjuk pimpinan saya,” katanya. Ia menambahkan, untuk melaksanakan program kerja tersebut, tentunya harus didukung juga dengan beberapa bidang yang ada di Kejari Ngabang. “Kita harus menjaga kebersamaan, terutama dukungan moral dari masyarakat. Sayapun siap dan bersedia mendukung program pimpinan, baik ditingkat Pusat, Provinsi dan Kabupaten. Walaupun saya putra daerah, saya tetap memprioritaskan tugas-tugas di Kejari Ngabang untuk mengabdi kepada negara dan tidak mendahulukan kepentingan pribadi dan golongan,” janji Romulus. (wan)


HUBUNGI : (0561) 735070 (0561) 735071


KERAMBA: Budidaya ikan dengan pola keramba apung masih menjadi primadona di Kabupaten Landak. Masayarakat banyak menebar keramba di sungai atau laut.

Tingkatkan Saham Pemkab MEMPAWAH-WakilKetuaDPRD, H Rusli Abdullah pelayanan Bank Kalbar kepada para nasabah perlu dievaluasi agar kinerja meningkat. Sedangkan Kapten Inf T Tanjung mengeluhkan besarnya tarif potongan pinjaman yang diberlakukan kepada nasabahnya. “Potongan pinjaman modal dirasa nasabah terlalu besar. Mustinya bisa lebih kecil dari tarif yang diberlakukan saat ini,” kata Tanjung serayamempertaanyakanmenyangkut prosedur pengajuan pinjaman untuk garap tanah negara agar bisa produktif. Bupati H Ria Norsan mengaku sosialisasi yang dilaksanakan PT Bank Kalbar itu dapat membawa pencerahan serta membawa angin segar untuk kemajuan pembangunanekonomimasyarakatKabupaten Pontianak. “Semoga bermanfaat terhadap pembangunan di masa mendatang. Hubungan baik yang telah terjalin antara Pemkab dengan Bank Kalbar hendaknya terus ditingkatkan,” pintanya. Dalam sosialisasi itu juga dilakukan dialog antara peserta

dan PT Bank Kalbar dipimpin langsung Direktur Utama Bank Kalbar, Sudirman HMY itu dihadiri Komisaris Utama Bank Kalbar, Murdjani Abdullah, Sekda, Gusti Ramlana, Forkorpimda, Staf Ahli, Asisten, para SKPD Pemkab Pontianak para camat dan Anggota DPRD. Sudirman HMY menerangkan, penyertaan modal Pemkab Mempawah berada di peringkat sembilan. Dengan besaran modal Rp 6,735 miliar atau 6. 735 lembar saham (2,19) dari total modal Rp 307, 001 miliar. “Berharap terus meningkatkan penyertaan modalnya. Idealnya, penyertaan modal pemkab mendekati angka 10 persen dari saham yang ada,” ujar Sudirman pada sosialisasi program kerja dan silaturahmi PT Bank Kalbar dengan Pemkab di Aula Kantor Bupati. Dia menjelaskan, sosialisasi yang dilaksanakan PT Bank Kalbar kepada Pemkab dimaksudkan untuk menambah penyertaan modal. Yang berimplikasi terhadap meningkatnya kepemilikan saham

Pemerintah Kabupaten Mempawah di Bank Kalbar. Kenapa perlu ditingkatkan, hal itu dilakukanuntukmendukungprogram BPDRegionalChampion(BRC).Tentu untuk meningkatkan peran Bank Kalbar, agar mampu menjadi garda terdepan pembangunan ekonomi daerah. Yang pada akhirnya dapat mendukungprogrampemerintahdalam rangka menciptakan lapangan kerja dan meningkatkan taraf hidup masyarakat daerah. BRC, kata Sudirman, merupakan program inisiatif perbankan yang diluncurkan Bank Indonesia (BI) pada 21 Desember 2010 lalu di Jakarta. BRC dilakukan untuk antisipasi tibanya era Masyarakat Ekonomi Asean (MEA) tahun 2015. “MEA itu merupakan masa di mana bank-bank asing berikut tenaga kerja asing diperbolehkan melakukan ekspansi hingga ke seluruh Indonesia termasuk Kalbar. Sebelum semua itu terjadi, kita harus memperkuat bank daerah, agar bank asing tidak masuk,” bebernya. (ham)

Konvensasi Kesehatan dan Pendidikan TOHO- Jika ada anggapan kalau pemberian bayar langsung tunai (BLT), yang merupakan konvensasi dampak kenaikkan Bahan Bakar Minyak (BBM) tepat sasaran adalah sesuatu kekeliruan besar. “Justru membuat masyarakat kita semakin malas bekerja, lantaran hanya berharap dari pemberian itu,” nilai Amon Amed Sth, anggota komisi B pada DPRD Mempawah “Berapa lamalah kemampuan bertahan warga miskin bertahan dengan rencana bantuan BLT yang hanya Rp 150 ribu. Rata-rata sehari hanya Rp5000, mau makan apa,” nilai dewan dapil empat itu. Malah, dari pengalaman BLT periode sebelumnya, justru yang banyak menikmati BLT, adalah

keluarga kalangan mampu. Justru keluarga miskin, kurang mampu malah banyak yang tidak menerima dan menikmati bantuan tersebut. “Bukti otentik dari kesalahan itu, terjadi pada waktu pendataan, banyak warga dari kalagan keluarga miskin dan kurang mampu yang tidak terdata. Itu disebabkan, ada pemaksaan kehendak dari mereka yang masuk katagori mampu,” predeksi Amon Amed. Sedangkan yang benar-benar masuk katagori miskin, malu untuk berteriak dan memaksakan kehendak. Sebab, tak bisa ditampik masih melekat dikalangan adat orang timur budaya malu. Mmebantu keluarga miskin itu memang menjadi tanggungjawab

pemerintah Dilain pihak, BLT apakah nantinya tepat sasarannya dan tidak terjadi bumerang bagi petugas pendata. Lantaran, masih ditemukan yang mampu mengaku miskin,begitu mendengar ada BLT ataupun bantuan sosial lainnya. Mungkin lebih tepat, jika konvensasi BLT itu disalurkan pada bidang pendidikan dan kesehatan, dalam bentuk pelayanan kesehatan dan pendidikan gratis. “Sebab, dua bidang itu paling penting dan memang prioritas, agar kalangan keluarga miskin dan kurang mampu dapat dilayani saat berobat maupun masukan anak mereka kesekolah,” tegas Asmon Amed. (ham)

Pontianak Post


31 Maret 2012

3 Bulan Bolos PNS Dipecat SK Diproses

“Sebab ini merupakan salah satu tugas dan tanggungjawab dari pimpinan. Kalau NGABANG-Seluruh Pe- pimpinan tidak mampu memgawai Negeri Sipil (PNS) bina pegawainya, tentu akan dilingkungan Pemerintah memiliki konsekwensi logis Kabupaten (Pemkab) Landak, dari yang bersangkutan sebasaat ini tidak bisa main-main gai pimpinan,” ungkapnya. Ditempat terpisah, Kepala lagi didalam melaksanakan tugasnya untuk mengabdi BKD Landak, Marcos Lahiran mengurai kembali Peraturan kepada Negara. Pasalnya, Bupati Landak, Pemerintah (PP) No. 53 tahun Adrianus Asia Sidot berjanji 2010 tentang disiplin PNS. akan memeriksa absensi ke- “Didalam PP itu memang dishadiran PNS di setiap SKPD ebutkan sanksi-sanksi kepada yang ada selama 3 bulan PNS yang tidak melaksanakan tugas, seperti sekali dan akan tidak masuk kandiumumkan. tor tepat waktu,” “Sebelumnya ujarnya. Menurut sudah saya umumMarcos, didalam kan ketidakhadPP itu disebutkan iran para PNS ada 3 tingkatan dilingkungan sanksi dan 10 jenis Pemkab Landak. hukuman. Ketiga Ada oknum PNS sanksi tersebut yang masuk kanyakni sanksi rintor hanya satu kali gan, sanksi sedalam setahun. dang dan sanksi Terhadap oknum berat. PNS itupun akan “Kepada PNS kita proses SK peAdrianus AS yang dikenai sanksi mecatannya,” ujar Bupati pada kegiatan Coffe berat apabila dia tidak masuk Morning belum lama ini di kerja selama 46 hari. Bagi PNS aula besar Kantor Bupati yang tidak masuk kerja lebih dari 4 hari akan kita panggil Landak. Bupati sendiri tidak akan atasannya, karena yang akan mentolerir para PNS yang memberikan sanksi adalah tidak disiplin. Bagai PNS yang atasannya,” jelas Marcos. Ia menambahkan, PNS memang tidak layak sebagai PNS, Bupatipun akan mem- yang sudah lama tidak masuk kerja, akan dilihat dulu daftar berhentikannya. “Sebab banyak kerugian- hadirnya yang ditandatangani nya kalau PNS bersangkutan Kepala SKPD. “Kalau dia terbukti diatas masih dipertahankan. Jadi ini harus dimaklumi juga,” kata 46 hari tidak masuk kerja dan sudah dilakukan pembinaan Bupati. Ia sendiri meminta kepada oleh atasannya, maka pejabat Badan Kepegawaian Daerah pembina kepegawaian akan (BKD) Landak untuk meny- memberikan sanksi sesuai iapkan rekapitulasi absensi dengan peraturan yang berlaku,” katanya. para PNS disetiap SKPD. Marcos mengaku, memang Dengan cara itu, nantinya akan bisa dilihat Kepala SKPD ada PNS di Pemkab Landak mana yang bisa melaksanakan yang sudah lama tidak masuk pembinaan kepada stafnya kerja. Surat sanksipun akan dan Kepala SKPD mana yang diberikan kepada yang bertidak bisa membina stafnya. sangkutan. (wan)

Pontianak Post

Sabtu 31 Maret 2012




Kunjungi PIK BKKBN Provinsi Kalbar bersama Badan Pemberdayaan Masyarakat, Perempuan dan Keluarga Berencana (BPMPKB) Kota Singkawang melihat secara langsung kegiatan serta aktivitas PIK Remaja, Jumat (30/3). Pusat Informasi dan Konseling Remaja Kota Singkawang yang dikunjungi telah memperoleh beberapa penghargaan, baik tingkat provinsi maupun tingkat nasional. Demikian informasi dari Media Center, kemarin. Kegiatan pemantauan dilakukan di tiga PIK Remaja unggulan yang ada di sekolah-sekolah, yakni PIK Remaja Lavender (SMA negeri 4, tahap tumbuh), PIK Remaja Bintang (SMP Negeri 7, tahap tegak) dan Madrasah Aliyah (MA) Ushuluddin (tahap tegar). “Selain memantau, kami juga akan melakukan penilaian terhadap tiga PIK Remaja Unggulan Kota Singkawang, yang nantinya untuk dibawa ke tingkat provinsi bersama kabupaten/ kota lainnya se-Kalbar. Nanti, akan ada penyeleksian. Hasilnya, bagi yang lolos akan dibawa ketingkat nasional pada saat HUT Harganas ke-19 di NTB tanggal 29 Juni 2012 nanti,” ucap Kabid Keluarga Sejahtera (KS), Gugus Suprayitno saat dijumpai bersama rombongan BKKBN Provinsi Kalbar di SMA Negeri 4 Sedau, Jum,at (29/3). Ditanya pemantauan dan penilaian yang seperti apa di PIK Remaja unggulan Kota Singkawang, Gugus mengatakan, banyak yang mesti di lihat seperti salah satunya permasalahan yang sering ditemui dikalangan pelajar. Dia mencontohkan, seperti masalah narkoba, keluarga dan kespro. Bersama rombongan BKKBN Provinsi, Kasubbid KS Badan Pemberdayaan Masyarakat, Perempuan dan Keluarga Berencana (BPMPKB) Kota Singkawang, Ashari Arhap menjelaskan, PIK Remaja Kota Singkawang pernah beberapa kali meraih prestasi tahun 2011, baik tingkat provinsi maupun tingkat nasional. Ke-3 PIK Remaja itu adalah Raflesia, MA Ushuluddin dan PIK Remaja Bintang. Kabid Pemberdayaan Masyarakat mewakili Kepala BPMPKB Kota Singkawang, Sukardi, berharap agar sukses tahun 2011 bisa berlanjut di tahun ini. “Mudah-mudahan salah satu dari 3 PIK Remaja unggulan Kota Singkawang yang kita kunjungi ini, bisa lolos ditingkat provinsi sehingga bisa berlaga ditingkat nasional seperti pada tahun lalu. Kami dari BPMPKB yakin itu bisa terwujud mengingat persiapan kearah itu telah kita siapkan,” pungkas Sukardi. (zrf)


HUBUNGI : (0561) 735070 (0561) 735071

TAK TERMASUK: Kantor DPRD Kota Singkawang, bukan termasuk diantara 162 aset yang diserahkan dari Pemkab Sambas ke Singkawang. Berita di halaman 17.


Pertanyakan Status SINGKAWANG- Tim Pansus DPRD Kabupaten Bengkayang tidak akan mempersulit penyerahan 162 aset Pemerintah Kota Singkawang. Namun pihaknya terlebih dahulu memperjelas jumlah maupun status ke Pemkab Sambas. Hal tersebut merupakan hasil pertemuan Tim Pansus Aset DPRD Kabupaten Bengkayang dengan Komisi B DPRD, beserta DPPKA dan Kabag Hukum Pemkot Singkawang yang dipimpin Wakil Ketua DPRD Kota Singkawang Bong Cin Nen, Jumat (30/3) di ruang paripurna DPRD Kota SIngkawang. “DPRD Bengkayang konsen terhadap aset, jangan sampai aset yang ada dimanfaatkan pihak ketiga, sebagai tim pansus kita tidak mau penyerahan ke Singkawang melaluiBengkayanghanyalewatsaja,pengecekan yang kami maksud adalah apakah memang aset yang dimaksud (Pemkab Sambas) itu ada atau tidak,” kata anggota Pansus DPRD Kabupaten Bengkayang, Herman Planet, Jumat (30/3) di Singkawang.

Pasalnya, menurut Herman, dari jumlah aset yang disebutkan (162), diduga ada beberapa diantaranya sudah menjadi hak milik perseorangan. Hal inilah yang perlu dikroscek kebenarannya dengan meminta kejelasan dari Pemkab Sambas. “Dilihat dari surat keputusan DPRD Kabupaten Sambas nomor 10/PIMP/2009 tentang persetujuan DPRD Kabupaten Sambas terhadap penyerahan asset milik pemerintahan Kabupaten Sambas kepada Pemkab Bengkayang, artinya setelah penyerahan tersebut (2009), kalau memang ada aset (yang sekarang akan diserahkan ke Singkawang) menjadi hak milik perseorangan harus sepengetahuan Kabupaten Bengkayang, tapi selama ini hal itu tidak ada,” jelas Herman. Meski dirinya tidak tinggal di Singkawang, dikatakan Herman, perpindahan aset Negara ke tangan orang per orang harus melalui prosedur, paling tidak ada koordinasi dengan Bengkayang. “Jangan sampai ada pihak

ke tiga yang memanfaatkan kesempatan tersebut,” katanya. Sementara itu, sebanyak 162 aset yang akan diserahkan ke Pemkot Singkawang. Tim Pansus DPRD Kabupaten Bengkayang tidak akan mempersulitnya. Bahkan sudah dibuatkan surat hanya tinggal mengisi nomornya saja. “Kalau langsung serahkan begitu saja, nanti kasihan Pemkot Singkawang dalam hal administrasi, karena masalah aset juga menjadi penilaian hasil audit BPK P,” katanya. Hal sama juga diungkapkan Anggota Pansus Aset DPRD Kabupaten Bengkayang, Marsianus. Pihaknya sangat berharap permasalahan asset cepat selesai. “Jika ini tidak cepat selesai, membuat tidak tahu harta kekayaan kita, karena masih ada yang tercatat di Singkawang dan Bengkayang,” kata Marsianus. Kepala Dinas Pendapatan, Pengelolaan Keuangan dan Aset (DPPKA) Kota Sing-

kawang, Siti Kodam Mariana menyebutkan berdasarkan pertemuan pada 7 sampai 9 Februari 2012 antara tim teknis aset dari Kabupaten Sambas, Bengkayang dan Kota Singkawang difasilitasi Pemprov Kalbar, dalam rangka percepatan proses serah terima aset Pemkot Singkawang sebanyak 162 aset. Menghasilkan beberapa poin, diantaranya Pemkab Sambas melalui DPRD Kabupaten Sambas telah menetapkan 162 aset yang akan diserahkan kepada Pemkot Singkawang melalui Pemkab Bengkayang Kemudian proses serah terima tersebut harus melalui Kabupaten Bengkayang, dalam hal menunggu persetujuan DPRD Kabupaten Bengkayang sebagaimana penetapan yang dilakukan Kabupaten Sambas. Pemprov akan mengadakan pertemuan lanjutan tingkat pimpinan untuk tiga kabupaten dan kota pada pertengahan tahun ini, sambil menunggu persetujuan DPRD Bengkayang. (fah)

