Page 1

Berantas Percaloan, Tak Ada Lagi Dongan Sahuta

Baca di Hal



Tahun ke VII


Rp. 2000 Per Eksemplar

Bung! Hari Ini SABTU 31 JANUARI 2009

16 Halaman

Menyajikan Fakta, Peristiwa & Fenomena

Pengusaha Kayu Asal Medan Edarkan Miliaran Uang Palsu JAKARTA NAMA Benny Hasibuan sempat berkibar saat illegal logging masih marak dan jadi bisnis menggiurkan. Pengusaha kayu asal Medan ini bahkan sempat

terlibat dalam perambahan hutan di Tapanuli Selatan namun penahanannya ditangguhkan. Kini, nama Benny kembali menggemparkan dunia kriminal. Dia menjadi otak dari peredaran puluhan

miliar uang palsu di Indonesia. Bersamanya, 20 tersangka lain ikut dibekuk Polda Metro Jaya. Total puluhan miliar rupiah uang palsu disita dari mereka. Kasus (Bersambung ke hal 2)

Cek Harta Koruptor Jaksa Medan Tewas MADINA PENGUSUTAN kasus Adelin Lis memang unik dan melelahkan. Mulai Adelin ditangkap di China pada 2007, hingga kontroversi lima hakim Medan yang membebaskannya walau kasasi MA (Mahkamah Agung) memvonisnya 10 tahun penjara, dan kemarin (30/1) siang serombongan jaksa menuai petaka usai mendata aset perusahaan sang ‘raja kayu’ itu.

Ceritanya, usai menginventaris aset PT. Mujur Timber di daerah Sikara-kara, mobil Suzuki APV yang ditumpangi serombongan

Rumah Caleg Hanura Dilempar Molotov

Sering Diancam Sejak Jadi Pengurus MEDAN PELEMPARAN bom molotov ke kediaman Rusdi Sinuraya, Caleg DPRD Medan Dapem I dari Partai Hanura, masih misterius. Namun Rusdi (Bersambung ke hal 2)

Tangkap Kurir 105 Kg Ganja Brigadir Guntur Direncong BABALAN NYAWA Brigadir Guntur hampir melayang andai dia tak lincah mengelak. Beberapa kali tikaman rencong dielakkannya saat menangkap kurir ganja bersama Bripka Tona Simanjuntak dan Briptu Solicun, kemarin (30/1) di Desa Babalan, Kecamatan Besitang, Langkat. Awalnya, tiga personil Patwal Satlantas Polres Langkat ini berpatroli rutin di jalan lintas Besitang-Aceh. Namun mereka curiga melihat dua sepeda motor Kawasaki Ninja hijau, melaju kencang dari arah Aceh menuju Langkat. Berdasarkan pengalaman, mereka yakin, dua pengendara Ninja itu adalah Cucuk. Dalam dunia peredaran narkoba di Langkat, Cucuk (Bersambung ke hal 2)


Isnadi Yusuf bersama 105 kg ganja.

Bule Jerman Tewas OD di Tuktuk MEDAN KAWASAN wisata Tuktuk di Desa Ambarita, Kecamatan Simanindo, Samosir, Kamis (29/1) (Bersambung ke hal 2)

Kasus Sekeluarga Dibakar di Padang Lawas

“Rumah Kami Dibakar, Tangkaplah Pak Polisi” MEDAN DUA hari menjalani perawatan di RSU Herna, kondisi Yeni br Hasibuan (12) dan Nanda (4) makin membaik. Awal dirawat, tangan dan kaki kanan

Yeni melepuh. Kini, kaki kanan Yeni sudah bisa digerakkan dan luka bakar yang sebelumnya gembung, mulai kempes. Yeni juga tak meringis lagi bila menggerakkan tangan kanannya.

Sedangkan luka bakar di tangan dan kaki kanan Nanda, mulai mengering. Nanda mulai bisa senyum dan jarang menangis lagi. Sementara, Ali Nanga

(Bersambung ke hal 2)

Ketiga nelayan yang dibajak 15 pria berklewang.




15 Pria Berklewang Bakar Pukat Trawl PANTAI CERMIN AKSI pembajakan disertai pembakaran terjadi di wilayah perairan Pantai Kuala Lama, Kecamatan Pantai Cermin, Ser-


jaksa dari Kejaksaan Negeri (Kejari) Medan terjun bebas ke parit besar. Peristiwa terjadi di


gai. Pukat Trawl yang dinakhodai Muslim (32) warga Dusun II, Desa Regemuk, Kecamatan Pantai Labu dibakar 15 pria (Bersambung ke hal 2)

SIAPA yang meragukan keseksian penyanyi Anggun. Keeksotisannya semakin terpancar dengan gayanya yang energik. Penampilan Anggun memang terkesan kuat. Kuat bagai suara altonya (Baca hal 2)



(Bersambung ke hal 2)

Bayi Kepala 2 RS Adam Malik Medan

Kandang Singa

Lepas Selimut Saja Syukur SUGIONO mulai lega. Kecemasan warga Julok Rayeuk Utara, Kecamatan Julok, Aceh Timur, ini mulai berkurang begitu mendapat kabar istrinya bakal datang ke Medan. Sambil menghisap rokok Gudang Garam Merah di tangannya, ayah bayi kembar siam Marwati 1 dan Marwati 2 (foto) ini, mengaku sempat bingung menghadapi kondisi istrinya di Aceh dan bayi kembarnya di Medan.

Seorang Kepala kebun binatang yang bernama John Koplo hari itu terkejut ketika mengetahui kalau kandang singa (Baca hal 2)




(Bersambung ke hal 2) PM/DOK

Alamat Redaksi: Graha Pena Medan Jl. SM Raja KM 8.5 No. 134 Medan Telp : Sekretariat (061) 7881661, Redaksi 061- 77057364-08126309088, Iklan: 061-91013355, Pemasaran:081362235898, Fax (061) 7881733, Klik :







Celoteh Pemerkosa Siswi SMP Namun Sunarsih lega juga kala Bunga masih mau berangkat sekolah meski wajahnya murung. Tapi, pulang sekolah, Bunga hanya berdiam diri di rumah. Ditengah perbincangan dengan Sunarsih, Bunga kemudian mau nimbrung dan menceritakan aib yang dirasakan. Sepulang sekolah, siswi kelas II SMP ini tidur telungkup di ruang tengah usai menyapu rumah. Suh yang melihat rok Bunga tersingkap, mendadak nafsu apalagi pemuda ini memang suka padanya. Begitu masuk ke rumah, Suh menarik celana dalam

Bunga lalu menyetubuhinya kemudian pergi. Suh sendiri kemudan minta maaf didampingi ayahnya. Namun keluarga Bunga tetap mempolisikan Suh. “Anu ku tak berdarah bang, cuma masuk sikit kok,” terang Bunga polos. Suh sendiri menyesali nafsunya yang tak tertahan kala itu. “Aku cinta sama dia bang sejak kerja dekat rumahnya. Aku nyesal udah memperkosanya dan udah minta maaf. Tapi udah terlanjur bang. Cuma masuk kepalanya aja kok bang. Baru masuk sikit aja pun udah nembak,” ucap Suh.(Ali)

Cek Harta Koruptor Jaksa Medan Tewas jalan umum Km 20-21 jurusan NatalTabuyung, di Dusun Kunkun, Desa Sundutan Tigo, Kecamatan Natal, Kabupaten Madina. Insiden terjadi sekira pukul 12.30. Dua orang tewas, yakni Kasubag Administrasi Kejari Medan, Satya Tambunan SH, dan sopir bernama Wahyu, yang juga staf Seksi Pidana Khusus Kejari Medan. Mobil hitam BK 1816 JI itu terjun ke parit besar di Dusun Kunkun, Desa Sundutan, Tigo Natal, sekira 98 Km dari Kota Panyabungan, ibukota Kabupaten Mandailing Natal, atau tepat di lintasan Km 20-21. Ada lima penumpang di dalam mobil yakni, Wahyu (sopir), SatiaTambunan,Andi Sagala (bendahara Kejari Medan), Harli Siregar (Kasi Pidsus Kejari Medan), dan Miswasdin (pegawai Kejari Penyabungan). Dua saksi mata, Faisal Lubis (30) dan Maswardin (40), keduanya karyawan PT. Rimba Mujur Mahkota, mengatakan, kecelakaan terjadi akibat ban kanan pecah setelah menabrak lubang di badan jalan. Karena itu, seketika mobil terjungkal lalu terjun

bebas ke parit besar di sisi jalan. Parit itu berkedalaman sekitar 2 meter. Nahasnya, saat terjun bebas, mobil langsung tenggelam ke parit. Sementara lima penumpang dalam mobil kesulitan keluar. Di saat-saat genting itu, tiga penumpang; Andi Sagala, Harli Siregar, dan Miswasdin -yang berada dibangkubelakang,berhasilkeluardari dalam mobil setelah memecahkan kaca pintu mobil. Namun, Satia Tambunan dan Wahyu yang berada di bangku depan, tidak berhasil keluar hingga mobil tenggelam ke dasar parit. Satia dan Wahyu kemudian tewas akibat kehabisan nafas karena tenggelam. “Korban tewas tidak mengalami lukaluarserius.Kematianterjadiakibat korban kehabisan nafas karena mobil dan korban tenggelam,” kata Kasat Lantas Polres Mandailing Natal,AKP Hendri Matondang SH, ketika dihubungi lewat telepon selulernya, Kamis (30/1) malam sekira pukul 20.00. Sementara itu, Kasi Intel Kejari Medan, Andy Y Herlan yang

dihubungi di Medan, mengatakan, jaksa yang meninggal dunia adalah Kasubag Administrasi Kejari Medan, Satia Tambunan, dan seorang staf Seksi Pidana Khusus (Pidsus) Kejari Medan, Wahyu. Sedangkan Kasi Pidsus Kejari Medan, Harli Siregar, Bendahara Kejari Medan, Yan Noor Sagala dan Miswasdin, personil Kejari Penyabungan, selamat dari musibah itu. Rombongan Kejari Medan berangkat ke Mandailing Natal guna menginventarisirasetAdelin,terpidana kasus illegal logging, yang berada di daerah itu. Rencananya, hari (31/1) ini jenazah KasubbagAdministrasiKejariMedan, SatyaTambunanSHdibawakerumah duka di Kota Pematangsiantar, sedangkan jenazah Wahyu dibawa ke Tanjung Morawa, Deli Serdang. Kajari Medan, Sudung Situmorang, kemarin mengaku sedang menunggu perkembangan kondisi anggotanya yang selamat. “Kami sedang menunggu perkembangan selanjutnya, termasuk berkoordinasi dengan Kejari

Penyabungan agar para korban dapat segera dibawa ke Medan,” katanya. Hal senada juga dikatakan Kepala Kejaksaan Negeri Panyabungan, Danang Purwoko. “Dua jenazah sedangperjalanandariNatalkegedung Kejaksaan Negeri untuk selanjutnya menuju Medan,” katanya. Danang mengungkapkan, rombongan nahas itu baru saja pulang dari PT. Mujur Timber Grup milik AdelinLisdiSikara-kara,Natal,dalam rangka kepentingan eksekusi aset Adelin Lis. Atas insiden mencurigakan ini, Kepala Kejaksaan Tinggi (Kajati) Sumatera Utara, Gortab Marbun SH mengaku itu kecelakaan murni. “Belum ada unsur lain. Maaf dulu ya sayalagidiluarkota,”pungkasGortab, menutup selulernya. Sementara, Kabid Humas Poldasu Kombes (Pol) Drs Baharudin Djafar Msi hingga kemarin mengaku mengatakan insiden itu murni kecelakaan lalu lintas. Pun begitu, katanya, “Kita masih menyelidiki.” “Kondisi jalan lurus, lebar beraspal

hotmik dan berlobang serta marka dan rambu tidak ada diiringi cuaca hujan gerimis dan sepi, tetapi mobil yang mereka tumpangi dikemudikan Wahyu dengan kecepatan tinggi datang dari arah Natal menuju Tabuyung. Sesampai di TKP, ban depan sebelah kanan masuk lobang dan pecah sehingga hilang kendali dan langsung masuk parit,” beber Baharuddin. Penyebab korban tewas, sambungnya, akibat tenggelam di parit. Dalam mobil itu antara lain, Wahyu (20) PNS Kajari Medan dan Satya Tambunan (42) Kabid Bin Kajari Medan, keduanya meninggal di tempat. Kemudian, Harli Siregar (39) PNS, warga Jalan Taman Karya Wisata Medan, Andi Sagala (39) PNS, warga Kampung Anugerah Medan, Miswardin (45), PNS warga Pasar III Natal. “Ketiga korban yang selamat kini dirawat intensif di RSU Natal, kini barang bukti mobil sudah diamankan di Pos Lantas Natal,” tandasnya. (dahlan/ alvin/johan/zul)

Tangkap Kurir 105 Kg Ganja Brigadir Guntur Direncong merupakan orang yang bertugas memantausituasijalansebelumnarkoba -biasanya ganja- melintas. Dengan kata lain, Cucuk adalah pemantau polisi. Tugas Cucuk hanya melaporkan apakah jalan yang akan dilintasi ada polisi atau tidak kemudian melaporkannya pada bosnya. Itu pula yang membuat trio polisi ini yakin bakal ada kendaraan yang membawa ganja. Dugaan mereka benar. Lima belas menit kemudian, Kijang Innova hitam BK 1919 HM ditumpangi dua pria datang. Belum melewati mereka, mobil itu tiba-tiba berbelok ke sebuah gang. Jelasmanuvermobilituditanggapi.Tiga polisiinimengejardanakhirnyaberhasil

menghentikannya. Saat menyergap, pengemudi mobil sudah kabur duluan dan hanya Isnadi Yusuf yang berada di dalam. Brigadir Guntur yang coba mengamankan tiba-tiba diserang pakai rencong. Namun serangan itu dielakkan dan Isnadi akhirnya ditangkap. “Yang punya daun ganja itu namanya Rijal.Aku cuma numpang aja sama dia, kebetulan aku mau belanja ke Medan,”dalih Isnadi Yusuf (26) warga Jalan Perdangan, Kota Lhokseumawe, NAD saat ditemui POSMETRO MEDAN di ruangan juru periksa Sat Narkoba Polres Langkat. Isnadi mengaku baru tahu kalau Rijal

Bule Jerman Tewas OD di Tuktuk siang heboh. Seorang turis asal Jerman ditemukan tewas di sebuah penginapan di sana. Diduga kuat, Thomas Ritzer (44--foto--), turis itu, over dosis alkohol. Setelah dibawa dari Puskesmas Ambarita, hingga kemarin, jenazah warga Jalan Ohne Festen Wohnsit, Jerman, itu masih berada RSU Pirngadi Medan guna otopsi dan menunggu pihak Dubes Jerman di Jakarta. “Tidak ada tanda-tanda penganiayaan di tubuh korban, diduga tewas over dosis minuman alkohol berkadar tinggi,” ungkap Kapolres Samosir AKBP Aiman S kepada POSMETRO MEDAN. MenurutAiman, pria Jerman dengan nomoridentitasPasport332700586Visa 211, itu menyewa kamar nomor 7 di penginapan Tuktuk Timbul, Desa Ambarita, sejak Selasa (27/1) malam pukul 21.30. Besok (28/1) malamnya, Thomas masih terlihat dan tidur di penginapan kawasan wisata tersebut.

Namun,Thomasyanghanyaseorang dirididalamkamar,didugamenenggak minuman beralkohol berkadar tinggi sehingga ditemukan tewas tengkurap oleh pegawai hotel, Sulastri, saat mau mengantar makanan ke kamar nomor 8. “Dugaan korban tewas over dosis dikuatkan dengan ditemukannya 3 botol minuman beralkohol bermerek Alkohol Super Kwalitet 96%,” kata Aiman. Kini, kasus kematian bule itu sudah ditangani intensif oleh pihak Polres Samosir dengan mengevakuasi jenazah Thomas ke Puskesmas Ambarita, sebelum dijemput keluarganya dari Jerman. Sementara, Kabid Humas Poldasu Kombes (Pol) Drs Baharudin Djafar MSi kepada POSMETRO MEDAN, membenarkan peristiwa tersebut. “Kita masih menunggu pihak Kedubes Jerman datang untuk melihat kondisi jenazahnya,” tandasnya.(Zulfadli/Surya)

bawa ganja ditengah perjalanan hingga membuatnya berniat turun. “Pas mau turun,Rijalmelarangdanjanjingasiuang Rp 500 ribu kalau ganja itu sampai ke tujuan,”terang Isnadi. “Beratnya sekitar 105 kg dan udah kita serahkan ke Unit Narkoba,”ujar Kasat Lantas Polres Langkat, AKP Mohammad Risya Mustario. DuoJandajadiKurirGanja Sementara itu, berdalih butuh biaya karena ditinggal suami, dua janda nekat jadikurirganja.KeduanyaMaryam(40) warga Desa Kampung Ganda Pura, Bireun, dan Muliana (30) warga Desa

Mobil L 300 BK 1173 GK yang dikemudikan Rudi (26) dan kernetnya David (23), diperiksa dan ditemukan ganja dari tas dua janda itu. “Baru sekali ini kami melakukanya pak, inipun karena butuh duit buat bayar uang kontrakan dan sekolah anak,”cetus Maryam memelas. “Iya, kita memang kita adan menangkap dua orang pelaku kurir ganja berikut barang buktiya dan untuk saat ini kita sudah menyerahkannya ke Mapolsek Besitang,”terang KepalaPJRIIIBukitSelamat,IpdaJoko SagiwoketikadihubungiPOSMETRO MEDAN. (darwis)

Rawa Itik, Kecamatan Panton Labu, NAD. Dari keduanya, polisi mengamankan dua ransel berisi 19 bal ganja dengan perkiraan 1 Kg tiap bal. Duojandainimengakuganjaitumiliki Wahid (40) warga Kampung Baru, Biruen, NAD. Mereka bertugas mengantarkan ke kawasan Pondok Kelapa, Medan dengan upah Rp 100 ribu per bal. Sialnya, belum sampai ke tempat yang dituju, keduanya terjaring personilPolisiJalanRaya,BukitSelamat, Kecamatan Besitang, Langkat yang mengadakan patroli.

15 Pria Berklewang Bakar Pukat Trawl berklewang. Ditengarai, hal itu dipicu pelanggaranbataswilayahmencariikan. Berawal dari perginya Muslim serta dua temannya yakniAbdul Hamid dan Imranmenujulautgunamenangkapikan pada Kamis (29/1) malam. Mereka menaiki kapal motor bermesin dompleng23PKdanalattangkapjaringjenis pukat Trawl mini. Di tengah laut, kapal mereka didekati 15 pria berklewang menaiki sampan jenis fiber bermesin temple. 5 dari mereka menaiki kapal Muslim kemudian menyandera usai mengancam pakai klewang.

Bahkan Muslim dan dua anggotanya diikat. Ikan hasil tangkapan, solar dan tali kapal juga dirampas. Muslim dan anggotanya tak bisa bergerak hingga kapal mereka digiring ke tepi pantai. Sadisnya, Muslim Cs dipaksa turun begitutibadipantailalukapalnyadibakar hinggajadihangus.Aksiitudilihatwarga sekitar yang langsung melapor ke Sat PolAir Bedagai. Namun pelaku kabur duluan sebelum polisi tiba. Menurut Kasat PolAir Bedagai, Iptu Suwito Widodo, motif pembakaran diduga akibat melanggar batas wilayah

penangkapan ikan. Pada 8 Mei 2008 lalu,ujarSuwito,telahdisepakatiwilayah penangkapan ikan oleh nelayan pukat trawl dan tradisional. Dalam perjanjian dikatakan,pukattrawldilarangmenangkapikandisekitarwilayahperairanlebih kurang 3 mil dari bibir pantai. “Juga batas jermal ke arah Utara (tengah laut) yang merupakan wilayah tangkap pukat tarik dan sejenisnya. Sebelumnya juga sudah pernah terjadi penyanderaan kepada nelayan pukat trawlolehnelayantradisionalakibatmelanggarperaturan,”ujarSuwito.(Malik)

Pengusaha Kayu Asal Medan Edarkan Miliaran Uang ... initerbongkardariinformasimantanistri Benny. “Penangkapan ini bermula dari informasi masyarakat yakni seorang wanita,” kata Direktur Kriminal Khusus (Direskrimsus) Polda Metro Jaya KombesPolRajaErizmandalamjumpa pers di kantornya, Jl Sudirman, Jakarta, kemarin (30/1). Penangkapan terhadap 21 orang dilakukan di masing-masing

Lepas Selimut Saja Syukur

“Cuma Masuk Kepalanya Aja Kok” HELVETIA SIFAT periang cewek berkulit hitam manis berambut sebahu itu mulai redup. Keceriaan hari-harinya sirna ‘dirampas’ pemuda tetangga. Sehari usai diperkosa Suh (23--foto--), Bunga -nama samaran- (16) mendadak jadi pendiam. “Dulu anaknya periang, sering main sama adik-adiknya. Tapi, seharian ini jadi pendiam,” tutur Sunarsih, ibu Bunga saat ditemui POSMETRO MEDAN di kediamannya kemarin (30/1).


tempat berbeda yakni daerah Citayam, Depok, Jawa Barat, Atrium Senen, JakartaPusat,DutaMerlin,JakartaPusat, Hotel Mega Pro, Jalan Proklamasi, Jakarta Pusat, dan Cilegon, Serang, Banten. “Penangkapan juga dilakukan padawaktuyangberbedamulaidariNovember 2008-Januari 2009,” ujarnya. Setelah dilakukan penyelidikan selama

duabulan,polisimenemukanupalberupa pecahan US$ 100 sebanyak 1.148 lembar, pecahan 5 ribu dolar Brazil sebanyak 1.310 lembar. Pecahan Rp 50 ribusebanyak31lembardanRp100ribu sebanyak 5 lembar. Dari Benny, disita, pecahan 5 ribu dolar Brazil sebanyak 13.100 lembar. “Sementara, otaknya adalah Benny,” jelas Raja.(dc)

rumah. Usaha Takli tak membuahkan hasil. Kobaran api, terus membesar dan menjilati rumahnya. Seiring juga, Yeni terbangun dan lompat dari jendela kamar. Begitu tegak di pintu, Yeni pun melihat ibunya Takli dan Fikih sudah terbakar. Kemudian, Ali sambil mengendong Nanda keluar ditengah-tengah api sudah marak. Karena tak sanggup lagi mengendong Nanda, Ali pun melempar Nanda. Ali pun terjatuh. Yeni dengan gigih pun berusaha menyelamatkan bapaknya. Tapi, usahanya sia-sia. Karena tubuh ayahnya tak bisa diangkatnya, Ali pun tak luput dari jilatan api. Terpisah, Polsek Barumun tengah mengumpulkan bukti dan menyelidiki

kasus terbakarnya rumah Ali. “Masih mengumpulkan bukti-bukti untuk ditindaklanjutimeskipunpengaduannya belum dilaporkan,”ungkap Kabid Humas Poldasu, Kombes Pol Drs Baharudin Djafar Msi saat dihubungi POSMETRO MEDAN kemarin malam. Diharapkan juru bicara Kapoldasu ini, seharusnya pihak korban membuat laporan pengaduan (LP) ke polsek setempatterlebihdahulu,sehinggapolisi mudahmenyelidiki.“Kasusitubisasaja diambilalihpenanganannyaolehPolres Madina, bila mana pihak Polsek meminta bantuan untuk mempercepat pengungkapan kasus tersebut,” tandasnya.(Ali/Zulfadli)

“Sekarangkan jadi ada teman yang menjaga, biasanya dua kekhawatiran saya, anak dan istri seperti apa, kadang saya bingung,” ucapnya saat ditemui POSMETRO MEDAN di RSUP H Adam Malik, kemarin (30/1). Sugiono mengatakan istrinya sedang menuju RSUPHajiAdam Malik untuk memberikan ASI kepada buah hatinya yang ketiga ini. Istrinya diperkirakan sampai pada (30/1) malam bersama dengan keluarganya yang lain. “Karena dibutuhkan ASI-nya, makanya ibunya diharuskandatang.Kondisiistrisayajuga sudah mulai membaik, jadi bisa dibawa ke Medan,” kata pria ini. Ditambah kabar anaknya sudah mulai membaik, Sugiono merasa senang.Apalagi,kehadiranistrinyayang dianggapnya bisa membantu kesehatan bayinya. Hingga kemarin, kondisi bayinya berangsur membaik. Sebelumnya hanya diberikan cairan untuk konsumsi tubuhnya, kini bayi berkepala dua itu sudah bisa minum susu pakai dot. Tim perawatan dokter belum memikirkan tindakan lebih jauh lagi sebelum usianya lebih satu minggu penuh. “Kami tidak usah pikir yang lain-lain, lepas oksigen dan lepas selimut panas

saja sudah syukur,” kata Ketua Tim Perawatan Bayi bekepala dua RSUP HajiAdamMalikMedan,ProfdrMunar Lubis SpA. Menurutnya tim medis saat ini berpikir dan menyiapkan berbagai literatur tentang kondisi bayi ini ketika berusia lebih dari satu minggu. Bila usianyasudahgenapsatuminggu,maka pihaknya akan merapatkan dengan tim untuk melakukan tindakan yang lebih mendalam lagi. Terkait tindakannya, dia bilang pihaknyamulaimelepaskanoksigendan menguranginya. Bila setiap harinya dibutuhkan dua liter. Kini, pihaknya menurunkan satu liter kebutuhan oksigen. “Kondisinya sudah mulai membaik, jadi kami sudah mulai menurunkannya,” ucapnya. Tapi, lanjut dr Munar, Marwaty I sering mengalami kejang dan membiru. Halinidiakibatkanjantungyangdimiliki bayi ini berdempet dan tidak memiliki bilik. Sehingga rongga untuk pernafasannya dan pompa darahnya sering terganggu. Ini juga nantinya bisa membuat bayi semakin kritis. “Kami membutuhkan ASI ekslusif untuk bayinya, makanya ibunya kami minta hadir,” akhirnya. (ril/SMG)

Seksi dan Energik yangpowerfull.Anggunmemangselalu memilihbusanayangseksidalamsetiap penampilannya. Seksi namun tak terkesan bitchy (binal). Anggun sering memilih tube dress mini yang membuat bentuk badannya terlihat aduhai. Dalam memilih warna, ia lebih suka warna-warna netral seperti hitam dan putih. Namun di beberapa kesempatan,

gaun kuning berbahan sifon dengan detail kristal di pinggang juga ia pakai. Seakan tak ingin meninggalkan kesan seksinya, ia pilih gaun bermodel dada rendah. Saat ingin bergaya lebih santai, celana jeans tetap menjadi pilihan Anggun. Namun blouse yang ia pakai tetap seksi. Tube blouse putih berbahan ringan membuatnya tampak santai namun tetap hot.(dc)

Sering Diancam Sejak Jadi Pengurus mengaku sejak kepengurusannya, sejumlah ancaman kerap diterimanya. Namun Rusdi tak mau menjelaskan detail bentuk ancaman dan siapa orang yang menerornya itu. SaatditemuiPOSMETROMEDAN di kediamannya di Jalan Tilak Simpang Jalan Demak, Kelurahan Sei Rengas, Kecamatan Medan Area, Rusdi mengaku keluarganya masih trauma dan takut kejadian yang lebih besar akan menimpa mereka sekeluarga. Menurut suami dari Delima ini, aksi pelemparan yang terjadi pada Kamis (29/1)sekirapukul6.30malamituadalah tindak pidana murni. “Tindakan itu bukan lagi berupa teror yang menakutinakutikarenasudahberbuat,”ujarRusdi yang juga merupakan Sekretaris DPC Partai Hanura Kota Medan. Peristiwa pelemparan bom molotov ini terjadi ketika Rusdi Sinuraya baru selesai melaksanakan sholat maghrib di lantai II rumahnya. Bom molotov yang terbuat dari botol minuman keras itu dilemparkan oleh dua orang pelaku dengan mengendarai sepeda motor.

