Page 1

Pontianak Post Jumat 18 Februari 2011 M / 15 Rabiul Awal 1432 H


Eceran Pontianak Rp.2.500


Berkah Para Tatung Lelang Barang Akhiri Cap Go Meh SINGKAWANG-Festival Cap Go Meh 2562 di Singkawang berlangsung spektakuler, kemarin (17/2). Kota amoy itu dipenuhi lautan manusia. Pembukaannya dilakukan Gubernur Kalbar Cornelis, dihadiri juga para muspida setempat. Sebanyak 723 Tatung beraksi mengitari jalanan, sembahyang di Vihara hingga memberkati barang-barang lelang di altar. Pelelangan barang yang sudah diberkati Tatung hingga malam hari, me-

Arumi Bachsin

Dipaksa Stop Ngartis Hampir empat bulan Arumi Bachsin kabur dari rumah. Padahal 19 Februari nanti, bintang film Not For Sale ini akan berulang tahun yang ke-17. “Iya nanti dia ulang tahun. Mudah-mudahan di umur 17 itu dia lebih dewasa dan lebih wise,” ujar ibunda Arumi, Maria Lilian Pesch di Polda Metro Jaya, kemarin. Menurut Maria, keluarga hanya bisa berdoa agar Arumi dalam keadaan baik-baik saja. Keluarga juga tidak menyiapkan acara apa-apa untuk bintang film 18+ itu. X


Oesman Sapta Digugat Prabowo



Ke Halaman 7 Kolom 1

Multi Etnis Membaur Cermin Kalbar Kondusif

Ke Halaman 7 Kolom 5

KONFLIK pasca musyawarah nasional (Munas) Himpunan Kerukunan Tani Indonesia (HKTI), antara pimpinan Prabowo Subianto dan Oesman Sapta , berlanjut ke pengadilan. Kubu Prabowo akan mengajukan gugatan terhadap kubu Oesman. “Intinya, kami menggugat organisasi lain karena telah menggunakan nama dan simbol yang sama,” ujar Prabowo, usai menghadiri undangan rapat dengan Komisi IV, di Gedung DPR, Senayan, Jakarta, kemarin (17/2). Dia menyatakan, pihaknya terpaksa mengambil langkah hukum karena pihak Oesman Sapta terus mengunakan nama HKTI.

nandai akhirnya festival CGM di kota seribu vihara. Hingga pukul sembilan malam kemarin, pelelangan masih berlangsung di altar yang dibangun oleh panitia Festival CGM, di persimpangan Kepol Machmud-Niaga atau sekitar berdirinya tugu naga. Sejumlah masyarakat masih melihat secara langsung prosesi pelelangan sejumlah barang tersebut. Aparat kepolisian tampak berjaga-jaga guna mengamankan jalannya lelang yang tiap tahun dilaksanakan. Menurut salah satu pembeli, barang yang sudah diberkahi oleh para tatung memiliki khasiat. “Semua orang percaya, ada


K – Perayaan CGM di PONTIANAK Kota Pontianak dan Kabupaten Kubu Raya berlangsung lancar dan aman. Panasnya matahari di Pontianak dan sekitarnya begitu menyengat kemarin 17/2), hal tersebut tak menyurutkan antusiasme puluhan ribu orang yang ingin menonton berbagai atraksi dan pertunjukan suguhan para panitia. Di Pontianak, Yayasan Bhakti Suci (YBS) mengusung acara bertajuk “Puncak Acara Perayaan Cap Go Meh Bersama 2011”. Pawai besar-besaran yang menempuh rute Jalan Gajah Mada, Diponegoro, dan ruas jalan

sekitarnya ini menampilkan berbagai macam pertunjukan lintas etnis dan budaya. Tidak hanya dari etnis Tionghoa saja, berbagai kesenian budaya etnis Melayu, Dayak, Jawa, Batak, Sunda, Ambon dan beberapa suku nusantara lainnya turut menyemarakan suasana. Lebih dari duapuluhan grup yang mengisi tampil dari siang hingga sore hari. Duduk di panggung kehormatan (depan Sekretariat YBS); Wakil Gubernur X

Ke Halaman 7 Kolom 5

TATUNG WANITA : Tatung wanita menjadi perhatian penonton pada perayaan puncak Cap Go Meh 2011, Kamis (17/2) di Singkawang

Ke Halaman 7 Kolom 1



ATRAKSI : Seni kekebalan tubuh ditampilkan ratusan pemain tatung merupakan atraksi

NAGA A : Atraksi Naga tampil dalam Festival Cap Go Meh di Kota Pontianak,

paling ditunggu penonton setiap tahunnya di Singkawang.

yang digelar Yayasan Bhakti Suci, kemarin (17/2).

Melihat Derita Armayeh, TKI Asal Kubu Raya yang Disiksa Majikan

Sayuri Segera ke Arab Saudi Perasaan bimbang terhadap Armayeh, diakui Sayuri, sebenarnya sudah sejak awal. Saat kepergian sang putri kelimanya berangkat ke Saudi Arabia. Apalagi, ketika mendengar kabar gadisnya menjadi korban penganiayaan majikan. “Saya sangat kesalkan mengapa Armayeh berangkat waktu itu? Padahal ia masih sekolah.”

Sumber : Kanwil Depag Kalbar

Meski berusaha untuk tegar, Sayuri, ayah Armayeh-korban penganiayaan majikan di Arab Saudi, tetap tak dapat menyembunyikan kegundahan didalam

CPNS Baru Terancam Dicoret JAKARTA A - Bagi peserta yang dinyatakan lulus dalam seleksi Calon Pegawai Negeri Sipil (CPNS) 2010 lalu, jangan tenang dulu. Kementerian Pemberdayaan Aparatur Negara dan Reformasi Birokrasi (Kemenpan dan RB) mencium ada pelanggaran pelaksanaan CPNS 2010 di 40 kabupaten dan kota di seluruh negeri. Modus yang digunakan beragam. Jika terr bukti, penyematan Nomor Induk Pegawai (NIP) bakal ditangguhkan dulu. Ditemui di kantornya kemarin (17/2), Deputi Menteri PAN dan RB Bidang SDM Aparatur Ramli Naiboho membeber 40 titik tembak tersebut. Sebelumnya, dia mengatakan jika pihak kementerian sudah menurunkan tim investigasi untuk

Kalbar Bersih


SEGERA BERANGKAT: Sayuri, ayah Armayeh-TKI korban penganiayaan di Arab Saudi, bersama anggota DPD RI Hairiah, bertandang ke Kementerian Luar Negeri, Rabu (16/2). Ia segera berangkat menemui anaknya di Saudi.

benaknya. Terus terang dia mengaku sudah tak sabar ingin melihat langsung anaknya yang dikabarkan mengalami luka parah di sekujur tubuh akibat kebi-

adaban orang yang tak berhati nurani. “Belum melihat langsung, hati ini X

Ke Halaman 7 Kolom 1


Ke Halaman 7 Kolom 5

Menelusuri Keberadaan Ponpes Al Ma’hadul Islam Yapi di Pasuruan, setelah Diserang Massa

AKSI PEDULI TELUK PONGKAL SUDAH puluhan tahun warga Desa T Teluk Pongkal, Kecamatan Nanga Sokan, Melawi, menderita gatal-gatal akibat jamur kulit (tinea imbricata). Istilah masyarakat setempat menyebutnya Lusung. Pontianak Post mengajak segenap pembaca untuk merr ingankan beban saudara kita ini. Bantuan dapat disalurkan ke redaksi Pontianak Post, Gedung Graha Pena, Jalan Gajahmada Nomor 2-4 Pontianak atau melalui rekening Bank Kalbar No : 1025118118 an Aksi Peduli Pontianak Post. Kami juga menerima pakaian pantas, sarung, handuk dan peralatan mandi. Dana Sumbangan Senin (14/02) Rp


Via Bank Kalbar 1. Hamba Allah 2. Rayhan

Rp 400.000 Rp 100.000 X

Ke Halaman 7 Kolom 1


Anut Keberagaman, Akui Ada Santri Beraliran Syiah yang berserakan, sudah tidak terlihat lagi. Suasana pagi itu tidak lagi tegang. Meskipun, beberapa polisi tampak berjaga-jaga di sekitar ponpes. Pagi itu ratusan santri berkumpul di masjid yang berlokasi di tengah pondok. Mereka yang rata-rata mengenakan baju koko putih dan berpeci itu sedang mendengarkan ceramah Ustad Achmad Shiddiq yang juga sekretaris diniyah di ponpes tersebut. Shiddiq ketika ditemui setelah acara mengatakan, acara pagi itu merupakan istighotsah setelah insiden penyerangan sehari sebelumnya. ’’Kami juga sekalian memperingati Maulid Nabi Muhammad SAW,’’ paparnya. Pagi itu Radar Bromo (Jawa Pos Group) juga menemui beberapa santri yang mengalami lukaluka akibat penyerangan tersebut. Salah seorang di antara mereka adalah Achmad Miqdad Al Hadar.

Benarkah Pondok Pesantren (ponpes) Al Ma’hadul Islam Yayasan Pesantren Islam (Yapi) di Pasuruan menganut paham Syiah? Apakah hanya karena tuduhan menganut paham itu sehingga pondok tersebut diserang ratusan orang Selasa lalu (15/2)? MUHAMMAD FA F HMI, Pasuruan Pukul 08.00 kemarin (16/2) suasana di Ponpes Yapi putra pasca penyerangan Selasa lalu sudah terlihat normal. Para santri ponpes yang berlokasi di Desa Kenep, Beji, Kabupaten Pasuruan, itu sudah beraktivitas seperti biasanya. Bekas-bekas penyerangan, seperti pecahan kaca dan batu-batu


PULIH: Kondisi para santri Ponpes Al Ma’hadul Islam Yapi di Beji, Kabupaten Pasuruan, kemarin.

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 3.000 *Ketapang & KKU Rp 4.000 *Kapuas Hulu Rp 3.000


Ke Halaman 7 Kolom 1

Jawa Pos Group Media

Politik & HUKUM

2 STAIS Tegaskan Netral



Jumat 18 Februari 2011

Presiden Ingin Lemhanas Mendunia


KETUA Sekolah Tinggi Agama Islam Sambas (STAIS) Sultan Muhammad Safiuddin Jamiat Akadol menegaskan perguruan tinggi yang dipimpinnya itu netral pada Pilkada Sambas 2011. “STAIS tidak melibatkan diri dalam politik praktis atau mendukung salah satu calon. Kami netral,” tegasnya. STAIS, kata Jamiat, akan mempertahankan independensinya sebagai lembaga ilmiah. Mendukung salah satucalonakanmemJamiat Akadol bawa dampak negatif bagi perguruan tersebut. Merusak sistem pendidikan dan berpengaruh pada perkembangan mental mahasiswa. “Itu adalah pilihan terbaik, tetap netral di lembaga ilmiah. Memang sejak awal kami sudah netral,” katanya. Namun Jamiat mengaku, tidak dapat mencegah jika ada dosen atau mahasiswa STAIS yang melibatkan diri pada pemilihan pemimpin Sambas ini. Perguruan tinggi swasta seperti STAIS tidak dapat melarang orang ikut berpolitik. Dia menganggapnya sebagai hak pribadi. “Kalau sebagai pribadi, kami tidak dapat melarang dosen atau mahasiswa ikut berpolitik. Itu hak mereka,” ujarnya. Sejak awal STAIS tidak ingin dimasuki unsur politik. Tujuan pendirian lembaga pendidikan ini, tegas Jamiat bukan ke arah tersebut. Murni sebagai lembaga pengembangan pendidikan Islam di Sambas. Namun jika ada pasangan calon atau siapapun meminta masukan kepada STAIS, akan dilayani. Terutama tentang wawasan pendidikan keislaman dari sudut pandang perguruan tinggi. “Tidak hanya pasangan calon bupati yang kami layani kalau meminta masukan. Masyarakat pun kalau datang juga diterima,” ungkapnya. Saran yang diberikan STAIS pada dasarnya sama saja dengan masyarakat biasa. Bedanya hanya pada sudut pandang. Perguruan tinggi jelas memberi masukan secara ilmiah. “Jelas apa yang kami sampaikan secara ilmiah. Sesuai dengan kemampuannya,” ucapnya. Jamiat yang juga Pelaksana tugas Sekretaris Daerah Kabupaten Sambas ini mengutarakan, dosen dan mahasiswa STAIS tentunya berbeda dengan pegawai negeri sipil. (hen)

Pontianak Post

Mustafa Ramli/Jawa Pos

KAKAK DAN ADIK: Gubernur Lembaga Ketahanan Nasional (Lemhannas) RI Budi Susilo Soepandji (kiri) mendapat ucapan selamat dari mantan Jaksa Agung Hendarman Soepandji usai dilantik, kemarin. Budi Susilo Soepandji yang merupakan saudara kandung dari Hendarman Soepandji itu dilantik menjadi Gubernur Lemhannas RI menggantikan Muladi yang telah menjabat selama enam tahun.

JAKARTA—Lembaga Ket- skala nasional, namun juga ahanan Nasional (Lemhanas) internasional. memiliki pimpinan baru. KeLemhanas, kata dia, memimarin (17/2), Presiden Susilo liki tantangan-tantangan yang Bambang Yudhoyono resmi bersifat lokal, regional, maumelantik Budi Susilo Supandji pun internasional. “Kalau sebagai Gubernur Lemhanas tidak dilakukan manajemen menggantikan Muladi di Istana atau dikaji secara baik bisa Negara. mengganggu persatuan kesBudi Supandji atuan bangsa,” yang merupakatanya. kan adik manTerkait dentan Jaksa Agung gan penunjukHendarman kannya sebaSupandji sebelgai Gubernur Jadi tidak perlu umnya menjabat Budi didramatisasi (per- Lemhanas, Dirjen Potensi mengatakan tePertahanan Ke- gantian) berkaitan lah mendengarmenhan. Pen- dengan partai poli- nya beberapa gangkatan Budi waktu lalu. “Katik atau reshuffle lau dikaitkan, sebagai Gubernur Lemhanas ya memang dia Muladi berdasarkan ( He n d a r ma n , Keppres N0. 128/ Mantan Gubernur R e d ) a b a n g P/2010 tanggal 1 saya. Lemhanas Desember 2010. Mau diapain Muladi menlagi,” tuturnya gatakan, pergantian tersebut tentang hubungannya dengan sudah direncanakan sejak Hendarman Supandji, lantas empat bulan silam. Dia juga tersenyum. telah menjabat sebagai GuUsai pelantikan Gubernur bernur Lemhanas lebih dari Lemhanas, di Istana Negara lima tahun sejak dilantik 30 juga dilakukan pengucapan Agustus 2005. sumpah keanggotaan Om“ Yang lain (gubernur budsman Republik Indonesia Lemhanas lain, Red), dua di hadapan Presiden SBY. sampai tiga tahun. Jadi tidak Mereka yang mengucapkan perlu didramatisasi (pergan- sumpah adalah Danang Girtian) berkaitan dengan partai indrawardana (ketua), Azlaini politik atau reshuffle,” tutur Agus (wakil), Budi Santoso, Muladi. Ibnu Tri Cahyo, Hendra NurtBudi Supandji mengaku jahyo, Pranowo Dahlan, Petrus mendapat pesan dari presiden Beda Peduli, Muhammad untuk membawa Lemhanas Khoirul Anwar, dan Kartini dikenal baik tidak hanya dalam Istiqamah. (fal)


Maling Bobol Kantor Advokat PONTIANAK—Kantor Advokat Andel dan Partner yang terletak di di Jalan Trunojoyo, Pontianak dibobol maling, Kamis (17/2). Seperangkat komputer lengkap berisi dokumen penting hilang dilarikan pelaku. Andel mengatakan telah dua kali kantornya dibobol. Pada aksi pertama pelaku gagal mengambil barang berharga di kantor. Baru kali kedua, barang berharga raib. “Padahal komputer tersebut berisikan dokumen penting menyangkut pekerjaan,” kata Andel.

Menurut dia, bukan nominal kerugian yang membuat pihaknya merasa kehilangan. Melainkan dokumen yang tersimpan di komputer. File dokumen komputer itu banyak memuat data penting. Adapun komputer yang dilarikan lengkap dengan sound system. Dia berharap pelaku dapat segera terungkap. Andel menyerahkan kasus ini sepenuhnya ke pihak berwajib. “Kita sudah melaporkan kasus ini ke polisi,” kata dia. Andel mengatakan, saat

kejadian dirinya sedang berada di luar kota. Kemalangan ini diketahui dari rekan satu kantornya, Suarmin. Dia mendapati pintu samping kantor sudah terbengkas. Pembobolan di kantor Andel diperkirakan terjadi dini hari atau subuh Kamis. Sebab pada Rabu malam, kantor masih berlangsung aktifitas. “Saya prediksi, aksi pembobolan berlangsung lewat jam tengah malam. Soalnya hingga pukul 23.00 sebelum kejadian, sopir masih berada di kantor,” kata Suarmin. (stm)

Sarankan SBY Lakukan Reshuffle JAKARTA - Ketua Dewan bangunan (UKP4). Satu tahun Pembina Partai Golkar, Ak- kabinet bekerja, masyarakat bar Tandjung menyarankan ternyata lebih banyak memPresiden Susilo Bambang Yud- perlihatkan sikap tidak puas. hoyono (SBY) unKalau sudah betuk tidak ragu-ragu gitu, presiden dalam melakukan tidak boleh ada reshuffle kabinet keraguan untuk sebagai respon termemperbaikinhadap ketidakpuaya,” saran Akbar san masyarakat terTandjung di Akhadap kinerja para bar Tandjung Inpembantunya. stitute, Jakarta, ”Kan sudah Kamis (17/2). satu tahun kabiKalau reshuffle net ini bekerja dan tidak segera dipresiden pasti ada lakukan presipenilaian kinerja Akbar Tanjung den, lanjut mankabinetnya baik secara lang- tan Ketua DPR itu, maka SBY sung maupun melalui Unit akan tercatat sebagai presiden Kerja Presiden bidang Penga- yang tidak berbuat apa-apa wasan dan Pengendalian Pem- selama memimpin bangsa dan


Pontianak Post

negara ini. Lebih lanjut, Akbar juga mengingatkan presiden agar menggunakan parameter yang jelas dan tegas dalam merombak kabinetnya. ”Utamakan kompetensi. Sepanjang ada orang yang punya kapasitas memadai untuk memperkuat pemerintahan, gunakan itu. Tidak perlu ada keraguan dalam bertindak sepanjang tidak bertentangan dengan konstitusi.” Dikatakan mantan Ketua Umum Golkar itu, pengalaman satu tahun lalu dimana presiden dalam menyusun anggota kabinetnya sangat dipengaruhi oleh pertimbangan partai politik, harus segera ditinggalkan. ”Alasan dan pertimbangan politik dalam menyusun kabinet sesungguhnya pengkhianatan awal dari cita-cita bangsa dan negara ini untuk membentuk presidensiil kabinet,” tegas Akbar Tandjung lagi. Ditegaskan lagi, sepanjang perubahan itu untuk kepentingan dan memperkuat bangsa dan negara ini, sebaiknya segera saja lakukan reshuffle kabinet itu. (fas/jpnn)

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Per­setujuan Peru­bahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11­September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redak­si: (0561) 735070.Telepon Iklan/Pema­saran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: redaksi@pon­ Penerbit: PT.Akcaya PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Utama Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Re­daksi/Penang­gung Jawab: B Salman. Redaktur Pelaksana: Khairul­rahman, Muslim Minhard, Donatus Budiono, Basilius Sidang Redaksi: Abu Sofian, Surhan Sani, Mela Danisari, Yulfi Asmadi, Andre Januardi, Mursalin, Robert Iskandar. Sekre­taris Redaksi: Silvina. Staf Redaksi: Marius AP, U Ronald, Efrizan, Deny Hamdani, Budianto, Chairunnisya, M Kusdharmadi, Hari Jawa Pos Group Kurniatama, Hendy Irwandi, Pracetak/Artistik: A Riyanto (Koordinator), Grafis: Sigit Prasetyo, Ilustrator: Kessusanto. Fotografer: Timbul Mudjadi, Sando Shafella. Biro Singkawang: Zulkarnaen Fauzi (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: Thoriq (Jl P Anom Telp (0562) 392683) Biro Sanggau: Anto Winarno (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Andi Chandra, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Wahy Ismir. Pema­saran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie. Harga Lang­ganan per 1 Bulan dalam kota Rp 65.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 25.000,- spot colour Rp 30.000,- full colour Rp 37.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, mak­­si­mal 10 baris) pem­bayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No.4 Pasar Ming­gu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.



Pontianak Post

Pontianak bisnis


Jumat 18 Februari 2011

Lokomotif Kemajuan Ekonomi Kalbar

Proyeksi Pertumbuhan Ekonomi 6,5 Persen JAKARTA - Pemerintah memproyeksikan pertumbuhan ekonomi di triwulan I-2011 mencapai 6,5 persen, atau lebih optimistis dibandingkan perkiraan Bank Indonesia sebesar 6,4 persen. Pertumbuhan masih akan ditopang oleh konsumsi rumah tangga, investasi, dan ekspor. Kepala Badan Kebijakan

Fiskal Kementrian Keuangan Bambang P.S Brodjonegoro mengungkapkan hal tersebut di Kantor Kementrian Keuangan, Jakarta, kemarin. “Dengan pertumbuhan yang lebih tinggi dari triwulan pertama tahun lalu, kita harapkan target 6,4 persen tahun ini bisa tercapai. Syukur-syukur bisa lebih,” kata Bambang.

Bambang menambahkan, untuk meningkatkan kualitas pertumbuhan, pemerintah akan terus memperbaiki sektor industri pengolahan. Sektor tersebut mampu menyerap tenaga kerja lebih banyak. Selain industri pengolahan, masuknya investasi selama ini telah menggerakkan sektor konstruksi. Bambang berharap

Indonesia bisa kembali di masa sebelum krisis 1997, di mana industri manufaktur menjadi penggerak utama pertumbuhan. “Sekarang adalah waktunya bagaimana merevitalisasi industri manufaktur,” katanya. Mantan Dekan FE UI tersebut menambahkan, investasi asing langsung (FDI) tahun ini diperkirakan akan melebihi

modal portofolio. “Itu artinya akan cukup bagus,” katanya. Di 2010 sendiri, surplus NPI yang melonjak dua kali lipat lebih menjadi USD 30,3 miliar, banyak disumbang oleh transaksi modal dan keuangan yangmencapaiUSD26,2miliar. Transaksi modal dan keuangan tersebut terutama berbentuk FDI dan portofolio. (sof)

Hasbani Siap Berdayakan Kadin Kota

Rice Bowl Cabang ke-61 Dibuka

Minuman Lima Menit, Makanan Lima Belas Menit Rice Bowl Indonesia, franchise restoran khas Oriental kini hadir di Pontianak. Bertempat di Jalan KH Ahmad Dahlan, grand opening cabang ke-61 ini berlangsung meriah dan penuh keakraban kemarin (17/2) siang. Usaha waralaba yang telah berdiri sejak tahun 2004 ini siap menjadi tempat makan tervaforit warga Pontianak. Aristono Edi K, Pontianak Dua orang waitress cantik dengan senyum lebar berdiri di sisi kiri dan kanan pintu masuk restoran. Setia menunggu tamu yang datang. Tidak lama kemudian satu keluarga melangkah ke arah mereka. Terdiri dari ayah, ibu, dan seorang anak. “Goes coming, three person,” ujar seorang waitress dengan

nada yang enak didengar. Sementar pelayan yang satunya membuka pintu dan mempersilahkan keluarga itu masuk. “Thank you,” jawab seseorang dari bagian dalam restoran. Ia kemudian berlari masuk dan menggiring tamu ke meja yang masih kosong.“Tunggu sebentar ya pak, sedang kami siapkan,” ucapnya. Kata ‘sebentar’ yang diucapkan ternyata bermakna sungguhan. Lima menit kemudian, tiga orange juss telah terletak di atas meja. Disusul beberapa hidangan yang menggugah selera. Konsep pelayanan yang ditawarkan Rice Bowl dirancang untuk memanjakan pengunjung. Iwan, Direktur Rice Bowl Pontianak mengatakan terdapat banyak standar servis yang dimiliki restoran ini, dua di antaranya yaitu fast table service dan open kitchen concept. “Pertama pelayanan yang cepat, standar kami maksimal lima menit untuk makanan dan lima


Terpilih Secara Aklamasi

NIKMAT : Konsumen menikmati menu hidangan saat hari pertama pembukaan di Rice Bowl, kemarin (17/2). belas menit untuk makanan,” sebutnya. Sedangkan open kitchen concept berarti dapur terbuka. Semua kegiatan staf restoran yang dilakukan di dapur dapat terlihat dengan jelas oleh pelanggan. Semua peralatan dapur menggunakan bahan stainleesssteel.“Iniuntukhigienitas produk kami, jadi tidak ada rahasia-rahasiaan. Semua nampak dari meja tamu,” sambung Iwan. Selain pelayanannya yang memuaskan, masakan yang ditawarkan Rice Bowl berbeda

ingin pasang iklan di... Pontianak Post Call aja...disini... 735071

dengan kebanyakan food franchise lainnya. Restoran dua lantai dengan 180 kursi ini menawarkan menu khas Oriental. Salah satu andalannya adalah roasted duck, bebek yang dipanggang empuk dengan saos yang mantap. “Di banyak cabang, menu ini adalah yang paling favorit. Saya yakin di Pontianak ini orang akan menyukai roasted duck,” ungkap Dicky Pracoyo, General Manager Rice Bowl Indonesia. Selain menu tersebut, rumah makan ini juga menyediakan berbagai suguhan khas

Asia Timur lainnya. Bahkan ada menu yang hanya seharga Rp15 ribu saja. Beberapa tamu yang ditanyai oleh Pontianak Post mengakui bahwa sajian Rice Bowl memang enak. “Ayam khung pao-nya enak. Asinnya tidak terlalu asin, tapi gurih. Pokoknya pas di lidah,” kata Thomas Bun (24 tahun), seorang tamu. Aciau (40 tahun), pengunjung lainnya mengatakan hal serupa. “Jamurnya lembut, rasanya juga khas. Pokoknya beda dengan masakan yang lain-lah,” kata konsumen itu. (*)


PONTIANAK – Kandidat tunggal Ketua Umum Kadin Pontianak, Hasbani terpilih aklamasi memimpin Kadin Pontianak lima tahun kedepan. Keputusan itu diambil dalam pelaksanaan ulang Musyawarah Kota V Kadin Pontianak di Auditorium Untan, 17 Februari 2011. Ia siap memberdayakan Kadin Kota Pontianak kedepannya. Hasbani terpilih aklamasi setelah dua calon lainnya mengundurkan diri, yaitu Herry Fadhilah dan Mardiani. Mardiani mundur sebelum pelaksanaan pertama Mukota V Kadin Pontianak pada 21 Desember 2010, sedangkan Herry mengundurkan diri pada 11 Februari 2011. Ketua Kadin Pontianak periode sebelumnya, Fachruddin D Siregar mengatakan, ketua baru harus mampu membentuk kepengurusan yangkompak.Sehinggalebihmudah ikutmenyokongperekonomianKota Pontianak, sesuai moto sebagai kota jasa dan perdagangan. “Ketua dan pengurus baru harus membentuk kadin yang lebih baik dari periode sebelumnya,” tegas Fachrudin.

Hasbani mengakui, amanah untuk memimpin Kadin Kota Pontianak merupakan tugas berat. Meski berat, ia tetap berpegang teguh pada visi misinya. “Kepengurusan lengkap Kadin Pontianak nanti disusun dengan mengakomodir tiga pelaku ekonomi, sehingga kami mampu menggairahkan perekonomian kota,” katanya. Kepentingankelompokiaminimalisir. Semua pelaku ekonomi dari golongan kecil sampai besar mereka rangkul untuk sinergitas. Menurut Hasbani, terpilih sebagai Ketum Kadin Pontianak bukan kemenangan yang harus dibanggakan. “Dukungan peserta mukota yang harus kita banggakan, termasuk kandidat calon ketua yang pernah menghangatkan persaingan. Penghargaan patut pula disampaikan pada sahabat saya, Bapak Fachruddin D Siregar karena telah membimbing saya,” ujarnya. Ketum Kadin Kalimantan Barat Santyoso Tio yang turut menghadiri Mukota V menyatakan, lima tahun terakhir, ekonomi Kalbar mengalami kemajuan yang menyakinkan. Dimana dana terhimpun perbankan naik 129% di 2010 menjadi Rp22,7 triliun dari Rp9,9 triliun di 2005, kredit perbankan naik 176% dari Rp6,4 trilun menjadi Rp17,8 triliun, dan kredit UMKM naik 169 persen dari Rp4,2 triliun menjadi Rp11,3 triliun. Tumbuh kembang ekonomi Kota Pontianak sangat dipengaruhi tumbuh kembang ekonomi daerah/kabupaten.Selainibukota provinsi dan pusat pemerintahan, Pontianak juga pusat perdagangan,keuangan,danjasa.Pengusaha Pontianak punya posisi sangat strategis dan menguntungkan. “Selain dapat mengembangkan usaha di Pontianak, kita juga berperan serta dalam kegiatan ekonomi di seluruh Kalbar,” pungkasnya. (*/mde)

Industri Farmasi Tumbuh Pesat JAKARTA - Industri farmasi Indonesia terus tumbuh. Tahun 2010 lalu, pasar industri farmasi sudah menembus angka Rp37,53 triliun. Deputi Menteri BUMN bidang Industri Strategis dan Manufaktur Irnanda Laksanawan mengatakan, tahun 2011 ini, pasar farmasi diperkirakan akan terus tumbuh hinggaRp42triliun.“Daripasaritu, BUMN kita targetkan bisa meraih pangsa Rp6,5 triliun,” ujarnya di Komisi VI DPR kemarin (17/2). MenurutIrnanda,pasarfarmasi akan terus tumbuh seiring dengan tumbuhnya kebutuhan obat-obatan oleh masyarakat karena kondisi perekonomian yang makin bagus. “ Untuk itu, BUMN farmasi harus memperkuat dirinya agar tidak kalah bersaing dengan perusahaan swasta nasional,” katanya. Irnandamengakui,saatini,BUMN farmasi yang terdiri dari PT Kimia FarmaTbk,PTIndofarmaTbk,dan PT Biofarma (Persero) baru menguasai kurang dari seperenam dari total pangsa pasar nasional. “Karenanya, ke depan, BUMN farmasi harus bisa bersinergi dengan regrouping (penggabungan, Red) untuk memperkuat daya saing,” ucapnya. Meski prospektif, namun Wakil Ketua Komisi VI DPR Aria Bima mengatakan, BUMN farmasi harus tetap waspada mengingat tekanan dari sisi bahan baku masih aman dialami industri farmasi di 2011 ini. “Karena itu, agar BUMN farmasi bisa tahan dari tekanan harga bahan baku ini, sebaiknya ketiganya memang digabung,” ujarnya. Dengan langkah sinergi tersebut, lanjut Aria, Komisi VI DPR berharapagarperanBUMNdalam industri farmasi bisa meningkat. Terkait target pemerintah yang menyebut angka seperenam atau hanya 16 - 17 persen dari pangsa pasar farmasi nasional, Komisi VI DPR memberikan target lebih tinggi. (owi)


Pontianak Post


Jumat 18 Februari 2011

Warga Padati Perayaan Cap Go Meh Yayasan Bhakti Suci Pontianak

Keberagaman Etnis Pererat Persatuan H

AMPIR seluruh warga Kota Pontianak memadati Jalan Gajahmada, kemarin (17/2) siang. Jalan dipenuhi warga terjadi mulai depan Hotel Orchadz hingga persimpangan empat Jalan Gajahmada, Diponegoro, Sulung Lelanang, dan Patimura. Tidak hanya itu, warga pun memadati ruasruas jalan yang berhubungan dengan Jalan Gajahmada. Bagai dihipnotis, para warga rela berdesakkan menyaksikan acara perayaan Cap Go Meh 2011 Yayasan Bhakti Suci bertajuk Festival Cinta Budaya Nusantara di Sekretariat Yayasan Bhakti Suci (YBS). Mereka ingin menyaksikan pertunjukan dari sembilan naga dan belasan barongsai, yang sehari sebelumnya tampil di halaman rumah Ketua Umum YBS The Iu Sia. Selain itu pertunjukkan budaya dari berbagai etnis ikut menyita perhatian warga. Tidak kurang 20 grup kendaraan pawai turut mengibur warga. Puncak Perayaan Cap Go Meh (CGM) yang dimotori Yayasan Bhakti Suci, kemarin, tidak hanya diramaikan kalangan etnis Tionghoa. Beragam seni budaya etnis lain pun ikut tampil, diantaranya dari etnis Melayu, Dayak, Madura, Jawa, Batak, Sunda dan Ambon. Sejumlah pihak mengaku kagum dan memberikan apresiasi atas pengemasan acara yang mencerminkan kerukunan antarelemen masyarakat. Duduk di panggung kehormatan (depan Sekretariat YBS); Wakil Gubernur Kalbar Christiandy Sanjaya, Kapolda Kalbar Brigjen Pol Sukrawadi Dahlan, dan Walikota Pontianak Sutarmidji, serta Muspida Provinsi dan Kota Pontianak. Ketua Umum YBS The Iu Sia saat dihubungi mengatakan, karnaval yang mereka adakan ditujukan pada semua etnis. “Melalui perayaan CGM, kami ingin memajukan Kota Pontianak khususnya dan Kalbar umumnya, terutama di bidang pariwisata dan jasa. Ini (festival) bukan hanya milik orang Tionghoa saja, tapi seluruh masyarakat Kalbar dan Indonesia. Meskipun kita berbeda-beda tapi satu tanah air,” katanya. “Sebagai ketua umum YBS, saya sangat


TUNTAS: Para pejabat, tokoh masyarakat serta undangan lainnya, mengikuti hingga tuntas akhir acara.

ANGPAO: Pangdam XII/Tanjungpura Mayjen TNI Geerhan Lantara (kedua kiri) dan The Iu Sia bersama keluarga memberikan angpao pada barongsai pada perayaan Cap Go Meh di Makodam.


TANDATANGAN: The Iu Sia membubuhkan tandatangan pada kepala naga.

JABAT TANGAN: The Iu Sia berjabat tangan dengan Semar, Gareng, Bagong serta Petruk.

AMBON MANISE: Permainan rakyat serta tari pergaulan, diiringi musik begitu khas, mendapat aplaus pengunjung. cmyk

DIABADIKAN: The Iu Sia, ketua umum YBS bersama istri dan anak-anaknya diabadikan bersama salah satu naga yang tampil di rumahnya pada malam Cap Go Meh, 16 Februari.

LESTARI: Walaupun jauh dari daerah asal, reog tetap lestari.

MANGGUL SINGA: Para seniman Banten, memari sambil memanggul singa.

berterima kasih pada saudara-saudara kita dari hampir semua etnis dan budaya yang ada di daerah ini telah ikut perpartisipasi dalam festival hari ini (kemarin, Red).” Wakil Gubernur Kalbar Christiandy Sanjaya menilai, perayaan CGM bukti kebersamaan dan kebersatuan. Dia menyatakan sangat terkesan. Perpaduan beragam seni budaya yang ditampilkan dapat menjadi suatu tanda bahwa situasi Kalbar sangat kondusif. Berbagai potensi budaya yang ada dan dikemas dalam satu acara, dapat menjadi suatu aset andalan demi membangun bidang pariwisata di Kalbar. Karena itu, model seperti ini diharapkan dapat terus dikembangkan sehingga ke depan dapat menarik lebih banyak lagi wisatawan. Walikota Pontianak Sutarmidji juga terkagum-kagum dengan perayaan CGM tahun ini. Penyelenggaraan dinilai cukup bagus, rapi, dan tertib. Apalagi ketika melihat kemeriahan yang tercipta di mana para penonton tampak begitu antusias. “Yang jelas, ini dikemas dengan parade budaya nusantara, suatu hal yang baik, yang bagus. Ini salah satu media hiburan bagi masyarakat Pontianak. Buktinya, puluhan ribu yang hadir dalam kesempatan ini,” ujarnya. Menurut Sutarmidji, tampilnya berbagai seni budaya dalam CGM membuktikan bahwa masyarakat Kota Pontianak hidup dengan rukun. Apalagi, tak hanya peserta atraksi yang berasal dari berbagai etnis, warga yang menonton juga berasal dari lintas suku dan agama. Warga Pontianak dinilai dapat menjaga ketentraman dan ketertiban kota. Di samping itu, perayaan CGM Pontianak pun berlanjut hingga malam hari yang dipusatkan di depan Makodam XII/Tanjungpura. Kegiatan itu pun sangat menarik minat warga, meski baru mulai sekitar pukul 20.00, warga sudah memadati lokasi kegiatan sejak pukul 18.00. Antusiasme warga untuk menyaksikan atraksi sembilan naga dan barongsai tidak surut di depan Makodam XII/Tanjungpura.(*) Foto-foto : MUJADI/PONTIANAK POST dan YBS

SANDUR: Aksi para remaja dalam menari sandur.

MABM: Majelis Adat Budaya Melayu, menampilkan para remaja serta meriam karbit.

MEWAH: Para penari dari kerukunan masyarakat Batak, tampil dengan kostum cukup mewah.


TANPA MUSIK: Walaupun menari tanpa diiringi musik, namun tetap tampil kompak.


Pontianak Post l Jumat 18 Februari 2011



Naoto Kan Dilawan Internal Partai TOKYO - Perdana Menteri Jepang Naoto Kan, yang baru saja tujuh bulan menjabat, mendapatkan perlawanan dari sekelompok anggota parlemen dari partainya sendiri. Konflik internal tersebut dikhawatirkan akan mengganggu agenda reformasi pemerintah sekaligus mengancam kepemimpinan

Kan. Enam belas anggota majelis rendah (setingkat DPR) loyalis salah satu tokoh penting, yang juga rival Kan di Partai Demokratik Jepang (DPJ), Ichiro Ozawa, meminta agar dikeluarkan dari fraksinya. Mereka menyatakan tidak akan mendukung pemerintah dalam pengambilan

kebijakan krusial. Kelompok “pemberontak? menyatakan ketidaksepahaman mereka dengan lemahnya kepemimpinan Kan dan gagalnya pemerintah memenuhi janji-janji DPJ. Padahal DPJ-lah yang membawa Kan naik ke tampuk pimpinan tertinggi pemerintahan, mengakhiri

dominasi kelompok konservatif selama 50 tahun. Dewan pimpinan partai menolak permintaan ke-16 anggota parlemen tersebut untuk keluar dari fraksi DPJ. Namun langkah mereka memperjelas adanya perpecahan di tubuh partai penguasa saat ini. Survei yang dilakukan Jiji

Press menunjukkan bahwa dukungan masyarakat terhadap kabinet turun drastis hingga 17,8 persen. Kan, yang naik takhta Juni tahun lalu, terus berjuang memulihkan perekonomian Jepang dan masalah sosial yang diwariskan oleh kelompok konservatif saat masih berkuasa. Saat

ini oposisi mengancam akan menggagalkan pembahasan anggaran untuk pos-pos penting yang diajukan pemerintah. Dengan penarikan dukungan oleh 16 anggota fraksi pemerintah, amunisi oposisi bertambah. Perekonomian Jepang, mengalami masa sulit selama dua dekade terakhir. Geraknya terhambat dengan buruknya pertumbuhan populasi. Tahun lalu, posisi Jepang sebagai kekuatan ekonomi terkuat kedua di dunia, diambil alih oleh Tiongkok dan tengah menghadapi tantangan dari Korea Selatan. Kan, perdana menteri Jepang kelima selama lima tahun terakhir, telah berjanji untuk mendorong reformasi ekonomi guna memacu pertumbuhan dan mereduksi utang publik yang jumlahnya bertambah dua kali lipat hingga mencapai lima triliun dolar. Lembaga Standard & Poor menurunkan tingkat kemampuan rata-rata melunasi utang Jepang. Lembaga yang berbasis di Eropa tersebut meragukan kemampuan pemerintahan Kan untuk mencegah bertambahnya utang. Perdana Menteri Kan juga mendorong Jepang untuk bergabung dengan zona pasar bebas. Namun wacananya tersebut mendapatkan tentan-

gan dari sektor pertanian. Mereka khawatir akan mati dengan pasar bebas. Partai Konservatif, Partai Demokratik Liberal (LDP), yang berkuasa di Jepang selama 50 tahun setelah perang dunia berakhir, dan hingga kini masih menguasai majelis tinggi (Senat) mengancam akan menghambat pembahasan sejumlah UU penting. Kan juga gagal memperoleh dukungan dari partai-partai kecil untuk memenuhi suara mayoritas yang diperlukan dalam meloloskan berbagai undang-undang dan anggaran negara dalam Diet (parlemen Jepang). Jika ke-16 anggota parlemen tersebut tak lagi mendukung partainya, bisa diartikan “kiamat” bagi DPJ. Karena memerlukan dua pertiga suara majelis rendah untuk bisa membahas sebuah undang-undang yang ditolak oleh majelis tinggi. “Apa yang diinginkan 16 anggota parlemen tersebut adalah mengganti Kan tanpa harus membubarkan parlemen dan mempercepat pemilu,” terang Tetsuro Kato, profesor politik asal Waseda University. “Tapi masalahnya, mereka tidak punya tokoh lain untuk menggantikan Kan,” tandasnya seperti dilansir Agence France Presse. (cak/dos)

Bajak Somalia Dihukum 33 Tahun NEW YORK - Karir Abduwali Abdukhadir Muse sebagai bajak laut berakhir di penjara Amerika Serikat (AS). Rabu waktu setempat (16/2), Pengadilan New York menjatuhkan hukuman 33 tahun sembilan bulan pada remaja asal Somalia tersebut. Diharapkan, vonis berat itu bisa membuat kapok para perompak lainnya. “Saya sangat menyesal dan saya mohon pengampunan,” kata Muse didampingi tim kuasa hukumnya, seperti dikutip Agence France-Presse kemarin (17/2). Pemuda yang saat melancarkan aksinya masih belum genap 18 tahun itu tampak sangat tertekan. Mengenakan kaus warna hijau dan celana khaki, dia terus menunduk saat vonis dibacakan. Muse tertangkap pada 2009 lalu, saat kelompoknya terlibat bentrok dengan para pelaut AS. Sebelumnya, bersama rekanrekan perompaknya, dia sukses membajak kapal Maersk Alabama yang melintas perairan Somalia. Bahkan, mereka juga menangkap kapten kapal dan

membawanya ke kapal-kapal kecil milik bajak laut untuk dijadikan sandera. Sial bagi Muse, saat hendak berunding dengan para pelaut AS di atas kapal Angkatan Laut (AL), dia justru ditangkap. Tiga rekannya pun juga lantas dibekuk. Selanjutnya, para pelaut AS itu berhasil membebaskan si kapten kapal. Pasca bentrok itu, Muse dan tiga rekannya dibawa ke Negeri Paman Sam untuk menjalani proses hukum. Diantara mereka, Muse merupakan bajak laut termuda. Sebenarnya, tim pembala Muse sudah mengajukan keberatan atas proses hukum yang berlangsung, karena klien mereka masih belia. Tapi, Hakim Federal Loretta A. Preska, pemimpin sidang, tak mengindahkannya. Apalagi, berdasar kesaksian kapten kapal dan kru Maersk Alabama lainnya, perilaku Muse sangat brutal. “Kekerasan dan kesadisan Muse serta rekan-rekannya menjadi pasal yang memberatkan,” ujarnya. (hep/dos)

Gudang Amunisi Meledak 20 Warga Tewas ZANZIBAR - Serangkaian ledakan pecah di gudang amunisi militer Tanzania di Kota Dar es Salaam Rabu malam waktu setempat (16/2). Dalam waktu singkat, api merembet ke beberapa rumah di sekitarnya dan memaksa ribuan warga mengungsi. Sedikitnya 20 orang tewas dan sekitar 145 lainnya terluka akibat ledakan tersebut. Ledakan beruntun itu membuat langit di atas kota terbesar republik Afrika Timur itu membara. “Dampak ledakan di pangkalan militer Gongola Mboto semalam (Rabu malam) terasa sampai lokasi yang berjarak sekitar 15 kilometer,” kata Perdana Menteri (PM) Mizengo Pinda kepada Associated Press kemarin (17/2). Selain beberapa rumah, api yang timbul dari ledakan juga membakar sebuah sekolah. Saking kuatnya ledakan, serpihan logam dari senjata yang disimpan di gudang itu terlempar sampai ke pinggiran