Hambat ASI Iklan Susu Formula Dilarang SINGKAWANG-Kegiatan pengiklanan susu formula yang dapat menghambat program pemberian ASI Eksklusif dilarang sebagaimana disebutkan dalam pasal 19 huruf E dalam PP No 33/2012 tentang Pemberian ASI Eksklusif. Sebagaimana hal tersebut juga, telah diatur dalam pasal 5 Permenkes No. 1787/Menkes/PER/XII/2010 tentang Iklan dan Publikasi Pelayanan Kesehatan. Demikian diungkapkan Yuliana Suliyanti, Local Public Service Specialist Program Kinerja USAID Kota Singkawang. Pengiklanan susu formula dilarang dimuat dalam media

massa, baik cetak maupun elektronik dan media luar ruang. Selain itu, kata dia, produsen juga dilarang memberikan contoh produk susu formula bayi secara cuma-cuma atau dalam bentuk apapun kepada penyelenggara fasilitas pelayanan kesehatan, tenaga kesehatan, ibu hamil, atau ibu yang baru melahirkan. “Produsen juga dilarang memberikan penawaran atau penjualan langsung susu formula bayi ke rumah-rumah, memberikan diskon harga dengan berbagai variasinya.” Namun, larangan iklan dikecualikan

atau diperbolehkan sepanjang media cetak tersebut khusus mengulas perihal kesehatan dengan syarat harus mendapatkan persetujuan dari Menteri Kesehatan dan memuat keterangan bahwa susu formula tersebut bukan pengganti ASI. “Aturan tersebut juga masih membolehkan produsen dan distributor susu formula memberi bantuan biaya pelatihan, penelitian atau kegiatan lain pada institusi pendidikan dan fasilitas layanan kesehatan,” kata dia. Kata Yuliana, ASI sangat bermanfaat bagi kelangsungan hidup bayi, bahkan merupa-

kan hak bayi mendapatkannya. Menurut dia, ASI Eksklusif dan IMD dapat menekan kematian bayi hingga 22 persen. Sebagaimana diungkapkan dalam Riset KesehatanDasar2010menyebutkanbayiyang mendapatkanASIEksklusifhinggaumurenam bulan baru 15,3 persen, sementara IMD yang dilakukan kurang dari satu jam setelah bayi lahirhanya29,3persen.“Dengan diterbitkannya PP No. 33/2012 tentang Pemberian ASI Eksklusif ini, perlu dilakukan pemantauan pelaksanaannya oleh semua pihak termasuk Pers, LSM dan masyarakat sendiri.” (zrf)


20 terigas

Waspadai Penyakit Kemarau PEMERINTAHKabupaten(Pemkab)Sambas melalui Dinas Kesehatan (Diskes) memberikan peringatan dini terhadap beberapa penyakit menular yang berpotensi menjadi kejadian luar biasa (KLB). Diskes melalui surat nomor 443/1154/PMK-DKS tertanggal 26 Maret 2012, telah menginstruksikan kepada seluruh puskesmas di Kabupaten Sambas, agar siaga, terkait penyebaran penyakit menular sebagai dampak dari musim kemarau. Kabag Humas, PDE, dan Sandi Setda Pemkab Sambas, Rusniardi, dalam rilis resmi kepada koran ini mengungkapkan langkah awal, sesuai informasi dari Diskes. Ditambahkan dia bahwa yang terlampir dari surat Diskes tersebut adalah memberikan pemahaman awal dan meneruskan informasi terkait beberapa penyakit menular, mengenai dampak dari musim kemarau ini. Dijelaskan Rusniardi, beberapa penyakit yang perlu diwaspadai di antaranya diare, demam berdarah dengue, ISPA, serta penyakit menular lainnya. “Setiap puskesmas sudah disurati dan diperintahkan Dinas Kesehatan melakukan langkah-langkah antisipasi terhadap pencegahan penyakit-penyakittersebutkepadamasyarakat,dan petugas surveilans serta staf di lapangan diminta melakukanpengamatanintensifdankewaspadaan dini,” ujar Rusniardi. (har)


Hutan Selindung Terbakar AKIBAT ulah oknum warga yang melaksanakan sembahyang kubur (ceng beng), Jumat (23/3) lalu, wilayah perkebunan rakyat yang berada di lokasi kebun kelompok Cakra Timba Baya (CTB) Desa Twi Mentibar, Selakau, terbakar. Dilaporkan sekitar 10 hektar lahan terbakar, di mana dua di antara pemilik kebun yang merugi akibat kebakaran ini adalah Salwi (1,5 hektar) dan Mistur (1 hektar). “Kita minta hal ini menjadi perhatian berbagai pihak, warga yang tergabung kelompok tani CTB tidak melarang siapapun melakukan ritual, namun di musim kemarau saat ini, mohon semua pihak lebih cermat kepada potensi yang membahayakan lingkungan sekitar,” ungkap Ketua Kelompok Tani Cakra Timba Baya, Erwin Johana, kepada koran ini, kemarin. Menurut Erwin, kejadian ini diperkirakan berlangsung sekitar siang hari pascaumat Islam melaksanakan salat Jumat. Secara kebetulan, ada petani hutan Selindung yang pergi ke kebun dan melihat kebunnya sudah terbakar. (har)


Pontianak Post

Sabtu 31 Maret 2012

Desak Segera Rekomendasikan Sambas Pesisir


PEMANGKAT: Kota Pemangkat nantinya akan menjadi sentra Kabupaten Sambas Pesisir, jika calon kabupaten baru tersebut benar-benar terbentuk.

SAMBAS – Berlakunya Undang-Undang Otonomi Daerah di Indonesia yang salah satunya ditujukan sebagai langkah percepatan pembangunan, memberikan peluang bagi seluruh wilayah untuk memekarkan diri dan membuka akses dari keterisoliran daerah masing-masing, dengan sistem desentralisasi. Tendensi untuk memeraktikkan undang-undang ini di setiap wilayah di Indonesia tidak seragam, tapi hampir dipastikan memiliki kemiripan. Yakni tidak ingin terisolir dan kebutuhan untuk menikmati hasil pembangunan yang merata, termasuk

calon Kabupaten Sambas Pesisir. Perilaku kalkulasi ‘untung-rugi’ yang melatarbelakangi gonjang-ganjing ‘yatidak,’ pada pembentukan Sambas Pesisir, oleh Pemkab Sambas, semasa masih bupati terdahulu, sepantasnya dikurangi atau bahkan dihilangkan dimasa kepemimpinan yang baru ini, karena ini menyangkut aktivitas sosial yang tidak bisa diukur secara matematika. “Kalkulasi ini malah bisa diarahkan sebagai manuver politik yang menimbulkan “sikap ketergantungan” masyarakat Sambas Pesisir yang mungkin

hanya akan membebani Kabupaten Sambas induk kelak dikemudian hari. Sebaiknya kalkukasi untung rugi dicermati dengan sikap bahwa Sambas Pesisir keseluruhan tidak akan rugi dan juga tidak akan untung bila bergabung atau tidak bergabung,” ungkap Ketua Lembaga Sentra Informasi dan Media Pendidikan Untuk Rakyat ‘SIMPUR,’ Jono kepada koran ini, kemarin. Menurut Bung John begitu ia disapa, untuk mendobrak ketertinggalan dan kemajuan pembangunan di wilayah Sambas Pesisir keseluruhan mempersyaratkan

sejumlah hal. Strategi dan pola saling mendukung dan sama-sama menang (win-win solution) bisa saja menjadi alternatif dalam perundingan untuk mencapai kesepakatan. Namun tidak salah juga bila pihak Sambas Pesisir memegang sikap untuk tidak menjadi beban pada sebuah tatanan sosial yang ingin mandiri. Pemda Sambas (dalam hal ini Bupati) harus bertanggung jawab dan memberikan klarifikasi kepada publik terkait pembiaran SK DPRD Sambas Nomor 1 tahun 2008 karena pada prinsipnya sesuai dengan persyaratan Panitia KSP telah mengacu dan berpedoman pada PP 78 tahun 2007 dan semua persyaratan telah rampung, jadi ini merupakan hak konstitusional KSP telah diabaikan oleh Pemda Sambas dahulunya. Tapi hari ini masyarakat Sambas Pesisir menatap masa depan, jadi diharapkan Bupati Sambas saat ini segera untuk memberikan rekomendasi persetujuannya terkait Pembentukan Kab Sambas Pesisir tanpa berhitung untung rugi karena ini menyangkut kesejahteraan rakyat Dapil 2 pada umumnya. Jadi, dukungan tetap harus diberikan kepada setiap wilayah yang hendak memekarkan diri termasuk kepada calon Kabupaten Sambas Pesisir. “Keaktifan semua pihak sangat diharapkan untuk memberikan pendidikan politik yang benar kepada masyarakat sehingga turut melibatkan diri memberi sumbangsih dalam pengambilan keputusan di era otonomi, yang pada hakikatnya adalah untuk membangun ke arah yang lebih baik lagi,” pungkasnya. (har)

Penandatanganan Pakta Integritas, Siap Cegah Korupsi SAMBAS – Untuk mencegah tidak terjadi penyimpangan dan hal-hal lain yang merugikan masyarakat dalam tata kelola pemerintahan, Jumat (30/3) seluruh kepala Satuan Kerja Perangkat Daerah (SKPD) membuat kesepakatan menandatangi dokumen Pakta Integritas di lingkungan Pemkab Sambas di Aula Utama Kantor Bupati Sambas. Mereka berkomitmen menciptakan pemerintahan bersih dan mencegah korupsi. Wakil Bupati Sambas Pabali Musa mewakili Bupati Sambas mengatakan, pakta integritas merupakan kewajiban seluruh pemerintahan yang telah ditetapkan dalam upaya membuat kesepakatan bersama menjaga pemerintahan yang bersih “Pendatanganan Pakta Integritas bertujuan untuk menuju pemerintahan yang bersih dan bebas dari korupsi serta KKN, dalam hal ini, komitmen pejabat dalam pakta integritas dapat memperkuat kiner-

ja birokrasi, karena kita ditunlaksanakan, karena komitmen tut bekerja efesien dan efektif, ini berupaya menciptakan peterutama dalam memberikan merintah yang bersih dan bepelayanan kepada publik, bas Korupsi serta KKN. “Pakta yaitu amanah untuk melayani integritas ini merupakan hal masyarakat,” ungkapnya. yang wajib dilaksanakan oleh Pemkab berharap komitpemerintah, itu dikarenakan men dari pakta integritas ini hasil kesepakatan ini selanjutdapat meningkatkan, mindset, nya akan dikirim ke pemerinkultur dan budaya kerja, sehtah pusat,” katanya. ingga program pemerintahan Jamiat menegaskan, pakta yang dijalankan mendapatkan integritas ada kaitan dengan respon baik dari masyarakat. reformasi birokrasi yang sudah Pabali Musa “SKPD hingga jajaran bawah juga kita laksanakan, dalam hal ini diharapkan dapat membuat kesepakatan ini SKPD yang telah membuat komitmen secara bersama, selanjutnya dilaksanakan agar menjalankannya dengan baik, sepsesuai kesepakatan pakta integritas yang erti respon terhadap keluhan masyarakat telah kita buat,” himbaunya. tentang pelayanan pemerintah, data best Sementara itu, Sekda Sambas H Jamiat daerah, tolak ukur keberhasilan, mauAkadol selaku Ketua Panitia penandatan- pun upaya tidak terjadinya korupsi. “Ini ganan dokumen Pakta Integritas dalam yang harus kita sikapi agar tidak terjadi laporannya menegaskan, pakta Integritas kabar yang simpang siur dimasyarakat,” merupakan hal yang penting untuk di- katanya.

Sesuai komitmen yang disepakati bersama, Pakta integritas adalah sebuah komitmen menyatukan sikap ingin melakukan perubahan yang lebih baik kedepan, sehingga komitmen yang dibuat mampu menciptakan keterpaduan, kebulatan dan keutuhan dalam menjalankan program pemerintah, terutama memberikan pelayanan yang baik terhadap masyarakat. Dalam pelaksanaannya, pakta integritas merupakan keinginan bersama antara pemerintah dan masyarakat, komponen masyarakat sangat penting, sehingga pemerintahan yang bersih dalam penegakan hukum, pelaksanaan mendapatkan hasil yang baik. “Awal April ini diminta kepada seluruh SKPD sudah menyiapkan komitmen sesuai pakta integritas, ini sudah harus kumpul dengan melibatkan seluruh staf, mulai dari Dinas, Badan, Kantor dan Kecamatan,” pungkasnya. (har)

Pontianak Post


Sabtu 31 Maret 2012


Surati DPR, Tunda BBM MENYIKAPI maraknya tuntutan agar pemerintah menunda kenaikan harga BBM bersubsidi per-1 April ini, juga disikapi Pusat Konsultasi Pengkajian dan Bantuan Hukum. Mereka bahkan telah menyurati DPR-RI dengan meminta agar mempertimbangkan keputusan tidak populis tersebut. “Kami telah menyurati Ketua DPR-RI cq Komisi VII, meminta dan menyarankan agar mempertimbangkan Handy Abdul Syukur maksud pemerintah tersebut. Jika pihak pemerintah juga tetap memaksakan kehendaknya untuk menaikkan (harga) BBM, hendaknya dilakukan secara bertahap,” ungkap Ketua Umum Pusat Konsultasi Pengkajian dan Bantuan Hukum, Handy Abdul Syukur, didampingi Sekretaris Jenderal, Kliwon Hariyanto, dalam konferensi persnya yang berlangsung di Pontianak, kemarin (30/3). Semakin meningkatnya tensi para pengunjuk rasa belakangan ini, menurut dia, hendaknya disikapi secara bijak oleh pemerintah. “Jika mau tidak mau harus naik, hendaknya secara bertahap, agar unjuk rasa dapat menurun, dengan catatan pemerintah harus melakukan pengawasan ketat, agar pedagang tidak menaikkan harga barangbarang, khususnya sembilan bahan pokok, sesuai dengan kenaikan harga BBM,” pinta Syukur kembali. Syukur yakin, saran dan permintaan mereka telah menjadi perhatian dan pertimbangan para anggota parlemen di legislatif. “Kita lihat sajalah, apakah surat yang kami sampaikan tersebut akan ditanggapi atau tidak oleh wakil-wakil rakyat di DPR-RI tersebut. Semoga ditanggapilah,” harapnya.(ote)



Koperasi PNS Disuntik Rp11 M


TANJUNG BELANDANG: Keindahan Pantai Tanjung Belandang yang terancam abrasi, jika tidak segera diambil tindakan untuk pencegahannya.