Delima, isteri dari Rusdi begitu mendengar ledakan langsung keluar dari rumah dan mendapati bagian teras rumahnya telah terbakar. Selanjutnya penghuni rumah Rusdi berhasil memadamkan api setelah menyiramnya denganair.Peristiwainipunselanjutnya dilaporkan ke Panwaslu Kecamatan MedanArea, Ketua DPC Hanura Kota Medan dan Mapolsekta Medan Area. Rusdi Sinuraya meminta Kapolsekta Medan Area bersama jajarannya segera mengusut tuntas pelaku dan otak pelaku pelemparan tersebut. Keterangan diperoleh dari Rusdi, hingga pukul 4 dinihari kemarin petugas gabungan dari Brimob Poldasu bersama-sama petugas kepolisian dari Polsekta Medan Area masih tetap berjaga di sekitar kediaman Rusdi. “Soal motifnya kita belum tahu, tapi yang jelas pelakunya masih diburu,” tegas Kabid Humas Polda Sumut Kombes Pol Drs Baharudin Djafar Msi ketika ditanya POSMETRO MEDAN, kemarin (30/1) siang.(Lamdor/Zulfadli)

Lae Togar (Kandang Singa) ternyata tidak terkunci. Dengan penuh amarah ia kemudian berteriak memanggil orang yang bertanggung jawab menjaga kandang singa tersebut. ternyata orang tersebut bernama Lae Togar. Dengan tampang tak berdosa Lae Togar menemui si Bos. Lae Togar : “Kenapa pak?” John Koplo : “Kamu yang bertanggung jawab atas kandang singa?” Lae Togar : “Benar pak.”

John Koplo : “Kamu tahu apa kesalahan kamu? Lae togar : “Ng....memangnya apa salah saya pak?” John Koplo : “kamu ceroboh sekali! Kenapa kandang singa ini tidak kamu kunci? Kan bahaya!” Lae Togar : “Ooooh...Kalau itu bapak gak usah khawatir. Di sini gak ada orang yang berani mencuri singa kok pak.” John Koplo : “......?!@#$%^

“Rumah Kami Dibakar, Tangkaplah Pak Polisi” Hasibuan (38) dan istrinya,Takli serta Fikih (10), menjalani perawatan di Penang, Malaysia. Sekeluarga penderita luka bakar ini adalah korban teror yang membakar kediaman mereka di kawasan Afdeling 10, Kecamatan Barumun Tengah, Kabupaten Padang Lawas pada Senin (26/1) malam. Ali adalah Komandan Regu (Danru) Security PTAgri Nusantara Jaya (ANJ). MenurutSende(13),terbakarnyarumah mereka ditengarai akibat konflik jabatan yangdidudukiayahnyadikerjaan.Sende mengaku kalau ayah pernah bersiteru dengan rekan kerjanya beberapa bulan lalu. “Berantam sama kawan kerjanya bang,”ujar Sende sambil menemani

adiknya, Nanda. Meski baru berumur 13 tahun, Sende merasakan penderitaan ayah, ibu dan ketiga adiknya. Untuk itu, Sende berharap agar kasus pembakaran kediaman mereka diusut tuntas. Sende sendiri tidak jadi korban karena saat kejadian tak di rumah, dia nginap di kediaman neneknya. Namun, keyakinan rumah mereka dibakar diungkapkan oleh Yeni. Yeni mengaku kalau api yang melahap kediaman mereka dan juga melukai dirinya dan orang tua serta adiknya, berasal dari jendela kamar dan pintu rumah. “Api di bawah jendela kamar depan dan belakang bang. Di pintu juga ada, makanya kami terbakar,”tutur Yeni.

Menyajikan Fakta, Peristiwa & Fenomena Penerbit : PT. Posmetro Medan Pers (Harian Posmetro Medan) Komisaris Utama Komisaris Direktur Utama Direktur

: : : :

Rida K Liamsi Ari Purnama Marganas Nainggolan Porman Wilson Manalu

“Rumah kami dibakar. Tangkaplah pak polisi orang itu,”pinta Sende yang mengaku kalau belum pernah polisi setempat datang meyelidiki kasus itu. “Kami ngak tahu apa-apa kok dibakar. Selama ini, bapak kerja bagus-bagus kok,”tambah Sende. Sekedar mengingatkan, pembakaran ituterjadisaatAlitidurdikamarbelakang bersama Nanda Hasibuan. Sementara itu, Yeni Hasibuan dan Fikih tidur di kamar depan. Sedangkan istrinya Takli lagi nonton TV di ruang tamu. Selang beberapa menit, api dari pintu kamar depan dan kamar belakang marak.Takli yang mengetahui kalau rumahnya terbakar, berusaha memadamkan api dengan kayu yang diambil dari luar

Pemimpin Umum/Penanggungjawab: Marganas Nainggolan Wakil Pemimpin Umum/Pemimpin Perusahaan: Porman Wilson Manalu Wakil Pemimpin Umum Bidang Redaksi/ Pemimpin Redaksi: H Affan Bey Hutasuhut Ombudsman: Vincent Wijaya Dewan Redaksi: Marganas Nainggolan (Ketua), Porman Wilson Manalu Wakil Pemimpin Redaksi: Maranatha Tobing Redaktur Pelaksana (Redpel): Kompartemen I : Ahmad Faisal Matondang

Kompartemen II : Hendra Sembiring Kordinator Liputan: Jhonson Sibarani Ass Koordinator Liputan: Johasman Tarigan Redaktur : Abdurrahman, Maria Surbakti Ass Redaktur : Budi Hariadi, Hiras Budiman, Solideo S. Reporter: Mula Naik Halomoan, Kali A Harahap, Rusdi Nasution, Johan HP, Jaffar Siddik, Nanang, Pasta Wijaya T, Darwis Sinulingga, M.Faisal Iswan, Ali Amrizal, Surya Irwandi, Ardiansyah Tanjung. Sekretariat Redaksi: Sekretaris Redaksi: Dewi Syahfirda

Staf Redaksi: Leni Dept Perwajahan, Artistik & Pracetak: Ka.Bag: Simon Sinaga Kord Pracetak/Perwajahan : Ferry Sumarlen Art/Graphis: Syafrizal, Boniq Tekhnisi, Maintenance dan IT: Sudiarman Departemen Umum/Adm/Keuangan: Manager Umum/Sdm/Keuangan: Rudyanton M Sidabutar Departemen Sirkulasi/Pemasaran: Ka. Bagian Pemasaran: Feri Agustika Kord Adm/Piutang : Imelda S.

Departemen Iklan: Ka.Bagian Iklan/EO: Losber Sihotang Kord. Adm/Piutang: Sri Kurniasih Penasehat Hukum : A Hakim Siagian M.Hum Tarif Iklan : Halaman 1 (Utama) Full Color Rp. 26.000 mm kolom, Hitam/Putih (B/W) Rp. 20.000/mm kolom, Halaman 8, 9 & 16, Full Color Rp. 15.000 mm kolom, Hitam/Putih (B/W) Rp. 10.000/mm, Ucapan Duka Rp. 8.000 mm kolom, Halaman Dalam (B/W) : B/W Rp. 8.000 mm kolom, B/W duka Rp. 5.000 mm kolom. Harga iklan ditambah PPN 10%. Harga Eceran Rp. 2.000 (dalam kota).

Rekening a/n : PT. Posmetro Medan Pers, Bank Mandiri Cab. Tiara Medan Ac: 105-0003103441. Rekening a/n: Marganas Nainggolan Alamat Redaksi/Iklan/ Pemasaran: Jl.SM RAJA KM 8,5 No.134 Medan-Amplas, Telp (061) 7881661 Fax (061) 7881733. e-mail: Perwakilan Jakarta: Jalan Raya Kebayoran Lama17 Jakarta Selatan, Telp. (021)-5349205, 5349206, 5349115. Fax. (021)-53490522. Pencetak : PT Medan Graindo, Jl.SM RAJA KM 8,5 No.134 Medan-Amplas Telp (061) 7881661 Fax (061) 7881733

PENGUMUMAN : Setiap menjalankan tugas peliputan, Wartawan POSMETRO MEDAN dilengkapi Surat Tugas atau Kartu Pers POSMETRO. Jika ada yang mencurigakan, silahkan hubungi call centre kami di 0812-6309088. Terima kasih


MEDAN PENGURUSAN kartu tanda penduduk (KTP) di Kota Medan masih terus menuai masalah. Kepada warga yang menjadi korban pungli diminta segera melapor ke Badan Pengawas Kota (Bawasko) di Pemko Medan. “Bila masyarakat dipungut atau ada ancaman dari petugas, sebaiknya buat laporan ke Kecamatan bila permasalahannya di Kelurahan dan buat laporan ke Bawasko bila pungutannya di Kecamatan,” kata Pj Kepala Dinas Kependudukan Medan, H

Sulaiman Hasibuan kepada wartawan pada (30/1). Menurutnya permasalahan pungutan di beberapa kecamatan atau dikelurahan di Kota Medan merupakan pelanggaran disiplin, bila kedapatan oknum yang melakukan pungutannya bisa dikenakan dengan sanksi pendisiplinan pegawai. “Sekarang ini saya masih membagi waktu untuk pengurusan anggaran, jadi untuk mengumpulkan camat dan lurah masih diatur waktunya,” bilangnya.

Baca Celakai di hal 4


Pungli KTP Lapor Bawasko


Sumut Sepakat Berantas Percaloan

Tak Ada Lagi Dongan Sahuta PM/ HENDRA MULYA

Kondisi Jalan rusak di kawasan Jalan Denai, Sukaramai kian parah. Akibatnya menyusahkan warga dan penggunan jalan.

Tunggul Terbaik dari Gubsu Selain tunggul Kecamatan Terbaik I, Gubsu juga menyerahkan piagam penghargaan, trophy dan dana kepada Camat Pegajahan, Camat Siantar Narumonda Kabupaten Tobasa Drs Audi Murphy Sitorus SH (terbaik II), Camat Batang Kuis Deliserdang Dedi Maswardy S Sos (terbaik III), Camat Nainggolan Kabupaten Samosir M Agustan Situmorang SH MM (harapan I), Camat Natal Kabupaten Madina Helmi SE

Baca Tunggul di hal 4

Tirtanadi - Angkasa Pura Kerjasama MEDAN PT (Persero) Angkasa Pura II menjalin kerjasama dengan PDAM Tirtanadi dalam penyuplaian air ke Bandara Kwala Namu. Penyaluran air bersih ke bandara juga akan sampai ke rumah-rumah warga. Dirut PDAM Tirtanadi Drs Sjahril Effendy Pasaribu MSi MA mengatakan perjanjian kerjasama tersebut merupakan kelanjutan dari penandatanganan Nota Kesepahaman antara PT (Persero) Angkasa Pura II dengan PDAM Tirtanadi tentang

Kajian Kelayakan (Feasibility Study) atas kelayakan penyediaan layanan air bersih di Bandara Kualanamu yang ditandatangani pada tanggal 25 Maret 2008 lalu. "Pelayanan air bersih ke bandara yang baru tidak hanya ke bandara saja, tapi juga ke masyarakat yang ada di sekitar bandara. Rencananya jumlah pelanggan lebih kurang 3.750 sambungan rumah (SR) yang akan direalisasikan sesuai dengan perkembangan penduduk di

Baca Tirtanadi di hal 4

Gubsu Syamsul Arifin saat panen padi di Deli Serdang.

Gubsu H Syamsul Arifin usai menggelar Telekonfrence dengan Presiden SBY di ruang Tri Brata Lantai IV Mapolda Sumut, kemarin (30/1) sore.

MEDAN CALO-calo yang banyak tersebar di berbagai instansi di Sumut, khususnya di Samsat (Satuan Administrasi Satu Atap), tampaknya sudah harus mencari pekerjaan lain. Pasalnya, banyak pejabat di Sumut telah sepakat memberantas percaloan. Bahkan Gubsu H Syamsul Arifin menegaskan, tak akan ada lagi istilah dongan sahuta (kawan sekampung). Kebijakan itu berkenaan dengan memberikan kemudahan bagi telah diresmikannya pembukaan masyarakat dalam setiap pengurusan sistem peningkatan pelayanan untuk segala bentuk keperluan, terutama

yang berkaitan dengan Polisi. "Ini jawaban nyata, secara global negara ini ingin memperbaiki keadaan pelayanan terhadap masyarakat banyak, mulai dari masalah kriminalitas (kejahatan), penerimaan polisi dan pengurusan SIM," kata Syamsul Arifin yang didampingi W aka Poldasu Brigjen Pol Drs Djoko Trisno Santoso usai menggelar Telekonfrence dengan Presiden SBY di ruang Tri Brata Lantai IV Mapolda Sumut, kemarin (30/1) sore.


Dikatakan Gubsu, hal itu dilakukan sebagai langkah memperbaiki keadaan pelayanan terhadap masyarakat. Bila mulus berjalan, resikonya para calo-calo yang tersebar di sana bisa kehilangan mata pencaharian. "Tidak ada lagi istilah titip-titip, tanpa terkecuali. Tapi reskionya calo-calo akan kehilangan pekerjaan," katanya. Sebelumnya, upaya penertiban telah dilakukan di Sumut dengan pemasangan camera CCTV di Baca Tak Ada di hal 4

Perombakan Pejabat Pemprov Gelombang I

Ah, Masih Wajah Lama MEDAN GUBERNUR Sumut (Gubsu) H Syamsul Arifin kemarin (30/1) pagi melantik 18 pejabat eselon II. Hal itu menjawab ungkapannya yang telah bersliweran di media massa, tentang adanya perombakan jabatan di Pemerintahan Provinsi Sumut (Pemprovsu). Hanya saja, ke 18 pejabat yang dilantik merupakan wajahwajah lama. Dalam pelantikan yang digelar pagi itu, sejumlah wajah lama masih mendominasi. Perombakan yang sempat gembor di media tak lebih hanya sekedar rotasi tempat dimana Asisten II yang selama ini dijabat Rahudman Harahap kini dijabat oleh Ir H

Djaili Azwar MSi, sementara Rahudman sendiri pindah menjadi Asisten IV, sementara AsistenItetapdijabatHasiholan Silaen demikian juga asisten III masih dijabat oleh Kasim Sio. Eddy Sofyan yang selama ini diisukan akan menduduki jabatan Kepala Dinas Sosial ternyata tetap di tempatnya yakni Kepala Dinas Infokom, sementara Plh Kepala Bapeda Riadil Akhir didaulat sebagai pejabat definitif untuk jabatannya itu. Maulana Pohan yang selama ini di PD Aneka Industri dan Jasa Industri diberikan wewenang memimpin lembaga Litbang. Ir Umar Zunaidi Hasibuan MM (Kadis


SEI RAMPA H GUBSU H Syamsul Arifin menyerahkan penghargaan kepada Kecamatan Pegajahan Kabupaten Serdang Bedagai (Sergai) yang ditetapkan sebagai Kecamatan Terbaik I Tingkat Provinsi Sumatera Utara tahun 2008. Tunggul Kecamatan dan penghargaan tersebut diterima Camat Pegajahan Henry Suharto SH dalam acara yang digelar di lapangan bola kaki Kebun Melati PTPN II Kecamatan Pegajahan, Kamis (29/1).

Baca Kebakaran di hal 4

Gubsu Syamsul Arifin melantik pejabat eselon II, kemarin (30/1).


Bina Marga), Ir Nurlisa Ginting MSc (Kadis Kebudayaan dan Pariwisata), Ir W ashington Tambunan (Kadis Pertambangan), Mangasing Mungkur SH MM (Kaban Pendidikan dan Pelatihan), Prof Syamsul Arifin SH MH (Kaban Lingkungan Hidup), Nurdin Lubis SH MM

(Inspektur Provsu), dan Drs Arsyad Lubis MM (Kepala BKD). Selanjutnya, H Daudsyah MM (Staf Ahli Gubsu Bidang Pemberdayaan Masyarakat dan Penanggulangan Kemiskinan), Ir Hj R Sabrina MSi (Staf Ahli Gubsu Bidang Baca Perombakan di hal 4


Kebutuhan Beras di Sumut Aman

Deli Serdang Sumbang 9 Ton Beras

Serdang, kemarin (29/1). BerbicarausaipanenpadihibridadiBalai Benih Induk (BBI) Murni, Deptan meyakini, produksiberassebanyak40jutatonitubisa dicapai melalui P2BN (program peningkatan produksi beras nasional) yang dicanangkan sejak awal tahun 2007. Sejak P2BN dicanangkan, peningkatan produksi beras nasional dalam dua tahun terakhir mengalami peningkatan sangat signifikan. Di tahun 2006, misalnya, produksi gabah masih 54, 45 juta GKG, sedangkan pada 2007 berdasarkan angka tetap BPS, produksi sudah mencapai 57, 16 juta ton GKG atau meningkat 4, 96 persen dibandingkan 2006. Baca Deli Serdang di hal 4

DICARI BURON ! Telah melarikan uang, barang siapa yang mengetahui keberadaan saudara dibawah ini agar menghubungi kami di 061-7861771, akan diberi hadiah sepantasnya. Identitas dirahasiakan Medan, 30 Januari 2009 dto Lidya Br Simbolon


DELI SERDANG KETERSEDIAN beras di Sumatera Utara masih dalam tahapan aman. Bahkan, rencana ekspor beras satu juta ton tahun ini bakal terealisasi menyusul produksi bahan pangan nusantara itu yang diyakini mencapai 40 juta ton atau 63,52 juta ton gabah kering giling (GKG). Deli Serdang sendiri telah menyumbangkan 9 ton beras. “Dengan produksi beras sebanyak 40 juta ton itu ada surplus sekitar 3,8 juta ton sehingga kalau ditambah dengan stok di Bulog 2,3 juta ton, maka kebutuhan dalam negeri mencukupi bahkan bisa ekspor satu juta ton,” kata Dirjen Tanaman Departemen Pertanian (Deptan), Sutarto Alimoeso, di Deli



panggung sambungan panggung sambungan politik 4 pelayanan pelayanan umum politik umum

KANTOR POLISI Polda Sumut: : 061 – 7851686 Poltabes Medan : 061 – 4530506 Tim Pemburu Preman : 081375608010 Polsekta Medan Kota : 061 – 7366770 Polsekta Deli Tua : 061 – 7030378 Polsekta Medan Area : 061 – 4556732 Polsekta Medan Timur : 061 – 4563110 Polsekta Medan Barat : 061 – 6614776 Polsekta Medan Helvetia : 061 – 8445176 Polsekta Medan Baru : 061 – 4532141 Polsekta Medan Labuhan : 061 – 6851001 Polsekta Medan Belawan : 061 – 6941585 Polsekta Pancur Batu : 061 – 8367705 Polsekta Medan Sunggal : 061 – 8459110 Polsekta Percut Sei Tuan : 061 – 7369110 Polsekta Patumbak : 061 – 7867382 Polsekta Kutalimbaru : 061 – 66280795 Polsekta Hamparan Perak: 061 – 6628978




Dr Pirngadi Medan Adam Malik Bhayangkara Haji Medan

: 061 : 061 : 061 : 061

– – – –

4536022 8365667 8220812 6619520

Kirim pengaduan tentang fasilitas Jika Anda juga korban dan sarana nakal. umum ke Redaksi koperasi Kirimkan POSMETROSMS MEDAN, Jl. SM Raja ke : Km 8,5 No. 134. Atau SMS ke : 06176794284 06176794284 Ayo, jangan takut bicara Ayo, jangan bersama takut bicarakita kebenakebenaran, berran, bersama kita bersihkan sihkan korupsi. korupsi.

Lapor Pak Polisi PAK Polisi yang terhormat, tolong dong ditertibkan tempat kumpul kebo yang berkedok koskosan yang ada di Jalan Flamboyan, Tanjung Selamat, Kecamatan Medan Tuntungan. Terima kasih. 06176911475 Pak Kapolres DS. Tolong ditertibkan pungli di simpang empat timbangan Lb Pakam yang dilakukan oleh sejumlah preman. Kami para sopir truk sudah sangat resah. Pungli setiap hari dilakukan dari pagi hingga pagi lagi. Tiap hari terkumpul uang pungli hingga ratusan ribu. 081397306309

pro kota Tak Ada

sejumlah titik. Positifnya, seperti ujian kelulusan Sekolah Staf Pimpinan (Sespim) Polri bisa berjalan baik, tanpa adanya bantuan dari calo dan kecurangankecurangan yang terjadi. "Saya dengar langsung A1(pasti)ujiankelulusanSespim telah baik," ucapnya. Ditambahkan, soal pelayanan satu atap yang akan diterapkan menjadi badan, maka pihaknya berharap semua elemen masyarakat dapat menyepakati istilah Sumut dengan 'semua urusan tuntas', bukan semua urusan harus uang tunai. "Kalau memang bisa dipermudah, kenapa harus dipersulit. Kita nggak usah sesumbar-sesumbar," himbaunya. Karena itu Syamsul berharap, kepada


Kades Bingkawan, Sibolangit, 12 Tahun tak Defenitif KEPADA Bapak Bupati Deli Serdang, sesuai Perda DS No. 7 Tahun 2007, disebutkan, bahwa seorang pejabat sementara (pjs) kepala desa menjabat selama 6 bulan. Status tersebut dapat diperpanjang 6 bulan lagi, sehingga menjadi 1 tahun. Tapi yang terjadi di Desa Bingkawan, Kecamatan Sibolangit, pjs kepala desanya menjabat sampai 12 tahun. Dan selama itu pula dia tidak pernah mencalonkan diri ikut Pilkades. Kami atas nama masyarakat Desa Bingkawan sangat menginginkan kepala desa definitif, sebab sebagai pjs, kadesnya hanya tuntuk kepada camat dan bukan kepada masyarakat, karena bukan pilihan masyarakat. Tolong kepada Bapak Bupati untuk menindaklanjuti masalah ini. Terima kasih. 085831689674

PENGURUSAN KTP di Kelurahan Lau Cimba, Kabanjahe, dikenakan biaya Rp 200 ribu. Yach … semoga lurahnya sehat selalu. 081263993588 Yth Humas PT Jamsostek Regional I, katanya tukang

tenaga kerja jika mengalami kecelakaan kerja, biaya perawatan medis, biaya rehabilitasi, penggantian upah sementara tidak mampu bekerja (STMB), santunan cacat tetap sebagian, santunan cacat total tetap, santunan kematian (sesuai label), biaya pemakaman, santunan berkala bagi yang meninggal dunia dan cacat total tetap. Selain itu, juga mendapat jaminan kematian (JK), yang terdiri dari biaya pemakaman dan santunan berkala. jaminan hari tua (JHT) yang terdiri dari keseluruhan iuran yang telah disetor, beserta hasil pengembangannya. Serta jaminan pemeliharaan kesehatan (JPK). Sanco Simanullang Humas PT Jamsostek Regional I

becak dan tukang bakso bisa menjadi peserta Jamsostek, apa betul Pak. Dan apa saja manfaat yang bisa kami peroleh Pak? 08126355*** Jawab : Betul. Tukang becak dan tukang bakso bisa menjadi peserta

setiap masyarakat untuk bersikap arif dan bijak menyikapi setiap keputusan yang diambil aparat berwenang dalam menindak setiap kesalahan. "Tidak ada lagi istilah dongan sahuta. Yang terbaik hanyalah jangan buat kesalahan. Kalau itu benar, maka jangan takut," tegasnya. Kabid Humas Poldasu Kombes Pol Drs Baharudin Djafar Msi mengaku dalam teleconfrence itu lebih menekankan dalam hal pemberantasan preman. Karena menurut juru bicara Kapoldasu ini, preman adalah musuh negara. "Preman harus habis di Sumut. Negara tidak boleh kalah dengan preman termasuk juga dengan preman berdasi,"tandasnya. (zulfadli)

Perombakan Ekonomi, SDA, dan Keuangan), Drs Ridwan Bustan ( Sekretaris DPRD Provsu), serta Drs Martinus Lase MSP (Staf Ahli Gubsu Bidang Pertanahan dan Aset).. Sesaat akan mengangkat sumpah ke 18 pejabat tersebut Gubsu Syamsul Arifin sempat marah, sebab udangan yang saat itu hadir riuh hingga membuat suara gaduh di tempat itu. “Kalau tak bias tenang saya batalkan pelantikan ini, yang dibelakang bias tenang tidak,” hardiknya. Dalam amanatnya H Syamsul menekankan bahwa pelantikan ini merupakan konsekuensi adanya mutasi, baik promosi,



mutasi vertikal atau horizontal. Apalagi, pelantikaninimerupakanhalyangalamiah, sesuai aturan kepegawaian. Yang jadi masalah dan harus dipertimbangkan matang-matang, menurutnya yakni siapa yang akan mengisi jabatan yangakanditinggalkanitu.“Iniyangharus menjadi perhatian kita, supaya tidak terkesan di saat mengisi jabatan tertentu, tuduhan-tuduhan KKN, dan ada tuduhan pendekatantertentu. Yakinlah, bahwa saya mencintai persaudaraan dan persahabatan dari pada uang, dan saya adalah sabahat semua orang,” beber H Syamsul.(Kali Harahap)

Jamsostek. Masyarakat yang berusaha sendiri dan menjadi peserta jamsostek disebut tenaga

kerja yang melakukan pekerjaan di luar hubungan kerja (LHK). Manfaat yang bisa diperoleh,

Deli Serdang

Yth Pak Gubernur Sumut, tolong ditindak tegas aksi Sekretaris Dusun Pengkolan, Kecamatan Bosar Maligas, Simalungun, karena acap kali melalaikan pengurusan surat-surat. Katanya masih dalam pengurusan. Tapi mendapatkan jaminan kece- kenapa sudah 1 tahun tak selesailakaan kerja (JKK), yang terdiri selesai. Terima kasih. terdiri dari biaya pengangkutan 081362310057