Dar es Salaam. “Sejauh ini, penyebab ledakan masih belum bisa dipastikan. Tapi, bisa kami pastikan tidak ada unsur kesengajaan,” kata Letkol Kapambala Mgawe, jubir militer Tanzania. Dia menambahkan, ledakan tersebut merupakan yang kedua di pangkalan militer Gongola Mboto, setelah insiden 2009 lalu. Mussa Wambura, pejabat administrasi Dar es Salaam, mengonfirmasikan jumlah korban tewas sebanyak 20 orang. Namun, menurut dia, jumlah tersebut akan meningkat. “Sebagian dari 145 korban luka yang dirujuk ke rumah sakit ini mengalami luka bakar serius. Beberapa diantaranya, bahkan, kritis,” ungkapnya dalam jumpa pers. Mereka yang terluka dirawat di rumah sakit Amana, Temeke dan Muhimbili. Akibat ledakan tersebut, Bandara Internasional Julius Nyerere yang terletak di Dar es Salaam terpaksa ditutup. (hep/dos)



Pontianak Post l Jumat 18 Februari 2011

Kiat Menangkal Bencana Di zaman dahulu, ada se­kelompok orang menemui seorang ulama besar. Mereka mengeluh, “Bagaimana mengatasi bencana dan krismon saat ini?“ Dengan cepat si Ulama menjawab, “Atasi dengan taqwa.” “Maksud pak kiai?” tanya salah seorang diantaranya. Sang Ulama membaca, “Kalau penduduk suatu negeri itu beriman dan bertaqwa, pasti Kami (Allah) akan membukakan keberkahan dari langit dan bumi“ (Al A;raf 96). Diantara ciri hamba yang beriman dan bertaqwa ialah seperti dalam surah Az-Zariyat (561) ayat 15-19 ) “Sesungguhnya orang-orang yang bertaqwa berada di dalam taman-taman (surga) dan mata air. Mereka mengambil apa yang diberikan Tuhan kepada mereka. Sesungguhnya mereka sebelum itu (di dunia) adalah orang-orang yang berbuat baik. Mereka sedikit sekali tidur pada waktu malam. Dan pada akhir malam mereka memohon ampunan (kepada Allah). Dan pada harta benda mereka ada hak untuk orang miskin yang meminta,

dan orang miskin yang tidak meminta.“ Sekurang-kurangnya ada empat kreteria orang yang bertaqwa menurut ayat diatas. Pertama, senang berbuat baik. Kedua, Istiqamah qiyamullail. Ketiga, memohon ampunan (beristighfar) di tengah ma­lam dan keempat, senang ber­sedekah. Rasululullah saw bersabda kurang lebih “Se­sungguhnya tidak ada orang masuk surga (termasuk saya) lantaran amalnya. Tetapi ia masuk surga semata-mata karena rahmat (kasih sayang) Allah.“ Adapun kita diperintahkan beramal baik oleh Allah dan Rasul-Nya adalah dalam rangka untuk menjaring rahmat Allah tersebut. Salah satu contoh seorang tokoh sufi, yang bernama Asy-Syibli, ketika wafat, salah seorang teman dekatnya bermimpi ketemu beliau dan bertanya “Apa yang diperlakukan Allah terhadap anda?“. “Ternyata 40 kali ikut jihad di medan perang, 30 kali naik haji, dan bersedekah 4.000 dirham itu, tidak bernilai disisi Allah, karena niatnya kurang ber-

O l e h :

Uti Konsen.U.M

sih. Dan Allah memberikan rahmat kepadaku, lantaran aku memungut pecahan kaca (beling) di tengah jalan, agar para pemakai jalan tidak cedera karena terinjaknya. Terkait yang kedua, banyak sekali ayat dan sabda Rasulullah saw yang menyatakan keutamaan melaksanakan qiyamullail atau salat tahajjud itu. Salat tahajjud memang merupakan anugerah yang teramat berharga. Disamping menyenangkan Allah, salat ini juga menjamin keselamatan dari malapetaka dan menjadikan kita tenang dan jernih. Ibnu Hajar RA menyebutkan terdapat keteran-

gan bahwa salat malam bisa menolak azab (Fathul Bari 3). Qiyamullail merupakan suatu bentuk pendekatan seorang hamba kepada Rabbnya di waktu malam sunyi, pendekatan ini dimaksudkan agar seorang hamba dapat mengadukan tentang permasalahan hidupnya kepada Allah Yang Maha Mengetahui segala permasa­ lahan seluruh makhluknya. Itulah mengapa Allah sangat menekankan seorang hamba untuk melakukan qiyaamullail, dimana Allah akan meninggi­kan maqam seorang hamba ka­rena taqarrub dan rasa ta­kut­nya kepada Rabb-nya. Ti­dak sedikit ketika para ulama yang buntu pikirannya untuk memecahkan suatu masalah, kemudian ia bermunajat kepada Allah swt, ditengah malam, sehingga Allah memberinya futuh dan membukakan untuknya masalah itu. Kriteria ketiga orang yang bertaqwa adalah istiqamah beristighfar di penghujung malam. Dari Anas RA bahwa Rasulullah saw bersabda, “Setiap anak Adam adalah

gemar berbuat salah, dan orang terbaik diantara yang bersalah adalah yang bertaubat“ (HR.Turmuzi, Ibnu Majah dan Al Hakim). Dalam Al Quran banyak sekali ayat yang menyuruh kita banyak beristighfar. Sebab, beristighfar, menyesali kesalahan itu, termasuk amal yang disukai oleh Allah. Diantara firmanNya, “Sesungguhnya Allah menyukai orang-orang yang taubat dan menyukai orangorang yang mensucikan diri “ (Al Baqarah 222). Rasulullah saw sendiri orang yang telah maksum, yang telah dijamin Allah bebas dari seluruh dosa, namun setiap harinya tidak kurang dari 70 kali mengucapkan istighfar. Beliau bersabda, “Demi Allah, sesungguhnya aku selalu mohon ampunan kepada Allah sehari semalam lebih dari 70 kali “ (HR.Bukhari). Siti Aisyah RA bertanya kepada Nabi SAW, “Wahai Rasulullah, apakah ada umatmu yang nanti dapat masuk surga tanpa hisab?” “Beliau menjawab, “Ada, yaitu orang yang mengenang dosanya lalu ia menangis.“

Nabi Yunus dihukum Allah dengan masuk ke dalam perut ikan hiu lantaran meninggalkan dakwah.“ Al Quran mengatakan “Seandainya Yunus tidak mendapat ampunan Allah, maka ia akan tinggal di perut ikan hingga hari kiamat.“ Adapun doa nabi Yunus AS, “Tidak ada Tuhan kecuali Engkau. Maha suci Engkau, aku sungguh termasuk orang-orang yang berdosa.“ Menurut riwayat, dengan membaca doa ini, ikan hiu itu perutnya menjadi kepanasan, sehingga ia memuntahkan Nabi Yunus ke tepi pantai. Kriteria keempat orang ya­ng bertaqwa ialah gemar bersedekah, berinfak. Sedekah adalah amalan

istimewa ber­demensi ganda. “Akhirat sekaligus dunia.” Ia tidak saja menunjukkan kecerdasan intelektual dan spiritual, tetapi juga sosial.ia menyimpan energi “misterius“ dalam meng­gerakkan orang meraih sukses, hidup bahagia, rezeki lapang, juga menangkal kesulitan dan bencana. Rasulullah saw bersabda, “Sedekah dapat menolak 70 macam bencana, yang paling ringan diantara bencana itu adalah penyakit kusta dan supak“ (HR.Thabrani ). Hadis lain, “Bersegeralah kalian untuk mengeluarkan sedekah, karena sesungguhnya bencana tidak dapat melewati sedekah“ (HR.Thabrani). Wallahu a’lam.**

Surat Pembaca

Drive Thru PLN untuk Siapa? Dua hari berturut-turut, Rabu & Kamis (16 – 17/2) kemarin, saya datang ke Kantor PLN Cabang Pontianak di Jalan Ahmad Yani untuk membayar rekening listrik. Saya menggunakan mobil dan langsung menuju fasilitas area pembayaran listrik drive thru yang terletak di depan kantor tersebut. Namun alangkah kagetnya begitu tiba di lokasi, ternyata loket drive thru sudah dikerumuni oleh ramai orang. Usut punya usut, ternyata mereka adalah masyarakat yang ingin membayar listrik. Mereka sengaja memarkirkan motornya di parkiran dan memilih mengambil jalur pintas dengan membayar di drive thru, mengingat antrian yang sangat panjang di loket pembayaran di dalam kantor. Saat saya tanya ke petugas loket drive thru, dengan entengnya dia menjawab, “Kasihan juga masyarakat yang harus antri didalam.

Makanya kita terima saja mereka bayar disini, khan kebetulan juga lagi sepi tadi,” katanya. Okelah saya dan siapapun pastinya bisa memaklumi bila berada di posisi masyarakat tadi, yang lebih memilih untuk mencari cara pembayaran yang cepat dan gampang, urusan beres! Daripada ngantri didalam kantor, enakan memilih loket yang cepat seperti di drive thru. Tapi bukankah hal itu ujungnya merugikan para pemilik mobil yang sebenarnya sudah dijanjikan kemudahan dari fasilitas drive thru tersebut? Karena ternyata justru dalam prakteknya malah terjadi penyimpangan fungsi. Mereka terpaksa harus ‘mengalah’ dengan masyarakat pembayar lain, yang sudah duluan mengerubuti loket drive thru. Banyak pengendara mobil selain saya, yang memilih untuk tidak berhenti dan ke luar dari area drive thru dengan menelan kekecewaan. Tapi ada

juga yang rela memarkirkan mobilnya di area drive thru dan turun ikut mengantri bersama masyarakat yang sudah duluan mengerubungi drive thru. Sekedar mengingatkan saja, mengutip dari Koran Pontianak Post terbitan Januari 2010, dikatakan oleh Manajer Rayon Kota Pontianak saat itu, Agus Rianto bahwa fasilitas drive thru ini dilaunching sebagai salah satu bentuk layanan pembayaran rekening listrik yang dapat dilakukan pengendara roda empat, hanya dengan membuka jendela mobilnya. Pembayaran melalui drive thru ini dapat dilakukan setiap hari kerja. Senin hingga Jum’at beroperasional mulai pukul 07.00 hingga pukul 16.00 wib, hari Sabtu hanya beroperasional sampai pukul 12.00 siang saja. “Pembayaran melalui kaca mobil ini akan lebih efektif, karena setiap satu kali transaksi melalui

drive thru, hanya memakan waktu kurang lebih dua menit saja. Sehingga pengemudi tidak perlu repot memarkir kendaraannya. Terlebih bila menggunakan uang pas,” ujar Agus kala itu kepada wartawan. Makanya atas dasar itu pula, saya berani menuliskan Surat Pembaca ini. Mana janjimu, PLN? Seharusnya PLN bisa bersikap lebih tegas dalam hal ini. Kembalikan fungsi drive thru ke peruntukkan sebenarnya. Kalaupun memang ada antrian panjang didalam kantor, tidak berarti harus mengganggu fasilitas yang sudah ada khan? Perbanyak saja loket-loket pembayaran didalam kantor, sehingga masyarakat bisa lebih cepat terlayani dan tidak sampai menunggu berjamjam lamanya duduk di tangga kantor. Sungguh pemandangan yang tidak mengenakkan dilihat. Atau kalaupun mau, sediakan saja loket pemba-

Muara Jungkat

yaran khusus diluar gedung, seperti halnya dengan drive thru mobil. Mungkin ada drive thru untuk motor? Ntahlah itu sekedar saran saja, karena tentulah semua kembali lagi pada ketegasan dari PLN. Saya berharap drive thru ini bukan diadakan hanya untuk gaya-gayaan dan pemanis saja – atau justru ingin mengejar penghargaan tertentu, tapi kenyataannya pada pelaksanaannya justru jauh dari harapan. Nisari Jln. Abdurrahman Saleh Pontianak

Formulir Pengisian Pensiun Meskisudahagakterlambat, perkenankanlah saya menyampaikan selamat ulang tahun kepada Pontianak Post, semoga kedepan koran kita ini makin maju dalam segala hal seperti pemberitaannyamaupunruang lingkup pemberitaannya. Selanjutnya kepada rekanrekan pensiunan, dalam kesempatan ini kami mengingat-

kan agar kita segera mengisi dan menyerahkan segera formulir yang harus diisi tentang data pribadi dan keluarga saat ini yang akan menjadi data akurat tentang besaran penerimaan pensiunan kita. Segera isi dan legalisir ke Lurah setempat dan diserahkan ke Taspen. Kamimendengaradapensiunanyangmungkinkarenakhilaf,

bukan karena disengaja sampai saatinimasihmenerimapensiunan untuk istrinya, sedangkan sang istri telah meninggal 5 tahunyanglalu.Kamiyakinpensiunan tersebut bukan berkarya Gayus, namun karena khilaf dan tidak hati-hati mengisi formulir tersebut diatas. Mohonbapak/ibuLurahyang melegalisir formulir tersebut

berhati-hati, lihatlah Kartu Keluarga yang berlaku saat ini. Ada ancaman dalam formulir yang harus diisi tersebut yakni apabila terlambat diisi dan diserahkan, makapembayaranpensiunakan dihentikan sementara. Semoga hal ini tidak kita alami. Laswardi Firman di Pontianak

Dengan adanya insiden Muara Jungkat, pemerintah mesti cepat dan berpikir. Kapal kecil tenggelam saja sudah kalang kabut, apalagi kapal besar. Coba pemerintah berpikir, andai kapal besar yang tenggelam, jangan-jangan Pontianak gelap gulita selamanya, karena tanker tak bisa masuk. Bensin antri, kebutuhan distribusi ekonomi hancur. Pesan saya, kalau tak mampu buat pelabuhan di tepi muara, buat alur lebat 200 x 10 meter dalamnya. Aman khan? Mana kerja proyek keruk tiap tahun yang dilakukan, kok

Kebutan di Mayasopa Satlantas Singkawang, mohon pengawasannya di jalan raya Mayasopa, se­ ring adanya kebut-kebu­tan masyarakat luar kabu­paten, tanpa mengindahkan ketert­ iban umum. (085822236510)

Pemancing Berkedok? Kami warga Parit Aem, Sungai Ambawang khusus­ nya tepian sungai Kapuas memohon polisi untuk mera­ zia orang yang sering purapura memancing ikan, kar­ ena dikhawatirkan mereka adalah para pencuri yang mengintai rumah warga seki­ tar. Tak heranlah bila keadaan mereka cukup meresahkan warga, apalagi mereka kerap

tetap 5 meter saja dalamnya. Nah lebarnya berapa? Paling cuma 30 meter, capek deh. (085245662777) melakukan perbuatan terse­ but. Setidaknya mohonlah untuk dirazia keberadaan­ nya. (085883871197)

Bayar Listrik via Bank Kemarin saya bayar rekening listrik bulan ini, kok struck-nya model baru? Apa karena kerjasama dengan Bank Bukopin? Cobalah jelaskan kepada kami ini yang orang awam kenapa masih dikenakan admin bank Rp 1.600,-Padahal setahu saya, bayar listrik itu khan sudah kena PPJ, betol tadak? Maklumlah pelanggan PLN nih banyak yang buta admin, jadi janganlah kami nih dibutakbutakkan terus. (081345055007)


Pontianak Post l Jumat 18 Februari 2011

Multi Etnis Membaur Cermin Kalbar Kondusif

Berkah Para Tatung Sambungan dari halaman 1

memperoleh keberuntungan jika membeli barang yang sudah diberkahi oleh para tatung ini,” kata pembeli yang mengaku bernama Ason. Menurut salah satu panitia pelaksana, lelang sejumlah barang ini diprediksi hingga sebelas malam. Saat ini, kata Bong Cin Nen yang juga Sekretaris Panitia Festival CGM 2011, penawaran tertinggi berupa liontin CGM seharga lima puluh sembilan juta sembilan ratus sembilan puluh sembilan rupiah. Panitia, kata Bong Cin Nen, tidak akan menargetkan berapa besar pendapatan. Jika dana pendapatan besar dari lelang ini, maka panitia akan memberikan sumbangan kepada sejumlah stakeholder yang mendukung suksesnya pelaksanaan CGM kali ini. “Lelang ini nantinya akan menutupi operasional pelaksanaan CGM,” kata dia. Sedangkan lelang yang dilakukan oleh Majelis Tao Indonesia Resort Singkawang, hanya berlangsung hingga

pukul enam sore. Ketua MTI Resort Singkawang, Chai Ket Khiong memastikan tahun ini pendapatan dari lelang menur un. S ebab, jalan menuju ke altar ditutup oleh oknum penegak hukum. “Kita ada bukti sehingga tatung tidak bisa memberkahi semua barang yang berada di altar,” kata Akiong kecewa. Menurut dia, hanya sepertiga dari barang yang tersedia terjual. Barang yang dilelang termahal hanya Rp10 juta yakni lampu pekong untuk melaksanakan ritual. “Pembelinya berasal dari Bodok, Sanggau,” kata Akiong, dihubungi, kemarin. Ketua Tri Dharma, Bong Wui Khong mengakui, mereka tidak menargetkan dalam pelaksanaan lelang. Barang-barang yang dilelang pun hanya sedikit dan pukul empat sore sudah selesai. “Kita hanya menyediakan barang untuk umat saja. Kita tak mengejar target dari lelang itu sendiri. Kita mengedepankan ritual, bukan keuntungan dari pelelangan itu sendiri,” kata Wui Khong. Pendapatan dari lelang, diakui man-

tan calon wakil wali kota ini, hanya untuk menutupi operasional saja. “Inikan rutinitas ritual. Tak boleh mengambil keuntungan,” kata dia. Dia juga berterima kasih kepada seluruh ma sya ra kat Si ngkawa ng yang mengedepankan teloransi beragama. “Kesuksesan ini bukan hanya kita, tapi seluruh masyarakat Singkawang. Mereka memberikan andil terhadap kesuksesan,” kata BWK, biasa namanya disingkat. Sementara itu, CGM ini memberikan nilai tambah bagi pedagang kecil. Sejumlah pedagang makanan mengaku memperoleh keuntungan. “Karena ramai, tentu jualannya kita cepat habis,” kata salah satu pedagang nasi di Jalan Budi Oetomo, kemarin. Pedagang kacang rebus saja mengaku dua kali memasak kacang. Hasilnya, semuanya ludes. “Cukup lumayan. Ini yang kedua. Pagi tadi banyak saja jual dan habis,” kata pedagang yang sering mangkal di Taman Burung Singkawang ini. “Alhamdulillah sejak, dimulainya persiapan CGM

hasil penjualan makanan jadi meningkat 50 persen lebih banyak dari hari-hari biasanya, dan memang kebanyakan yang beli adalah para tamu-tamu asing atau bukan warga Singkawang,” ujar Rina salah satu penjual makanan jadi di sekitar Jalan Ponegoro. Tidak hanya Rina, Amir yang merupakan penjual es buah yang tak jauh dari arena stand juga mengaku, jika hari-hari biasanya ia hanya mampu mendapat penghasilan bersih sekitar Rp60 hingga Rp85 ribu perhari. Namun menjelang ajang perayaan CGM ia mengaku bisa meraup penghasilan dua kali lipat bahkan lebih. “Pembelinya beragam, mulai dari masyarakat setempat hingga wisatawan,” jelasnya. Sejumlah wisatawan mancanegara juga terlihat membeli pernak pernik. Bagi jasa perhotelan, berkah CGM juga dirasakan. Semua hotel penuh. Hal ini selalu terjadi setiap tahun pada event CGM yang terbesar di Indonesia. (selengkapnya baca halaman 17) . (zrf/ ash)

Namun, dia menyatakan, bahwa selama ini kubu Oesman hanya melakukan klaim. Menurutdia, HKTI dibawah kepemimpinannya lah HKTI yang sah. “Kami yang ditentukan oleh munas, kalau mereka munas yang mana?” tandasnya. Rencananya, gugatan kubu Prabowo itu akan didaftarkan ke Pengadilan Tata Usaha Negara (PTUN) pada Februari

2011 ini. Konflik keduanya berawal saat Munas HKTI, di Bali, pada Juli 2010 lalu. Oesman yang kecewa dengan pelaksanaan munas karena menganggap cacat prosedur, lantas memilih mengadakan munas sendiri. Dua pelaksanaan munas berbeda itu lantas menghasilkan dua ketua umum yang berbeda. (dyn)

Oesman Sapta Digugat Sambungan dari halaman 1

Belakangan, lewat iklan di sejumlah media, HKTI kubu Oesman Sapta bahkan menyampaikan ucapan terimakasih kepada Menkum HAM Patrialis Akbar, atas pengesahan kepengurusan di bawah kepemimpinannya. Dalam iklan tersebut, ketua umum Partai Persatuan Daerah (PPD) itu bersyukur

telah mendapat badan hukum, hak cipta logo, dan mars HKTI dari kemenkumham. SuratnyaNomor AHU-14.AH.01.08. Tahun 2011. Terhadap hal tersebut, ketua dewan pembina Partai Gerindra tersebut mengaku belum tahu pasti pengesahan dari pemerintah tersebut. “Saya belum tahu kalau mereka (Kemkumham, Red) mengakui,”kata Prabowo.

Anut Keberagaman, Akui Ada Santri Beraliran Syiah Sambungan dari halaman 1

Dia mengalami luka di wajah. ’’Sekarang saya sudah nggak trauma lagi,’’ kata Miqdad. Dia menceritakan, saat kejadian dirinya sempat merasa trauma dan bahkan berniat akan pulang. ’’Tapi, sekarang niat mau pulang saya batalkan,’’ imbuhnya. Humas Yapi Muhammad Alwi mengatakan, penyerangan terhadap pondoknya itu bukan kali pertama terjadi. ’’Sejak 2007, Yapi tidak pernah putus mengalami teror, kekerasan, dan tindakan-tindakan anarkistis. Kami sudah melapor kepada pihak aparat, mulai polsek hingga Polri,’’ tandasnya. Dia melanjutkan, pihaknya juga pernah melapor kepada ketua RT hingga presiden. Dalam kesempatan itu, dia kepada war tawan membantah keras soal tuduhan yang menyebut Ponpes Yapi mengajarkan aliran Syiah. ’’Kami tegaskan, ponpes kami ini adalah lembaga pendidikan yang merujuk kepada dinas pendidikan,’’ tandas Muchsin Assegaff,

ketua YAPI. Dia menambahkan, dalam memberikan pembelajaran, Ponpes YAPI menganut kebebasan berpikir para santrinya. Muchsin menjelaskan, pihak pondok memberikan pemahaman terhadap semua ajaran Islam. ’’Kami member ikan wacana-wacana ajaran yang ada dalam Islam. Intinya, tidak berbeda jauh dengan yang diajarkan pesantren yang lain. Kami juga mengedepankan toleransi,’’ jelasnya. Model pengajaran yang menjunjung tinggi semangat toleransi terhadap berbagai macam mazhab dan aliran yang ada dalam Islam menjadi ciri Ponpes Yapi sejak didirikan. Ponpes tersebut didirikan pada 1973 oleh (alm) Ustad Husein Habsyi bin Abu Bakar. Saat kecil Ustad Husein ditinggal wafat sang ayah. Dia pun sejak kecil d i a s u h o l e h p a ma n nya, Ustad Muhammad Baraja. Dia mengenyam pendidikan dasar di Madrasah Al Khairiyah, Surabaya. Setelah lulus, Husein mengajar di Madrasah Al Khairiyah ber-

sama kakaknya, Ustad Ali Al Habsy. Lantas, mereka hijrah ke Penang, Malaysia. Di sana mereka berguru kepada Ustad Abdul Qadir Balfaqih, Syeh Muhammad Robah Hassuna (seorang ulama dari Qolili, Palestina, yang berkhidmat mengajar di Madrasah Al Khairiyah), Al Habib Alwi bin Thahir Al Haddad (mufti Kerajaan Johor Bahru, Malaysia, di masanya), dan Assayid Muhammad Muntasir Al Kattani (ulama dari Maghribi, Maroko). Di Johor, Husein juga sempat mengajar di Madrasah Al Athhas. Setelah mengajar cukup lama di Malaysia, Husein menikah dengan Fatimah. Lantaran saat itu terjadi peristiwa politik semasa penjajahan Inggris di Semenanjung Malaysia, akhirnya Husein meninggalkan Malaysia dan kembali ke kampung halamannya di Surabaya. Di Surabaya dia mulai menjalankan aktivitas dakwah dan banyak berkecimpung di dunia politik. Dia pernah menduduki kepengurusan di Partai Masyumi bersama M. Natsir. Setelah

tidak berkecimpung dalam dunia politik, Husein memilih mendirikan lembaga pendidikan Islam. Menurut Ali Ridho, Ustad Husein adalah sosok yang mempunyai toleransi keberagaman yang cukup tinggi. Dia menjelaskan, di Ponpes Yapi, beberapa santri berbeda mazhab. Termasuk mazhab Syiah. ’’Jangan heran, kalau di masjid, pemandangannya cukup beragam saat salat. Kami sangat toleran dengan perbedaan itu,’’ jelas Ridho. Karena cukup beragam itulah, menurut Ustadz Muchsin, sebagian santrinya bermazhab Syiah. ’’Tetapi, kalau secara lembaga, kami ini lembaga pendidikan. Tidak terpaku kepada satu mazhab,’’ bebernya. Saat ini Ponpes Yapi memiliki jumlah santri sekitar 600 orang yang terdiri atas putra dan putri. Kepala Desa Kenep Nur Soleh menyatakan, selama ini Ponpes Yapi memiliki hubungan yang baik dengan masyarakat setempat. ’’Mulai dulu hingga sekarang tidak ada permasalahan,’’ jelasnya. (jpnn/c4/kum)

kat menjenguk, Saya menyegerakan pergi,” tukas Sayuri yang mengaku sebena r nya s e mpat b i ngu ng bagaimana cara pergi ke Saudi Arabia mengingat biayanya yang tidak sedikit. “ Tapi sy ukurlah banyak yang bantu, mudah-mudahan perjalanan nanti lancar,” tandasnya. Tatang Razak, Direktur Perlindungan WNI dan Bantuan Hukum Indonesia Kementerian Luar Negeri Republik Indonesia, saat menerima Sayuri didampingi anggota Dewan Perwakilan Daerah asal Kalbar Hairiah, menegaskan komitmen mereka di Deplu untuk membantu pengurusan masalah yang dialami Armayeh. “Perawatan masih berlangsung dan proses hukum terhadap pelaku tetap jalan,” ujarnya. Menurutnya Deplu juga sudah menyewa pengacara yang akan mendampingi Armayeh dan keluarga selama pemeriksaan hingga ke persidangan nanti di Saudi. “Kuncinya hanya satu, pihak keluarga jangan mau berdamai dan memaafkan pelaku begitu saja. Karena itu akan menggugurkan tuntutan hukum terhadap pelaku yang saat ini masih ditahan,” papar Tatang. Mengenai keberangkatan Sayuri ke Arab Saudi, pihak perusahaan TKI yang mengirim Armayeh juga sudah dimintakan Deplu untuk

bertanggungjawab membiayai. Sementara Kementerian, jelas Tatang, menyiapkan segala administrasi yang dibutuhkan Sayur i untuk bepergian ke luar negeri. “Mudah-mudahan visanya dalam sebulan sudah bisa keluar,” ungkap pejabat Deplu yang juga alumnus SMA Negeri 3 Pontianak ini serius. Anggota DPD RI asal Kalbar Hairiah, mengatakan penanganan terhadap Armayeh harus terus dipantau oleh semua pihak. Sebab tidak mustahil, ungkapnya, keluarga pelaku selalu berupaya untuk melakukan berbagai hal agar masalah penganiaan tersebut segera ditutup dengan berdamai antara keduabelah pihak. “Itu bukan penyelesaian. Harapan Kitakan ini jadi pelajaran kedepan suaya jangan sampai terulang dan terus terulang lagi,” tegas mantan pengacara yang aktif di Lembaga Bantuan Hukum Perempuan ini. Selain membantu proses hukum pengobatan selama di Arab Saudi, ujar Hairiah, penanganan setelah kembali ke Indonesia, khususnya Kalbar, juga mesti diperhatikan oleh Pemerintah. “ Te r u t a m a b a g a i m a n a terapi psikis yang dialami Armayeh. Karena penyembuhan trauma yang dialami akan membutuhkan waktu cukup panjang,” tandasnya. (mursalin)

Sayuri Segera ke Arab Saudi Sambungan dari halaman 1

rasanya belum puas dan yakin bahwa itu adalah benar-benar Armayeh,” ujar ayah delapan anak yang berusia 55 tahun ini kepada Pontianak Post, saat berada di Kementerian Luar Negeri RI, di Jakarta, Rabu (16/2) sore. Kegundahan seorang Bapak terhadap anaknya-sebagaimana dialami Sayuritersebut tentu dapat dimaklumi. Betapa tidak, seperti diberitakan sebelumnya, Armayeh adalah salah seorang TKI yang mengalami nasib buruk saat mengadu nasib di negeri orang. Malang tak pernah dicari, Namun, bekerja hampir dua tahun di rumah salah seorang guru di Madinah, ternyata bukan uang yang didapat, melainkan hanya petaka. Penyiksaan demi penyiksaan terus dialami Armayeh dalam kurun tiga bulan terakhir, di hamparan negeri tempat turunnya para Nabi tersebut. Saat dijenguk peja-

bat dari Indonesia di Rumah Sakit di Saudi, di bagian kepala gadis yang berangkat ke Saudi saat masih berumur 16 tahun (menurut ayahnya usia Armayeh sekarang baru 18 th, bukan 19 th atau 20 th sebagaimana diberitakan) ditemukan luka dan mengeluarkan nanah. Begitupun telinganya, terkelupas dan infeksi karena sering diinjak dengan kaki. Tubuhnya juga tak jarang jadi sasaran penyiraman air panas. Benda keras kabarnya pun kerap dihantamkan ke tubuh putri pasangan Sayuri dan Arminten tersebut. Menurut Sayuri, istrinya Ar minten, adalah orang yang paling terpukul mendengar kabar buruk dialami anaknya Armayeh. Pada saat pertama mengetahui nestafa melanda gadisnya yang saat berangkat baru berusia 16 tahun itu, ia tak hentinya bersedih. “Saya bekerja juga tak tentu akhirnya,” ungkap ayah dari delapan anak yang kesehariannya disibukan d i kebu n ka re t mau pu n berladang, di kediamannya di daerah Ambawang, 1.850.000 K a b u p a t e n 45.000 Ku b u R a y a , 200.000 Provinsi Ka1.000.000 limantan Ba50.000 rat . “Makanya 50.000 100.000 b e g i t u a d a 3.795.000 k e s e m p a 21.347.500 tan b erang-

Aksi Peduli Teluk Pongkal

Sambungan dari halaman 1 3. Marwan 4. NN via Atm 5. NN via ATM 6. Capt Sudiono 7. NN 8. NN via ATM 9. NN Jumlah Total

Rp Rp Rp Rp Rp Rp Rp Rp Rp

7 Sambungan dari halaman 1

Christiandy Sanjaya, Kapolda Kalbar Brigjen Pol Sukrawardi Dahlan, dan Wa l i ko t a Po nt ia na k Su tar midji, s er ta Muspida Pemda Provinsi dan Kota. Meski tanpa atraksi tatung, kegiatan tetap meriah. Sembilan liong (naga) sepanjang kurang lebih dua ratus meter dan beberapa grup barongsai menjadi magnet bagi ribuan orang untuk datang ke lokasi karnaval. Tak ayal hal ini membuat kemacetan panjang di beberapa titik. Sebagian jalan ditutup dari siang sampai sore hari. Malamnya pesta kembang api dimulai di sekitaran Gajah Mada. “Ini bukti kebersamaan k i t a. Bu kt i keb e r s at u a n kita,” kata Wakil Gubernur, Christiandy Sanjaya usai acara. Dia menyatakan sangat terkesan. Perpaduan beragam seni budaya yang ditampilkan ini menurutnya dapat menjadi suatu tanda bahwa situasi Kalbar sangat kondusif. Berbagai potensi budaya yang ada dan dikemas dalam satu acara dinilai dapat menjadi suatu aset andalan demi membangun bidang pariwisata di Kalbar. Karena itu, model seperti ini d i ha rap ka n d ap at t e r u s dikembangkan sehingga ke depan dapat menarik lebih banyak lagi wisatawan. Wa l i Ko t a P o n t i a n a k , Sutarmidji juga terkagumkagum dengan perayaan CGM tahun ini. Penyelenggaraan dinilai cukup bagus, rapi dan ter tib. Apalagi ketika melihat kemeriahan yang tercipta di mana para penonton tampak begitu antusias. “Yang jelas, ini dikemas dengan parade bu-

daya nusantara, suatu hal yang baik, yang bagus. Ini salah satu media hiburan bagi masyarakat Pontianak. Bu kt i nya, p u l u ha n r i b u yang hadir dalam kesempatan ini,” ujarnya. Menurut Sutarmid j i , t a mp i l nya b e rb aga i seni budaya dalam CGM ini membuktikan bahwa ma sya ra kat Ko t a Po nt i anak hidup dengan rukun. Apalagi, tak hanya peserta atraksi yang berasal dari berbagai etnis, warga yang m e n o n t o n j u g a b e ra s a l dari lintas suku dan agama. Warga Pontianak dinilai dapat menjaga ketentraman dan ketertiban kota. “Saya berterima kasih ke p a d a s e l u r u h l ap i s a n masyarakat. Semua etnis d a p at i ku t m e ra ma i k a n dan mengamankan pelaksanaan CGM ini,” katanya. Dia berharap, ke depan, pengemasan acara dapat lebih ditingkatkan sehingga menjadi semakin meriah. Bukan cuma jajaran eksekutif yang menyampaikan apresiasinya tetapi juga kalangan legislatif dan tokoh masyarakat. Ketua DPRD Kota Pontianak, Hartono Azas misalnya. Menurut Hartono, keragaman yang ditampilkan merupakan wujud pembangunan budaya dalam konsep kebersamaan. “Tampak sekali, perayaan CGM hari ini bukan hanya d i ra m a i k a n m a s y a ra k a t etnis Tionghoa. Hampir semua elemen masyarakat ada di Kalbar bersamasama merayakan,” ujarnya. Hartono melihat nuansa kemajemukan begitu kental dalam CGM kali ini. Konsep seperti ini diharapkan dapat terus dibangun, tak hanya ketika CGM tetapi juga dalam event-event budaya

lainnya. Minimal, dengan cara demikian, menurutnya warga Pontianak dan Kalbar dapat menunjukk a n ke p a d a ma s ya ra k at luar bahwa daerah ini kondusif. DPRD Kalbar, kata Hartono, juga akan terus mendorong pengembangan seni budaya karena hal itu berdampak positif terhadap promosi daerah baik di dalam maupun luar negeri. Ketua Panitia Simon Budianto mengatakan bahwa festival yang mereka adakan ditujukan kepada semua etnis. “Lewat perayaan CGM ini, kami ingin memajukan Kota Pontianak terutama di bidang par iw isata dan jasa. Ini bukan hanya milik orang Tionghoa saja. Meskipun kita berbeda-beda tapi satu tanah air,” katanya. S e m e n t a ra i t u , Maj e lis Adat Budaya Tionghoa (MABT) Kalbar menggelar Festival Cap Go Meh 2562 di Jalan Tol Kapuas Dua Arteri Supadio, Kubu Raya. (berita selengkapnya baca di halaman, 14). MABT menghadirkan atraksi tatung. Lebih dari lima puluh tatung atau yang dikenal di Pontianak sebagai Loya, memukau ribuan manusia yang memadati lokasi festival. Selain itu, ada pula atraksi naga, barongsai, dan lakon tokoh mitologi Tiongkok macam Sun Go Kong, Cu Pat Kai, Naca, dan peran lainnya. Ha r s o Su w i t o Ut o m o, Ketua MABT mengaku te rke ju t d e nga n ju m la h massa yang datang ke festival. “Saya benar-benar tidak menyangka begitu banyaknya orang yang hadir di sini. Secara kuantitas, hal ini di luar perkiraan kami. St an-st an kuliner juga mengaku kehabisan stok,” ujarnya.(rnl/ars)

CPNS Baru Terancam Dicoret Sambungan dari halaman 1

menelusuri pelanggaran itu. Diantara 40 kabupaten dan kota tersebut tersebar di Provinsi Jawa Timur ada tiga kabupaten dan kota, Jawa Tengah (3), Sumatera Utara (6), Jambi (8), NTB (4), dan Sulawesi Utara (3). Pelanggaran juga ditemukan di seluruh kabupaten dan kota di Sulawesi Barat. Selain itu, pelanggaran juga dilaporkan dari Provinsi Riau, Lampung, Jawa Barat, dan di Batam. Untungnya Kalimantan Barat tidak termasuk dalam daftar tersebut. Ramli menjelaskan, untuk kepentingan penyelidikan dirinya tidak bisa membongkar nama-nama kabupaten dan kota tersebut. “Jika saya omongkan, nanti barang buktinya hilang semua,” jelas dia. Sebagai catatan, pada 2010 lalu, jumlah kabupaten dan kota yang menggelar tes CPNS mencapai 500 lebih. Menurut sumber di lingkungan Kemenpan dan RB, dua dari tiga kabupaten dan kota yang dibidik di Jawa Timur adalah di pulau Madura. Salah satunya adalah di Kabupaten Pamekasan. “ Yang mencolok masih itu (Kabupaten Pamekasan),” terang dia. Menurut dia, beberapa tim investigasi yang bekerja di luar pulau Jawa sudah rampung. Sementara untuk di Jawa Timur sendiri, tin investigasi ditarget sudah menyusun laporannya pekan depan.

Terbongkarnya pelanggaran seleksi masuk CPNS 2010 di 40 kabupaten dan kota tersebut berawal dari laporan LSM yang sudah diakui oleh Kemenpan dan RB. “Selain itu laporan juga muncul dari anggota DPRD setempat,” ujar Ramli. Bentuk pelanggaran yang dilakukan terdiri dari beragam modus. Seperti, meloloskan orang menjadi CPNS meskipun ia sama sekali tidak mengikuti tes. Modus selanjutnya adalah, merekayasa nilai yang didapat, dan meloloskan calon-calon dari titipan penguasa daerah. Tetapi, jelas Ramli, modus yang paling banyak dilakukan adalah tidak melaporkan lembar jawaban dan hasil s e l e k s i ke Ba d a n Ke p e gawaian Negara (BKN). Pihak Kemenpan dan RB sangat menyayangkan rekrutmen CPNS jadi-jadian tersebut. Mereka mendata, jumlah kabupaten dan kota yang melakukan pelanggaran naik dari CPNS 2009 yang hanya 20 orang. Ramli menyebut, tingginya daerah yang melakukan pelanggaran ini bukan semata-mata kualitas penerimaan CPNS mengalami kemrosotan. Dia berkilah, tahun-tahun s eb elumnya jumlah p elanggaran kecil karena pelapor masih sedikit. Ramli menilai, beragam pelanggaran itu bisa mencoreng upaya pemerintah yang s e dang g encar melakukan reformasi birokrasi. Salah satu sanksi yang bakal diterima oleh CPNS nakal tersebut, ada-

lah ditangguhkan penyematan NIP-nya. “Pemberkasan NIP akan kami panding (tunda) dulu. Tidak kami keluarkan,” ujar dia. Kemenpan memahami akan muncul pergolakan dengan penundaan pemberkasan NIP tersebut. Tetapi, gelombang protes itu dikembalikan lagi kepada pemerintah daerah. Pemerintah daerah dibiarkan menanggung resiko kacaunya penyelenggaraan t e s C P N S. “Su d a h k a m i sosialisasikan untuk menggelar (tes CPNS) s ecara jujur, kok dilanggar,” papar Ramli. Sementara itu, jika pelanggaran sudah masuk ranah penyuapan, pihak Kemenpan dan RB akan bekerjasama dengan polisi u n t u k m e n i n d a k t e g a s. Sebab, dia menilai tindakan tersebut sudah masuk pelanggaran pidana. Ramli menyebutkan, tim investigas masih bekerja mendalami laporan-laporan tersebut. “Tidak menutup kemungkinan jumlah pelanggaran bisa naik,” jelas dia. Kemenpan dan RB menyiapkan formulasi baru untuk menekan pelanggaran CPNS di tahun-tahun selanjutnya. Yaitu, lembar jawaban dari peserta tes di penjuru Indonesia, langsung dikoreksi oleh satu perguruan tinggi negeri (PTN ) yang ditunjuk pemerintah. Selanjutnya dikoreksi secara serentak oleh PTN dengan pengawasan Kemenpan dan RB. (wan)

Dipaksa Stop Ngartis Sambungan dari halaman 1

Hingga kini, Arumi belum kembali ke pelukan orangtua. Sejak November 2010, Arumi kabur dari rumah dan meminta perlindungan kepada KPAI ( Ko m i s i P e r l i n d u n g a n Anak Indonesia). Arumi berdalih dijodohkan paksa oleh Maria. Oleh KPAI, Arumi ‘disembunyikan’ di tempat rahasia. Bicara soal hubungan asmara putrinya, Maria menuding Miller telah bertindak posesif terhadap Arumi. Dia mengklaim, bintang sinetron asal Ma-

laysia itu pernah melarang Arumi melanjutkan karier di dunia entertainment. “Saya justru bersyukur jika Arumi tak lagi menjadi artis karena dari awal saya tidak mengizinkan. Itu pilihan Arumi sendiri. Malah yang melarang Arumi di dunia entertainment itu adalah Miller,” beber Maria. Maria mengaku punya bukti tentang larangan Miller terhadap anaknya. Miller, lanjut Maria, pernah mengancam akan mempermalukan Arumi jika tak menuruti keinginannya. “Larangan itu pernah

dia (Miller) katakan lewat keponakan saya. Katanya, ‘Apabila Arumi masih di dunia entertainment, maka akan saya permalukan’,” ujar Maria. Maria beralasan, Miller bukan lelaki yang baik bagi Arumi. Apalagi, selama ini Miller dituding sebagai biang keladi di balik kaburnya Arumi dari rumah. “Bukan masalah apa-apa, tapi akhlaknya dia (Miller) yang saya tidak suka. Bagi saya, seorang laki-laki itu akhlak yang nomor satu. Dia otak di balik semua masalah ini,” tudingnya. NET

Pontianak Post


Jumat 18 Februari 2011

Kandidat Calon Bupati dan Wakil Bupati Sambas 1



29.80 %

Pabali Musa

Darwin Muhammad 37.13 %




25.04 %




5.47 %


Ferden Firdaus

Bonevasius Boni Munawar M Saad 2.56 %

Pembunuhan Maharani

Keluarga Merasa Sidang Disembunyikan PONTIANAK—Kasus pembunuhan Maharani (15) dengan terdakwa Wisnu (25), memasuki sidang perdana, kemarin (17/2) di Pengadilan Negeri Pontianak. Sidang berlangsung dengan penjagaan ketat aparat di lantai dua. Namun, keluarga korban tidak mengetahuinya. Mereka menunggu di lantai satu. Padahal, mereka telah hadir di PN untuk menyaksikan sidang itu. Untuk diketahui, kasus pembunuh yang terjadi akhir November tahun silam ini sempat menggegerkan masyarakat Pontianak. Maharani ditemukan tak bernyawa di lokasi pembuangan sampah pinggir Jalan Komyos Sudarso. Dari hasil reka ulang Polresta Pontianak, diketahui motif pembunuhan karena tersangka jengkel kepada korban. Tersangka beberapa kali mengajak siswi kelas IX SMP Negeri 2 Sungai Berembang, Kecamatan Sungai Kakap ini berhubungan badan, namun selalu ditolak. Usai majelis hakim menutup persidangan keluarga korban baru mengetahui sidang telah dilangsungkan. Namun terdakwa telah digiring menuju ruang tahanan pengadilan. Mereka pun merasa dipecundangi dan langsung berang. Tanpa henti menyampaikan protes dengan mendatangi ruang tahanan. Tapi aparat keamanan langsung mem-

blokade. Nenek korban, Aisiah (59), terus berteriak hingga membuat gaduh suasana pengadilan sekaligus mengundang perhatian. Dia menyatakan keberatan dengan sidang terdakwa dan terkesan disembunyikan. Padahal mereka telah menunggu sejak lama dengan tujuan ingin menyaksikan persidangan. Bahkan sempat terjadi adu mulut nenek korban dengan seorang aparat kepolisian yang bersiaga di pengadilan. Sayangnya, salah satu oknum aparat mengancam jurnalis yang meliput kejadian itu. Dia meminta agar kameraman salah satu stasiun televisi lokal tidak mengambil gambar. Ibu korban, Rafeah (35), juga tampak emosi. Dia terus memanggil nama terdakwa. Matanya memerah karena tidak kuasa menahan tangis. Rasa penasaran Ibu korban tidak berhenti sebatas mencari ke ruang tahanan. Tapi dia masuk ke mobil tahanan yang terparkir di halaman pengadilan. Sebagai bentuk kekecewaan atas keinginan bertemu dan melihat wajah terdakwa secara langsung gagal terwujud. Semua keluarga korban sempat berkumpul di halaman pengadilan. Mereka menunggu terdakwa digiring ke mobil tahanan. Tapi akhirnya memilih pulang setelah mendapat penjelasan dari aparat kepoli-

sian dan petugas kejaksaan agar mempercayakan kasus pembunuhan korban kepada aparat penegak hukum. Keluarga korban menyatakan hadir ke persidangan bukan ingin menghakimi terdakwa. Karena mereka telah menyerahkan sepenuhnya penanganganan kasus pembunuhan Maharani sesuai proses hukum. “Kami hanya ingin mengikuti sidang. Bukan untuk bertindak macam-macam. Tapi sidang berjalan tanpa sepengetahuan kami ini sungguh mengecewakan,” kata Basri, bapak korban. Menurut Basri, kekecewaan keluarga sejak Rabu kemarin. Lantaran telah hadir ke pengadilan namun ternyata sidang terdakwa terjadi penundaan. Kekecewaan berlanjut karena jalannya persidangan luput dari pantauan mereka. Sidang perdana pembunuhan Maharani ini diketuai majelis hakim Suharjo. Usai membuka persidangan, ketua majelis sempat bertanya kepada terdakwa, siapa kuasa hukumnya untuk mendampinginya selama bersidang. Terdakwa Wisnu memang menghadiri sidang tanpa didampingi pengacara. Majelis hakim sempat menawarkan kuasa hukum atas penunjukan negara. Tapi terdakwa menolak tawaran tersebut dengan menyatakan tidak perlu didampingi kuasa hukum. (stm)


GEBRAK JAKARTA: Iron Maiden saat konser bertajuk ‘The Final Frontier World Tour 2011’, di Carnaval Beach, Ancol, Jakarta, Kamis (17/2).