Abrasi Landa Pantai Tanjung Belandang KETAPANG – Meski merupakan salah satu objek wisata yang menarik untuk dikunjungi, namun tidak dipungkiri secara geologis Pantai Tanjung Belandang memiliki laju sendimentasi yang cukup tinggi. Ini terjadi karena merupakan estuaria dari Sungai Pawan, sehingga dengan demikian, kawasan ini merupakan kawasan pantai sendimentasi yang relatif mengandung lumpur yang tersuspensi. Demikian dipaparkan staf Disbudparpora Kabupaten Ketapang, Abdul Manan. Sebenarnya, menurut dia, tidak sedikit objek wisata lain di Ketapang yang jauh lebih bagus dibanding Pantai Tanjung Belandang. Namun, karena jarak tempuh yang cukup dekat dari pusat kota, menjadikan pantai ini selalu ramai dikunjungi, terutama pada hari-hari libur. “Aktivitas kepariwisataan di pantai ini sedikit banyak telah memberikan kontribusi positif bagi pendapatan masyarakat sekitar, yang berusaha di sektor pariwisata, terutama para pedagang di sekitar pantai,”

paparnya. Apalagi, sambungnya, kencendrungan masyarakat sekarang, termasuk di Kabupaten Ketapang, di mana kegiatan berwisata atau rekreasi sudah merupakan kebutuhan. Meski begitu, ia tak memungkiri, jika tidak diperhatikan secara serius, maka keberadaan Pantai Tanjung Belandang tidak akan bertahan lama. Pasalnya hingga sekarang, permasalahan abrasi terus terjadi di pantai tersebut. “Setiap tahun abrasi yang terjadi di Pantai Tanjung Belandang sekitar 5 meter,” jelasnya. Abrasi yang terus melanda tersebut, salah satunya karena pantai ini berhadapan langsung dengan Laut Cina Selatan. “Jadi pada musim barat, tinggi gelombangnya mencapai 1,25 meter. Apabila dibiarkan, maka lambat laun pantai Tanjung Belandang akan hilang,” ujarnya. Untuk mengatasi masalah abrasi tersebut, menurut dia, perlu dibuat bangunan pemecah gelombang atau bangunan

penahan gelombang. Selain menyoroti soal abrasi, Manan juga berharap adanya penataan kawasan di pantai tanjung belandang. “Agar tampak lebih indah, sebaiknya bangunan di kawasan Pantai Tanjung Belandang harus tertata dengan baik dan sedapat mungkin memiliki nilai estetika sehingga menarik dan tidak merusak keindahan pantainya,” imbuhnya. Karenanya Pemerintah daerah Ketapang telah membuat detail enginering desain (DED) sebagai acuan pembangunan di kawasan Pantai Tanjung Belandang. Namun, karena lahan di pantai ini milik masyarakat, dan mereka membangunnya tanpa memperhatikan DED yang dibuat. Akibatnya pantai ini terkesan kumuh dan semrawut. “Agar bisa terlihat lebih indah, sebaiknya kawasan pantai tersebut perlu dilakukan penataan ulang terhadap bangunan yang telah dibangun oleh masyarakat sesuai dengan DED yang telah disusun,” ungkapnya. (ash)

KETAPANG – Adanya rencana penyertaan modal dari Bank Kesejahtraan Ekonomi (BKE) sebesar Rp11 miliar, membuat Sekda Ketapang, Andi Djamiruddin, optimis, ke depan Koperasi Praja Nirmala Kabupaten Ketapang akan tumbuh lebih baik lagi. “Kalau dibanding daerah lain, saya rasa saat ini pertumbuhan koperasi pegawai negeri di Ketapang sudah jauh lebih baik dibanding tahuntahun sebelumnya,” ujar Sekda. Meski jumlah PNS di kabupaten ini saat ini cukup banyak, namun menurut Andi, mereka yang tergabung menjadi anggota koperasi masih cukup terbatas. Karena itu, ia berharap agar para anggota bisa merekrut anggota baru, sehingga Koperasi Praja Nirmala bisa semakin tumbuh dan berkembang.Selainitu,Sekdajugamenginginkan agar pengurus koperasi PNS yang baru, bisa lebih optimal lagi dalam bekerja. “Sebenarnya tidak hanya pengurus, kemajuan suatu koperasi juga dari solidaritas dan peran serta anggotanya,” jelasnya. Sekda mengingatkan kepada para anggota koprasi agar terus meningkatkan kedisiplinan, sehingga ke depan tidak ada lagi kemacetan piutang dalam koperasi. Sementara itu, pengurus Koperasi Praja Nirmala Kabupaten Ketapang manargetkan keuangan yang akan masuk pada kepengurusan yang baru mencapai Rp557 juta. Jumlah tersebut tentu naik hingga dua kali lipat. Hal itu menyusul adanya sisa hasil usaha (SHU) yang mencapai Rp314 juta. “Kalau tahun 2012 ini hanya Rp98 juta, dengan sisa hasil usaha (SHU) sebesar Rp314 juta, jadi tahun depan target kita dua kali lipat lebih tinggi yakni Rp557 juta,” ujar Ketua Umum Koperasi Praja Nirmala Kabupaten Ketapang, Parto. Menurutnya, pemasukan terbesar koperasi yang dipimpinnya ini berasal dari simpan pinjam, dengan kontribusi sekitar Rp2,5 miliar. Dengan adanya penyertaan modal dari BKE, ke depan, ia optimis perkembangan koperasi ini akan bsa berkembang lebih baik lagi. “Bank ini kan milik anggota koperasi pegawai negeri yang ada di seluruh Indonesia, pernyertaan modal tersebut tentu saja akan dipergunakan untuk pengembangan koperasi pegawai negeri di Ketapang ini,” katanya. Sedangkan sisa hasil usaha koperasi, kata Parto, kemungkinan besar nantinya akan dibagikan kepada anggota, dalam bentuk tunjangan hari raya (THR). “Namun pembagian SHU nanti akan kira bicarakan lebih kanjut, tergantung kesepakatan hasil musyawarah,” imbuhnya. (ash)



Pontianak Post

Sabtu 31 Maret 2012

Bersiap Wakili Singkawang

Tangkap Tiga Pelaku Pencurian

SINGKAWANG- Pemenang lomba perorangan dalam Olimpiade Olah raga dan lomba Seni dan sastra Tingkat SD, SMP dan SLB se kota Singkawang, akan dipersiapkan guna mewakili kota ini di tingkat Provinsi Kalimantan Barat. “Secara otomatis mereka pemenang lomba mewakili Kota Singkawang di tingkat provinsi, kecuali yang grup atau sepak bola harus ada seleksi lagi karena kita perlu ada

SANGGAU--SatuanReskrim Polres Sanggau, Kamis (29/3) kemar in mengamankan sedikitnya 3 orang tersangka kasus pencurian di Sanggau danSekadau.Ketiganyaditangkap di Desa Penyeladi, Sanggau setelah melalui pengintaian yang cukup lama. Kasat Reskrim, AKP Muh. Husni Ramli membenarkan bahwa anggotanya telah mengamankan 3 orang tersangka dengan inisial EA (41),

perbaikan,” kata Kepala Dinas Pendidikan Kota Singkawang, Ahyadi ketika Acara Penutupan Olimpiade Olahraga dan lomba Seni dan sastra Tingkat SD, SMP dan SLB Kota Singkawang tahun 2012, Jumat (30/3) di SMP Pengabdi Kota Singkawang. Menurut Ahyadi, sebagai usaha mempersiapkannya,pelajarpemenang lomba akan diberikan latihan lebih ataupun training center dari para pembimb-

ing. Diharapkan itu dilakukan dengan serius. “Para pembimbing diharap melakukan dengan penuh semangat, sehingga perwakilan kita nanti siap secara fisik maupun mental,” katanya. Kegiatan Olimpiade Olah raga dan lomba Seni dan sastra, lanjutnya, telah dilaksanakan selama empat hari. Diharapkan untuk penyelenggaraan berikutnya akan berlangsung lebih baik dari

sekarang. Hadir dalam acara tersebut, Kepala Dinas Pendidikan Kota Singkawnag, Ahyadi, Kepala SKPD di lingkungan Pemerintah Kota Singkawang, Ketua Tim Penggerak PKK Kota Singkawang, Elisabeth Majuyetty Hasan Karman, Camat, Pimpinan Bank Kalbar, Pimpinan Bank BNI, Kepala Sekolah, Guru sekota Singkawang, panitia penyelenggara serta seluruh peserta olimpiade.(fah)

kepolisian. “Memang tugas pokok pengamanan tersebut dari kepolisian, tetapi kami pasti melakukan back up berupa upaya antisipasi dan diminta membantu kepolisian dalam pengamanan,” katanya.

Iaberharapprosesdemokrasi bisa berjalan lancar dan pengamanan sesuai dengan rencana dapat berjalan lancar. Karena pada dasarnya, pesta demokrasi adalah milik kita semua, maka harus dijaga keamanan dan ketertibannya secara bersama-sama juga. Sebelumnya, Kapolda Ka-

lbar, Brigjen Pol Unggung Cahyono mengatakan bahwa untuk pengamanan pilkada Kepolisian Daerah Kalbar mempersiapkan 6.872 personil atau 2/3 kekuatan kepolisian daerah Kalbar. Jumlah tersebut juga akan dibantu dari TNI sebanyak 2.774 personil. “Iya, kita kerahkan 2/3 kekuatan personil ke-

polisian dan dibantu dengan TNI. Tidak ada penempatan anggota secara khusus, semua daerah sudah kita siapkan pengamanannya. Pelaksanaan latihan-latihan pengamanan juga sudah dilakukan tinggal bagaimana nantinya berkoordinasi di lapangan saja,” jelasnya. (sgg)

Evi Pimpin Demokrat Mempawah Sambungan dari halaman 17

Sabli yang semula mendapat enam suara, berkurang menjadi lima suara, di mana satu suara abstain. Kemenangan tersebut langsung menghantarkan Evi mendapat mandat untuk memimpin partai berlambang bintang mersi ini dalam lima tahun ke depan. Secara simbolis, dia kemudian menerima bendera partai dari Rasmidi, sekretaris DPD Partai Demokrat Kalbar. Kepada sejumlah wartawan dalam konferensi persnya di Pontianak, kemarin (30/3) Evi menegaskan bahwa kemenangan yang diraihnya bukan merupakan kemenangan dirinya secara pribadi. Me-

lainkan kemenangan bagi Partai Demokrat dan para kader khususnya di Kabupaten Pontianak. Karena itu dia bertekad akan segera melakukan konsolidasi internal, dengan merekrut para kader dan pembenahan kesekretariatan dengan kemajuan Partai Demokrat.     “Kita akan merangkul dan memanggil kader yang sebelumnya pernah keluar untuk bergabung kembali. Begitu pula dengan para PAC-PAC yang tidak mendukung pada pemilihan kemarin tetap akan kita rangkul untuk membesarkan bersama-sama Partai Demokrat. Hal itu biasa dalam dinamika berpolitik,” tandasnya. Keberhasilan Evi, sontak

menambah lagi kepemimpinan kaum srikandi di Demokrat, setelah sebelumnya keberhasilan serupa terjadi di di Kabupaten Sambas dan Kapuas Hulu. Sama halnya dengan yang lain, dia juga berupaya menargetkan 30 persen perolehan suara pada Pemilu 2014 mendatang, dengan perolehan 10 kursi. Saat ini Partai Demokrat hanya menempatkan empat wakilnya di DPRD Kabupaten Pontianak. “Bukanlah target yang muluk-muluk tentunya harus dilakukan dengan kerja keras dan kesolidan dari semua elemen dan kader. Untuk itu bagaiman kita akan menjalankan roda organisasi

dengan pola transparansi dan musyawarah kepada pengurus dalam setiap mengambil keputusan,” ucapnya. Sementara itu, Koordinator Bidang Kominfo DPD Partai Demokrat Kalbar, Tesano, memberi apresiasi terhadap hasil muscab yang berjalan lancar dan sukses. Ia pun berharap kepada ketua terpilih yang baru dapat membawa PD ke arah yang lebih baik dan mampu membesarkan dan menyerap aspirasi. “Lakukan sosialisasi dan konsolidasi program partai hingga ke tingkat yang paling bawah. Dan saat terjadi pro kontra diharapkan tetap solid dan mengembalikan PD yang sejati,” imbaunya. (ote)

bupaten Mempawah sudah memiliki Peraturan Daerah (Perda) tentang walet. Namun, hingga kini belum bisa dijalankan lantaran belum ada persetujuan dari kementerian Dalam Negeri. “Perda walet memang sudah disahkan DPRD Mempawah. Namun pihak eksekutif belum bsia menjalankan. Lantaran, masih menunggu ersetujuan Menteri Dalam Negeri,” terang Susanto SE ME, Ketua Komisi A pada DPRD Mempawah.

Alasan musti diajukan ke pusat, disebabkan, perda itu menyangkut adanya pungutan retribusi pajak buat pemilik bangunan walet. Makanya, musti diajukan ke pusat dan harus mendapat persetujuan Mendagri. “Belum bisa dijalankan kepada sasaran pajak, lantaran belum ada peretujuan. Hinga kini mamang kita semua masih menunggu,kapan persetujuan itu disetuji dan dikembalikan kepada Pemkab,” ucapnya. (ham)

Dikepung Rumah Walet Sambungan dari halaman 17

“Satu unit bangunan, bisa menelan dana mendekati satu miliar,” kata pekarja saat diwawancarai. Bangunan rumah walet juga tidak dibangun asal-asalan. Satu bangunan posisi kotak ukuran 20x40 dengan ketinggian 35-50 meter lebih, dengan konstruksi cor bertulang. Sampai kini, khusus bangunan walate yang ada di kecmatan Sui Pinyuh belum diketahui secara pasti, berapa

jumlah. Namun ditaksir sudah lebih dari 300 buah lebih, dari berbagai ukuran. Baik yang dibangun untuk dijual lagi, untk disewakan atau bangunan tambahan. Camat Sui Pinyuh Drs Syamsul Rizal Msi mengaku, belum tahu pasti berapa jumlahnya. Sebab rekomundasi untuk pembangunan, tidak pernah disebutkan rekomundasi bangunan walat. “Rata-rata bangunan ruko,” akunya. Saat ini Pemerintah Ka-

Tersangka Dinilai Pro Aktif Sambungan dari halaman 17

diminta. Tipikor lama prosesnya karena perlu audit dari BPKP dan juga melibatkan instansi lain, baik secara pribadi maupun institusi. Tapi saya percaya bahwa Tipikor yang

sudah kita tangani akan sampai ke persidangan,” jelasnya saat dihubungi Pontianak Post. Sementara itu, salah satu pengamat hukum di Sanggau, Abdururrahim, SH menjelaskan bahwa untuk penahanan tersangka itu merupa-

Petani Gaharu Kapuas Hulu, Antonius L Ain Pamero, Sm.Hk beserta tiga petani pun ikut serta. Ketua Komisi B DPRD Kapuas Hulu, A Gupung, S.Tp mengatakan bahwa kunjungan pembelajaran itu merupakan upaya pihaknya untuk mendapatkan gambaran yang jelas akan budidaya gaharu. Dimana,KabupatenBangka Tengah, Provinsi Bangka Belitung adalah salah satu daerah yang sudah sukses membudidayakan gaharu. Padahal, gaharu yang di kembangkan di Bangka Tengah itu merupakan gaharu budidaya. “Sementara Kapuas Hulu ini merupakan kawasan populasi terbesar gaharu alam. Tapi hasil yang diperoleh masyarakat belum maksimal. Begitupun dengan yang ditanam masyarakat melalui budidaya. Sehingga perlu ada langkah transformasi pengetahuan agar pengembangan bisa baik dengan hasil maksimal,” ungkap Gupung. Diakui Gupung, dalam kunjungan pembelajaran itu, pihaknyabenar-benarmendapatkan referensi pengetahuan bagaimana pengembangan budidaya gaharu yang baik. Mulai dari kebijakan, payung hukum, sampai dengan implementasi di lapangan. Selama di sana pihaknya tidak hanya mendapatkan pengetahuan di dalam ruangan saja. Akan tetapi di bawa hingga ke lapangan. Seperti mengunjungi laboratorium inokulan gaharu Dinas Perkebunan dan Kehutanan Bangka Tengah, kunjungan ke pembibitan gaharu di Desa Nibung. Selain itu melakukan ramah tamah

dan dialog dengan kelompok tani setempat. Kunjungan ke kebun gaharu di Desa Lubuk Pabrik. Melihat penyuntikkan pohon gaharu di kebun budidaya gaharu Desa Lubuk Pabrik. “Bahkan kita di bawa untuk melihat penglahan pasca panen gaharu dan kunjungan ke kebun induk di Desa Trubus,” kata Gupung. Salah satu kelebihan di Bangka Tengah dikatakan gupung adanya dukungan dari pemerintah daerah dan DPRD akan program tersebut. Dinas Kehutanan dan Perkebunan di sana betul-betul melakukan pembinaan yang intensif. Bahkan disana telah dibangun laboratorium khusus gaharu. Sehingga mereka bisa menghasilkan inokulan yang berkualitas dengan harga yang murah. Padahal dikatakan Gupung, usia gaharu yang dibudidayakan antara Bangka Tengah dan Kapuas Hulu tidak jauh berbeda. Akan tetapi, di Bangka Tengah, kelompok tani yang ada sudah merasakan jerih payah menanam gaharu. Dimana pohon gaharu yang berusia antara 5 – 10 tahun sudah bisa diambil gubalnya. Bahkan gaharu di Bangka Tengah sudah mengantongi sertifikat. Sehingga dalam pemasaran dan tata niaganya sudah terlindungi dengan baik. Bahkan pengembangan gaharu tidak sebatas menghasilkan gubal. Pucuk daun gaharu di Bangka Tengah telah diolah menjadi teh gaharu. “Intinya banyak hal yang kita peroleh. Apa yang kita dapatkan itu akan kita mulai implementasikannya bersama Dinas Perkebunan dan Kehutanan.