Sedangkan tahun 2008, produksi padi sesuai angka ramalan III BPS, produksi padi diperkirakan 60, 28 juta GKG atau naik 5, 46 persen dibandingkan 2007. Dalam kurun waktu dua tahun terakhir, kataDirjen Tanaman Deptan itu, produksi padi telah meningkat 5, 82 juta ton GKG danituluarbiasa, “Tapi meski bisa ekspor, ekspornya diharapkan jangan hanya beras bermutu saja, agar warga juga masih bisa menikmati beras yang enak seperti jenis Ramos di Sumut,” katanya. Mengenai rencana tujuan ekspor beras, kata dia, diutamakan ke negara tetangga seperti Malaysia. “Banyak negara yang minta, tapi ekspor ke negara-negara dekat ajalahdulu,”kataSutarto. Menurutdia,meningkatnyaproduksiberas dan termasuk bisa ekspor merupakan dukungan seluruh stake holder sehingga pemerintah memang harus berterimakasih kepada semuanya khususnya ke petani dan pejabat pemerintah daerah/provinsi.Dia memberi contoh, kontribusi produksi padi Sumut untuk nasional pada tahun 2008 cukuptinggiatausebesar5,51persen.“Untuk mendukung peningkatan produksi dan ekspor beras, pemerintah akan terus melakukan berbagai upaya,” katanya. Upaya itu antara lain memberikan bantuan benih padi hibrida yang mampu meningkatkan produktivitas sekitar 20


persen dibandingkan penggunaan varietas padinonhibrida. Tahun ini, sasaran tanaman padi hibrida direncanakan seluas 500 ribu hektare dari 2008 seluas 300 ribu hektare dan 2007 yang masih 160 ribu hektare. Menurut dia, hingga dewasa ini sudah dilepas35varietashibridayangditanamdi berbagailokasidenganhasilyangbervariasi. “Untuk hasil optimal, kunci utamanya adalah pengawalan yang ketat dengan melibatkan para POPT-PHP (Pengendali Organisme Pengganggu Tumbuhan, PBT dan penyuluh pertanian,” katanya. Termasuk penanamannya yang harus dilakukan secara berkelompok 10 - 25 hektare sehingga memudahkan dalam pengawalannya. Diakui, permasalahan pengembangan padi hibrida adalah harga benihnya yang relatif mahal dan umumnya rentan terhadap serangan organisme penggerak tumbuhan(OPT). Gubernur Sumut, Syamsul Arifin, mengatakan tahun ini, produksi GKG sebanyak 3.487.882 ton atau naik 167.337 ton dibandingkan 2008 yang sebesar 3.320.545ton(aramIII2008). Dia mengakui, masalah peningkatan produksi GKG antara lain menurunnya ketersedian lahan trmasuk air akibat laju konversidandegredasilahan,infrastruktur pertanian yang banyak rusak dan rendahnya pemakaian benih unggul. (Pasta)


( T ra d i t i o n a l c h i n e s e M e d i c i n e ) J I S H E N G G R O U P

TCM untuk PENGOBATAN KANKER/ TUMOR Penyakit tumor /Kanker sangat membahayakan kesehatan manusia dan telah mengambil banyak sekali nyawa manusia di dunia termasuk Indonesia. Pengobatan tradisional China (TCM) dalam menuntaskan penyakit ini sudah mengalami kemajuan yang sangat pesat. Pengobatan ini Sudah mendapat pengakuan dunia Internasional dimana memiliki cara yang sangat baik didalam pengobatan kanker /tumor. Pengobatan ini tidak mempunyai efek samping. Adapun, jenis-jenis kanker yang bisa diobati secara TCM adalah : Kanker payudara, THT,paru-paru, otak, kulit, saluran makanan, usus, lambung, hati, pankreas, tulang tyroid,ginjal, rahim, Indung telur, prostate dll. Bagi pasien sebelum maupun sesudah operasi, bila mau melanjutkan pengobatan bisa ditanggulangi disini. TCM bisa menghilangkan efek samping atau toxcin sesudah pasien dikemoterapi dan di sinar. Dan juga mengobati gejala penyakit sampai ke akar-akar penyakitnya. Hasil pengobatan secara TCM efektif untuk memperpanjang usia, mengurangi rasa sakit pasien, dan meningkatkan taraf hidup pasien. Demi untuk kesehatan pasien dan kepentingan keluarga pasien hubungi kami untuk mendapatkan pengobatan dengan hasil yang memuaskan, oleh karena itu kami hadir disini untuk membantu Anda yang terkena penyakit kanker.

KLINIK TCM HARAPAN BARU J L . K . H . WA H I D H A S Y I M N o . 4 A , M E D A N ( depan pintu masuk RS Brimob ) KAWASAN MEDAN BARU Buka Jam 08.30 s/d 16.30 WIB untuk hari Senin-Sabtu Jam 08.30 s/d 13.00 WIB untuk hari Rabu dan Minggu Telp. 061- 4518168, 061- 4513274 atau Hubungi HOTLINE : 0815 1012 2222.

Dia mengharapkan kepada masyarakat agar melakukan pengurusan KTP sesuai dengan prosedurnya. Bila masih adanya pungutan dari oknum di kelurahan dan kecamatan, maka buatlah laporan kepada Bawasko agar bisa segera ditindak lanjuti dan diberikan sanksi. Sementara itu, Ketua Fraksi PKS DPRD Medan, Ikrimah Hamidy mengatakan pelayanan KTP di Kota Medan sangat buruk. Seharusnya perubahan SIMDUK ke SIAK membuat prosesnya lebih mudah. Kenyataannya sekarang ini masyarakat terus menjadi korban oknum nakal kelurahan dan kecamatan atas pungutan

KTP. “Bila ini dibiarkan saja berlarut-larut, sama saja mencelakai warga sendiri,” bebernya. Dia menegaskan pengurusan KTP di Kota Medan agar dipermudah lagi. Seharusnya, dengan SIAK ini bisa membuat oknum kelurahan dan kecamatan memahami sistemnya. Bukan menciptakan pungutanpungutan yang memberatkan masyarakat. “Kalau bulanan KTP belum selesai juga, inilah yang menyengsarakan masyarakat. Bagi masyarakat menengah ke bawah urus KTP ratusan ribu ini sangat berat, makanya komitmen Kepala Daerah harus lebih tegas lagi,” sarannya. (ril/smg)

Tirtanadi sekitar Bandara yang telah disusun melalui Rencana Pengembangan Jangka Menengah (RPJM) dan disetujui oleh Gubsu beberapawaktulalu,"terangSjahrilEffendy dipertemua yang dihadiri Direktur Operasi dan Teknik PT (Persero) Angkasa Pura II Sumiyat Tulus Pranowo.

Dengan ditandatangani perjanjian kerjasama itu, pembangunan pelayanan air bersih ke Bandara sudah dapat ditenderkan. Sehingga 6 bulan ke depan layanan air bersih ke Bandara Kualanamu sudah dapat dioperasikan. (hendra sembiring)

Tunggul (harapan II), dan Camat Kualuh Hulu Kabupaten Labuhan Batu H Habibuddin Siregar AP (harapanIII). Sedangkan Kapten Inf Salmon Sembiring Danramil 07 Perbaungan dan AKP Ramli Sirait Kapolsek Perbaungan mendapatkan tanda penghargaan khusus berupa piagam dan trophy dari Gubsu atas peran sertanya melaksanakan pembangunan di wilayah

Kecamatan Pegajahan sehingga daerah tersebutberhasilmeraihpredikatKecamatan TerbaikIuntuktingkatProvinsiSumuttahun 2008."Camat adalah pemimpin rakyat yang paling bertanggungjawab di wilayahnya. Oleh karenanya Camat harus dapat berdiri di depan dan menjadi pengayom bagi rakyat yang dipimpinnya," bilang Syamsul. (hendra sembiring)





Anggota Dewan Aktif Minim Layak Dipilih DARI 150 anggota DPRD Sumut dan Kota Medan, diperkirakan hanya 20 persen yang bakal dipilih kembali oleh rakyat. Perkiraan itu didasari banyaknya kepercayaan yang pudar dari masyarakat, terhadap mereka yang kini duduk sebagai anggota dewan hasil Pemilu 2004. Hal itu dibeberkan Burhanuddin Harahap MA, pengamat politik asal kampus USU. Dari amatan yang dilakukannya, terlalu banyak warga yang kecewa. Keluhan yang disampaikan, banyak mengambang. Masih lanjutnya, perkiraan itu juga didasari berbagai sikap tidak pro rakyat. Ada yang sombong, serakah dan tidak peduli dengan rakyat yang telah memilihnya. “Tentu sikap-sikap seperti itu akan menimbulkan rasa sakit hati, khususnya para kader yang pada Pemilu lalu ikut mengusungnya duduk sebagai anggota parlemen,� kata dosen ini. Siapa saja yang bakal terpilih kembali? Burhanuddin tersenyum. Dia tak mau bak peramal yang berani menyebutkan perorangan. Namun dia yakin, mereka yang terpilih itu adalah orangorang yang benar-benar terjun dan prihatin atas persoalan warga selama ia duduk di kursi DPRD. Salah satu, imbuhnya, adalah anggota dewan yang selalu berkomentar di mass media tentang pembelaan persoalan rakyat. Bukan mereka yang masuk koran lantaran acara seremonial, pelantikan, peresmian dan sebagainya. “Jujur saja, wartawan lebih tau dari saya. Kalau pers ingin meminta keterangan untuk mengkritik, tentu pilih-pilih. Siapa anggota DPR yang idealis, tentu itu yang dicari dan diwawancarai,� bebernya. Diminta prediksi soal partai yang bakal unggul, Pembantu Dekan III FISIP USU ini mengatakan, suara partai lama masih akan tetap menguasai jalannya pemilu nanti. Alasan Burhanuddin, sebelum partai baru nongol, kader partai lama sudah bersosialisasi kepada masyarakat. Lalu bagaimana bakal nasib partai-partai baru? Katanya, umumnya mereka masih menggodok internal partai, dan hanya sebagaian yang sudah berbuat kepada masyarakat. Bukan berarti partai baru bakal ‘memble’, namun jika ingin punya suara, para pengurus dan kadernya harus ekstra keras


Hari Lagi

mencuri hati rakyat. Tentunya harus mendoktrin, bahwa partai mereka layak untuk dipercaya membawa perubahan yang baik. Di tempat lain, Pandapotan Tamba SH MHum, anggota KPU Medan, tidak bersedia memberikan keterangan luas. Alasan dia, masing-masing caleg punya strategi yang berbeda untuk menduduki kursi parlemen. “Saya tidak bias menjawab masalah ini. Karena semua caleg memiliki strategi. Begitu juga dengan anggota DPRD pemenang pemilu 2004 lalu. Saya tidak bisa memprediksi, berapa lagi akan yang terpilih,� kata Pandapotan. JANGANTUKARSUARA DENGANRUPIAH Pemilu 2009 ini, merupakan sejarah baru untuk masyarakat di Indonesia. Untuk kali pertama kebijakan pemilihan legislative tidak lagi berdasarkan nomor urut. Namun berdasarkan suara terbanyak. Untuk itu, kata Burhanuddin Harahap, masyarakat diharapkan untuk tidak menukar suaranya dengan rupiah. Namun harus memilih berdasarkan idealisme caleg yang diharap bisa memberi perubahan. “Saran saya, jika ada caleg memberikan hadiah, baik itu uang atau lainnya, terima saja. Tapi soal pilihan, jangan beri dukungan,� pintanya. Alasan Burhanuddin, caleg berkelakuan seperti ini yang bakal menimbulkan masalah di kemudian hari. Karena diprediksi, setelah berhasil duduk menjadi anggota legilatif, ia akan mencari ganti pemberian yang telah dikeluarkannya. Selain akan korupsi, caleg seperti itu akan lupa pada pendukungnya. Pendapat senada diutarakan Pandapotan Tamba, anggota KPU Medan. Saran mantan penasehat hukum Federasi Serikat Buruh Sejahtera Indonesia (DPC FSBSI) Kabupaten Deli Serdang ini, agar masyarakat sadar dan tidak mau suaranya dibeli. Sebab lanjutnya, pilihan rakyat nantinya memberikan sumbangsih bakal seperti apa negara ini ke depan hari. “Tentukan pilihan berdasarkan hati nurani Anda. Kenali pilihan, baik moral, latar belakang pekerjaan, juga riwayat hidupnya. Jadi jangan mau beli kucing dalam karung,� akhirnya. (Mula)

LU 2009

sambungan menuju pemilu



Caleg Sesatkan Masyarakat Tapi Membantu Sosialisasi Pemilu MEDAN KETUA Komisi Pemilihan Umum Daerah (KPUD) Sumut, Irham Buana Nasution (foto) menegaskan kebebasan berdemokrasi yang diartikan para Calon Anggota Legislatif (Caleg) saat ini telah meyesatkan masyarakat.

“Kampanye Caleg telah menyesatkan masyarakat. Masyarakat dibingungkan dengan ramainya foto-foto caleg yang harus mereka pilih. Sebab harus menentukan Caleg - Caleg yang ada di dalam satu partai, belum lagi caleg dari partai berbeda. Hal lain, menentukan caleg dari daerah pemilihan yang berbeda pula. Belum lagi menentukan caleg dan capres,� ujar Irham dalam Lokakarya “Peliputan Pemilu & Pilpres Bagi Jurnalis�

yang digelar di Hotel Inna Dharma Deli, kemarin (30/1). Dengan arogansi para Caleg yang lebih mengedepankan profil pribadi ketimbang partai yang menaunginya, telah menyesatkan masyarakat. Hal itu pun telah dilakukan hampir semua caleg di partai politik. Padahal harusnya, terang Irham, para caleg harusnya memahami konsep dasar Pemilu adalah memperjuangkan dan membesarkan eksistensi partai. Dan bukan

malah mengeyampingkan partai. Pada kesempatan yang sama, Wakil Ketua Dewan Pers, Drs S Leo Batubara menjelaskan kesa-

lahan caleg itu pula yang mengakibatkan masyarakat tak kompak saat memilih antara partai dan caleg. Artinya, memilih Caleg dari partai A, belum tentu masyarakat juga memilih partai A. “Itulah yang dihadapi Partai Demokrat di Pemilu 2004 lalu. Kemenangan SBY (Presiden Susilo Bambang Yudhoyono) tak serta merta diikuti kemenangan partainya. Buktinya, Partai Demokrat hanya memperoleh 8 persen suara di Senayan,� terangnya. Parahnya lagi, lanjut Leo Batubara, �Kecilnya kekuatan Partai Demokrat di Senayan, kerap membuat SBY takut saat datang ke DPR. Hal itu justru berbeda dengan Jusuf Kalla,

yang mempunyai kekuatan partai di legislatif. Karena, kader Partai Golkar kuat di DPR, Jusuf Kalla lebih percaya diri ketika datang ke Senayan.� Kembali ke Irham Buana, yang menyampaikan materi dengan topik ’Potensi Pelanggaran Pemilu/Pilpres dan Peranan Lembaga Pers’ mengatakan, �Meski disatu sisi kampanye yang dilakukan para caleg menyesatkan, namun tak terbantahkan juga mereka turut membantu sosialisasi Pemilu 2009 ini.� Karenanya, Irham tetap mendukung upaya-upaya yang dilakukan para Caleg yang ingin mendekatkan diri dengan masyarakat. �Toh, para caleg-caleg sekarang lebih rajin turun ke masyarakat,� puji Irham. (Budi Hariadi)

Manuver Mega Bikin Sultan Makin Ngetop JAKARTA MANUVER politik Partai Demokrasi Indonesia Perjuangan (PDI-P) yang dimainkan oleh ketua umumnya, Megawati Soekarnoputri, terkait silaturahimnya dengan Sri Sultan Hamengku Buwono X dinilai semakin menguntungkan popularitas Sultan. Artinya, Sultan makin ngetop melalui manuver ini. Hal ini disampaikan oleh pengamat politik dari Lembaga Ilmu Pengetahuan Indonesia Fahri Ali di Jakarta, Kamis (29/1). “Sultan sangat diuntungkan manuver yang dilakukan oleh PDI-P. Dia kan tidak ada partai namun memiliki panggung dari manuver-manuver PDI-P,� ujar Fahri. Fahri menyebutkan bahwa upaya suami Megawati yang juga adalah Ketua Dewan Pertimbangan Pusat (De-

perpu) PDI-P Taufik Kiemas yang terus mempertemukan Mega dan Sultan menunjukkan bahwa PDI-P menyediakan panggung khusus untuk Sultan menunjukkan dirinya kepada publik. Fahri berpendapat duet Mega-Sultan sebenarnya akan sangat menguntungkan PDI-P karena secara suara, PDI-P memerlukan tokoh lain yang memiliki massa. “Sultan tentu punya massa untuk itu. Sama seperti SBY. SBY itu punya massa. Jadi kalau ada yang naik bersama dia, dia akan memberi suara,� tandas Fahri. “Kalau saya lihat Sultan mau (bersanding dengan Mega). Tapi secara kultural, dia tidak bisa karena dia sudah mencalonkan sebagai capres. Secara Sultan, dia sulit untuk mencabut kata-kata itu,� lanjut Fahri.(kps)

Suara Caleg

Caleg PDP Sikapi Intimidasi Siswa MEDAN TINDAKAN kasar seorang guru terhadap siswa menjadi sorotan Caleg Partai Demokrasi Pembaruan (PDP), Ade Sandrawati Purba, SH. Menurutnya hal itu menunjukkan masih rendahnya tingkat perhatian pemerintah terhadap dunia pendidikan. Ade Sandrawati sangat menyayangkan tindakan guru SMU Yayasan Pencawan, Medan yang mengintimidasi tiga siswanya, 19 Desember 2008 lalu. Pasalnya akibat perlakuan oknum guru itu, para siswa pun melaporkannya ke Polsekta Deli Tua. Pasalnya, para siswa tak terima dengan perlakuan kasar oknum guru itu. Ade Sandrawati yang juga Ketua Partai Demokrasi Pem-

baruan (PDP) Kota Medan, berharap agar pihak berwajib memberikan sanksi tegas. �Agar hal itu tak terulang lagi,� terangnya yang didampingi Erlitha Br. Silalahi, S.Pd selaku Ketua Barisan Perempuan Pembaruan Kabupaten Deli Serdang dan Aktivis Pergerakan Indonesia Kota Medan dan Maria Br. Sinaga Ketua Barisan Perempuan Pembaruan Kota Medan ketika ditemui di sekretariat PDP Kota Medan di Jalan Burjamhal No. 8A Medan. Karenanya, Ade Sandrawati menganjurkan kepada para guru agar tak hanya menyiapkan ilmu pengetahuan. Akan tetapi juga menyiapkan mental sebagai seorang pembimbing dan contoh yang harus ditiru para siswa.(Mula)

Bukan Utusan Rakyat BENARKAH Caleg merupakan wakil rakyat? Tidak selalu! Caleg juga tak lebih seperti pencari kerja yang menitipkan lamarannya di pos Satpam kerakyatan. Diterima syukur, tak diterima paling stres.

foto : Tri Mujoko Bayuaji/JP

Ketua Pokja Desain Surat Suara KPU Andi Nurpati menunjukkan perubahan desain surat suara untuk Pemilu Legislatif Pemilu 2009 di Jakarta, kemarin (28/1).

Ketua Umum PDIP Megawati Soekarnoputri bertemu dengan Gubernur DI Yogyakarta Sultan Hamengku Buwono X dalam jamuan makan malam di Keraton Yogyakarta, Senin (26/1) malam. Sultan meminta kepada sejumlah media untuk tidak hanya memandang pertemuan tersebut sebagai peristiwa politik, namun juga sebagai wahana silaturahmi.

Magnet Prabowo Pikat Politisi Kawakan JAKARTA SEJUMLAH nama beken di kancah perpolitikan Indonesia, kini banyak merapat ke Gerindra. Mencuat tanggapan, itu lantaran Prabowo Subianto, Calon Presiden Partai berlambang kepala burung garuda tersebut, punya daya pikat serta pesona luar biasa. Berkibarnya nama mantan menantu Soeharto ini, disebut sejumlah lembaga survei, langsung menyodok para seniornya untuk memberi dukungan. Survei LP3ES pada Desember lalu misalnya, mantan Danjen Kopassus tersebut ditempatkan di peringkat empat dengan memperoleh dukungan 7,8%. Perolehan ini jauh meninggalkan Wiranto,Amien Rais, Gus Dur, Hidayat Nur Wahid dan politisi kawakan lainnya. Iklan politik Gerindra dan Prabowo yang tak pernah berhenti sejak penayangan awalnya, medio 2008 lalu, diyakini menjadi magis kuat atas meroketnya popularitas mantan istri Titiek Soeharto itu.

Hasil survei Lembaga Survei Indonesia (LSI), September lalu, mengungkap Partai Gerindra memperoleh gurihnya iklan televisi dengan meraih 51% dan sebanyak 66% viewership iklan politik. Perolehan ini mengungguli partai politik lainnya seperti Partai Demokrat (42%), Partai Golkar (31%), dan PDI Perjuangan (27%). Angka-angka itu tentunya fakta hasil survei yang mencerminkan persepsi publik atas figur Prabowo dan iklan politiknya. Namun, merapatnya para ‘bintang’ ke Prabowo, tentunya bukan karena pesona iklan politik yang memang cukup massif semata. Dengarlah pengakuan Permadi, bekas politisi PDIP yang hengkang dari partai Moncong Putih itu. Menurut dia, Prabowo jauh lebih Sooekarnois dari Megawati dan PDIP. “Kenapa saya memilih Prabowo, karena ia lebih Soekarnois dari Mega dan PDIP,� akunya, Kamis (29/1) di Jakarta seperti dilansir dari situs

Permadi pun sempat mengajak Prabowo untuk ziarah ke makam Bung Karno di Blitar belum lama ini. Diakuinya, hal itu itu dilakoni untuk menguatkan magis Soekarnois tersebut. Permadi tidak sendirian. Salah satu Ketua DPP Partai Golkar yang enggan disebutkan namanya juga mengaku merapat dan mendukung Prabowo Subianto menjadi Presiden 2009. Dia berkeinginan menduetkan Prabowo dengan

Sultan HB X. “Pasangan ideal Prabowo-Sultan akan membawa Indoensia keluar dari krisis seperti saat ini,� klaimnya. Sebelum Permadi, mantan tokoh PDI Perjuangan lainnya, Haryanto Taselam juga merapat ke Prabowo. Kini, dia malah memegang Direktur Media Massa Gerindra. Bagi Direktur Eksekutif Charta Politika, Bima Aria Sugiarto, hijrahnya para elite ke Prabowo dan Gerindra memiliki banyak latar belakang. Faktor utama, kata Bima, orang-orang merasa termarjinalkan dari partai politik lamanya. “Yang pasti, karena orang-orang tersebut termarjinalkan dari partai politik lamanya,� katanya. Menurut dia, Prabowo juga melakukan hal yang sama saat dirinya merasa tidak memiliki tempat di Partai Golkar. Kemungkinan lainnya, merapatnya para bintang di lingkaran Prabowo, sambung Bima, juga dikarenakan kedekatan dalam pemikiran politik dan ideologis.

“Bisa juga Prabowo dipersepsikan sebagai sosok yang dibutuhkan saat ini daripada capres lainnya, baik SBY maupun Megawati,� tegas Bima yang juga dosen Universitas Paramadina Jakarta ini. Berkumpulnya politisi gaek di inner circle Prabowo jelas akan berdampak positif bagi jalan putra begawan ekonomi Sumitro Djojohadikusumo ini menuju kursi pucuk pimpinan negeri ini. Selain bakal memperluas jaringan politik Prabowo, merapatnya para bintang tersebut juga akan menaikkan citra positif bagi Prabowo. “Akan menentukan kegiatan lobi dan memperluas networking. Yang pasti, banyaknya tokoh yang berkumpul jelas akan membuat citra positif ke publik,� tegasnya. Apakah para politisi gaek tersebut hanya mencari tempat dan posisi di Gerindra? Ketua Umum DPP Gerindra Suhardi membantah keras jika perpindahan tokohtokoh tersebut karena mengincar posisi dan kursi.(int)



DIPUKULI RENCANA Yanti Br Nainggolan (14), anak jalanan, ingin melihat teman-temannya bermain judi berbuntut penganiayaan di Jalan Juanda, Medan.

TEWAS SEORANG pria kurus tanpa identitas ditemukan tewas di Jalan Putri Hijau, Medan tepatnya di halte bus tidak jauh dari kantor TVRI Medan. Sebelum tewas, seorang warga bernama Anderson sempat melihat pria berkulit gelap itu menggigil. Iba, Anderson pun memberikan nasi padang. Ciri-ciri Mr.X itu adalah berusia

Kemarin siang, dia dipukuli rekannya yang kalah main judi. Pemukulan itu terjadi, karena dia tidak mau disuruh pergi oleh pelaku. Atas penganiayaan itu, Yanti membuat pengaduan ke Mapolsek Medan Kota. (Reza) 50-an tahun, pakai celana panjang warna coklat tanpa baju dan suku Tamil. Oleh petugas Polsek Medan Barat, mayat pria ini diboyong ke RSU Pirngadi Medan. “Untuk sementara, korban diduga gelandagan. Namun begitu, jika ada warga yang merasakan kehilangan anggota dengan ciri-ciri di atas, bisa mengenalinya di rumah sakit,” ujar Kanit Reskrim Polsek Medan Barat, Iptu Bazoka. (surya/suci)


Mr X saat masih di TKP

JUDI ABADI Bangun (32) dan Andreas Bangun (28), abang beradik warga Jalan Jamin Ginting ditangkap petugas Polsek Medan Baru karena terlibat kasus judi togel dan dadu. Dalam penangkapan Kamis (29/1) lalu, polisi juga

KEMALINGAN SEBUAH rumah kos di Jalan Harapan Pasti, Kelurahan Binjai, Kecamatan Medan Area yang dihuni 4 mahasiswa dibobol

mengamankan Rp 240 ribu, kertas rekap dan perlengkapan dadu sebagai barang bukti. “Saat penggrebekan, tidak seorang pun pemain yang diamankan karena melarikan diri. Keduanya masih menjalani pemeriksaan,” ujar Kapolsek Medan Baru AKP Sugeng Riyadi Sik. (Ali) maling. Akibatnya, M Reynaldo (19), Evan (20), Nanda (19) dan Edi (19) kehilangan 5 hape, 1 laptop dan 2 ijazah. Kasus ini telah mereka adukan ke polisi, Kamis (29/1) lalu. (Lamdor)

PENGANIAYAAN HANYA gara-gara kaset CD hilang, Suheri dan rekannya tega menganiaya Fitriono. Akibat perbuatannyan, kini warga Jalan pantai kasan, Desa Lantasan Baru, Kecamatan Patumbak harus berurusan dengan polisi. Dia ditangkap sementara rekannya berhasil

CURANMOR NASIB apes dialami Hasan Basri (45) warga Jalan Pertanahan, Patumbak. Jupiter MX biru BK 6163 GR, miliknya yang diparkir di rumah makan Kamang Jaya di Jalan Singa simpang Jalan Lembu Medan Kota, tempatnya

TABRAKAN NASIB naas dialami Ismail (23) warga Jalan Simpang Turunan, Lorong IV, Kecamatan Sudiarjo, Batang Kuis. Sepulang dari rumah temannya, kendaraan yang

lari. “Tersangka kita jerat dengan pasal 170 yo 351 ayat 1 KUHP. Saat ini, kita masih memburu temannya yang berhasil lari,” ujar Kapolsekta Patumbak AKP ZP. Matondang melalui Kanit Reskrim Iptu Sangkot SimareMare. (Reza) bekerja raib. “Baru kali ini kehilangan di tempat itu. Saat itu stang sudah terkunci.Anehnya, tak seorang pun karyawan yang melihat aksi pelaku. Kejadian ini sudah saya laporkan ke Polsek Medan Kota, dengan laporan Nopol: LP/107/I/2009/TBS tertanggal Rabu (29/1) lalu. (Surya) dikendarainya adu kambing dengan sepeda motor lain yang datang dari arah berlawanan. Akibatnya, bahu sebelah kirinya luka-luka dan kaki kanan patah. Karena kritis, keluarga membawanya ke RSU Pirngadi Medan. (Suci)

BERASTAGI MESKI sukses mencuri 2 sepeda motor dalam sehari, Untung Surbakti (foto) tidak seberuntung namanya saat akan menjual hasil curian itu. Dalam perjalanan, dia mengalami kecelakaan. Tidak hanya itu, dia juga dibonyoki massa dan diserahkan ke polisi.