Iron Maiden Gebrak Jakarta JAKARTA - Legenda rock asal Inggris, Iron Maiden, Kamis (18/2) malam memuaskan sekitar 20 ribu penggemarnya dalam konser The Final Frontier World Tour 2011 di Pantai Carnaval, Ancol. Ribuan Troopers, sebutan fans Iron Maiden, langsung berjingkrak begitu lagu Final Frontier menghentak. Meski tak lagi muda, penampilan Bruce Dickinson, Dave Murray, Janick Gers, dan Adrian Smith di atas panggung tetap enerjik, seperti ketika mereka tampil di penghujung 90-an. ”Welcome Jakarta,” kata Dickinson setelah lagu yang diambil dari judul album yang rilis tahun lalu tersebut berakhir. ”Saya harap tidak ada gangguan di

sini, karena kami sudah menganggap Indonesia seperti rumah, melihat antusiasme kalian, kami seperti pulang ke rumah,” kata Bruce disambut gemuruh teriakan Troopers.Tanpa ada jeda, grup cadas yang telah menelorkan 15 album tersebut langsung menggeber dengan lagu-lagu dari album Final Frontier. Troopers pun sepertinya sudah hafal luar kepala lagu-lagu di album yang baru dirilis tahun lalu tersebut, terbukti dengan gemuruh nyanyian dari arah penonton yang seakan bersaing dengan teriakan Bruce di atas panggung.

”Saya sudah suka Iron Maiden sejak SMP, awal-awal ngeband metal. Ini mimpi yang menjadi kenyataan, akhirnya mereka datang ke Indonesia,” ujar Bagus, vokalis sekaligus bassis grup band cadas Netral. ”Harusnya mereka datang sejak dulu, di masa-masa mereka masih muda. Tapi sebagai rocker, saya harus tetap nonton Iron Maiden.”(nar)

Hijaukan Kota, Sehatkan Lingkungan

Ayo! Ikut Bersih-bersih Kota Pontianak PONTIANAK—Pontianak Post kembali menggelar Program Bersih-bersih Kota Pontianak. Kegiatan dengan tema Hijaukan Kota, Sehatkan Lingkungan ini digelar Sabtu (19/2) pukul 06.00 WIB. Program ini berupa aksi membersihkan parit dan selokan, membersihkan sampah di jalan serta aksi penanaman pohon. Acara ini difokuskan di Jalan Veteran, Gadjahmada, Suprapto dan Jalan S Parman. “Kegiatan bersih-bersih ini kita lakukan masih dalam rangkaian HUT ke-38 Pontianak Post. Program ini juga menjadi

agenda rutin yang kita gelar sebulan sekali,” kata Budi Darmawan, koordinator Event Organizer (EO) Pontianak Post, kemarin. Dijelaskan Budi, kegiatan ini melibatkan seluruh komponen masyarakat yang bermukim di kawasan yang telah ditetapkan. Pihaknya telah berkoordinasi dengan Camat Pontianak Selatan. Pihak kecamatan juga telah melakukan koordinasi dengan pihak kelurahan dan ketua rukun tetangga (RT) setempat. Diungkapkan Budi dalam kegiatan ini difokuskan untuk membersihkan selokan dan

parit. Untuk itu pihaknya melibatkan Dinas PU Kota, Dinas Kebersihan dan Pertamanan, serta petugas Badan Pemadaman Kebakaran (BPK). Sampah dan lumpur di selokan akan dibersihkan. “Saluran yang tersumbat dan tergenang air akan kita atasi bersama,” kata Budi yang berharap masyarakat juga bisa turut serta. Selain itu kegiatan ini juga membersihkan sampah-sampah yang ada di pinggir jalan. Kegiatan lain yang tak kalah seru adalah penanaman pohon pucuk merah dan trembisi. Diharapkan Budi, dengan

kegiatan bersih-bersih ini akan semakin memperindah Kota Pontianak. Selain itu juga berupaya mendukung program pemberantasan sarang nyamuk sehingga kota khatulistiwa ini bisa bebas dari serangan nyamun demam berdarah. Program Bersih-bersih Kota ini tak hanya dilakukan kali ini saja. Kegiatan ini akan dilakukan setiap bulan. Lokasinya akan berpindah-pindah sesuai kebutuhan. “Kali pertama kita di kawasan Jalan Gadjahmada, bisa jadi bulan depan di Pontianak Barat atau Utara,” jelasnya lagi. (event)

Dari Yamaha Music Roadshow

Produk Canggih dan Handal Buatan Indonesia PONTIANAK—YAMAHA Music memilih Fresh Resto, Jalan Arteri Supadio, Kubu Raya, dalam kegiatan Roadshow music dengan Instructor Yamaha Musik Indonesia pada Selasa (15/2) lalu. Kegiatan berlangsung semarak dan dihadiri ratusan penonton. Roadshow ini berlangsung lancar. Kegiatan diawali dengan permainan electone oleh Instructor Yamaha Music, Sherly . Kemudian dilanjutkan perkenalan produk Yamaha, Guitar Pasifica oleh instruktur Gitar, Roni Nugraha. Berbagai kelebihan guitar ini, selain harganya terjangkau, juga kualitas suara yang dihasilkan gitar Yamaha sangat mengagumkan yang ditunjukkan lewat permainan jari jari terlatih dari Roni Nugraha. Tidak mau ketinggalan, dua instruktur drum, Roito S Naingollan memperkenalkan kecanggihan drum digital YAMAHA DTX 12, beserta Ario Wiji Pramudyo juga memperkenalkan drum Rock Tour Yamaha, dengan suara yang mantap. Konstruksi drum ini berbahan kayu berkualitas. Perpaduan musik yang dihasilkan kedua instruktur tersebut membuat decak kagum penonton. Selain drum, Instruktur Yamaha lainnya, Yepi Hendramaya juga memperkenalkan Yamaha MM 6, product digital Synthetizer yang memiliki suara yang canggih dan mewah.

Seakan suasana disulap menjadi area clubbing sesaat, lewat permainan dasyat di MM6. Menjelang malam, penonton kembali terpaku pada permainan musik klasik lewat lentingan suara gitar Yamaha CG series, oleh instruktur Gitar Klasik, Ihut Suluan, dan ditutup gesekan suara violin oleh Instruktur Yamaha Violin, Ramdhan. “Tujuan roadshow ini memperkenalkan produk terbaru Yamaha. Mulai dari sound system DSR series, sangat handal untuk skala hingga 500 penonton. Cukup satu pasang DSR 115 , kita sudah bisa ngeband. Selain itu berbagai produk Yamaha yang

ROADSHOW: Penonton memenuhi ruangan Fresh Resto pada acara Yamaha Music Roadshow.

canggih dan berkualitas made in Indonesia. Jadi kami bangga menjalankanRoadshowYamaha

Music karena produk buatan Indonesia sangat handal,” ungkap Sentosa. (kjs)

Sy. M Taufik

Kakan Pelayanan Terpadu Satu Pintu Sintang


Pontianak Post

Tribun Penonton CGM Ambruk Saat masyarakat dibius atraksi tatung dengan beragam aksinya. Warga dikejutkan dengan ambruknya tribun penonton di sebelah kanan tribun utama, di mana para pejabat tengah asyik menonton.


Ayam Jiran Dibakar Balai Karantina Pertanian Klas I Pontianak memusnahkan sejumlah unggas ilegal, yang didatangkan dari Malaysia, Jawa Timur, Jawa Tengah, dan Jakarta.


Metropolis halaman


Masalah izin kios telah dibahas bersama. Kalau syaratnya terpenuhi, tetap menerbitkan surat izinnya. Aturannya belum ada perubahan


JUMAT, 18 Februari 2011


Segera Urus APL WAKIL Gubernur Kalimantan Barat Christiandy Sanjaya mengatakan wilayahnya memiliki sumber daya alam potensial. Tidak hanya kehutanan, tetapi juga sektor lainnya. Tetapi, jika dibandingkan antara luas lahan yang tersedia untuk pengembangan sektor non kehutanan dengan keperluan yang ada, masih jauh dari ukuran rasio kecukupan. “Sektor lainnya yang juga berpotensi seperti pertanian, Christiandy Sanjaya perkebunan,” ujar Christiandy ketika membuka kegiatan Ekspos Penggunaan Kawasan Hutan Tak Prosedural Seluruh Bupati dan • ke halaman 15 kolom 1

Tolak Alih Kelola Aset

PONTIANAK - Pengambilalihan pengelolaan aset KONI di lingkungan gelanggang olahraga GOR Pangsuma Pontianak yang direncanakan akan dilakukan dalam waktu dekat oleh Pemerintah Provinsi Kalbar melalui Dinas Pemuda dan Olahraga disikapi KONI secara bijak. Ketua Umum KONI Kalbar, Sy Machmud Alkadrie menyatakan terang-terangan tidak setuju dengan pengambilalihan pengelolaan aset tersebut.

Apalagi, kata dia, aset tersebut beralih fungsi menjadi pusat perbelanjaan atau mal. “Pengelolaan aset KONI selama ini sudah berjalan dengan baik dan dilakukan secara profesional. Kenapa harus diambil alih. Saya tidak setuju jika aset tersebut diambil alih, apalagi dialihfungsikan,” tegas Machmud. Menurutnya, KONI yang ada saat ini sangat berbeda den-

gan KONI terdahulu. KONI periode ini, kata dia, sudah melakukan banyak perubahan. Tak hanya pembaharuan di tubuh KONI sendiri, tapi juga reformasi di berbagai induk cabang olahraga. Pembangunan dan kemajuan olahraga yang sudah dilakukan KONI Kalbar tersebut, ungkap Machmud, seharusnya didukung, bukan malah dike • ke halaman 15 kolom 1


Bantu Tekan Polusi PEMANFAATAN bahan bakar gas atau elpiji untuk sektor rumah tangga maupun industri relatif lebih ramah lingkungan. Hal yang paling mudah dilihat secara kasat mata, pembakaran dengan elpiji tidak menghasilkan polusi seperti halnya dengan minyak tanah. Polusi tersebut berupa karbon dioksida atau CO2, yang dalam bahasa awam disebut arang. Warnanya hiIgnatius Nuel tam dan mengotori tidak saja peralatan rumah tangga, tetapi juga udara. Udara yang sudah tercemar karbon dioksida berbahaya

Ketapang Potensial Melanggar Aturan Konservasi Alam PONTIANAK - Tiga kabupaten di Kalimantan Barat berpotensi pelanggaran berkaitan dengan perlindungan hutan dan konservasi alam, yakni Ketapang, Bengkayang, dan Kubu Raya.

”Kami sudah mempunyai data pelanggaran yang dilakukan pejabat dan mantan pejabat, makanya kami verifikasi ke sini. Potensi ada di • ke halaman 15 kolom 5

RUU Ketok Palu Kapolres Bisa Beli Mercy adanya insentif PONTIANAK – dari hasil lelang,” Direktur Jenderal ungkap Darori kePerlindungan Hutika menghadiri Ektan dan Konserpose Penggunaan vasi Alam KemenKawasan Hutan terian Kehutanan Tidak Prosedural Da ro r i m e nga Kabupaten dan takan Rancangan Kota di Kalimantan Undang-Undang Barat, kemarin. Pencegahan dan Darori Diusulkan sePemberantasan tiap orang dan Pembalakan penegak hukum Liar ketok palu yang berjasa dapada Mei 2011. Adanya insentif, lam upaya pencePihaknya mengusulkan insentif tidak ada suap lagi. gahan, pemberdari hasil lelang. Jadi jangan heran antasan, atau pengungkapan ”RUU ini inisiatif dari DPR. Di- kalau kapolres bisa pembalakan liar beli mercy berhak mendatargetkan Agustus patkan insentif ketok palu, tetapi ternyata Mei sudah ketok palu. dari pemerintah. Insentif ini Kadang ada keterbatasan berasal dari hasil lelang anggaran dalam penegakan • ke halaman 15 kolom 1 hukum. Kami mengusulkan

Sintang Dambakan Rumah Sakit Baru

• ke halaman 15 kolom 1 MUJADI/PONTIANAKPOST




Salah satu aset KONI yang sedang diinventarisasi oleh Pemprov Kalbar untuk diambil alih pengelolaannya. Namun KONI menolak rencana itu.

PONTIANAK - Masyarakat Kabupaten Sintang sangat mendambakan adanya sebuah rumah sakit yang lebih representatif. Soalnya, rumah sakit yang ada saat ini kapasitasnya tidak memadai sehingga tidak mampu lagi menampung jumlah pasien. Demikian menurut Anggota DPRD Kalimantan Barat, Antonius Situmorang, kemarin. “Masyarakat Kabupaten

Sintang mengharapkan bantuan dari Pemerintah Provinsi Kalimantan Barat dalam pembangunan rumah sakit rujukan,” ujar legislator asal daerah pemilihan Kabupaten Sintang, Melawi dan Kapuas Hulu ini. Aspirasi warga tentang pembangunan rumah sakit diterimanya ketika kunjungan di masa reses DPRD • ke halaman 15 kolom 1

Upaya Menekan Peredaran Narkotika

Dipicu Lingkungan, Ajak Bentuk Penyuluh Dini Kasus penyalahgunaan narkotika dan obat-obat terlarang didominasi kalangan pelajar. Sekitar 90 persen dipengaruhi lingkungan. Diperlukan strategi jitu agar angka penyalahgunaan narkotika itu bisa ditekan. AGUSTINAH, Pontianak ILUSTRASI : KEKES



Perlu ada strategi untuk menekan laju peredaran narkotika.

SUARA keprihatinan terhadap gejala itu datang dari Wali Kota Pontianak Sutarmidji. Ia pun meminta setiap sekolah membuat laboratorium sehingga tugas yang mengharuskan siswa mencari warung internet bisa dilakukan di sekolah. Hal ini karena sebagian warnet bisa jadi lokasi untuk bertransaksi narkotika. “Saya imbau setiap sekolah, tidak lagi menyuruh siswanya mencari tugas di warnet. Saya prihatin, ada yang mengerjakan tugas hingga malam

hari, kita tidak tahu apa yang dikerjakan anak itu. Setiap sekolah harus memiliki lab sendiri, jadi biarkan anak tersebut mencari tugasnya di sekolah,” katanya. Selain diaktifkannya lab komputer, Midji berharap sekolah bisa membentuk penyuluh narkoba sejak dini. Tenaga anak-anak dimanfaatkan untuk menjadi seorang penyuluh yang bisa memberikan pengarahan kepada teman-temannya di sekolah. • ke halaman 15 kolom 1



Pontianak Post

Owner KP Tak Harus Dipanggil

Pejabat Eselon IV Kemenag Sanggau Dilantik SANGGAU - Pergantian kepemimpinan dalam suatu organisasi adalah sesuatu yang wajar dan pasti terjadi. Karena, dengan adanya pergantian pejabat dalam suatu kedudukan merupakan ukuran dinamisasi jalannya roda organisasi tersebut. Demikian pula yang terjadi di lingkungan Kantor Kementerian Agama Kabupaten Sanggau. Pada 10 Februari 2011, telah dilantik beberapa pejabat pada kedudukan strategis, baik yang mengalami kekosongan pejabat, maupun pertukaran di antara pejabat yang ada. Pelantikan tersebut dipimpin oleh Kepala Kantor Kementerian Agama Kabupaten Sanggau Drs H Jamaludin KL, bertempat di Aula Kantor Kementerian Agama Kabupaten Sanggau Jalan H Abas Nomor 18 Sanggau. Drs H Jamaludin KL dalam sambutannya meminta kepada para pejabat yang dilantik untuk memperhatikan beberapa hal utama. Yakni senantiasa mematuhi peraturan tentang disiplin pegawai negeri, memahami dan mengaplikasikan tugas pokok dan fungsi masing-masing seksi dalam jabatannya, mampu bekerjasama dan berkoordinasi dengan semua pihak yang terkait dalam seksinya masingmasing, bekerja secara ikhlas dan professional, menjadi teladan bagi bawahan dan rekan kerja, serta meningkatkan pelayanan kepada masyarakat. Adapun yang dilantik adalah Drs Pahmi sebagai Kasubbag Tata Usaha yang menggantikan H. Hermanto Yanen yang dilantik sebagai Kasi Urusan Agama Islam. Kemudian Ikhwan Pohan SAg MPd sebagai Kasi Madrasah dan Pendidikan Dasar, mengisi jabatan yang kosong, karena pejabat lama Drs M Taufik diangkat menjadi Kepala Kantor Kementerian Agama Kabupaten Sekadau. Ikhwan Pohan sebelumnya menjabat sebagai Kepala Penyelenggara Zakat dan Wakaf. Ia digantikan Drs H. Toyib Saefudin Al-Ayubi, yang sebelumnya Kepala KUA Kecamatan Kapuas dan H. Nasri SAg sebagai Kepala KUA Kecamatan Kapuas, sebelumnya menjabat Kepala KUA Entikong. (Anto/PK)


DILANTIK: Pelantikan pejabat eselon IV di Kantor Kementerian Agama Sanggau.

Jumat 18 Februari 2011


MAULID: Para dai yang akan diterjunkan dalam rangka kegiatan Safari Maulid.

Terjunkan 10 Dai Safari Maulid SANGGAU - Pembinaan umat dan mempererat tali silahturahmi, Kantor Kementerian Agama Kabupaten Sanggau, membentuk dan mengirimkan Tim Safari Maulid Nabi Muhammad SAW 1432 H. Sebanyak 10 orang dai diterjunkan ke 5 kecamatan di Kabupaten Sanggau, yakni Meliau, Tayan Hulu, Balai, Mukok, dan Jangkang. Menurut keterangan Kepala Kantor Kementerian Agama Kabupaten Sanggau Drs H. Jamaludin KL, bahwa program ini adalah sesuatu yang baru di lingkungan Kementerian Agama Kabupaten Sanggau. “Menjadi tugas dan tanggung jawab Kementrian Agama dalam pembinaan umat, dalam rangka pencerahan pengetahuan dan pelestarian kebersamaan. Karena akhir-akhir ini, situasi dan keadaan umat dalam sekup nasional kurang baik. Namun saya yakin, kondisi kehidupan beragama di Kabupaten Sanggau akan selalu kondusif dan harmonis,” kata pria lembut ini. Lebih lanjut dikatakannya, bahwa

terkait diterjunkannya sebanyak 10 dai dalam rangka peringatan Maulid Nabi Muhammad SAW 1432 H tersebut, Jamaludin berharapk agar terjalin komunikasi, koordinasi, dan silahturahim yang erat antara umat beragama dengan Kantor Kementerian Agama Kabupaten Sanggau. “Saya memang masih baru menjabat sebagai Kepala Kantor Kementerian Agama Kabupaten Sanggau, sehingga harus bersilahturahim ke kecamatan yang ada di Kabupaten Sanggau. Dalam moment Maulid Nabi Muhammad SAW 1432 H ini, kita fokuskan kepada 5 kecamatan dulu. Untuk kecamatan yang lainnya akan segera dijadwalkan,” ungkapnya ramah. Sebanyak 10 dai yang diterjunkan tersebut yakni Ismail M Tera dan H Nursiwan Umar Ali ke Kecamatan Mukok, H. Hermanto Yanen dan Sugianto ke Kecamatan Balai, Drs H Toyib Saefudin Al-Ayubi dan Imam Rasyidin SHI ke Kecamatan Jangkang, Drs. H. Daljuli dan M Anyut ke Kecamatan Tayan Hulu, serta Aep

Mulyanto, SHum dan Nurkholis SPdI ke Kecamatan Meliau. “Sambutan masyarakat di 5 kecamatan yang dikunjungi Tim Safari Maulid Nabi Muhamamad tersebut sangat baik dan positif,” imbuhnya. Sementara itu menurut Mistiah, satu di antara pengurus BKMT Kecamatan Meliau, menyampaikan harapan yang besar akan perhatian para dai dari Kantor Kemenetrian Agama. “Kami sangat mendukung dengan adanya program dari Kantor Kementerian Agama Kabupaten Sanggau terhadap adanya Tim Safari dalam peringatan Hari Besar Islam. Bagi kami yang berada di kecamatan seperti Meliau, sangat membutuhkan pencerahan dan tambahan ilmu pengetahuan, terutama ilmu pengetahuan agama,” ujarnya. “Semoga ke depannya semakin sering Kantor Kementerian Agama Kabupaten Sanggau mengirimkan Tim Safari dalam peringatan Hari Besar Islam lainnya,” lanjutnya. (Anto/PK)

PONTIANAK – Panitia Khusus Khatulistiwa Plaza yang dijadwalkan ke Mabes Polri terkait UU Susduk DPR/DPRD akhirnya batal, namun hanya mengunjungi Mendagri dan Menhukam, karena kunjungan Pansus KP ke Mendagri sudah memberikan jawaban terkait kewenangan DPRD untuk memanggil paksa pemilik Khatulistiwa Plaza Bambang Widjanarko. Menurut Ketua Pansus KP Erick S. Martio, pansus tidak jadi ke Mabes mengingat jawaban yang diinginkan sudah diberikan di Mendagri. Di Mendagri diberikan jawaban bahwa DPRD memilikiwewenangtinggiterhadapmasalahyangselama ini dihadapi, apalagi langkah yang sudah dilakukan dibenarkan oleh Mendagri. ”Kita konsultasi ke Mendagri terkait masalah Susduk, dan jawabannya pemanggilan paksa dalam Susduk jelas sekali sudah diatur,” terang Erick. Jawaban jelas yang dimaksud Erick adalah peraturan Kapolri tidak berlaku jika berhadapan dengan UU, mengingat menurut Mendagri UU lebih tinggi aturannya, sehingga Kapolresta di daerah wajib membantu DPRD setempat untuk menghadirkan seseorang yang secara berulang-ulang diundang rapat tapi enggan hadir. Tidak hanya itu saja, Pansus KP pun bisa meningkatkan status Pansus KP menjadi lebih tinggi jika nantinya hasil rekomendasi yang segera dikeluarkan Pansus tidak dijalankan secara baik oleh pemerintah. “Pansus bisa buat hak angket atau hak interpelasi jika setelah membuat rekomendasi tidak diindahkan, setelah itu kita berhak bersama kepolisian memanggil kembali Bambang Wijanarko, baik mau atau tidak tapi untuk saat ini kita tidak perlu menghadirkan dia di sini, ada waktunya,” paparnya. Hal sama juga diungkapkan Wakil Ketua Pansus KP Ardiansyah. Menurutnya, hak angket akan memberikan kekuatan penuh kepada DPRD untuk memaksa kehadiran BW. “Nantinya polisi tidak bisa menolak ikut membantu Pansus KP karena ini sudah diatur sebagaimana kunjungan kita ke Mendagri dan Menhukam. Di Menhukam kita juga meminta keterangan seputar pencekalan yang bisa dilakukan dan bagaimana aturan mainnya, dan di Susduk pun sudah jelas di atur,” terangnya. Menurut Ardiansyah hasil dari Mendargi dan Menhukam sangat memuaskan, sehingga haisl tersbeut akan menjadi poit penting dalam rekomendasi Pansus KP yang segera akan dibuat, dalam waktu dekat ini. (tin)


11 Guru Paling Banyak Bercerai



NGETEM: Beberapa supir oplet Jurusan Sudarso-Pasar Kapuas tidak mengindahkan larangan yang telah terpasang.

Sepekan Perputaran Uang Capai Puluhan Miliar

Festival CGM Jadi “Lautan” Manusia SUNGAI RAYA—Menjelang penutupan hari terakhir Festival Cap Go Meh 2011 yang dilaksanakan di jalan Trans Kalimantan atau jalan tol menuju Jembatan Kapuas II, Sungai Raya, seluruh pengunjung dari berbagai kalangan memadati tempat pelaksanaan kegiatan. Bahkan, padatnya kunjungan menjadikannya seperti “lautan” manusia hingga membuat lalu lalang kendaraan mengalami macet, terutama di jalur A.Yani II sekitar lokasi kegiatan. “Iya macet neh, makin sore kendaraan makin ramai masuk ke stand Festival CGM,” kata Yanti (29) salah satu pengunjung di Sungai Raya. Yanti yang juga pegawai swasta di Kota Pontianak memutuskan ingin pulang ke rumahnya di Sungai Raya, Kubu Raya. Namun ke-



Jumat 18 Februari 2011

Modus Penipuan PT Taspen


ANGKA perceraian di Kota Pontianak saat ini didominasi kaum perempuan. Entah apa sebabnya, namun yang pasti berdasarkan catatan yang diterima Walikota Pontianak, Sutarmidji dari 12 orang per bulan yang menggugat cerai merupakan kaum hawa. “Saya tidak tahu, mengapa saat ini perempuan lebih banyak yang menggugat. Sekarang perempuan banyak yang hebat. Banyak lelaki yang jadi takut sama istri, bahkan KDRT saat ini bukan hanya dilakukan laki-laki kepada perempuan, melainkan sebaliknya,” kata Midji Kamis (17/2). Saat ini, pelaku KDRT malah bukan hanya kaum pria kepada perempuan, namun juga perempuan atau istri yang melakukan kekerasan kepada suaminya. “Saya pastikan siapa saja jika ada istrinya yang melakukan KDRT, kepada pasangannya, suaminya akan menikah lagi,” katanya. Midji menambahkan, selain kaum perempuan, ternyata selama ini yang paling banyak menggungat ialah dari guru. “Yang saya lihat saat ini malah guru-guru yang banyak bercerai. Mungkin karena gajinya memang yang tinggi,” terang Midji kepada awak media kemarin. (tin)

Pontianak Post

tika melewati jalur A.Yani II, kendaraan mengalami kemacetan. ”Akhirnya saya pilih parkir kendaraan dan melihat-lihat dulu stand di sekitar lokasi,” ungkap dia. Ketua Umum DPP Majelis Adat Budaya Tionghoa (MABT) Kalbar, Harso Utomo Suwito mengatakan acara hari ini (kemarin) pada tanggal 17 Februari adalah acara puncak atau tanggal 15 dalam penanggalan Imlek. Kemarin karnaval naga, barongsai, pagelaran para tatung dan mitologi lain ikut ditampilkan. “Memang kita tidak maksimalkan, mengingat Festival CGM kita berada di lokasi baru,” ujarnya. Puncak acara penutupan, sambungnya, adalah Jumat besok (hari ini). Pada malam harinya akan ditampilkan drumband sekaligus pem-

bagian hadiah pemilihan putra-putri Tionghoa Kalbar. Dalam kesempatan tersebut juga akan ditampilkan seni tari yang rencananya akan ditutup Wabup, Andreas Muhrotien atau Bupati Muda Mahendrawan. “Kami bersyukur sampai sekarang seluruh rangkaian acara berlangsung baik,” ungkap dia. Ia menambahkan cuaca hari ini (kemarin) sangat baik. Di sini lain sambutan warga sangat antusias terhadap pelaksanaan acara. ” Ini yang harus dipelhiara,” ujarnya. Disisi lain, ia mengaku senang stand kuliner dan pernak-pernik dipenuhi masyarakat. Kalau diprediksikan rata-rata pendapatan diluar target pedagang. Ini membuktikan masyarakat punya kemauan dan daya

beli tinggi. Sementara dana berputar seharinya mencapai ratusan juta rupiah. ”Dalam sepekan, bisa miliaran atau puluhan miliar rupiah,” jelas dia. Ia menerangkan dari perdagangan PKL saja, transaksinya tidak sedikit. Belum lagi lapak-lapak kuliner dan berbagai barang lain yang diperdagangkan. Inilah cikal bakal entreprenership sejati yang tengah digagas Pemkab Kubu Raya. ”Tidak menutup kemungkinan dari pedagang pinggiran disini kedepannya bisa menjadi bos besar. Bos-bos besardi Kota Pontianak seperti pemilik sejumlah pemilih hotel di Kota Khatulistiwa dulunya memulai dari pedagang kacang goreng dan pedaganga air tahu keliling bahkan bapak saya, dulunya pedagang kopra atau karet. Mereka

tumbuh dari kecil hingga menjadi besar,” terangnya. Ia menerangkan pedagang mikro seperti begini tahan banting. Wadah seperti Festival CGM menjadi tempat mereka berkembang. Bahkan tidak sedikit home industry di Kubu Raya juga tam,pil disini. ”Yang terpenting ketika kita siapkan tempatnya layak, harga terjangkau dan diterima semua kalabgan. Kalau diterima semua, otomatis barang terkenal, kalau terkenal akan terekpose keluar, kalau terekposes maka bisa dipesan keluar orang banyak dan kita tumbuh sebagai pengusaha baru,” ujar dia. Harso menambahkan untuk festival serupa tahun depan, sepertinya tidak ada tempat lain selain di Kubu Raya.(den)

PONTIANAK—Humas PT Taspen iming uang,” katanya. (Persero) Kota Pontianak, Partabas Dijelaskan Partabas, modus peH Hutabarat mengingatkan agar nipuan ini tak hanya terjadi di Kota masyarakat khususnya Pontianak dan sekipara pensiunan lebih tarnya. Di beberapa berhati-hati dan tidak daerah, termasuk di mempercayai modus Jakarta modus penipenipuan via telepon puan seperti ini juga yang akhir-akhir ini kerkerap terjadi. Bahkan ap terjadi mengatasnatak sedikit masyarakat mankan PT Taspen. yang menjadi korban. Dirinya menegasRata-rata si penipu, kan, PT Taspen tidak kata dia, mengatasnapernah mengimingmakan PT Taspen Pusat imingi uang berupa dengan menawarkan laba pemengang sauang sejumlah Rp20 ham (deviden) kepada juta, atas pembagian siapapun dengan cara laba dan keuntungan menghubungi via teledari pemegang saham. pon. “Kami tidak perNamun, pembagian nah menawarkan pemlaba tersebut baru bisa berian deviden melalui cair, dengan syarat si Kami mengtelepon. Jika Taspen penerima telpon harus ingatkan agar membayar dilakukan mentransfer sejumlah secara langsung melauang, 20 persen dari tomasyarakat lui rekening,” katanya tal yang akan diberikan. khususnya para kemarin. “Yang terjadi di Kota Menurut dia, kar- pensiunan untuk Pontianak si penelpon ena maraknya modus selalu berhati-hati meminta pensiunan penipuan tersebut, kita mentransfer uang tak sedikit para pen- dan tidak mudah ke rekening atas nama siunan yang menelpon percaya terhadap Widiantoro dengan langsung ke PT Taspen telpon (021) telepon dari sia- nomor untuk mengecek ke4242132. Saya langbenarannya. Padahal, papun yang men- sung mericek ke nomor kata dia, itu jelas-jelas gatasnamakan PT tersebut tapi tak diangtidak benar dan modus kat,” katanya. Taspen, apalagi penipuan. Sehubungan den“Makanya kemgan maraknya modus dengan imingbali kami mengingatpenipuan itu, maka iming uang kan agar masyarakat diirnya meminta agar khususnya para penmasyarakat yang menH Partabas Hutabarat siunan untuk selalu erima telepon bisa berhati-hati dan tidak menghubungi PT mudah percaya terhadap telpon dari Taspen (Persero) Cabang Pontianak siapapun yang mengatasnamakan di nomor telepon (0561) 731192 atau PT Taspen, apalagi dengan iming- 741139. (bdi)




phone plus


Pontianak Post

Jumat 18 Februari 2011

Peringati Maulid Nabi Muhammad SAW 1432 H SD Bawamai Gelar Aneka Lomba KELAHIRAN Nabi Muhammad SAW merupakan peristiwa penting bagi umat Islam. Karena Nabi Muhammad adalah suri tauladan yang baik, yang membimbing manusia menuju akhlak mulia. Selayaknya umat Islam mengucap syukur dengan memperingati hari kelahiran

Nabi Muhammad. Berlandaskan pemikiran tersebut dan sesuai Program Kerja PHBNA, SD Bawamai Pontianak dalam rangka Peringatan Maulid Nabi SAW 1432 H menggelar kegiatan dalam bentuk lomba yang sifatnya eksternal dan kegiatan internal sekolah, dengan menggelar ceramah agama. Lomba yang diselenggarakan antara lain; Lomba Mewarnai Gambar, Lomba Adzan dan Hafalan surah-surah pendek Al-Quran tingkat Taman Kanak-kanak

PENETAPAN HARGA TANDAN BUAH SEGAR (TBS) Hasil Rapat Tim Pengkajian dan Kesepakatan Penetapan Harga TBS Kelapa Sawit Produksi Petani Kalbar bln Februari 2011 PATOKAN HARGA / KG TBS KELAPA SAWIT PRODUKSI PETANI KALBAR SBB : • Umur Tanaman 3 tahun Rp. 1.374.51,• Umur Tanaman 4 tahun Rp. 1.477.55,• Umur Tanaman 5 tahun Rp. 1.5832.57,• Umur Tanaman 6 tahun Rp. 1.639.05,• Umur Tanaman 7 tahun Rp. 1.696.63,• Umur Tanaman 8 tahun Rp. 1.752.11,• Umur Tanaman 9 tahun Rp. 1.809.69,• Umur Tan. 10 s/d 20 tn Rp. 1.868.02,Harga CPO/ Kg Rp. 8.297.18 Harga Kernel/Kg : (tidak termasuk PPN) Rp. 6.331.67,- (tidak termasuk PPN) Indeks “K” : 89.82 % TIM PENETAPAN HARGA PEMDA TINGKAT I KALBAR

(TK) se-Kota Pontianak, dilaksanakan Senin, 14 Februari 2011. Sedangkan kegiatan ceramah agama akan dilaksanakan Sabtu, 19 Februari 2011. Ketua panitia Nur Asmah, S.Ag mengatakan, tujuan diselenggarakannya kegiatan lomba dalam rangka maulid Nabi Muhammad SAW, serta memperkenalkanSDBawamaikepadasekolah-sekolah TK di Kota Pontianak. “Selain itu, kegiatan ini juga dalam rangka silaturahmi meningkatkan ukhuwah Islamiyah dan menin-

HARGA KOMODITI DAN PAKAN TERNAK DI PONTIANAK Komoditi Doc Broiler FS/Ekor Broiler Hidup/kg Ayam Buras hidup/kg Daging Sapi/Kg Daging Babi/Kg Karkas Kambing/Kg Telur Ayam Ras/Kg Pakan Petelur Stater/Kg Pakan Petelur Grower/Kg Pakan Layer/Kg Pakan Pedaging Starter/ kg Pakan Pedaging Finisher/kg Kulit Sapi / Kg Kulit Kambing / Lembar


Harga Rp. 8.000,Rp. 19.000,Rp. 42.500,Rp. 75.000,Rp. 50.000,Rp. 70.000,Rp. 17.500,Rp. 5.700,Rp. 5.600,Rp. 4.500,Rp. 6.000,Rp. 5.800,Rp. 7.500,Rp. 20.000,-

gkatkan rasa cinta terhadap kebudayaan Islam,” katanya sembari mengatakan bahwa kegiatan lomba diikuti puluhan TK se-Kota Pontianak. Menurut Nur, sudah selayaknya umat Islam merayakan dan mengingat kembali sejarah penting kelahiran Nabi Muhammad. “Hal ini agar peristiwa tersebut tidak terlupakan dalam ingatan kita sebagai salah satu rangkaian perjuangan memajukan syiar Islam,” pungkasnya. (ags/ser)

Suasana lomba mewarnai gambar yang diikuti siswa TK seKota Pontianak.



1 2 3 4 5 6 7 8 9 10 11 12 13

NAMA BARANG BAHAN KEBUTUHAN POKOK Beras Lokal/Kampung Beras IR64 Gula Pasir Minyak Goreng Bimoli Minyak Goreng Curah Daging Sapi Murni Daging Ayam Ras Daging Ayam Kampung Telur Ayam Ras Susu Kental Manis Bendera Susu Bubuk Putih Cap Bendera Jagung Pipilan Kering Garam Beryodium










7.000 6.625 1.175 24.750 27.500 46.250 15.500 15.250 2.375 7.000 35.100 62.500 21.000

1 2 3 4 5 6 7 8 9 10 11 12 13


7.375 8.000 9.625 Luar Negeri 12.875 11.250 71.000 Kualitas A 23.000 42.250 16.900 7.975 24.675 4.250 925

14 15 16 17 18 19 20 21 22 23 24 25 26

Tepung Terigu Segitiga Biru Kacang Kedelai Mie Instan (Indomi Rasa Kaldu Ayam) Cabe Merah Besar (Biasa) Bawang Merah Ikan Asin Teri Kacang Hijau Kacang Tanah Ketelah Pohon Minyak Tanah Telur Ayam Kampung Cabe Keriting Bawang Putih

Sumber Data : Dinas Perindag Prop. Kalbar

Jeruk Grade A Jeruk Grade B Jeruk Grade C Tomat Aloe Vera K.panjang Buncis Cab rawit lokal Jeruk Sambal Sawi Keriting Jagung Manis Timun Terong

Kg Kg Kg Kg Kg Kg Kg Kg Kg Kg Buah Kg Kg

7000 6000 5000 10000 2500 12000 15000 28000 4000 7000 2500 7000 10000

JENIS KOMODITAS 14 15 16 17 18 19 20 21 22 23 24 25 26

Alpokat Nanas Pepaya Madu Pepaya Kampung Pisang Nipah Pisang Berangan lengkeng Pisang Ambon Semangka Biji Semangka Non Biji Sawo Salak Bers Cehereng

SATUAN HARGA KET Kg Buah Kg Kg Sisir Sisir Kg Sisir Kg Kg Buah Kg Kg

20000 3000 6000 4000 7000 15000 20000 15000 4000 6000 12000 20000 7000

Pontianak Post

Jumat 18 Februari 2011

komunikasi bisnis



Master Lu Sheng Yen Hadir di Pontianak Pameran Karya Tulis 21-22 Februari 2011


Dapatkan Tandatangannya di Ayani Megamal AHUN 2011 sekiranya menjadi tahun keberuntungan bagi masyarakat Pontianak/Kalimantan Barat pada khususnya dan Indonesia pada umumnya. Sebab, mengawali tahun yang baru ada berita yang sangat mengembirakan bagi kita semua yaitu kunjungan seorang penulis besar abad ini di Indonesia. Ia adalah Grand Master Lu Sheng Yen atau yang akrab disapa Grand Master Lu atau Master Lu. Pada kesempatan kali ini Master Lu

Sheng Yen mengunjungi Indonesia dalam kontek Pameran Karya Tulis Tahun 2011 Grand Master Sheng YenLu di 5 kota di Indonesia. Yaitu Jakarta, Surabaya, Pontianak, Palembang dan Medan. Dia adalah seorang penulis yang sangat aktif dalam mengoptimalkan potensi diri dan dituangkan dalam karya tulis, sehingga sampai dengan Februari 2011 ini Master Lu Sheng Yen telah menyelesaikan 222 buku

yang berhubungan dengan berbagai aspek kehidupan manusia, baik berupa hubungan manusia dengan manusia, manusia dengan lingkungan, manusia dengan pelatihan diri sampai dengan hasil akhir dari upaya manusia mencari makna hakiki dari hidup dan kehidupan. Sedemikian banyaknya buku yang telah ditulis, sehingga memungkinkan karya Master Lu Sheng Yen dikategorilan dalam 10 kategori yaitu: (1). Kategori Ilmu Roh, menjelaskan tentang cara membangunkan roh, membina roh yang terbangunkan, serta ilmu-ilmu roh lainnya. (2). Kategori Sadhana Tantra, mencakup semua Dharma Tantra, mulai dari sejarah Tantra, praktek penekunan Tantra yang sangat luas, ritual/ tatacara Tantra dan lain-lain. (3). Kategori Kumpulan Sajak, mengungkapkan perasaan beliau tentang hidup dan kehidupan berupa sajak, puisi dan prosa. (4). Kategori Doktrin Dharma, menjelaskan tentang kebenaran absolut, tentang 3 masa kehidupan dan tentang tuntunan Dharma untuk merealisasi makna tertinggi dalam kehidupan, (5). Kategori Wisata, sambil berwisata dari satu negara ke negara lain ternyata ada nilai-nilai kehidupan dalam setiap aspek tradisi yang mengakar di masyarakat setempat. (6). Kategori Tathata, pengulasan mendalam tentang hakekat sejati dari Dharma serta pendalaman kebijaksanaan Tathagata tentang AKU yang sejati (7). Kategori Penyelamatan, mengulas masalah-masalah yang timbul kar-

ena kebodohan manusia dan cara untuk menaggulanginya. (8). Kategori Aliran Tao, mengulas secara rinci dan mendalam tentang Taoisme. (9). Kategori Geomansi/Feng Sui, mengulas pengaruh tata letak dan hubungannya dengan keberuntungan penghuninya (10). Kategori Ceramah, berisi ceramah tentang hidup, pemberdayaan hidup dan mencari hakekat utama dari hidup dan kehidupan. Karya tulis Grand Master Lu telah diterjemahkan ke dalam 25 bahasa dan salah satunya adalah bahasa Indonesia, yang diterbitkan oleh PT. Budaya Daden Indonesia. Terjemahan karya tulis Grand Master Lu dalam bahasa Indonesia telah mencapai 17 judul antara lain Eskalasi Alam Dewa (Terbaru), Yang Terlihat Sejauh Ribuan Mil, Pengulasan Fengsui Rumah Tinggal, Menyingkap Tabir Misteri Alam, Sebuah Jalan Menuju Terang, Satu Mimpi Satu Dunia, HelaiHelai Pencerahan, Kitab Petunjuk Langit, Daya Magis Mantera, Batin Teduh Seketika, Cahaya Kebijaksanaan, dan lain-lain. Jika Anda berminat atas buku-buku tersebut, bisa Anda dapatkan di Pameran Karya Tulis Grand Master Lu pada Senin dan Selasa (21-22 Februari 2011) bertempat di Ayani Megamal Pontianak. Grand Master Lu secara pribadi akan hadir dan menandatangani buku terjemahan terbaru dalam bahasa Indonesia yang berjudul Eskalasi Alam Dewa dalam pameran tersebut pada Selasa (22 Februari 2011), pukul 19.0021.30 WIB. Prosedur untuk berpartisipasi dalam

acara tandatangan buku, adalah partisipan harus membeli 3 buku Grand Master Lu, dengan buku Eskalasi Alam Dewa sebagai buku wajib beli, dan 2 buku pilihan dari 16 judul yang tersedia. Ketiga buku harus dibeli di stand/ tempat pameran, partisipan membeli 3 buku akan mendapatkan nomor urut untuk antre tandatangan, 1 voucher belanja Hypermart seneliai Rp20.000 dan 1 kupon door price dengan hadiah utama 1 unit sepeda motor serta hadiah-hadiah lainnya. Penarikan kupon undian akan dilakukan pada Selasa (22 Februari 2011) pukul 18.00-18.30 WIB di tempat pameran dan khusus pemenang hadiah utama, hadiah akan diserahkan secara langsung oleh Grand Master Lu pada akhir tandatangan buku. Selama pameran karya tulis tersebut juga diadakan kegiatan-kegiatan sosial antara lain donor darah bekerjasama dengan Palang Merah Indonesia (PMI), dan kampanye anti HIV/AIDS bekerja sama dengan Perkumpulan Keluarga Berencana Indonesia (PKBI). Khusus pedonor darah di tempat pameran akan diberikan paket susu dari panitia dan kupon door price. Selain itu, selama pameran juga akan diadakan acara hiburan berupa tarian tangan 1000, menyanyi, sulap dan lain-lain. Adapun jadwal kunjungan Grand Master Lu secara garis besar adalah 22 Februari 2011 mengunjungi Vihara Vajrabumi Kertayuga di Jalan A Yani II pada sore hari, dan menghadiri Pameran Karya Tulis di Ayani Megamal pada malam hari. Sedangakn 23 Februari 2011 adalah mengunjungi Vihara Tri Ratna di Jalan Antasari Singkawang, dan acara ramah tamah di Pontianak pada malam harinya.(biz)