Sambungan dari halaman 17

orang tua dan manajernya sangat kecewa. Pemberitaan seperti itu, tentu merugikan secara psikologis anak dan menjadi preseden buruk. Apakah data yang disampaikan direkayasa. Kita sangat yakin, media memperolehnya dari panitia. Untuk itu, IMI Kalbar harus bertanggungjawab. Pemberitaan ini jadi menyesatkan,” kata Zulkifli, kemarin. Diakui, anaknya mengikuti kejuaraan Motor Prix Regional 4 Seri 1 Singkawang yang dilaksanakan Sirkuit Taman Pasir Panjang, Singkawang, 3-4 Maret lalu yang dilaksanakan oleh Bupati Sekadau. Rivaldo pun, kata dia, menyabet tiga juara sekaligus. Rivaldo memperoleh juara masing-masing juara pertama kelas bebek 125 CC 4 tak TU

Pemula B (MP5), juara 2 kelas bebek 110 CC 4 tak TU Pemula B (MP5) dan juara kelima kelas bebek 110 CC 4 tak TU Pemula A (MP4). Suksesnya, anak baru gede yang menimba ilmu di SMP 1, kata orang tuanya, karena didukung oleh keluarga. “Dia mengikuti sekolah Racing School HRS Yogyakarta. Potensi dan bakat sudah diperlihatkannya sejak kecil,” kata dia. Kata Zulkifli, nama anaknya diganti dengan nama Syarif Yantri Ade S dan Farouk Faisal. “Kan, sangat aneh sekali. Tiba-tiba nama ini muncul. Apalagi salah satu dari pembalap yang dimasukan dalam pemberitaan itu adalah masih famili Ketua IMI Kalbar,” katanya lagi. Kondisi seperti ini, Pengurus KONI Singkawang juga menyayangkan. “Bila hasil pemberitaan

tidak sesuai dengan fakta yang sebenarnya, bisa saja dipidanakan. Ini sudah mencemarkan nama baik dan tentu merugikan prestasi atlet itu sendiri. Kalau Rivaldo berprestasi, mengapa tidak diakui. Jangan hanya gara-gara ingin mengikuti kejurnas akhirnya kita harus mengadaikan fakta yang sebenarnya,” kata Iskandar, kepada Pontianak Post, kemarin. Iskandar minta kepada IMI Kota Singkawang berkoordinasi dengan IMI Kalbar agar pemberitaan itu diklarifikasi. “Saya dengar juga orang tuanya berusaha menghubungi media dimaksud, agar diklarifikasi. Kita sangat berharap, tidak ada unsur kesengajaan yang dilakukan oleh orang yang tidak bertanggungjawab, khususnya panitia atau pun IMI Kalbar,” kata dia. (zrf)

kalau gedung DPRD terdaftar pun belum di jumlah aset yang akan diserahkan, sementara untuk kantor Pemkot yang baru ini sudah termasuk 162 aset yang diserahkan,” kata Kodam. Permasalahan aset sendiri, dikatakan Kodam, membuat pihaknya sangat kesulitan, karena jika tidak segera diselesaikan nantinya bisa menjadi masalah dalam pemerintahan. “Kita temukan gedung dan tanah telah diklaim masyarakat, bahkan tahun lalu kita sudah digugat untuk bangunan kantor PU, sekarang ini ada yang mengajukan surat gugatan ke BPN lagi, hal seperti inilah yang bisa mengganggu pemerintahan,

belum lagi masalah itu memengaruhi hasil penilaian BPK,” katanya.Bahkan, lanjutnya, dari terakhir di audit BPK tiga kabupaten dan kota (Singkawang, Bengkayang dan Sambas) diberikan semacam sok terapi, tidak akan diberikan opini jika masalah aset tidak diselesaikan. “Dua pencatatan di dua neraca karena kepemilikan aset, inilah yang menjadi persoalan,” katanya. Dari 162 aset yang ada, lanjut Kodam, kebanyakan bangunan sekolah, puskesmas dan sebagian kecil kantor yang beberapa diantaranya dimanfaatkan, bahkan ada yang digunakan tapi belum masuk daftar asset yang diserahkan.(fah)

Tak Termasuk Sambungan dari halaman 17

kata Bong Cin Nen, Jumat (30/3) di ruang paripurna DPRD Kota Singkawang. Kepala Dinas Pendapatan, Pengelolaan Keuangan dan Aset (DPPKA) Kota Singkawang, Siti Kodam Mariana menyebutkan selama kurun waktu sebelas tahun. Hanya dua aset yang telah di serah terimakan. Paling menyedihkan adalah kantor DPRD Kota Singkawang tidak masuk dalam daftar aset yang akan diserahkan. “Dua aset tersebut adalah RS Abdul Azis serta PDAM, meskipun dengan utang yang berjumlah Rp28 miliar, padahal aset yang diserahkan (PDAM) nilainya Rp16 miliar,

Pertambangan Belum Tertata Sambungan dari halaman 24

kan kewenangan penyidik. “Kalau tersangka dikhawatirkan melakukan pelanggaran saat proses hukum misalnya menghilangkan barang bukti atau melarikan diri, penyidik berhak menahan. Setelah P21, penyidik kepolisian diharap-

kan secepatnya menyerahkan tersangka dan barang bukti demi menjaga citra penegak hukum,” ujarnya. Ia menambahkan, jika diperlambat,maka akan menimbulkan pertanyaan masyarakat akan penegakan hukum. (sgg)

Kapuas Hulu Populasi Terbesar Gaharu Alam Sambungan dari halaman 17

Saat diamankan, tsk dari Sekadau menuju Sanggau. Saat ini tsk dan barang bukti sudah dibawa ke Sekadau. Hasil pengembangan terdapat 1 tempat kejadian perkara di wilayah hukum Polres Sanggau yakni pencurian di toko laptop dan tsk terekam CCTV.“ Modusnya 1 orang berpurapura membeli sedangkan tsk yang lain melancarkan aksi pencuriannya,” katanya.(sgg)

Pebalap Kecewa

Siap Back Up Sambungan dari halaman 17

HG (34) dan Nz (41). Ketiganya adalah warga Pemangkat, Kabupaten Sambas. “Tersangka diamankan berdasarkan informasi dari Polres Sekadau dengan sebuah Mobil AVANZA KB 1512 WH berwarna silfver. Di dalamnya ada 3 orang yang telah melakukan pencurian 1 unit LAPTOP TOHSIBA L735 warna abu-abu,” ungkapnya saat dihubungi Pontianak Post, Jumat (30/3) kemarin.

Kita akan dukung program dinas terkait pengembangan gaharu ke depan,” katanya. Gupung menegaskan tidak ingin mendengar cerita lagi bahwa program pengembangan gaharu ke depan tidak berjalan maksimal. Pihaknya akan mendukung penuh langkah-langkah strategis Dinas Perkebunan Dan Kehutanan. Bahkan terkait penganggaran, pihaknya akan melakukan pembicaraan dengan Bupati Kapuas Hulu. Menurut Gupung, langkah yang akan dilakukan tahap awal adalah mendata kembali sebaran kelompok tani dan bibit yang sudah pernah disalurkan. Lalu merumuskan rencana aksi berikutnya. Diantara rencana aksi itu adalah mendorong berdirinya laboratorium gaharu. Dengan laboratorium tersebut, maka persoalan-persoalan terkait gaharu akan ada saluran pemecahannya. “Salah satunya ketersediaan akan inokulan. Petani bisa mendapatkan dengan harga yang lebih murah dan jaminan yang jelas. Tidak seperti sekarang banyak yang menjual inokulan, harganya mahal dan tidak jelas jaminannya. Akibat yang ditimbulkan, petani kemudian dirugikan. Ini yang tidak kita inginkan,” papar Gupung. Sementara, itu, Wakil Ketua DPRD Kapuas Hulu, M Yusuf Habibi, menuturkan banyak ilmu dan wawasan tentang budidaya gaharu di Bangka Tengah yang bisa diimplementasikan di Kapuas Hulu saat ini dan ke depannya. Seperti bagaimana budidaya yang baik, bagaimana manajemennya yang dikelola oleh Gabungan Kelompok Tani

(Gapoktan). Kemudian, soal pendanaan bersumber dari mana saja. “Kita akui Populasi tanaman gaharu di daerah kita ini banyak, tapi jujur kita masih kurang paham soal mengelolanya. Mulai dari pengelolaan, pendanaan dan bagaimana proses menghasilkan gaharu lebih cepat dengan suntikan menggunakan inokulan. Di Bangka tengah itu lah kita mendapatkan banyak ilmu dan pengetahuan. Tentu mana yang baik itu yang akan kita implementasikan,” kata Yusuf. Yusuf juga mengapresiasi sambutan jajaran pemerintah dan DPRD Bangka Tengah terhadap kunjungan mereka itu. saat kunjungan, pihaknya di diterima langsung oleh Wakil Bupati Bangka Tengah, Ir. Patrianusa Sjahrun, beserta Ketua DPRD, Algafry Rahman ST, di pendopo rumah dinas Bupati. Data yang diperoleh dari Radar Bangka Online, jumlah keseluruhan tanaman gaharu di Kabupaten Bangka Tengah 380.871 pohon. Merupakan jenis gaharu budi daya yang tersebar di enam kecamatan dengan rincian Kecamatan Sungai Selan sebanyak 19.189 pohon. Kemudian Simpang Katis 20.314 pohon, Lubuk Besar 79.520 pohon, Namang 23.666 pohon, Pangkalan Baru 3.239 pohon, Koba 9.243 pohon dan bantuan dari bibit gratis 2010 225.700 pohon. Sedangkan gaharu alam sebanyak 2.473 pohon dengan rincian di Kecamatan Sungai Selan 394 pohon, Simpang Katis 131 pohon, Lubuk Besar 968 pohon, Namang 702 pohon, Pangkalan Baru 260 pohon dan Koba 18 pohon. (w@Nk)

kerjanya. Menurut dia, ada banyak potensi pertambangan yang dapat digali untuk menambah Pendapatan Asli Daerah (PAD). Namun, untuk menggapai semua itu tentu diperlukan sarana dan prasarana yang memadai serta biaya operasional untuk mengadakan survei, sehingga bidang pertambangan memerlukan

personil yang cukup agar segala sesuatu yang berada diperut Bumi Lawang Kuari dapat diketahui secara pasti. Mengenai pertambangan emas di Sekadau, akatanya, sampai saat ini belum terdata semuanya. Hal tersebut dikarenakan belum ada sarana dan personil untuk mengecek ke lapangan terkait keberadaan penambang emas. “Apakah mereka bekerja termasuk dalam Wilayah Pertambangan

Rakyat (WPR) atau tidak,” ujarnya. Dia optimis, apabila potensi pertambangan di Kabupaten Sekadau dikelola secara maksimal tentu berpotensi untuk meningkatkan PAD melalui sektor retribusi. Misalnya pertambangan yang ada di Kecamatan Nanga Mahap, Kecamatan Sekadau Hilir dan Kecamatan Belitang Hilir. “Cukup besar pemasukan yang bisa di raih kalau bisa di optimalkan,” ucapnya.(nie)

Rehab 145 SD,Kucurkan Rp30,2 M Sambungan dari halaman 24

datang. Oleh karena itu, dia meminta masyarakat tidak berburuk sangka terlebih dahulu kalau terjadi keterlambatan pekerjaan, karena harus ada penyesuaian sesuai PP No 54 yang menegaskan, bahwa Harga Penyesuaian Sendiri (HPS) dilaksanakan minimal 28 hari sebelum tender. “Kita juga sudah minta kepada konsultan untuk merubah item-item tertentu menyesuaikan kenaikan harga bahan baku,” ujarnya. Rehab dan pengadaan

sangat penting agar tidak ada lagi sekolah di Sanggau ini dalam kondisi memprihatinkan mengingat biaya untuk perbaikan sekolah, sarana dan prasarananya sangat besar. “Kan sayang kalau ada yang tidak dikerjakan. Otomatis anggaran akan kembali ke pusat kalau kita tidak laksanakan. Untuk pekerjaan, tidak akan membayar pekerjaan yang belum selesai 80 persen. Kalau belum segitu, tidak akan kita bayar,” tegasnya. Sementara itu, Kepala Dinas Pendidikan Pemuda dan Olahraga Yohanes Ontot

mengingatkan, agar pejabat di Diknas baik di tingkat guru, cabang dan kabupaten untuk selalu berhati-hati dan selalu memonitor pekerjaan rekanan agar tidak bermasalah di kemudian hari. Ia juga meminta agar koordinasi antara kabupaten, Cabang Dinas, guru, komite, masyarakat dan siswa terjaga dengan baik demi kemajuan dunia pendidikan Sanggau ke depan. “Diknas ini organisasi besar, maka saya harapkan kita selalu menjaga kekompakan kalau mau maju,” harapnya. (sgg)

Tingkatkan Ketahanan Pangan, Dandim Panen... Sambungan dari halaman 24

program pemerintah menjadikan berbagai daerah sebagai lumbung pangan nasional, sekaligus mendukung program ketahanan pangan. “Semua Koramil dituntut untuk melakukanprogramketahanan pangan seperti menanam padi. Hasilnya untuk masyarakat juga, kita hanya membantu dan melakukan pendampingan,” sebut Parlindungan. Parlindungan juga tetap berharap pemerintah Kabupaten Melawi bisa terus membantu mengembangkan programprogram tersebut, termasuk

program lainnya di sektor pertanian. “Kami harap program ini berlanjut tiap tahun yang tentunya harus didukung pemerintah, sehingga Melawi nanti terus dapat menjadi lumbung pangan serta petani akan sejahtera,” katanya. Ia melanjutkan program yang dilakukan ini di lahan binaan koramil Nanga Pinoh dan ini menjadi bentuk keterkaitan antara TNI dengan programprogram pemerintah. Apalagi soal ketahanan pangan sudah menjadi program utama dari Presiden RI. “Makanya kita buat program di mana untuk setiap triwulannya, kita cari

satu kabupaten untuk percontohan di satu kecamatan. Jadi, triwulan pertama ini kita ke Nanga Pinoh, sedangkan untuk triwulan berikutnya bisa ke Kotabaru,” katanya. Parlindungan mengungkapkan, program yang ada ini diharapkan dapat menghindarkan masyarakat dari kelaparan. Oleh karena itu, tanaman yang ditanam bisa saja berupa jagung, padi ataupun sinkong. Ia juga menuturkan, program yang dibangun TNI tentunya diharapkan bukan hanya dijalankan oleh anggota, tapi juga oleh seluruh masyarakat. (nov)

Tunggu Hasil BPKP Sambungan dari halaman 24

sendiri dan membuat kelompok baru sendiri dan membuat rekapitulasi sendiri, yang sehar-

usnya tidak boleh dilakukan. Akibat, Is telah merugikan petani yang tidak dapat bantuan dan dikenakan pasal

3 UU RI No 31 Tahun 1999, dengan ancaman kurungan paling lama dua puluh tahun penjara. (sgg)

Pontianak Post


Sabtu 31 Maret 2012


Siap Berpolitik KEPALA Dinas Kependudukan dan Pencatatan Sipil (Disdukcapil) Kabupaten Kayong Utara, MF Pohan, resmi pensiun pada Maret ini. Hal ini diakui Pohan karena telah menerima surat resmi dari Baperjakat. “Saya telah pensiun dan tidak diperMF Pohan p a n j a n g ,” kata Pohan, Jumat (30/3). Mengenai rencana ke depan, setelah tak lagi berada di jajaran birokrasi, Pohan akan mengisi waktunya lebih banyak untuk bisa berkumpul dengan keluarga. Tidak menutup kemungkinan, dia juga akan mencoba terjun di dunia politik. “Mungkin saya juga akan ke politik, karena saya juga tertarik di dunia itu. Maunya sih bergabung dengan partai oposisi seperti PDI P,” kata Pohan. Pohan juga berpesan, agar kasus proyek SIAK di Disdukcapil yang masih belum terselesaikan dan sekarang sedang diproses hukum, agar dapat diusut secara tuntas. “Ini harus diusut sampai tuntas dan jangan ada tebang pilih,” pesannya. Diakui Pohan, sejumlah pihak telah diperiksa Kejaksaan terkait permasalahan proyek SIAK di dinas yang dia pimpin. Seperti PPK, PPTK, Bendahara, termasuk dia selaku kepala dinas. (mik)


Sambaran Petir Robohkan Rumah Baru Basir MELANO – Petir menggelegar pada Rabu (28/3) malam lalu sekitar 19.00 WIB, ternyata langsung menghantam rumah milik Muhammad Basir, 60. Warga Jalan Penjalaan Dusun Sepakat Jaya, Rantau Panjang, Simpang Hilir ini, hanya bisa menyaksikan sebagian rumahnya yang porak poranda, bagai terkena gempa. Rumah dengan panjang 7 meter, serta lebar 5 meter ini berdiri persis di tiga penjuru. Diperkirakan, sambaran petir di rumah berdinding papan itu awal kali menghujam pada pojok kiri bagian belakang hingga memporakporandakan bagian lainnya. Ini dapat dilihat dari tiang penyangga rumah pojok bagian kiri, di mana kayu ukuran 8X8 itu pecah beserpihan. Sedangkan, dinding papan yang sudah rapi dipaku, bagai terserabut. Pintu depan dan belakang rumah milik Basir pun kini tak terpasang lagi di tempatnya akibat kejadian itu. Saat kejadian berlangsung, rumah yang baru selesai dikerjakan itu, belum sempat dihuninya. Basir bersama istri, Kadariah, dan anaknya, Agus Sumi, untuk sementara masih tinggal di rumah lama mereka yang terletak di pinggir Jalan Raya Sukadana – Teluk Melano. “Rencananya, Jumat (30/4) besok (kemarin, Red), kami akan pindah dan menempati rumah ini. Sebab, rumah lama kami juga sekarang tidak bisa ditempati karena mendadak roboh malam tadi,” ungkap Basir sedih. Basir baru menyadari ru-

mahnya telah porak-poranda pada 29 Maret lalu sekitar pukul 06.30 WIB. Dia mendapat kabar dari salah seorang warga, yang membawa berita bahwa rumahnya hancur disambar petir. Mendapat kabar kurang sedap itu, Basir yang menderita gejala stroke sejak enam tahun lalu langsung bergegas melihat rumah barunya. Tak pelak, Basir pun terkejut begitu mendapati rumah yang dia kerjakan seorang diri itu, kini berantakan. Saat ditemui, lelaki sepuh tersebut hanya bisa pasrah. Di balik kepasrahannya, rasa sedih tidak dapat disembunyikan dari wajahnya. “Mau diapakan (lagi), ini musibah dan ujian bagi saya, terpaksa harus mulai dari awal lagi,” ungkapnya dengan kedua mata berkaca-kaca. Basir yang akrab disapa Bujang Agung ini mengisahkan bahwa bahan yang digunakannya untuk mendirikan rumah barunya itu, sebagian merupakan hasil pemberian dari warga. Sementara sebagian lagi berasal dari rumah lamanya yang dia robohkan dan dipindahkan untuk mencukupi rumah barunya. Rumah yang lama, diakuinya, sudah lama dirobohkan, karena bahannya untuk menambah rumah yang baru. Tinggal bagian dapur yang disisakan untuk tempat tinggal mereka sementara. Tragisnya, dapur yang mereka jadikan tempat tinggal sementara juga mendadak roboh pada malam kejadian itu, karena memang kayunya sudah lapuk. “Untuk sementara, mungkin kami cari