Pada POSMETRO MEDAN, Untung mengatakan, Rabu (28/ 1) lalu, dia dan rekannya bernama Roy Sembiring warga Tiga Binanga sepakat melakukan pencurian sepeda motor (Septor). Saat itu juga, keduanya meninjau lokasi target operasi di Desa Kandibata, Kabanjahe. Setelah mempelajari jalan di kawasan itu, besoknya mereka mulai mencari mangsa. Tidak butuh waktu lama bagi mereka dalam mencari korban. Baru beberapa menit keliling, keduanya melihat sepeda motor parkir tanpa plat polisi. Dengan sedikit hentakan kunci T, sepeda motor berhasil dibawa lari. Oleh keduanya, septor dibawa ke Desa Buluh Naman, Munthe. Tidak puas dengan 1 hasil,

warga Desa Kutambelin, Kecamatan Namo Rambe itu mengajak Roy beraksi lagi di kawasan yang sama. Tidak jauh beda dengan aksi pertama, mereka kembali sukses mencuri sepeda motor warga BK 3201 UD, yang sedang parkir di halaman rumah. Ingin segera menikmati hasil curian, Untung membawa sendiri sepeda motor terakhir menuju Kuta Cane. Rencananya, septor itu akan dijual seharga Rp 2 juta kepada penadah di Aceh. Apes buat resedivis kasus pencurian uang Rp 1,5 juta dan sempat ditahan 3 bulan di Pancur Batu itu. Septor yang dikendarainya mengalami kecelakaan, ketika melintas di Jalan Negara desa Buluh Pancur, Mardinding. Meski tidak dikenal, warga di

BERBUAT baik memangharus.Tapi,tindakanitu tidakharusdiberikankepadasemuaorang.Tidak adasalahnyajikaniatmuliaituhanyadiberikan kepadatemanataupunorangterdekat.Soalnya, jikasembarangan,bisa-bisaupahnyacumapetaka. Percayaatauti dak,tapibalasanpahitatas tindakanbaiktelahdirasakanAvantoriaSipayung danrekannya.Perasaanibayangdiberi kannya Kamis(29/1)lalu,berubahmenjadipenyesalan. Diajustrujadikorbanperampokan. CeritaAvantoria,soreitu,diamengendaraitruk menuju kawasan KIM untuk membeli pupuk. Oleh perusahaan,merekadibekaliuangRp3,5juta sebagaibiayapupuk.Sepertibiasa,pria29tahunitu melewatijalurjalantol. Begitulah,begitumelintasdikawasanJalan Cemara,Medan,truk merekadistop2pria.Pada Avantoria,salahseorangdaripriatakdikenalitu minta tolong menumpang ke KIM. Karena tujuanmemangkesana,tanpapikir panjang,permohonanitupundiamini. Keduanya duduk di bangku depan. Disepanjangjalan,perbincangan kecilterjadidiantaramereka.Buruh inisemakinsenang, karena ada teman ngobrol.Tapikesenangan ituhanyadirasakan sesaat.Begitumelintasi tolBelmerah,Tanjung Mulia, 2 penumpang tersebut mengeluarkan pisau dan menodongkan padasupirdankernek polosini.

TKP sempat memberikan pertolongan kepada Untung. Nah, di sinilah kesialan Untung berlanjut. Kebingungan yang ditunjukkan Untung mengundang kecurigaan warga. Dan puncaknya, dia semakin bingung mana kala warga mempertanyakan asal dan tujuannya. “Warga nanya asal dan tujuanku. Tidak hanya itu, orang itu juga nanya surat-surat kereta ku. Kata mereka, surat itu untuk jaminan ke bengkel. Bingung lah aku bang. Surat apa yang mau ku kasih,” terangnya. Karena tidak bisa menunjukkan surat-surat kendaraannya, salah satu warga nyeletuk dengan mengatakan ‘jangan-jangan kereta curian’. Mendengar ucapan itu, dirinya berusaha menghindari warga dengan mencoba lari. Tanpa dikomandoi, rencana lari itu langsung dijawab warga dengan bogeman mentah. Pukulan bertubi-tubi mendarat ke tubuh dan wajah Untung. Secercah keberuntungan Untung baru muncul, bersamaan dengan

kedatangan petugas Polres Karo. Kasat Reskrim Polres Tanah Karo AKP Lukmin Siregar mengatakan, berdasarkan catatan polisi, Untung juga pernah melakukan aksi serupa di Medan. Atas perbuatannya, tersangka dijerat dengan pasal 3 6 3 KUHPidana. (Nanang/ Amry)

Usai menyuruh menepi, 2 pria itu meminta Avantoria dan kerneknya memberikan seluruh uang yang mereka bawa. Hanya dalam hitungan menit, seluruhuangberpindahtangan.Setelah meyakinkantidakadalagiyangtersisah,2penjahat ituturundanlangsungmelarikandirikearah pemukiman warga. Tidak mau membuang waktu, Avantoria memutar stir ke arah Mapolsek Medan Labuhan guna membuat pengaduan. “Laporannyatelahkitaterima.Saatini,anggota sedang melakukan penyelidikan untuk mengetahui identitaspelaku. Dariketerangankorban,ciri-cirikeduapelaku telah kita peroleh. Mudah-mudahan dalam waktu dekatinipelakunyabisatertangkap.Dengan begitu,penggunajalantoltidakakanresahlagi,” ujarKanitReskrimPolsekta MedanLabuhanIptu EddySafari. (Dian)




1. PELET JALA SUKMA. Sangat ampuh...siapapun orangnya akan dibuat tunduk/takluk, benci, bebalik cinta,dilengkapi dengan pengunci sukma agar tidak berpaling selamanya. 2. AJI PENAWAR SUKMA Khusus untuk memutuskan PIL/WIL dan peselingkuhan, mendamaikan/mengakurkan istri lebih dari satu, merukunkan rumah tangga dan mengunci suami/istri, pacar agar tidak serong. 3. SUSUK TIRTA MAYA Wajah dan seluruh tubuh mempunyai daya tarik dan pengasihan tingkat tinggi, disayang semua orang dan dimudahkan segala urusan. Dapat menyelesaikan berbagai masalah mengobati penyakit sendiri/orang lain. 4.GENDAM ASMARA: Membuat suami/ istri pacar menjadi tunduk patuh, dan menurut, apasaja yang diminta diberikan, cocok untuk bekerja di cafe, diskotik, massage, dll. 5. MUSTIKA DERAJAT Khusus untuk melamar kerja supaya langsung diterima, anti PHK, cepat naik pangkat/jabatan, memperkokoh jabatan. 6. PUTER GILING JAGAD Untuk menarik/memanggil orang yang minggat/kabur dengan cepat, anak,suami, istri, pacar dan lain-lain. Insya Allah dalam waktu tiga hari akan pulang. 7. PAKU BUMI (Penglariskan Khusus) Untuk membangkitkan usaha/bisnis yang lesu, bangkrut, sepi pembeli, banyak saingan, menarik pembeli berduyun-duyun datang, sangat cocok untuk hotel, restau rant, supermarket, kafe, diskotik, dll. 8.GEMBLENGAN PROGRAM BIOENERGI : Menguasai semua ilmu yang tertera diatas dan masih banyak lagi yang tidak tercantum Hubungi :


Jl. SM.Raja Km. 7.5 Bajak V Perum. Vila Mutiara Blok C No.22

Hp: 0813 9672 0879





PARANORMAL dan Pengobatan Alternatif

Pemasangan susuk Panca Warna + Terapi Aura Piranti “DAHSYAT” Pengasih, Pemanis, Penglaris, Awet Muda,.BuangSial, Kerezekian, Kewibawaan, Karir, Jodoh, Kharismatik, Aman Lahir Bathin. Bebas semua agama, suku, permanen dan tidak ada efek samping negatif. Penglarisan + Pagar Usaha, Pengasihan, Puter Giling, Kunci Pasangan, Memisahkan PIL/WIL, Ruwatan Badan, Rumah, Usaha, Jual Tanah, Rumah, Mobil biar cepat laku. Pengobatan Penyakit Medis / Non Medis, Totok Syaraf, Terapi Telur, Pemindahan Penyakit ke Kambing, (khusus penyakit dalam) Kanker, Tumor, Ginjal, Kista, Hernia, Jantung, Usus Buntu, lambung, lever, paru2 dll Alamat praktek


izin Kejati No: B-71/DPS.5/05/2007 Jl. Medan - Tg. Morawa Km. 13,5 Gg. Lokasi Komplek perumahan Tamora Indah II Blok B No. 38 Tlp. (

061 ) 7945468 HP. 081375750399

Merawat Kejantanan secara alami: Ramuan & Minyak Lintah yang sudah terpopuler Dibantu dengan ilmu kekuatan batin/ Do’a dan hasilnya bisa langsung dirasakan reaksi di Tempat, dan paten permanen untuk selamanya Dijamin 100% tidak ada efek samping Yakinkan keinginan Anda, setiap penyakit tentu ada obatnya. Setiap kesulitan pasti ada solusinya. Bagi anda yang mempunyai keluhan alat vital seperti : • Besar diameter 4 - 4,5 -5- 5,5 -6 cm Pria/wanita: • Ukuran panjang 13-15-17-19 cm • Pelaris, pemanis, buka aura • Memperkeras / impotensi • kecantikan, kewibawaan • Kurang ereksi/kurang gairah • menyatukan pacar, disegani • Lemah syahwat/ ejakulasi dini atasan, disayangi suami/istri • Mandul sulit punya keturunanm, dll • Perjodohan, kerejekian, dll Penanganan sampai berhasil / sembuh dan garansi. Bebas umur, Semua Agama, bebas pantangan. izin Dinkes No.440/7082/VII/08 Anda yakin dan minat segera hubungi : Alamat: Jl. SM. Raja dekat simpang limun di barisan showroom Honda dibelakang toko obat Sim-Seng No.362, Hp: 0813 7057 9923






Terapi keperkasaan Seksualitas Pria, hasil permanen,alami tanpa efek samping, Di Jamin 100%. Langsung reaksi ditempat Untuk semua umur, dan Bebas Pantangan.

Menambah ukuran Panjang: Yang Bisa di Pilih : 13,14,15,16,17,18,19,20 CM

Juga Melayani :




Menambah ukuran Besar :


MAHAR RP. 500.000,-

Alamat: Jl. SM. Raja, Masuk ke Jl. Utama No.18 dari Toko Roti Majestik ± 100 M Hp: 0813 7000 7115, 0812 6388 7999 Dinkes : No.448/0649/I/2008 Izin : B / DSP.5 / 12 / 2007


OMPUNG TANGGO SIALLAGAN SPESIALIS PENYAKIT KULIT DAN GATAL-GATAL Anda menderita penyakit kulit, sudah bosan berobat kemana-mana dan sudah sembuh tetapi kambuh lagi, kami dapat mengobati semua jenis penyakit kulit dan gatal-gatal. Seperti Exim, Keputihan, Kurap Gajah, Panu, Pitiligo dan penyakit kulit lainnya, sampai tuntas. Setelah sembuh tidak akan kambuh lagi, nyata ampuhnya dan nyata sembuhnya, bukan janji tapi bukti. Alamat: Jl. Putri Hijau No. 46 H (Belakang Kantor Lurah Kesawan) Medan Buka Praktek: Jam 16.00 s/d 21.00 WIB Setiap Hari Hp. 0812 636 7676, 061-5014 0770

RADEN HARYO DAMAR Semua Program Hasil Resensi Ilmu Ghaib & Rujukan Kitab Kuning, Tidak Menyimpang dari Kitabullah, Assunnah, Ijmak,Kiyas, Bebas Agama, Arts Magic & Religi, Aman & Permanen. * PELET KAMASUTRA + MIMPI TEMBUS (Hajar Do’i Biar Klimpungan) Pancarkan Daya Pekasih Bikin Do’i Tunduk Takluk Bisa Difungsikan untuk pelaris/ memikat relasi/hubungan dengan atasan/merupakan senjata yang menggiriskan untuk menaklukkan lawan jenis yang angkuh (BONUS BUKA AURA). * SUSUK & MUSTIKA (KEMILAU) “SUPER STAR” & “SANG DIVA” & CHARGER Kajian dari Khazanah ilmu susuk terbaik dari yang baik & sudah diuji bertahun ( di Medan & Surabaya) Terbukti bikin cantik & bagus rupa (tak perlu operasi plastik) Aura Kemilau (silahkan poto aura) Pesona diri & Suara Karisma & bertaburan bintang, suksek bisnis,karir,jodoh,sial hilang & manfaat lain yang tak tertulis. Bahkan bisa pengaruhi wajah hingga mirip idolamu. Lihat RHD Mirip siapa? (+ Mantra Gendam + air aura keramat) Saksikan * MUSTIKA MACAM LANGIT (+ Body Guard Goib) Iklan Deli TV Tak cuma sensasi tapi sudah diuji ribuan orang dalam & Luar negeri Tiap hari jam 12 & Transfer Energi Ilahiah & Sufistik/Metafisika, Theormodinamika. jam 5 sore Fungsi : Kebal Sajam/Tembak/Kepruk/Anti Silet/Cukur (tes pakai silet Goal Tajam) Diwajibkan mengasah parang dari per - mobil Setajam - tajamnya untuk dites. Bacok,Sayat,Gorok,Tusuk,Bahkan Bisa tes sendiri sepuasnya. Anti Api (tes) Tes Kepruk,bela diri Ghaib. Keselamatan jiwa raga, Pukulan Sakti, menghalau musuh dll. Sudah dibuktikan oleh para Kyai & Ribuan Banser NU (dalam gemblengan masal) + Terbaik & Telah teruji Dilaga. Melayani: SULIT PUNYA ANAK / KETURUNAN Goyang Lidah/Mus Kyai Kanjeng (Pelaris Bisnis Dasyat) Pengobatan Medis / Non Medis/Pemindahan Penyakit ke Telur/Ayam / Kambing. Siap Diundang Ceramah Agama (Nada & Dakwah) & Gembleng Masal.

Alamat : Jl. Medan - Tamora KM 12,5 Gang Rasmi (± Masuk 100 M)

HP. 0815 3120669 Telp.061 77608103 Tanjung Morawa, website

“OLOT KLINIK AHLI ALAT VITAL” Dari Cisolok Pelabuhan Ratu Jabar ditangani: MAK OLOT Bpk. KOSIM, SAg Ust. R. Zaelani

“MASTER SPRITUAL PADEPOKAN ASSYPA” 30 Tahun berkiprah di Jakarta kini buka Praktek Menetap di Kota Medan, langsung breaksi di tempat, Untuk semua agama. 1 X datang hasil permanen

WANITA KHUSUS PRIA • Ingin mempunyai keterunan • Tambah Ukuran • Memperbesar Payudara • Panjang 13cm, 15 cm, MAHAR • Vagina seperti perawan 18cm, 20cm RP.500 RB kembali, hasil bisa dicek ke • Diameter 4cm, 6cm Dokter • Tahan Lama • Mati rasa, infeksi rahim, • Mani encer senggugut • Lemah Syahwat/ impotensi KONSULTAN UMUM: Masalah Rumah Tangga, Jodoh, Karir, Bisnis, Pelaris, PIL/WIL, dan susuk. Jual Tanah Alamat Praktek: Jl.SM. Raja Yuki Simp.Raya masuk dr Jl. Amaliun masuk lagi Jl. Cemara no.49 Medan Hp: 0812.6337.5477 izin Kejaksaan: B. 18/DPS.5/01/2008. izin Dinkes: 448/347


Pengobatan sistim trapi serta ramuan 100 % Alami Proses Cukup 20 menit langsung terbukti Hasilnya di tempat, permanen untuk seumur hidup Mengobati Jenis Keluhan Pria/Wanita untuk Pria: • Besar, Panjang, Keras • Ejakulasi dini • Lemah Syahwat • Impotensi Dll Untuk wanita: • Memperbesar/ mengencangkan payudara dan indah Mahar • Masalah keturunan dll • Tersedia ramuan tradisional yang berkhasiat mengembalikan Rp.500 rb keperawanan seperti semula Reaksi Langsung Berhasil di tempat Dijamin Tidak ada efek samping Bukan Janji Tapi Bukti

hubungi: Jl. SM. Raja Km.8 Gg. Kamboja No.3 Depan Pabrik Getah Amplas Medan. Hp: 0812 6573 6213 - 0812 638 111 61


sambungan metafisika 7




MEDAN Lazimnya, kumandang azan terdengar ketika waktu sholat akan tiba. Tapi 2 pekan lalu, sekira pukul 02.00 pagi, panggilan itu terdengar memecah keheningan malam. Beberapa warga mendengarnya, termasuk Indra, pemuda yang menetap di Gang Bilal, Jalan Medan Area Selatan, Medan.

WARUNG SUPRANATURAL Diasuh : Raden Haryo Damar

(Penafsir Mimpi, Ahli Ilmu Gaib, Raja Susuk & Pujangga Cinta) Ketik : POS(spasi)TGP(spasi)Pertanyaan. Kirim Ke 7669 (MAKS. 160 KARAKTER)

Hotline : 0815 3120 669 (No SMS)

PEGANGAN DUDA GAEK Tanya : RHD, saya duda jelang 60 tahun, rasa sepi hidup ini mau cari pendamping lagi. Pegangan apa yang cocok untuk saya ? Jawab : Bapak Yth. Pria seumur Anda memang harus ekstra sabar dan selektif dalam memilih jodoh jangan sampai jadi bumerang di kemudian hari. Kalau bisa cari yang umurnya tak jauh dari Anda yang bisa seisa sekata menuju rumah masa depan (kematian). Untuk pegangan pasang susuk yang aman alias tanpa efek samping, seperti susuk kemilau. Lebih jelas telepon aja. Trims.


â—‹ â—‹ â—‹ â—‹ â—‹ â—‹ â—‹ â—‹ â—‹ â—‹ â—‹


Tanya : Mas, saya bermimpi naik pelaminan dengan wanita lain, apa arti dari mimpi saya? Terima kasih. 6285276428*** jawab : Maknanya, kesehatan Anda akan terganggu.


(Pakar Pengobatan Alat Vital Pria) Ketik : POS(spasi)TGP(spasi)Pertanyaan. Kirim Ke 7669 Hotline : 0815 3443 1998 (No SMS)

HARUS BAGAIMANA Tanya : Saya mau tanya, bagaimana sih caranya agar bisa cepat dapat anak. Apa perlu alat vital saya direperasi? Tolong dijawab. 6285261573*** Jawab : Anak merupakan karunia Tuhan. Tak ada yang bisa memastikan untuk mendapatkan anak. Namun sebagai manusia, kita dituntut terus berusaha. Bisa dengan melakukan terapi dan minum ramuan tradisional. Sementara reperasi alat vital tak ada hubungannya dengan belum mendapat keturunan. Anda juga boleh datang dengan pasangan ke tempat praktek saya. Terima kasih.

081264574*** Annisa Br Aritonang 27 September 1977 Anda memiliki rasa kasih sayang yang tinggi kepada keluarga. Saran : Teruslah mendekati diri pada Sang Pencipta. PERHATIAN : ini hanyalah prediksi belaka, hanya padaTuhan jualah kita berserah diri.

Azan Gaib Hebohkan Warga Medan Area Selatan

Pengobatan Alternatif

Jin Muslim Sholat Zuhur PRIA yang akrab disapa Iin itu mengisahkan, ketika baru saja menginjakkan kaki di rumahnya, lantunan azan terdengar sayup masuk ke telinganya. Mendengar azan itu Iin merasa heran. Dalam hatinya bertanya, “Apa waktu Subuh telah tiba?� Kemudian ia melihat jam dinding rumahnya. Benar. Perkiraannya tak meleset. Waktu masih menunjukkan pukul 02.00 pagi. “Tapi kenapa ada suara azan?� pikirnya. Terpisah (sehari kemudian), Wagini, Ibunda Iin, yang rutin mengikuti pengajian bercerita, penceramah (ustadz) yang menjadi pembicara pada kesempatan itu, membicarakan gema azan pada tengah malam. “Berarti benar kata anak saya,� Wagini berbisik dalam hati. Dalam pengajian itu, kata Wagini, sang penceramah menghimbau kepada masyarakat untuk segera mendekatkan diri kepada Yang Maha Kuasa. Karena suara azan itu, merupakan pertanda kiamat semakin dekat.

BENCANA datang silih berganti melanda bumi. Dinding bergetar tatkala teriakan dari pegunungan tak lagi tertahan. Sapuan angin pusing tak kalah hebat hingga sulit dihindarkan. Dan gelombang pasang yang menggulung, menjadikan mimpi buruk bagi penghuni daratan. Kiamat semakin dekat ‌‌‌

“Jadi, masyarakat sebaiknya segera bertobat. Karena tanda-tanda akan kiamat semakin nyata,� ucap Wagini menirukan ungkapan sang penceramah. Hal yang hampir senada juga diungkapkan paranormal yang baru saja menunaikan ibadah haji, Raden Haryo Damar. Dari terawangan

Kaca Mata Bukan Untuk Mengobati

mata batinnya, fenomena tersebut menandakan usia planet bumi ini sudah cukup tua, sehingga terjadi benturan antara alam nyata (manusia) dan alam gaib (jin). “Azan yang terdengar itu sebenarnya datang dari alam gaib.Ada komunitas jin muslim yang akan melaksanakan Sholat Zuhur. Saking tipisnya perbedaan itu, aktivitas yang dilakukan jin muslim itu terdengar oleh manusia. Dan saya sendiri sudah pernah mendengarnya ketika berada di Semarang,� ujarnya. Raden Haryo menjelaskan, perbedaan waktu antara alam nyata dan gaib berbanding terbalik. Jika di alam nyata malam hari, maka di alam gaib siang hari, begitu sebaliknya. Tak ubah seperti manusia, komunitas jin muslim juga memiliki adat istiadat. “Ada yang hanya makan tanaman (vegetarian). Ada yang alim, yang hanya kenyang dengan doa. Bahkan ada yang sakti, bisa berkomunikasi lewat telepon,� ujar pria bersorban ini. (Yoedhi)

MEDAN MATA adalah jendela dunia. Jika telah mengalami kerusakan, akan berpengaruh pada aktivitas yang akan dilakukan. Dan solusinya adalah, menggunakan alat bantu, yang tidak sepenuhnya bisa menyembuhkan. Lebih baik menjaga dari pada mengobati. Mungkin pepatah ini sangat tepat. Karena jika mata telah mengalami kerusakan, biaya untuk mengobati cukup mahal. Dan itu belum tentu bisa 100 persen normal seperti semula. Dan alat bantu, hanya berfungsi untuk membantu, bukan untuk mengobati. Begitulah ungkapakn Jhoni, pakar pengobatan mata yang membuka praktek di Jalan Gatot Subroto No. 89, KM 4.5, tepatnya di depan showroom mobil Nissan. Ia menambahkan untuk mendapat penyembuhan pada mata, bisa menjalani terapi, atau melalui pengobatan tradisional, dengan ramuan khas India. “Bahan baku ramuan yang diberikan didatangkan dari India, yang sangat popular bagi masyarakat di sana,â€? ujarnya yang mengaku ramuan tersebut diracik sendiri. Menurut Jhoni, tingginya angka penderita yang mengeluhkan kerusakan pada penglihatan, tak terlepas dari perkembangan teknologi. “Yach ‌ itulah dampak dari kemajuan. Tapi tak perlu khawatir untuk menyikapinya, karena ramuan yang saya olah, mampu mengembalikan penglihatan, jernih seperti semula,â€? ujarnya meyakinkan. Menurutnya, untuk mengobati mata rusak, baik rabun jauh, dekat, katarak, buta warna dan lainnya, dalam tempo 15 hari, bisa sembuh total. “Tak memerlukan waktu yang lama, cukup 3 kali kunjungan, keluhan pada mata sudah bisa teratasi,â€? ujarnya. Sudah cukup banyak yang berhasil disembuhkan Jhoni melalui ramuan yang diberikannya. Pasiennya pun tak hanya datang dari Medan saja, melainkan juga dari daerah, sebut saja Padang Sidempuan, Siantar, Tebing Tinggi, bahkan dari Nangroe Aceh Darussalam. “Ramuan yang saya berikan, telah dibuktikan oleh ribuan pasien yang datang kemari. Kerusakan mata yang cukup parah pun, bisa disembuhkan,â€? tegas Jhoni.(Jafar)

Ekspedisi Alam Gaib Tebing Tinggi (2)

Kereta Kencana di Rambung Merah TEBING TINGGI TEPAT di depan Kantor Lurah Bandar Utama, Kecamatan Tebing Tinggi Kota, berdiri pohon raksasa yang telah berusia ratusan tahun. Tingginya mencapai 35 meter. Pada malam tertentu, terdengar ringkikan kuda dari pohon itu. Agus Rojali, pegawai kelurahan menuturkan, di pohon besar yang diberi nama Rambung Merah ini, bersemayam seorang putri yang selalu mengendarai kuda kencana. Dari arah pohon, juga sering terdengar suara- suara gaib. “Pada malam – malam tertentu, terdengar suara ringkikan kuda dari pohon itu,� ujarnya sambil menunjukkan ke arah pohon rambung merah. Menurutnya, sosok putri yang menetap di pohon Rambung Merah itu merupakan titisan dari kesultanan yang pernah berkuasa. Perlintasan kereta kencana yang tak menyentuh tanah itu, dari pohon Rambung Merah – bekas rumah sultan yang pernah berkuasa, dan arah Sungai Padang. Masyarakat setempat meyakini, mahluk gaib yang bersemayam di pohon tersebut tidak mengganggu, bahkan bisa membantu kesulitan, sehingga tepat di depan pohon rambung merah, disediakan tempat untuk meletakkan sesajen. Dan seminggu sekali, ramai dikunjungi oleh para penziarah.