Nyeri Lambung STMIK Pontianak, Semua Program Studi Terakreditasi Sudah Tak Terasa Lagi TAK ada yang merasa nyaman ketika sakit maag sudah menyerang. Ini dirasakan langsung oleh Sulaeman Slamet. Sekitar 2 tahun terakhir ini, kakek 2 orang cucu ini mengeluhkan kesehatannya sering terganggu tatkala terserang maag. Gastritis atau lebih dikenal sebagai maag berasal dari bahasa Yunani yaitu Gastro, yang berarti perut/lambung dan itis yang berarti inflamasi/ peradangan, dengan gejala-gejala seperti perih atau sakit seperti terbakar pada perut bagian atas yang dapat menjadi lebih baik atau lebih buruk ketika makan, mual, muntah, kehilangan selera, kembung, terasa penuh pada perut bagian atas setelah makan, kehilangan berat badan. Jika dibiarkan tidak terawat, Gastritis akan dapat menyebabkan peptic ulcers dan pendarahan pada lambung. Beberapa bentuk Gastritis kronis dapat meningkatkan risiko kanker lambung, terutama jika terjadi penipisan secara terus menerus pada dinding lambung dan perubahan pada sel-sel di dinding lambung. “Mungkin karena kurang menjaga asupan makanan, saya seringkali merasakan lambung saya perih karena maag,” terang pria berusia 59 tahun tersebut memulai percakapan. Beruntung, sekitar 6 bulan lalu, pria yang berprofesi sebagai pegawai swasta ini mulai mengkonsumsi Gentong Mas. Hasilnya, “Setelah saya minum Gentong Mas secara teratur, maag saya sekarang sudah jarang kambuh, badan terasa sehat,” ujar Sulaeman dengan bahagia. Setelah merasakan manfaatnya, kini ia tidak segan-segan berbagi pengalaman baik ini dengan yang lain. “Semoga pengalaman tentang Gentong Mas yang saya rasakan ini dapat bermanfaat bagi yang lain,” imbuhnya. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu gula aren dan nigella sativa (habbatussauda) terbukti memiliki banyak manfaat. Diantaranya memelihara pembuluh darah, perbaikan sistem saraf, optimalisasi aktifitas hormon, meningkatkan proses penyembuhan dinding lambung, meningkatkan daya tahan tubuh dan bersifat anti bakteri. Habbatussauda juga dapat mengatasi gangguan tidur dan relaksasi. Cabe Jamu yang terdapat dalam Gentong Mas bermanfaat untuk mempercepat penyembuhan mukosa lambung. Untuk hasil cepat dan maksimal dianjurkan makan teratur, hindari alkohol, rokok, kendalikan stress, dan jika memungkinkan hindari obat penghilang nyeri. Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Informasi lebih lanjut silahkan kunjungi Bagi Anda membutuhkan Gentong Mas bisa didapatkan di apotek dan toko obat terdekat atau hubungi Pontianak: 081376179880/0561-7020305. Kabupaten Pontianak: Apt Mempawah, TO Ceria. Singkawang: 085220713000. Kubu Raya: Apt Amelia, Apt Arwana. Sambas: TO Sehat, Apt Mitra Jaya, TO Aman. Sanggau: TO Mulia, Apt Mandiri. Ngabang: Apt Meriba, TO Sehat. Sintang: TO Tiara, TO Setia Budi. Bengkayang: TO Berkat, TO Meriba. Ketapang: 081256520280, Apt Medistra Farma, TO Murni, Apt Mulia. Terdaftar di Depkes:P-IRT:812.3205.01.114.(biz)

Pendaftaran Mulai 23 Mei 2011 Pendaftaran Sebelum 23 Mei Dapat Diskon Khusus

STMIK Pontianak merupakan sekolah tinggi pertama dan terpercaya. Semua program studi terakreditasi BAN-PT dalam menghasilkan Ahli Madya (A.Md) dan Sarjana Komputer (S.Kom) di Kalbar. STMIK telah melaksanakan 14 kali wisuda, dengan jumlah keseluruhan 1.879 lulusan. Setiap lulusan yang dihasilkan selain memiliki keahlian di bidang teknologi informasi juga memiliki jiwa kewirausahawan di bidang ICT (technopreneurship), yang dapat dibanggakan tidak hanya dalam negeri tetapi juga di luar negeri. Kenyataan telah membuktikan semua lulusan dapat diterima dengan baik dalam semua segmen masyarakat, seperti instansi pemerintahan (PNS), BUMN, LSM, kepolisian, perbankan, perusahaan swasta, wirausahawan, guru sekolah, hingga menjadi dosen di sejumlah perguruan tinggi untuk bidang sejenis dan bidang lainnya. Kondisi ini mengindikasikan mi-

nat masyarakat sangat besar untuk mendapatkan pendidikan di STMIK Pontianak. Tak hanya sekadar menghasilkan Software Engineer saja, tapi lebih pada menghasilkan seorang knowledge Engineer memiliki keahlian dalam bidang Technopreneurship. STMIK Pontianak menyelenggarakan 3 program studi. (1) Manajemen Informatika (D3) “Terakreditasi” No. 017/BAN-PT/ Ak-VII/Dpl-III/XII/2007 dengan 2 peminatan keahlian yaitu Multimedia dan Web Mobile Programming. (2) Sistem Informasi (S1) “Terakreditasi” No. 032/BAN-PT/Ak-X/ S1/I/2008 dengan 2 peminatan keahlian yaitu E-Business dan Corporate Information Systems. (3) Teknik Informatika (S1) “Terakreditasi” No. 029/BAN-PT/AK-XI/ S1/XI/2008 dengan 2 peminatan keahlian; Software Engineering

dan Artificial Intelligence. STMIK Pontianak telah mengembangkan teknologi e-learning melalui komunitas forum mahasiswa berbasis intranet, fasilitas e-book, teknologi jaringan Inherent, kemudahan pertukaran file/data, hotspot (wi-fi), dan STMIK e-learning. Di samping itu, sudah menerapkan metode StudentCentered Learning (SCL). STMIK Pontianak secara rutin memberikan berbagai pelatihan bidang software dan hardware terkini. Untuk menunjang proses belajar mengajar kondusif menyediakan fasilitas ruang kuliah full AC, praktik bebas setiap hari, OHP setiap ruang kuliah, LCD proyektor; Lab. komputer berbasis internet, praktik Robotika dan penggunaan Wi-Fi gratis. Perpustakaan lengkap bukubuku terkini, tabloid komputer, CD program majalah komputer dapat dipinjam. STMIK juga memberikan

beasiswa bagi mahasiswa berprestasi. Pendaftaran hubungi bagian pendaf­ taran setiap hari kerja, Jl. Merdeka No. 372. Telp: 735555 Pontianak atau kunjungi website:www.stmikpontianak.

Jantung, Asam Urat & Maag Sembuh dengan Sarang Semut

JAMCHIN (64 th), warga Pontianak, Kalimantan Barat adalah seorang ibu rumah tangga berusia sudah lama menderita penyakit jantung, asam urat, dan maag. Selama ini sudah sering berobat ke dokter dan berbagai jenis obat yang diberikan oleh dokter sudah dikonsumsinya. Tapi tidak juga sembuh, dia pikir sakitnya ini karena faktor usia dan sudah malas mau berobat lagi ke dokter. “Tapi saya sering mendengar cerita dari tetangga kalau ada obat yang namanya Sarang Semut sangat bagus untuk sakit jantung. Karena ada keluarga dari tetangga saya yang sudah sembuh setelah konsumsi Sarang Semut, akhirnya saya menceritakan

kepada suami saya dan kemudian suami sayapun mencari informasi di mana bisa membeli obat tersebut. Setelah Sarang Semut didapatkan, lalu saya konsumsi sesuai dengan aturan minum yang ada di Sarang Semut,” ceritanya. Ternyata setelah dia mengkonsumsi Sarang Semut, ia mendapatkan kesembuhan. Sekarang jantung dan tekanan darah Jamchin sudah normal, kesemutan di kaki jadi hilang. Sakit maag juga tidak pernah kambuh lagi semenjak konsumsi Sarang Semut. “Sampai sekarang saya masih terus konsumsi Sarang Semut agar penyakit saya benar-benar sembuh dan tidak kambuh kembali”. Sarang Semut secara em-

piris dan tradisional dapat digunakan untuk membantu mencegah dan mengatasi berbagai jenis kanker dan tumor, jantung koroner dan berbagai gangguan jantung, stroke, menghilangkan benjolan pada payudara, gangguan ginjal dan prostate, TBC/paruparu, ambeien (wasir) baru maupun lama, melancarkan dan meningkatkan Air Susu Ibu (ASI). Tidak disarankan mengkonsumsi Sarang Semut dalam bentuk lempengan, karena: (1) Tidak terjamin kehigienisannya karena hanya diproses melalui penjemuran berkali-kali menggunakan sinar matahari, sehingga dapat menimbulkan bakteri/jamur yang berbahaya bagi tubuh. (2) Dosis yang tidak tepat, karena setiap lempengan tidak memiliki kadar yang sama. (3) Tidak disarankan menggodok Sarang Semut berulang kali karena khasiatnya sudah jauh menurun atau hilang khasiatnya. (4) Tidak jelas jenis Sarang Semut yang dipergunakan, karena tidak semua jenis Sarang Semut

berkhasiat sebagai obat. (5) Tidak dapat dipertanggung jawabkan siapa produsennya bila terjadi keracunan, karena produk lempengan tidak memiliki registrasi Badan POM. (6) Pastikan Sarang Semut yang anda beli adalah hasil produksi PT. Prima Solusi Medika yang memberikan jaminan keaslian dan kualitas produk terbaik keunggulan Sarang Semut PT. Prima Solusi

Medika: Merupakan pioneer dan pemegang hak paten Sarang Semut di Indonesia, terdaftar di balai POM dan memiliki sertifikasi halal, diproduksi dengan standar Cara Pembuatan Obat Tradisional yang Baik (CPOTB). Dapatkan Sarang Semut di apotek dan toko obat terdekat di kota Anda. Info produk: 085245961665 (Pontianak) dan 082113688010 (Jakarta).(biz)


Kubu raya


Warga Batam Serbu CGM

Pontianak Post Jumat 18 Februari 2011

Batu Ampar Cocok Pelabuhan Internasional

EFEK domino Festival Cap Go Meh 2011, benar-benar luar biasa sekali. Jumlah kunjungan wisatawan meskipun tidak tercatat resmi mencapai ratusan bahkan ribuan orang. “Mereka umumnya berasal dari Batam, Singapura bahkan Malaysia,” kata Fauzi Kasim, Kepala Dinas Pariwisata, Budaya, Pemuda dan Olahraga Kubu Raya, Kamis (17/2) di lokasi CGM. Menurut dia yang diketahuinnya persis banyak datang ke Kubu Raya adalah warga Batam yang umumnya Tionghoa termasuk Singapura. Itu setelah monitoring Fauzi Kasim tim Disparbudpora ke beberapa tempat penginapan di Kabupaten Kubu Raya. ”Mulai dari penginapan kelas besar seperti Hotel Dangau sampai penginapan kelas biasa seperti Hotel Srikandi. Wisatawan lokal dan luar tidak sedikit menginap di Kubu Raya,” ungkap dia. Data tersebut, sambung Fauzi, tidak termasuk datadata wisatawan yang menginap di Kota Pontianak. Karena kepenuhan, mereka juga banyak mendatangi penginapan di Kota Khatulistiwa dan menyaksikan Festival CGM selama beberapa hari ini. ”Kita merasa senang dan terharu,” ujarnya. Ayi(23) warga Pontianak yang bekerja di Batam ini sengaja memilih pulang ke Kubu Raya sekedar menyaksikan Festival CGM. ”Saya diberitahu orang rumah, kalau Festival CGM di Kubu Raya ramai. Makanya saya pulang ke Pontianak,” ujarnya yang sengaja meminta cuti ke bosnya demi menyaksikan Festival CGM di Kubu Raya ini. (den)


Jelang Penutupan, Pembeli Membludak Merry(30) salah satu pedagang stand kuliner mengakui memperoleh keuntungan berlipat menjelang penutupan Festival Cap Go Meh 2011 yang digelar di Kabupaten Kubu Raya ini. ”Menjelang 2 hari ini, barulah pembeli ramai. Kalau hari biasa pada waktu pembukaan, banyak yang lihat daripada yang minat,” kata ibu dua anak ini yang menyewa salah satu stand kuliner ini, Kamis (17/2). Menurut dia pada awal pembukaan, pembeli cukup sepi. Itu mungkin dapat dimaklumi, mengingat hari pertama sewaktu Merry pembukaan justru angin kencang disertai hujan yang turun. ”Karena musibah tersebut, mana ada pembeli datang,” kata pemilik Kafe Jus di Jalan Jendral Urip , Pontianak ini. Ia menambahkan dalam 2 hari menjelang penutupan, jumlah pengunjung tidak sedikit. Bahkan melebihi kapasitas dari jumlah sebelumnya seperti Festival CGM 2010 di Pontianak. “Barang dagangan saya ludes habis. Ini karena saya jual es dan jus khas Kalbar yang diramu dengan tenaga ahli handal,” ujarnya berpromosi.(den)

Deni/Pontianak Post

KARNAVAL: Peserta karnaval Festival CGM 2011 tengah melewati warga yang sedang menyaksikannya. Salah satu peserta festival tersebut adalah kelompok sepeda ontel.

SUNGAI RAYA-Para politikus DPRD Kubu Raya asal daerah pemilihan Kubu, Batu Ampar dan Terentang mendukung wacana Batu Ampar, sebagai salah satu pelabuhan pilihan di Kalbar. ”Kita punya luas wilayah representatif. Bahkan Batu Ampar dulunya eks pelabuhan kayu berskala internasional. Tidak salah kalau dipilih sebagai salah satu pelabuhan pilihan,” kata Agus Sudarmansyah, Ketua Komisi C DPRD Kubu Raya, kemarin. Menurut Agus, lima pelabuhan yang diwacanakan Pemprov Kalbar dan tidak memasukan nama Kubu Raya, khususnya Batu Ampar patut dipertimbangkan kembali. ”Membuka Batu Ampar menjadi pelabuhan baru akan banyak mendatangkan manfaat. Daerah ini tidak perlu lagi dikeruk karena kedalamannya sangat cocok sebagai pelabuhan berstandar nasionalinternasional,” ungkap dia. Sebelumnya Sekda Kalbar melalui M. Zeet Hamdy Assovie seusai pertemuan muspida dan badan usaha berkaitan dengan keluar masuknya kapal di kantor Gubernur Kalbar, tidak menyinggung wilayah Kubu Raya sebagai salah satu wacana pembangunan pelabuhan laut. ”Yang disinggung hanya pelabu-

han di Kayong Utara berskala internasional, (Kendawangan— Ketapang), Temajo—Kabupaten Pontianak, Paloh—Sambas,” ujarnya. ”Heran ya, kok tidak ada nama Kabupaten Kubu Raya,” sambung Dede Ketua LPPD Kalbar kemarin. Subandi Dolet, politikus Dapil Kubater juga menyesalkan Kubu Raya, Batu Ampar tidak masuk dalam rencana pembangunan pelabuhan laut berskala nasional—internasional. Daerah ini dulunya tahun 1970-1980—an dikenal sebagai tempat keluar masuk industri kayu berskala internasional melewati alur laut. ”Akan tetapi, eks pelabuhan angkutan kayu tersebut tidak dipergunakan dan berfungsi. Kenapa tidak dimanfaatkan ulang lagi,” katanya. Mustafa Ms, politikus Golkar bersuara vokal dari dapil Kubater juga meminta ada pertimbangan supaya Batu Ampar menjadi salah satu pelabuhan pilihan Pemprov Kalbar. ”Dipertimbangkan dulu. Sebab, seandainya dibuka akses daerah terpinggir di Kubu Raya ini akan terbuka lebar. Bahkan, bukan tidak mungkin menjadi besar kedepannya. Dan saya optimis, Batu Ampar memenuhi kriteria menjadi pelabuhan nasionalinternasional,” terangnya.(den)

Sukses Festival CGM 2011 di Kubu Raya MABT Agendakan Festival Lain SUNGAI RAYA-Kegiatan yang digagas Majelis Adat Budaya Tionghoa (MABT) Kalbar tidak berhenti hanya sebatas pergelaran Festival Cap Go Meh tahun 2011 saja. Meski sukses dengan ramainya kunjungan masyarakat, tidak menyurutkan organisasi sosial ini merancang agenda lain. Bahkan rencananya lebih besar, menasional hingga dapat dikenal sampai keluar. Ketua Umum DPP Majelis Adat Budaya Tionghoa (MABT) Kalbar, Harso Utomo Suwito mengatakannya kepada Pontianak Post. ”Dari kegiatan ini, kita melihat sebetulnya banyak agenda atau momen tionghoa yang bisa ditampilkan. Sebenarnya saya agak merahasiakan karena banyak politik-politik ke MABT. Sebab, kalau MABT berbuat

sesuatu ada yang dipolitikan, tetapi tidak apa-apa kita akan hadapi,’ ujarnya kepada Pontianak Post, Kamis (17/2) di Lokasi Festival CGM. Ia mengatakan agenda lain yang tengah dirancang adalah festival bakcang. Didalamnya nanti akan diisi dengan wisata kuliner tradisional beragam makanan dan panganan khusus khas Kalbar termasuk luar. Kemudian akan digabungkan dengan kegiatan kerajinan tradisional. ”Kegiatan ini digabung menjadi satu,” jelasnya. Selain itu, ada juga Festival Kue Bulan dan dikeluarkan secara khusus. MABT Kalbar sudah fokus agar kegiatan etnis tionghoa dapat dilakukan setahun 3 kali diadakan. ‘Kami hanya berharap stimulan pendorong kegiatan dapat didukung berbagai kalangan,” harap dia. Wakil Bupati Kubu Raya, Andreas Muhrotien mengaku senang dan bangga dengan antusiasme dan kunjungan pe-

nonton, ternyata sangat luar biasa sekali. Pemkab Kubu Raya berharap kegiatan Festival Cap Go Meh digelar dan diadakan di Kubu Raya. ”Kita dukung kegiatan tersebut. Banyak efek domino dihasilkan, terutama segi perputaran roda perekonomian warga setempat,” ucapnya. Disamping pergelaran Festival CGM, Pemkab juga berharap ada agenda atau festival lain dapat digelar di Kubu Raya. Misalnya festival budaya lain seperti penampilan adat atau budaya Melayu, Bugis, Dayak, Jawa, Madura, China dan suku lainnya. ”Dan kita berharap itu bisa seheboh seperti Festival CGM,” ungkap dia. Ditempat terpisah, Fauzi Kasim, Kepala Dinas Pariwisata, Budaya, Pemuda dan Olahraga Kabupaten Kubu Raya memarpakan kedepan, pihaknya akan mendesain dan duduk satu meja dengan MABT KKR juga Kalbar. ”Kegiatan ini boleh dibilang sangat luar biasa

sekali. Dan tentunya menjadi apresiasi tersendiri bagi daerah pemekaran baru seperti Kubu Raya ini,” ujarnya. Meski begitu, pihaknya tengah merancang dan menyambut baik ide Wakil Bupati Andreas Muhrotien. Disamping momen Festival CGM, Disparbupora tengah merancang Festival Hadrah dan Pawai Budaya berbagai etnis. Nantinya akan ditampilkan, terutama dalam rangka kegiatan Apkasi Kalbar yang rencananya dihadiri Presiden RI, Susilo Bambang Yudhoyono. ”Akan kita gelar di Kubu Raya. Mudah-mudahan tidak ada perubahan,” harapnya. Selain itu, agenda   besar lain yang banyak mendatangkan masyarakat adalah Kabupaten Expo di Kubu Raya. Disparbudpora akan bekerjasama dengan berbagai pihak termasuk BPMPT Kubu Raya. “Kita akan adakan sekaligus menampilkan budaya dan kegiatankegiatan lain,” ungkap dia. (den)

Pontianak Post


Jumat 18 Februari 2011

Sintang Dambakan Rumah Sakit Baru Sambungan dari halaman 9

beberapa waktu lalu. Pada Desember 2010, kata dia, banyak wargayangtidakterlayanirumah sakit karena keterbatasan ruangan. Karena itu, pembangunan rumah sakit baru dinilai sangat mendesak. Apalagi rumah sakit yang ada di Sintang merupakan rumah sakit rujukan untuk

daerah-daerah yang ada di sekitarnya, seperti Kapuas Hulu dan Melawi. “Bayangkan saja apabila musimbanjirdatangditigakabupaten tersebut, banyak penyakit muncul dan jumlah pasien juga semakinmembeludak,”katanya. Untuk pendirian rumah sakit baruini,menurutnyamasyarakat Kabupaten Sintang sudah mem-

persiapkan lahan yang baru. Selain mendambakan rumah sakit baru, masyarakat di Kabupaten Sintang juga mengharapkan adanya penambahan tenaga guru, khususnya untuk daerah pedalaman. Selama ini, jumlah tenaga guru dirasakan masihsangatkurang.Disamping itu, warga pun mengharapkan adanya bantuan pemprov untuk

Ketapang Potensial Melanggar Aturan... pembangunan/rehab gedung sekolah. “Banyak sekolah yang sebetulnya tidak memenuhi standar sekolah.Banyakruangkelasyang berlobang atapnya, sehingga ketika hujan ruang kelas yang ada menjadi basah. Banyak juga sekolah yang papan dan dinding kelasnya sudah rapuh dimakan rayap,” ungkapnya.(rnl)

RUU Ketok Palu Kapolres Bisa Beli Mercy Sambungan dari halaman 9

dengan pembagian 50 persen untuk insentif dan 50 persen untuk dana konservasi dan rehabilitasi. ”Bisa juga untuk insentif untukproseshukumselanjutnya. Dengan adanya insentif, tidak ada suap lagi. Jadi nanti jangan heran kalau kapolres bisa membeli mercy,” katanya. Takhanyamembahasinsentif, dalam RUU juga disebutkan menebang pohon dalam kawasan

hutan secara tidak sah, membawaalat-alatberat,memanfaatkan hasil hutan, mengedarkan kayu hasilpembalakanliar,menerima, membeli, menjual kayu ilegal, turut serta melakukan pembalakan liar, mencegah, merintangi dan atau menggagalkan secara langsungmaupuntidaklangsung upaya pemberantasan tindak pidana kehutanan diancam pidana minimal 4 tahun kurungan dan denda Rp4 miliar. Hukuman maksimal 15 tahun penjara den-

gan denda Rp15 miliar. Apabila dilakukan perseorangan,termasukmasyarakatsekitar hutan, dikenakan pidana paling singkat enam bulan dan paling lama 2 tahun. Denda minimal Rp500 ribu dan maksimal Rp500 juta. Ancaman lainnya bagi yang melakukan pembukaan, mengerjakan, menggunakan, menduduki,danataumenguasai kawasan hutan tanpa mendapat izin menteri dikenakan pidana 8

tahunkurungandandendaRp20 miliar atau maksimal 20 tahun dan denda Rp50 miliar. Bagi yang mendanai pembalakan liar, membuka kebun dantambang,mentransferdana, menyembunyikan atau menyamarkan asal usul harta yang diduga berasal dari hasil illegal loggingdiancampidanaminimal 10 tahun kurungan dan denda Rp20 miliar, atau maksimal 25 tahun dan denda Rp1 triliun. (uni)

sudah dikelola dengan baik dan transparan,” ungkap dia. Setiap bulannya, tambah Firdaus, KONI juga sudah melakukan kewajiban penyetoran retribusi ke Pemprov sejumlah kurang lebih Rp15 juta. Aset-aset yang sudah dikelola secara baik tersebut, ungkap Firdaus, sangat disayangkan jika dipindahtangankan. Bercermin pada pengelolaan terdahulu, kata Firdaus, sangat jauh berbeda. Pemasukan retribusi pada periode terdahulu tidak tahu kemana juntrungnya. Bahkan KONI Kalbar harus utang puluhan hingga ratusan juta ke Pem-

prov, karena tidak menyetor retribusi. Diungkapkan Firdaus, di dalam UU Sistem Keolahragaan Nasional aset-aset olahraga harus dimanfaatkan untuk kegiatan keolahragaan dan tidak boleh bergeser di luar kegiatan itu. “KONI Kalbar dan Pemprov Kalbar dalam hal ini Dispora harusnya saling menunjang, bukan saling bertabrakan. Jika seperti ini bagaimana kita mau memajukan prestasi olahraga Kalbar, apalagi dalam waktu dekat kita akan menghadapi PON XVIII Riau 2012,” katanya. (bdi)

Tolak Alih Kelola Aset Sambungan dari halaman 9

kang dengan cara seperti pengambilalihan pengelolaan aset. “Kami sudah berusaha ingin memajukan olahraga Kalimantan Barat, seharusnya ini didukung. Semua ini demi kepentingan olahraga bukan demi kepentingan saya pribadi atau golongan,” kata mantan pembalap motor Kalimantan Barat itu. Hal senada juga diungkapkan Ketua I KONI Kalbar Slamet Raharjo didampingi Sekretaris Umum KONI Kalbar Fidraus Zarin. Keduanya juga

mengatakan tak setuju dengan pengambilalihan pengelolaan aset di lingkungan gelanggang olahraga GOR Pangsuma. Saat ini, kata Slamet, KONI sudah melakukan tugas dan tanggung jawab secara benar dan profesional. Seperti penyetoran retribusi ke Pemprov yang sudah berjalan sebagaimana mestinya. “Pengelolaan aset KONI yang kita lakukan selama ini juga sudah profesional. Seperti pengelolaan GOR Pangsuma, Stadion SSA, Lapangan Tenis Sutera, hingga keberadaan aset pihak ketiga, Kolam Renang dan Galaherang. Semua

Wali Kota di Kalbar, Kamis (17/2). Menurut Christiandy, Kalbar memiliki luas wilayah sekitar 146.807 kilometer persegi. Luasan tersebut 7,53 persen dari luas wilayah Indonesia. Jika dilihat dari luasan hutannya berdasarkan Kepmenhut dan Perkebunan nomor 259/ Kpts-II/2000 tanggal 23 Agustus 2000, Kalbar memiliki kawasan hutan sedikitnya 9,18 juta hektar. Luasan ini merupakan 62

persen dari luas provinsi yang berfungsi sebagai kawasan hutan konservasi seluas 1,65 juta hektar, hutan lindung 2,31 hektar, dan hutan produksi 5,22 juta hektar. Sementara areal yang bisa dikembangkan untuk budidaya non kehutanan diantaranya sektor pertanian, perkebunan, pertambangan, pemukiman dan prasarana umum pada lahan berstatus areal penggunaan lain hanya tercatat 5,5 juta hektar atau 38 persen dari total luas provinsi. “Untuk pengembangan

wilayah diperlukan pembangunan prasarana fisik seperti jalan, perkantoran, dan pemukiman. Untuk memenuhi hal tersebut tentunya memerlukan ketersediaan lahan berstatus areal penggunaan lain yang cukup luas,” ungkap Christiandy. Tidak tersedianya lahan berstatus areal penggunaan lain menyebabkan pembangunan di luar sektor kehutanan dan prasarana fisik di beberapa daerah mengalami hambatan. “Karena sebagian besar luas wilayahnya meru-

pakan hutan produksi, hutan lindung, dan konservasi yang notabene tidak bisa digunakan untuk pembangunan,” katanya. Ia menambahkan saat ini ada beberapa perusahaan perkebunan yang mengajukan proses pelepasan kawasan hutan produksi konversi. Beberapa perusahaan pertambangan juga telah mengajukan izin penggunaan dan pinjam pakai kawasan hutan kepada Menteri Kehutanan. “Namun hingga saat ini belum ada tanggapan,” katanya. (uni)

Dipicu Lingkungan, Ajak Bentuk Penyuluh Dini Sambungan dari halaman 9

“Sejak kecil bisa bentuk penyuluh, misalnya saat masih SMP bisa diajarkan menjadi penyuluh muda,” katanya saat membuka pelatihan pencegahan, pemberantasan, penyalahgunaan dan peredaran gelap narkoba bagi guru BK SMP dan SMA di Pontianak. Selain itu, ia meminta agar guru bisa melihat perubahan dari anak didiknya. Jika anak tersebut ada perubahan dari sifat, bisa langsung di selidiki, siapa tahu anak tersebut merupakan pengguna narkoba. “Anak yang awalnya pendiam, kemudian tiba-tiba bisa tampak pede. Atau sebaliknya

anak yang sifatnya biasa banyak ngomong, kemudian menjadi pendiam. Maka sebagai guru harus segera mencurigai anak tersebut,” kata Midji. Guru Bimbingan Konseling SMP di Pontianak, Yeni mengatakan akan berencana untuk mengajar anak didiknya menjadi penyuluh. Namun saat ini yang menjadi prioritasnya dalam mencegah penyalahgunaan narkoba bagi siswanya ialah memanfaatkan media. “Kita ada buat film dan sebuah tulisan, nanti anak bisa menontonnya dan melihatnya, agar bisa memberikan pelajaran kepada mereka tentang dampak bahaya narkoba,”

kata Yeni. Berdasarkan data yang diperoleh dari Polda Kalbar terdapat peningkatan pengguna narkoba, dari data kasus narkoba yang tercatat di Polda Kalbar menerangkan jenis narkotika yang ditindakpidanakan untuk tahun 2009 hanya sekitar 65 orang, namun meningkat tajam menjadi 225 kasus tindak pidana. Sementara kualifikasi pendidikan yang menjadi tersangka akibat narkoba yang dominan ialah SMA dan SD. Tahun 2009, SD mencapai 57 orang dan meningkat menjadi 93 orang pada 2010. Sementara SMP sekitar 59 orang juga meningkat men-

jadi 84 orang. Hal yang sama mengalami peningkatan juga di SMA awalnya untuk tahun 2009 130 orang, kemudian meningkat menjadi 138 untuk tahun 2010. Maka dari itu, dari segala sisi kota Pontianak untuk penggunaan dan peredaran narkotika meningkat terus setiap tahunnya. Dari jumlah demikian kaum pria mendominasi sekitar 276 untuk tahun 2010, ini berarti meningkat dari tahun 2009 yang berjumlah 217 orang. Ternyata bukan hanya pria, namun untuk kaum hawa juga ditemukan sekitar 41 orang untuk 2009 dan meningkat menjadi 52 orang pada 2010. (tin)

Di lain sisi, menggunakan kayu bakar tidak praktis, karena banyak sekali yang harus dikerjakan. Misalnya mulai dari menebang pohon atau ranting di hutan, mengeringkannya, sehingga siap digunakan. Sementara elpiji, cukup memutar tombol dan api biru segera menyala. Penebangan pohon juga sebagai bentuk merusak lingkungan hutan, atau istilahnya deforestrasi. Semakin banyak orang menebang pohon, hutan semakin hancur. Jika elpiji dijadikan energi baru, maka laju deforestrasi bisa ditekan. Setidaknya, warga di kawasan pedesaan tidak lagi perlu menebang pohon untuk bahan bakar rumah tangga. Hanya saja pemerintah harus menjamin kelancaran distribusi elpiji sampai ke pelosok desa. Dengan tidak menebang pohon, artinya pohon yang tetap ada bisa menyerap racun berupa karbon dioksida atau zat pencemar lainnya, yang lepas di udara. Sehingga pohon-pohon yang tetap berdiri bisa menjalankan fungsinya menguragi karbon dioksida karena pohon memerlukannya untuk pertumbuhannya. Nah, setelah menyerap karbon dioksida, pohon-pohon akan melepaskan ogsigen yang dibutuhkan mahluk hidup. Proses inilah yang disebut fotosintesis. Untuk elpiji, jelas tidak banyak memproduksi asap maupun arang, sehingga po-

lusi relatif kecil. Sedangkan untuk minyak tanah dengan ukuran yang sama, mengeluarkan asap dan arang yang relatif lebih besar. Dewasa ini orang banyak memperbincangkan tentang pemanasan global atau global warming. Kondisi ini artinya, meningkatnya konsentrasi gas rumah kaca yang lepas ke asmosfir, berupa metan, CO2, dan nitrogen dioksida. Zat-zat tersebut merupakan bahanbahan pencermar udara, yang akan menjadi selimut bagi bumi sehingga panas yang berasal dari mata hari tidak bisa langsung lepas ke angkasa. Efeknya, bumi semakin panas karena suhu rata-rata akan naik. Kemudian panas ini menyebabkan pergeseran iklim, misalnya masa penghujan dan kemarau yang sudah sulit diprediksi. Siklus iklim tidak menentu. Kita semua sudah merasakan seperti apa hidup dalam ketidakmenentuan iklim ini. Pada masa yang seharusnya kemarau, justru turun hujan. Begitu juga sebaliknya, pada masa yang seharusnya hujan, justru kemarau. Penggunaan elpiji bisa membantu menekan peningkatan gas rumah kaca, yang memicu pemanasan global. Ini artinya energi elpiji agak ramah lingkungan, jika dengan dibandingkan dengan minyak tanah. (Aktivis Lingkungan Hidup, Project Officer Yayasan Bio Damar Pontianak)

Bantu Tekan Polusi Sambungan dari halaman 9

bagi kesehatan, sebab mengandung racun bagi tubuh. Pembakaran dengan elpiji tetap melepaskan karbon dioksida, tetapi tidak sebanyak yang dilepaskan oleh bahan bakar minyak. Dari sisi praktis, pembakaran dengan elpiji relatif lebih cepat dan tidak membuang-buang waktu. Mari kita lihat perbandingan antara elpiji dan minyak tanah. Nilai kalor atau panas dari elpiji sebesar 53 kilo joule per gram. Artinya, setiap satu gram elpiji akan menghasilkan kalor pembakaran sebesar 53 ribu joule. Sementara kalor dari minyak tanah sebesar 45 kilo joule per gram. Artinya setiap satu gram minyak tanah, akan menghasilkan energi sebesar 45 ribu joule. Dengan matematis sederhana, kita temukan adanya selisih kalor tiap gram antara elpiji dengan minyak tanah sebesar 8 kilo joule per gram. Sekarang mari kita lihat secara lebih rinci, ditinjau dari aspek efektivitas kerja dan efesiensi waktu. Kita contohkan energi panas yang diperlukan untuk merebus air. Misalkan satu kilogram air mentah dalam suku 25 derajad Celcius, sampai mendidih mencapai suhu 100 derajad Celcius, diperlukan elpiji sebesar 5,915 gram. Sedangkan dengan minyak tanah, untuk mendidihkan air sebanyak satu kilogram, diperlukan 6,97 gram minyak tanah.

Sambungan dari halaman 9

Ketapang. Banyak. Tetapi ekspos hari ini Bupatinya tidak hadir,” ujar Dirjen Pelestarian Hutan dan Kawasan Konservasi Alam (PHKA) Darori, seusai EksposPenggunaanKawasanHutan Tidak Prosedural tahap pertama olehdelapanbupatidanwalikota di Kalbar, Kamis (17/2) di Balai Petitih Kantor Gubernur Kalbar. Menurut Darori, kedatangannya ke Kalbar merupakan kegiatan roadshow untuk mendengarkan ekspos dari kepala daerah kabupaten dan kota. SebelumnyadilakukandiKalimantanTimur,KalimantanTengah, dan Kalimantan Selatan. Begitu pula di Kalbar, tim yang datang mendengarkan penjelasan dari kepala daerah. Kedatangan ini mengajak Bareskrim Polri, Satgas Mafia Hukum, Komisi Pemberantasan Korupsi, Kementerian Lingkungan Hidup, Kejaksaan Agung, dan instansi berwenang lainnya. Nantinya, penjelasan dari kepala daerah setiap kabupaten dan kota akan diverifikasi dengan data yang ada, termasuk mengambil tindakan hukum. ”Faktanya dulu, baru ambil tindakan hukum. Makanya saya mengajak semua yang berkaitan datang ke sini,” kata Darori. Selain Ketapang, Darori juga menyebutkan Bengkayang sebagai daerah yang berpotensi terhadap pelanggaran. Saat ini ada kasus tambang yang tidak memiliki izin. Penambangan ini dilakukan dua perusahaan. Di sana sudah terdapat kebun dan peralatan. ”Yang lain-lain nanti-

Ada selisih sebesar 1,05 gram antara elpiji dengan minyak tanah, untuk mendidihkan air dengan takaran yang sama. Ini artinya penghematan, selain ada keuntungan lain yakni polusi yang relatif rendah. Jelas dari angka itu, terjadi penghematan energi maupun waktu digunakan untuk aktivitas pembakaran. Keunggulan ini masih ditambah lagi dengan rendahnya polusi, karena dalam masing-masing satu gram elpiji dan minyak tanah, memberikan dampak yang berbeda. Sedikit ekstrim, mari kita lihat pembakaran yang memanfaatkan kayu bakar. Di kawasan pedesaan, biasanya warga memanfaatkan kayu sebagai bahan bakar utama untuk memasak. Sekarang kita lihat seberapa besar kalor atau panas yang bisa dihasilkan oleh kayu bakar. Kayu memiliki kalor sebesar 18 kilo joule per gram. Mari kita bandingkan sekali lagi dengan elpiji yang 53 kilo joule per gram. Jauh sekali, bukan? Ada selisih sebesar 35 kilo joule! Belum lagi polusi yang dihasilkan. Karena kayu bakar banyak sekali mengeluarkan asap dan arang. Soal efektifitas dan efisiensi, untuk merebus air saja, dengan elpiji cukup 5,915 gram untuk mendidihkan satu kilogram air. Kalau menggunakan kayu bakar, untuk volume air yang sama membutuhkan 17,42 gram kayu bakar. Ada selisih 11,5 gram.

lah.Khawatirlarikarenakitamau tangkap,” ungkapnya. Kabupaten lainnya yang juga terindikasi melakukan pelanggaran adalah Kubu Raya, yakni berkaitan dengan Hutan Mangrove. ”Untuk mangrove saya sudahmemintaKejaksaanTinggi mengambil alih,” kata Darori. Berdasarkan PP 38 Tahun 2007,pengawasanhutanlindung danproduksiditugaskankepada bupati. Berdasarkan UU Nomor 5 Tahun 1990, hutan konservasi, taman nasional cagar alam di bawah pengawasan Direktorat Jenderal Pelestarian Hutan dan Konservasi Alam. Tetapi setelah evaluasi, kondisinya tidak bertambah baik sehingga Menteri Kehutanan mengambil alih. ”Nantinya pelanggaran bisa dikenakan pasal berlapis di pengadilan, termasuk jika ada unsur korupsinya. Nanti tim bisa bersama-sama atau bisa jalan sendiri, tetapi melaporkan kepada kami apa saja yang ditindak,” ungkap Darori. Saat ini kondisi kerusakan hutan keseluruhan di Indonesia masihdalampendataan.Khusus di Kalteng, kerusakan hutan mencapai 7 juta hektar dari total keseluruhan seluas 17 hektar. Sebagianbesardigunakanuntuk perkebunan dan pertambangan.Di Kalbar, kerusakan hutan sebagian besar disebabkan perkebunan sawit. ”Setelah seluruh Bupati ekspos, tim akan menyatukan data. Untuk Bupati Ketapang akan ekspos di Jakarta. Kita kros cek. Ada bupati sebelumnya. Nanti tidak bisa tidur,” kata Darori ketika diminta menyebutkan daerah-daerah yang

melakukan pelanggaran. Ia memastikan kepala daerah yang mengeluarkan surat izin pemanfaatan kawasan hutan yang tidak sesuai kewenangan, akan terkena kasus hukum. Sebab izin pemakaian kawasan hutanberadadiKementerianKehutanan. “Karena itu, kalau ada bupati atau wali kota yang telah mengeluarkanizinpemanfaatan kawasan hutan untuk tambang atau kebun, sebaiknya segera dicabut,” ujarnya. Ia juga mengatakan tidak ada pemutihan lahan sebelum RencanaTataRuangdanWilayah (RTRW) disahkan. Jika ditemukan penggunaan kawasan hutan yang belum memiliki izin pakai, maka dipastikan melanggar. Direktur V/Tipiter Bareskrim Mabes Polri, Brigjen Suhardi Alius juga meminta kepala daerah hati-hati dalam memberikan izin.Bupatijugaharusmengecek secara benar kepala dinas yang ditunjuknya dan jangan asal tanda tangan. ”Pelanggaran peraturan berkaitan dengan kehutanan ini pasti melibatkan aparat. Seperti kasus di Ketapang beberapa waktu lalu,” ujar Suhardi, kemarin. Ia mengungkapkan saat ini di Ketapang diketahui banyak galian yang tidak benar. ”Kami berikan persuasif kepada Polda Kalbar.Janganlangsungditindak, ingatkan dulu,” kata Suhardi. Saat dikonfirmasi mengenai galian tidak benar di Ketapang, Kapolda Kalbar Brigjen Pol Sukwardi Dahlan enggan berkomentar. ”Cukup satu polisi yang ngomong,” katanya singkat. (uni)

Perlu 15 Ton Ikan Sambungan dari halaman 16

Segera Urus APL Sambungan dari halaman 9


“Ikan itu diimpor bukan karena kita kurang ikan, namun melihat angka yang dikeluarkan dan dijual ternyata lebih untung jika kita impor dari luar. Jika permintaan banyak, maka kita impor dari luar untuk memenuhi kebutuhan,” terang Awaludin, Rabu (16/2). Meski Pontianak mengimpor ikan, namun juga mengek-

spor ikan ke luar negeri seperti ikan merah dan bawal. Ikan tersebut jika dijual di luar negeri jauh lebih mahal dibandingkan dengan dalam negeri. “Kita menjual ikan yang harganya mahal dan lebih banyak proteinnya. Ibaratnya ikan yang biasa saja kita makan, yang bagus kita jual,” katanya. Terkait dengan langkanya BBM, tidak berpengaruh terh-

adap pemasokan ikan di Pontianak. Hanya saja kedatangan ikan terlambat, beberapa hari, namun itu wajar, karena memang ikan biasa datang terlambat. “Ikan memang sempat terhambat, namun itu sudah biasa. Tidak begitu berpengaruh karena BBM. Biasanya stok BBM sudah tersedia di kapal nelayan untuk tiga hari perjalanan mencari ikan,” katanya. (tin)

Nomor 55 tahun 2005 tentang Dana Perimbangan (aturan pelaksana UU/33/2004), dana bagi hasil yang terdiri atas bagi hasil pajak dan bagi hasil sumber daya alam belum mengakomodasi sektor perkebunan. Aturan ini justru masih memasukkan dana bagi hasil dari sektor kehutanan yang jelas-jelas sudah tidak bisa dinikmati oleh Kalbar, karena sektor kehutanan bukan lagi menjadi primadona penghasilan di daerah ini. Pemerintah diharapkan dapat mengapresiasi pertumbuhan perkebunan sawit di beberapa provinsi termasuk Kalbar. Tumbuhnya perkebunan sawit menjadikan daerah ini sebagai penghasil sumber daya alam, setara dengan provinsi lain yang dikategorikan provinsi penghasil tambang minyak dan gas bumi seperti Aceh, Riau dan Kaltim. “Sebagai daerah penghasil, provinsi ini layak mendapatkan dana bagi hasil SDA sebagaimana diatur dalam UU 33/2004, namun harus direvisi objeknya,” jelas Wakil

Ketua Komisi B itu. Mengingat potensi perkebunan sawit di Kalbar yang besar, dana bagi hasil ini diharapkan dapat memberikan kontribusi yang signifikan bagi peningkatan struktur pembiayaan APBD Kalbar. Di samping itu, upaya optimalisasi pendapatan daerah Kalbar juga terkendala oleh ketiadaan pelabuhan laut. Pelabuhan Kalbar tidak memadai sehingga ekspor CPO terpaksa harus dilakukan melalui pelabuhan di daerah lain. Padahal, potensi pendapatan dari pajak ekspor CPO Kalbar cukup besar. Berdasarkan data 2009, ekspor CPO mencapai 800 ribu ton per tahun. “Masalahnya, dengan ketiadaan pelabuhan laut Kalbar, pajak ekspor CPO akhirnya dinikmati oleh provinsi lain dengan pelabuhannya, seperti Belawan, Tanjung Priok, Tanjung Perak dan sebagainya,” kata dia. Menanggapi aspirasi yang disampaikan Komisi B, Wakil Ketua Komisi XI, Surachman Hidayat memberikan respon positif. (rnl)

Dana Bagi Hasil Sambungan dari halaman 16

perkebunan di Kalbar relatif luas. “Dari luasan lahan potensial perkebunan sawit di Kalbar yang saat ini sudah menyentuh angka lebih kurang 600 ribu hektar, tak serupiah pun dinikmati oleh provinsi ini,” kata Jurubicara Komisi B, Sy Izhar Assyuri kemarin. Desakan ini disampaikan ketika Komisi B DPRD Kalbar yang dipimpin Nicodemus R Toun (Wakil Ketua DPRD Kalbar selaku koordinator Komisi B) berkunjung ke Komisi XI DPR RI yang membidangi keuangan, perbankan dan lembaga nonblank beberapa hari lalu. Dalam kunjungan ini, rombongan Komisi B yang terdiri atas 13 anggota juga didampingi Kadispenda Kalbar dan Bappeda Kalbar. Komisi B meminta agar wakil rakyat yang duduk di Komisi XI memperjuangkan adanya dana perimbangan bagi hasil sumberdaya alam dari sektor perkebunan. Menurut Izhar, dalam PP

Buruh Migran Tanpa Identitas Meninggal... Sambungan dari halaman 16

gizi yang buruk.” Kata dia, kondisi pasien sangat lemah dan mengalami anemia, kesadarannya juga sudah menurun saat mulai dirawat. Ketut menambahkan, pada

tubuh korban tidak ada menemukan bekas kekerasan. Hanya saja karena infeksi paru berat membuat kondisi Jarsinah menurun. Hingga membuatnya kesulitan menggali informasi dari pasien. Serta hasil rongtgen menyimbulkan Jarsinah men-

derita radang paru. “Hasilnya hari ini (kemarin) sudah keluar,” kata dia. Menurut dia, radang paru dapatdipicukarenafaktorkeletihan hingga membuat kondisi menurun. Dan virusnya menyerang ke seluruh tubuh. (stm)

Ayam Jiran Dibakar Sambungan dari halaman 16

ternak unggas, babi dan produknya. “Sebelum pemusnahan, kita sudah lewati tahapan-tahapan sesuai aturan. Pemilik tidak dapat melengkapi dokumen yang dipersyaratkan,” jelasnya. Terkait dengan DOC broiler asal Malaysia, Azmal mengungkapkan, pelaku sudah diinterogasi. Pelaku mengaku bahwa bibit ayam tersebut masuk melalui Pos Pemeriksaan Lintas Batas Entikong. Azmal menyesalkan lolosnya unggas ini dari pantauan petugas yang ada di pintu masuk Entikong. “Kita sudah koordinasi dengan petugas di Stasiun Karantina Pertanian Entikong. Kita minta supaya mereka meningkatkan lagi pengawasannya,” ujar dia. Dalam upaya pengawasan ini, Azmal juga berharap adanya peran serta dari seluruh elemen masyarakat.