TERSAMBAR PETIR: Muhammad Basir hanya bisa melihat rumah barunya yang seharusnya ditempati kemarin (30/3), kini roboh tersambar petir. Petir yang menggelegar pada Rabu (28/3) malam ternyata menyambar kediamannya, hingga porak poranda.

tumpangan di rumah saudara,” ungkap Basir kembali terbatabata. Kehidupan orang tua tersebut memang tergolong miskin. Akibat gejala stroke yang dialaminya sejak enam tahun lalu, membuatnya tidak bisa bekerja keras. Sementara istrinya, Kadariah, hanya seorang ibu rumah tangga. Untungnya di Kabupaten Kayong Utara, biaya pendidikan gratis, sehingga anak semata wayangnya,

Agus Sumi, bisa bersekolah dan sekarang sudah duduk di kelas III SMP. “Kebutuhan seharihari, biasa kami dapat dari bantuan warga,” kata Basir sambil mengusap air matanya. Dinsosnakertrans Beri Bantuan Pemerintah Kabupaten (Pemkab) Kayong Utara melalui Dinas Sosial, Tenaga Kerja, dan Transmigrasi (Dinsosnakertrans) langsung bergerak

cepat mengatasi apa yang dialami Basir. “Kita telah melihat langsung kondisi rumah korban yang tertimpa musibah. Selain itu, kita juga membawa beras 50 kilogram, peralatan dapur berupa food ware family kids, selimut, dan lain-lain. Bantuan ini bersifat emergency saja dan yang lain kita tunggu laporan dari desa,” kata Kabid Sosial Dinsosnakertrans, Lilik Hariadi, kemarin (30/3). (mik)

Liga Dandim Cup, Geosit Cukur Jalin Vaneo 4-0 SUKADANA- Geosit FC berhasil melaju ke langkah berikutnya di Liga Dandim Cup, setelah berhasil mencukur Jalin Vaneo dengan kemenangan telak 4-0 di GOR Tantemak Ketapang, Rabu (28/3). Manajer Geosit FC, Ati, merasa senang atas keberhasilan yang

didapat tim besutan Siduk itu. Kemenangan Geosit diawali dengan sundulan Henki yang memanfaatkan umpan manis dari Fahrijal di babak pertama, setelah 20 menit jalannya pertandingan. Setelah 10 menit kemudian, Kus yang bermain di posisi belakang,





maju ke depan hingga berhasil merobek gawang lawan. Skor 2-0 untuk kemenangan Geosit FC pun tidak berubah hingga turun minum. Di babak kedua, Geosit terus melakukan serangan. Tibi yang di posisi striker berhasil menambah

kemenangan Geosit menjadi 3-0, setelah berhasil memaksimalkan umpan silang yang ditendang Kus pada menit 60. Setelah 15 menit kemudian, Tibi yang diboyong dari Pontianak, kembali memperbesar kemenangan bagi tim andalan di Kabupaten Kayong Utara. Skor

4-0 pun tak berubah hingga wasit meniup peluit panjang. Geosit versus Jalin Vaneo merupakan putaran kedua. Sebelumnya, pada putaran pertama kapten Geosit, Rajali dkk, berhasil melumatkan Catalunia dengan kemenangan tipis 2-1. (mik)

PRO-KALBAR Pontianak Post


Rehab 145 SD Kucurkan Rp30,2 M


Pertambangan Belum Tertata DINAS Pekerjaan Umum (PU) Kabupaten Sekadau melaui Bidang Pertambangan ESDM, mengakui potensi pertambangan di Kabupaten Sekadau yang sejauh ini belum bisa diketahui secara pasti. Padahal jika potensi itu bisa diketahui, maka hal itu akan menarik perhatian investor untuk menanamkan modalnya di Bumi Lawang Kuari. “Selama ini kita masih banyak kekurangan hingga masih kurang.. Padahal ada banyak potensi pertambangan di tempat kita yang masih Mawardi Hasibuan belum tergali,” kata Kepala Bidang Pertambangan, Dinas PU Kabupaten Sekadau Mawardi Hasibuan, belum lama ini di ruang Ke Halaman 22 kolom 5


Tunggu Hasil BPKP KASUS dugaan korupsi pengadaan bibit jeruk 38.400 batang bibit jeruk dengan nilai Rp600.000 di Dinas pertanian Sanggau dengan tersangka Is, sejak tahun 2006 hingga kini belum dilimpahkan ke Pengadilan Negeri Sanggau. Kajari Sanggau melalui Kasi Pidana Khusus Rya Dilla ketika ditemui mengatakan, kasus dugaan korupsi tersebut merupakan tunggakan karena banyak pejabat Kejaksaan yang pindah, sekarang masih dalam penyelidikan dan menunggu hasil dari audit BPKP untuk mengetahui berapa besar kerugian negara. “Sekarang masih mencari harga satuan standar bibit jeruk dari provinsi,” katanya. Lebih lanjut, tersangka Is diduga menyalahkan hak kewenangan, karena dia memilih kelompok

Sabtu 31 Maret 2012


PANEN JAGUNG: Dandim 1205 Sintang Letkol Infantri Parlindungan Hutagalung didampingi unsur masyarakat melakukan panen jagung.

Tingkatkan Ketahanan Pangan, Dandim Panen Jagung MELAWI--Dalam upaya meningkatkan Ketahanan Pangan, Komando Distrik Militer (Kodim) 1205 Sintang melaksanakan panen jagung di Desa Tanjung Sari, Kecamatan Nanga Pinoh, Kamis (29/3). Hasil panen cukup mengembirakan mencapai 3 ton/hektar. Dandim 1205 Sintang Letkol Infantri Parlindungan Hutagalung mengungkapkan, panen jagung di lahan yang merupakan bentuk upaya TNI dalam memberdayakan sektor pertanian, terutama meningkatkan ketahanan pangan masyarakat. “Jadi tugas pokok TNI juga melaksanakan pemberdayaan

secara dini di wilayah pertahanan. Ini juga dilakukan untuk ikut membantu pemerintah, terutama dalam soal menjaga ketahanan pangan masyarakat Indonesia,” ujar Parlindungan di depan masyarakat Tanjung Sari. Dihadiri Camat Nanga Pinoh Midi Amin dan didampingi sejumlah anggota Danramil serta elemen masyarakat setempat, Parlindungan mengatakan, panen jagung di Desa Tanjung Sari ini dilakukan di atas lahan seluas 1 hektar dan menghasilkan 1 ton jagung, dan rencananya ke depan bukan hanya di Kecamatan Nanga Pinoh saja

Ke Halaman 22 kolom 5

diadakan panen seperti ini. Namun, akan dikembangkan ke kecamatan lain sesuai dengan Undang-undang nomor 34 Tahun 2004 tentang TNI yang menyebutkan, bahwa program tersebut merupakan program pengembangan ketahanan pangan. Untuk pencanangan program itulah, sehingga digelar panen jagung di Desa Tanjung Sari Kecamatan Nanga Pinoh yang sifatnya kerjasama masyarakat dengan Koramil Nanga Pinoh. Lebih lanjut ia menjelaskan, program ketahanan pangan ini dilakukan untuk mendukung Ke Halaman 22 kolom 5

SANGGAU--Sedikitnya 145 Sekolah Dasar (SD) se Kabupaten Sanggau akan direhab pada 2012. Perbaikan tersebut dengan rincian 435 ruang kelas menggunakan dana DAK 2012 dengan pagu dana Rp30,2 miliar. Sementara untuk pengadaan gedung perpustakaan sebanyak 46 gedung dengan anggaran Rp5,4 miliar. “Untuk pengadaan alat peraga sebanyak 47 paket, dana yang tersedia Rp2,4 miliar. Sedangkan pekerjaan proyek tersebut dengan menggunakan sistem swakelola dan tender lelang,” kata Kepala Bidang TK/SD Dinas Pendidikan Pemuda dan Olahraga (Dikpora) Kabupaten Sanggau, Suparman, Kamis (29/3). Dijelaskannya, saat ini proses pemutahiran data sekolah, guru, siswa dan sebagainya sedang dibicarakan dengan 15 kepala Cabang Dinas Pendidikan Kecamatan se Kabupaten Sanggau. “Inilah yang kita bicarakan dalam rapat, kita inginkan dalam waktu dekat, ada data baru tentang infrastruktur sekolah, guru, siswa dan lain sebagainya,” jelas Parman. Ia memprediksikan kemungkinan besar akan terjadi keterlambatan proyek tersebut, mengingat perubahan harga bahan baku menjelang kenaikan BBM per 1 April men Ke Halaman 22 kolom 5






Pontianak Post

Sabtu 31 Maret 2012

Soccer Man City




City Hadapi Mitos

MANCHESTER - Tinggal delapan laga lagi (4-2-3-1) Man City Sunderland (4-4-1-1) kompetisi Premier League akan berakhir. Akibat keteledoran saat kalah dari Swansea 0-1 (11/3) dan 22 2 18 ditahan seri Stoke City 1-1 (24/3), Manchester City 19 Clichy McClean Meyler terlempar dari takhta klasemen dan tertinggal tiga Nasri angka di belakang Manchester United. 42 28 Kondisi yang membuat ambisi City mengakhiri 23 25 28 Yaya Toure Sessepuasa gelar di kasta teratas kompetisi Inggris gnon McClean Kyrgiakos Kolo Toure selama 44 tahun berada dalam ancaman. Selain 25 22 32 10 harus menunggu United tergelincir, mereka juga Mignolet Hart 8 4 Tevez Dzeko 4 tidak boleh melakukan kesalahan sedikit pun. Gardner Turner Kompany Bila terus menang, maka City punya peluang 52 18 ketika bertarung pada derby Manchester, 30 April Bendtner nanti. Sebelum terlalu jauh memikirkan derby, 6 7 2 Barry 11 mending mereka fokus agar tidak tergelincir lagi Johnson CatterLarsson Richards mole saat menjamu Sunderland, malam nanti (siaran Stadion : Etihad, Manchester-Wasit : Phil Dowd langsung MNCTV kickoff 21.00 WIB). Pelatih :Roberto Mancini Pelatih: Martin O’Neill City benar-benar harus waspada kepada The Black Cats alias si Kucing Hitam. Dalam beberapa mitos, kucing hitam seringkali dianggap memHead to Head bawa sial. Di Inggris, mitos kucing hitam juga 01/01/12 Sunderland v Man. City 1-0 negatif. Akankah Sunderland menjadi pembawa 03/04/11 Man. City v Sunderland 5-0 sial buat City? 29/08/10 Sunderland v Man. City 1-0 Menilik pada bentrok sebelumnya, di mana 14/03/10 Sunderland v Man. City 1-1 City kalah dari Sunderland 0-1 pada 1 Januari 19/12/09 Man. City v Sunderland 4-3 lalu, melalui gol tunggal Dong-Won Ji pada injury time, maka potensi mereka membawa sial bakal dia (Aguero), tetapi dia tidak bisa bermain karena cedera besar. City harus ekstra waspada. itu, mungkin untuk sehari, 10 hari, atau dua pekan. Saya Selain itu, mereka juga tidak boleh panik, Inilah tidak tahu,” ketus Mancini, seperti dikutip Daily Mail. yang menjadi masalah bagi tim yang mental juarUntunglah, hubungan dengan Carlos Tevez sudah anya belum teruji, mudah panik pada fase-fase membaik. Dengan begitu, Mancini bisa memainkrusial. Untuk yang satu ini, United kan Tevez. Bila itu terjadi, maka ini adalah starter jelas unggul jauh di atas City. Soal pertama Tevez setelah ulah kontroversialnya dan materi pemain, mungkin City bisa pertengkarannya dengan Mancini. dibilang lebih variatif dan lengkap. Kabar baik lainnya datang dari pulihnya kapten Saling serang melalui media yang Vincent Kompany dari cedera betis. Dia berpeluang dilakukan Patrick Vieira, direktur turun mengisi jantung pertahanan menemani Kolo pengembangan sepak bola, kepada Toure, karena sekarang Joleon Lescott belum bisa kubu Setan Merah, julukan United. Siaran Langsung bermain akibat cedera otot. Sekalipun Vieira belakangan memSituasi yang dialami City sekarang membuat MNC TV bantahnya, tetapi psywar terus bermantan manajer Sunderland Peter Reid mulai ragu langsung. Pukul 21.00WIB mereka bisa juara. ”Saya berpikir City bisa menang Roberto Mancini, manajer City, juga pada Desember lalu. Saya pikir segalanya telah menunjukkan kepanikan ketika striker usai, tetapi sekarang saya harus mengubah pikiran saya,” andalannya Sergio Aguero mengalami cedera. ”Itu kata Reid. (ham) cedera yang bodoh. Itu memang bukan kesalahan



Carlos Tevez

Optimistis Kontribusi Tevez



Striker Manchester City asal Argentina itu diyakini akan membayar kepercayaan rekan-rekannya dan pelatih untuk bisa diandalkan di sisa musim ini. Carlos Tevez terus menunjukkan performa positif bersama Manchester City sejak pencekalannya dicabut Roberto Mancini. Di laga terakhir bersama tim reserves, Tevez kembali mencetak gol. Bagi Yaya Toure hal itu menunjukkan indikasi positif dari kembalinya Tevez di momentum terbaiknya dan Citizen bakal mendapat keuntungan dari hal itu. “Dia tahu ketika dia kembali ke klub dia menyadari sudah membuat kesalahan, tapi kini semua sudah berakhir dan dia fokus memenangi Liga Primer Inggris,” ujar Yaya Toure yang dinukil Sky Sports. “Dia ingin menunjukkan sebanyak mungkin kepada fans betapa menyesalnya dia. Dia akan menjadi pemain penting bagi kami karena dia ingin membuktikan kualitasnya.” “Saya yakin dia akan fantastis di sisa musim ini,” tutup Yaya Toure dilansir Tevez mungkin akan tampil di akhir pekan ini saat menjalani lanjutan Liga Primer Inggris melawan Sunderland di Etihad Stadium, mengingat Sergio Aguero sedikit bermasalah dengan kakinya. (int)

All soccer

26 Liga Domestik Tak Lagi Menarik


ATHLETIC Bilbao tidak bisa berlama-lama merayakan kemenangan atas Schalke 04. Sebab, hanyaselang48jamsepulangdariGelsenkirchen, Bilbaokembalimelawatketempatyanglebihsulit. Yakni, mengunjungi Barcelona di Nou Camp (siaran langsung TV One pukul 03.00 WIB) BarcaversusBilbaobolehdibilangmerupakan big match di jornada ke-30 Liga Primera. Ini juga pemanasan kedua tim sebelum bertemu dalam final Copa del Rey di Vicente Calderon (25/5). Namun, ancaman kebugaran karena minimnya recovery dan status bukan klub dengan skuad besarmembuatentrenadorBilbaoMarceloBielsa kesulitan dalam melakukan rotasi. Bielsa pun khawatirtrennegatifLosLeones“sebutanBilbao “ di liga domestik kembali berlanjut. Dalam empat laga terakhir, Bilbao tidak pernah menang dengan tiga di antaranya berakhir dengan kekalahan. Imbasnya, peringkat Bilbao terus merosot. Bulan lalu, Bilbao masih berada di kisaran empat besar. Kini, Andoni Iraola cs sudah terlempar dari sepuluh besar. “Lawan-lawan kami di liga domestik berhasil memanfaatkan kelelahan kami di Eropa, karena starting eleven kami di kedua ajang itu memang nyaris selalu sama,” kata Bielsa seperti dikutip AS. Gara-gara peringkat liga yang terus merosot, Bilbao mulai berpikir realistis. Seiring empat besaratauzonaLigaChampionssemakinmenjauh, Bilbao hanya menargetkan terhindar degradasi. Fokus Bilbao lebih dicurahkan untuk Europa League dan tentu saja final Copa del Rey. “Kami tidak menyangka masih eksis di tiga ajang yang kami ikuti musim ini. Kami pun sadar sangat sulit untuk tetap menjaga kondisi fisik dan konsistensi permainan tim di semua ajang tersebut,” kata kiper Bilbao Gorka Iraizoz di situs resmi klub. Iraizoz merupakan pemain Bilbao dengan minute play terlama musim ini. Iraizoz mencatat 4.320 menit dari 48 pertandingan. Di bawahnya, ada sembilan pemain Bilbao lainnya yang mencatat minute play lebih dari 3 ribu menit. Sebagai catatan, sejumlah ilmuwan sepak bola menyimpulkan apabila fisik pemain di liga Eropa akan menurun setelah 3 ribu menit. Padahal, Bilbao belum menuntaskan musim ini. Jika mampu lolos ke final Europa League, Bilbao bakal memainkan 63 pertandingan. Jumlah yang terlalu banyak untuk agenda klub Eropadalamsemusimyangrata-ratahanya45-50 pertandingan. (dns/bas)