RAMBUNG Merah yang rimbun, berdiri gagah di Kelurahan Bandar Utama. INZET : tempat untuk meletakkan sesajen.

Sementara Agus yang ditemui POSMETRO MEDAN, merupakan orang yang terpilih untuk membersihkan dan merawat pohon itu. Jika ada yang datang ke tempat itu, tentu harus

berpamitan denganAgus. Jika tidak, kataAgus, bisa mengakibatkan suatu masalah. Bisa kerasukan mahluk halus, atau bahkan jatuh sakit.(Jafar)



Izin Kejati No.B367/DSP5/II/2008 1. Kesempurnaan susuk inti karomah. (tanpa memasukkan Benda/Halal !) Kekuatan megis yang ampuh dan merupakan inti dari segala jenis ilmu susuk spontan ! pancarkan sinar aura seluruh tubuh, cantik/tampan dan awet muda, mempertajam aura mata, murah rejeki & membawa anda menuju puncak sukses 2. “ Pengasihan nur Muhammad + nur Yusuf Ilmu pengasihan tingkat tinggi, cahaya seribu bulan, seribu bintang, sedap dipandang, wajah berseri-seri, berkharisma, selalu dimuliakan banyak orang & membawa kasih setiap yang memandang..... 3. Mustikan batu cincin� (berisi khodam) Sebagai perisai diri, menambah keberanian, mental baja, penunduk, wibawa besar & memperkokoh jabatan 4. “ Ikat pinggang inti karomah� (berisi khodam) Terbuat dari kulit asli, memiliki khasiat sama dengan mustika batu cincin & membawa keberuntung 5. “ Pengisian kosmetik ratu cennera� Menjadikan wajah Anda cantik jelita, bercahaya, mengundang perhatian & cinta dahsyat! 6. “ Pelet Vagina+ramuan perawan� Bikin pasangan terpikat cinta, tergila-gila, nikmat tiada tara & anti selingkuh 7. “Uang Asma & Aji Sedot rejeki besar� 8. “Ilmu gendam pelaris besar 4 penjuru� 9. “Ruwatan akbar buang sial & aura bersinar terang� 10. “Susuk pamungkas Samber lilien & Kinjeng Mas� Bertuah ghaib sangat dahsyat, di isi kekuatan semar mesem Bebas Semua Agama & Mahar Terjangkau ! Jadwal Konsultasi Tiap Hari Kecuali Minggu Hub: Bambang Al-Aziz (061) 773.773.70, Hp: 0813 7084 7253 Jl. Medan-Tg. Morawa km.12,5 Gg. Suka Mulia No.76 Dekat Pesantren Al- Mukhlisin


izin Dinkes No.44 84/0721/I/2004 Kini kami telah hadir di kota Medan. Tahukah anda, dimana kelemahan pada hidup anda??? kami hadir dan berpengalaman untuk mengobati penyakit serta keluhan anda. kami juga telah siap membantu dengan cara fhisiotherapy dan aku pressure. serta dibantu dengan obat-obatan Tionghoa. adapun keluhan dan penyakit yang dapat kami obatin antara lain: gagal ginjal, batu ginjal, infeksi, segala jenis kanker, segala tumor, rematik tulang, rematik saraf, kencing batu, darah, nanah, ginjal tak berfungsi, ingin langsing, gemuk, darah tinggi,darah rendah, paru-paru bocor, bengkak, belum ada keturunan, polip, pilek menahun, sinusitis, batu asma, TBC, prostan, usus turun, spilis,raja singa, keseleo, liver, hernia, amandel, gondok, steroid, malaria, kolestrol, stroke, ambeien, usus buntu, sakit maag, sakit ulu hati, exim, mani encer, ejakulasi, lemah syahwat, telinga keluar nanah, kencing manis, gula, kanker payudara, kanker rahim, tipes, epilepsi,dll Buktikan !!!!!! Jarang ada yang gagal Biaya sedikit hasilnya banyak !!! Praktek buka mulai jam 09.00 s/d 19.00 WIB

Alamat Praktek: Jl. Prof. H.M Yamin/Jl. Pahlawan Gg. Mawar No. 4A MEDAN (Âą 100m dari Aksara Plaza) Informasi Hub:

Hp. 0812 657 98324

�Pemeriksaan dan Konsultasi gratis.... �

PEMIKAT MAHA META Bermanfaat untuk: • Mengatasi perselingkuhan • Menundukkan pasangan • Manarik/menawan orang banyak • Memancarkan karisma/ wibawa • Pelarisan usaha • Cahaya Pemanis Wajah • Membobol karir terhambat • Cepat dapat jodoh • Cepat dapat kerja • Pancaran aura pesona Melayani pengobatan alternatif • Terapi totok energi • Terapi bekam/ hijamah • Ruwatan pribadi/ ruwatan masal • Pagar gaib rumah, toko, restoran, kantor, hotel • Bimbingan pelatihan Inner Power Tersedia Aji rajah pitunang pangkat - dompet bertuah - sabuk hikmah lipat tujuh - koin penarik rizki - sapu tangan keberuntungan - ramuan dahsyat kewanitaan Hubungi:Spiritualis Mang Ujang Jl. Luku I No.65 (Simp.Universitas Al-Azhar) Medan Johor, Flexy: (061)769 69001 izin Depkes No.448/2875/III/2008 Kejati no.B.50/dsp.5/03/2008



Kami mempunyai ramuan alami tanpa efek samping seperti: - Mata Merah - Mata katarak - Rabun Jauh/ dekat - Buta Warna - Mata berkunang2 - Mata berlemak akibat diabetes Baik pria/wanita, tua/muda yg berkacamata sembuh tanpa kacamata Kami juga dpt mengobati keluhan pria seperti: lemah syahwat, kurang perkasa, ejakulasi dini, kurang gairah, serta asam urat, reumatik, ambeien, polif, sakit telinga, atas ijin Tuhan yg maha Esa, cukup 1 x pengobatan, sembuh untuk selamanya Hub: Jl. Prof. HM. Yamin SH, No.378 buka praktek jam 08.30 s/d 18.00 WIB Minggu libur, tetap buka 08.30 s/d 14.00 WIB Mohon perhatian kami tdk mempunyai cabang di Kota Medan dan sekitarnya



IZIN KEJATI NO.B-130/DSP-5/2009 1. Program “ISMU PAMUNGKAS JAGADâ€? dengan mengikuti program keilmuan ini seketika Anda akam memiliki kesehatan tubuh, wajah bercahaya, daya tarik mempesona berwibawa, ilmu pemikat, pelarisan usaha, terbukanya pintu rejeki mendapat keturunan (bagi yang belum punya anak) usaha bisnis jabatan jadi lancar, kebal sajam, tumpul, pukulan berbahaya, tenaga dalam, menembus dimensi gaib, dimensi cahaya, kendalikan mendung, hujan, bisa mengobati diri sendiri, keluarga, maupun orang lain, ketenangan lahir & batin, selamat dunia & akhirat, ilmu ini sangat banyak manfaatnya bagi anda sekeluarga. Pengisian hanya dalam tempo 2 jam permanen. 2. Program “ Meditasi jabal nurâ€? Fungsi: meningkatkan kualitas kesehatan tubuh, wajah bercahaya, awet muda, daya tarik mempesona, inner beauty, ketenangan lahir dan batin, dll 3. Gendam Burung Walet Dalam tempo Âą 100 hari burung-burung walet akan datang berduyun-duyun kesarang walet anda, bergaransi 4. Melayani: konsultasi asmara, jodoh, rumah tangga, usaha, bisnis, karir, jabatan, pilkada, jual beli tanah, rumah, mobil, tender, dll 5. Pengobatan Medis & non medis Jantung, ginjal, stroke, diabetes, kanker, kista, anemia, gunaguna, teluh, polong, cirik barandang, plasik, anak rewel, dll Hub: Bpk. Sopan Syah, Pane, Mph

0813 6146 4926 Alamat: Jl. Sunggal No.373 B (disamping Wisma Bambu) “ Ketenangan Jiwa Adallah Kunci Sukses di dunia & akhirat�



Melayani Berbagai Macam Keluhan Antara Lain: * Khusus Pria, Tambah Ukuran * Khusus Wanita - Panjang 13-16-19-22 cm - Memperbesar payudara diameter : 3,5, 4- 4,5, 5- 5,5- 6 cm - Terapi Perawan/ virgin - Kuat dan Tahan Lama - Kista, Lemah Kandungan - Ejakulasi dini, sphilis/ rajasinga, - Kanker Payudara mani encer - Ingin Mempunyai Keturunan dll - Lemah Syahwat, diabetes, Buka setiap hari impoten , dll

* Ingin cepat dapat jodoh, pengasihan disegani jam 08.00- 21.00 atasan, menyatukan dan memisahkan PIL/ WIL, puter Mahar Rp.500.000 giling, juga melayani pasang susuk dll Bergaransi,alami tanpa efek samping, langsung reaksi ditempat, hasil permanen untuk seumur hidup. izin: B-70/DSP.5/II/2007 Alamat Praktek: Jl. SM. Raja Depan Taman Makam Pahlawan No.130 B Medan Samping Showroom Toyota Auto 2000 Belakang Tambal Ban

Hp: 0813 8042 6253- 0856 5953 9676



HJ. MAK. EROT Ditangani Langsung oleh A. SAHRUDIN Izin No : B-204/DSP.5/08/2007 Mengobati khusus alat vital komplit bagi pria dan wanita asli alami, paten seumur hidup, bebas usia dan agama. Khusus Pria : Khusus Wanita : - Panjang, besar, perkasa. - Ingin punya keturunan - Kuat, keras, tahan lama. - Payudara jadi montok dan indah R HA MA - Lemah Syahwat Rp.600.000, - Ingin cepat dapat jodoh - Mani Encer - Buka Aura, pengasihan - Impoten, Kencing batu, dll - penglaris, pasang susuk, dll Bentuk ukuran: Panjang: 14 cm, 16 cm, 17 cm, 20 cm Buka tiap hari: Jam 08.00 s/d 21.00 WIB Diameter: 3 cm, 3,5 cm, 4 cm

Alamat Prakter : Jl. SM. Raja Depan Bengkel MIKRO Auto service belakang CV. PERDAMAIAN GG. Purnama No.1 Âą 50m dari simpang Jl. HM. Joni/ Taman Makam Pahlawan HP : 0813 9752 5049

EYANGPASMA PARANORMAL KODRATULL AH Dengan Izin Tuhan YME siap membantu Anda: l.Pengisian Ilmu Hikma Sejati: Jatuhkan Musuh Tanpa Menyentuh, Kekebalan, Pengobatan, Anti Air Keras, Silat Ghaib, Pencak Keramat, Hlpnotisme, llmu Gerak Rasa, llmu Abdul Jabar, dan Tembus gaib. 2. Pelet Semar Mesem. Jaran Goyang. Ular Cinta Mani, Untuk Menaklukan Pasangan, Merukunkan RumahTangga, Menarik Pasangan Minggat dan Kunci Pasangan. 3. Susuk Intan. Emas. Rekso, Gotri,Pembukaan Aura Luar Biasa, Cantik, Menarik, Mempesona, Tampil Beda, dan Awet Muda. 4. Asoceris Hikmah: Sabuk Hikma, cincin Asmak, Untuk Penarik Rizki, Urusan Tender, Dimudah kan Urusan, Percaya Diri, Terhindar Dari Santet • Guru Besar Cakra Sakti Indonesia (Caksindo) • Ketua Paranornal Sumut 2002 - 2006 Hubungi:

PADEPOKAN EYANG PASMA Jl. Sei Belutu No.39 Medan Baru Hp: 081 633 1604 izin Kejati: 1333/DSP/02/08 NB: Tidak Ada pantangan untuk semua suku dan agama, bebas

1. Impoten, L. Syahwat (gula), kurang gairah/ keras, tambah besar & panjang 2-3-5 cm, ejakulasi dini, mani encer, telor turun, mandul, terbukti di tempat, permanen, aman, tanpa efek samping mahar 100 ribu 2. Urat terjepit, otot persendian kaku, mati rasa, angin duduk, mahar 50 rb 3. Pagar badan, pelet, penglaris mahar 50 rb 4. Pengobatan ghaib (ruqyah),membuang hasad dengki manusia, ilmu2 hitam, dll 100 rb 5. Buka aura, kewibawaan, penunduk, awet muda,murah jodoh/kerja, buang sial, dgn mandi minyak panas, air raksa, samber lilin mahar 200 rb 6. “Ramuan� keperawanan agar rapat, legit, wangi, kesat, keputihan, 300 rb 7. Mengobati jerawat batu mahar 200 rb 8. Patah tulang, terkena guna, santet, narkoba, stress, siplis (raja singa), medis/non medis, lainnya. 9. Memisahkan WIL/PIL 10. Buka pintu ghaib, pandangan ghaib, silat ghaib, komunikasi dengan seluruh ghaib.


Jl. Pertahanan / Patumbak Taman Jasmin Mas No. A 4 Amplas, Hp: 0812 604 1050 Flexy 061-7769 8634 Izin. Kejatisu : B-23/ DSP 5/ 001/2008


IZIN TERDAFTAR DEPKES NO.448/2057/11/2008 Tidak ada penyakit yang tidak bisa sembuh, kecuali malas berobat dan berusaha. Suatu penemuan ramuan resep kuno di zaman dahulu kala yang bisa mengobati segala macam penyakit, dengan pengobatan tradisional yang luar biasa mujarab dan sudah diakui oleh ilmu kesehatan sekarang ini, bahkan sudah ribuan orang yang sudah kami bantu pengobatannya. Maka bila Anda sudah menderita penyakit, belum pernah mendapat kesembuhan segera Hubungi alamat kami (nsya Allah, anda akan sembuh dengan ramuan kami). Cara pengobatan yang kami lakukan Reflexiologi dan Terapy. KELUHAN YANG DAPAT KAMI OBATI ANTARA LAIN: Amandel/Radang Tenggorokan, Ambeyen/ Wasir Alergi exim/Gatal. Batuk Darah, B.karang/B. Ginjal. Cepat K.Mani. Darah Tinggi/Rendah. Fistelkista. Flek Hitam-jerawat, Gondok/K.triod. I. Keturunan. Ingin Gemuk/ Kurus, Jantung/Stroke. Keputihan/ Vrigite. S.Napas/TBC, Kanker Rahim, Payudara. Manis/Gula. Kanker Ganas/Jinak, Kurang Ingatan/Sawan, L. Syahwat/Mani Encer, Liver (S.kuning). Lemah Syaraf/Ayan. Leukimia, Mata Rabun/ Katarak. Maag/Ulu Hati/Asam Lambung, Malaria, Tipus/Hepatitis, Hernia/ Turun Berok, Sinusitis. Paru-paru/Asma, Polip/ Pilek Menahun, Pengapuran Tulang-asam Urat, Pendengaran Kurang, Polio, Reumatik/Lumpuh. Radang Otak, S.Pinggang, Susah Tidur/ Lesu. Spilis/G.O. Telat Datang Bulan. Varises, Kusta/Lepra. Usus Buntu. Dll.

Dengan izinAllah SWT, Semua Penyakit Diatas Dapat Sembuh dalam Tempo YangTidak Teralalu Lama Dan Sehat Seperti Semula Alamat Praktek: Jl. Letda Sujono Gg.Banjar No.3 (depan Galon SPBU/Belakang tk.Fajlina Maryam) Bandar Selamat Medan Tembung Medan Sumut

MAJELIS SPIRITUAL AL- JANNAH Anda sudah kemana-mana belum berhasil baik belajar atau hajatan Anda? Insya Allah kami siap membantu Anda !!! 1. Ritual 7 pancar, untuk kesuksesan, mudah jodoh, pengasihan, daya tarik biaya Rp.175 rb 2. Mandi Arashy: untuk mempercepat jodoh nenbuang penghambat kerezekian Biaya Rp. 125 rb 3. Penyatuan pasangan agar suami/ istri tidak selingkuh, keharmonisan rumah tangga biaya Rp.165 rb 4. Pelatihan menjadi paranormal yang berkualitas dan profesional 1. Terowongan 5 . Pembersihan 2. Pemagaran gaib rumah dari gaib 3. Pengobatan 6. Menguasai semua 4. Mengatasi kemasukan program yg di iklan dll. Biaya Rp.375 rb Hub: EYANG ABAS (061)77648370 - 0813 9730 6018 Jl. KL. Yos SUdarso Lr. Iya No.23 Glugur Kota depan PT. Socfindo/ tanya rumah JEFRI Praktek jam 10.00 - 20.00 WIB Non SMS - Miscall Siap membantu Tuntaskan

( PADEPOKAN MACAN WALI ) Masalah Anda Terbuka untuk semua agama 1.SUSUK SEMAR MESEM (Pengasihan super dahsyat). Khasiat: Wajah bercahaya, bak pelangi, berkilau, bikin doi jadi lengket, suami/ istri/ pacar, teman kerja, atasan/bawahan jadi tunduk pada Anda 2.MUSTIKA KAROMAH WALI Fungsi : Bela diri gaib, kebal pukul, kepruk, sajam (langsung tes) selamat dari gangguan jin/syetan, black magic, bonus penderas (pukulan tapak wali) 3. PENGASIHAN MUSTIKA DELIMA Paduan energi alam dan energi Ilahiyah, daya magicnya langsung terasa di badan, bikin pesona diri, kharisma, wibawa, sukses karir, jodoh, dan lain-lain 4. MUSTIKA PUSER BUMI (Pelaris super) Daya gaibnya untuk menggaet pelanggan, melindungi tempat usaha dari lawan bisnis anda, usaha laris jadi berkah, dunia akhirat. 5. RUWATAN 1000 BUNGA Cocok bagi anda yang sulit jodoh, gagal dalam asmara, rumah tangga, karir macet, usaha jalan ditempat sakit tdk kunjung sembuh, selalu sial, kena guna2, santet, korban ilmu hitam 6. KAMI JUGA MELAYANI: Pijat refleksi, meditasi buka aura, tafsir mimpi, terawang alam gaib, ketemu kembaran diri, benda pusaka, membaca garis nasib anda, keartisan, kunci pasangan, pengobatan segala penyakit, dan lain-lain

Hub: GUS ILHAM MAULANA Jl.Medan Tjg Morawa km 13,5 Gg. Lokasi, Komplek Tamora Indah 2 Blok B 38 Hp: 0852 2619 8295

3 X KUNJUNG SEMBUH/ RINGAN KECUALI KRONIS & BERAT Mengobati Sakit di Anggota Badan a. Kaku d. Kebas b. Linu e. Pegal c. Semutan f. Tegang otot

Efek samping dari penyakit : 1. 2. 3. 4. 5. 6.

Syaraf terjepit Pengapuran Jantung Diabetes Tek. darah tinggi Asam urat

7. Pinggang 8. Pinggul 9. Betis 10.Tengkuk 11. Asam lambung 12. Kolestrol

Juga melayani sakit lemah syahwat Hub: SIN SHE DENNY AHLI URAT SYARAF Jl. Polonia No.60 Medan (masuk dari Jl. Monginsidi Âą 300M sebelah kanan Jalan/ Pagar Hijau ) Tlp.061- 3030 8068 Praktek: Jam 8.30 pagi s/d 17.30 sore Tarif Rp.50.000,- 1 X berkunjung

POSMETRO MEDAN Telp. 7881661






BANYAK pria mengonsumsi obat kuat untuk memuaskan pasangannya. Gairah seks pada pria akan menurun pada usia 45-50 tahun. Beda dengan wanita yang tidak mengalami penurunan gairah seks meski usia sudah lanjut. Kalaupun ada hanya sedikit dan tidak kentara. Seeeee…

DIASUH : SPIRITUALIS MANG UJANG (Pemilik Ilmu Maha Meta & Pemikat Lawan Jenis ) CP : 0813 6122 8624

Gairah memegang peranan pen- fungsi yang dimilikinya yaitu ting dalam hubungan seks yang nor- bikin keras dan mal. Tanpa gairah, hubungan seks akan terasa hambar. Untuk itu para pria sering mengkonsumsi obat kuat untuk menam bah gairah dan meningkatkan daya tahan dalam berhubungan intim. Ada banyak jenis dan merek obat kuat. Ada yang ditelan seperti pil dan dioles seperti minyak dan tissue. nMenurut Dewo, pete mp at me sa la h sa tu daya seks itu. Di si ni la h milik King Seng di grak n pil pendon tka pa da Jalan SM Raja, MePM/ Widya dan yang menjual obat paten dan jamu tahan lama. Selain itu perkasa khusus untuk pria menga- reaksi Lang Zio yang bisa berutakan, banyak pria yang mencari lang-ulang membuat pria jadi dan ketagihan dengan obat kuat. ketagihan mengkonsumsinya. “Ingin membahagiakan istri “Banyak yang cari karena khasiatnya terbukti dan kalau cocok supaya lebih tahan lama, kadangbisa ketagihan dan balik lagi kadang istri pengen variasi dalam kesini,” tuturnya. Kebanyakan berhubungan ya kita layani” ucap oles seperti oil dan tissue. Jika kaum adam yang datang ketem- Bayu salah seorang pengguna memakai obat oles biasanya oil pat ini membeli obat berupa pil pendongrak kelelakian itu. Tapi atau tissue dioleskan 5 - 10 menit yaitu Lang Zio yang sedang di- ada juga yang tidak cocok dengan sebelum berhubungan. minati sekarang. Karena dua obat ini dan lebih memilih obat Bagi mereka yang tidak mau me-

AQUARIUS (20 JANUARI-18 FEBRUARI) Kalau Anda mau maju, Anda harus membuka mata dan telinga Anda. Manfaatkan kesempatan dan sarana yang ada. Buka juga telinga Anda terhadap berbagai informasi. Nasihat dan wejangan orang yang lebih berpengalaman bisa membantu Anda untuk maju. ARIES (21 MARET-19 APRIL) Apa yang Anda perbuat dan katakan dilihat dan didengar orang. Mereka tertarik dan merasa bahwa apa yang Anda katakan itu bukan omong kosong. Tapi jangan terlena. Anda mesti tetap membuka mata dan sadar bahwa Anda juga masih harus belajar. TAURUS (20 APRIL-20 MEI) Kalau Anda tidak kreatif, Anda akan mendapat masalah. Sehingga tantangan terbesar Anda pekan ini adalah apakah Anda tenang, Anda akan berpikir dengan jernih apa yang mesti Anda buat. GEMINI (21 MEI-21 JUNI) Anda sudah dikepung kesibukan pada awal pekan ini. Ada pekerjaan ini, ada pekerjaan itu. Ada urusan ini, ada urusan itu. Menariknya, Anda bisa menghadapi semua itu dengan senyum. CANCER (22 JUNI-22 JULI) Ada hal yang tak beres, baik di lingkungan atau pun pekerjaan Anda. Hal itu benar-benar mengganggu Anda. Perlukah Anda marah ? Atau sewot ? Kalau Anda ingin menunjukkan kematangan dan kedewasaan, cari tahu akarnya dan pecahkan masalahnya. LEO (22 JULI-22 AGUSTUS) Pekan ini adalah pekan khusus untuk keluarga dan teman-teman Anda. Dan Anda mesti memberikan waktu untuk mereka. Tidak perlu dengan memberi hadiah yang “wah”. Yang mereka butuhkan adalah kehadiran dan kehangatan sikap Anda. VIRGO (22 AGUSTUS-22 SEPTEMBER) Mengapa bersusah payah sendiri ? Mengapa keukeuh berjalan sendiri ? Anda kira bisa mengatasi semua hal seorang diri ? Ingat baik-baik, Anda membutuhkan kehadiran orang lain. Karena itu, jalinlah komunikasi dan kerja sama yang efektif. LIBRA (23 SEPTEMBER-22 OKTOBER) Tidak salah bahwa Anda berjuang keras untuk meraih ambisi Anda. Tapi jangan terlalu ambisius. Anda harus ingat bahwa orang lain juga ingin maju. Karena itu, jalinlah kerja sama yang mutual. Itu senjata paling aman untuk maju bersama. SCORPIO (23 OKTOBER-21 NOVEMBER) Jangan betah dan kagum pada kemampuan yang Anda miliki sekarang. Ingat, dunia selalu berubah. Perkembangan teknologi semakin cepat. So, belajar dan tingkatkan kemampuan dan wawasan Anda. Jangan menjadi orang asing di dunia sendiri.


makai obat kuat ada juga jamu yang bisa jadi alternative untuk menambah gairah dalam bercinta. Kata Dewo jamu lebih aman dikonsumsi karena lebih alami. Meski reaksinya lambat

tapi tidak ada efek samping seperti obat pil dan oles. Karena bagi mereka yang tidak cocok dengan pil dan oles bisa pusing dan sedikit kebas ‘anunya’. (Widya)

DIASUH : BAMBANG AL AZIZ (Spiritualis Masalah Asmara & Problem Rumah Tangga) Cp : 0813 7084 7253

DUNIA entertaint yang glamour dan menuntut orang-orang di dalamnya untuk multitalent membuat Windi Jayanti tertarik berkecimpung ke dunia ini. 2 tahun menggeluti modeling anak tunggal pasangan Alm. Aliong dan Marina ini mengaku enjoy dan ingin profesional menjalaninya. Gadis kelahiran Jakarata, 17 April 1991 ini ingin total di entertaint. Tidak hanya model tapi juga acting dan menyanyi. “Bibit entertaint itu dimulai dari model. Karena di model gak cuma diajari catwalk tapi juga disiplin dan berjiwa besar,” ucapnya.

MENU TIPS : Senin : Griya, Selasa : Kecantikan, Rabu : Seks, Kamis : Psikologi, Jumat : Sehat, Sabtu : Asmara

Jurus Cinta Paling Seru

Gadis yang awalnya diajak temannya masuk modeling ini sudah melakoni model dan akting hanya tinggal menyanyi saja yang belum. “Pengen juga sich nyanyi, kata teman-teman suaraku bagus tapi harus banyak belajar dulu lah,” ucapnya. Prestasi cewek dengan tinggi badan 170 cm ini cukup banyak antara lain, juara favorit Sophie Paris 2008, juara favorit busana Kartini 2007, the best performance busana muslim butik etalase 2008 dan juara III beasiswa Imagen. Cewek berdarah China-India ini juga pernah jadi model video klip band Medan.(Widya)

Kemana Malam Minggu ?

“Saya cinta kamu.” Tiga kata yang simpel dan sarat makna. Hanya diucapkan di mulut saja sudah membuat hati melayang. Apalagi jika diucapkan dengan cara yang tidak biasa, mau tau cara yang paling seru ?

RETRO : Znergy Band dari Philippines, DJ Inus dari Jakarta DJ Dendy dari Jakarta SOCCER : Neo Fantasi Band Child Band Parissiene Band.

IKLAN SURAT KABAR Buat iklan di surat kabar yang sering dibaca dan deklarasikan cinta Anda. Ia pasti surprised melihat namanya muncul di iklan surat kabar.