Jika menemukan ada ternak dari luar yang masuk ke Kalbar, hendaknya dapat segera melapor ke pihak Karantina. Kasi Wasdak Balai Karantina Pertanian Klas I Pontianak, Faisyal N menambahkan, pihaknya sedang mengupayakan proses hukum terhadap pelaku. Selain itu, upaya pengembangan kasus juga sedang dilakukan bersama instansi terkait. “Kita ingin mengungkap kemungkinan adanya jaringan yang lebih luas dan siapa-siapa saja yang terlibat,” tambahnya. Ketua I Asosiasi Agrobisnis Perunggasan Kalbar, Suryaman yang berperan dalam penangkapan DOC broiler asal Malaysia, menyampaikan apresiasi yang tinggi atas langkah pihak Karantina. “Ini yang kami harapkan. Pelaku harus ditindak tegas supaya ada efek jera,” tandasnya. Di samping itu, AAP juga menyesalkan masuknya ternak

unggas dari luar, bahkan dari Malaysia. Beberapa waktu lalu, selain di Kota Pontianak, menurutnya AAP juga menemukan adanya bibit ayam Malaysia yang masuk ke Kota Singkawang. Kenyataan itu mengindikasikan bahwa masuknya bibit ayam dari Malaysia ini sering terjadi dan kemungkinan juga sudah merambah kabupaten-kabupaten lain. “Kami akan gerebek lagi di Singkawang. Tersangkanya sudah kami kantongi,” ujarnya. Ketika disinggung mengenai keterkaitan antara masuknya unggas dari Malaysia ini dengan wabah flu burung di Kabupaten Pontianak, Suryaman tidak dapat memastikan. Namun, menurutnya bisa jadi ayam dari luar inilah yang menjadi media penularan flu burung ke Kalbar. “Kalbar kan sebelumnya bebas flu burung. Bisa saja faktor ini yang jadi penyebab penularan,” katanya.(rnl)



Pontianak Post


Perlu 15 Ton Ikan KEBUTUHAN ikan di Pontianak mencapai 15 ton setiap harinya. Untuk memenuhi kekurangan itu, pedagang mengimpor dari Sarawak dan Brunai Darusalam. Hal ini dilakukan karena ada faktor ekonomisnya. Anggota Komisi C DPRD Kota Pontianak Awaluddin mengungkapkan, ikan yang diimpor dari Malaysia dan Brunai itu berupa kembung dan tongkol yang kisarannya seAwaluddin banyak 25 persen. Ke Halaman 15 kolom 5


Dana Bagi Hasil KOMISI B DPRD Kalimantan Barat mendesak agar pemerintah pusat segera merevisi Undang-Undang Nomor 33 tahun 2004 tentang Dana Perimbangan Keuangan Pemerintah Pusat dan Pemerintah Daerah, khususnya dalam hal pengaturan dana bagi hasil. Soalnya, selama ini, Kalbar sama sekali tidak kecipratan dana bagi hasil dari sektor ini meskipun luas Ke Halaman 15 kolom 5

Jumat 18 Februari 2011

Ayam Jiran Dibakar PONTIANAK - Balai Karantina Pertanian Klas I Pontianak kembali memusnahkan sejumlah unggas ilegal, Kamis (17/2). Kali ini, unggas yang dimusnahkan adalah 549 DOC broiler (bibit ayam) dari Malaysia, 17 ekor ayam dari Jawa Timur, 6 ekor merpati dari Jawa Tengah, seekor burung ciblek dan perkutut dari Jakarta. Unggas-unggas tersebut merupakan hasil penangkapan beberapa waktu lalu. Kepala Balai Karantina Pertanian Klas I Pontianak, Azmal Az, menegaskan, unggas-unggas yang dimusnahkan ini masuk ke Kalbar tanpa dilengkapi dengan sertifikat kesehatan hewan (KH-9) dari daerah asal. Sedangkan DOC broiler asal Malaysia, yang terkategori hewan impor, juga tidak dilengkapi dengan surat izin pemasukan dari Direktorat Jenderal Peternakan sebagaimana disyaratkan dalam Undang-Undang nomor 16 tahun 1992 tentang Karantina Hewan, Ikan dan Tumbuhan serta Peraturan Pemerintah Nomor 82 tahun 2000 tentang Karantina Hewan. Disampingitu,pemasukanunggasinipunmelanggar Kepmentan Nomor 316/Kpts/PD.630/1/2010 tentang pernyataan provinsi Kalbar bebas dari flu burung dan SK Gubernur 259/2005 yang menyatakan Kalbar tertutup (sementara) dari pemasukan Ke Halaman 15 kolom 5


DIBAKAR: Ayam yang didatangkan dari Malaysia, Jatim, Jateng, dan Jakarta ini dimusnahkan pihak karantina dengan cara membakar.

Buruh Migran Tanpa Identitas Meninggal di RSUD Soedarso PONTIANAK - Seorang perempuan diduga Tenaga Kerja Wanita asal Jawa Barat tanpa identitas meninggal di Rumah Sakit Umum Daerah Soedarso karena mengalami shock septic. Kondisinya telah kritis saat kali pertama menjalani perawatan dan terus memburuk hingga nyawanya

tidak tertolong, Kamis (17/2). Tidak ada pihak yang mengetahui alamat jelas bernama Jarsinah (40). Tapi berdasar atas sekilas informasi menyebutkan Jarsinah berasal dari Jawa Barat. Namun alamat persisnya masih misterius. Serta selama di rumah sakit

dia hanya sebatangkara. Tanpa sanak keluarga atau kerabat. Menurut Kabid Penanggulangan Bencana dan Bantuan Sosial Dinas Sosial Provinsi Kalbar, Suwandi, mengatakan Jarsinah sempat ditampung di Selther. Tiba ke penampungan kondisinya sudah sangat memprihatinkan. Serta tidak diketahui siapa yang mengantar Jarsinah ke shelter. Ketika masuk ke penampungan, kata Suwandi, salah seorang penghuni mengenali bahwa dia bernama Jarsinah dengan daerah asal Jawa Barat. Namun tidak ada petunjuk untuk memastikan identitas jelasnya. Sebab dia tanpa mengantongi kartu tanda penduduk maupun identitas lainnya. Jarsinah tiba ke Dinsos Minggu malam kemarin. Usai sempat menginap satu malam langsung dilarikan ke rumah sakit. Mengingat kondisinya begitu memperihatinkan serta membutuhkan penanganan medis. Hingga akhirnya meninggal dunia.

Pihak Dinsos juga belum mendapatkan kepastian menyangkut asal Jarsinah. Menyimpulkan sebagai TKI atau bukan. Karena tidak ada pihak yang dapat dimintai penjelasan. Termasuk jarsinah. Dia sulit diajak berkomunikasi. Kondisinya fisiknya sangat lemah saat datang ke Dinsos. “Kami tidak tahu siapa yang mengantar,� kata Suwandi. Kini jasad Jarsinah berada di ruang Jenazah RSUD Soedarso. Belum ada pihak keluarga yang menghubungi Dinsos untuk mengambil jenazahnya. Karena itu, lanjut Suwandi, PBBS berkoordinas dengan Dinsos kota Pontianak. Jika hingga tiga hari ke depan jenazah Jarsinah tetap berada di kamar mayat akan segera dikebumikan. Dengan difasilitasi Dinsos Kota Pontianak. Selama berada di rumah sakit, Jarsinah menjalani perawatan intensif di ruang Enggang. Menurut dr I Ketut Sudjana, spesialis penyakit dalam,� Jarsinah mengalami radang paru berat serta kondisi Ke Halaman 15 kolom 5


PRO-KALBAR Pontianak Post



Patuhi SKB MENANGGAPI keberadaan jamaah ahmadiyah di kabupaten Landak, Kepala Kantor Kementerian Agama Kabupaten Landak, Mudjazie Bermawie kemarin mengatakan bahwa belum ada laporan secara resmi kepada Kemenag Landak. “Belum ada laporan dari camat setempat atau pun masyarakat, tetapi informasi ini akan ditindaklanjuti dan tentu diharapMudjazie Bermawie kan seluruh warga ahmadiyah yang ada dan umat islam yang ada dikabupaten Landak tetap taat dan patuh kepada surat keputusan bersama (SKB) tiga menteri agar tidak saling membantu, tidak saling menyudutkan kemudian dan jangan terprovokasi dengan kasus di Cikeusik di Banten,” jelasnya saat ditemui Pontianak Post. Ia juga meminta kepada umat Islam diluar Ke Halaman 23 kolom 1



HUTAN: Ross dan Karina saat menikmati hutan kota.

Gaet Wisman HUTAN kota yang terletak di Kelurahan Sukaharja ternyata menarik perhatian wisatawan mancanegara. Kawasan seluas sekitar 91 hektar ini direnacakan sebagai salah satu lokasi untuk pelestarian tanaman khas Kalimantan. Menurut Yudo Sudarto SP, M.Si, Kepala Dinas Kebudayaan Pariwisata Pemuda dan Olahraga Kabupaten Ketapang bahwa kawasan hutan Kota selain sebagai kawasan konservasi, juga merupakan salah satu obyek wisata alam (ecotourism). Ke Halaman 23 kolom 1


Kesan Mendalam PERAYAAN Imlek bersama 2562/2011 yang dilaksanakan di Sandai 12 Februari 2011 memberi makna dan kesan mendalam. Menurut Camat Sandai, Drs Anwar MM. hal ini bukan semata kemeriahan acara yang bervariasi dengan mendatangkan artis-artis ibukota dan pendopo entertaimen sebagai hiburan utama atau karena pesta kembang api dan kehadiran Anwar ribuan penonton yang penuh sesak di lapangan Sandai. “Kesan mendalam tersebut bagi saya sebagai camat Sandai diantaranya dari persiapan rencana kegiatan panitia yang terdiri dari

Jumat 18 Februari 2011

Cap Go Meh Singkawang Paling Diminati

Hotel Penuh, Wisatawan Mengeluh SINGKAWANG –Puncak perayaan Cap Go Meh yang digelar di Singkawang (17/2) kemarin, ternyata mampu mengundang perhatian wisatawan baik domestik maupun mancanegara seperti dari Kuching, Brunei Darussalam, Singapura dan beberapa negara lainnya untuk bertandang ke kota Amoi tersebut. Pantauan Pontianak Post, pada malam puncak perayaan (16/2) seluruh hotel yang ada di Singkawang dipadati para wisatawan. Baik yang berasal dari dalam, maupun luar negeri. Bahkan karena penuh sebagian wisatawan dari luar Kalbar yang masuk melalui bandara Supadio memilih untuk menginap di hotel-hotel

TATUNG: Para tatung dengan hewan peliharaannya berpose setelah ritual cuci jalan.

Ke Halaman 23 kolom 1 HARI/PONTIANAKPOST

Tribun CGM Ambruk Pemprov Sumbang Rp100 Juta SINGKAWANG—Di tengah masyarakat “dibius” atraksi para tatung dengan beragam aksinya. Puluhan warga dikejutkan dengan ambruknya tribun penonton di sebelah kanan tribun utama, dimana para pejabat tengah asyik menonton. Meski tak ada warga mengalami luka-luka serius, namun mereka mengeluh kesakitan. Insiden tersebut terjadi selang kurang lebih dua pulu menit saat para tatung mulai menampilkan kebolehannya di Jalan Diponegoro, Kamis (17/2) kemarin. Teriakan histeris pun keluar dari mulur para penonton. Namun suara teriakan mereka kalah bersaing dengan genderang musik para tatung. Tak ayal puluhan penonton jadi panik. Dengan cepat anggota polisian, TNI dan Sat Pol PP cepat mengevakuasi penonton yang masih terjebak di reruntuhan tribun. Ada yang cemas, bahkan menangis karena kejadian yang cukup mengagetkan itu. Salah satu penonton, A Ling asal Singkawang, mengatakan kaget terhadap kejadian tersebut. Meski tak mengalami luka, ia mengeluhkan sakit pinggang, maklum


AMBRUK: Beberapa penonton menahan sakit setelah tribun penonton Cap Go Meh ambruk di Jalan Diponegoro Singkawang ambruk saat tatung beraksi.

Ke Halaman 23 kolom 1

Dua Saksi Tak Pernah Diperiksa Landak Negatif Kasus Terminal Antarnegara SINGKAWANG-Dua saksi ahli meringankan yang diajukan oleh kuasa hukum dua tersangka dalam kasus pembebasan tanah untuk pembangunan terminal antarnegara di Kelurahan Sui Wie, tak pernah diperiksa oleh Kejaksaan Negeri Singkawang. Dua saksi yang meringankan itu dari akademisi Universitas Tanjungpura Pontianak dan pegawai Badan Pertanahan Nasional (BPN) Pusat. “ Bambang Setiadi selaku kuasa

hukum Pedro Halim dan Iswan sudah mengajukan dua saksi, sejak 2 Pebruari 2011. Tapi, sampai saat ini belum pernah diperiksa oleh jaksa penyidik,” kata alumni STIH Singkawang, Suryadi Hadran, kepada Pontianak Post, kemarin. Diakui Suryadi, dua orang saksi ahli meringankan yang diajukan itu adalah hak tersangka yang diatur dalam KUHAP. “Kenapa tidak ditindaklanjuti oleh jaksa penyidik,” kata mantan pengurus Partai Golkar Kabupaten Sambas. Diakui Suryadi, masyarakat pada intinya tidak anti dalam pemberantasan korupsi.

“Sebagai masyarakat yang paham soal hukum, kita ingin kebenaran objektif lebih dikedepankan agar terjadi keseimbangan hukum dalam proses penyidikan yanbg dilakukan oleh kejaksaan, sehingga tidak ada pihakpihak yang terzalimi secara hukum,” kata dia. Adanya saksi ahli pembanding ini, maka akan semakin jelas keobjektifan perkara dalam kasus pengadaan tanah terminal antarnegara. “Kita berharap kedua saksi ahli ini segera dipanggil oleh penyidik,” kata dia. Dia khawatir, terjadi kriminalisasi Ke Halaman 23 kolom 1

TERBALIK : Sebuah mobil terbalik setelah menghantam sebuah motor di persimpangan Jalan Soetomo, Sambas kemarin. Tak ada korban jiwa dalam peristiwa tersebut.

Ke Halaman 23 kolom 1

Flu Burung

NGABANG – Kepala Dinas Kesehatan Kabupaten Landak, drg. Magdalena Nurainy Sitinjak, MM menjelaskan bahwa pasien dengan suspect flu burung dari kecamatan menjalin dinyatakan negatif flu burung. Keterangan tersebut disampaikannya pada Rabu (16/2) kepada Pontianak Post saat Nurainy Sitinjak ditemui dikantor bupati Landak. Dengan hasil laboratorium yang negatif tersebut dirinya bersyukur dan berharap jangan sampai flu bu- 11 Februari lalu rung masuk di kabuJakarta mempaten Landak. “Tanggal 11 Februari berikan hasil 2011 dari Jakarta memlaboratoriumberikan hasil laboratorinya dan sample umnya dan dinyatakan negatif H5N1. Kalau flu yang dikirim burung ini memang luar negatif H5N1.’’ biasa penularannya. Kalau gejala penyakit yang didiagnosa oleh tim laboratorium terhadap pasien bisa disembuhkan dengan minum obat teratur, asupan giji yang cukup,” katanya. Ke Halaman 23 kolom 1


Perayaan Cap Goh Meh di Ketapang Meriah

Naga, Tatung dan Barongsai Diarak Tak cuma di jalur Pantura dan pusatnya di Singkawang, ternyata perayaan pucuk Cap Go Meh 2011 berlangsung meriah di Ketapang. Siang nan terik, tak membuat warga memanfaatkan nonton di pinggir jalan menyaksikan arak-arakan naga dan barongsai. Andi Chandra, Ketapang


BINARAGA: Aksi binaraga pun ditampilkan dalam festival lampion.

PINGGIR jalan sontak ramai kemarin pagi. Warga tumplek blek untuk menikmati aksi naga dan barongsai ‘’membersihkan’’ kota dari pengaruh jahat. ‘’Ya, selain atraksi budaya, arak-arakan naga ini diyakini oleh warga Tionghoa sebagai cuci


KELILING: Naga merah kuning diarak berkeliling kota Ketapang. Buat menyucikan kota dari hawa jahat.

kota dari hawa buruk yang mungkin bakal menghadang di tahun yang sedang berjalan,’’ ujar A Lim, 33 tahun, seorang penambang di bumi Ale-ale yang ikut serta menikmati tontonan gratis ini. Dia bersama rekan-rekannya memang tidak menambang hari itu demi bisa menyaksikan aksi naga dan tatung di kota Ketapang. ‘’Hari ini meliburkan diri. Ke ketapang untuk menyaksikan tatung, naga dan barongsai,’’ ujarnya. Arak-akan Naga di Ketapang dimulai ketika memberikan penghormatan di kantor Bupati Ketapang, Selasa (16/2). Rabu malam (16/2) naga sepanjang 60 meter dari Yayasan Dharma Bakti memeriahkan malam Cap Go Meh diarak keliling Kota Ketapang. Arak-arakan naga dilepas Bupati Ketapang, Drs. Henrikus, M.Si di Pendopo Jalan H. Agus Salim, Rabu Malam (16/2). Sesuai agenda, pelepasan naga dihadiri Muspida, Kepala SKPD Kabupaten Ketapang, tokoh Masyarakat, tokoh Agama dan tokoh Adat. Selain itu, Kamis pagi juga dilakukan atraksi Ke Halaman 23 kolom 1



Pontianak Post


Jumat 18 Februari 2011

Antusias Sambut Atraksi CGM PINYUH-Setiap kali dihelatnya perayaan Imlek hari ke-15 yang disebut Cap Go Meh alias Kocat istilah warga Pinyuh, mengundang ribuan warga menyemut sepanjang jalur yang dilewati arakan drumband Pariwisata, puluhan tatung, naga persatuan serta pernik-pernik Cap Go Meh 2011, kemarin. Kendati terbilang molor dari perkiraan penonton yang sejak pukul 10.00 WIB sudah membanjiri komplek pasar Pinyuh. Namun begitu pawai Cap Go Meh dilepas Drs Suharjo Lie, Kadis Perhubungan, Kebudayaan dan Pariwisata (PKP) mewakili karena mengikuti pertemuan dengan Gubernur di Balai Petitih Pontianak, seketika jalanan menjadi padat dan macet. Pabnitia dikonfirmasikan menyangkut jumlah tatung tak bisa memberikan angka pasti. Itu disebabkan, jumlah tatung yang diundang resmi dengan tatung yang ikut berpartisipasi memeriahkan pawai Cap Go Meh cukup banyak. Yang pasti, pemandangan seperti tahun-tahun sebelumnya memang agak berkurang. Setidaknya pawai perayaan CGM tidak diikuti oleh pakaian adat dari lain. Kendati tetap menghadiri undangan pada acara pelepasan. Molornya waktu dari perkiraan semula membuat warga lebih suka menyaksikan tayangan melalui TV kabel ketimbang datang ke lokasi. Selain panas menyengat, ditambah bau arak karena dikonsumsi oleh para tatung dan pendukungnya, bau gaharu yang dibakar oleh setiap kelompok tatung. Mereka sejak pukul 11.00 sudah datang meramaikan dan berkumpul ddi komplek pasar tinggkat tiga. Sedangkan pelepasan oleh Kadis PKP dilakukan sekitar pukul 15.00 WIB. “Diharapkan perayaan Cap Go Meh yang dipusatkan di Sungai Pinyuh dapat memberikan konstribusi positif


TATUNG: Rombongan tatung juga beraksi di Sungai Pinyuh. Ribuan warga membanjiri jalan menikmati aksi tahunan tersebut.

,” kata Suharjo membacakan arahan Bupati Pontianak. Oleh karena itu, dimintakan, setiap perayaan CGM hendaknya dikemas sedemikian rupa, sehingga bisa menarik minat wisata domistik maupun manca Negara untuk hadir. Disebutkan Suharjo Lie, Kabupaten Pontianak sejak beberapa tahun lalu memang sudah menetapkan tiga lokasi perayaan, untuk robo-robo dipusatkan di Kuala Mempawah (Pasir Wan Salim-red), Imlek dan Ccap Go Meh di Sungai Pinyuh dan untuk naik Dango di Anjongan. Hadir pada acara itu H Rahmad Satria Ketua DPRD, Kompol HM Daulay Waka Polres, pemuka masyarakat serta undangan dari berbagai etnis. (ham)

Nonton, Anak Hilang SEORANG anak bernama sahra, 4 tahun dilaporkan sang ibu karena lepas dari pegangannya, saat menyaksikan Cap Go Meh kemarin. Kepada petugas pasangan suami istri (pasutri) sempat melaporkan kepada Kapolsek Pinyuh dan petugas lainya serta menyebarkan foto sang anak yang berpakaian merah. Sang ibu tidak memperkenalkan nama dan asal, lantaran buru-buru mencari sang anak. Tetapi membenarkan, kalau putrinya bernama Sahra itu lepas dari pegangann dan pantauannya dan berbaur dengan warga yang berjubel. Saat berita ini diturunkan, tidak diketahui secara pasti, apakah Sahra berhasil ditemukan orangtua dan keluarganya. Bebeapa warga yang mengetahui secepatnya mengin-

formasikan kepada petugas dan warga lainnya untuk membantu jika melihat anak yang disebutkan itu. “Kami berharap, Sahra bisa ditemukan orangtuanya. Hal itu bisa diketahui saat anak haus atau lapas. Pasti menangis.” sebut pedagang kaki lima yang menerima informasi itu. Yang pasti, kata Waniwati, PKL jenis kompeksi itu, akan terjadi hal seperti itu, jika orangtua asik melihat keramaian dan lupa dengan anak yang dipegangnya. “Mudah-mudahan kejadian itu bsia menjadikan sebagai pengalaman berharga,” katanya. Yang pasti sebut ibu tiga anak itu, jika kehlangan secpatnya menginformasikan baik kepad apetugas Kepolisian, Satpam, angota Pol PP maupun pedagang Kaki Lima. (ham)

CU Pancur Kasih Sekolah Tambah Jam Belajar Gelar RAT PINYUH- Kopdit Pancur Kasih (Credit Union) Tempat Pelayanan Sui Pinyuh kembali melaksanakan Rapat Anggota Tahunan (RAT) Tahun Buku 2010 ber tempat di Gedung Shiny Star, sabtu. Agenda RAT terdiri dari 3 bagian, yakni Laporan Pertanggungjawaban Pengurus yang disampaikan oleh Ahmad Tabrani (SPO) TP Sui Pinyuh. Laporan BP disampiakan Sabinus Nus serta penyampaian target untuk Tahun Buku 2011 oleh Silvanus Ilvan selaku pimpinan manajemen TP Sui Pinyuh. RAT TB 2010 ini dihadiri 104 orang anggota yang merupakan perwakilan dari seluruh wilayah pelayanan TP Sui Pinyuh dan 12 orang yang akan mewakili TP Sui pinyuh terdiri dari unsur Manajemen, SPO, Pokti dan 3 orang perwakilan wilayah) yang akan mengikuti RAT Pleno pada 26 Pebruari 2011 mendatang di Pontianak. Data per 31 Desember 2010 jumlah anggota CUPK TP Sui Pinyuh sebanyak 1.091

dengan pertumbuhan 43,18 persen, dan asset Rp 12,7 M dengan pertumbuhan 36,67 persen dan SHU sebesar Rp 209.754.509. Pengurus pusat Marselus L A.Pd yang hadir pada saat RAT, menyampaikan apresiasinya melihat perkembangan TP yang cukup baik sekaligus menginformasikan kepada seluruh peserta RAT bahwa tahun ini akan dibangun Tempat Pelayanan di Sui Pinyuh dan untuk meningkatkan pelayanan dan informasi , tahun 2011 ini CUPK TP Sui Pinyuh akan melakukan pelayanan 2 hari seminggu di Mempawah. Tahun Buku 2011 pertumbuhan anggota ditargetkan 1.651 anggota atau 51,33 persen, dengan pertumbuhan asset mencapai Rp18,6 M atau 42,64 persen. RAT mengedepankan tema ‘ Mensinergikan Tata Kelola Internal dan Eksternal untuk keberlanjutan Credit Union Pancur Kasih ‘. Yang dibuka Drs. Syamsul Rizal, M.Si Camat Sui Pinyuh. (ham/ser)

Ingin Pasang Iklan di Biro PINYUH?

NGABANG – Dalam rangka menghadapi Ujian Nasional (UN) yang akan digelar dalam beberapa bulan ke depan, sejumlah sekolah telah melakukan berbagai persiapan. Diantaranya dengan menambah jam belajar bagi siswa maupun dengan menggelar try out. Kepala Sekolah Madrasah Aliyah (MA) Negeri Ngabang, Muhamad Subirin saat ditemui Pontianak Post Kamis (17/2) mengatakan bahwa dalam persiapan menyongsong UN pihaknya telah membekali, mengarahkan dan bimbingan kepada guru mata pelajaran agar pembelajaran lebih menekankan pada persiapan yang akan diujiankan dengan tidak mengesampingkan pelajaran tambahan lainnya. “Lebih mengefektifkan pembelajaran terfokus, artinya sekiranya materi yang disampaikan mengarah pada SKL maka kami bahas sampai tuntas dan terus menerus. Sedangkan materi yang sifatnya tambahan saja kami berikan dengan porsi pembelajaran seperti biasa,” ujarnya kepada wartawan. Ia juga mengatakan ke-

inginan untuk meluluskan siswanya secara kualitas tidak hanya sebatas berangan-angan, tetapi harus diwujudkan menjadi kenyataan. Maka kami terus melakukan monitoring berkenaan dengan perkembangan siswa. Apalagi untuk tahun 2011 berdasarkan permendiknas sesungguhnya kelulusan ditingkat sekolah lebih mudah, karena pihak sekolah memiliki peran yang besar dalam rangka menentukan kelulusan, yakni dengan melampirkan nilai semester 3, 4, dan 5 serta nilai ujian sekolah. Untuk memberikan ruang belajar yang lebih besar, pihak sekolah membebaskan siswa kelas XII yang akan mengikuti ujian dari kegiatan ekstrakurikuler sekolah. Mereka sengaja diberikan tambahan waktu agar lebih memaksimalkan belajar mereka. Sementara itu, di Sekolah Menengah Atas (SMA) Negeri 1 Ngabang dalam waktu dekat siap menggelar try out sebagai bentuk persiapan bagi siswa dalam menempuh UN. Wakil Kepala Sekolah Bidang Kurikulum SMA Negeri 1 Ngabang, Dominikus Dasit saat ditemui diruang kerjanya


mengatakan bahwa dalam rangka mempersiapkan ujian nasional 2011 pihak sekolah sudah dibuatkan pelajaran tambahan yang dimulai sejak 17 Januari 2011 yang lalu dan programm ini berjalan sampai dengan menjelang UN. Dalam menjelang UN 2011 sendiri memang ada kegiatan-kegiatan penunjang salah satunya try out yang akan digelar satu kali saja yakni 21 Februari 2011 mendatang selama empat hari. Ditambahkannya, try out yang disiapkan tetap mengacu pada materi-materi ujian nasional saja. Ditanya soal target kelulusan, pihaknya menargetkan 100 persen lulus seperti tahun lalu, dan ada peningkatan dari segi nilainya. Dengan pemberlakuan sistem baru di tahun 2011 ini, diharapkan semua stakeholder di SMANSA Ngabang bisa mempersiapkan diri secara maksimal agar kelulusan bisa semakin membaik secara kualitas. “Tentu saja kami berharap seperti tahun lalu lulus 100 persen, dan pastinya dengan peningkatan nilai hasil ujian nasional,” timpalnya. (sgg)



Pontianak Post

Pasang Iklan Biro SINGKAWANG (0562) 631912 08125713422

Jumat 18 Februari 2011

Jalan Perbatasan Rusak

Menguak Dahsyatnya Turbo Hipnotis Apakah anda ingin menguasai hipnotis dalam waktu cepat dan mendapat garansi dijamin langsung bisa praktek hipnotis hanya dalam 1 hari? Dapatkan solusinya dengan mengikuti Workshop Turbo Hipnotis; belajar hipnotis instant dan rahasia menghipnotis cepat dalam hitungan detik. Instruktur Turbo Hipnotis adalah Dipl. Ing. Awie Suwandi, MCH (Jakarta), seorang experienced Trainer, Hypnossis Coach & Hypnotherapist, lulusan Diplom Ingenieur in Berlin, Germany. Manfaat workshop adalah untuk meningkatkan karisma dalam kepemimpinan (hypno leadership) dan pendidikan (hypno teaching), terapi diri untuk berbagai kasus seperti menghilangkan kebiasaan buruk, penyakit, memotivasi diri, menggali dan mengembangkan potensi, mengatasi fenomena kesurupan, stress dan pain management, pelangsing tubuh tanpa diet dan olahraga (hypno slimming), melejitkan bisnis dan usaha (hypno selling) dll Beberapa materi yang diajarkan diantaranya: rahasia & prinsip kerja Turbo Hipnotis, manfaatnya dalam penyembuhan serta dalam menggali & mengembangkan potensi diri seseorang, teknik melakukan deepening yang cepat dan praktis, strategi menanamkan sugesti & anchor, teknik sugesti pra & post hipnotik, standing induction (teknik menghipnotis dalam posisi berdiri), auto suggestion (metoda menghipnotis diri sendiri), hypnoparenting (teknik menghipnotis anak-anak) dll. Dapatkan bonus senilai jutaan rupiah dalam bentuk DVD Pelajaran dan ebook “Stage Hypnosis”, koleksi teknik-teknik Induksi, deepening, tes Sugestibilitas. Dapatkan juga bonus teknik menghipnotis “non verbal” (hipnotis tanpa ucapkan sepatah katapun). Bonus teknik deepening dan emerging, teknik melakukan “waking hypnosis” (menghipnotis suyet tanpa ditidurkan terlebih dahulu), plus bonus teknik hypnotic seal yang bisa diaktifkan sendiri untuk melindungi diri dari pengaruh hipnotis yang tidak dikehendaki. Garansi sampai mahir!!! Jika masih belum mahir..anda boleh mengulang terus berkali kali sampai mahir hanya dengan membayar bea ganti konsumsi saja. Peserta mendapat sertifikat dan gelar Certified Turbo Hypnotist (C.TH) dan berhak membuka praktek sebagai seorang hypnotist. Workshop belajar hipnotis instan super cepat dilaksanakan Minggu, 20 Februari 2011 pukul 08.00 sd 17.00 wib di Hotel Mercure Pontianak. Sehari sebelum workshop, trainer akan berbagi rahasia menangkal kejahatan mirip hipnotis dalam sebuah talkshow gratis pada Sabtu, 19 Februari 2011 pukul 18.30 wib di Toko Buku Gramedia Ayani Megamall Pontianak. Informasi & Pendaftaran: 0857 5026 1188 atau 0857 5118 9113. Diskon khusus bagi pendaftar berdua atau lebih, dan potongan 50% buku Turbo Hipnotis bagi yang memesan tiket workshop di Gramedia. (Ser)



SIGAP: Petugas keamanan sigap membantu penonton yang terjatuh saat tribun Cap Go Meh Singkawang kemarin siang ambruk.

Kecewa Anaknya Dipecat Digabung Milad

S I N G KAWAN G- O ra ng tua Amru, Ilyas Buchari mengaku kecewa, karena anaknya dipecat oleh Pemkot Singkawang, sebelum proses hukum selesai. Amru sebelumnya ditangkap Polre sta Pontianak dalam kasus kepemilikan narkoba beberapa bulan lalu. Menurutnya, seharusnya proses pemecatan dilakukan setelah proses hukum selesai. “Saat ini proses hukumnya sedang berjalan langsung dipecat,” kata Ilyas yang juga Ketua FPI Kota Singkawang. Ilyas minta penegakan hukum haruslah adil. Dia m e n c o nt o h k a n ma nt a n Camat Singkawang Barat, Bujang Ali yang juga ditahan polisi dan kejaksaan dalam kasus kepemili-

kan narkoba. Sampai saat i n i , b e l u m d i p e cat d a n menunggu proses hukumnya selesai atau memiliki kekuatan hukum tetap. “Penegakan hukum hanya untuk pejabat saja, bukan pegawai biasa,” katanya. Demikian juga Sekretaris Daerah Kota Singkawang, Suhadi Abdullani ya n g t e r s a n d u n g k a s u s p e nga d aa n t a na h t i d a k diberhentikan. “Diduga seluruh pegawai negeri disuruh membutuhkan tandatangan agar kejaksaan tidak menahannya. Kalau mau adil, biarkan proses berjalan dan bila terbukti, maka harus dinonaktifkan,” katanya. Ia berharap Badan Kepegawaian Daerah menerapkan aturan yang merata. (zrf)

HIMPUNAN Mahasiswa Islam Cabang Singkawang, akan menggelar Milad HMI ke 64. Milad HMI ini disatukan dengan peringatan Maulid Nabi Muhammad SAW. Milad dilaksanakan, Sabtu, 19 Pebruari 2011, pukul 19.30 WIB. Milad HMI dan maulid nabi akan dilaksanakan dikediaman Pengurus KAHMI Singkawang, Edy R Yacoub, di Jalan Alianyang atau rumah dinas Wakil Wali Kota Singkawang. Menurut Ketua Cabang HMI Singkawang, Yudi Ksatria kepada Pontianak Post, semua undangan untuk anggota HMI sudah disebar dan juga kepada seluruh alumni yang tergabung dalam KAHMI. “Berita ini adalah undangan resmi dari pengurus. Kita mohon maaf jika banyak yang tidak memperoleh undangan. Semua daftar yang kita miliki baik itu anggota HMI maupun KAHMI sudah kita sampaikan undangan. Tentu ada yang tak terdata, sehingga tidak diberikan undangan. Kita berharap semuanya bisa hadir,” kata dia. Sementara itu, Sekretaris KAHMI Singkawang, Sukardi kepada Pontianak Post, penceramah pada maulid nabi ini adalah dosen STAIN Pontianak, DR Syarif. (zrf)

BENGKAYANG-Jalan di Kecamatan Jagoi Babang, Kabupaten Bengkayang mengalami rusak yang cukup parah. Pemerintah diminta untuk memperbaiki jalan yang berbatasan langsung dengan negara tetangga, Malaysia. Menurut sejumlah warga kepada Pontianak Post, jalan perbatasan sejak lama mengalami kerusakan. “Kita mengalami kesulitan untuk membawa hasil bumi,” kata Andri kepada Pontianak Post, belum lama ini. Menurut dia, banyak masyarakat yang membawa hasil bumi ke Malaysia setiap Sabtu dan Minggu. “Karena kerusakan yang cukup parah mengakibatkan hasil bumi itu juga mengalami kerusakan,” kata Andri. Dia minta kepada pemerintah untuk segera memperbaiki jalan tersebut. “Kami menilai perbatasan tidak pernah diperhatikan. Padahal, jalan tersebut adalah garda depan kondisi Indonesia sebenarnya,” kata dia. Sementara itu, Bupati Bengkayang, Suryadman Gidot mengakui, kerusakan jalan perbatasan ini sering dikeluhkan oleh warga. Diakui, status jalan perbatasan adalah jalan provinsi. “Jalan tersebut berstatus jalan provinsi, bukan jalan kabupaten. Provinsi yang berhak memperbaikinya,” katanya yang mengajak Pontianak Post ke Serikin dalam kunjungan kerjanya, Jumat lalu. Gidot menjelaskan, pemerintah kabupaten dalam musrenbang provinsi seringkali menjelaskan soal kondisi jalan tersebut kepada Pemerintah Provinsi Kalbar, agar memperoleh perhatian serius. “Kita sangat bersyukur sekali, ternyata pemerintah provinsi merespon baik. Mereka pun telah menganggarkan dana untuk perbaikan jalan tersebut. Bahkan, kita dengar pemerintah provinsi menganggarkan dana dengan cara multiyear. Artinya, jalan sudah diperhatikan serius,” katanya. Dia melihat sejumlah ruas jalan sudah diperbaiki dengan cara betonisasi. “Sudah mulai dikerjakan,” kata dia. Pantauan Pontianak Post, sejumlah pekerja sudah memperbaiki jalan dengan menutupi sejumlah lubang yang mengganggu lalu lintas dan membeton sejumlah ruas jalan yang memang sangat rendah. (zrf)

Dahsyatnya Aktivasi Potensi Jenius SELAMA ini orang tua sering bingung dalam memilih sekolah, kursus, dan kegiatan lain bagi masa depan anak mereka, karena orang tua tidak tahu secara akurat karakteristik dan bakat bawaan anaknya. Untuk itu, kini, hadir metode mutakhir yang memadukan deteksi bakat bawaan anak dengan pelatihan yang dirancang khusus untuk meningkatkan potensi anak. Sebuah pelatihan dahsyat untuk putera puteri anda yang berusia 5 sd 15 tahun, metode yang

dikenal dengan nama Aktivasi Potensi Jenius (APJ), bukan sekedar aktivasi otak tengah. Solusi bagi para orang tua untuk secara akurat mendeteksi potensi karakteristik, bakat, dan kejeniusan anak. Deteksi ini bisa dijadikan panduan agar orang tua bisa mengambil sikap, langkah dan respons yang tepat bagi anak-anak mereka Metode APJ menawarkan solusi bagi para orang tua untuk secara akurat mendeteksi kejeniusan dan potensi pengembangan anak secara maksimal dengan dua langkah; Pertama, tahap menemukan (Discover), yakni untuk menemukan karakteristik dan bakat bawaan anak.

Kedua, tahap meningkatkan (Unleash) yaitu untuk meningkatkan potensi tersembunyi anak. Manfaatnya; kecerdasan meningkat (IQ bertambah), daya ingat bertambah, lebih mudah fokus dan konsentrasi, semakin semangat dalam belajar, emosi stabil dan empati meningkat, semakin mencintai keluarga, daya tahan tubuh bertambah, kecerdasan emosi dan spiritual bertambah dan intuisi serta panca indera semakin baik Tahap pertama (menemukan karakteristik dan bakat bawaan anak) dilaku-

kan melalui Dermatoglyphics Potential Response (DPR) dengan menganalisa 10 jari tangan. Akurasi hasil tes metode yang telah dipatenkan di Amerika Serikat ini mencapi 95 persen. Tahapan pertama ini dilakukan untuk mendeteksi empat hal penting, yakni: dominasi otak anak, gaya belajar bawaan anak, bakat dan potensi tersembunyi anak dan kekuatan serta kelemahan anak dan solusi bagi pengembangan diri anak. Sementara untuk tahap kedua, yaitu tahap unleash atau meningkatkan potensi

tersembunyi anak, dilakukan dengan mengikutsertakan anak dalam dua hari intensive workshop yang kaitannya mencakup: Pertama, test IQ dan memori games (untuk mendorong partisipasi dari siswa untuk menjawab teka-teki sederhana yang memerlukan fungsi kognitif dari otak kiri dan kanan). Kedua, senam koordinasi otak (senam koordinasi otak dilakukan untuk menghubungkan koordinasi dan sinkronisasi dari otak kiri dan kanan dengan menggunakan; kinestik tubuh). Ketiga, kekuatan visualisasi atau imaginasi (menggunakan tehnik imaginasi yang kreatif untuk menstim-

ulasi otak anak). Keempat, stimulasi visual dan auditory menggunakan Smart Wave System (audio gelombang alpha) untuk mengaktifkan potensi otak (thinking). Workshop ini berfungsi ibarat kunci pembuka untuk menghidupkan mesin anak. Kegiatan training ini dilaksanakan di Hotel Mercure Pontianak, 19-20 Februari 2011. Diselenggarakan oleh SMAP (SuperMind Activating & Programming) Jakarta bekerjasama dengan LP3SDM Kalbar. Informasi dan pendaftaran ke Jl. Dr. Wahidin Gg. Adyaksa No. 7 Pontianak telp. 0852 4511 1174 dan 0852 4526 4444. (ser)


20 Terigas

Solusi Pedagang Pantai Sinam

Foto: istimewa

PANTAI SINAM: Obyek wisata pantai Sinam Pemangkat begitu indah menjelang matahari terbenam.

IKATAN Pedagang Pantai Sinam (IPPS) Kecamatan Pemangkat menagih janji Pemkab Sambas untuk merenovasi pembangunan café dan kantin sepanjang pantai Sinam Pemangkat. Jumlah keseluruhan bangunan café dan kantin yang bakal direnovasi 20 unit, namun sampai sekarang belum ada realisasi. “Sampai sekarang belum ada realisasi renovasi, jadi janji tinggal janji, padahal wacana renovasi pantai sinam ini sudah terdengar sejak tahun 2008,” ungkapnya Ketua IPPS Suriansyah kepada Koran ini, kemarin. IPPS meminta kepada Dinas Kebudayaan dan Pariwisata Sambas untuk segera merealisasikan program renovasi pantai Sinam ini. Apalagi masa kepemimpinan Burhanudin A Rasyid selaku Bupati Sambas tahun ini bakal berakhir. Ia pun mengurai proses lampau, dimana pembangunan renovasi juga penah diseminarkan di tingkat kabupaten, lengkap dengan master plan, desaign gambar, rincian denah, taman, lahan parkir, dan fasilitas lainya. Selain janji yang pupus ditelan waktu, kini masalah baru kembali dihadapi para pedagang. Pasalnya lahan parkir sepanjang 300 meter akan disulap untuk jalan. “Tak lama lagi ada pelebaran jalan poros raya Sebangkau kearah Tebas, dimana pelebaran jalan memakan lahan 2,5 meter,” ungkapnya. Namun pihaknya tidak keberatan dengan pelebaran jalan asalkan Pemkab Sambas dapat memberikan solusi, terkait hilangnya kawasan lahan parkir. “Kalau kami bertahan tetap saja lahan parkir pengunjung ke pantai Sinam terkena dampak pelebaran jalan. Kita minta harus ada solusi akan hal ini,” pintanya. Apalagi dalam pelebaran jalan yang tentunya berdampak pada rumah, pagar, halaman kantin atau café, tidak ada ganti rugi hanya ada biaya santunan. Soal pelebaran jalan ini dibenarkan Camat Pemangkat M.Sherly. “Memang betul dalam waktu dekat jalan poros Sebangkau ke arah Tebas akan dilebarkan , untuk itu bagi masyarakat yang terkena pelebaran khususnya halaman, pagar untuk dapat berpartisipasi aktif pembangunan jalan sebagai amal jariah,” katanya. Terkait wacana, Dinas Kebudayaan, Pariwisata, Pemuda dan Olahraga untuk merenovasi Pantai Sinam dirinya sangat mendukung. Kalaupun rencana tersebut terealisasi kedepan Pantai Sinam Pemangkat bakal jadi aset wisata unggulan di Kabupaten Sambas. (har)

Pontianak Post


Jumat 18 Februari 2011

Noreh Karet, Wiwin Hilang Ditemukan Tanpa Nyawadi Sungai SAJAD – Warga Desa Tengguli, Sajad, Sambas Wiwin (25) yang hilang, Selasa (15/2) akhirnya ditemukan warga, kemarin (17/2) sekitar pukul 05.30 WIB tidak jauh dari lokasi yang diduga tempat tenggelam. Jenazah Wiwin dimakamkan sekitar pukul 08.00. Warga yang terus mencari akhirnya menemukan jenazah Wiwin timbul. Lokasi tersebut tidak jauh dari Kantor Camat Sajad.