Pontianak Post


Sabtu 31 Maret 2012

Catania v AC Milan

Maksimalkan Potensi Menjauh CATANIA - Persaingan scudetto di Serie A Liga Italia sudah mulai memasuki fase-fase penentu. Pantang bagi AC Milan ataupun Juventus sebagai dua kandidat utama scudetto kehilangan konsentrasi di sembilan pertandingan sisa. Kedua tim, fokusnya terbagi. Milan dengan Liga Champions dan Juve dengan Coppa Italia. Tetapi, konsentrasi Milan lebih berat, karena mereka masih berada pada perempat final dan lawannya adalah juara bertahan Barcelona. Makanya, sebelum konsentrasi semakin terbagi, Milan berambisi memaksimalkan kesempatan untuk menjauhi Juve. Pada pekan ke-30, ketika Juve bertarung melawan Napoli, Senin dini hari (2/4), Milan bentrok dengan Catania, dini hari nanti (siaran langsung Indosiar pukul 02.45 WIB). Menilik pada rekor bentrok dengan Catania, Milan punya potensi menang. Bahkan, di Angelo Massimino, markas Catania, sekalipun. Sejak 2007, Milan selalu membawa pulang angka dan dalam tiga lawatan terakhir selalu menang. Lagipula, selain ingin menjauhkan diri dari Juve, di mana sekarang Milan mengemas 63 poin dan unggul empat angka atas Juve, mereka juga ingin mempersembahkan kemenangan kepada Silvio Berlusconi yang mulai kemarin (30/3) resmi kembali menjadi presiden Milan. Allenatore Milan Massimiliano Allegri tentu tidak mau dua kali membuat Berlusconi kecewa.


Zlatan Ibrahimovic

Ketika bermain imbang tanpa gol melawan Barcelona (29/3), Berlusconi kecewa berat karena Milan tidak memainkan sepak bola indah yang diinginkannya. Kekecawaan Berlusconi ditunjukkan dengan keluar dari stadio tanpa mengeluarkan kata sepatahpun. “Ayah saya senang dengan cara Barcelona bermain dan dia ingin Milan melakukan yang sama. Tetapi,


kami memiliki pemain dengan tipe berbeda,” jelas Barbara Berlusconi, putri Berlusconi, seperti dikutip Football Italia. Allegri menyadari, cara mengambil kembali hati Berlusconi adalah dengan kiprah di lapangan. “Saya tidak punya masalah dengan Berlusconi. Kami tetap sering berbicara. Soal melawan Catania, kami akan memainkan gaya berbeda,” kata Allegri.

Kebetulan, Milan juga punya tambahan beberapa tenaga fresh yang baru pulih dari cedera seperti Ignazio Abate atau Mark van Bommel yang sebelumnya absen melawan Barcelona karena skorsing. “Kondisi fisik pemain sudah membaik dan ada beberapa pemain yang comeback,” jelasnya. Masalahnya, tidak akan mudah bagi Milan untuk menang kali ini. Catania yang dilatih

Vincenzo Montella sedang on fire. Sejak Januari lalu, mereka sudah mengemas 20 poin dan hanya tidak kali kalah dari 13 pertandingan. “Kami tahu cara dan sistem permainan mereka. Kami bisa beradaptasi. Tetapi, akan berat karena mereka tim yang tangguh. Dukungan fans akan sangat fundamental bagi perjuangan kami di lapangan,” bilang Montella. (ham)








Pontianak Post ● Sabtu 31 Maret 2012


"Kok ada keraguan besar di hati kamu? Coba dengarin aja kata hatimu secara lebih peka. Sebab, suara-suara dari luar malah bikin hatimu semakin bimbang."


"Lebih giat dan kesuksesan sekarang buatlah menjadi motivasi, bukan malah membuatmu semakin merasa cukup. Dorong dirimu sendiri lebih keras lagi."

(22 Desember-19 Januari)

(20 Januari-18 Februari)


(19 Februari-20 Maret)

"Kamu butuh ikut kegiatan baru deh, cocok untuk kamu yang senang tantangan. Untuk urusan asmara, kamu harus sedikit mengurangi ego dan keras kepalamu."

Bete banget mergokin mantan jalan sama gebetan barunya!

Kita masih menyimpan barangbarang pemberian mantan.

Setiap malam kita berharap mantan ‘datang’ di mimpi.

Ada yang flirting sama kita. Kasih respons nggak ya?



"Wah, kamu lagi semangat-semangatnya nih. Soalnya, ada seseorang di belakangmu yang selalu ngasih tambahan spirit. Masalah kecil jangan dipikir serius."


“Lagi deket sama seseorang nih? Jaim sih boleh, tapi jangan sampai jadi sosok yang nggak kamu banget. Yakin deh bahwa kamu adalah pribadi yang luar biasa.”

HP selalu dipegang karena berharap ada SMS atau telpon dari mantan.


"Jangan keburu ngedrop dan mundur sebelum mencapai tujuan. Itu sih kalah sebelum bertarung. Yakinlah bahwa kamu pasti bisa mencapai yang kamu pengenin."



"Merasa nyaman di suatu kelompok tertentu? Kenapa nggak dilanjutkan, seseorang memang membutuhkan ’’tim” untuk memajukan dirinya."


"Rentan galau nih. Jangan suka menyimpulkan hanya dari perspektif kamu. Jangan sampai kesalahanmu mengambil kesimpulan malah membuat kamu galau."


"Two thumbs-up buat kamu! Kamu termasuk orang yang mudah banget move on. Aura positif kamu ini mendatangkan hal-hal baik lain. Cieee semangat terus yah!"


"You need holiday! Kalau nggak ada waktu untuk liburan ke tempat yang tenang, kamu bisa makan malam bareng teman atau pacar di tempat yang romantis."

(20 April-20 Mei)

(21 Mei-20 Juni)

(21 Juni-22 Juli)

(23 Juli-22 Agustus)

(23 Agustus-22 September)

(23 September-22 Oktober)

(23 Oktober-22 November)


(23 November-21 Desember)

"Minggu ini, hubunganmu dengan pacar plus mood kamu kaya roller coaster yah. Gampang naik-turun dengan sangat cepat. Ayo belajar mengendalikan diri kamu."

START! Kita masih suka nangis kalau dengerin lagu kenangan berdua.

Foto berdua mantan masih tersimpan rapi di dompet kita.

"Lagi berubah jadi batu ya? Introspeksi nggak ada salahnya kok. Kalau bingung, berarti inilah waktunya kamu membutuhkan orang lain untuk diajak bicara."

(21 Maret-19 April)

Status Facebook, Twitter atau BBM menunjukkan kangen kita ke mantan.


: Ya : Nggak

PATAH hati emang nyebelin. Belum lagi kalau mantan masih menari-nari di pikiran. Huh! Daripada bete, mendingan ukur secepat apa kita mampu melupakan mantan yang, uugh…ngeselin!

Sendirian kemanamana bikin kita sedih.



Hidup lebih bebas karena nggak perlu laporan ke pacar setiap saat.




A. Minimum Speed Ibarat mobil, kecepatan kita lambaaat banget. Kalaupun maju, pelan banget. Buat kita, kenangan sama mantan susah ditinggalkan gitu aja. Duh, gals, daripada buang masa muda kita nangisin mantan, mending cari pengalih perhatian. Coba cari hobi baru atau make over penampilan. Syukur-syukur ada cowok baru yang head over heels, hehe. Cheer up, please. B. Going For Another Pit Stop Kalau disuruh balik lagi sama mantan, kita mungkin nggak mau. Tapi, perlu diakui, memang terasa berat banget putus sama dia. Untungnya, kita punya obatnya, yaitu perhatian yang diberikan cowok lain. Kita memang paling suka diperhatikan, dimanja, dan disayang. Boleh saja sih, asal nggak salah pilih, ya. jangan gara-gara pengin cepat ngelupain mantan, kita mengiyakan pernyataan cinta cowok pertama yang naksir. Kasihan, kan, kalau dia cuma dijadikan pelarian. Remember, boys aren’t toys… C. Whoosh…! Begitu putus, kita langsung tancap gas ngelupain mantan. Nggak ada, tuh, dalam kamus kita mengingat-ingat yang sudah lewat. Apalagi mellow-mellow-an kangen sama mantan. Memang, sih, nggak dipungkiri awal-awal jadi jomblo itu berat. tapi, nyatanya setelah dijalani kita tetap survive tuh. Dan sekarang, kita justru sangat menikmati kebebasan baru ini. Kata siapa hidup tanpa pacar itu seperti sayur tanpa garam? Nggak ada pacar, nggak ada masalah kok. Horeee! (*/kwk)


@ X pr e s iP t kPo s t


X-presi Pontianak Post



Siap Pertahankan Juara Umum


KONTINGEN Pekan Olahraga Pelajar Daerah (POPDA)kotaPontianakbertekadkembalimempertahankan gelar juara umum di ajang tersebut yang rencananya akan dihelat Mei mendatang di kota ini. Sebagai tuan rumah para pelajar kota Pontianak siap mempertahankan gelar juara umum yang direbutnya tahun lalu. Hal ini ditegaskan Kepala Dinas Pemuda dan Olahraga Kota Pontianak Suparma kepada sejumlah wartawan di ruang kerjanya kemarin. Menurutnya saat ini seluruh atlet, pelatih dan manager telah dipersiapkan mengikuti seluruh cabang olahraga yang dipertandingkan. Diantaranya, tenis meja, tenis lapangan, bolavoli, pencaksilat, sepaktakraw, bulutangkis, bolabasket dan sepakbola dengan jumlah 133 atlet, 16 pelatih dan 8 manager. Pemilihan atlet tersebut, dilakukan dengan mekanisme seleksi yang ketat yakni dimulai dengan even kejuaraan cabang olahraga yang digelar, kemudian pemantauan, pemanggilan atlet dan terakhir penyeleksian atlet bekerja sama dengan pengcab cabang olahraga bersangkutan. Dirinya menegaskan juara umum menjadi harga mati bagi tim POPDA. Pasalnya melihat potensi atlet yang dimiliki di kota pontianak ini dirinya yakin target tersebut akan terpenuhi. Apalagi, lanjut dia, pihak Dispora Kota Pontianak bekerja sama dengan pengcab cabang olahraga terus melaksanakan pembinaan atlet muda. (bdi)

Pontianak Post


Sabtu 31 Maret 2012

Walikota Prihatin Prestasi Sepakbola PONTIANAK--Terpuruknya prestasi sepakbola Kota Pontianak di ajang tingkat Provinsi Kalimantan Barat seperti Porprov 2010 lalu dan terakhir di Kompetisi Sepakbola Divisi III tingkat provinsi Kalimantan Barat mendapat perhatian serius dari Walikota Pontianak Sutarmidji. Orang nomor satu di kota Kahtulistiwa ini prihatin terhadap pembinaan yang sudah dilakukan klub dan PSSI kota Pontianak. Ditemui wartawan beberapa waktu lalu di Halaman Kantor Walikota Pontianak Sutarmidji mengungkapkan keprihatiannya tersebut. Dirinya merasa heran mengapa sepakbola Kota Pontianak tidak mampu berprestasi di kancah provinsi, padahal, kata dia, Kota Pontianak memiliki akses terdepan dalam pembinaan sepakbola dan didukung dengan sarana dan prasarana sepakbola yang representatif. “Ini yang membuat saya prihatin. Berbanding terbalik dengan daerah lain yang memiliki sarana dan prasarana yang kurang memadai justru memiliki pembinaan dan prestasi yang baik,” ungkap dia. Menurut dia Kota Pontianak saat ini sudah memiliki banyak lapangan sepakbola. Terdapat di Pontianak Utara, Pontianak Kota, Pontianak Timur, Pontianak Barat dan Pontianak Selatan. “Hampir seluruh kecamatan di kota Pontianak ada lapangan namun sayangnya prestasi malah melempem,”

ujar dia. Dengan kondisi seperti ini, Walikota menilai hal ini sebenarnya kembali ke ranah organisasi PSSI kota Pontianak. Dia mengatakan PSSI kurang getol dalam melakukan pembinaan, bahkan dia menilai selama ini PSSI belum melakukan program pembinaan bagi perbaikan prestasi tersebut. Maka dari itu dirinya meminta agar Dispora Kota Pontianak sebagai salah satu ujung tombak pembianaan olahraga, termasuk di dalamnya sepakbola melakukan sesuatu bagi kemajuan prestasi sepakbola kota ini. Salah satunya dengan menggelar kompetisi sepak bola kelompok umur secara berkesinambungan. “Saya harap Liga Pelajar Indonesia Piala Presiden tingkat kota Pontianak ini bisa memberikan kontribusi positif bagi perkembangan dan kemajuan pembinaan sepakbola usia dini,” harapnya. Dia juga meyakini, setiap sekolah di kota Pontianak pasti memiliki atletatlet sepakbola handal dan berpotensi yang kelak bisa menjadi pemain berbakat dari daerah ini. Selanjutnya dia mengharapkan induk organisasi cabang olahraga sepakbola PSSI bisa berkolaborasi bersama Dispora serta instansi lainnya dalam melaksanaan terobosan pembinaan berkesinambungan. (bdi)


Foto Budianto/Pontianak Post

PRIHATIN: Prestasi sepakbola Kota Pontianak di ajang tingkat daerah yang semakin melempem mendapat perhatian serius dari Walikota Pontianak Sutarmidji. Dia menilai PSSI Kota Pontianak kurang melakukan terobosan dalam pembinaan sepakbola.