D’NEWS Café : The C-Reform from Jakarta DJ Cruz from Bandung ZODIAK PUB : Rithym n Beat dari Jakarta Sexy dancer (ali)

ABADIKAN LEWAT BUKU Bukukan kisah perjalanan cinta Anda berdua. Kirimkan novel tersebut di momen spesial, seperti di Hari Valentine, hari jadian, dan ulang tahunnya.

PM/ Widya

CAPRICORN (22 DESEMBER-19 JANUARI) Fokuskan perhatian Anda pada apa yang mau dirauh. Kerahkan tenaga dan kemampuan Anda untuk maju. Tapi jangan menyinggung perasaan rekan kerja atau pimpinan Anda. Lebih baik Anda mengerjakan bagian Andan dengan tenang. Tapi kalau Anda diminta untuk bekerja sama, jangan tolak. PISCES (19 FEBRUARI-20 MARET) Anda harus percaya diri bahwa Anda bisa. Anda harus percaya diri bahwa Anda punya kemampuan. Anda harus percaya diri bahwa apa yang Anda miliki ini, sekalipun kecil dan sederhana, dibutuhkan orang lain. Itu kunci pertama untuk sukses.

PM/ Widya

Aku Hanya Sapi Perah Kekasihku >>> Penulis : Syahrul

sebut tetap saja aku lakukan di dalam rumah. Namun sejak aku mengenal Hendra saat aku duduk di bangku kuliah, secara perlahan kejenuhan dan kehampaan yang selalu membayangi hidupku mulai sirna, aku sepertinya baru terlahir di dunia. Dan pertanyaan yang selama ini tersimpan rapi di hati

NAMAKU Sari (bukan nama sebenarnya), usiaku saat ini 38 tahun, aku anak tunggal yang berasal dari keluarga yang cukup mapan. Orang tuaku adalah orang-orang yang memiliki penghasilan yang lumayan besar, sehingga semua kebutuhanku selalu bisa mereka berikan. Walau dibesarkan di lingkungan keluarga yang serba berkecukupan, dengan fasilitas yang serba lengkap, aku tetap merasakan ada sesutu yang hilang dalam hidupku. Sejak aku duduk di bangku SMP, papa dan mamaku sudah sering meninggalkan aku di rumah, terkadang selama beberapa hari mereka tak pulang, sehingga semua keperluanku pembantu yang mengaturnya. Aku sebenar jenuh dengan keadaan itu, untuk bermain keluar rumah bersama teman-temanku aku tak berani, karena papa dan mama melarangku untuk melaPM/ Ist kukan hal itu. Hingga aku SMU, situasi tak pernah berubah, bahkan semakin menjenuhkan. Orang tuaku bahkan ini terjawab sudah, bahwa aku lebih lebih sering meninggalkan aku sam- membutuhkan perhatian dan kasih sapai beberapa minggu lamanya. Aku yang daripada fasilitas dan kemamemang berusaha mengatasi kejenu- panan. Perhatian yang selama ini han tersebut dengan bermacam jarang aku dapatkan dari kedua orkegiatan, namun semua kegiatan ter- ang tuaku. (Bersambung)


„ Fingerprint

Pesan Positif Lewat Lirik



PM/ Int

DI TENGAH maraknya band-band Kota Medan bermunculan dengan aliran musik pop yang easy listening, Fingerprint hadir dengan jenis musik hardcore. Terbentuk pada tahun 2003, berawal dari komunitas hardcore yang sepakat membentuk band ini karena kesamaan hobi yakni sama-sama mencintai musik hardcore. Fingerprint hadir dengan gaya mereka sendiri dan ingin dikenal karena musikalitas mereka yang cukup baik. Terdiri dari 4 personil, Putra (vocal), David (guitar), Ari (bass) dan Rio (drum) Fingerprint ingin musik mereka bisa diterima masyarakat Indonesia khususnya kota Medan. Meski bagi masyarakat awam jenis musik ini belum akrab ditelinga, tapi menurut mereka musik mereka cukup bisa diterima karena selalu mendapat respon baik setiap kali manggung. Lirik mereka yang terfokus pada sosial, family, friend dan kehidupan membuat mereka mencoba untuk menyampaikan pesan-pesan positif lewat lirik-lirik yang mereka ciptakan. (Widya)

KOLEKSI SMS Bukukan semua SMS atau e-mail cinta yang Anda terima dari si dia. Kemudian, kirimkan buku tersebut padanya. Cantumkan tanggal dan momen saat SMS atau e-mail itu dikirim. CINTA DALAM 100 BAHASA Belajarlah mengatakan “saya cinta kamu” dalam 100 bahasa. Kirimkan kata yang berbeda setiap hari. Selamat mencoba. (*)

SAGITARIUS (22 NOVEMBER-21 DESEMBER) Anda harus punya tingkatan nilai yang jelas. Terhadap setiap tingkatan nilai itu. Anda mesti memberikan sikap yang berbeda. Jangan perlakukan hal yang biasa berlebihan. Jangan memperlakukan hal yang penting sebagai sangat mendesak.



SERATUS PERMEN CINTA Belilah sekantung permen dan bungkus setiap permen dengan kertas kecil yang berisi alasan Anda mencintai dia, dari yang serius, romantis hingga lucu. Masukkan permen yang telah terbungkus dalam satu stoples atau wadah lucu. Berilah label dengan tulisan besar 100 alasan saya mencintai kamu. Dosis: Ambil satu setiap hari selama 100 hari.




Putra PM/ Widya



31 JANUARI 2009

Dituding Sengsarakan Rakyat

Sementara itu

MEDAN SEPANJANG tahun 2008 tercatat 57 kasus pelanggaran hak asasi manusia yang terjadi di Sumut. Pelanggaran HAM ini banyak menelan korban dari kaum yang termarjinalkan seperti petani, buruh, dan nelayan. Hal ini diungkapkan sejumlah lembaga swadaya masyarakat, yakni Bakumsu, Bitra Indonesia, KSPPM, KPS, Yapidi, KAMG, Kontras Sumut, dan OPPUK, saat bertemu wartawan kemarin. “Dari 57 kasus, 26 di antaranya merupakan pelanggaran hak sipil politik (Sipol), yakni hak

BERASTAGI TERKAIT terjangan limbah Mikie Holiday Hotel Berastagi ke areal pertanian warga Peceren dan Jalan Tembus Vihara. Walhi Sumut menghimbau masyarakat (konsumen) untuk memboikot kunjungan ke hotel berbintang itu. Hal ini perlu dila-

kukan dalam mendukung terciptanya tatanan lingkungan yang sehat di Berastagi. Ajakan boikot ini disampaikan Ekskutif Daerah Wahana Lingkungan Hidup ( WALHI) Sumut, Jop Rahmad Purba pada POSMETRO MEDAN, kemarin (30/1)


>> Baca WALHI Di Hal 10

Dendam Pembantu yang jadi Budak Seks Majikan Selama 12 Tahun

>> Baca Pelanggaran Di Hal 10


BINJAI KETUA KPU Kota Binjai, Agus Susanto, kemarin (30/1) siang diteror seorang pria yang mengaku Asisten Pidana Khusus (Aspidsus) Kejari Binjai bernama Gunawan. Ironisnya, dalam perakapan via handphone itu, Agus disuruh menghubungi Kepala Kejaksaan Negeri (Kajari) Binjai. Bahkan, Agus juga diminta dating ke Kejari dengan membawa sejumlah uang. Ketika dinkonfirmasi, kepada POSMETRO MEDAN, Agus mengatakan, telpon gelap itu masuk sekitar pukul 10.00 WIB, dan diterima stafnya. Ketika itu, melalui stafnya, Gunawan menyuruh Agus menghubungi Kajari Binjai ke

TEBINGTINGGI Ingat kisah sedih Roslaila Boru Manik (30), gadis asal Tebing Tinggi yang 12 tahun jadi budak seks majikannya, A Kiet alias Lim Lie Kiet (65), si toke belacan. Setelah menempuh perjalanan panjang nan terjal, akhirnya keadilan yang lama dinantinantikan kaum hawa yang harkat martabatnya dizolimi itu terwujud jua, menyusul jatuhnya palu hakim yang memvonis A Kiet pidana 6 tahun 8 bulan penjara.

>> Baca Kajari Di Hal 10


Setidaknya vonis bersalah dan hukuman yang dijatuhakan majelis hakim PN Tebing Tinggi yang diketuai Zulkarnaen SH itu sedikit mengobati deritan warga Jalan Pekong, Kecamatan Padang Hulu, Tebing Tinggi itu dan keluarganya. Betapa tidak, semula pria bejat yang telah membenihi Roslaila, tapi tak mengakui Leni (3) darah dagingnya itu begitu angkuh saat Roslaila dan keluarganya melaporkan kasus


itu ke Polres Tebing Tinggi dua tahun lalu. “Mana mungkin orang miskin seperti keluarganya (Roslailared) itu bisa memenjarakan aku, hebat kali rupanya orang itu” kalimat angkuh ini diucapkan A Kiet, yang diucap kembali oleh Adi (36) abang kandung Roslaila pada POSMETRO MEDAN saat ditemui di Lembaga Bantuan Hukum (LBH) Menara Keadilan

>> Baca Biarkan Di Hal 10

Korupsi ATK Rp 1,3 Milliar


Saat pengambilan sample darah A Kiet untuk diperiksa DNA nya

Derita Riz, Korban Penyiksaan Ayah Kandung

REDPEL 085261116*** : PLN kurang jeli dengan banyaknya pencurian arus, saya sudah lapor 3 kali tapi tak ditanggapi, mungkin karena pelaku juga bekerja di PLN.

MEDAN KEKERASAN terhadap anak kembali terjadi di Medan. Kali ini menimpa Riz (8),bocah ingusan ini dianiaya

James Manurung (40) ayah kandungnya hingga babak belur. Ironisnya, perbuatan tak berprikemanusiaan itu dilakukan James karena tak senang Riz

berkunjung ke rumah neneknya di Jalan Mesjid, Gang Bersama Medan, sepulang sekolah.

>> Baca Kalau Di Hal 10

LANGKAT BEBERAPA waktu lalu, Kejari Langkat telah menangkap dan menjebloskan Kasubag Dinas P dan P Langkat, Adilta Bangun, tersangka dugaan korupsi pengadaan Alat Tulis Kantor (ATK) yag merugikan keuangan negara Rp 1,3 milliar. Setelah Adilta, kini penyidik mengincar AZ, Kepala Dinas P dan P Langkat, yang diduga sebagai pelaku utama pengadaan ATK tersebut. Hal ini ditegaskan Kasi Intel Kejaksaan Negeri (Kejari) Langkat, G. Sinuhaji, kemarin (30/ 1). Menurut

Sinuhaji, saat ini pihaknya tengah mengumpulkan bukti-bukti terkait aliran dana, termasuk memeriksa sejumlah Kepala Sekolah. “Jika pemeriksaannya sudah rampung dengan bukti yang kuat, maka Kadis P dan P Langkat akan kita tahan,” tegas Sinuhaji. Lanjutnya, selama ini pihaknya sudah melayangkan tiga kali surat panggilan terhadap AZ, namun

>> Baca Kadis Di Hal 10

KPK Limpahkan Suap Depnakertrans ke Kejari PIMRED JAKARTA Komisi Pemberantasan Korupsi (KPK) akhirnya memilih melimpahkan kasus dugaan suap yang mewarnai rapat koordinasi pertanggungjawaban dana dekonsentrasi 2008 Depnakertrans ke Kejaksaan Negeri Jakarta Barat. Begitu penyidikan berpindah meja, Lusmarina, Kepala Bagian Keuangan Bina Pelatihan dan Produktifitas, yang menjadi tersangka utama kasus itu pun harus mulai menguhuni Rutan Wanita Pondok Bambu.

Pelimpahan kasus tersebut didasari sikap bahwa Lusmarina tidak termasuk sebagai penyelenggara negara seperti yang diatur dalam UU No 28 tahun 1999. Sifat pekerjaan dan Lusmarina tersebut sama

>> Baca Lusmarina

Di Hal 10






sambunganhukum panggung






Roslaila, anak dan Ibunya.

melanggar Pasal 45 dan 46 UU RI No 23 tahun 2004 tentang penghapusan kekerasan dalam rumah tangga Vonis itu menurut hakim juga mengacu pada hal yang memberatkan, diantaranya tidak adanya itikad baik A Kiet untuk mempertanggung jawabkan perbuatannya yang memperkosa Roslaila selama 12 tahun. Selain itu, A Kiet juga sempat membantah kalau Leni (3) anak yang dilahirkan Roslaila adalah darah dagingnya. Namun bantahan itu mentah, setelah keluarnya hasil positif tes DNA yang diperiksa Mabes Polri yang menyatakan

Pelanggaran bebas berserikat dan berorganisasi, bebas dari penyiksaan, intimidasi, dan perlakuan kejam lainnya. Selain itu ada juga kasus yang menyangkut kebebasan menjalankan kepercayaan dan keyakinan, serta kesamaan di depan hukum,” kata Diah Susilowaty, Koordinator Kontras Sumut. Sementara, Iswan K Putra dari Bitra Indoensia, mengatakan di luar kasus-kasus di atas itu, ada juga 42 kasus pelanggaran hak ekonomi sosial budaya (Ekosob). Di antaranya hak atas pangan, hak atas perumahan, hak atas kesehatan, hak atas pendidikan, hak atas pekerjaan, dan hak akan lingkungan yang sehat. Menurut Iswan, pelanggaran hak asasi Sipol dan Ekosob di Sumut dipicu oleh minimnya kebijakan politik lokal (baik berbentuk Perda maupun peraturan kepala daerah) yang secara prinsipil dan substansial bertujuan untuk melindungi dan menegakkan HAM di Sumut. “Tidak ada pola pikir pemerintah yang maju dalam upaya menyelesaikan berbagai kasus sosial masyarakat yang terjadi. Yang ada justru watak plagiat dalam membentuk peraturan yang tidak menyentuh kepentingan masyarakat banyak,” tukasnya. Selain itu, pelanggaran HAM juga terjadi akibat minimnya terobosan politik dan agenda aksi yang jelas,

pikir. “Walaupun dia (A Kiet) nanti banding ke Pengadilan Tinggi (PT) Sumut, tapi putusan hakim itu menurutku sudah adil. Puas kali aku A Kiet dihukum tinggi. Jangankan aku, adikku (Roslailared) pun bersyukur atas putusan itu. Sejak kukasih tahu A Kiet divonis 6,8 tahun, adikku langsung gembira, dan penderitaanya sedikit berkurang. Bahkan adikku bilang, biarkan dia mati-mati di penjara,” celoteh Adi seraya bilang dulu sewaktu melapor ke Polres Tebing, A Kiet sempat sepele pada mereka yang hidup di garis kemiskinan. “Harapku, kiranya majelis

hakim yang menyidangkan kasus ini di Pengadilan Tinggi (PT) harus benar-benar berpihak pada hokum. Kalau bisa, hukuman untuk A Kiet ditambah lagi,” ujar Adi berharap. Hal senada juga diungkapkan Hj Herlina SH selaku penasehat hukum Roslaila. “Putusan hakim dan tuntutan JPU sudah sesuai keadilan. Tapi begitupun, di tingkat PT nanti harap kami hakim bisa memihak keadilan,”ungkapnya. Untuk persiapan ke tingkat PT, M Ridho selaku Direktur LBH berjanji akan terus mendampingi dan memantau kasus ini, “Kami sangat prihatin sekali dengan kasus ini, soalnya korbannya orang

berkoordinasi dengan Kejagung. Ini dilakukan karena ada perdebatan soal status penyelenggara negara. Penjemputan Kepala Bagian Keuangan Depnakertrans itu juga luput dari pengamatan wartawan. Sebab, iring-iringan mobil itu langsung meluncur dari sisi utara gedung KPK. Padahal, lazimnya tersangka korupsi yang ditangani KPK melintas di pintu lobi. KPK juga menyertakan 17 amplop yang disinyalir mengalir kepada Lusmarina tersebut. Nilai amplop itu sekitar Rp 100 juta. Untuk mengawal kasus itu, KPK juga menugaskan seorang penyidik untuk memantau penanganan kasus tersebut. “Kami tetap melakukan supervisi penanganannya seperti apa,” jelasnya. Secara terpisah, Jaksa Agung Muda Pidana Khusus (JAM Pidsus) Marwan Effendy menginstruksikan jajarannya untuk menindaklanjuti hasil tangkapan KPK itu. Dia membenarkan jika kasus tersebut ditangani oleh Kejari Jakbar. “Meski (nilainya) kecil, tapi ini strategis,” katanya usai menghadiri MoU antara Kejaksaan dan LBH APIK di Kejagung. Dia menegaskan, jaksa dari Kejagung akan

mendampingi tim pidsus Kejari Jakbar. Kajari Jakbar Sugiono membenarkan pelimpahan tersebut. Dia selanjutnya akan ditahan di Rutan Wanita Pondok Bambu. “Tersangka sementara waktu masih Lusmarina saja. Kami akan mengikuti perkembangan penyidikan,” jelasnya. Untuk memberkas kasus ini, Mantan Kajari Purworejo itu menugaskan enam orang jaksa. “Biar pemberkasannya cepat rampung,” jelasnya. Sugiono juga menjanjikan akan terus mengembangkan kasus tersebut. Kejari Jakarta Barat akan memanggil para utusan Disnaker yang telah sampai daerah. “Kami akan kirim surat panggilan. Mereka harus menjalani pemeriksaan di Jakarta,” jelasnya. Panggilan itu berdasarkan identitas yang tercantum di amplop yang diberikan kepada Lusmarina. “Banyak yang kami panggil, ada dari Jogja, Purworejo dan wilayah Jatim juga ada,” katanya. Apakah para pemberi akan menjadi tersangka suap ? Untuk soal ini, Sugiono akan melihat perkembangan penyidikan. “Ya kami lihat dulu. Sebab suap yang diberikan nilainya ada yang hanya Rp 2 juta,” ungkapnya. (git/fal)

dilakukan suaminya itu sudah sering terjadi. Ironisnya, selain suka mukul, Dahlia juga bilang kalau selama ini James tak pernah memberikan nafkah. Hingga kini, polisi masih melakukan pengejaran, karena James keburu melarikan diri saat akan diamankan dari rumahnya. Direktur Reskrim Poldasu melalui Kasat I Tipidum AKBP Yustan Alfiani Sik ketika dikonfirmasi POSMETRO MEDAN, mengaku belum mengetahui perihal laporan tersebut. “Nanti saya cek ya,” singkatnya. Terpisah, Kabid Humas Poldasu Kombes Pol Drs Baharudin Djafar Msi ketika ditanya perihal tersebut mengaku pihak Sat I Dit Reskrim telah menerima laporannya. “Sudah kita terima, kasusnya melanggar Undang-undang perlindungan anak dan kekerasan dalam rumah tangga (KDRT). Sejauh ini pelakunya masih dikejar,” tandasnya. Sementara itu, Direktur Pusat Kajian Perlindungan Anak

(PKPA), Ahmad Sofian saat dikontak POSMETRO MEDAN, berharap agar aparat penegak hukum dapat cepat bertindak dan memberikan hukuman kepada pelakunya. “Meskipun itu orang tuanya sendiri, aparat penegak hukum harus segera bertindak agar hak anak dapat terpenuhi,” katanya. Menurut catatan PKPA terhitang Januari- November 2008 tercatat 373 kasus kekerasan terhadap anak. Hal itu meningkat dari tahun sebelumnya berjumlah 308 kasus, terhitung Januari-November 2007. Selain itu, dirinya juga menyebutkan Sumut belum mempunya peraturan daerah yang melindungi anak-anak korban kekerasan. Akibatnya, tidak jarang korban eksploitasi memilih membalas dendam, sehingga menjadi pelaku kekerasan setelah ia dewasa. Makanya, agar ada penjeraan harus diberikan hukuman yang berat,” tegasnya. (Zulfadli)

Lusmarina terukur, dan berkelanjutan dari eksekutif dan legslatif Sumut untuk menyelesaikan dan mengentikan kasus yang berdimensi pelanggaran HAM di Sumut. Salah satunya adalah tindak lanjut Perda Kesehatan dan Perda Sistem Kesehatan Sumut. Minimnya fasilitas dan sulitnya akses kesehatan yang merata bagi masyarakat Sumut menunjukkan bahwa tidak ada tindak lanjut yang berarti dalam setiap kebijakan yang dibuat pemerintah. Pengamat politik Sumut dari Bakumsu, Benget Silitonga, yang hadir pada kesempatan itu juga mengatakan bahwa kondisi politik dan hukum Sumut 2008 yang jauh dari spirit penegakan HAM tentu tidak semata hanya mencerminkan lemahnya kapabilitas politik birokrat dan politisi lokal. Lebih dari itu, kondisi tersebut mencerminkan betapa pemerintah daerah di Sumut telah mengingkari konstitusi UUD 1945. Sebab dalam UUD 1945 jelas disebut bahwa negara harus melindungi dan menegakkan HAM. “Nyatanya, alih-alih menjadikan HAM sebagai basis politik untuk mensejahterakan rakyat, eksekutif dan legislatif di Sumut justru masih menajdikan SARA sebagai basis politik dalam mempertimbangkan dan mengambil keputusan,” pungkasnya. (dia/SMG)

Kajari no 08128094xxxx. Bahkan, Agus sempat bicara langsung dengan Gunawan yang mengaku Aspidsus Kejari Binjai itu. “Dalam pembicaraan itu saya diminta Kajari Binjai,” ujarnya. Setelah diberikan nomor baru dari Kajari Binjai, Agus langsung menghubunginya. “Saat saya hubungi nomor itu, saya sudah curiga, karena suara yang nyahut sangat beda dengan suara Kajari. Saya kenal baik dengan Kajari, karena kemai memang sering berkomunikasi,” terang Agus lagi. Begitulah, saat dihubungi Kajari yang diduga palsu itu mengarahkan Agus untul datang ke Kejari dengan membawa sejumlah uang. Merasa curiga Ketua KPU kembali menghubungi ketua Kejari dengan nomor lama, yang ada padanya. Hasilnya Ketua Kejari Binjai membantah jika telah menghubunginya. “Dari awal, saya memang sudah curiga kalau yang

Leni adalah darah daging A Kiet. Sementara hal yang meringankan lanjut hakim, A Kiet belum pernah dihukum dan bersikap sopan dalam persidangan. Atas pertimbangan kedua hal itu, akhirnya hakim memvonis A Kiet dengan pidana 6 tahun 8 bulan penjara. Vonis itu diketahui lebih ringan dari tuntutan Jaksa Penuntut Umum (JPU) Hepy Sibarani SH yang menuntut A Kiet dengan pidan 10 tahun penjara. Merasa hukuman itu terlalu berat, saat itu juga A Kiet yang didampingi kuasa hukumnya lantas mengajukan banding. Sementara jaksa, mengaku pikir-

menelpon itu bukan Kejari. soalnya nomornya berbeda, dan saya tahu Kajari tak mungkin mengganti nomor handphonenya. Kalaupun diganti, sudah pasti saya diberi tahu, karena saya kenal dekat dengan beliau (Kejari-red). Dan saat saya bicara dengannya, suaranya tidak saya kenal. Sangat berbeda dengan Kajari yang asli. Lagian koq Kajari meminta saya datang ke kantornya dan bawa uang segala. Ini pasti penipuan,” ujar agus. Atas kejadian itu, Agus berharap agar masyarakat lainnya lebih hati-hati dengan modus penipuan dengan telepon yang mengaku pejabat penting dan meminta untuk mentransferkan sejumlah uang melalui nomor rekening. “Kalau ada ditelpon seperti itu, jangan lansung percaya. Selidiki dahulu kebenarannya, jangan cepat mengambil keputusan yang bakal merugikan diri sendiri,” pasan Agus. (Aswin)

sekali tak dirumuskan dalam pasal 2 undang-undang tersebut. Yang dimaksud penyelenggara negara adalah Pejabat Negara pada lembaga tertinggi negara; pejabat negara pada lembaga tinggi negara; menteri; gubernur; hakim; pejabat negara yang lain sesuai dengan ketentuan peraturan perundangundangan yang berlaku; dan pejabat lain yang memiliki fungsi strategis dalam kaitannya dengan penyelenggaraan negara sesuai dengan ketentuan peraturan perundangundangan yang berlaku. “Kami telah melimpahkannya ke Kejari Jakarta Barat sesuai dengan tempat kejadian,” ucap Juru Bicara KPK Johan Budi SP, kemarin. Dalam pelimpahan itu, kata Johan, jaksa langsung menjemput Lusmarina di gedung KPK. Iringiringan mobil yang membawa tersangka suap itu meluncur dari gedung komisi sekitar pukul 15.00. Bersama mereka termasuk dua orang saksi, yakni YW, salah seorang Kabid di Disnaker Kuala Kapuas, Kalimantan Tengah dan seorang lagi adalah utusan Dinas Tenaga Kerja Nagroe Aceh Darusalam. “Mereka sementara waktu menjadi saksi kunci,” ungkapnya. Soal ini, sebelumnya KPK memang telah

Untuk itulah Roslaila terpaksa bekerja sambil sekolah sampai kelas III SMP. Di situlah, pada hari, tanggal dan bulan yang sudah tak diingatnya, tapi masih di tahun 1995, ia diperkosa. Setelah kegadisannya dirampas, Roslaila diancam akan dibunuh kalau membeberkannya pada orang lain. Karena ketakutannya, ia memilih bungkam. Sialnya, hal itu justru dimanfaatkan Akiet melakukan perbuatan bejat itu untuk kedua, ketiga dan selanjutnya sampai tak terhitung lagi sampai 2006, hingga akhirnya Roslaila melahirkan Leni , benih Akiet. (Syahrul)


Kalau Tak terima, putranya dianiaya seperti binatang, kemarin (30/1) sore, Riz dan ibunya akhirnya melaporkan James ke Unit Perlindungan Perempauan dan Anak (UPPA) Satuan I Tindak Pidana Umum (Tipidum) Direktorat Reskrim Polda Sumut. Menurut informasi menyebutkan, kekerasan yang dialami siswa kelas IV Sekolah Dasar (SD) Sambu Baru Medan ini berawal ketika James melihat Riz berkunjung ke rumah neneknya sepulang sekolah. Singkat cerita, melihat Riz sepulang dari rumah neneknya, James langsung emosi dan membabibuta memukuli Riz dengan gantungan baju hingga babak belur. “Ayah sering memukuliku kalau dia marah, itu dilakukannya padaku maupun pada ibu,” polos Riz pada polisi. Akibat penganiayaan itu, sekujur punggung Riz membiru dan penuh luka-luka pukulan. Menurut Dahlia, ibu korban saat mebuat laporan, sikap kasar dan aksi main pukul yang

miskin yang dizolimi hingga 12 tahun. Untuk itu, dengan ke ikhlasan kami akan terus mendampingi korban sampai kasus ini berkekuatan hukum tetap,”ujar Ridho. Sekadar mengingatkan, Roslaila yang sejak kecilnya hidup dalam kepahitan kepahitan selalu hidup dalam pas-pasan. Di usia dini, dirinya sudah kehilangan ayah yang menjadi tulang punggung bagi keluarganya. Di masa seharusnya ia masih menikmati bermain dengan sesama teman kanakkanaknya, wanita berparas manis ini, harus merasakan sakitnya menjadi babu di rumah tetangga.