“Warga telah menemukannya. Memang awalnya diduga di tempat itu Wiwin tenggelam,” kata Camat Sajad, Edi Supriadi, kemarin. Sebelumnya, warga mengetahui Wiwin pergi ke kebun untuk menoreh karet sekitar pukul 04.00. Hingga kemarin, warga belum menemukannya. Hanya sampan yang digunakan Wiwin ditemukan oleh orang tuanya. “Orang tuanya Alfian mencari ke kebun, tapi hanya menemukan sampan yang digunakannya saat pergi dari rumah,” kata Kepala Kepolisian Sajad, Ipda Yustendi, kemarin.

Dar i keterangan Alfian, anaknya setiap hari pergi menoreh menggunakan sampan. Sebelum sore biasanya Wiwin sudah kembali dari kebun. Pulang dan pergi ke kebun Wiwin kerap menggunakan sampan. Karena tidak pulang hingga pukul 17.00, Alfian dan warga mencari Wiwin dengan menelusuri jalur yang biasa digunakannya ke kebun. Namun hanya sampan yang digunakannya ditemukan warga. Wiwin raib. “Warga langsung melapor ke polsek, setelah itu polisi dan

warga mencoba mencarinya. Karena hari sudah larut, pencarian dihentikan sementara karena hasilnya nihil. Dan dilanjutkan lagi hari ini,” paparnya. Karena menggunakan sampan dan menempuh jalur sungai, yakni Sungai Sambas Kecil warga berasumsi Wiwin tenggelam. Dugaan itu diperkuat karena warga Dusun Sawang Rt 15 Rw 04, Desa Tengguli ini memiliki riwayat penyakit ayan. Camat Sajad Edi Supriadi mengatakan, pencarian korban tetap dilakukan. Warga bahu-membahu untuk menemukan Wiwin.

Selain pencarian di sepanjang jalur yang dilaluinya, warga juga mencoba menghubungi warga lain di sepanjang Sungai Sambas Kecil. Barangkali saja ada barang Wiwin atau bahkan jasadnya ditemukan. ”Kemarin (Selasa) pencarian dilakukan terus hingga malam hari. Berbagai macam cara dilakukan untuk mencari Wiwin. Ada yang menggunakan pengait, kail, jangkar dan ada juga yang menggunakan jala serta jaring dilokasi yang diduga tempat tenggelamnya Wiwin,” jelasnya. (hen)

Malam Pembukaan PSMBS

25 Peserta Tampil Pukau Masyarakat PEMANGKAT—Pembukaan malam Pagelaran Seni Musik dan Budaya Sambas (PSMBS) di Pemangkat memukau ratusan masyarakat Kota Pemangkat, Rabu (16/2). Dengan menampilkan band-band bergenre melayu, masyarakat disuguhkan nyanyian khas melayu, dan seluruh peserta diwajibkan menggunakan pakaian khas melayu Sambas. Kegiatan yang dipusatkan di terminal

Pemangkat ini dibuka secara langsung oleh Anggota DPRD Kabupaten Sambas, Giffarian, yang dihadiri seluruh kepala desa dan unsur muspikan Pemangkat. Pagelaran ini demi melestarikan seni dan budaya melayu, jangan sampai kecintaan generasi muda terhadap budaya melayu ini memudar seiring berjalannnya waktu. “Saya harap dengan pagelaran seni musik dan budaya Melayu Sambas ini da-

pat meningkatkan kecintaan kita terhadap nilai-nilai budaya kita sendiri,” ungkapnya dihadapan seluruh peserta dan masyarakat yang hadir. Pihaknya sendiri selaku wakil rakyat, kata dia, terus mendorong gerakan cinta budaya digalakkan. Jangan sampai, kata dia, budaya Sambas hilang tertelan zaman akibat tidak ada lagi generasi penerus yang mencintainya, memaink-

Harry/Pontianak Post

MEMUKAU: Malam pembukaan Pagelaran Seni Musik dan Budaya Sambas (PSMBS) di Pemangkat begitu meriah dan memukau.

1.000 Buku untuk Desa Perbatasan

SAMBAS – Lima desa di Sambas mendapat bantuan 1.000 eksemplar buku dengan 500 judul. Bantuan tersebut merupakan bagian dari gerakan Kalbar membaca dari Pemerintah Provinsi Kalbar. Lima desa menjadi sasaran penyerahan bantuan buku itu yakni Desa Santaban, Desa Kalia’u Kecamatan Sajingan Besar, Desa Malek Kecamatan Paloh, Desa Galing Kecamatan Galing dan Desa Sarang Burung Usrat Kecamatan Jawai. Secara simbolis penyerahan Ingin Pasang Iklan? bantuan itu digelar di Kantor BIRO SAMBAS Arsip dan Perpustakaan Daerah Hub : Kab Sambas, Kamis (17/2) diRabbul 0813-4554-1441

annya, memahaminya. Karena kenyataan sekarang anak muda lebih mecintai musik modern. Hal ini disebabkan arus globalisasi yang berdampak pada pola piker masyarakat. “Untuk mengimbangi inilah, pagelaran budaya seperti ini patut terus digalakkan dan diperbanyak, agar arus modernisasi saat ini bisa disaring melalui budaya lokal,” ujarnya. Diharapkan seluruh masyarakat pun bisa lebih memberikan pemahaman pentingnya mencintai budaya lokal kepada generasi muda. Sementara itu, Ketua Panitia PSMBS, Habibi, jumlah peserta yang mengikuti peserta ini sebanyak 25 peserta, dengan diselingi rangkaian penampilan sanggar seni dari Pemangkat dan Sambas. “Penampilan mereka akan dinilai dewan juri, dan hasilnya akan diumumkan saat penutupan tanggal Sabtu malam,” katanya. Salah satu warga, Jainudin (36) warga Sinam, mengungkapkan kekagumannya terhadap penampilan sejumlah peserta yang tampil perdana dalam malam pembukaan. Menurutnya anak muda saat ini masih ingat dengan lagi lokal, serta mereka piawai memainkannya dengan alat musik modern. “Sangat bagus, mudah-mudahan lebih banyak lagi pesertanya yang tampil demi lestarinya budaya Sambas,” ucapnya. Selama ini, kata dia, kebanyakan acara pagelaran musik didominasi musik modern seperti pop. Dengan acara ini diharapakan generasi muda mengetahui kebudaya asli lokal sehingga tidak punah ditelan zaman. (har)

saksikan langsung Kepala Unit Pelayanan Perpustakaan Kalbar, Untad Dharmawan dan Kepala Kantor Arsip dan Perpustakaan Daerah H Abdul Manan. Untad Dharmawan mengatakan, tujuan program salah satunya mewujudkan pencanangan gerakan Kalbar membaca yang telah dirintis Gubernur Kalbar. “Salah satu langkahnya dengan bantuan buku ini. Sebagai perhatian Pemprov Kalbar terhadap rendahnya SDM di provinsi ini. Indeks prestasi manusi Kalbar masih rendah karena minat bacanya rendah juga,” katanya. Program Penyerahan bantuan buku ini lanjutnya, menjadi cikal bakal berdirinya perpustakaan desa. Upaya ini merupakan semangat mewujudkan peningkatan minat

baca masyarakat desa serta sebagai bagian pencerdasan bangsa. “Kita akui ini tidak semudah yang dibayangkan, tentunya dalam perjalanannya akan didapatkan halangan dan hambatan. Ini harus didukung penuh pemerintah daerah, pemerintah kecamatan serta pemerintah desa dan masyarakat itu sendiri, hambatan jangan dijadikan alasan, tetapi dijadikan tantangan untuk memajukan masyarakat,” paparnya. Untad mengungkapkan, program ini pada 2010 meliputi sekitar kurang lebih 50 desa. Khusus kabupaten perbatasan mendapatkan jatah masing-masing lima desa. Sedangkan ditahun 2011 ungkap dia direncanakan sekitar 75 desa. “Kabupaten Sambas

direncanakan mendapat bantuan untuk tujuh desa lagi. Ini sebagai stimulan, kita berharap semua desa di Kalbar mendapatkan bantuan buku dan ada perpustakaan desanya, tapi bertahap karena masalahnya adalah terbatasnya pendanaan. Sehingga sekarang ini kita masih memprioritaskan sasarannya,” katanya. Kepala Kantor Arsip dan Perpustakaan Daerah Abdul Manan mengucapkan terima kasih kepada Pemprov Kalbar. Menurut dia langkah itu merupakan upaya tepat membuka akses informasi bagi masyarakat di desa. “Pemkab Sambas sangat mendukung kegiatan ini. Pastinya bermanfaat untuk mengembangkan SDM di desa terutama wilayah perbatasan,” tuturnya. (hen)

Pontianak Post

Jumat 18 Februari 2011



Kamboja Mundur dari Ketua DPRD


Salurkan Hobby Automotif MENYALURKAN bakat dan minat sejumlah pemuda yang tergabung dalam komunitas balap motor Kendawangan, dalam sebulan terakhir melakukan latihan di Pantai Jambat Desa Mekar Utama Kecamatan Kendawangan. Kegiatan ini dilakukan hampir setiap hari pada waktu petang. “Apalagi pada hari Sabtu lokasi itu dipadati pengunjung,” kata Sy Razali, tokoh pemuda Mekar Utama. Pemuda yang akrab dipanggil Jali ini mengaku salut kepada para pemuda yang mau bergotong royong menyiapkan lokasi. Walaupun dengan alat yang sederhana untuk menebas dan membersihkan lokasi tersebut guna menyalurkan bakatnya dibidang automotif. Dipilihnya lokasi itu dianggap baik, daripada mereka melakukan kebut-kebutan di jalan raya.. Dengan ada sarana untuk menyalurkan bakat seperti itu, maka bisa mereka salurkan untuk latihan. “Tinggal pembinaan dari pemerintah atau dari pihak swasta agar potensi ini bisa dikembangkan,” katanya. Gotong royong para pemuda membersihkan lahan untuk latihan itu juga mendapat apresiasi dari Ramses S, mantan Ketua DPC PDIPerjuangan. Salah satu pemilik lokasi di Pantai Jambat ini tak keberatan lokasi tersebut dipakai untuk ajang grasstrack anak-anak muda Kendawangan. Bahkan, dirinya sangat mendukung sekali kegiatan positif anak-anak muda Kendawangan untuk mengembangkan potensi yang dimilikinya. Pengembangan potensi itu, kata dia bisa sinergis dalam meningkatkan kepariwisataan di daerah ini. Bahkan, lokasi ini juga dinilai bagus untuk kegiatan bola voli pantai. Pihaknya mendukung kalangan muda Kendawangan yang mau mengembangkan bakat dan minat yang positif. (idn)

cap go meh

Terapkan Hidup Kelinci Bupati Ketapang, Henrikus mengatakan di tahun kelinci ini, diharapkan masyarakat hidup laksana kelinci. Hidup bersih, baik, tidak pernah berkelahi dan selalu damai dalam hidup berdampingan di masyarakat. “Shio di tahun Chines ini, adalah kelinci, dimana hewan ini biasa hidup bersih, baik, tidak berkelahi dan suka berdampingan di kehidupan bermasyarakat. Marilah kita bisa terapkan hidup kelinci itu,” dikatakan Henrikus, saat menyaksikan atraksi naga dan barongsai dalam perayaan Cap go Meh di Ketapang, kemarin. Bupati dalam kesempatan itu, terkait dengan perayaan Cap Go Meh menegaskan bahwa selaHenrikus ma budaya itu tidak bertentangan dengan aturan negara. Ke depannya akan dijadikan budaya itu sebagai salah satu daya tarik daerah ini. “Selama budaya itu diakui negara, harus dilesatarikan sebagai potensi daerah untuk menarik wisatawan. Nantinya akan dirangkai dengan kebudayaan lain yang ada,” kata Bupati. Henrikus pun merasa bangga. Bagaimana dalam perayaan Imlek maupun Cap Go Meh di Ketapang. banyak juga warga non Tionghoa ikut berpartisipasi dalam rangkaian kegiatan itu. Sehingga kebersamaan seperti yang terjadi, perlu untuk dikembangkan ke depannya. “Mari mulai saat ini kita jadikan imlek dan Cap Go Meh menjadi penyumbang wisata budaya Ketapang,” kata Henrikus. Karena budaya, ditambahkan Henrikus, adalah alat pemersatu daerah dan bangsa. Semua budaya yang tidak bertentangan dengan aturan negara, Bupati berjanji akan memberikan dukungan sepenuhnya. (fah) Iklan sebuah sarana yang paling efektif dalam memasarkan sebuah produk.. Contact person:


(0534) 35514

Andi Chandra/Pontianak Post

TATUNG: Atraksi tatung juga smepat singgah di kediaman rumah Henrikus jalan KH Wahid Hasyim, pada Kamis pagi.

Keliling Kota, Tatung Singgah ke Rumah Bupati KETAPANG -- Perayaan Cap Goh Meh di Ketapang ditandai juga dengan atraksi tatung keliling kota. Bahkan tatung sempat melakukan atraksi di depan kediaman Bupati Ketapang. Hadirnya tatung di depan rumah kediaman Bupati juga disaksikan Ny Riniwati Henrikus. Adanya atraksi tatung tersebut disambut baik oleh Ketua TP PKK Kabupaten Ketapang ini. Kedatangan tatung di depan rumahnya itu dianggap sebagai wujud

penghormatan. Walaupun Cap Goh Meh tak semeriah tahuntahun lalu, namun kebersamaan ini harus terus dipertahankan. Menurut Ny Riniwati Henrikus adat budaya merupakan asset wisata. Oleh karenanya itu harus dipelihara dan jaga dengan baik. “Kebersamaan dalam perayaan Imlek ini harus terus kita pupuk,” kata Ny.Riniwati Henrikus. Atraksi tatung keliling Kota Ketapang ini menjadi perhatian

masyartakat. Tak pelak, ruas jalan yang dilalui dan sekitar kelenteng pun menjadi macet. Para tatung yang melakukan atraksi itu beragam, Mereka unjuk kebolehan pada senjata tajam. Atraksi tatung kian menjadi-jadi tak kala gendang dengan semangat ditabuh secara terus menerus. Mengatasi kemacetan jalan, maka sebagian besar aparat keamanan sibuk mengatur lalu lintas. (idn)

RAT Sangat Penting bagi Koperasi KETAPANG – Koperasi Serba Usaha Gumapan yang dibentuk 29 April 2009, akhirnya berhasil melaksanakan rapat anggota tahunan (RAT) kedua 14 F ebruari 2011. RAT tutup buku tahun 2010, dilaksanakan di SDN 2 Sui Awan Kiri Kecamatan Muara Pawan yang dihadiri Kepala Dinas Koperasi UMKM dan Perindustrian Kabupaten Ketapang Drs H Syahrani serta Kasi Koperasi, Hairol Anwar. Selain itu hadir juga UPPK dan Sekretaris Kecamatan (Sekcam) Muara Pawan, dan para anggota koperasi yang berjumlah 119 orang. RAT yang berlangsung secara kekeluargaan itu dipimpin Ketua Koperasi Gumapan Jamjami, S.Pd. Ia mengatakan hingga saat ini Koperasi Gumapan telah memiliki anggota 173 orang yang berstatus sebagai tenaga guru dan jajaran UPPK Muara Pawan. RAT ini dilaksanakan selain merupakan kewajiban yang harus dilakukan KSUjuga sebagai bentuk tanggungjawab pengurus dalam mengelola koperasi selama tahun 2010. “Kita akan melaporkan aspek kelembagaan, usaha, permodalan dan keuangan,” kata Jamjami. Ketua KSU Gumapan ini juga menambahkan untuk sementara ini, mereka baru bergerak dibidang simpan pinjam. Ke depan, Insya Allah kita akan mengembangkan usaha di unit yang lain. Hingga saat ini perputaran kas berkisar Rp181 juta. Dana tersebut berasal dari simpanan anggota Rp131 juta. Bantuan dari Kementerian Koperasi Rp50 juta. Sementara itu Kepala Dinas Koperasi UMKM dan Disperindag Kabupaten Ketapang, H Syahrani menegaskan pelaksanaan RAT

sangatlah penting bagi koperasi. Karena salah satu cara untuk menilai sebuah koperasi apakah sehat dan berkembang dari pelaksanaan RAT. Selain itu Kepala Dinas Kopersi dan UMKM ini juga memberikan apresiasi kepada KSU Gumapan. Karena tidak semua koperasi yang ada di Kabupaten Ketapang ini melaksanakan RAT. Padahal diketahui telah memberikan teguran dan instruksi kepada koperasi agar melaksanakan RAT. “Saya harap kedepan supaya Gumapan bisa mengembangkan usaha –usaha koperasi pada ke sector yang lainnya seperti waserda, perbengkelan dan lain-lain,” kata H Syahrani. Menurut dia Koperasi Gumapan telah memiliki anggota yang cukup banyak dan aktif. Sementara itu Thamrin, S.Ag selaku Badan Pengawas Koperasi Gumapan menambahkan kinerja dan pencapaian yang dilakukan Koperasi Gumapan dinyatakan cukup bagus dan memperlihatkan perkembangan yang baik. Thamrin menyebutkan ini dapat kita lihat dari meningkatnya SHU dari tahun 2009. Dari Rp3.500.000 menjadi Rp 22.595.000. Selain itu Gumapan juga telah menunjukkan prestasinya ditingkat kabupaten karena pada tahun 2010 Gumapan mewakili Kabupaten Ketapang sebagai koperasi terbaik guna untuk menerima

penghargaan tingkat Provinsi dari Gubernur Kalbar. “Selaku Badan Pengawas ia meminta Pengurus Koperasi Gumapan harus mengoptimalkan pelayanan dan melakukan langkah-langkah pengembangan serta penguatan kelambagaan sesuai dengan kemampuan lembaga,” kata Thamrin. Ia mengucapkan terima kasih kepada para anggota yg telah mempercayai gumapan untuk mengelola simpanan yang dititipkan kepada lembaga Koperasi. Ia memberikan penghargaan setinggi-tingginya kepada anggota kopersi, karena sebagaimana diketahui anggota Koperasi sebagai modal utama dari koperasi. Maju mundurnya kinerja koperasi ditentukan oleh peran aktif anggota . Masih belum bisa memberikan pelayanan yang optimal dan memenuhi semua pemintaan anggota, maka ia memohon maaft. Menurut Thamrin, hal ini dikarenakan masih minimnya modal yang dimiliki. “Kita ucapkan terima kasih Dinas Koperasi dan UKM Disperindagkop yang telah banyak memberikan bantuan, baik berupa pembinaan, bimbingan maupun permodalan, mudah-mudahan kedepan Dinas Koperasi dan UKM Perindustrian dan Perdagangan tetap bisa memberikan kontribusi kepada kami,” kata Thamrin menuntaskan. (idn)

KETAPANG- Berdasar ha- rapat pleno. “Tanggal 2 atau sil rapat DPP Partai Golkar, 3 Maret akan kita gelar rapat Gusti Kamboja akhirnya pleno. Juga akan dihadiri bersedia mengundurkan DPP,” kata Yasyir, Kamis diri dari posisi Ketua DPRD (17/2). Ketapang. Kesepakatan itu Menurut Yasyir, kesepakatertuang dalam kesepakatan tan tersebut, diharapkan Golpenyelesaian permasalahan kar di Kabupaten Ketapang organisasi DPD Partai ber- akan semakin utuh. Tentulambang pohon Februari nya berharap permasalahan 2011. seperti itu tidaklah terulang Terdapat tujuh poin kes- kembali. “Kesepakatan ini epakatan dalam surat yang juga akan menjadi rujukan ditandatangani Gusti Kam- dalam penyelesaian masalah boja (GK) dan Yasyir Ansyari. ke depan,” kata Yasyir. Pertama, GK mengundurkan Saat ditanya apakah ada diri sebagai Ketua DPRD k a i t a n n ya p e n y e l e s a i a n Kabupaten Ketakisruh di Partai pang. Kedua, GK Golkar Ketapang mencabut gugaada kaitannya tan perdata yang dengan Pilgub. ditujukan ke Ya s y i r m e n g u Partai Golkar di tarakan sekarang Pengadilan Negbelum berfikir kea eri. Ketiga, DPD rah itu. Tetapi baGolkar Ketapang gaimana melakmempertahanksanakan hasil kesan GK sebagai epakatan terseanggota Fraksi but. Pa r t a i G o l k a r Sementara itu, (FPG). Ke emGK, hingga saat ini pat, DPD Golkar belum dapat dimYasyir Ansyari m e n e mp at k a n intai konfirmasi kembali sebagai terkait kesepakaketua harian. Kelima, DPD tan tersebut. Kisruh internal Golkar Provinsi menyem- partai Golkar, memang sanpurnakan kepengurusan gat panjang. Hingga pecat DPD Golkar Ketapang. memecat pun terjadi dalam Ke enam, menyepakati tubuh partai itu. GK, yang Yasyir Ansyari selaku peng- menjabat Ketua Harian DPD ganti antar waktu Ketua Golkar Ketapang masuk daDPRD Kabupaten Ketapang lam daftar yang dipecat. periode 2009-2014. Ke tujuh, Karena merasa tidak puas, seluruh butir kesepakatan GK pun mengajukan gugadilaksanakan selambat-lam- tan ke Pengadilan Negeri batnya 28 Februari 2011. Ketapang. Mediasi di tingkat Penandatanganan di atas pengadilan sempat menmaterai tersebut disaksikan emui jalan buntu sampai Theo L Sambuaga, Wakil akhirnya kedua belah pihak Ketua Umum DPP Golkar, yang bertikai sepakat menH Morkes Effendi, Ketua gakhiri kemelut. DPD Golkar Propinsi Kalbar, Wakil Ketua DPRD KetaAdang Gunawan, Sekretaris pang Budi Mateus menDPD Golkar Provinsi Kal- gatakan, jika pergantian bar. Ketua DPRD Ketapang akan Yasyir Ansyari, Ketua DPD tetap dijalankan sesuai denGolkar Ketapang, mengaku gan prosedur yang ada dan menyambut baik kesepaka- tetap mengaju pada PP tan tersebut. Yasyir juga No.16 tahun 2010 dan Tatip menunggu pihak GK untuk DPRD Ketapang,tentang mesecepatnya melaksanakan kanisme pergantian Ketua hasil kesepakatan terse- DPRD Ketapang ini. ‘’Kita but. Direncanakan untuk tetap akan jalankan, tapi penyempurnaan hasil kes- harus sesuai prosedur dan epakatan tersebut, DPD Gol- mekanisme yang ada,’’ kata kar berencana menggelar Budi. (fah)


RAT: Kepala Dinas Perindustrian, Perdagangan, Koperasi, UKM dan Penanaman Modal Kabupaten Ketapag hadir dalam RAT Koperasi Gumapan.



Pontianak Post

Kelompok Tani Terima Ternak Bantuan dan APPO


Dukung Rencana Kodim Ketapang KETAPANG-- Ketua DPRD Ketapang, H Gusti Kamboja menyatakan menyambut baik adanya rencana dari Kodim 1203 Ketapang menyebar pasukan untuk menelusuri adanya dugaan pelanggaran distribusi Bahan Bakar Minyak (BBM) di kabupaten ini. “Ini sebagai bentuk keterlibatan TNI terkait permasalahan yang ada di masyarakat dan membantu petugas. Diantaranya akan m e la ku ka n p e n e r tiban terhadap SPBU, calo, dan kios BBM nakal. Ia mengatakan i t u m e ma n g s u d a h tugas TNI membantu Gusti Kamboja aparat lain. Menurut Gusti Kamboja, jika ada keinginan dari TNI ada. Haruslah disambut dengan baik. Karena kalau ada informasi masyarakat tentang penyalahgunaan. Tentunya itu haruslah disikapi dengan serius. Begitu juga dengan masyarakat. Jika mengetahui silakan laporkan saja. “Menurut saya, itu tidak perlu lagi ada surat permohonan. Karena ini berkaitan dengan masyarakat yang sudah begitu resah, apalagi jika memang BBM yang disalahgunakan adalah BBM bersubsidi,” kata Gusti Kamboja. Kalaupun perlu, lanjut GK, rencana tersebut seharusnya bisa dilaksanakan secepatnya. Dalam pekan ini misalnya, segera itu dilaksanakan. Kemudian ditunggu apakah ada perubahan atas kejadian ini. “Kalau tidak ada perubahan, sudah selayaknya kita akan bentuk tim khusus menangani permasalahan BBM,” kata Gusti Kamboja. Sebelumnya, Komandan Komando Distrik Militer (Kodim) 1203 Ketapang, Letkol Inf, Agus Prasetyo, pihaknya sekarang ini telah menyebar puluhan anggotanya di lapangan untuk mencari titik permasalahan kelangkaan BBM jenis premium di kota ini.Terlebih lagi, Agus mengatakan telah mendengar informasi yang telah berkembang di masyarakat adanya kencingnya BBM dari sebuah kapal penadah yang diduga di tempat tidak resmi. “Guna mengecek kebenaran dari informasi tersebut, saya telah mengirim anggotanya ke lapangan untuk mencari kebenaran atas informasi itu,” dikatakan Agus, kepada wartawan. Menurut Agus, persoalan kelangkaan serta tingginya harga eceran bensin di pengecer. Sudah seharusnya mendapat perhatian serius dari polisi, pemda, dan TNI. Sehingga tidak boleh membiarkan hal itu, terjadi dalam waktu lama. “Karena TNI tidak mungkin bergerak sendiri. Sehingga masih menunggu kerja sama dari semua pihak,” kata Dandim 1203 Ketapang. Penertiban bisa dilakukan pihak TNI. Tetapi ada dasar yang kuat untuk melakukan penertiban langsung dan tidak harus menunggu lama lagi seperti ini. Misalkan surat permohonan dari Pemda. (fah)

Jumat 18 Februari 2011

tas/humas KKU

BANTUAN: Secara simbolis Wakil Bupati Kayong Utara, Ir. H. Muhammad Said menyerahkan ternak bantuan dan APPO kepada Kelompok Tani.

Rencanakan Aksi Turun ke Jalan Bensin Langka dan Mahal KETAPAN G-- Ke ke s a l a n masyarakat akan susahnya dapatkan dan mahalnya bensin khususnya, sudah mulai memuncak. Atas kejadian itu, direncanakan Senin (21/2) mendatang ratusan mahasiswa akan menggelar unjuk rasa. Ketua Himpunan Mahasiswa Islam (HMI) Kabupaten Ketapang, Adang Hamdan menyebutkan ini merupakan bentuk kekesalan. Dimana ada unsur pembiaran yang menimbulkan kelangkaan bensin atau premium. Serta tingginya harga premium di kelas pengecer. “Ini sebagai bentuk protes terhadap aparat, karena seakan ada

pembiaran lonjakan harga premium yang mencapai Rp7-8 ribu per liternya di pengecer,” kata Adang Hamdan, Rabu (16/2), di markas HMI Kabupaten Ketapang. Menurut Adang, rencana aksi kali ini khusus hanya melibatkan mahasiswa. Diharapkan dengan aksi turun ke jalan nantinya bisa merubah keadaan ini. Kalaupun selanjutnya tidak ada perubahan. Direncanakan akan melibatkan lebih banyak lagi masa yang juga berasal dari luar mahasiswa. “Mahasiswa juga mempunyai dasar, dimana sebelumnya sudah melakukan pantauan di Stasiun Pengisian Bahan Bakar Umum, persisnya sejak dua bulan terakhir,” tegas Adang. Atas temuan mahasiswa juga,

lanjut Adang, diduga ada indikasi kecurangan. Dimana SPBU lebih mengutamakan melayani pengisian menggunakan jeriken dan drum. Ataupun memakai tangki kendaraan yang dimodifikasi. “Diharapkan kepada aparat penegak hukum untuk bisa mengambil tindakan atas kejadian itu,” kata Adang. Para mahasiswa pun juga memperkirakan, lanjut Adang, kelangkaan masih akan terus terjadi, jika kondisi ini dibiarkan berlarut-larut. Karena setiap harinya, mobil, jeriken serta drum selalu memenuhi SPBU. Unjuk rasa yang akan dilakukan, lanjut Adang, pertama kali di Mapolres Ketapang. Kemudian ke kantor DPRD dan diakhiri di kantor Pemkab Ketapang.(fah)

Mapolres Tangkap 30 Drum BBM KETAPANG- Kamis (17/2), sore sekitar pukul 17.30 wib. Jajaran Mapolres mengungkap penangkapan sebanyak 30 drum BBM, terdiri dari 25 drum bensin, dan lima drum jenis solar dari sebuah truck bernomor D 8139 di Kecamatan Benua Kayong. Guna penyelidikan lebih lanjut, barang bukti tersebut beserta sopir dan kernet digelandang ke Mapolres Ketapang. Kasat Reskrim Polres Ketapang, AKP Temangnganro Machmud, penangkapan yang dilakukan berdasarkan informasi dari masyarakat. Dimana puluhan drum BBM itu rencananya akan dibawa ke Keca-

matan Kendawangan. Namun, saat berada di Kecamatan Benua Kayong, petugas sudah terlebih dahulu memergokinya. “Petugas selanjutnya melakukan pemeriksaan, baik surat izin atau surat lainnya. Tetapi untuk pemeriksaan lebih lanjut, sopir, kernet serta barang bukti dibawa ke Mapolres Ketapang,” kata Temangnganro, Kamis (17/2). Setelah diperiksa, lanjut Temangnganro, jika tidak bisa menunjukkan surat keterangan. Akan dikenakan pasal 53 huruf b jo pasal 23 ayat (2) huruf b UU No 22 tahun 2001 tentang migas. Sementara itu, Ridwan, supir truk pengangkut BBM mengakui

bahwa BBM yang dibelinya dari SPBU di DI Panjaitan akan dibawa ke Kecamatan Kendawangan. Ridwan pun hanyalah supir suruhan saja. “BBM ini milik Pak Is warga Kampung Sukun, Kendawangan, saya hanya mengambil upah angkut saja,” aku Ridwan. Pengangkutan BBM ini, lanjut Ridwan, memang sudah biasa dilakukan. Hampir setiap seminggu sekali, Ridwan mengaku membawa ke Kendawangan. Harga per drum nya, diakui Ridwan, berharga Rp900 ribu. Kemudian dirinya pun mengaku berbekal surat rekomendasi camat.(fah)

SUKADANA--Warga kel- mengatakan disektor peterompok tani dari beberapa nakan KKU memiliki potensi desa yang ada di Kecama- yang cukup baik untuk dikemtan Sukadana, pada Kamis bangkan baik ternak besar dan (17/2) kemarin di Kantor Desa ternak kecil. Untuk ternak sapi Benawai Agung Sukadana, dan kambing, KKU menjadi pesecara simbolis menerima masok untuk Kabupaten Ketapenyerahan ternak bantuan pang dan Pontianak, terutama dan Alat Pembuat Pupuk Or- pada saat lebaran Idul Fitri ganik (APPO). Penyerahan dan Idul Adha. ”Disamping tersebut dilakukan langsung itu, untuk kebutuhan daging Wakil Bupati Kayong Utara, Ir di KKU tidak mendatangkan H Muhammad Said. lagi dari luar artinya KKU sudah Ternak bantuan yang dis- bisa mencukupi kebutuhan erahkan diantaranya sep- daging dari daerahnya sendiri,” erti Sapi Peranakan Ongole jelasnya. (PO), kambing Ettawa, itik Sebagai gambaran untuk dan ayam. Sementara itu ban- tahun 2010 ini katanya, KKU tuan ini berasal dari APBN dan mencatat sebanyak 435 sapi APBD provinsi maupun kabupaten. Ternak sapi dari APBN berjumlah 95 ekor yang diserahkan di tiga desa di Kecamatan Pulau Maya Karimata Disamping itu, untuk (PMK), yakni Desa Satai Lestari dan Desa Kamboja kebutuhan daging di mendapat bantuan sapi seKKU tidak mendatangbanyak 50 ekor dan Desa Payak Itam juga menerima kan lagi dari luar artinya bantuan sebanyak 45 ekor. KKU sudah bisa mencuUntuk bantuan sapi dari kupi kebutuhan daging APBD Provinsi yang diserahkan ke Desa Dusun Kecil dari daerahnya sendiri Kecamatan PMK sebanyak Muhammad Said 34 ekor. Sedangkan bantuan ternak sapi dari APBD kabupaten sebanyak 22 ekor yang yang keluar dari Kayong Utara. diberikan ke Desa Benawai Sedangkan yang dipotong Agung dan Medan Jaya Ke- (yang tercatat) sebanyak 397 camatan Sukadana masing- ekor. Jadi total ternak sapi yang masing sebanyak 11 ekor. keluar dan dipotong tahun Sedangkan Desa Sedahan 2010 adalah 832 ekor. Jaya Kecamatan Sukadana Pengadaan ternak sapi baik mendapat bantuan ternak dari APBD Kabupaten Kayong kambing dari APBD kabupaten Utara, APBD Provinsi Kalimansebanyak 22 ekor. Selanjutnya, tan Barat dan dana APBN adasebanyak 200 ekor ternak itik lah dalam rangka mengimbangi dari APBD provinsi diserahkan angka pemotongan ternak dan ke Desa Mentubang dan untuk jumlah ternak sapi yang keluar Desa Pulau Kumbang men- setiap tahunnya. Oleh karenanerima 500 ekor ternak ayam. ya, hal ini dimaksudkan untuk Selain bantuan APPO sebanyak mendukung menyukseskan 15 unit yang berasal dari DAK program Pemerintah yaitu diserahkan kelima kecamatan Program Swasembada Dagyang ada di KKU, juga terdapat ing Sapi dan Kerbau (PSDSK) bantuan berupa Bio Gas seban- Nasional 2014, dimana pada yak empat unit yang diberikan pada saat itu diharapkan  Inuntuk Kecamatan Seponti dan donesia sudah bisa mencukupi Kecamatan Sukadana masing- kebutuhan daging sebanyak masing sebanyak dua unit. 90 persen dari produk daging Dalam sambutannya, Said lokal. (tas/hms)

Pontianak Post


Jumat 18 Februari 2011

Kesan Mendalam Sambungan dari halaman 17

berbagai etnis selalu mengutamakan musyawarah dan koordinasi dengan muspika untuk mendapatkan masukan-masukan demi terlaksananya kegiatan,” kata Drs Anwar MM. Setelah empat tahun berturut-turut Imlek bersama di Sandai dilaksanakan, tahun ini diputuskan dilaksanakan di lapangan terbuka dan mengundang muspida

menghadiri acara tersebut. Kebersamaan antara panitia, tokoh masyarakat dan instansi pemerintah maupun swasta dalam memeriahan acara ini. Begitu juga respon yang baik dari semua kalangan dalam mendukung acara dan menciptakan suasana kondusif di masyarakat. Spontanitas masyarakat berbagai etnis yang menyambut kedatangan rombongan Muspda mencerminkan kebersamaan yang ada pada masyarakat Sandai.

Gaet Wisman Sambungan dari halaman 17

”Ternyata turis mancanegara terkesan dengan keindahan alam seperti ini,” kata Yudo Sudarto SP, M.Si. Menurutnya,selain itu kawasan Hutan Kota juga berfungsi untuk perlindungan dari berbagai masalah lingkungan perkotaan. Belum lama ini, Kadis Bud-

parpora Ketapang bersama dua orang turis asal Inggris melakukan kunjungan ke objek wisata hutan kota tersebut. Dengan adanya Hutan Kota ini, diharapkan dapat memberikan suasana Kota yang nyaman sehat dan indah (estetis) sehingga juga dapat dijadikan sebagai salah satu objek dya tarik wisata. (idn)

Keadaan seperti ini, kata Drs Anwar MM mesti dapat dipertahankan dan ditingkatkan demi terwujudnya masyarakat yang adil dan sejahtera di Ketapang umumnya, dan di sandai khususnya. Kondisi kondusif ini tercipta di Kecamatan Sandai ditengah-tegah derasnya informasi berbagai media tentang kerusuhan, kekerasan di berbagai daerah di Indonesia. Sebagai camat Sandai mengucapkan terima kasih kepada semua puhak yang telah berpartisipasi dan mendukung terlaksananya perayaan Imlek bersama di sandai dengan sukses dan meriah. Bupati Ketapang dan Muspida serta ketua DPRD Ketapang yang telah meyempatkan waktu hadir pada acara ini meskipun dilaksanakan pada hari libur (sabtu malam), memberikan kesan mendalam baginya. Begitu juga ungkapan terima kasih disampaikannya kepada manajemen perusahaan yang ada di Sandai dan semua donatur

yang tak dapat disebutkannya satu persatu. “Terima kasih khususnya kepada panitia penyelenggara yang telah mampu memaksimalkan semua sumber daya menjadi sebuah kekuatan yang menakjudkan sehingga teralisasi sebuah kegiatan spektakuler yang menjadi apresiasi dari bapak bupati dan jajaran Muspida Ketapang,” kata Drs Anwar MM. Ia berharap, mudah-mudahan kegiatan ini bisa menjadi cermin semua pihak bahwa perbedaan yang ada seharusnya adalah kekayaan yang luar biasa besarnya jika dikelola dengan benar. Tuhan menciptakan perbedaa umat agar menjadi hubungan saling membutuhkan. Jangan pernah menyelesaikan sebuah persoalan perbedaan dengan kekerasan. Budaya warisan leluhur dalam musyawarah dan mufakat. Di Sandai dan Kabupaten Ketapang bisa tercipta seperti itu. (idn)

Patuhi SKB Sambungan dari halaman 17

Ahmadiyah jangan berbuat anarkis dan warga Ahmdiyah dikabupaten landak mentaati SKB yang sudah dikeluarkan pemerintah. Diantaranya tidak menyebarkan ajaran ahmadiyah

kepada umat islam. Ketika ditanya tindakan tegas jika ternyata ada penyebaran ajaran ahmadiyah Mudjazie memberikan penjelasan bahwa menyebarkan yang dimaksud artinya mendakwahkan secara terbuka, tetapi jika pertemuan antara jamaah

secara personal tentu mereka tidak menyebarkan secara terbuka. Tetapi Mudjazie menegaskan akan melakukan pengawasan dan kroscek mengenai kebenaran keberadaan jamaah ahmadiyah serta mengecek kebenaran penye-

baran ajarannya. “Kami menghimbau kepada masyarakat agar bisa bekerjasama dengan kementerian agama dan kepolisian untuk menetralisir dan menjaga kondisi keamanan dan ketertiban masyarakat,” harapnya. (sgg)

Hotel Penuh, Wisatawan Mengeluh Sambungan dari halaman 17

yang ada di Kota Pontianak. “Sejak dari tahun 2009, saya dan rombongan ingin menyaksikan perayaan Cap Go meh di Singkawang, namun terpaksa ditunda karena kala itu tempat penginapan yang ada di sini (Singkawang,red) sudah penuh, agar tidak terjadi kegagalan kedua kalinya sejak tujuh bulan yang lalu, kami sudah memesan kamar hotel disini,” kata tour leader Kapitan Tour Surabaya, Yong Sen (57) sembari mengaku semula rombongan yang mau

ikut lebih dari 100 orang. Namun terbatasnya penginapan akhirnya ia hanya membawa rombongan sebanyak 79 orang saja. Alasan tertariknya Yong Sen beserta rombongan turnya untuk menyaksikan perayaan Cap Go Meh di Singkawang, tidak lain adalah karena, mereka menilai perayaan Cap Go Meh di Singkawang dikemas sangat menarik sehingga mampu mengalahkan perayaan di tempat lain di Indonesia. “Kalau ditempat lain paling hanya ada barongsai, kalaupun ada pawai tatung tapi tidak se

meriah di Singkawang,” ungkap Yong Sen. Keluhan akan masih minimnya tempat penginapan di Kota Singkawang tidak hanya dialami rombongan wisatawan dari Jawa Timur, namun juga dialami oleh rombongan wisatawan dari daerah lainnya. “Coba saja disini hotel lebih banyak, maka kami tidak repotrepot menginap di Pontianak karena akan memakan waktu lagi untuk tiba disini,”jelas Diana (40) salah satu rombongan wisatawan dari Jakarta saat menyaksikan arakan tatung

berjalan di sepanjang Jalan di Ponogoro kemarin untuk merayakan puncak perayaan Cap Go Meh. Melihat besarnya potensi perayaan Cap Go Meh sebagai salah satu pusat parisiwata andalan yang mampu menarik banyaknya wisatawan. Yong Sen berharap kedepan Pemerintah kota Singkawang dapat terus melestasikan budaya tersebut, tentunya diimbangi dengan penambahan jumlah hotel dan prasaran lain sehingga mempermudah para wisatawan untuk mencari tempat penginapan. (ash)

“Penyebabnya di belakang banyak yang naik, sehingga banyak yang menaiki tribun hingga akhirnya roboh,” terangnya. Warga lainnya, A Cung, heran mengapa tribun yang ditempatinya roboh. Sementara tribun lainnya tidak roboh, padahal banyak juga orang berjibun dan naik ke tribun. “Saya sempat kaget maklum mendadak, jatuh tiba-tiba, untung tak ada yang terluka,” sambil membersihkan celananya. Akhirnya, ia pun membaur dengan warga lainya, sehingga tiket yang dibeli mahal pun sia-sia. Ia pun juga terpaksa berdesak-desakan dengan peserta lainya yang tak membayar seharga tiket tribun. Sebelumnya, pembukaan festival Cap Go Meh 2011 dipusatkan di jalan Diponegoro. Pelepasan langsung dilakukan Gubernur Kalbar Drs Cornelis MH didampingi Walikota Singkawang Hasan Karman dengan menabuh gendrang. Dalam sambutannya, Cornelis mengatakan Cap Go Meh ini merupakan kegiatan tahunan. Bukan saja melestarikan budaya etnis, namun sebuah ajang promosi wisata yang patut dikembangkan, agar lebih banyak lagi wisatawan datang ke Kalbar khususnya ke Singkawang. “Silakan nikmati hiburan dan tontonan gratis ini. Meskipun dibayar pemerintah melalui sumbangan Rp 100 juta,” ujarnya yang disambut aplaus pengunjung. Ditambahkannya, tontonan gratis ini salah satu persembahan pemerintah kepada masyarakat,dimana semua pihak terlibat mulai kepoli-

sian hingga kemiliteran yang mengamankan festival ini. “Apalagi kurangnya pemerintah, jangan pula pemerintah dianggap gagal,” jelasnya. Bukan hanya memberikan tontonan menarik, festival Cap Go Meh ini memberikan manfaat ekonomi yang besar bagi masyarakat. “Hotel, restoran, taksi, silakan panen, inilah manfaat acara setahun sekali ini,” katanya. Bahkan dengan percaya diri, gubernur ini meminta promosikan CGM ini hingga keseluruh pelosok dunia. “Biar lebih banyak orang datang ke Pontianak, bila perlu buat jadwal penerbangan hingga 30 kali ke Pontianak,” ujaranya. Ia menyampaikan terima kasih atas kedatangan seluruh wisatawan baik luar Kalbar maupun mancanegara, terutama bagi masyarakat Kalbar. Walikota Hasan Karman, menyampaikan terima kasih kepada seluruh warga yang datang. Bahkan HK berpesan sampaikanlah kabar baik ke keluarga dan masyarakat. “Kalau yang baik-baik diceritakan kalau yang jelek-jelak sampaikan ke walikota, untuk diperbaiki,”ungkapnya.Bahkan perayaan CGM ini merupakan wujud keharmonisan etnis, budaya dibawah nauangan Kebhinekaan Tunggal Ika. “Mari kita (warga Tionghoa,red) jangan raguragu menjadi bagian bangsa ini, tidak ada lagi asli pribumi dan non pribumi, yang ada warga negera Indonesia,” tegasnya. Sementara itu, Ketua Panitia CGM 2011, Lio Kurniawan, berterima kasih atas kehadiran seluruh masyarakat. (har)

Tribun CGM Ambruk Sambungan dari halaman 17

tengah asyik menyaksikan tatung beratraksi, ia jatuh bersama puluhan penonton lainya. “Tak ada luka, tapi pinggang sakit dan shock langsung jatuh tanpa ada persiapan,” jelasnya. Akhirnya kenyamanan dirinya bersama puluhan penonton lainya terganggu, akhirnya pun ia terpaksa membaur dengan warga lainya yang berdesakan dengan warga yang menyaksi-

kan di samping tribun. “Padahal sudah bayar Rp 100 ribu untuk tiket tribun. Supaya lebih enak nontonnya. Tapi malah begini keadaannya,” katanya. Ia mengatakan kecewa dengan panitia yang tak membuat tribun yang tak kokoh. Padahal kejadian ini tidak perlu terjadi, andai saja panitia tegas melarang warga lain memanjat tribun penonton, yang notabena tidak membayar kursi tribun ke panitia.