Kota Pontianak Gudang Atlet Bolavoli Junior VOLI JUNIOR: Para atlet junior putri yang akan berkompetisi 29 Maret hingga 5 April di Lapangan ICM Ponbar pada acara pembukaan Kamis (29/3) kemarin. FOTO Budianto/Pontianak Post

PONTIANAK--Hampir setiap tahunnya Kota Pontianak selalu menyabet seluruh gelar juara pada kompetisi bolavoli junior antar kabupaten kota, baik di nomor bolavoli indoor maupun pasir. Untuk mempertahankan prestasi tersebut, Pengcab PBVSI Kota Pontianak terus gencar melaksanakan pembinaan bagi para atlet muda, salah satunya dengan menggelar berbagai kompetisi bolavoli junior antar klub kota Pontianak. Saat ini kompetisi tersebut sedang berlangsung, sejak 29 Maret hingga 5 April mendatang di Lapangan Bolavoli ICM Kantor Kecamatan


Pontianak Barat. Even bolavoli tersebut, Kamis (29/3) sore kemarin dibuka secara resmi Walikota Pontianak yang diwakili Kepala Dinas PemudadanOlahragaSuparma. Turut hadir Binpres KONI Kota Pontianak Ramli Ramlan. Kepada sejumlah wartawan usaimembukakegiatantersebut Ketua Umum Pengcab PSSI Kota Pontianak Eka Kurniawan menjelaskan even ini digelar setiap tahun sebagai agenda tetap dari Pengcab PBVSI Kota Pontianak. Melihat antusias para klub yangterusgencarmelaksanakan pembinaan atlet-atlet muda,

tahun ini PBVSI kota Pontianak kembali termotivasi untuk menggulirkankejuaraanserupa. “Kita harap tahun ini kompetisi akan lebih alot dan menarik dengan tampilnya para pemain muda dan berbakat daerah ini,” katanya. Eka mengakui, saat ini jajaran klub semakin bergairah dalam melakukanpembinaan.Bahkan beberapa diantaranya, bertekad untuk mencetak atlet-atlet handal. “Itu telah dibuktikan dengan mayoritas atlet kita yang memperkuat tim bolavoli PON XVIII Kalbar. Pada kompetisi ini kami akan memantau kemudian menyeleksi para atlet yang ber-

potensi untuk memperkuat tim bolavoli kota Pontianak untuk mengikuti kejurda bolavoli yang akan dilaksanakan Juni mendatang,” katanya. Sementara itu ketua panitia pelaksana kejuaraan bolavoli antar klub Bilyanto menjelaskan, kejuaraan ini diikuti 15 klub putra dan putri Pengcab PBVSI Kota Pontianak, minus satu klub yakni Voltara. “Sistem pertandingan adalah setengah kompetisi. Saya memprediksi jalannyapertandinganakanberlangsung seru dan alot karena setiap klub memiliki kemampuan yang merata,” tandasnya. (bdi)







Pontianak Post

Sabtu 31 Maret 2012

Sepupu Paul Prediksi Portugal



Kelelawar Terjatuh di Alkmaar

PORTO - Anda masih ingat dengan gurita peramal bernama Paul di Piala Dunia 2010 ? Gurita dari akuarium sea life center di Oberhausen, Jerman, itu mendadak kondang setelah tepat menebak tujuh pertandingan, termasuk Spanyol sebagai pemenang dalam final melawan Belanda. Nah, di Euro 2012, bakal ada gurita peramal lainnya. Seiring Paul sudah mati akhir Oktober 2010, muncul sepu- punya yang bernama Paulo. Kemarin, Paulo telah dipindahkan dari akuarium Oberhausen ke akuarium di Porto, Portugal. “Dia (Paulo) kami sewa sampai akhir tahun ini,” kata juru bicara akuarium Porto seperti dilansir Gazeta Wyborcza. Seperti Paul, Paulo memiliki kemampuan visioner yang sama. Yakni, menebak pemenang pertandingan dari dua kotak yang masing-masing ditempeli gambar bendera masing-masing tim. Hanya, seiring rumah barunya adalah Portugal, Paulo bakal khusus menebak hasil pertandingan Cristiano Ronaldo cs. Tugas Paulo cukup berat karena Portugal menempati grup B yang disebut memiliki tingkat persaingan paling ketat alias grup neraka. Lawan-lawan Seleccao das Quinas “ sebutan Portugal “ antara lain Jerman (9/6), Denmark (13/6), dan Belanda (17/6). (dns)

Facts & Figures Raul Masih Haus Gol DUA gol ke gawang Athletic Bilbao makin mengukuhkan status Raul Gonzalez sebagai top scorer kejuaraan antarklub Eropa dengan 75 gol, 71 gol di antaranya di Liga Champions. Pemain Raul Gonzalez Filippo Inzaghi Andriy Shevchenko Gerd Muller Ruud van Nistelrooy

Klub Gol Schalke 04-Real Madrid 75 AC Milan, Juventus, Parma 72 Dynamo Kiev, Chelsea, AC Milan 67 Bayern Munchen 62 Hamburg, Real Madrid, Man United 62 PSV Eindhoven, SC Heerenveen

Hasil Kemarin (30/3) AZ Alkmaar v Valencia (Holman 45+1, Martens 79/Topal 52)


Schalke 04 v Athletic Bilbao (Raul 22, 60/Llorente 20, 73, De Marcos 81, Muniain 90+3)


Sporting Lisbon v Metalist Kharkiv 2-1 (Izmailov 51, Insua 64/Cleiton 90+1-pen) Atletico Madrid v Hannover 96 (Falcao 9, Salvio 89/Biram Diouf 38) Keterangan : Leg kedua digelar 5 April 2012


REUTERS/Robin van Lonkhuijsen/United Photos

REBUT: Ricardo Costa, kiper Diego Alves dan Jordi Alba (kiri ke kanan) berebut mengamankan bola dari pemain AZ ALkmaar Johann Gudmundsson (kanan) pada putaran pertama Piala Eropa di stadion AFAS Alkmaar dini hari kemarin.

ALKMAAR - Ambisi Spanyol menempatkan tiga wakilnya di semifinal Europa League sedikit terhambat. Itu menyusul hasil di leg pertama perempat final kemarin dini hari WIB. Athletic Bilbao dan Atletico Madrid menang, tapi Valencia takluk. Kelelawar Mestalla - sebutan Valencia - dipaksa menyerah 1-2 saat bertandang ke pemuncak klasemen sementara Eredivisie, AZ Alkmaar, di AFAS Stadion. Dua gol kemenangan tuan rumah dicetak Brett Holman di pengujung babak pertama dan Maarten Martens pada menit ke-79. Valencia hanya bisa membalas melalui sundulan gelandang internasional Turki Mehmet Topal di menit ke-52. Kendati keok, kubu Valencia tetap optimistis menatap peluang lolos ke semifinal. Itu karena dalam leg kedua di Mestalla pekan depan (5/4), tim asuhan Unay Emery tersebut hanya butuh me-

nang 1-0 untuk melenggang. Sepanjang pemain asal Prancis tersebut. home Eropa musim ini, Valencia tidak Kubu AZ tidak memungkiri apabila terkalahkan alias empat kali menang Valencia tetap favorit lolos. Kapten sekadan sekali seri. ligus defender AZ Niklas Moisander Salah satu kemenangan dicatat atas mengatakan, kemenangan leg pertama klub Eredivisie lainnya, PSV Eindlebih karena keberuntungan. “Valencia hoven, dengan skor 4-2 di 16 besar menunjukkan reputasinya sebagai (8/3). “Kekalahan selalu mengeceklub top Eropa dengan mengontrol wakan, apalagi kami sebenarnya jalannya pertandingan dan mereka layak menang. Tapi, kekalahan seharusnya bisa mencetak lebih juga memberi semangat bagi banyak gol,” ungkapnya di situs resmi kami untuk bermain lebih baik UEFA. di kandang sendiri,” kata Emery Jika Valencia keok dalam lawaseperti dilansir Marca. tannya, Bilbao mempermalukan Bek kiri Valencia Jeremy Mawakil Bundesliga Schalke 04 thieu berkata senada. Valencia PEREMPAT FINAL # 1 dengan skor meyakinkan 4-2 di bakal bermain lebih frontal dan Veltins-Arena. Bilbao yang sukses agresif di Mestalla. “Kami akan melaku- menyingkirkan jawara Inggris Manchester kan segala cara agar terus melaju di United di 16 besar tersebut praktis sudah ajang ini. Bagi kami, memenangi Europa menjejakkan satu kakinya di semifinal. League sama pentingnya dengan finis Sedangkan Atletico juga mengalahkan ketiga di liga (Liga Primera, Red),” tutur wakil Bundesliga lainnya, Hannover 96,





dengan skor 2-1. Top scorer Europa League musim lalu dengan 17 gol, Radamel Falcao, membuka skor pada menit kesembilan. Hannover sempat membalas melalui mantan striker United Mame Biram Diouf di menit ke-38. Namun, Los Colchoneros “ sebutan Atletico “ mengamankan kemenangan berkay gol Eduardo Salvio pada menit ke89. Itu adalah gol keempat Salvio dari tiga laga terakhir di Europa League. Sebagai catatan, Atletico adalah pemenang edisi perdana Europa League atau pada musim 2009-2010. Sementara itu, Sporting Lisbon berpeluang mengisi satu slot semifinal. Itu setelah Sporting mengalahkan kuda hitam asal Ukraina, Metalist Kharkiv, 2-1, di kandang sendiri. Di musim lalu, Portugal menempatkan tiga wakilnya di semifinal dan membuahkan gelar untuk FC Porto. (dns)


30 Try Out ke Eropa

3 Persijap v Timnas U-23 0

SURABAYA - Pengprov FORKI (Federasi Olahraga Karate Indonesia) Jatim memberi kesempatan karatekanya untuk melakukan try out di luar negeri. Caranya, dengan mengikutkan mereka dalam dua kejuaraan di Eropa. Kejuaraan pertama yang mereka ikuti adalah Luxemburg Open yang akan berlangsung 14-15 Mei mendatang. Disusul sebulan kemudian, Berlin Open 8-10 Juni. Keikutsertaan para karateka Jatim di kedua even tersebut adalah bagian dari persiapan menghadapi PON yang tinggal beberapa bulan lagi. “Tinggal menunggu keputusan KONI Jatim terkait masalah pendanaan saja,” papar manajer PON FORKI Jatim Johanes Kunto, kemarin (30/3). Meski sudah memastikan akan mengirim atletnya dalam dua kejuaraan tersebut, Kunto belum bersedia membeberkan karateka-karateka yang akan dikirimnya. Kunto berdalih bahwa proses seleksi masih berlangsung. “Karateka yang masuk puslatda 14 orang. Seleksi belum selesai. Pertengahan April baru akan tahu siapa saja yang masuk seleksi untuk PON dan yang dikirim untuk ikut kejuaraan tersebut,” jelas Kunto. Dia menuturkan bahwa proses seleksi diserahkan pada tim monitoring dan evaluasi (Monev), yang dibentuk FORKI Jatim. Tim beranggotakan jajaran Binpres FORKI Jatim. “Siapa saja yang masuk seleksi dan berhak ikut kejuaraan saya serahkan ke tim monev tersebut,” ungkap Kunto. Untuk memuluskan rencana mengikutsertakan karatekanya dalam kedua ajang tadi, FORKI Jatim meminta bantuan mantan karateka Jatim Umar Syarif yang kini tinggal di Swiss. “Kami sudah hubungi Umar sendiri untuk membantu tim PON ini,” tambahnya. Umar juga diminta bantuan untuk mencarikan pelatih asing. Dalam kejuaraan tersebut, FORKI Jatim berencanakan mengikuti nomor komite. Sementara nomor kata tidak, karena tidak terlalu dominan di Eropa. “Untuk nomor kata, kiblatnya masih Jepang. Lagi pula atlet andalan kami Anggoro Bayu yang turun di nomor kata perorangan putra berada di Pelatnas.” ujarnya. (ovi/ruk) Foto Donny Setyawan/Radar Kudus


Sulut Juara Umum


JAKARTA - Kontingen tinju Sulawesi Utara (Sulut) menahbiskan diri menjadi juara umum ajang Turnamen Tinju Amatir Piala Wakil Presiden I 2012. Pada even yang berakhir kemarin malam di GOR POPKI, Cibubur, Jakarta Timur itu Sultra menjadi pengoleksi medali emas terbanyak, yaitu tiga emas. Tiga medali emas tersebut masingmasing dipersembahkan Vinky Montolalu di kelas 64 kg putra, Toar Sompotan (75 kg putra), serta Yunike Rotty (45-48 kg putrid). Posisi kedua direbut kontingen Papua yang sama-sama meraih tiga medali emas. Tapi Papua kalah dalam perhitungan poin dari kontingen Sulut. Kontingen Papua sesungguhnya berpeluang untuk meraih gelar juara umum. Sayang, pada partai terakhir di kelas 54-57 kg, Lisa Kmur dari Papua kalah di tangan petinju NTT, Imaculata Loda dengan skor 13-22. Kekalahan tersebut mengundang kekecewaan kubu Papua karena merasa dicurangi. Mereka sempat protes karena gagal menjadi juara umum. Diantara gelagat “kecurangan” terlihat sejak sejak di partai ke-10 ketika petinju DKI Jakarta, Apriliani Tombeg tak naik ring saat harus berhadapan dengan petinju Sulut, Yunike Rotty. Akibat Apriliani tak muncul di ring, wasit hakim pun memberikan kemenangan WO untuk Yunike (Sultra). Ironisnya, Apriliani pada Kamis pagi sempat menjalani timbang badan. Namun secara keseluruhan, ajang tinju amatir Piala Wakil Presiden yang baru pertama kali digelar ini berlangsung sukses. Kepada wartawan Ketua Umum PP.Pertina Reza Ali mengaku puas dengan pergelaran yang merupakan program pertama dalam masa kepengurusannya ini. “Kami berharap event ini akan menjadi agenda tetap setiap tahunnya. Pesertanya pun ke depan akan diperbanyak lagi,” kata Reza ali. Turnamen Tinju Amatir Piala Wakil Presiden I 2012 diikuti 90 petinju dari 22 provinsi yang telah lolos ke PON Riau 2012. (ali)


Sabtu 31 Maret 2012

Tekuk Garuda Muda



Pontianak Post

KALAH: Banaken Basoken Persijap (merah) berjibaku dengan Ferdinand Sinaga Timnas seleksi Indonesia. Di laga itu, timnas kalah.

JEPARA - Andik Vermansyah dkk yang tergabung dalam Timnas U-23 dipaksa menyerah dengan skor telak oleh Persijap. Tim asuhan Aji Sansoto itu kebobolan tiga gol tanpa balas dalam pertandingan uji coba, di Stadion Gelora Bumi Kartini (SGBK) Jepara, Jumat sore (30/3). Dengan menurunkan sebagian besar pemain yang turut memperkuat Indonesia dalam laga Pra Piala Dunia melawan Bahrain lalu, ditambah sejumlah pemain Timnas U-21, ternyata tetap tak mampu memberikan perlawanan berarti di hadapan Persijap. Tuan rumah Persijap masih mampu mendominasi jalannya pertandingan selama 90 menit. Tiga gol kemenangan Persijap dicetak Banaken Bassoken di menit ke-33, disusul gol Noor Hadi (36”) dan Bayu Andra (86”). Sejak kickoff babak pertama dimulai, Persijap tampil mendominasi pertandingan dan langsung mengambil inisiatif menyerang. Meski tanpa menurunkan striker asal Chile Julio Lopez, duet Noor Hadi dan Yahya Sosomar berulang kali mampu memberikan ancaman ke barisan belakang tim Garuda Muda. Persijap sukses membuka kemenangan setelah Yahya gagal memanfaatkan peluang, kemudian bola bergulir ke tengah dan disambut tendangan keras Banaken dari luar kotak penalti. Tendangan melengkung ke sudut kanan gawang Timnas U-23 tak mampu dihalau kiper Muhammad Ridwan. Selang tiga menit, serangan Persijap terus dilancarkan ke pertahanan Timnas U-23. Danan yang berdiri bebas mendapat umpan dari Nurul Huda melancarkan tendangan keras ke arah gawang. Bola keras tak mampu

diantisipasi dengan sempurna oleh Ridwan sehingga mental dan disambut oleh Noor Hadi untuk mengggandakan keunggulan. Ketinggalan dua gol, Aji Santoso memasukkan Andik Vermansyah satu menit menjelang babak pertama bubar. Andik sempat mendapat peluang, namun tendangan dari depan gawang M Yasir sedikit melambung. Skor 2-0 untuk keunggulan Persijap bertahan sampai 45 menit babak pertama. Di babak kedua, Aji Santoso mengganti sebagian besar pemainnya. Irfan Bachdim, Rendi Irawan, Slamet Nurcahyo, Yosua Pahabol dimasukkan. Meski demikian masih belum mampu mengimbangi dominasi pemain Persijap. Persijap sendiri memasukkan sejumlah pemain mudanya. Latif Tuhaerera, Gipsi, Latif Hasyim yang selama putaran pertama Indonesian Premier League (IPL) belum dimainkan juga diturunkan. Meski banyak terjadi pergantian pemain, konsistensi penampilan Persijap masih mampu terjaga. Hasilnya, menit ke-86, Bayu Andra melengkapi keunggulan menjadi 3-0 melalui tendangan dari luar kotak penalti. Andi M Guntur yang menggantikan Ridwan gagal menghalau bola yang menyusur di sudut kanan gawangnya. Sehabis pertandingan, Aji Santoso mengatakan, target dari uji coba ini untuk melihat pemain mana saja yang masih layak untuk dipertahankan di seleksi berikutnya. ”Dengan pertandingan ini kami akan tahu pemain yang masih layak, dan pemain mana yang tidak, ujarnya. Sementara pelatih Persijap Agus Yuwono mengaku puas dengan penampilan Anam Syahrul dkk. ”Para pemain bisa tampil lepas dan konsisten. Ini surprise dan menjadi modal untuk menjalani putaran kedua IPL,” katanya. (han/aji)

Piala Soeratin Tersandera Perseba Tolak Permintaan PSSI Djohar JAKARTA- Ajang kompetisi Piala Soeratin PSSI musim 2012 terancama berganti piala. Itu setelah Piala Soeratin sebagai simbol supremasi tertinggi juara liga remaja U-18 tersebut sampai saat ini belum berada di tangan PSSI. Deputi Sekjen bidang kompetisi PSSI Saleh Mukadar menyebut-

kan bahwa Piala Soeratin sampai saat ini masih berada di tangan tim juara musim 2009 silam, Perseba Bangkalan. Karena itu, pihak PSSI masih berusaha untuk mengembalikan Piala tersebut. ”Mereka tidak mau mengembalikan. Sekarang kami sedang bersuaha untuk bisa mengembalikan piala tersebut ke PSSI,” katanya saat ditemui, kemarin (30/3). Menurut Saleh, penyebab belum kembalinya piala tersebut karena Perseba menilai PSSI masih memiliki tanggungan uang hadiah kepada mereka.