hingga kini orang nomor satu di Dinas P dan P itu tidak pernah hadir memenuhi panggilan. “Sampai saat ini kita sudah memanggil AZ sebanyak tiga kali, jika pada panggilan lanjutan nanti dia (AZ-red) tak hadir juga, maka kita akan jemput paksa,” tegas Sinuhaji. Ditanya soal kritikan beberapa LSM yang mengatakan kalau Kejari Langkat hanya mencari kambing hitam untuk dijadikan tumbal untuk melindungi Kadis P Dan P Langkat. Sinuhaji mengatakan penyidikan ada pada pihak Kejaksaan, sehingga masyarakat ataupun LSM harus bersabar. “Yang lebih tahu itu kami, selaku penyidik, jika memang nantinya terdapat indikasi ke sana, bukan

hanya Kadisnya yang kita tahan, yang lebih tinggi dari Kadis juga akan ditahan,” tandasnya. Terpisah Sekretaris Dinas P dan P Langkat, Saiful SH saat dikonfirmasi POSMETRO MEDAN justru mengatakan, kalau Kejari Langkat serius dan profesional menangani dugaan korupsi itu. Seharusnya, penyidik juga diwajibkan untuk memanggil dan memeriksa sejumlah Kepala Sekolah (Kasek) yang diduga ikut kerjasama dalam penyimpangan uang milik negara itu. “Kita menduga Kepsek juga ikut melakukan tindakan korupsi. Karena itu seluruh Kepala Sekolah di Langkat juga harus diperiksa, dong,” ceplos Saiful sedikit mengkritisi. (darwis)

Walhi menyusul sikap ‘bengal’ pihak manajemen hotel menanggapi keluhan petani dan pengurus Vihara yang menjadi korban terjangan limbah. Langkah langkah boikot ini sangat urgent dilakukan dalam upaya menunjukkan watak masyarakat Indonesia yang cinta akan lingkungan hidup. Sebab jika tidak dimulai, kerusakan lingkungan akibat industri, termasuk hotel akan semakin besar terjadi di Berastagi. Apalagi hak untuk mendapatkan lingkungan yang sehat dan lestari sesuai undang undang No 23 Tahun 1997 tentang lingkungan hidup dijamin. “ Kalau kita peduli akan lingkungan yang lestari, tidak ada salahnya kita boikot kunjungan ke Mikie Holiday hingga pihak hotel memperbaiki kesalahannya dalam proses pembuangan limbah,” tegas Jop. Keseriusan Walhi lanjut Jop sangat berdasar setelah meninjau langsung lokasi jalan Vihara dan perladangan milik petani, dua hari lalu (29/1). Dimana saat itu, Jop mendapati pihak Mikie tidak membangun bak penampungan air secara permanen dengan sistem filterisasi. Seharusnya menurut Jop, ada empat atau lima kolam penampungan yang dibangun secara anak tangga sehingga air limbah dapat tersaring. Di samping itu, pengelola hotel juga mengabaikan pembuatan paret permanen di sisi jalan menuju Vihara, sehingga air tidak tumpah ruah ke badan jalan. Ini

yang menandakan kalau Mikie Holiday Hotel tidak memikirkan dampak dari pembuangan air limbahnya itu. “Sekali lagi saya tekankan kalau Mikie Holiday Hotel Berastagi sama sekali tidak memiliki IPAL (Instalasi Pembuangan Air Limbah). Pihak Hotel hanya membuat satu buah kolam atau waduk penampungan saja, di mana air yang terkumpul dari Hotel tidak terfilter, bak hanya berfungsi sebagai sentral saja, selanjutnya air dibuang langsung ke paret tanah yang tidak permanen,” tegas Jop. Selain itu, Jop juga mendesak Pemkab Karo pro aktif dalam menanggapi masalah ini. Karena, lanjut Jop, kesalahan yang dilakukan Mikie Holiday Hotel tak terlepas dari buruknya sistem dan pola pembangunan yang dilakukan pemerintah daerah ini. Karena dalam amatannya Pemkab Karo juga tidak memiliki sebuah sistem pembangunan yang dapat menjamin terciptanya lingkungan yang sehat dan lestari. Hal inilah yang kemudian dimanfaatkan oleh para pengusaha untuk bertindak semauanya dalam membangun tanpa memperdulikan masyarakat di sekitarnya. “Pemkab Karo harus pro-aktif menyelesaikan masalah ini, karena kecendrungannya, masalah ini sangat erat kaitannya dengan lemahnya pengawasan pada setiap proyek pembangunan,” tandas Jop. (Nanang/ Amry)







bisnis hari ini



 Penyerahan Hadiah Pemenang Vitasus

Pasaran Emas

Dorong Anak-anak Berprestasi Nokia 9500 Baru Second

::Rp. 1.900.000,-

Nokia Communicator 9500 adalah seri Communicator yang paling tinggi saat ini, Nokia Communicator 9500 adalah salah satu selular yang kemunculannya sangat ditunggu tunggu oleh pembeli, Nokia mengeluarkan model Communicator 9500 ini untuk pertama kalinya di Indonesia lalu baru di negara negara lainnya. Nokia Communicator 9500 merupakan sebuah upgrade dari Communicator 9210i, semua kekurangan 9210i telah dipenuhi 9500, penambahan yang paling dirasakan dibanding 9210i adalah masalah konektivitas-nya yang sangat komplit, 9500 memiliki Infrared, Bluetooth, GPRS, EDGE dan bahkan mendukung WiFi 802.11b. Penambahan lainnya adalah VGA kamera, memory internal yang besar yaitu 80 MB (dalam paket pembelian juga disertakan kartu memory MMC 128MB), dan layar TFT berwarna 65 ribu untuk bagian dalam dan luar.

Samsung i780 Baru Second

: Rp. 3.750.000,: Rp. 3.350.000,-

Anda tahu bagaimana cara bergaya di dunia bisnis. Beri kesan terkini dengan The Ultra Messaging i780. Melengkapi semua keinginan dengan perlengkapan yang dibuat untuk anda. Berbasis Windows MobileŽ 6 Professional. Kecepatan koneksi data yang tinggi. Navigasi GPS yang sangat membantu. Semuanya dengan mudah dapat di kendalikan dengan layar sentuh dan 360° optical joystick. Fitur utama : * Sentuhan lebih handal * Menjelajah rimba raya * Download lebih cepat dengan koneksi wi-fi * Charge ahead

Sony Ericsson W980i Baru Second

: Rp. 4.150.000,: Rp. 3.700.000,-

Tak banyak produk ponsel Sony Ericsson yang mengaplikasikan clamshell form factor, salah satunya adalah W980i ini. Produk yang mencoba menggabungkan ponsel dan piranti pemutar musik digital ini mengusung media simpan dengan kapasitas 8GB. Dalam keadaan tertutup, W980i ini terlihat 'baik-baik saja' meskipun mungkin agak sedikit tebal. Namun dengan ukuran 92 x 46 x 16.9 mm, ponsel ini terasa nyaman saat digenggam.

HP apa yang kita ulas besok? sms ke : 081260972131

Manfaatkan HP Anda Untuk Menghasilkan Uang......! Dicari 100.000 DIstributor untuk Sumut

V -net



SIUPL No. 79/PDN-2/SIUPUPP/1 2/2006

Peluang Bisnis

DAFTA R K A N Nomor HP anda dengan “ Tehnologi V-NET“ Untuk mendapatkan Penghasilan tambahan ( Passive Income ) Puluhan Juta/ Bulan Keuntungan Menjadi Member V-Net : 1 . Kemudahan isi pulsa utk sendiri keluarga dan orang lain. 2. Lintas Operator tanpa harus ganti kartu 3. Online 24 jam 4. Bonus sponsor Rp. 33 rb/orang 5. Bonus target mencapai Rp 31 jt setiap penambahan member 6. Bonus extra sponsor mencapai Rp. 57 jt/ orang yang di sponsori 7. Bonus bulanan mencapai Rp. 97 jt/Bulan 8. Cash Reward 500-1000/transaksi Hubungi: Herman Purba (Tj. Morawa) 0812 6577 619 - 061-7768 2581 BENNY (Lubuk Pakam) Hp: 0812 655 85410878 6849 9381, Drh. Fahmi Hrp (Lubuk Pakam)0813 6212 1172, Sunar (Bengkel Tk. Dinamo-Beringin) 0812 6566 434, Agus Saragih (Medan) 0812 6353 0793


Dari Kiri : Febria Angelika Br. Pasaribu didampingi orang tuanya Efendi Pasaribu, Paskarani Br Marbun didampingi Rekson Marbun dan Silviana Dewi didampingi Adi Chandra.

PENYERAHAN hadiah pemenang vitasus tahap pertama dilangsungkan (30/01) di Graha Pena Medan. Program yang dibuat Vitasus bekerjasama dengan POSMETRO MEDAN ini dimaksudkan untuk menumbuhkan daya kreasi dan menghidupkan imajinasi anak agar lebih aktif dan kreatif.

Tiga pemenang yang telah diundi minggu lalu yaitu Silviana Dewi, Paskarani Br Marbun dan Febria Angelika Br Pasaribu ditemani orang tua mereka menerima hadiah. Silviana Dewi, siswi kelas 2 SD Negeri 20 Medan berada diurutan pertama penyerahan hadiah. Anak pasangan Adi Chandra dan Nur

Samsiah yang tinggal di Jalan Stadion Teladan No 22 Medan ini memang suka menggambar dan mewarnai di sekolahnya. Nilainya juga lumayan, sering dapat 7. Bercita-cita jadi guru Bahasa Inggris, Silvi mengaku rajin minum vitasus, minimal satu kali sehari, kata sang Ayah. Diurutan kedua ada Paskarani Br Marbun, warga Jalan Bahagia By Pass Medan. Bocah berambut keritinginibersekolahdiTKGrecia. Anak pertama dari dua bersaudara pasangan Rekson Marbun dan Anita Napitupulu ini suka mewarnai meski tidak terlalu bagus. Tapi anak yang hobi menyanyi ini rutin minum vitasus 2 kali sehari karena citacitanya pengen jadi dokter. Febria Angelika Br Pasaribu berada diurutan ketiga juga tampak malu-malu saat menerima hadiah. Siswi TK Sustain Grace yang tinggal di Jalan Turi Gang Bersama inirutinminumvitasus2kalisehari. Bercita-cita jadi Polwan, anak pasangan Effendi Pasaribu dan Basaria Siagian ini suka mewarnai di sekolah dan nilainya juga bagus. Febri juga sering mengikuti perlombaan mewarnai dari sekolah tingkat TK walaupun belum pernah juara. (Widya)

Gebyar Promosi Class Mild

LOWONGAN KERJA SEKTOR K O N S T R U KS I D I M A L AY S I A Peluang kerja Sektor Konstruksi (Pekerja Bangunan) di Kuantan, Pahang - Malaysia dengan gaji yang menarik untuk: • Mandor Besi Beton • Mandor Tukang Kayu • Tukang Plaster • Tukang Besi Beton • Tukang Kayu & Kusen • Tukang Pasang Batu Bata Dengan persyaratan sebagai berikut: • Laki-laki umur: 20 s/d 35 tahun (boleh telah menikah) • Berpengalaman di bidangnya masing-masing FASILITAS: • Gaji pokok= RM 35-RM 45/ hari • Perkiraan lembur= RM 6.56-RM 8.44/ jam • Potongan levy= (pajak, pekerja asing) RM 100/ bln • Tempat tinggal dan perlengkapannya • Transportasi, asuransi dan kesehatan • Jam kerja 8 Jam/hari, 6 hari/ minggu • Diberangkatkan dengan pesawat terbang - Testing dilaksanakan pada hari Minggu dan Senin tgl 22 dan 23 Februari 2009 dimulai jam 08.00 pagi. Pendaftaran dilakukan setiap hari dengan membawa: Copy KTP, passphoto 3 x 4 = 2 lembar, foto copy ijazah, copy KTP Orang tua / yang memberi izin, copy kartu rumah tangga . ( Tidak dipungut biaya pendaftaran ) Untuk pendaftaran datang langsung ke :

PT. AL WIHDAH JAYA SENTOSA Jl. Setia Budi No. 74-C ( Sebelah Showroom Yamaha, dekat simp.Jl. Sei Serayu ) Medan - 20122 Telp : 061 - 8215444 ( Hunting )

Tugu Class Mild sebelum layar dibuka.

pustakaan dan arsip (Propinsi Riau, Pekan Baru), Jembatan Balerang (Batam), Komplek Ocaina (Batam), Taman Baca dan Poly Amin. Batu, Pulau Penyu (Bali), Musium Kartun Indonesia (Bali), Jati Luwih (Bali), FX (Jakarta), Bandara Soekarno Hatta (Terminal IA), Kereta Wisata (Jakarta), SPBU Km 19 (Cikampek) dan Rasuna Epicentrum. Penghargaan akan dikemas dalam sebuah program acara yang berdurasi 1 jam dan disiarkan di salah satu tv nasional. Promo monumen clas music heroes dapat ditemui di berbagai sudut kota besar di Indonesia, antara lain Jakarta (FX Mall), Bandung, Semarang (Pandanaran), Jogja (Bunderan UGM), Surabaya, Malang, Ma-

kasar (Pantai Losari), Medan, Batam (Simpang jam), Jambi, Palembang, Pekanbaru, Padang, Lampung dan Denpasar. Monumen tersebut akan tetap tertutup logo clas musik heroes sampai 1 maret 2009 dan dibuka 2 Maret saat dimana para heroes yang masuk kategori talk less do more sebagai gaya hidup para heroes tersebut. “Dengan adanya acara yang dipersembahkan oleh class mild ini kami berharap blantika musik di tanah air akan semakin berkualitas dan berkembang. Juga akan tumbuh tempat-tempat sensasional berfilosofi talk less do more, yang sangat mempunyai makna dan dampak positif bagi kehidupan masyarakat seluruh tanah air Indonesia tercinta,� harapnya.(Hiras)

(99,99%) (96%) (90%) (75%) (70%) (50%)


(per gram) Rp.319,000,Rp.306,240,Rp.287,100,Rp.239,250,Rp.223,300,Rp.159,500,-

Sumber : Toko Mas & Berlian Hj Ismalina Siregar Jaya Jalan A R Hakim No 1 Sukaramai Medan.

SIMPANAN BAGI HASIL DI BANK (3) Kewajiban Mengelola Zakat Bank syariah diwajibkan menjadi pengelola zakat yaitu dalam arti wajib membayar zakat, menghimpun, mengadministrasikannya dan mendistribusikannya. Hal ini merupakan fungsi dan peran yang melekat pada bank syariah untuk memobilisasi dana-dana sosial (zakat. Infak, sedekah) Struktur Organisasi Di dalam struktur organisasi suatu bank syariah diharuskan adanya Dewan Pengawas Syariah (DPS). DPS bertugas mengawasi segala aktifitas bank agar selalu sesuai dengan prinsip-prinsip syariah. DPS ini dibawahi oleh Dewan Syariah Nasional (DSN). Berdasarkan laporan dari DPS pada masingmasing lembaga keuangan syariah, DSN dapat memberikan teguran jika

lembaga yang bersangkutan menyimpang. DSN juga dapat mengajukan rekomendasi kepada lembaga yang memiliki otoritas seperti Bank Indonesia dan Departemen Keuangan untuk memberikan sangsi. Bagaimana Kita Menyimpan Uang Di Bank Syariah Sebelumnya kita sudah sangat mengenal tabungan, giro dan deposito dari bank konvensional. Pada ke tiga produk bank ini maka setiap bulanya bank berjanji akan membayar sejumlah bunga. Di bank syariah juga mempunyai produk simpanan berupa tabungan, giro dan deposito hanya sebagai nasabah kita tidak menerima pembayaran bunga. Di bank syariah ada 2 cara yang bisa dipilih orang untuk menyimpan uangnya. (Int/ Bersambung)



DIASUH: KiAgeng TapaPutih, A m d (Konsultan Bisnis, Ahli Penglaris Usaha & Pengusaha) Ketik : POS(spasi)TGP(spasi)Pertanyaan. Kirim ke 7669

Hotline : 08126451785


Lewat Jalur Musik Akrabkan Produk MEDAN DALAM rangka memajukan belantika musik Indonesia, Clas Mild menggelar event dengan tema Clas Music Heroes. Selain mendukung perkembangan musik tanah air, melalui program ini Clas Mild akan memberikan penghargaan kepada 12 artis. Dan sebagai ungkapan terima kasih, Clas Mild mengajak seluruh masyarakat untuk mendukung sekaligus menetapkan siapa pemenang. Braja Pandawa, kepala cabang Clas Mild Medan mengatakan, pemilihan nominasi para artis berdasarkan Talk Less Do More (sedikit bicara banyak kerja). Tentunya prestasi dan gebrakan mereka selama karir merupakan kunci utama untuk layak dijadikan heroes. “Para artis yang terpilih (12 pemenang), nantinya akan dibuatkan patung dengan tinggi sekitar 3 meter. Ke-12 patung didirikan di 12 kota berbeda (berdasarkan banyaknya pendukung),� ujar pria bertubuh tinggi ini seraya mengungkapkan, untuk Medan, rencananya patung akan didirikan di kawasan Sudirman. Sebuah penghargaan yang diberikan kepada tempat-tempat yang ada di Indonesia yang memiliki prestasi dan contoh baik sehingga patut untuk dipublikasikan. Tidak hanya itu, penghargaan diharapkan menjadikan tempat tersebut semakin baik dan memberikan inspirasi untuk tempat lainnya. Ke -12 titik tersebut adalah Per-

LM London A Emas 24 Emas Putih Emas 22 Suasa



Tanya : Saya adalah pengguna jasa internet yang setia, hampir setiap hari saya pergi ke warnet untuk mencari berita lalu terbersit di pikiran saya untuk mendirikan warnet sendiri. Pertanyaan saya apakah untung ruginya jika saya mendirikan warnet dengan modal pinjaman dari bank dan bagaimana cara me-manage pendapatannya untuk angsuran bank ? Terima kasih. 08137630**** Jawaban : Mendirikan suatu usaha memerlukan proyeksi perhitungan income yang diteruskan ke rugi laba dan arus kas. Usaha warnet memang cukup menjanjikan saat 1997-1999. Namun saat ini persaingannya sangat ketat ditambah kebijakan Telkom yang saat ini sebagai provider access broadband untuk warnet yang men’charge’ biaya cukup mahal. Walhasil tidak sedikit warnet yang gulung tikar karena skala ekonomis yang harus dicapai lewat jumlah pengunjung dan access hour minimal harus naik - supaya usaha warnet bisa survive. Saran saya jika Bapak memang punya lokasi traffic pengguna warnet bagus seperti dekat lokasi koskosan pelajar/mahasiswa mungkin masih feasible. Cara lain juga dengan mendiferensiasikan layanan misalnya cafe internet. Hanya saja biaya awal untuk membuka cafe internet cukup mahal - modal kerjapun bisa puluhan sampai ratusan juta jika lokasi diambil di prime district/mall area. Untuk mengambil pinjaman modal kerja dari bank dengan rate pinjaman masih diatas 14% saya rasa Bapak bisa kesulitan untuk mengembalikannya. Ini bukan saya pesimis tetapi memang kenyataannya agar BEP dan Pay out time nya bisa terpenuhi, Bapak perlu bantuan pemodal yang bisa memberikan bunga di bawah bunga bank untuk usaha warnet. Saran saya pak Dedi perlu lebih jeli melihat peluang - coba cari tahu usaha yang pak Dedi justru belum tahu banyak selama ini. Masih banyak usaha lain yang memberikan keuntungan atraktif selain warnet. (*)


Dengan no. 882/3/APH/MTT/1985 An. M.MARZUKI S. KEMBAREN. Ukuran tanah 7x28 M, terletak di Gg. Pembangunan Kel. PB. Selayang II, Kec. Medan Selayang. Bagi yang ,menemukan Hub: 822 0428, dengan alamat yg diatas.



i k l a n Telp 0 6 1 7 8 8 1 6 6 1


31 JANUARI 2009


DIJUAL : Mobil Suzuki Estem Thn’93 TERIMA HP SUPER TINGGI : N 73=2jt. DIBUTUHKAN : Karyawati untuk kasir DIBELI DIATAS HARGA YG LAIN!! : W.Hijau Metalic, Kondisi mulus & terawat, siap pakai 76255463/081361322601

: Toyota Corolla ‘73. Ada TV,DVD DAIHATSU BARU 2009 : New Pick DIJUAL Velg Racing Harga 17 Juta/Nego Hubungi :

Up Dp. 10Jt angs 2,5Jt. New Mini Bus Dp. 13Jt angs 3,3 Jt. Xenia, Terios, Sirion Ok!!. Hub: Efrizal ST 77384534, 081370518388

DAIHATSU : Pick Up Gran Max baru Dp. Rp. 12Jt-an angs Rp. 2 Jtan. Langsung bawa pulang mobil. Proses cepat. Hub: Didi Mulyono Astra Daihatsu 08126512348

NEW XENIA : Dp. 17 Jt-an angs 3Jt-an. Pick Up Gran Max Dp. 8Jt-an ang 2Jt-an. Hubungi: 08126310900, 061-77049000 (Rozak Nst) Pasti Ok DAIHATSU LANGSUNG BAWA MOBIL!!

Pick Up Gran Max & Minibus Gran Max Xenia, Terios, Sirion....Call Dp. nego dan bunga murah. Hub: Reza Astra 061-77485588, 0815 3333 1982

087868455717/08196007271 Maaf TP

MITSUBISHI BARU : Mobil yg lama bs

jadi Dp. & dihargai tinggi. PU T120, FD, PU L300FD/PS110-125. Proses cepat, luar kota ok. Hub: Napi 061-77561760, 081370301000


DAIHATSU BARU : Paket termurah Minibus

Gran Max, mobil keluarga, untuk usaha Dp. mulai 13Jt-an. Bawa pulang. Sedia Pick Up Xenia, Terios, Sirion. Hub: 77060301, 0819 7308 0818

DAIHATSU BARU PALING MURAH Pick Up Gran Max. Hub: Telp. 061-77060301 Minibus Gran Max. Hub: HP. 08163124916 Bunga rndh, proses gmpng. HP. 081973080818

DAIHATSU HEBOH BUNGA MURAH Khusus bln ini Gran Max Pick Up Dp. 15% Minibus Dp. 15%, Xenia & Terios Dp. 15%. Proses cepat. Hub: 081376111867, 061-76647557

DAIHATSU BARU READY STOCK : Pick Up Dp. 7Jt-an angs 2Jt-an, Minibus Gran Max Dp. 12Jt-an angs 3,1Jt-an, Xenia, Terios Dp. 15% aja. Hub: Pengkus Purba Astra 061-77915246

New Shogun FL 125, dll. Hub: CV. Daboss Motor (0813 9722 2228, 061-76377367)

ran ringan. Proses 1 jam, Gratis adm, data dijemput, turun barang baru bayar. Hub: 061-76549887

Jl. AH. Nasution No. 6A sebelah Obor Sport Fit X Dp. 1.500.000 angs Rp. 450.000 Revo CW Dp. 1.700.000 angs Rp. 562.000 Beat Dp. 2.000.000 angs Rp. 522.000 Supra X125 Dp. 1.500.000 angs Rp. 622.000 CS-1 Dp. 2.500.000 angs Rp. 717.000 Tiger CW Dp. 6.000.000 angs Rp. 929.000

Mega Pro Dp. 5.000.000 angs Rp. 738.000 Vega RD Dp. 1.500.000 angs Rp. 512.000 Jupiter Z Dp. 1.500.000 angs Rp. 577.000 Jupiter MX CW Dp. 1.600.000 angs Rp. 628.000 Mio CW Dp. 2.200.000 angs Rp. 518.000 Mio Soul Dp. 2.200.000 angs Rp. 562.000 Vixion Dp. 5.700.000 angs Rp. 738.000 Scorpio Z CW Dp. 6.300.000 angs Rp. 678.000 Smash Dp. 1.500.000 angs Rp. 497.000 Shogun SD Dp. 1.600.000 angs Rp. 722.000 New Satria Dp. 4.600.000 angs Rp. 722.000 Spin SC Dp.1.500.000 angs Rp. 537.000 Sky Wave Dp. 2.000.000 angs Rp. 591.000 Thunder KS Dp. 2.100.000 angs Rp. 634.000 Hub: Dodi 0812 6521 5666, 77643666

PAKET AWAL TAHUN : Daihatsu, mini- New Smash DB 07 Dp. 1Jt angs 354.000

PAKET AWAL TAHUN: New PU Dp. 8Jt-an atau 12 jt-an, Angs. 1,8x60 bln. Bs tkr tmbh, dptkn full discon & hadiah. Hub: Syahrul Capella HP. 0816 307 084

PAKET AWAL TAHUN : Xenia 1.0 STD Dp. 20Jt Angs. 2 Jt-an x 60, Xenia DLX 1.3 Dp. 20 Jtan Angs. 3 Jt-an x 60, data dijemput bs tkr tmb. Hub: Syahrul Capella HP. 0816 307 084 DAIHATSU 100% BARU : Xenia 1.0 Dp.