Landak Negatif Flu Burung Sambungan dari halaman 17

Sayangnya, Nurainy enggan berkomentar tentang penyakit apa yang dialami oleh pasien tersebut. Ia mengatakan karena sudah booming di media, pihaknya enggan membeberkannya dengan alasan pribadi dari pasien. Ditanya mengenai antisipasi dari Dinas Kesehatan Kabupaten landak menyangkut flu burung ia memaparkan bahwa pihaknya telah berkoordinasi kepada semua puskesmas yang ada dikabupaten landak untuk lebih waspada dan melaporkan setiap temuan yang menggambarkan ciri-ciri flu burung dari pasien

yang sakit. “Puskesmas harus segera melaporkan jika mendapati kasus demam didaerah puskesmas tersebut agar segera memberitahukan kepada dinas kesehatan untuk ditindaklanjuti secara cepat,” tegasnya. Ia lantas mengingatkan masyarakat agar terus waspada dalam mengantisipasi penuaran penyakit berbahaya ini. Begitu juga dengan penyakit-penyakit lainnya. Pola hidup bersih harus senantiasa dilakukan masyarakat untuk menghindari terjangkitnya virus atau bakteri yang bisa menyebabkan penyakit. (sgg)

Dua Saksi Tak Pernah Diperiksa Sambungan dari halaman 17

dalam kasus tersebut. “Sangatlah sadis jika kriminalisasi itu terjadi,” katanya. Sebelumnya, diberitakan Kejaksaan Negeri Singkawang menetapkantigaorangtersangka dalam kasus pembebasan

tanah untuk pembangunan terminal antarnegara. Ketiga tersangka itu adalah, Ketua Tim 9, Sekda Singkawang, Suhadi Abdullani, Sekretaris Tim 9, Iswan yang juga Kepala Badan Pertanahan Nasional Singkawang dan pemilik tanah Pedro Halim. (zrf)

Naga, Tatung dan Barongsai Diarak Sambungan dari halaman 17

tatung di Tugu Perdamaian Jalan Merdeka Ketapang dan juga melakukan pawai keliling Kota Ketapang. Keberadaan naga dan barongsai pada perayaan Imlek dan Cap Goh Meh, kata Bupati Ketapang merupakan fenomena yang sangat menarik dan menunjukkan bahwa Indonesia mempunyai kultur yang berbeda-beda tapi tetap dalam bingkai Negara Kesatuan Republik Indonesia. Perayaan Cap Go Meh dengan Naganya bukannya sekedar seni atau hiburan semata

akan tetapi memiliki makna spiritual bagi etnis Tionghoa yang merayakannya. Bupati berharap kepada umat beragama, tokoh masyarakat dan lembaga keagamaan untuk tetap menjaga kerukunan umat beragama untuk menuju masa depan yang lebih baik. “Dengan memahami makna dan hakekat agama agar keragaman dan perbedaan dapat mendatangkan rasa aman dan damai dilandasi oleh ajaran agama yang diyakini masing-masing,” kata Drs Henrikus M.Si. Untuk itu Bupati berpesan

agar suasana damai tetap terpelihara dengan penuh rasa persaudaraan. Karena semangat persatuan dan kesatuan merupakan modal dasar dalam membangun kehidupan berbangsa dan bernegara. Sesuai agenda setelah peserta arak-arakan Naga dilepas oleh Bupati dengan start dari Pendopo mengelilingi kota Ketapang dan finish di Kelenteng Pek Kong Jalan Merdeka Ketapang. Arak-arakan naga ini ternyata menambah penghasilan pedagang kecil. Kimin, 41, pedagang es tebu dan cincau merasakan benar

perolehan ketika naga mulai menggeliat di jalan-jalan kota. Sejak Selasa, dagangannya laris manis. Puncaknya tentu saja, kemarin. Dimana sejak pagi naga dan barongsai lewat, dia pun kebagian rezeki. ‘’Lumayan, meningkat dibanding hari-hari biasa,’’ ujarnya. Dia berharap kalau di tahun Kelinci ini perekonomian bisa lebih membaik. Terutama untuk keluarganya. Sekarang Cap Go Meh, artinya pelepasan Imlek tahun ini. Cap Go Meh artinya hari kelima belas Imlek, sebagai penutup perayaan tahun baru. (*)


Optimis APBD Tepat Waktu Antisipasi Resiko Keterlambatan SINGKAWANG—DPRDdan Pemkot Singkawang berkomitmen menyelesaikan pembahasan APBD 2011 tepat waktu. Karena per 1 Maret rancangan APBD 2011 harus segera diserahkan kepada Provinsi, dengan demikian pembangunan di Singkawang tak terhambat, saat ini pelaksanaan pembangunan sedang berjalan. Hal tersebut diungkapkan Wakil Walikota Edy R Jacoub usai menyampaikan nota keuangan tahun anggaran 2011 di ruang paripurna DPRD Singkawang Rabu (16/2).

“Kita optimis pembahasan tetap waktu, ini tergantung kerjasama tim anggaran pemkot dan Badan anggaran DPRD, kita harus berpikir keterlambatan ini memiliki resiko-resiko, apalagi anggaran ini untuk operasional pembangunan, dan sudah ada yang harus dibayar,” ujarnya kepada Pontianak Post. Selain itu operasional pembangunan terhambat, resiko lainya adalah pemangkasan APBD 2,5 persen. Makanya kedua belah pihak harus ada semangat bahwa APBD ini untuk kepentingan masyarakat. Apalagi, kata dia, waktu yang ada mepet. “Makanya kita pandai-pandai mengatur yang penting kerjasama eksekutif dan legislatif maksimal agar

proses pembahasan APBD maksimal,” katanya. Ia juga menambahkan dalam penyusunan anggaran, tentunya menetapkan prioritas pelaksanaan program pembangunan. Sesuai dengan usulan masyarakat melalui musrenbang. Namun tentunya, kata dia, usulan tersebut tidak semua diakomodir. “Banyak sekali yang penting tapi harus dipilih yang paling penting atau prioritas, pembangunan ini berkelanjutan kalau tak di APBD murni, bisa diakomodir di APBD perubahan,” ungkapnya. Komitmen serupa juga diungkapkan Ketua DPRD Singkawang, Tjhai Chui Mie, bahwa draf APBD 2011 sudah diserahkan ke DPRD untuk dibahas. (har)

Panitia Dinilai Tak Konsekuen SINGKAWANG—Ketua V DPW Persatuan Forum Komunikasi Pemuda Melayu wilayah Singbebas, Noviar, menyesalkan masih adanya orang melayu yang muslim memikul tandu dalam acara ritual cuci jalan Rabu (16/2), dan kemungkinan ini berlanjut saat festival cap go meh berlangsung. “Kita menyangkan ini masih terjadi, padahal dalam pertemuan sebelumnya antara Polres Singkawang, panitia CGM, tokoh masyarakat dan tokoh agama sudah sepakat agar panitia tidak melibatkan orang melayu muslim dalam ritual, jadi saya menilai mereka tak

konsisten,” ungkapnya kepada Pontianak Post, kemarin. Ia meminta kesepakatan yang telah dibuat dilaksanakan. Apalabila ini tidak dilakukan, maka dapat menimbulkan kesalahpahaman dan gangguan keamanan. “Kalau dimasa mendatang kembali terjadi dapat menciptakan ketidak kondusifan Singkawang,” tegasnya. Padahal, kata dia, panitia CGM juga sudah memberikan selebaran himbauan kepada para tatung agar tak melibatkan etnis tertentu, karena menyangkut aqidah dan kepercayaan, serta mengantisipasi timbulnya

potensi konflik. “Saya minta Polres Singkawang dan panitia CGM bertindak tegas atas permasalahan ini,” pintanya. Selaku perwakilan pemuda Melayu, pihaknya protes atas sikap panitia CGM dan ketidaktegasan Polres Singkawang. Oleh sebab itu, pihaknya akan mengevaluasi perayaan CGM agar hal serupa tidak terulang lagi dimana mendatang. Ia sendiri selaku warga Singkawang mendukung pelaksanaan festival Cap Go Meh. Karena tujuannya demi kemajuan Kota Singkawang khususnya di bidang pariwisata. (har)

Bola Voli Junior 6 Maret NGABANG- Ketua Panitia Lokal Kejuaraan Provinsi (Kejurprov) Bola Voli Junior 2011 Kabupaten Landak Lukas Kanoh, didampinggi Ketua Pengprov PBVSI Kalbar Ir. Jakius Sinyor dan pengurus  PBVSI Kalbar serta Pengkab PBVSI Landak sesuai hasil rapat menyepakati pengunduran kegiatan Kejurprov Bola Voli Junior 2011 tanggal 28 Februari sampai dengan 6 Maret 2011. Kegiatan yang rencananya

digelar 21-27 Februari 2011, diundur karena berbenturan dengan pelaksanaan tray out pelajar SMP dan SMA se Kalbar, sekaligus agar persiapan Kejurprov lebih matang dan lebih siap. Hal tersebut diputuskan dalam rapat gabungan dan evaluasi  kesiapan panitia  kejurprov bola voli junior 2011 di ruang pertemuan Cafe Raja Wali, Selasa (15/2) di Ngabang. Pengunduran kegiatan ini tidak lain agar memberikan

kesempatan panitia untuk lebih matang dan lebih siap menggelar even akbar setahun sekali ini.   “Sebelum ini kita putuskan banyak dari seluruh   kabupaten mengajukan masukan agar kegiatan ini diunudur, mengingat banyak dikalangan pelajar yang ikut dalam Kejurprov ini tanggal 21-23 Februari melakukan kegoatan tray out jelang pelaksanaan Unjian Nasional (UN),” kata Jakius Sinyor. (sgg)

Izin Kios BBM TetapDiberikan Sambungan dari halaman 24

perizinan yang sudah memenuhi syarat, pihaknya tidak bisa melarang seseorang membuka usaha. Apalagi saat ini kondisi masyarakat susah mencari pekerjaan. Namun demikian, disisi lain, pemberian izin kios BBM

juga merupakan syarat untuk penambahan kuota BBM di Sintang, sehingga hal tersebut juga merupakan salah satu bentuk laporan ke pihak Pertamina untuk pengajuan penambahan kuota tersebut. “Dalam pemberian izin kios BBM, kita juga melihat bentuk kiosnya. Untuk kios yang kecil,

di mana hanya berupa atap kecil dan beberapa rak untuk menyimpan dirigen tidak kita berikan. Yang kita kasi surat izin, hanya kios besar yang menjual BBM dalam jumlah besar, dan bentuk kiosnya seperti pondokan yang biasanya terdapat drum penyimpan BBM,” tutur dia.(wah)

Sosialisasi Konversi Gas Harus Intensif Sambungan dari halaman 24

lain dan kemudian di jual di Sintang dengan harga standar, maka itu sebenarnya sudah menyalahi ketentuan,” ungkapnya. Keberdaan tabung gas tiga ki-

logram yang beredar di Sintang saat ini, katanya, pada dasarnya cukup membantu masyarakat yang membutuhkan gas dalam jumlah sedikit. “Bisa saja ada penerima konversi gas dari Pontianak pindah ke Sintang, tabungnya di bawa dan untuk

isi ulang tentunya harus ada penjual. Tetapi sekali lagi, kalau belinya harga subsidi dan dijual dengan harga normal, itu yang tidak dibenarkan, karena beli dengan harga subsidi mestinya dijual dengan harga subsidi,” pungkasnya dia. (wah)

Tetap Semangat Belajar di Tengah Keterbatasan Sambungan dari halaman 24

Kedamin Hilir dan mengalami dua kali pindah. Baru setelah gedung baru selesai dibangun yang berada di depan SMAN 2 Putussibau, sekolah berpindah. “Dari pertama berdiri banyak lika liku yang kita hadapi. Terutama guru yang ada. Dan hingga kini kita memiliki guru negeri tiga orang, guru honor dua orang, penjaga sekolah dan tenaga kebersihan masing-masing satu orang,” tambahnya. Begitupun murid yang ada. Pasang surut keberadaan siswa SLB juga diakui Endang. Sampai saat ini siswa 30 orang dengan 3 jurusan. Yakni jurusan B tuna rungu, c tuna grahita, d autis. Aktivitas belajar mengajar yang ada sama dengan sekolah biasa. Ada muatan nasional, muatan

lokal dan program khusus. Selain kegiatan belajar, ada program ekstrakurikuler, pengembangan dir,i olahraga dan kesenian. Sejumlah prestasi, juga dikatakan Edang, sudah dicapai. Bahkanhinggaketingktprovinsi dan mewakili ke nasional 2 kali. Cabang olahraga lari 100 meter tingkat nasional sudah 2 kali. Kesenian biasa tampil2 kali di berbagai kegiatan ulang tahun atau perayaan. Seperti kepolisian, dan ulang tahun pertanian. “Karena itu kita menaruh harapan masyarakat semakin percaya kepada SLB. Karena kita berkeinginan para siswa kita kelak mampu mengembangkan diri dan tidak menjadi beban bagi masyarakat,” kata Endang. Sebab itu, Endang berkeinginan di sekolahnya memiliki bengkel kerja. Melalui bengkel kerja itu para murid

dibekali dengan berbagai keterampilan. Terutama keterampilan yang bisa menjadi penopang hidup. Seperti pembuatan batako, pertukangan dan permebelan, serta lainnya. “Ketika mereka bisa trampil, tentu akan dapat mendatangkan penghasilan, sehingga mereka bisa mandiri,” tambahnya. Karena itu, Endang mengatakan, pihaknya tidak ingin anak yang memiliki kelainan mental dan fisik seakan dikesampingkan. Walaupun memiliki kelainan, anak-anak itu dikatakannya memiliki potensi. Sekecil apapun kalau tidak digali dan dikembangkan tidak akan kelihatan. Sebab itu, pihaknya akan berusaha sekuat tenaga untuk menggali dan mengembangkan potensi yang ada pada anak, potens itu dengan berbagai latihan yang intensif. (wank)

Tingkatkan Kinerja Dharma Wanita Sambungan dari halaman 24

merawat anak, jangan sampai dilupakan. Karena peran yang baik, akan mengantarkan gererasi muda yang berkualitas. “Sebagai organisasi perempuan yang masih eksis, Dharma Wanita mempunyai banyak tugas mulia. Salah satunya sebagai sarana dalam

menyejahterakan anggota melalui bidang pendidikan dan ekonomi serta sosial budaya,” jelas dia. Dharma Wanita, lanjut dia, diharapkan dapat membangun organisasi yang sensitif gender, dan dapat meletakkan kaum perempuan dalam konteks kegiatan yang bermakna bagi bangsa dan negara. “Faktor pendidikan

dipandang penting agar seseorang mempunyai kekuatan untuk menegmbangkan diri secara optimal. Adanya pendidikan, akan menadi potensi pembanguna yang berkualitas. Nah, disinilah Dharma Wanita di tuntut bisa mengambil peran itu. Begitu juga di bidang ekonomi dan budaya,” pungkas Zulkifli. (wah)

pro-kalbar Pontianak Post


Jumat 18 Februari 2011

Izin Kios BBM Tetap Diberikan


Tingkatkan Kinerja Dharma Wanita DHARMA Wanita Persatuan Kabupaten Sintang ke depan diharapkan dapat lebih meningkatkan kinerjanya. Mengingat, seiring perkembangan zaman di masa depan, tantangan dan rintangan yang dihadapi semakin berat. “Dharma Wanita Persatuan sebagai organisasi istri PNS, dalam pelaksanaan tugasnya telah mencapai banyak kemajuan dan keberhasilan. Zulkifli HA Keberadaannya juga mampu memberi manfaat bagi banyak pihak, dan perannya dalam menyukseskan kegiatan pembangunan. Walaupun demikian, kinerja yang baik harus ditingkatkan karena tantangan kedepan makin berat,” kata Zulkifli. Menurut Zulkifli, peran wanta sebagai pendamping suami dalam menjalankan tugasnya sebagai PNS, hendaknya dapat mendorong semangat pengabdian suami agar dapat berpertisipasi membangun Sintang dengan baik dan lancar. Begitu pula peran sebagai ibu yang Ke Halaman 23 kolom 5

Sepanjang Syarat dan Ketentuan Dipenuhi

keberadaan SPBE juga mestinya terpenuhi, selain keberadaan kantongkantong distribusi hingga ke desa. “Kalau tidak ada, yang kasihan masyarakat nanti. Sebab, harga elpiji bisa lebih mahal dari harga dasar subsidi, sementara untuk mencari minyak tanah mereka juga bakal kesulitan,” ucapnya. Hadi menilai ada baiknya jika program konversi itu dijalankan, pasokan minyak tanah di Sintang juga tetap ada, meskipun sudah tidak lagi dengan harga subsidi. Sebab, dilihat kondisi sekarang yang masih menggunakan harga subsidi, masyarakat di pedalaman sudah terbiasa membeli minyak tanah dengan harga yang tinggi. Ditanya soal keberadaan tabung gas tiga kilogram yang sudah beredar di Sintang meskipun saat ini Sintang belum memulai program konversi, ia mengatakan. kalau itu sudah mekanisme pasar. “Yang bisa dipersoalkan ketika gas itu dibeli dengan harga subsidi dari daerah

SINTANG--Kantor Pelayanan Terpadu Satu Pintu Kabupaten Sintang masih tetap mengeluarkan surat izin usaha kios BBM, selama persyaratan dalam proses pembuatannya dapat dipenuhi, sesuai dengan Peraturan Bupati (Perbup) Sintang Nomor 64 tahun 2009, tentang perizinan. “Permasalahan perizinan kios BBM memang telah dibahas pada rapat bersama pihak terkait beberapa waktu lalu. Namun dari pihak kami kalau Sy. M Taufik memang syarat tersebut memenuhi, maka kami tetap melakukan pembuatan surat izinnya. Sebab, dalam Perbup Sintang No. 64 tahun 2009, masih belum terdapat perubahan,” kata Kepala Kantor Pelayanan Terpadu Satu Pintu Kabupaten Sintang Sy. M Taufik, kepada Pontianak Post belum lama ini. Menurut Taufik, sampai saat ini memang banyak masyarakat yang membuat surat izin usaha untuk kios BBM tersebut. Namun demikian, pihaknya tetap selektif dalam mengeluarkan perizinan. Terutama kita melihat syarat yang sudah ditentukan, diantaranya surat izin gangguan lingkungan, surat permohonan, surat izin kepala desa, camat, status tanah yang jelas, serta bukti pembayaran pajak dari yang bersangkutan. “Selama 2010 sampai saat ini ada 235 kios BBM se-Kabupaten Sintang yang mengurus izin. Didominasi oleh Kecamatan Sintang, Sepauk, dan Kelam Permai. Itu sudah termasuk baru dan perpanjangan,” jelas Taufik. Dia melanjutkan, dilihat dari aspek

Ke Halaman 23 kolom 5

Ke Halaman 23 kolom 5


SAMPAH KAYU: Sungai di pedalaman Kabupaten Melawi sering ditemukan sampah kayu. Hal ini selain membahayakan warga yang sedang mandi juga mengancam bagi pengendara motor air.

Sosialisasi Konversi Gas Harus Intensif SINTANG--Jika program konversi dari minyak tanah ke gas di Sintang berjalan, maka sosialisasi harus dilakukan intensif. Karena

banyak masyarakat yang belum terbiasa menggunakan gas, sehingga dapat menghindari hal yang tidak inginkan. “Salah-salah kejadian seperti meledaknya tabung gas di beberapa daerah, bisa juga terjadi di Sintang, itu yang kita harus hindari,” kata Ketua Dewan Pimpinan Daerah (DPD) Lumbung Informasi Rakyat (Lira) Kabupaten Sintang Abdul Hadi kepada Pontianak Post, kemarin. Menurut Hadi, selain sosialisasi, pendataan terhadap masyarakat penerima manfaat tabung gas tersebut juga harus secara efektif dilakukan, agar tidak ada masyarakat yang layak menerima tabung gas terlewatkan dari pendataan. “Pendataan harus benarbenar dilakukan, sehingga program yang dijalankan tersebut bisa tepat sasaran,” jelasnya. Ia menilai, jika program itu berjalan di Sintang, paling tidak soal infrastruktur dasar dalam program konversi tersebut seperti

Melihat dari Dekat Aktivitas Murid SLB Putussibau

Tetap Semangat Belajar Ditengah Keterbatasan KALAU memiliki berbagai keterbatasan, namun para siswa Sekolah Luar Biasa (SLB) Negeri Putussibau tetap semangat belajar. Meski juga berada di tengah-tengah sekolah yang terbatas infrastruktur pendukungnya. Pantauan koran ini saat berkunjung ke SLB Negeri Putussibau, secara fisik gedung sekolah refresentatif. Hanya saja lokasinya cukup jauh berada di tengah belantara hutan dan kebun karet. Jalan masuk sekolah masih jalan tanah dan lebarnya hanya bisa muat satu buah mobil. Di kiri dan kanan jalan ditumbuhi semak belukar yang jika dibiarkan dapat dipastikan menjalar ke jalan. Begitupun di kompleks bangunan sekolah. Pekarangan ditumbuhi rumput liar. Tanah rawa berbecek menyebabkan para siswa

tidak bisa bermain di pekarangan. Saat waktu istirahat, olahraga dan bermain, aktivitas hanya dilakukan di dalam ruangan. Kepala SLB Negeri Putussibau Endang Sugandi, mengaku kondisi yang ada sekarang relatif lebih baik. Dahulu waktu pertama pindah, dikatakan Endang, kondisi jalan masuk ke komplesk sekolah becek karena belum di timbun tanah. “Bahkan dari ujung jalan menuju teras sekolah dulunya di buat jembatan dari kepingan papan. Meski demikian, para siswa tetap bersemangat ke sekolah,” katanya. Endang mengatakan, gedung sekolah yang sekarang merupakan gedung baru dan baru ditempati tahun 2008 lalu. SLB sendiri, dikatakanya, telah berdiri sejak tahun 1987. Lokasi pertama berada di Ke Halaman 23 kolom 5


BELAJAR: Siswa di SLB Putussibau sedang belajar.

2010 - 2011


Pontianak Post l Jumat 18 Februari 2011

Soccer L i g a

Statistik Pertandingan Arsenal 5 8 4 16 3 4 3 - 34%

Barcelona 5 Tendangan ke Gawang 6 Tendangan Melenceng 1 Tendangan Sudut 12 Offsides 9 Penyelamatan 3 Pelanggaran 2 Kartu Kuning Kartu Merah 66% Penguasaan Bola

2 Arsenal


Tuding Wasit Teman Mourinho



v Barcelona 1




C h a m p i o n s

Nicola Rizzoli

KEPUTUSAN wasit asal Italia Nicola Rizzoli yang menganulir gol Lionel Messi jelang jeda turun minum menjadi sorotan. Bahkan, media di Spanyol sampai menyebut Rizzoli sebagai kroninya Jose Mourinho, pelatih Real Madrid. Kok bisa nama Mourinho sampai dibawabawa” El Mundo Deportivo dan Sport menu­ ding keputusan wasit lah yang menyebabkan Barca takluk dari Arsenal kemarin dini hari (17/2). Bukan hanya dianulirnya gol Messi, tapi juga beberapa insiden lainnya. Nah, dua surat kabar terbitan Catalan itu mengklaim Rizzoli memiliki hubungan dekat dengan Mourinho. Hubungan kedua­nya terjalin tatkala The Special One, begitu Mourinho menyebut dirinya, masih menjadi tactician di Inter Milan. Beberapa insiden masih bisa ditolerir, tapi keputusan menganulir gol Messi membuat gerah publik Barcelona. Berdasarkan rekaman video, sulit menyebut Messi berada dalam posisi offside ketika menyundul bola masuk ke gawang Arsenal. Saat itu, Messi menggiring bola di antara bek Arsenal dan kemudian menyodorkannya ke arah Pedro yang berdiri bebas. Sayang, sepakan Pedro masih membentur kaki kiper Wojciech Szczesny, bola kemudian bergulir ke arah gawang dan disundul Messi. Yang jadi kontroversi adalah saat bola di­sepak Pedro, Messi memang berada di depan bek Arsenal, tapi dia berada di belakang bola. Sehingga dia tidak masuk kategori offside. Namun, asisten wasit mengangkat bendera tanda offside dan wasit menganulir gol itu. Meski mengkritik kinerja wasit, El Mundo juga sepenuhnya membela Barca. Mereka bahkan mengkritik klub asal Catalan itu habis-habisan. “Di babak kedua, Barca bermain layaknya mainan yang kehabisan batere,” tulis El Mundo. Senada dengan El Mundo, surat kabar Sport menyebut, kegagalan dari Barca adalah karena wasit dan entrenador Barca Josep Guardiola. “Wasit telah menganulir gol yang legal dan tidak menjatuhkan penalti,” tulis Lluis Mascaro, wartawan Sport. Dia juga mempertanyakan keputusan Guardiola yang menarik David Villa pada pertengahan babak kedua dan digantikan dengan Seydou Keita. “Mereka kalah di saat seharusnya bisa menang 3-0 karena pergantian yang keliru,” lanjutnya. Kolumnis AS Santi Gimenez punya pendapat berbeda. Menurutnya, Barca kalah karena kehilangan spirit bertandingan. “Secara teknik kedua tim merata, tapi yang menjadi masalah adalah tim asal Inggris itu punya motivasi lebih,” tulisnya.(ham)



Keogh REUTERS / Eddie

CETAK GOL: Striker Arsenal Robin van Persie (kiri) mampu mencetak gol dari sudut sempit di sisi kanan gawang Barcelona yang dikawal Victor Valdes.

LONDON - Pertarungan dua klub yang mengusung sepak bola indah untuk sementara dimenangkan Arsenal. Mereka mengalahkan Barcelona 2-1 (0-1) pada first leg babak 16 besar Liga Champions di Emirates Stadium, kemarin dini hari (17/2). Kemenangan yang membuka peluang The Gunners, julukan Arsenal, untuk melaju ke perempat final. Hanya butuh hasil imbang saja pada second leg agar Arsenal bisa terus melaju. Namun, mereka harus meraihnya di Nou Camp, markas Barca. Melawan Arsenal, Barca memulainya d­e ngan penuh percaya diri. Tim besutan Josep Guardiola itu seperti biasanya mendominasi penguasaan bola. Arsenal lebih sering tertekan dan hasilnya kebobolan oleh gol David Villa di menit ke-26. Pada babak kedua, Arsenal berupaya lebih menekan. Manajer Arsenal Arsene Wenger juga memasukkan Andrei Arshavin dan Nicklas Bendtner untuk menggantikan Alex Song dan Theo Walcott pada pertengahan babak kedua. Bersamaan dengan itu, Barca justru menarik keluar Villa dan Seydou Keita dimasukkan untuk memperkuat barisan tengah. Ternyata, keputusan itu membuat Arsenal lebih berkembang dan lebih sering menekan benteng pertahanan Barca. Alhasil, di menit ke-78, striker asal Belanda Robin van Persie mampu mencetak gol dari sudut sempit di sisi kanan gawang Barca yang dikawal Victor Valdes. Skor imbang membuat Arsenal masih beringas, mereka pun kembali mencetak gol melalui Arshavin (83’). Gol Arshavin layaknya pukulan telak di wajah Barca. Namun, sulit bagi mereka balik menekan tuan rumah. Di akhir laga, justru Arsenal yang lebih mendominasi serangan. Meski secara statistik penguasaan bola tetap didominasi Barca. “Mereka sangat jarang kalah. Bisa dibilang yang terbaik dalam sejarah sepak bola menurut saya. Namun itu hanya terjadi pada babak pertama. Pada babak kedua, kami bisa meningkatkan kepercayaan diri dan menang,” bilang Cesc Fabregas, kapten Arsenal, seperti dilansir AFP. Senada dengan Fabregas, Wenger juga meyakini Barca adalah tim terbaik saat ini. Namun, bukan tim yang tak terkalahkan. “Sekalipun begitu kami tetaplah bukan favorit. Masih ada second leg dan kami akan berusaha,” ujar Wenger, seperti dilansir Reuters. Yang lebih membanggakan bagi Wenger adalah karena mereka tetap mempertahankan gaya bermain Arsenal untuk kontra Barca. Selain itu, The Gunners juga tampil lebih agresif ketimbang Barca. Kalah penguasaan bola, tapi unggul peluang di depan gawang. Meski selama babak kedua, terlihat jelas permainan Barca menurun, tapi entrenador Barca Josep Guardiola menolak mengkritik pemainnya. “Secara umum saya senang dengan performanya, tapi soal hasil saya tentu tidak senang,” ketus Guardiola. Namun, Guardiola tetap tenang. Dia memuji permainan kedua klub yang sama-sama menyerang dan memberikan tontotan yang menyenangkan bagi penikmat sepak bola. “Segalanya belum berakhir,” ujar mantan kapten Barca itu. Guardiola melanjutkan, mereka siap menanti dan membalas kekalahan itu pada second leg pada 8 Maret nanti. “Tidak ada yang lebih baik daripada pertarungan dua tim yang sama-sama menyerang. Berikutnya kami tunggu mereka di Nou Camp,” tantang Guardiola.(ham)





All Soccer L i g a

2 AS Roma

Pontianak Post l Jumat 18 Februari 2011

C h a m p i o n s


Shakhtar 3

Badai Belum Berlalu ROMA - Tren negatif AS Roma selama Februari masih berlanjut. Setelah melewati tiga laga tanpa kemenangan di Serie A Liga Italia, klub berjuluk Giallorossi itu juga menuai hasil negatif di ajang Liga Champions, kemarin dini hari (16/2). Ya, Roma yang ber­ status tuan rumah pada first leg babak 16 besar dipermalukan tamunya asal Ukraina Shakhtar Donetsk 2-3 (1-3). Kekalahan yang membuat tugas Francesco Totti dkk lebih berat pada second leg nanti di kandang Donetsk. Bila masih berambisi lolos ke perempat final, maka kemenangan saja tidak cukup. Mereka harus menang dengan selisih dua gol atau lebih. Kalau hanya menang dengan selisih satu gol, maka mereka harus memastikan gol tandang mereka lebih banyak. Situasi yang tidak menyenangkan bagi pelatih Roma Claudio Ranieri. Tuntutan mundur mulai disuarakan sejumlah tifosi Roma. “Saya sama sekali tidak berpikir untuk mundur. Kami juga tidak berada dalam krisis,” ungkap Ranieri, seperti dikutip Reuters. “Saya tidak melihat tim yang berada dalam kondisi krisis dalam laga ini. Kalau dibilang tim kami agak rapuh, mungkin iya. Seharusnya kami berreaksi dengan lebih baik ketika skor menunjukkan 1-1,” bilang tactician berusia 59 tahun itu. Bermain di Olimpico, Roma, tuan rumah lebih dulu unggul melalui gol Simone Perrotta pada menit ke-28. Sayang, keunggulan tersebut hanya ber-



KALAH: Pemain AS Roma Francesco Tooti (kiri) di tekel bek Shakhtar Dmytro Chygrynskyy pada lanjutan liga Champion di Stadion Olimpiade Roma (16/2). Shaktar dikalahkan AS Roma 3-2.


kami hampir tiga bulan tidak pernah melakukan pertandingan. Pertandingan terakhir kami saat menghadapi Braga pada bulan Desember lalu.” Pertandingan leg kedua akan berlangsung di Donbass Arena pada tanggal 8 Maret dan Eduardo tidak sabar menantikan pertandingan tersebut untuk memastikan timnya meraih satu tiket ke babak perempat final. “Kami masih memiliki 90 menit tersisa di Donetsk dan jika kami berhasil lolos ke babak perempat final, semoga saja kami tidak harus menghadapi klub-klub seperti Arsenal atau Barcelona,” pungkasnya.(int)

Wajar Kalau Dicemooh Iklan Iklan sebuah sebuah sarana sarana yang yang paling paling efektif efektif dalam dalam memasarkan memasarkan sebuah sebuah produk.. produk.. Contact Contact person: person:


7 3 5 0 7 1 cmyk


Eduardo: Peluang Roma Belum Berakhir Penyerang Shakhtar Donetsk, Eduardo menyatakan jika peluang Roma untuk tetap melaju di ajang Liga Champion masih belum berakhir karena masih ada leg kedua yang berlangsung di Donetsk pada tanggal 8 Maret nanti. Shakhtar Donetsk secara mengejutkan mampu mengalahkan Roma pada pertandingan leg pertama babak 16 besar Liga Champion yang berlangsung di Olimpico pada hari Kamis dini hari (17/2) WIB dengan skor akhir 3-2. Tapi, Eduar­ do mengingatkan rekan-rekan setimnya kalau pertarungan dengan Roma belum berakhir karena Roma bisa membalikkan keadaan di leg kedua yang berlangsung di Donetsk. ”Semua orang sangat senang dengan kemenangan 3-2 yang kami raih dari Roma, tapi kami menyadari kalau pertandingan masih belum berakhir. Kami masih memiliki waktu 90 menit di Donetsk dan berharap kami dapat kembali meraih kemenangan di depan para pendukung kami,” ujar Eduardo seperti dikutip dari “Pertandingan melawan Roma cukup berat karena


tahan satu menit. Pada menit ke-29, Donetsk menyamakan skor melalui Jadson. Begitu skor disamakan, justru Roma yang kehilangan momentum dan mereka kesulitan me­nahan gempuran Do­n etsk. Alhasil, ga­wang Roma yang di­k awal kiper asal Bra­zil Doni kebobolan dua gol di babak pertama melalui Douglas Costa (36’) dan Luiz Adriano (41’). Ketika jeda turun minum, Roma tertinggal 1-3. Akibatnya, tuan rumah justru menjadi sasaran ejekan dari fans mereka. Hingga akhirnya pada menit ke-61, winger asal Prancis Jeremy Menez mampu menipiskan ketertinggalan dengan golnya. “Saya melihat tim ini bermain tanpa kenal menyerah. Hanya, laga itu tidak berjalan baik. Saya bertanggung jawab atas ejekan yang kami terima. Saya merasa bersalah atas apa yang para pemain alami di lapangan,” bilang Ranieri. Bagi Donetsk yang berstatus debutan, kemenangan di partai tandang itu sangat berarti. Apalagi, didapat dari Roma. Pelatih Donetsk Mircea Lucescu menilai, kemenangan itu diraih karena mampu memaksimalkan kelemahan Roma, yakni tidak konsisten. “Saya selalu percaya mereka tidak yang sulit diprediksi. Terkadang mereka melewati beberapa laga dengan sangat hebat dan kadang mereka juga kalah. Segalanya belum berakhir, penentunya di second leg,” bilang Lucescu.(ham)

Ada yang janggal saat AS Roma menjamu Shakhtar Do­netsk dalam gelaran Liga Champion di stadion Olimpico, Kamis (17/2) din hari tadi. Bukannya mendapat dukungan dari suporternya, tim berjuluk Giallorossi itu malah mendapat cacian. Menanggapi hal ini, kapten kedua Roma, Daniele De Rossi menagatakan wajar bila fans memaki mereka. Apalagi semalam Roma tidak bermain baik dan dipaksa menerima kekalahan Secara umum saat ini Roma memang tengah dalam situasi tidak menyenangkan. Rentetan kekalahan di Serie A, isu pergantian kepemilikan, hingga romur dipecatnya Claudio Ranieri seakan membuat De Rossi dkk. makin tertekan. “Ini adalah saat yang sulit untuk klub, dan kami berterima kasih pada para pendukung yang sudah menonton kami,” kata De Rossi dikutip dari “Wajar kalau kami diejek, kami harus menerima kritikan yang ditujukan pada kami, ”tambahnya. Dalam laga itu

Daniele De Rossi

Roma sempat unggul 1-0 terlebih dahulu melalui gol Simone Perrotta menit ke-28. Namun keunggulan itu tidak bertahan lama setelah tim tamu mampu menceploskan tiga gol ke gawang Roma sebelum babak pertama berakhir, dan ini menjadi pemicu kemarahan suporter tuan rumah. Memasuki babak kedua Roma hanya mampu menyarangkan satu gol dan tidak mampu menghindari kekalahan 2-3 dari tim asuhan Mircea Lucescu itu.Meski kalah namun De Rossi tetap optimis menatap duel legh kedua tanggal 8 Januari nanti di Ukraina.(int)


Pontianak Post


Jumat 18 Februari 2011

Cinta Olahraga SIAPA pun paham bahwa olahraga mampu membuat tubuh sehat jiwa dan raga. Para binatang ini pun mengetahui hal tersebut. Jadi, jika Anda masih malas menggerakkan badan, malu dong sama mereka.


Anjinganjing ini ikut dalam kompetisi lari maraton yang startnya dimulai dari depan Koloseum, Roma.


Bulldog satu ini cinta pantai. Dia sudah siap beraksi di atas papan surfing-nya. Melawan ombak, siapa takut.


Santra punya tubuh lebih fleksibel ketimbang beruang pada umumnya. Penghuni kebun binatang Ahtari, Finlandia, ini setiap pagi rutin menggerakkan tubuhnya bak seorang yogi betulan.(*/bbsb)

Sepuluh Hobi Penghilang Stres D 6

engan gaya hidup stres hari ini, penting untuk memiliki waktu yang Anda ambil untuk melakukan sesuatu hanya untuk bersenangsenang. Meskipun ada banyak hobi untuk dipilih, ini adalah daftar-daftar hobi yang sangat berguna dalam menghilangkan stres. Pelajari tentang manfaat dari masing-masing, dan menemukan sumber untuk memulai hobi baru untuk menghilangkan stres anda sekarang!


booking menggabungkan kesenian dengan pengalaman untuk membuat kendaraan yang unik untuk menampilkan kenangankenangan anda dan diteruskan kepada generasi mendatang. Biasanya perembuan lebih hobi, scrapbooking menawarkan banyak kesempatan sosial (dalam bentuk kelas, pertemuan, dan forum), dan mengistirahatkan dari apa yang membuat anda stres, untuk menciptakan sesuatu yang indah bahwa orang lain bisa menikmatinya juga.


Melihat ikan B e r k e b u n d a p a t di akuarium

menghilangkan stres anda dengan berbagai alasan, termasuk membawa anda ke dalam sinar matahari dan udara segar, menciptakan lingkungan yang lebih indah untuk pulang ke rumah setiap hari, dan banyak lagi.

Explore Fotografi


Waktu anda belaja r m e nga mb i l ga mba r- ga mba r ya ng ba i k dengan teman dan keluarga anda, atau menyelidiki dunia dan menciptakan seni sejati, fotografi bisa menjadi hobi yang sangat hebat. Ketika anda berlatih melihat dunia melalui mata seorang fotografer, Anda mungkin mulai melihat hal-hal yang berbeda. Hasil akhir? Tidak hanya apakah anda memiliki hobi dan mengalihkan kegiatan untuk diri ada sendiri, tetapi anda melihat dunia sebagai tempat yang lebih indah dalam kehidupan sehari-hari Anda!



Waktu anda memiliki beberapa gambar, Scrapbooking bisa menjadi hobi yang sangat menarik. Scrap-

Anda bisa berhubungan dengan sisi artistik dan menggunakan gambar sebagai cara untuk memproses emosi anda, mengalihkan perhatian anda, dan mencapai manfaat untuk mengatur stres lainnya. Hasil akhirnya akan menjadi sesuatu yang indah dan pribadi yang dapat anda nikmati atau berbagi.


Melihat ikan air asin (ikan laut) di akuarium telah membuktikan manfaat kesehatan, termasuk mengurangi tekanan darah dan menghilangkan stres. Memelihara ikan akuarium yang indah dapat dianggap hobi yang berguna karena perlu perhatian teratur (tapi tidak berlebihan), memiliki potensi untuk menghubungkan anda dengan penggemar ikan laut lainnya, dan memberikan anda kesempatan untuk menciptakan sesuatu yang unik: Anda sendiri yang mencampurkan ikan, batu dan tanaman hidup lainnya.




Melibatkan pikiran anda dalam sebuah teka-teki dapat menghilangkan stress dari apa yang menekan anda, dan mengembangkan kekuatan otak anda pada waktu yang sama. Hasil akhirnya adalah bahwa anda mendapatkan istirahat yang lebih baik, dan mengatasi masalah anda dengan lebih segar, pikiran lebih kuat, yang dapat membantu anda untuk menangani tekanan hidup.


Melukis dapat membawa manfaat untuk mengatur stres anda sama seperti menggambar, tetapi melalui media yang berbeda.



S e l a i n membantu anda menciptakan hadiah yang indah untuk diri sendiri dan orang lain, merajut m e mb e r i k a n a n d a kesempatan untuk meringankan stres. Gerakan yang berulang-ulang dapat membuat anda dapat memberikan jalan keluar dari perasaan gugup.


Main piano

M u s i k memiliki banyak manfaat kesehatan dah menghilangkan stress anda. Sewaktu mendengarkan musik, mungkin dapat dianggap sebagai hobi, menciptakan musik bisa menjadi lebih

kuat sebagai hobi yang menghilangkan stres anda, karena dapat menyerap perhatian anda sepenuhnya dan menjadi alat komunikasi bagi ekspresi kreatif juga. Belajar untuk memainkan alat musik seperti piano dapat menghilangkan stres anda maupun bagi orang-orang di sekitar anda, karena


anda berbagi kreasi anda.


Banyak orang telah menemuk a n b a hw a 'Menulis catatan harian' dapat meringankan stres. dan keuntungan kesehatan juga! Menulis, baik catatan pribadi, sebagai penulis amatir, atau bahkan sebagai seorang profiesional, adalah suatu hobi yang dapat katarsis dan santai, dan memberikan sesuatu yang hebat untuk berbagi dengan orang lain. (*/ bbsb)


Pontianak Post ● Jumat 18 Februari 2011



Sadar Menjaga Hubungan

Siapa yang ingin hak-nya dihargai, dia juga harus menghargai hak orang lain dulu. Masa penginnya dihargai terus sih, nggak adil dong. Untuk itu, tim X kasih tips nih biar kalian sadar bahwa menghargai orang lain itu penting. Butuh orang lain Mau egois? No way. Jangan sekali-kali nggak mau tahu urusan orang lain. Bersikaplah sebagaimana mestinya makhluk sosial. Nah, saat kalian tebersit rasa egois, langsung aja ingat-ingat bahwa kalian makhluk sosial yang nggak bisa hidup tanpa orang lain.

Selalu berbuat baik Tahu hubungan timbal balik kan? Siapa yang menanam pasti akan menuai buahnya. Artinya, siapa yang nimpukin orang pasti akan ditimpuk ganti, hehehe. Bercanda, bercanda. Arti yang sebenarnya, Kalau kita selalu menghargai orang lain, mereka pasti akan menghargai kita juga.

60 orang

Indahnya Saling

(3 tertinggi)


Toleransi : 41,7% Senang berbagi : 20% Menolong dalam kesusahan : 18,3%


ETIAP umat manusia adalah sama kedudukannya di mata Tuhan. Kalimat yang simple dan mempunyai satu arti. Dimana kita semua adalah sama dimata-Nya, Sang Pencipta. Kita sama karena kita sama-sama terlahir di dunia dan kita adalah manusia. Lalu, berhak kah kita merasa lebih dari orang lain? Berhak kah kita ingin lebih dipandang dan dihargai dari orang lainnya? hayooooo… masih bingung tentang apa itu menghargai dan saling menghargai ? Yuks, sama-sama cari tau di edisi X hari ini. Menghargai dan dihargai itu hal yang biasa kita dengar bahkan diucapkan. Tapi, belum tentu kita semua bisa melakukannya. Sebelumnya, kamu memang harus menghargai orang lain, baru kamu akan dihargai. Indah bukan hidup yang seperti itu ? Kadang keadaan menjadikan kamu lupa atau menganggap sepele apa itu menghargai hak orang lain. “Karena status sosial biasanya banyak orang yang ingin dipandang lebih dan sama sekali nggak mikirin orang lain. Padahal, dia kaya juga masih dari harta orang tuanya kan!” ujar Dohar Jeniffer, mahasiswa Polnep satu ini. Padahal nih, kalau kita mau dan yakin bisa, coba menghargai orang lain dalam hidup ini nggak sulit kok. Misalnya, Kamu bisa belajar bertoleransi terhadap orang lain.