”Ini kendala karena PSSI yang dulu. Itu menjadi tanggungan yang dulu, sekarang kan beda,” ucap lelaki asal Surabaya tersebut. Melihat kondisi itu, ketua komisi disiplin (Komdis) PSSI Bernhard Limbong pun langsung bergerak. Dia akan mengirimkan utusan PSSI untuk mengambil piala tersebut. Pasalnya, piala tidak diberikan secara permanen kepada klub. ”Kami akan minta baik-baik. Jika belum diberi, kami akan usahakan cara lain. Piala itu adalah milik PSSI dan harus kembali ke

PSSI,” tuturnya. Sementara itu, saat pihak Perseba dikonfirmasi, mereka menegaskan tak memegang Piala tersebut. Manajer tim Imran Abdul Fattah meyebut Piala sedang berada di tangan K-conk Mania, pendukung Perseba. Piala itu tidak berada di tangan pengurus Perseba karena selama ini menjadi kebanggan supporter. Alhasil, piala diserahkan kepada suporter. ”Kami tidak pegang. Pialanya ada di K-Conk mania. Itu dibawa mereka karena Perseba mengakui bisa besar dengan dukungan

mereka,” ujarnya. Lantas, apakah ada solusi untuk bisa mengembalikan piala tersebut ke PSSI? Imran memastikan piala bisa kembali namun bukan kepada PSSI versi Djohar Arifin. Alasannya, K-Conk Mania hanya mau mengembalikan piala kepada PSSI yang diakui 2/3 lebih anggota PSSI. ”Kalau PSSI pak Nyalla (La Nyalla Mattalitti) yang minta, K-Conk Mania pasti mengembalikan. Kalau PSSI Djohar, kami tidak mengakuinya. Kami sudah menganggapnya lengser,” tandasnya. (aam)

Persiram Terhindar dari Juru Kunci SORONG – Pertandingan baru berjalan satu menit sekitar 5000 penonton yang menyaksikan pertandingan antara tuan rumah persiram Raja Ampat lawan Persiba Balikpapan dibuat kaget. Pasalnya striker Persiram Boumsom berhasil menggetarkaan jala gawang Persiba yang dikawal I Made Wirawan. Gol cepat yang mengagetkan Persiba tersebut berawal dari umpan lambung yang diberikan Sakai kepada Boumsom di kotak finalty langsung disambut dengan tendangan keras . Dan gol pun tak terelakkan sehingga merubah kedudukan menjadi 1-0 untuk Persiram. Ketinggalan, pemain-pemain Persiba terus melakukan tekanantekanan ke pertahanan Persiram yang dikawal Kubay Kudian, Shanus Alqadri serta Nasution Karubaba. Namun serangan pemain-pemain dari Balikpapan selalu mental dan belum membuahkan hasil. Jalannya pertandingan yang dipimpin wasit Setiyono, berlangsung berimbang. Kedua kesebelasan

saling melakukan serangan ke pertahanan lawan. Namun hingga babak pertama berakhir, kedudukan tidak berubah tetap 1-0 untuk Persiram. Dalam babak pertama Persiram melakukan pergantian pemain keluar Yando Ruatakurei digantikan Yance Yoe. Dan wasit mengeluarkan satu kartu kuning untuk pemain tuan rumah Gideon Way yang menjatuhkan pemain depan Persiba dari belakang. Memasuki babak kedua pertandingan lebih seru, karena Persiba terus berusaha mengejar ketertinggalannya. Di babak kedua Periram kembali melakukan pergantian pemain Aidin Helmi digantikan Frans Sauyai. Sedangkan tim tamu melakukan tiga kali yakni Tomislave Labudavic digantikan Absor, Bahtiar digantikan Stavanus dan Eki Nurhakim diganti Sultan Samad. Dengan semakin tingginya tensi permainan di babak kedua, wasit mengeluarkan tiga kartu kuning. Masing-masing untuk Elton Maran (Persiram) serta Tomislave Labuda-

vic dan Absor dari Persiba. Hingga peluit akhir dibunyikan wasit Setiyono kedudukan tetap berakhir dengan kedudukan 1-0 untuk anak asuh Bambang Nurdiansyah. Dengan tambahan poin 3 ini membuat nilai Persiram menjadi 16 sekaligus menggeser Arema Indonesia dan Deltras. Karena Arema dan Deltran sudah menyelesaikan semua pertandingan di putaran pertama. Posisi ini Perisram ini bisa naik ke posisi 15kalauPSASiglitidakmampumeraih poin penuh di kandangnya. Sehingga Arema harus puas menempati posisi juru kunci putaran pertama Indonesia Super Leage (ISL). ‘’Dengan hasil ini kami puas, karena pemain bisa mencapai target meraih poin penuh. Dan anak-anak bermain bagus,’’ jelas pelatih Kepala Persiram Bambang Nurdiansyah usai pertandingan. Sementara itu pelatih kepala Persiba Balikpapan Piter Butler mengaku kecewa dengan kepemimpinan Wasit Setiyono. Ia menilai kepemimpinannya berat sebelah dan merugikan anak asuhnya.(iso)


Foto: Anshori/Radar Sorong

POIN PENUH: Elthon Maran coba dihentikan pemain Persiba dalam laga lanjutan ISL Persiram Raja Ampat menjamu tamunya Persiba Balikpapan di Stadion Wombik KM 16 Sorong. Gol Cepat yang dilesakkan Boumsom di menit pertama, membawa Persiram terhindar dari juru kunci putaran pertama ISL.

Tutup Putaran Pertama Tanpa Poin PSAP 3 v 2 PSPS

Rakyat Aceh-Amiruddin

GIRING: Pemain PSAP Sayuti saat menggiring bola cmyk


PEKANBARU (RP) - PSPS menutup putaran pertama dengan hasil yang tak memuaskan. PSPS dikalahkan PSAP Sigli dengan skor 2-3 di Stadion Kuta Asan Sigli, Jumat (30/3). Dengan demikian, PSPS pulang ke Pekanbaru tanpa membawa poin di dua laga derby Sumatera tersebut. Sebelumnya, PSPS juga kalah 1-3 dari PSMS. Kekalahan PSPS ini terasa menyakitkan karena dalam laga

kemarin PSPS sempat leading 2-1 di babak pertama, bahkan hingga menit ke-73. ”Bukan mau mencari kambing hitam. Tapi wasit memang parah sekali memimpin pertandingan. Wasit membuat semuanya berubah,” ujar manajer PSPS, Boy Sabirin saat dihubungi. Boy menjelaskan dalam pertandingan kemarin seharusnya PSPS mendapat dua penalti. Namun, wasit tak bergeming meski jelas-jelas Patrice Nzekou diganjal keras di kotak penalti. ”Tapi kalau pemain lawan yang disenggol

sedikit saja free kick. Bahkan, dua gol terakhir PSAP berbau off side,” ujarnya. Dalam pertandingan kemarin, PSPS langsung unggul 1-0 di menit ke-13 lewat gol yang dicetak M Isnaini. Namun, berselang satu menit, PSAP berhasil menyamakan kedudukan 1-1 lewat gol Abdul Faizal. Tapi, PSPS kembali unggul 2-1 setelah kapten Dzumafo Epandi Herman mencetak gol di menit ke-18. Pada babak kedua anak-anak PSAP terus menggempur pertahanan PSPS yang koordinir Ambrizal dkk. Hasilnya, gawang

PSPS pun kebobolan dia gol dalam waktu 20 menit. Kedua gol tersebut diborong striker asing PSAP, Sekou Camara di menit ke-72 dan ke-78. PSPS pun kalah 2-3. Usai pertandingan, PSPS langsung bertolak menuju Pekanbaru, malam tadi. Banyak yang menjadi bahan evaluasi bagi tim pelatih PSPS setelah gagal menutup putaran pertama kompetisi ISL 2011/2012 dengan catatan baik. Apalagi, lawan yang dihadapi merupakan tim promosi. “Memang berat sebab mereka setiap menyerang selalu gol.

Sementara pemain kita gagal memanfaatkan setiap peluang yang ada. Malam ini istirahat sebentar dan langsung bertolak ke Pekanbaru,” lanjut Boy. Dengan kekalaham ini maka PSPS berad di posisi 13 klasemen sementara dengan nilai 20. Memasuki putaran kedua yang baru berjalan pertengahan April mendatang, Boy masih terus berharap adanya bantuan dari pihak swasta terkait pendanaan klub demi menunjang performa pemain dan meningkatkan semangat dan daya juang dalam sebuah pertandingan.(das/egp)


Pontianak Post


Sabtu 31 Maret 2012



MIAMI - Usaha Maria Sharapova untuk meraih gelar perdananya di musim 2012 tinggal selangkah lagi. Mantan ratu tenis asal Rusia itu sudah memastikan langkah ke final Miami Terbuka. Final kali ini merupakan yang ketiga bagi Sharapova sepanjang musim 2012. Sharapova melaju ke partai puncak usai menga-

Sabtu 31 Maret 2012

Axiata Cup 2012

Kesempatan Sharapova Akhiri Kutukan

Maria Sharapova

Pontianak Post

Diuntungkan Absennya Chong Wei

lahkan unggulan keempat Caroline Wozniacki (Denmark) dalam pertarungan tiga set. Sharapova unggul dengan 4-6, 6-2, 6-4 dalam durasi 2 jam 34 menit. Di final, Sharapova bakal berhadapan dengan unggulan kelima Agnieszka Radwanska (Polandia). Kemarin, Radwanska menunjukkan dominasinya untuk menundukkan Marion Bartoli (Prancis). Bartoli menang dengan 6-4, 6-2. Insiden kurang menyenangkan terjadi di akhir laga Sharapova versus Wozniacki. Sharapova melakukan servis saat kedudukan 40-30 dalam kondisi match point. Servis kedua Sharapova dinyatakan keluar oleh salah satu linesman, namun Umpire menyatakan servis harus diulang. Kondisi tersebut membuat kecewa Wozniacki. Tanpa meminta rekaman video, Wozniacki bersedia laga dilanjutkan. Setelah itu, Sharapova memastikan kemenangan usai forehand Wozniacki out. Saat laga berakhir, Wozniacki tak mau berjabat tangan dengan Umpire.“Kondisinya benar-benar sulit, karena itu terjadi begitu dekat dengan akhir pertandingan dan kami berdua sudah bertarung sangat keras selama lebih dari dua jam. Anda tentu tak mau pertandingan seperti itu berakhir dengan keputusan aneh,” ujar Sharapova. Hasil tersebut membawa Sharapova ke final Mimai Terbuka empat kali beruntun. Tapi, dalam tiga final sebelumnya, dia harus puas sebagai pecundang. Tahun ini, dia juga sudah dua kali meraih final, tapi kegagalan meraih gelar juara masih mengakrabinya. “Selalu mengecewakan mengalami kekalahan di final, tapi itu adalah bagian dari karir. Saya senang bisa memberikan kesempatan pada diri saya meraih final lagi,” tutur Sharapova. Di final tahun lalu, Sharapova harus mengakui keunggulan petenis nomor satu saat ini, Victoria Azarenka (Belarusia). Azarenka pula yang membuatnya gagal meraih gelar di grand slam Australia Terbuka dan Indian Wells Terbuka. Peluang Sharapova untuk meraih gelar terbuka lebar karena Azarenka sudah tersingkir di babak ketiga Miami Terbuka. “Menjalani pertandingan di sini sangat berarti bagi saya, karena saya sudah berpartisipasi sejak masih muda. Saya tak mau memikirkan apa pun sebelum final, kecuali untuk membuat pengalaman di sini makin berarti dengan gelar juara,” tutur Sharapova. (ady)


Tim Indonesia Garuda membuka peluang lolos ke babak final Axiata Cup 2012. Itu setelah di leg pertama semifinal yang digelar di Britama Arena Kelapa Gading Kelapa Gading kemarin siang Taufik Hidayat dkk menang 2-1 atas tim Malaysia Tigers. Tapi tim Indonesia Garuda belum bisa bernafas lega. Sebab dalam pertandingan kemarin Malaysia Tigers ternyata tidak turun dengan tim terbaiknya. Pemain terbaik dunia Lee Chong Wei yang sebelumnya menyatakan siap main di semifinal ternyata kemarin tidak jadi main dengan alasan masih belum sembuh benar dari cedera. Tak hanya Lee Chong Wei yang tak turun, di leg pertama babak empat besar kemarin juga tidak memainkan ganda terbaiknya, yaitu peringkat Hendra Setiawan menang 21-17 dan delapan dunia Koo Kien Keat/Boos 21-17 atas Lim Khim Wah/Goh Wei Heong Tan. Pasangan ganda yang Shem. kemarin diturunkan adalah pasangan Sayang, target sapu bersih gagal ranking 29 dunia Lim Khim Wah/Goh Manu Ginobilli terwujud setelah di partai ketiga Sony Wei Shem. Dwi Kuncoro menyerah straight Tidak turunnya pemain - pemain game 13-21 dan 19-21 dari Hafiz terbaik itu dimanfaatkan dengan Hashim. maksimal oleh Indonesia Garuda. Di “Saya minta maaf kali ini belum laga pertama Taufik Hidayat menang bisa memberikan kemenangan dua gim langsung atas Daren Liew. untuk tim. Saya sudah berusaha 21-19, 21-9. Di partai kedua pasangan tampil maksimal,” kata Sony usai Mohammad Ahsan yang kembali pertandingan. “Di game pertama, dipasangkan dengan pemain senior saya masih mencari bentuk permai-

Sony Dwi Kuncoro

nan sementara lawan mampu mengontrol permainan. Di game kedua, saya sudah dapat ritme dan mampu mengimbangi hingga 18-18. Tapi belum bisa memanfaatkan momen itu untuk merebut kemenangan,” sambung Arek Suroboyo ini. Manajer Tim Indonesia Garuda , Mohammad Feriansyah mengatakan absennya Lee Chong Wei, cukup memberi angin bagi Garuda. “Tim bermain bagus hari ini. Kami bersyukur bisa menang,” ujar Feriansyah.(ali)

Kans Besar Tim Lapis Dua KUALA LUMPUR - Tim Indonesia Rajawali yang diperkuat pemain-pemain muda berhasil membuat kejutan di ajang Axiata Cup 2012. Bertanding di Stadium Badminton Cheras Kuala Lumpur, Tommy Sugiarto dkk berhasil menjadi juara Grup K mengungguli tim Malaysia Tigers. Siang ini, pukul 13.00 waktu Kuala Lumpur, Indonesia Rajawali akan melakoni leg pertama babak semifinal dengan melawan runner up Grup J, yaitu tim Malaysia Leopards. Di atas kertas, jika di babak penyisihan Indonesia Rajawali berhasil mengalahkan Malaysia Tigers yang diperkuat pemain ” pemain lapis utama, maka mestinya siang ini Tommy Sugiarto dkk bisa mengatasi permainan skuad Malaysia Leopards yang bermaterikan pemain-pemain U-21 Malaysia dan membuka peluang lolos ke final. Secara ranking, para pemain Indo-




nesia Rajawali lebih baik dari skuad Malaysia Leopards. Tunggal pertama Tommy Sugiarto misalnya, saat ini putra legenda bulu tangkis tanah air Icuk Sugiarto itu bertengger di posisi ke-16 dunia. Sedangkan tunggal utama Malaysia Leopards Misbun Ramdan Misbun berada di posisi ke-90 ranking dunia. Tunggal kedua Dinoyisus Hayom Rumbaka saat ini bertengger di peringkat ke-23 dunia. Sedangkan tunggal kedua Leopards Zulfadli Zulkifli tercecer di posisi ke-110. Di sektor ganda, pasangan Alvent Yulianto Chandra/Hendra Aprida Gunawan Saat ini menempati posisi ke-11 dunia. Sedangkan rivalnya Nelson Heg Wei Keat/Teo Ee Yi berada di posisi ke-103 dunia. Ganda kedua Rajawali Angga Pratama/Ryan Agung Saputra Sementara ini menempati posisi 18 dunia. Sedangkan ganda kedua Leopards Chooi Kah Ming/ Ow Yao Han tercecer diurutan ke-149.

Berdasarkan data fakta itulah, mestinya Tommy Sugiarto tidak akan mengalami kesulitan untuk meraih kemenangan. Dihubungi tadi malam, manajer tim Indonesia Rajawali Jacob Rusdianto yang mendampingi tim di Kuala Lumpur optimistis tinya bisa kembali membuat kejutan di Stadium Badminton Cheras Kuala Lumpur. ”Semua pemain dalam posisi siap tempur. Tidak ada yang cedera,” kata Jacob. Mengenai siapa yang akan diturunkan pria yang juga Sekjen PB PBSI ( Persatuan Bulu tangkis Seluruh Indonesia) ini menyatakan baru akan ditentukan hari ini. ”Siapa yang akan dipasang saat ini belum kita tentukan karena batas waktunya besok siang (siang ini ”red) sebelum main. Kita akan bahas starteginya besok pagi (pagi ini-Red) setellah mengeceak satu persatu kesehatan pemain,” beber Jacob. (ali)

Pontianak Post  

31 Maret 2012

Read more
Read more
Similar to
Popular now
Just for you