Ita Alman Andela

Siswa SPP-SPMA Singkawang "Anak yang menghargai orang lain adalah teladan yang baik. Dia bisa menjaga perasaan orang lain. Dia juga bisa membuat orang lain senang. Coba kalo kita aja nggak dihargai orang pasti kesal kan?"

Inspirasi dari buku Nggak ada salahnya kok kalau kita baca-baca buku psikologi sosial. Dengan begitu, kamu bisa tahu sendiri bagaimana hal yang baik dan buruk untuk orang lain. (*/det) PROFIL RESPONDEN :

Apa yang kamu tahu dari menghargai hak orang lain ?

Baba Ali Akbar

Nggak usah jauh-jauh dulu deh.. dalam ruang lingkup keluarga kamu bisa coba mengalah sama adikmu, seperti Angella Putri yang kadang payah buang ego-nya saat berurusan dengan sang adik. “Coba ngertiin apa yang adik mau itu payah, tapi aku tetap berusaha. Selama apa yang dia mau itu masih masuk akal, coba diikutin aja lah,” cuap cewek yang masih berstatus pelajar di SMKN 5 P ini. Lain dengan Febicola Manihuruk, menurut cewek berzodiak Gemini ini, menghargai hak orang lain bisa ditunjukan lewat bagaimana dia berbagi dengan orang lain. “Banyak cara kok buat nunjukin kalau kita mau menghargai hak orang lain. Kamu mau berbagi dengan orang lain udah termasuk salah satunya, dengan ini kita juga udah bantu mereka yang mungkin nggak seberuntung kita,” ungkap mahasiswi Fekon Untan ini bijak. Mungkin kita sering tidak menyadari arti penting dari menghargai orang. Padahal itu adalah satu kunci penting untuk kita menuju kedamaian. Tapi X pengen tau dunk dalam hal apa sich kamu menghargai hak orang lain ini? “Pastinya dalam smua hal, nggak perlu yang berlebihan, cukup menghormati aja keputusan orang lain,” cuap Satri Putri. Bayangkan aja jika di dunia ini nggak ada yang saling menghargai pasti akan kacau berantakan. “Coba deh rasain kita nggak dihargai, pasti rasanya ingin marah,” papar pelajar SMPN 20 ini. “I’m agree too, jangan pernah mengucilkan orang lain hanya karna dia tidak lebih kaya dari kita dan tidak lebih sempurna dari kita,” sahut Melanie Sari. Pelajar SMKN 7 ini sangat menerapkan arti menghargai di hidupnya dengan cara nggak pernah mengucilkan orang lain. Intinya bagaimana seseorang dapat menghargai orang lain, maka orang lain pun akan menghargai orang tersebut dan akan tercipta suatu kondisi yang harmonis dan nyaman. So, tingkatkan terus akan kesadaran menghargai orang lain yah guys. Itu baru sobat X (kar/li2)

by : Laras

Mahasiswa STIKES Kapuas Raya Sintang "Bagus banget kalo ada anak yang pandai menghargai orang lain. Berarti nilai-nilai moral dan etika udah tertanam dalam diri anak tersebut. Niscaya itu akan menjadi kebiasaannya sampe tua nanti."


Beda Orang, Beda Cara Menghargai orang lain wajib untuk dilakukan. Apalagi kepada teman, orang yang biasa kita jumpai. Salah satu caranya adalah menjaga sikap saat berinteraksi dengannya. Ketika dia menyampaikan pendapat, cara menghargainya adalah dengan memberikan komentar yang baik agar dia merasa dihargai. Kalau dengan sahabat, caranya bisa berbeda. Karena hu bungan dengan sahabat lebih akrab daripada teman biasa, bahasa yang digunakan pun lebih akrab. Kecenderungan untuk melakukan hal-hal ”gila” juga lebih besar. Untuk itu, cara untuk menghargainya berbeda. Jika ada sepasang sahabat yang malah menggunakan sapaan aneh, bukan berarti dia tidak menghargai. Namun, itu bukti keakraban mereka. Intinya, kepada siapa pun, kita harus menghargai. Namun, caranya saja yang berbeda, bergantung pada siapa yang dihadapi. (*/det)

Menurutmu, anak yang menghargai orang lain? (3 tertinggi) Nggak egois : 35% Pengertian : 33,3% Teladan yang baik : 31,7%


"Label Harga"




Pontianak Post l Jumat 18 Februari 2011

Bunga Citra Lestari Berat badan penyanyi Bunga Citra Lestari kembali normal setelah melahirkan. Sempat berbobot 72 kilogram saat hamil anak pertama, kini beratnya susut menjadi 50 kilogram. Kini istri Ashraf Sinclair itu lebih percaya diri. “Alhamdulillah, berat badanku sudah ideal lagi berkat kerja keras juga lho. Sebenarnya, beratku masih harus turun 1”2 kilogram lagi sampai ke berat awal. Tapi, nggak apa-apa,” ucap Bunga saat ditemui dengan sang suami di Senayan Selasa malam lalu (15/2). Pelantun tembang Kecewa tersebut mengatakan, dirinya mengikuti program penurunan berat badan pasca melahirkan. Dengan berat badannya sekarang, Bunga mengaku nyaman. Meski, bentuk tubuhnya tidak bisa kembali normal seperti saat masih gadis dulu. “Bagian tertentu seperti lengan dan payudara nggak bisa ditutupi, pasti akan terlihat lebih berisi meski beratnya sudah turun. Sebab, itu risiko menyusui. Ya, namanya juga baru jadi ibu,” tuturnya. “Buat saya, namanya juga sudah nggak gadis lagi, nggak apa-apa. Nggak perlu langsing banget,” tambah dia. Bintang film Saus Kacang itu menjelaskan, dirinya tidak mau menurunkan berat badan secara drastis dalam waktu cepat. Sebab, sekarang yang diperhatikan tidak hanya dirinya sendiri, tetapi juga anak pertamanya, Noah Sinclair. “Nanti malah nggak bagus buat tubuh dan Noah,” ujar Bunga. Sebagai ibu, dia bersyukur karena kandungan ASI yang dimiliki sangat cukup. Sebab, ada ibu-ibu yang ASI-nya tidak mencukupi. “Alhamdulillah, saya sih tidak masalah dengan ASI. Saya berniat memberikan ASI hingga anakku nanti berusia dua tahun. Setiap dua jam sekali pasti saya menyusui,” jelasnya. Karena itu, Bunga tidak bisa meninggalkan anaknya lama-lama. “Kalaupun ditinggal, maksimal hanya empat jam,” tegasnya. Jika berangkat ke luar kota, sebisabisanya Noah diajak. Sejauh ini Bunga telah membawa Noah ke Semarang, Jogjakarta, dan Bandung untuk menemaninya bekerja. (jan/c8/tia)


Ogah Terlalu Langsing

Justin Bieber

Menentang Seks Bebas dan Aborsi Sebagai bintang yang digilai banyak penggemar muda, Justin Bieber, 16, menyadari bahwa apa yang dilakukannya menjadi perhatian para fans. Selain terus berjalan di jalur positif, dia belakangan kerap membahas isu-isu yang berhubungan dengan anak muda. Yang terbaru, pelantun Never Say Never itu menyatakan menentang seks bebas tanpa cinta dan aborsi. “Saya pikir, Anda tidak semestinya melakukan hubungan seksual kepada siapa pun, kecuali Anda mencintainya,” ujar Bieber dalam wawancara dengan majalah edisi terbaru Rolling Stone terbitan Amerika Serikat (AS). Apakah Bieber menunda berhubungan seksual sam-

pai menikah” Dia menjawab, “Saya pikir, Anda sebaiknya menunggu sampai orang yang benar-benar Anda cinta itu datang,” katanya, seperti dilansir People kemarin. Dalam wawancara tersebut, Bieber juga mengemukakan pendapatnya tentang aborsi yang masih jadi perdebatan di AS. “Saya benar-benar tidak meyakini aborsi. Bukankah itu sama dengan membunuh bayi” tutur penyanyi yang digosipkan menjalin hubungan dengan Selena Gomez tersebut. Tentang kemungkinan menjadi warga negara AS, Bieber mengungkapkan belum tertarik. “Anda (AS, Red) seperti setan,” katanya. “Kanada adalah negara terhebat di dunia,” im-

buh penyanyi yang terlahir di Kanada dan berkewarganegaraan Kanada itu. “Jika pergi ke dokter, kami tidak perlu cemas biayanya. Di sini (AS, Red), sepanjang hidup Anda bisa sangat cemas tentang masalah biaya kesehatan. Anda bisa jadi bangkrut karena tagihan kesehatan,” papar Bieber. “Bayi bodyguard saya terlahir prematur. Dia harus membayar tagihan tersebut. Di Kanada, jika bayi Anda prematur, bayi tersebut masih boleh tinggal di RS bila diperlukan. Anda bisa pulang tanpa memusingkan biaya,” jelasnya. Saat ini Bieber masih sibuk dengan promo film dokumenter Never Say Never yang berkisah tentang perjalanan hidupnya.

Kemarin dia menyambangi London, Inggris, untuk menyapa penggemarnya. Seperti di tempat lain, premiere film yang berlangsung di O2 Cineworld itu dipadati ribuan penggemar Bieber. Sebagian besar adalah remaja putri. (c12/tia)


Siapkan Mental Raul Hadapi Media

KD Rayu Calon Suami JAKARTA - Menjelang hari bahagia, Krisdayanti (KD) tak hanya sibuk mempersiapkan segala sesuatu yang berbau teknis penikahan. Tetapi, dia juga sibuk mempersiapkan mental calon suaminya, Raul Lemos. Perbedaan profesi antara KD dan Raul memang mendasar. KD sangat terbiasa dengan publikasi, sedangkan Raul tidak. Dalam beberapa kali kesempatan, pengusaha asal Timor Leste itu merasa kurang nyaman berhadapan dengan wartawan. Kali pertama saat keduanya menggelar jumpa pers tentang hubungan kasih yang terjalin. Saat itu, secara spontan Raul mencium KD dan esok paginya adegan itu tersiar di infotainment. Aksi spontan Raul dan KD sempat diprotes beberapa pihak. Lalu, yang kedua ketika keduanya ditemui setelah menonton konser David Foster pada Oktober lalu. Raul membentak wartawan saat kamera menyorot mereka. Sebagai public figure papan atas, gerakgerik KD memang selalu menjadi incaran media. Namun, rupanya, Raul belum terbiasa

dengan hal semacam itu. “Kalau ditanya tentang persiapan (menikah), sekarang ini saya justru berkonsentrasi ke persiapan mental. Calon suamiku kan bukan orang entertainment,” kata penyanyi bersuara merdu itu saat ditemui di Studio 1 RCTI, Kebon Jeruk, Jakarta Barat, kemarin (17/2). Selanjutnya, pelantun Amarah itu mengungkapkan bahwa Raul masih trauma dengan justifikasi masyarakat terhadap dunia keartisan yang dianggap glamor. Jika menggelar pesta pernikahan nanti, tentunya akan banyak orang dari kalangan entertainment yang hadir dan juga media yang memberitakan. “Jadi, sekarang ini saya sedang terus merayu Raul supaya nanti dia bisa nyaman berhadapan dengan orangorang entertainment. Soalnya, dia masih trauma dengan kamera teman-teman wartawan,” jelas ibu dua anak itu. Padahal, selama ini justru Raul-lah yang paling sibuk mempersiapkan pesta pernikahan. Apalagi, sebagai pengusaha, dia masih memiliki banyak pekerjaan yang harus diselesaikan. “Proyeknya di mana-

mana. Gara-gara menyiapkan ini, jadi sedikit terbengkalai. Sebab, Raul harus bolak-balik Jakarta?Dili,” tambahnya. Beberapa waktu lalu dikabarkan bahwa salah satu persiapan pernikahan mereka ialah membuat klip video di Dili yang akan dijadikan suvenir saat pesta pernikahan. Maia Estianty disebut-sebut sebagai orang yang menciptakan lagu yang dipersiapkan untuk pernikahan KD. “Klip video itu bukan untuk dibagikan ke teman-teman, tapi sebagai kado pernikahan saya buat Raul. Saya berterima kasih sekali karena dikasih kesempatan untuk membuat klip video di sana,” jawab KD. Raul juga terlibat sebagai model dalam klip video itu. Sudah semakin jelas bahwa persiapan pernikahan KD-Raul begitu nyata. Seolah sudah mendekati hari H. Tetapi, lagilagi KD lebih suka menyembunyikan tanggal pernikahannya. Apakah 24 Maret nanti tanggal pernikahannya, bertepatan dengan ulang tahun yang ke-36” “Eh!!..Ulang tahun. Yah tunggu saja nanti ya,” ucapnya berahasia.(jan/c4/tia)

world soccer

30 Nagatomo Debut Starter


FLORENCE- Pemain Jepang Yuto Nagatomo akhirnya menjalani debutnya sebagai starter bersama Internazionale Milan. Nagatomo bermain sebagai bek kiri saat Inter menekuk Fiorentina 1-2 di kandangnya dalam lanjutan Serie A Liga Italia kemarin. Dalam laga tersebut, Nagatomo bermain cukup baik. Dia berhasil menggantikan peran yang selama ini diemban Cristian Chivu yang absen karena skorsing. Walau berperan sebagai fullback, pemain pinjaman dari Cesena tersebut berani naik membantu penyerangan. Kecepatan Nagatomo kerap menyulitkan pertahanan lawan. Meski demikian, pemain 24 tahun tersebut tidak bermain 90 menit penuh. Dia digantikan Houssine Kharja pada menit 71. Kesempatan menjadi pemain inti membuat Nagatomo sangat bahagia. “Saya sedikit gugup. Tetapi saya percaya diri dan berusaha untuk memberikan yang terbaik baik dalam bertahan dan menyerang,” katanya seperti dilansir Football Italia. Asisten Pelatih Inter Giuseppe Baresi sangat gembira dengan penampilan Nagatomo. Dia mengatakan mantan pemain FC Tokyo tesrebvut menjalankan tugasnya dengan baik. “Dia tampil baik saat melakoni debut melawan tim kuat. Kami senang dengan kemenangan ini. Hasil latihan kami tidak sia-sia,” ujar Barsei di situs resmi klub. Di sisi lain, pemain yang mengantarkan Jepang menjadi juara Asia 2011 tersebut menambahkan, kemenangan itu sangat penting. Terutama untuk membawa kembali Inter pada jalur scudetto. Saat ini I Nerazzurri hanya tertinggal lima poin dari pimpinan klasmen AC Milan. “Ini kemenangan besar karena diperoleh dari tim yang sangat tangguh. (Esteban) Cambiasso memberikan bantuan yang sangat besar. Dia selalu memberi saya nasehat,” ungkapnya. Sampai sejauh ini Nagatomo sudah bermain tiga kali bersama Inter. Dia menjalani debut saat Inter menang 5-3 atas AS Roma pekan lalu. (nur)

Yuto Nagatomo


Pontianak Post


Jumat 18 Februari 20111

1 Fiorentina v Inter Milan 2

Terus Dekati Capolista FLORENCE - Inter Milan berreaksi dengan baik pascakekalahan dalam derby d’Italia melawan Juventus (13/2). Tim berjuluk Nerazzurri tersebut meraih kemenangan atas Fiorentina 2-1 (1-1) pada laga tunda Serie A di Artemio Franchi, kemarin dini hari (17/2). Kemenangan yang penting bagi Inter dalam perburuan scudetto di musim ini. Mereka sekarang menyodok ke posisi ketiga dengan 47 poin dan hanya tertinggal lima angka di belakang penguasa klasemen sementara AC Milan (52 poin). “Setelah kekalahan dari Juve, ini hasil signifikan. Menyenangkan bisa kembali ke trek yang benar ketika menghadapi salah satu tim yang sedang tampil baik di kompetisi. Kami bermain baik dan sangat kompak,” ungkap Beppe Baresi, asisten pelatih Inter, di situs resmi klub. Namun, Baresi ogah menyatakan diri sedang mengejar Milan. “Kami tidak sedang berkejaran dengan siapapun. Namun, kami sedang berkejaran dengan didi sendiri. Kami hanya harus berjuangdan merebut tiga poin,” ujar kakak dari legenda AC Milan Franco Baresi itu. Saat ini, Inter memiliki jumlah pertandingan sisa yang sama banyak dengan Milan. Dengan sisa 13 pertandingan lagi, maka segalanya masih mungkin terjadi. April nanti,

di kala derby della Madonnina antara Milan dan Inter dihelat, diyakni sebagai momen-momen penentu. Bermain di Artemio Franchi, tuan rumah sudah terkejut ketika laga baru berlangsung enam menit. Kesalahan bek Fiorentina Michele Camporese dalam mengantisipasi umpan silang striker Inter asal Kamerun Samuel Eto’o berbuah gol bunuh diri. Namun, Fiorentina mampu menyamakan skor pada menit ke-33 lewat Manuel Pasqual. Skor imbang 1-1 itu bertahan hingga jeda turun minum. Di babak kedua, Inter akhirnya mampu mengungguli Fiorentina melalui gol yang dicetak Giampaolo Pazzini di menit ke-62. Kemenangan yang membuat mereka membawa pulang tiga angka dan juga menjaga catatan hebat di tangan Leonardo. Dalam sepuluh laga di era kepelatihan Leonardo, Inter mampu merebut delapan kemenangan dan itu membuat Inter terus mendekati Milan. Bagi Fiorentina kekalahan itu sangat menyakitkan, karena dalam beberapa laga terakhir performa mereka terus membaik. Apalagi, menurut pelatih Fiorentina Sinisa Mihajlovic, permainan kedua tim cukup berimbang, sebelum akhirnya kalah. “Kami tidak pantas kalah. Inter



Gol: Pemain tengah Inter Milan Giampaolo Pazzini (kanan) saat mencetak gol ke gawang Fiorentina dalam pertandingan Liga Seria A Italia yang digelar di Stadion Artemio Franchi di Florence (16/2).

mencetak gol dari satu-satunya peluang mereka sepanjang babak pertama. Sungguh disayangkan karena kesalahan pertama kami itu membuat mereka lebih dulu unggul,” bilang Mihajlovic, seperti dilansir Football Italia. Mantan asisten pelatih Inter itu

ogah menyalahkan pemainnya atas gol bunuh diri yang dilakukan Camporese. “Michele memang melakukan kesalahan, tapi saya yakin dia akan belajar. Dia masih muda dan perlu banyak belajar,” lanjut Mihajlovic. Kekalahanitu membuatLaViola,

julukan Fiorentina, tertahan di posisi kesepuluh klasemen sementara dengan mengemas 32 poin. Sulit bagi mereka untuk memenuhi ambisi finis di zona Eropa pada musim ini seiring performa inkonsisten sepanjang musim. (ham)

Dirampok, Bintang Palermo Shock ROMA - Abel Hernandez tak akan bisa melupakan tragedi pada Rabu (16/2) lalu. Sebab, pada hari itu dia menjadi korban perampokan bersenjata yang nyaris merenggut nyawanya. Insiden yang menimpa bintang Palermo itu terjadi pada pukul 18.30 waktu setempat. Dalam perjalanan pulang menuju rumah setelah mengikuti sesi latihan, pemain asal Uruguay tersebut dihadang perampok di tengah jalan. Perampok memintanya turun dari mobol dan kemudian memasukkan pistol ke dalam mulutnya. Dia diancam akan dibunuh jika jika tidak menyerahkan semua barang berharganya. Setelah mempreteli jam tangan dan cincin yang dikenakan, perampok itu langsung pergi. Abel tampak shock berat dengan kejadian tersebut. Namun, pemain 20 tahun itu masih bisa

melaporkan kejadian yang menimpanya kepada pihak berwajib. Agen Abel, Vincenzo D?Ippolito mengakui, kalau kliennya masih trauma. Vincenzo juga menegaskan kalau Abel tak akan meninggalkan Palermo. “Saya sudah berbicara dengannya, dan dia memang masih trauma. Tapi, dia tak akan kemana-mana,” kata Vincenzo kepada SportItalia. “Dia pulang setelah berlatih. Nah, saat mobilnya melaju, ada sepeda motor yang menguntit dan ingin mendahuluinya. Abel saat itu keluar untuk melihat apa yang terjadi. Tapi, saat akan masuk ke mobil, dia ditarik perampok yang kemudian menodongkan senjatanya,” jelasnya. “Abel sangat takut. Tapi sekarang dia sudah tenang karena berkumpul dengan keluarganya,” timpal Vincenzo. (bas)

Abel Hernandez




Pontianak Post


Rita Pasti Mundur



Jumat 18 Februari 2011

JAKARTA- Dua periode kepengurusan rupanya sudah cukup bagi Rita Subowo. Dia akhirnya bakal menanggalkan jabatannya sebagai Ketum KONI/ KOI pada Musornas Desember mendatang. “Saya tidak akan maju lagi untuk menjadi ketum KONI/ KOI. Biarkan orang lain saja yang menjabatnya,” terang Rita kemarin (17/2). Rita merasa dirinya sudah cukup lama mengemban tugas tersebut. Karena itu, dia ingin memberikan kesempatan pada generasi muda untuk menggantikannya sebagai ketum induk organisasi olahraga se Indonesia tersebut. Selain itu, mantan Ketum PP PBVSI tersebut sudah merasa sangat tua untuk kembali mengamban amanah itu. Bahkan, Rita juga tak mau maju seandainya ada pihak yang mengusungnya. Artinya, keputusan Rita untuk tak maju lagi sudah bulat dan tak bisa ditawar-tawar lagi. Apalagi, menurutnya masih banyak sosok muda yang bisa menggantikan dirinya sebagai ketum KONI/ KOI. “Pasti banyak yang lebih muda yang mau. Saya ini ingin momong cucu. Saya kan sudah lama sekali menjabat sebagai Ketum KONI/ KOI,” tambah perempuan asal DI Jogjakarta tersebut. Rita mengharapkan, nantinya sosok yang menggantikan dirinya harus lebih bekerja keras untuk membangun kejayaan olahraga Indonesia. Selain itu, figure pengganti tersebut mesti bisa menyatukan berbagai elemen pendukung kemajuan olahraga tanah air. Di antaranya ialah KONI seluruh provinsi, semua induk organisasi serta Kemenpora. Elemen terakhir lah yang sebenarnya lebih ditekankan. Pasalnya, sudah menjadi rahasia umum jika hubungan antara KONI/ KOI dengan Kemenpora nyaris tak pernah romantis. Terutama jika menyangkut dana untuk persiapan para atlet guna menyongsong sebuah even. “Jadi memang harus dirangkul semua. Karena itu, Ketum KONI/ KOI yang baru mesti mau bekerja keras untuk olahraga Indonesia,” tambah perempuan yang juga menjabat sebagai ketua dewan pelakasana Program Indonesia Emas (Prima). Kepengurusan KONI yang sekarang sebenarnya sudah habis 23 Februari mendatang. Namun, berdasarkan rapat anggota yang digeber di Riau Minggu (13/2) kemarin, mayoritas masih menginginkan Rita untuk kembali menjabat sebagai ketum KONI/ KOI. (ru)


Hadapi “Dragon”, Daud Lahap Semua Menu Latihan Damianus Kecewa Terhadap Pemprov Kalbar

BUDIANTO/Pontianak Post

KELOLA: Stadion sepakbola kebanggaan masyarakat Kalimantan Barat, SSA, kini akan dikelola oleh PSSI Kalimantan Barat. Itu setelh KONI Kalbar menurunkan surat keputusan yang menunjuk PSSI sebagai pengelola utama.

PSSI Kelola Stadion SSA PONTIANAK-Kebingungan PSSI selama ini tentang kewenangan pengelolaan Stadion Sultan Sy Abdurachman (SSA) terjawab sudah. KONI Kalbar pada tanggal 8 Februari 2011 lalu telah mengeluarkan SK Nomor 02 tahun 2011 yang menunjuk PSSI Kalbar sebagai pengguna, pemakai sekaligus pihak yang bertanggung jawab atas pemeliharaan dan perawatan Stadion SSA Pontianak beserta lingkungannya yang terletak di kawasan Gelanggang Olahraga Khatulistiwa. SK ini dengan tegas telah menyatakan kewenangan penuh pengelolaan SSA berada di tangan Pengprov PSSI Kalbar selama empat tahun kedepan. SK ini merujuk pada beberapa surat dari KONI maupun Gubernur Kalbar periode silam, di antaranya SK Ketum KONI Nomor 12/SKEP/KONI-KB/VIII/1998 tertanggal 14 Agustus 1998 yang belum dicabut, yang kala itu Komda PSSI diberikan kewenangan penuh untuk

mengelola SSA. SK tersebut juga menegaskan Ketua Pengprov PSSI Kalbar bertanggung jawab atas segala biaya perawatan dan pemeliharaan SSA. Dan juga tidak diperkenankan mengalihkan penggunaan dengan hak memakai kepada pihak ketiga tanpa izin Ketua Umum KONI Kalbar. Pun demikian, lingkungan SSA tidak hanya dipakai PSSI semata melainkan juga dipakai beberapa cabor antara lain PERTINA, PABBSI, KODRAT, FPTI dan PASI serta sejumlah kantin dan kerap digunakan untuk ajang balap motorcross. “Surat ini sudah jelas PSSI yang kelola SSA. Tinggal nanti kita akan koordinasi dengan cabor-cabor lainnya,” kata Ketua Harian Pengprov PSSI Kalbar Rusman Nilam disela rapat internal jajaran pengurus PSSI Kalbar Sabtu (12/2) lalu di Sekretariat PSSI Kalbar. Rapat berlangsung alot untuk menentukan langkah-langkah

yang akan diambil PSSI menindak lanjuti SK KONI tersebut. Peninjauan terhadap SSA sebelumnya telah dilakukan antara KONI, PSSI dan beberapa cabor lainnya Januari lalu. Sejumlah bagian di SSA banyak yang mengalami kerusakan. Namun, KONI telah mengusulkan anggaran Rp700 juta untuk perawatan SSA dan beberapa venues lainnya. Dan terhadap empat cabor lainnya seperti FPTI, PABBSI, KODRAT dan PERTINA secara bertahap akan dicarikan venues baru. Kecuali PASI yang tetap melekat di SSA. “Jadi untuk sementara pengelolaan SSA akan dilakukan secara terpadu dan komprehensif. Untuk itu kita akan membentuk koordinator yang mungkin diketuai Bidang Sarana dan Prasarana KONI kemudian ada subkoordinator yang diketuai oleh masing-masing keenam cabor tersebut,” kata Erwin Anwar Ketua Bidang Binpres KONI Kalbar. (bdi)

Mantan Bomber Timnas Gabung LPI JAKARTA - Di pengujung karirnya, mantan bomber andalan timnas Merah Putih Kurniawan Dwi Yulianto memilih bergabung dengan salah satu tim Liga Primer Indonesia (LPI). Kemarin, pemain 34 tahun itu resmi diperkenalkan sebagai pemain baru Tangerang Wolves. Di paruh pertama musim ini, pemain yang akrab disapa Kurus itu memperkuat tim Divisi Utama PSMS Medan. “Kurniawan resmi menjadi pemain Tangerang Wolves. Dia sudah latihan bersama tim sejak dua hari lalu. Kami berharap sebagai pemain senior, Kurniawan bisa membantu para pemain muda di klub,” kata Akmal Marhali CEO Tangerang Wolves saat press conference


di Kantor LPI kemarin siang. Menurut Akmal, dikontraknya Kurniawan adalah satu keinginan dari public Tangerang yang ingin ada pemain bintang di Tangerang Wolves. “Karena itu kami putuskan memilih Kurniawan. Kmai yakin dia akan jadi daya tarik tersendiri bagi masyarakat Tangerang,” lanjutnya. Kepada wartawan Kurniawan mengungkapkan bahwa dirinya memilih bermain di LPI karena tertarik dengan misi sepak bola professional yang diusung liga non APBD itu. Selain itu, pemain yang pernah berkostum Sampdoria Primavera itu juga mengaku mendapat masukan dari salah satu

sahabat dekatnya, Bima Sakti, yang terlebih dulu bergabung di LPI bersama Persema Malang. “Sebelum saya memutuskan bergabung di sini, saya banyak bertanya kepada Bima Sakti dan jajaran LPI mengenai visi misi LPI ke depan. Saya melihat mereka bener-benar ingin menuju sepakbola Indonesia dan saya ingin bermain di Liga Profesional,” kata Kurniawan. Sebelum resmi bergabung dengan Tangerang Wolves, Kurniawan sempat diberitakan bakal bergabung dengan Real Mataram dan Solo FC. “Saya sebenarnya ingin bermain di Jawa Tengah agar

bisa lebih dekat dengan orang tua. Tapi setelah bertanya-tanya dengan CEO Tangerang Wolves saya akhirnya putuskan main di sini,” beber pemain kelahiran Magelang 13 Juli 1976 itu.Mantan striker Oelita Jaya, PSM Makassar, Persebaya, Persija, PSPS Pekan baru, Persitara Jakarta Utara, dan Persela Lamongan itu menyatakan tidak ambil pusing dengan dipersoalkannya LPI oleh PSSI. “LPI kan baru berjalan enam minggu. Saya juga baru baru melihat dua pertandingan. Jadi belum bisa melihat terlalu jauh. Tapi saya yakin ke depan LPI bisa menjadi lebih baik,” tegasnya. (ali)

PONTIANAKgat banyak petinju Kesempatan meberpotensi baik mang tidak akan yang junior maudatang berulang pun yang senior. kali. Demikian Mereka termotivasi pameo kuno yang oleh keberhasilan selalu diingat oleh Daud, bahkan Daud “Cino” Yormereka tinggal dan pasca diteriserumah dengan manya tantangan Daud. Jadi sedikit dirinya menghbanyak, kata Daadapai Sang Naga, Daud “Cino” Yordan mianus, keinginan Chris Jhon, pemeuntuk berprestasi gang sabuk juara Super Cham- mengikuti seniornya sangat pion WBA 17 April mendatang tinggi dan para petinju inilah di Jakarta. yang dijadikan latih tanding di Untuk itulah dalam masa daerah walaupun rencananya persiapan yang kurang lebih akan mendatangkan petinju delapan minggu ini Daud men- dari Jakarta Maret mendatang gasah seluruh kemampuannya untuk sparing daud. bersama sang kakak Damianus Sementara itu dukungan Yordan di Sukadana KKU. Per- semangat untuk Daud datang siapan yang matang akan men- dari Masyarakat KKU dan pihak jadi faktor pendukung dalam Pemda Kayong Utara dalam hal mencapai impian menjadi juara ini Bupati, Wakil Bupati serta dunia yang sudah didepan mata. Ketua Pertina KKU yang juga ”Setiap hari Daud melahap Sekda KKU Hendri Siswanto. semua menu latihan yang spar- “Kami merasa sangat beruntung tan yang diberikan saya guna mendapatkan support yang menyokong kemampuannya besar dari semuanya,walaupun menghadapi Chris Jhon. Hingga tidak berupa uang atau materi saat ini Daud menjalankan lati- tapi kami merasa ada perhatian han dengan sangat antusias dan dengan membuka akses komembuat dirinya merasa sangat munikasi pada kami. Ini sangat enjoy walaupun program lati- kontradiktif dengan han berat,” ungkap sang pelatih Pemerintah Provinsi Kalbar Damianus Yordan. yang seolah tidak mau tahu Damianus juga sangat op- dengan prestasi yang telah kami timis jika pola latihan tersebut raih selama ini,” ungkap Dami dijalankan secara sungguh- panjang lebar. sungguh maka hasil yang diperJustru, kata Dami, kubunya oleh akan maksimal. Untuk disupport oleh orang luar yang membuat adiknya tampil baik tidak ada pertautan daerah menghadapi Cris Jhon, Dami- ataupun keluarga. Perhatian anus mengatakan sudah me- tersebut datang dari Gubernur nyusun program yang memang Aceh, DKI dan Kalimantan Tensudah lama menjadi program gah yang dengan rasa bangga terbaik. “Untuk menghadapi mau datang ke arena pertandChris Jhon saya memberi pe- ingan Daud saat mengalahkan nambahan dalam peningkatan petinju Argentina David Marvolume dan intensitas latihan ciano Desember 2010 lalu. baik endurance, power,dan “Tanpa diundang mereka speed,” ungkapnya. datang, ini hal yang sangat luar Saat itu, tambah Damianus, biasa, mereka tahu bahwa Daud dirinya juga memberikan pro- yang berasal dari pedalaman gram bagi Daud dengan volume Kalimantan adalah bagian anak yang panjang seperti aerobik bangsa yang berprestasi. Tapi dan anaerobik power, sedang- kami merasa aneh jika sudah kan untuk intensitasnya akan tiba di tempat sendiri, jangankmasuk saat empat minggu je- an perhatian yang kami dapat lang laga. “Metode ini saya pakai dari Pemprov Kalbar, bertanya agar sepanjang pertandingan atau salam tangan ucapkan Daud mampu bugar dan di- selamat saja belum pernah harapkan konsisten menyerang kami rasakan. Padahal untuk sang Naga julukan Chris Jhon,” olahraga Kalbar kami sudah katanya berbuat. Kami malu jika ditanya Diungkapkan Damianus, teman-teman tentang hal ini,” di Kayong Utara memang san- tandasnya. (bdi)





PSSI Belum Beri Dana JAKARTA - Timnas U-23 menghadapi persoalan klasik. Yaitu pendanaan. Seminggu menjelang menghadapi Turkmenistan (232/2) di leg pertama babak pra kualifikasi Olimpiade 2012 pendanaan masih menyisakan tanya jawab besar. Sampai saat ini Timnas mengaku belum mendapatkan suntikan dana dari PSSI juga pemerintah. Menurut Wakil Bidang Teknis BTN Iman Arif mengungkapkan, timnas membutuhkan biaya besar. “Kami belum menerima dana dari PSSI atau pemerintah. Agak bingung karena agenda sudah dekat. Timnas butuh dana yang tidak sedikit,” katanya. PSSI sebelumnya mengalokasikan dana Rp 1,9 miliar untuk membiayai kegiatan timnas proyeksi kualifikasi Olimpiade. Pemerintah juga mengaku sudah menyiapkan total dana Rp 50 miliar untuk 2011. Dana besar itu sudah disetujui Komisi X DPR dan diproyeksikan untuk membiayai semua kegiatan timnas. Selain Pra Olimpiade, Merah Putih muda akan bertarung di SEA Games (SEAG) 2011. Iman Arif menambahkan, biaya transportasi timnas U-21 ke Turkmenistan pada leg kedua 9 Maret mendatang diperkirakan menelan anggaran Rp 1,5 miliar. Biaya akan membengkak bila ditambah akomodasi pemain. “Kalau transportasi ke Palembang tidak terlalu besar. Tapi, biaya ke Turkmenistan sangat tinggi karena harus transit di Dubai. Biaya transportasi Rp 1,5 miliar sudah pergi pulang, tapi itu penerbangan komersial. Kalau uang saku pemain masih bisa ditangani,” lanjutnya. Saat iniYongky Aribowo dkk mendapatkan uang saku USD 50 per hari. Terkait pendanaan tersebut, Bendahara PSSI Achsanul Qosasih mengatakan dana sedang diurus. “Sedang kita usahakan dananya. Toh surat dari BTN juga baru saya terima kemarin (Rabu-Red),” kata Achsanul. “Kami tahu tahu sekarang Timnas butuh dana besar karena agendanya padat. Kita sedang upayakan,” lanjutnya. Tapi, meski pendanaan belum ada kejelasan, rencana naturalisasi pemain keturunan terus berjalan. Tiga pemain Indo-Belanda saat ini tengan diproses menjadi WNI ( Warga Negara Indonesia). Yaitu Diego Michiels, Ruben Wuarbanaran, dan Joey Suk. “Untuk naturalisasi Ruben sudah oke karena tinggal menunggu paspor keluar. Bisa dikatakan Ruben sudah WNI (Warga Negara Indonesia). Kami saat ini sedang mengusahakan paspor ketiganya keluar pada akhir bulan ini,” beber Iman Arif. Sementara itu, dalam latihan kemarin sore Alfred Riedl tampak lebih memfokuskan pada akurasi tembakan pemain. Yongki Aribowo dkk juga menjalani latihan free kick dan penalti. “Kali ini latihan memang lebih banyak finishing, free kick dan penalti,” ujar Riedl usai latihan. “Selain untuk colling down, latihan ini juga untuk melihat kemampuan pemain sehingga kami dapat menentukan penembak penalti pertama, kedua, ketiga dan seterusnya,” lanjut Riedl. Ditanya mengenai formasi tim inti, Riedl masih enggan berkomentar. (ali)


Pontianak Post

Jumat, 18 Februari 2011

Memalukan, Cavaliers Tekuk Lakers CLEVELAND - Kesan perkasa pada Los Angeles Lakers seakan luntur di pekan ini. Tiga kali mereka mengalami kekalahan secara beruntun saat menjalani laga away. Tapi, yang paling menyakitkan justru mereka peroleh saat bertandang ke Quicken Loans Arena, kandang Cleveland Cavaliers, kemarin (17/2) WIB. Lakers yang merupakan juara bertahan dua kali gagal meraih kebangkitan saat menghadapi tim terlemah di musim reguler 2010-2011 itu. Jelas terlihat raut kekecewaan di wajah Kobe Bryant juga pelatih Phil Jackson seusai kalah 104-99. Kobe terlihat paling emosional dengan melempar jersey seusai pertandingan. “Ini menyakitkan, kekalahan yang menyakitkan. Sangat mengecewakan, saya tidak bisa mengerti,” ujar Pau Gasol, forward Lakers seperti dilansir Associated Press. Kekecewaan pantas dialami Gasol yang sebenarnya tampil gemilang dengan mencetak doubledouble. Gasol mengoleksi poin tertinggi bagi Lakers dengan 30 poin plus 20 rebound. Kobe bahkan hanya mencetak 17 poin plus 12 rebound dalam pertandingan itu. Namun, Lakers seperti kehilangan akal melawan motivasi tinggi yang ditunjukkan Cavaliers di hadapan pendukungnya. Kekalahan dari Cavaliers tersebut memberikan pekerjaan besar sebelum mereka kembali ke markasnya. Laga melawan Cavaliers itu memang menjadi penutup dari rangkaian tujuh laga away secara berturut-turut. Di empat away pembuka dari rangkaian itu, Lakers selalu menang, termasuk melawan dua tim besar di wilayah timur, Boston Celtics dan New York Knicks. Rentetan kemenangan terhenti ketika mereka

menghadapi raksasa wilayah timur lainnya, Orlando Magic. Tapi, dua kekalahan terakhir yang membuat Lakers tak bisa pulang dengan tenang. Kalah dengan selisih 20 poin dari Bobcats dan tak berkutik di hadapan Cavaliers yang sulit menang. “Problem kami adalah menganggap enteng lawan. Kami menganggap beberapa tim sebagai lawan ringan. Lalu, kami bermain seperti kucing dan tikus. Kadang kala, kucing harus kalah,” tutur Power Forward Lamar Odom. Pelatih Lakers,Phil Jackson menilai kekalahan timnya selain karena pertahanan solid lawan juga karena banyaknya kesempatan yang dibuang percuma oleh pasukannya. Selama pertandingan, Lakers melakukan 19 kali turnover, serta hanya memanfaatkan 42 persen tembakan yang didapat. “Kami terlalu banyak melakukan turnover yang melukai kami. Kami juga tidak bermain bagus secara keseluruhan sebagai tim yang bermain away,” ujar Jackson. Usai buzzer tanda berakhirnya laga kemarin, para pemain Lakers berjal;an gontai Kobe Bryant ke ruang ganti. Mereka baru akan bertanding lagi melawan Hasil NBA kemarin WIB Atlanta Hawks, Selasa (22/2) Washington W 76 v Orlando Magic 101 waktu setempat atau setelah Miami Heat 103 v Toronto Raptors 95 All-Star Weekend di kandang New Jersey nets 80 v Boston Celtics 94 mereka, Staples Center. LA Lakers 99 v C Cavaliers 104 Tak urung, dengan makin Indiana Pacers 109 v D Pistons 115 (OT) dekatnya deadline pertuAtlanta Hawks 90 v NY Knicks 102 karan pekan depan, rumor LA Clippers 98 v M Timberwolves 90 yang menyebutkan keterSacramento Kings 100 v Dallas M 116 tarikan Lakers pada bintang Philadelphia 76ers 114 v H Rockets 105 Denver Nuggets diperkiraD Nuggets 94 v Milwaukee Bucks 87 kan makin panas. Sejak dua GS Warriors 107 v Utah Jazz 100 pekan lalu, kubu Lakers NO Hornets 96 v PT Blazers 103 dan Nuggets sudah terlibat *Tuan rumah disebut terakhir dalam diskusi untuk pertukaran tersebut. (ady)

Resmi Gantikan Kubica - Teka-teki pengganti Robert Kubica untuk musim 2011 sudah terjawab. Tim Lotus Renault GP secara resmi merekrut Nick Heidfeld sebagai salah satu pembalapnya di musim ini. Heidfeld akan berpartner dengan Vitaly Petrov yang sejak tahun lalu sudah bergabung dengan Renault. Dengan kepastian tersebut, Heidfeld akan kembali menjalani sesi uji coba bersama Renult R31. Sebelumnya, dia sudah menjajal mobil baru Lotus Renault itu di Sirkuit Jerez, pekan lalu. Saat itu, dia masih bergantian dengan bruno Senna yang juga menjadi salah satu kandidat pengganti Kubica. Kubica mengalami cedera parah saat tampil dalam sebuah kejuaraan reli awal bulan ini. Pembalap asal Polandia itu masih berada di rumah sakit untuk terus menjalani perawatan secara intensif serta beberapa kali operasi. Karena itu, dia harus absen untuk pemulihan yang lama dan nyaris tak mungkin untuk tampil for-

mula 1 musim depan. Dalam perkembangan selanjutnya, selain heidfeld dan Senna, sejumlah nama dihubungkan dengan Lotus Renault. Sempat muncul nama juara dunia musim 2007 Kimi Raikkonen juga Vitantonio Liuzzi. “Saya kembali ke F1 dalam situasi yang b e r b e d a, tapi saya merasa sangat terhormat mendapatkan kesempatan ini. Semua berjalan begitu cepat dan saya sangat terkesan sejauh ini dalam hal fasilitas dan dedikasi mereka yang bekerja di Enstone (markas lotus Renault GP),” ujar Heidfeld. “Saya sangat menikmati uji coba akhir pekan lalu di Jerez dan saya sudah merasa nyaman dengan tim. Saya memiliki perasaan yang bagus terhadap mobil yang cukup inovatif. Saya sangat termotivasi dan tak sabar untuk memulai musim,” lanjut pembalap berusia 33 tahun itu. Pembalap yang mendapat julukan Quick Nick itu memulai karir F1 di musim 2000 bersama

REUTERS/Tim Chong/Files

GANTI : Pembalap Nick Heidfeld (kanan) dan Robert Kubica saat keduanya berada di Singapore mengikuti Formula One Grand Prix beberapa waktu lalu. Heidfeld akan menggantikan posisi Kubica

tim Prost. Dia sempat menjadi pembalap tes untuk Mercedes dan Pirelli di tahun 2010, lalu kembali ke ajang F1 pada September tahun tersebut. Dia bergabung dengan Sauber menggantikan Pedro de La Rosa di sisa musim.

Tak berlebihan, keputusan tim memilih Heidfeld karena didasarkan pada hasil memuaskan yang didapatkan pembalap Jerman itu di Jerez akhir pekan lalu. Team Principal Eric Boullier mengatakan dia dan timnya optimis pengalaman dari Heidfeld

bisa menghadirkan hasil sesuai harapan bagi Lotus Renault. “Tim kami melalui pekanpekan yang sangat sulit dan kami harus bereaksi dengan cepat. Kami memberikan kesempatan pada Nick di Jerez pekan lalu dan dia mengesankan kami. Dia cepat, berpengalaman, dan memiliki pemahaman yang kuat dalam hal teknis. Itu ditunjukkan dengan feedback yang dia berikan serta pemahaman terhadap mobil,” ujar Boullier. “Kami selalu mengatakan, prioritas kami adalah memiliki pembalap berpengalaman dan merasa bahwa Nick adalah pilihan ideal. Kami sangat senang menyambut Nick dan kami menantikan start mengesankan musim ini bersama Nick dan Vitaly di Bahrain,” bebernya Sementara itu, Kubica telah melalui operasi terakhir. Operasi tersebut berlangsung pada Rabu (16/2) malam waktu setempat di rumah sakit Santa Corona, tempat selama ini dia menjalani perawatan sejak mengalami kecelakaan. (ady/ang)

Pontianak Post  

18 Februari 2011

Read more
Read more
Similar to
Popular now
Just for you