15Jtan angs 2Jtan. Gran Max Minibus Dp.13Jtan angs 3Jtan. Pick Up Dp. 7Jtan angs 1,9Jt. Data dijemput Hub: Rudi Capella HP. 0815 3462 6624 (Ready stock)

DAIHATSU : Paket Akhir Tahun PU Gran Max Dp. 8 Jtan angs 2,7Jtan. MB Dp. 17Jtan angs 3Jtan. Xenia Dp. 20Jtan angs 3Jtan. Hub: Anto Sinaga 061-77038771/08126525230 PAKET MENARIK DAIHATSU : New Pick Up Dp. 10Jt angs 2,5Jt. New Mini Bus Dp. 13Jt angs 3,3 Jt. Xenia, Terios, Sirion Ok!!. Hub: Andy Capella 77409298, 08126318799

New Shogun SP ‘07 Dp. 1,3Jt angs 485.000 New Vega R DB ‘07 Dp. 1Jt angs 387.000 New Jupiter Z DB ‘07 Dp. 1,3Jt angs 457.000 Jupiter MX CW ‘06 Dp. 1,3Jt angs 515.000 New Supra Fit DB ‘07 Dp. 1Jt angs 398.000 Revo CW ‘07 Dp. 1,2Jt angs 457.000 Hub: Rezeki Motor Jl. Cemara No. 44E (Brayan Bengkel) Tel. 6627004, 7868073


Vega RD 2007 8.200.000 New Supra Fit 2006 8.500.000 Spin S 2008 8.400.000 Vega RD 2008 8.600.000 Shogun 125 SD 2008 9.400.000 Revo racing 2007 9.500.000 XL-Com Motor Jl. Tuasan 114A Telp. 77879273

Triton, Colt, Sparta. Cash/credit. Proses cepat harga nego. Hub: Awi 0856 5856 8888, 061-77679998

SUZUKI 100% BARU : PU Dp. 14Jt ang 2,4Jt. Ready stock APV, Vitara, SX4, Swift, bs tukar tambah. 0812 644 0720 (Ando)

TOYOTA BARU : Ready: Innova, Vios,

Yaris, Rush, Avanza. Dp. ringan, hadiah menarik. Hub: 0812 6010 066, 77728120


Kijang Kapsul Rp. 300.000 + Supir Hub: 061-91047122, 0813 7031 0249

RENTAL MOBIL : Xenia, APV, pakai supir/ lepas kunci. Hub: Griya Mora Indah Block C No. 105. 061-77955403, 081533322446


Kapsul LGX Efi 2.0, double ac. Hub: 0812 6554 4664 (Medan) 0812 633 5913 (Binjai)

bergaransi. Kilat Comsel Jl. Jamin Ginting No. 30. 77812360, 08126463418 (Rusak juga terima) cepat seperti M-Kios, harga bersaing. Dicari agen dalam & luar kota, dengan keuntungan menjanjikan. Buktikan sendiri. Hub: Mitha Phonsel. Jl. AR. Hakim/Bakti No. 122 (disamping galon SPBU) 061-77148148, 76660688

DIBUTUHKAN : 1 org tk. pangkas yg berpengalaman, sopan dan rapi, jaminan Rp. 40.000 + silet. Hub: 0812 6553 8538

DIJUAL : Mio Soul thn 2007, warna merah,

DIJUAL : Yamaha Jupiter Z tahun 2004, pajak mati 1 tahun, harga 6,5Jt. Hubungi: 061-76438616

Mocin, model Jupiter Z CW Rp. 4,7Jt. Yamaha Jupiter MX CW ‘06 Rp. 9,5Jt Hub: 0856 6291 967, 76942309

Ninja RR 2005, hitam 16,5Jt. Supra Fit ‘04 Rp. 5,8Jt. Shogun ‘03 Rp. 5,5Jt. Satria ‘01 Rp. 4,5Jt. Supra X 02 Rp. 6,5Jt/nego. 081376770051

Suzuki, Shogun 125R 2005, mulus Rp. 6,8Jt/ nego. Honda Supra X 125CW 2007 Rp. 10,5Jt/ nego. Acong Jl. HM. Said 21. 0811634120

SUZUKI ANGPAO GONG XI FAT CAI Smash Dp. 1,3Jt ang 466rb. Spin Dp. 1,7Jt ang 497rb. Thunder Dp. 1,4Jt ang 657rb. Shogun Dp. 1,4Jt ang 575rb. Skywave Dp. 1,3Jt ang 603rb. Hadiah HP+voucher 120rb utk semua tipe. Hub: 76281045, 0813 7690 5487, 0812 6566 176. Data dijemput

jd jaga anak, gaji Rp. 550rb s/d 1Jt/bln (bersih) + Rp. 60 ribu bonus/bln. Hub: Cahaya Telp. 061-76700079 HP. 081265143676

reperasi AC, bongkar pasang AC central, dispenser,psng baru. Terima servis luar kota. Bergaransi. Hub. 4537693/HP. 08126012868

anak, gaji Rp. 550rb/bln bersih. Hub: Mama Mia HP. 0812 6387 4949

kulkas, m. cuci, dispenser, TV, dll. Hub. 061-77856677, 081376186677. Jl. Mesjid Gg. Damar No. 31 G Helvetia



rental & sewa mobil, lepas kunci dan pakai supir. Tujuan Medan, Siantar, Parapat, Tarutung, Sibolga, P. Sidempuan, dsb. Office: Jl. Letda Sujono Bandar Selamat Telp. 77955403 HP. 081533322446, 085296313114 (antar jemput dalam kota)


GPL SERVER : 1 Chip u/ semua opera-

tor trx cepat & stock lengkap. Harga bersaing/ lbh murah. Dicari dealer/reseller dlm/luar kota. Hub: 061-76687130 Dijemput gratis

BK Medan, ac bagus, siap pakai. Hrg 15Jt/damai. Hub: Jl. Tgk. Bongkar 3 No. 68 Mandala (Medan) HP. 081263581253, 081361990832

bulan, kelebihan pemakaian Rp. 0,275/Kb. Hub:

DIJUAL (OVER KREDIT): Suzuki APV Arena ‘07, hitam metalic, type X, paling lengkap, rawat, mulus, BK pjg 18 bln x 4.970.000 (sisa). Hub: 081260337272, 081264099700 Dp. 43Jt nego

isi freon, bongkar pasang & bergaransi. Hub: 061-77948428, 08153045029 (Kisno)

TERCECER : speksi BK 1196. BK an. persatuan Abang Becak Sumatera UANG TAMBAHAN 50-300RB/HARI: PAKAR TV (RIDWAN): Ahli TV semua merk Yayasan Utara Jl. G krakatau No. 109A Medan BUTUH UANG TUNAI: 1 Jam pasti cair. Sukses di Jakarta, kini (2009) “Program Bos” 14" s/d 63". Hub: Telp. 7862634, 77621674, Jaminan:BPKB mobil/kereta kredit/leasing, SHM/ PT. KDI hadir di Medan. “Produk anti maling” 0812 6303 4400. Siap ditempat & bergaransi HILANG : Laptop merek X-ware model Sk Camat Hub:QL Motor 77920424, 0882 1004 motor/mobil (sistem sentuh) Pemasaran secara member get member. Hub: Surya 061- AC KING SERVICE : Cuci AC Rp. 20.000, lite 1057 N-T23 cover ferary dan BPKB,STNK 0693, 0819 626 552 Jl.Ng Surbakti No. 72 BK 9613 Subi an to.Bagi yg 77590040, 0812 6565 7300

naikan bass, setting ulang p. window, alarm, central lock, tersedia paket audio murah dan paket big bass. Segera datang di Jl. Kpt. Jumhana No. 634/21C simp. Sabbarudin (Mdn)

24 jam, dicari dealer semua wilayah indonesia hari minggu & libur tetap buka. ayo segera bergabung dan dapatkan souvenir. Hub : EPTronik 061-7330261/0812 654 1105 Komp. Asia Mega Mas Blok CC No.27

NEW DAIHATSU : 76404021. 08126 SERVICE HANDPHONE : Segala 3000585. Proses cepat. Xenia li Dp 15% bawa pulang!! Terios TX,Sirion Dp15% bawa pulang!! pick up Dp 8 Jt. Minibus Dp15 JT

kerusakan semua type hardware & software. Menerima kursus teknisi HP belajar selama 1 bulan hub : Indocell Jl. Gedung arca No.72 Mdn

* Isi dari Materi Iklan diluar tanggung jawab Penerbit

MILLENIUM MASSAGE : Untuk pria/ wanita suami/istri, panggilan 24 jam ke hotel. Hub: Ivan 081396009405

DEWAAR : Sauna oukup, lulur, kusuk, mengobati kolesterol, asam urat, melangsingkan badan. Jl. Sunggal No. 57 Titi Bobrok. 77629492

DICARI : Beberapa orang siswa/i SMA, Mahasiswa/i, yg berjiwa dagang utk mewujudkan niat itu sampai kejenjang pengusaha. Hub: Bp. Agusman 061-7354533, 081375537742

DANA 500 JT : SHM, HGB, Sk. camat, DICARI : dana pribadi. Proses 2 jam, dana bank juga

Fiat-X 0813 6165 4445, antar

EMPEROR (ISI 10) + SPRAY 007 Spontan kuat, keras & tahan lama, dll. Tersedia kebutuhkan sex P/W dewasa Fiat-X 0813 6165 4445, antar

OPA MARTIN, 061-76619003 : Terapi khusus keluhan seksual bagi pria yg ada mslh dgn metode Tibet China, alami & aman

AHLI TUMOR GANAS : Dapat mengobati segala tumor ganas diseluruh otot & organ dalam. Hub: Tabib Sarizi, Jl. SM. Raja Gg. P. Harapan No. 36/ 43 dpn. Fak. Pertanian UISU Mdn. 081375363843

menemukan diberi hadiah 08126032690

REPARASI BATTERY : Garansi 3 bln. Terima tempahan/tukar tambah. Terima battery rusak/cass battery. Hub: Jl. Pasar 3 Barat No. 28 Marelan. Bpk. Yumirin HP. 081376711841


dll. Hub: 061-76301143, 7330990

Capek2, Pegal2, Kebas2, Rematik, Encok,

dispenser, cuci, isi freon, b. pasang, dll. Tlp. 06177323834, 76488779 Jl. Gaharu No. 62 Mdn

kaki berat, Pinggang, Terkilir, Asma, Turun perut, Ambeien, D. tinggi, Stroke, dll



KACA MATA MURAH : Periksa mata gratis, bersedia dipanggil, sedia banyak frame model baru. Hubungi: Abu Ali 08126401195,

AHLI PIJAT URAT TRADISIONAL 061-6643637, 0813 7682 4942 bisa, BPKB mobil/spd mtr th 2000 yg masih Tukang pangkas mahir, jujur, bersih, rapi, YONO SERVICE : AC, Kulkas, Mesin BU’ TIWI Melancarkan sirkulasi darah, ada jaminan. Hub: 08126369995 cuci, Dispenser, cuci, isi freon, B. Pasang, menyembuh kan: M. Angin, Angin duduk, TERAPI SEHAT : Pijat/urut & lulur. Jl. kredit juga bisa proses. Rudy 08126303887

SM. Raja Km. 8 Gg. Kamboja No. 3 (dpn. PT.

DIBUTUHKAN SEGERA : Teknisi berpe urat, Nyeri sendi, Ngilu lutut, Leher Asahan) Hub: 061-76747331 Mba’ Waty ANDA BUTUH DANA CEPAT : Jaminan BPKB ngalaman bidang ac, kulkas, m. cuci. Hub: Jl. SUQMA SERVICE : AC, kulkas, mesin cuci, Asam kaku, Gula, Tangan sulit diangkat, Tapak

spd motor/mobil, proses cepat dan mudah, bunga ringan. Hub: 061-4158061, 081263171017


Jminan BPKB spd mtr / Mbl, Prss cpt lngsng survei. Hub : 061-77864534, 081260778786. Daerah Kp. Baru, Pdg bulan, SM. Raja Mdn Sktrnya.

Pantai Timur Psr. II No. 2 Kp. Lalang. Hub: 77023231



rempah beramuan asli Karo. Menyembuhkan:

Saluran air, murah bergaransi.

No.390 Medan HP. 0815 3165003 (no SMS)

bergaransi. Hubungi : 061-7862713, 0812 6491 1858

DIJUAL : Minyak rempah beramuan asli karo menyembuhkan : Asam Urat,encok, Rematik, gula,kolestrol, dll. untuk luar dalam


Lemah syahwat (impoten) ED, Sulit ereksi, RUMAH DIJUAL : Jl. Sekata Gg. Alfalah Kurang bergairah, untuk kuat,keras, kokoh , Hub: 061-7878791, 0852 7084 9508 ANDA BUTUH UANG ? Cukup jaminan TV, DVD, Ampli, Spk, dll. Hubungi: Umar No. 7 Medan, SHM, pdam, pln, garasi, ada 2 unit. perkas abadi, berhasil ditempat, dijamin tidak 175 Jt/unit, pagar keliling. Hub: 081396200801 kecewa ditangani lngs ibu tiwi.Jl. Bayang kara WC TUMPAT : Sedot, saluran air, murah BPKB mbl, spd. motor, truk. Proses cepat 15 Telp. 77137799 HP. 0816 333 799


mnt cair, bunga ringan & lsg proses. Hub: Robby 061-77030 938, 0812 6303 1438

DIBELI HARGA TINGGI : TV, dvd, spk, DIJUAL CEPAT : Rumah uk. 11x35, SHM,

mobil, sp. motor. Proses cepat, mudah, bunga ringan, aman terpercaya (langsung proses 15 mnt JUAL BELI : Baru/second PS1, PS2, cair). Hub: Sopan.P. 081362310155 slim+tebal, TV, barang elektronik, sedia instal game hardis PS2, bergaransi Hub: Rias & Ivos Jl. ANDA BUTUH UANG KONTAN : Bromo No. 34. 061-7365282, 77629052 Jaminan hanya BPKB spd. motor/mobil. Proses cepat & mudah. Hub: 061-4562277, 06177393720 tanpa agen, Medan sekitarnya


BUTUH DANA : Jaminan BPKB spd. mo-

keramik, tlp, listrik. Almt Jl. Sering Gg. Sado No. 42 daerah Pancing. Hrg nego. 76750084, 7030118

Sal. Air. Murah, garansi 3 bulan.

DIJUAL/DIKONTRAK : 1 unit rumah cukup 1 paket sembuh selamanya Hub :Yudi Hubungi: 7869237, 0812 6578 734

di Comp. Griya Wisata Indah Johor. Telp. 061-76534652. Siapa cepat dia dapat

Anak buk Tiwi. HP. 0812 6351 5003

Jl. Beringin Psr. 7 Tembung Gg. Kuini No. 4 wrn. biru, hrg Rp. 70Jt. Hub: 085361003131

Yani HP. 0813 9731 9613. Jl. Prajurit No. 87 (bersedia dipanggil kerumah)

MOBIL SEDOT WC : 7773 7996 salPIJAT TRADISIONAL : Masuk angin, air, cucian piring, rehab garansi 0852 7093 DIJUAL RUMAH : Permanen murah, sakit pinggang, capek-capek, lulur. Hub: Mbak 3649 Maju Jaya Murah Gatot Subroto 159 ANDA INGIN : Memiliki rumah idaman atau PIJAT & LULUR MBAK RIZKY

WC TUMPAT SEDOT : Saluran air, kamar mandi, wastafel. Bergaransi. Hubungi: 061-76279447

tor/mobil, SHM. Proses cepat, langsung survey. TERIMA LAPTOP : Hub: Samuel 76486084, 085296156555 Segala kondisi, laptop anda. Dihargai tertinggi dari yang lain. 76222377, JAMINAN APA SAJA .....!!! 0813 6101 8577 (Dijemput) Proses cepat Hubungi Akien HP. 08196005252, TERIMA LAPTOP/KOMPUTER P4/ 061-77065252, 081263419291 LCD/PS2/PS3/PSP. Segala kondisi x-tra tinggi Hub: 77307799 (dijemput x-press) BUTUH DANA CEPAT : Jaminan BPKB spd motor, mobil pribadi, KPUM, betor. Hub: TERIMA KOMPUTER P4 & PLAYSTATION 2 KSU Yoga Solafide Jl. Pertempuran No. 41 Telp. “Segala kondisi” PS2, PS3, PSP, Laptop, CPU 061-6628116, 061-4557607 P. Brayan Telp. 76629966, 081361999986 (dijemput)

kavlingan. Bisa credit/KPR atau cash bertahap. Hub: 061-76366558, 081264485809

HP. 061-91076769, Jl. SM. Raja (300m dari pjk. Sp. Limun) NB: Bersedia dipanggil ketempat

DIKONTRAK/DIJUAL : Rumah di kompleks

KUSUK TRADISIONAL : Hub: Ibu Hubungi: 0812 6082 7816 (SM. Raja)

BUNGA RENDAH 1-2% : 1 jam cair, jaminan

DIJUAL : Rumah Permanen Luas tanah 30x20m,4kt,1km, Garasi,listrik,PAM,Harga Nego di Jl. Karya Gg. Amplas Sari No.30 kel.Karang Berombak Mdn HP.085760959002

K U S U K S E H AT M A S S A G E :

RAJANYA KREDIT PS2 : PS2 (slim) 300rbx6. Hub: Toko Bakti Elektronik Jl. AR. Hakim No. 130-B, Toko Sinar Maju Elektronik Jl. Pancing No. B-128 Telp. 6630080, 7356745, 7356756



slim+tebal, TV, barang elektronik, sedia instal games hardis PS2 bergaransi. Alamat Jl. Garuda Raya No. 002. 7344165, 77629052

sisa 65 kav di Jl. Gn. Kidul Binjai Selatan Berngam. Hrg 20Jt net, disc 2Jt/bln. Hub: 77060301

SHM, SK. camat, BPKB mobil truck, angkot, betor, kreta, juga terima yg masih kredit. Hub: HP. 081264244760, 061-76854885 (Family Finance)


Dibutuhkan P/W, usia 17-45thn, min. SMP, SMA sederajat. Dtg lgsg kerja, penghasilan diatas UMR. Hub: Aditia, SE. 081397269931, 06191104058. Jl. Jamin Ginting Komp. Citra Garden Blok B1 No. 17 P. Bulan Medan


taman citra blok Hi-3 marelan, listrik, Pam, 2 kt1 Km. Hub:Nico 08153001814 atau 76369807

Penghasilan 250-550/hari, bahkan lebih. Hub: Dharma 0819 890 956 (SMS nama & alamat)

DIJUAL : Rumah dan tanah. Rumah Jl. KUSUK/PIJAT CAPEK2 : Seksama Kel. Binjai Gg. Dame 07 Medan, 2kt, listrik, Lt. keramik, permanen, ada garasi, uk. tanah 11x18m, SHM. 170Jt/nego. Tanah uk. 8x13, 3 kavling, 400rb/m, SHM. Jl. Menteng VII Gg. Murni Ujung, Pasar Dua (II) Hub: 081396246802

KUSUK SEHAT : Dapat menyembuhkan capek-capek, masuk angin, pegal-pegal, lulur. Hub: Bu Ely 081533312169 Jl. Selam Gg. 1 Mandala

Bersedia dipanggil ke rumah/hotel H u b : H P. 0 8 1 5 3 3 4 4 6 4 4 7

Mengobati masuk angin, badan pegal-pegal,

DVD, CD Game. Hub: Jl. Veteran No. 6 (simp. Pertempuran) 061-76719787, 77629052

8465635, 0882 6152 3141 (sore)

HDD, TV. Sgla kondisi. Jual PS1, PS2, PS3, PS HDD,PSP, TV baru/bks, grnsi, service PS1, PS2, PS2 HDD, TV, install games. Hub: Jl. AR. Hakim No. 173A Telp. 77034082, 081370426731.

Tembung. Telp. 061-7381278, 081375508468

DIJUAL : Tanah & Rumah Ut. 29x24m, Ub. 15x10m, LALA GAMES : Terima PS1, PS2, PS3, PS permanen, lt. keramik, kt4, km2, lokasi B. Klippa

DIBUTUHKAN : Wanita untuk dipekerjakan jaga anak, gaji 500rb s/d 1Jt/bulan (bersih) dapat cuti 2 hari/bulan. Hub: Desi Telp. 06177975545 HP. 0812 652 2680


8x15 = 3 kvlng. 7x14=2 kvlng, bebas biaya surat, harga nego Lokasi Sei Mencirim Kp.

PALEM GAMES : Terima PS1, PS2, PS3, PS Lalang. Hub: 77072611, 77467719

HDD, TV, jual PS1, PS2, PS3, PS HDD, TV, service

PS2, PS HDD, install games. Hub: Psr. DIBUTUHKAN : Wanita utk dipekerjakan PS1, Merah/HM. Joni No. 345. Telp. 061-76245077

7059, 061-8471104. Pendaftaran tdk terbatas

Lemah syahwat/lulur Mbak Anna. Hubungi: 0852 9052 4344. Hotel Saiba (dibelakang cuci mobil otomatis dpn simp. HM. Joni

TANAH KAVLING MURAH SHM: keseleo, mandi rempah-rempah/air panas PROGAMES : Jual baru/second PS1, PS2, Buat rumah di Kota Binjai, Uk. 7x16, bersih 85 kav Alamat : Jl. Veteran Krakatau No.7 C dekat

BISNIS BARU : Blm kerja langsung untung, dicari stokis, leader & siap saja yg berani kaya. Opp gratis. Info Ibu Maya 77950035, 0819 870 806

menjaga anak, gaji 530 s/d 700rb. Hub: Melda (061) 77942694, 0811 602 145

Rela Jl. Letda Sujono masuk Jl. Padang 50 m No. 11B. HP. 081264620007

BERANI BELI EXTRA TINGGI : PS, TV, HDD segala kondisi, jual/beli PS, TV, HDD, bergaransi. Instal, servis PS, stik. Hub: Zein Elektronik HP. 0813 6199 3636, 76287522. NB: Berani beli PS slim (950 ribu)

ANEKA RAGAM Tempahan Murah : Hub. 6620695-6616802 Lemari pakaian 3 Pt sungkai asli Rp.1,4Jt. Kursi Sofa Kulit 3,2,1 Spring Rp. 1,3Jt. Spring Bed 6 kaki, 2 lapis Rp. 1,1Jt Grs per 10 th

DIBUTUHKAN : Supir yg bisa bawa TERIMA PS 1 JUTA S/D 3 JUTA : SPESIALIS SHOCK BREKER : mobil matic. Syarat: rajin, jujur, tdk merokok.

Maju Bersama HP: 061-76417925

MBAK INDAH : Ahli kusuk capek-capek, pegalpegal. Tersedia obat untuk pria. Bersedia dipanggil. Hub: HP. 061-91122329 (No SMS/Miscall) MBA’ TATA MASSAGE :

Ahli Pijet tradisionil khusus panggilan rumah/ hotel Hub: 0813 9612 2079 (24 jam)

HILDA MASSAGE : Pijat kebugaran, efleksi, ejakulasi dini, terkilir, ditangani ahli. Khusus hotel & rumah, P/W. Hub: 061-76569560

Dpt disembuhkan mata mius, plus, glaucoma, mata merah, berair, bengkak, katarak, khusus yg gagal msk angkatan jrk ± 7 mtr b/w (buta warna dpt disembuhkan) smpi tuntas. Hub: Ibu Farida Akhram Jl. Prof HM Yamin SH (Serdang) No. 251. Tlp. 061-4563067 Medan

SPECIALIST AMBEYENT (WASIR) : Tanpa oprasi, putus sampai ke akar2 ± 10 hari garansi. Dijamin Hub Mhd. Rawal Jl. Prof HM Yamin SH (Serdang) No. 251 Tlp. 061-45630367 Medan Cabang: Jl. Puyuh Mas No. 9 Pekanbaru Tangerang Tengah HP. 0812 6568 700, 0761-7674197

PIJAT T R A D I S I O N A L : DIJUAL : Kursi pangkas 120 unit, alamat: Khusus panggilan rumah/hotel DIBUTUHKAN : Satu orang laki - laki TERIMA : PSP, PS1, 2 & 3, HDD, handycam, 1. Depan Polsek Tanjung Morawa. 2. Depan H u b : M b a M a y a H P . 0 8 1 3 7 6 5 3 untuk mengelola kompresor tambal ban, mahir, roda dua dan empat Hub: 76547009

Games, 77418902, 081361922006. Jl. Sei Bt. Hari No. 2 dekat BRI/Jl. AR. Hakim No. 104. NB: Jual beli & service Playstation

No.37 B.Sukadomo Tj. Gusta Telp. 8477560

No.8 Telp. 061-4568385/081375667678

657 1055. Dicari agen seluruh Indonesia

PIJAT & LULUR TRADISIONAL JUAL : Kursi Pangkas dan Alat2 pangkas Sehat Lestari Jl. Sipiso-Piso No. I-6

ulang tipe A Komplit buatan Australia baru

DIBUTUHKAN : T K . P a n g k a s y g berpengalaman Muslim- Jaminan Rp.30.000 Hub : 0813 97041373

tempat). Isi permainan PS2 HDD Hub : Jl. SM Raja/Simp limun No.263 A Mdn, Jl. Sutomo Simp.Kantor Pos L. Pakam Telp. 061-77503276 081370502222


BODY STRONG : Massage Aroma Therapy. Hub: Fizal (081260833074)

SABAR MENANTI BILLYARD : Jual- Bersedia dipanggil ke rumah from Men

DIBELI HARGA TINGGI : PS1, 2, 3, beli/sewa meja (murah) Jl. Jahe Raya No. 1A TRAVEL - LIBURAN - HOTEL keyboard, handycam, camera, laptop, lcd, Simalingkar Tel: 061-77603450 HP. 0812 6020 KURUS/GEMUK : (Obesitas & Kolesterol Lowongan Kerja - Domain Gratis North Sumatera CN

projektor, tv, tape, kulkas, m. cuci, dll. Hub: Lily Elektronic Telp. 061-8456975. Gaperta 229-A

493 Kabanjahe Telp. (0628) 20002 (Pak Ginting) Jl. Binjai Km. 15,5 HP. 0812 6336 9306

WC TUMPAT SEDOT : Saluran air, kamar mandi, wastafel. Bergaransi.

WC TUMPAT : Sedot / Saluran Air K. Mandi Westafel Rehab S.Bor Garansi Hub : 77626388-081263922800

WC TUMPAT : Penuh, saluran air, rehab. Survey gratis/bergaransi dan murah. Hub: Pak Putra Telp. 061-8227240


Sedot, sal. air, k. mandi, rehab bangunan. Garansi. Hub: 77617826, 7866342

WC TUMPAT SEDOT MARTIN SERVICE Saluran air kamar mandi, wastafel, bergaransi. Hub: 061-7862679, 08126007919

WC TUMPAT/SALURAN AIR : Jl. Setia Budi No. 45 H u b : Te l p . 0 6 1 - 7 7 9 4 4 6 4 2

WC TUMPAT/SEDOT : Saluran air westafel/murah. Garansi. Hub: Abadi Jaya 061-76557566. Jl. Gatot Subroto No. 78

WC WIJAYA : 0813 9761 2319 Sedot sumbat, sal. air, ps piva sanyo, rehab. Gatot Subroto 90. Garansi WC TUMPAT ? :

Hubungi: 0813 6159 3462 Sal. Air, pipa, rehab2, sedot, dll. Bergaransi

WC TUMPAT : Penuh, saluran air, wastafel, SPECIALIST MATA TANPA OPRASI : rehab saluran/kamar mandi, pasang keramik.

TERAPI KHUSUS : Kesehatan REZEKI GAMES : Jual baru PS2 slim, dipakai 8 bulan harga 25 juta Hub : 8366895 tradisional menangani penyakit: Ginjal, ted * Satu chip untuk semua operator GSM & DIBUTUHKAN : Asisten salon yg Jual/beli PS1,PS2 HDD, segala kondisi, - 081375242558 berpengalaman dibid: Creambath,Facial,Belambung dan keluhan pria. Hub: Mbak BORNEO AUDIO : Dekorasi mobil anda, CDMA, modal 100rb langsung jualan Online bylist,blow Hub: Salon Shinta Jl. Perjuangan pusat service PS1,PS2 (Bisa siap di Yati 061-76702978 Bersedia dipanggil EP-TRONIK: Cepat terpercaya,stok unlimi


Valdo 0831 9805 0808

Bngkr/Psng AC,Kulkas, M Cuci, Dispenser,TV Libur Buka Hub: 77651615, 0815 3322 9839

DIBUTUHKAN : 1 Org cewek utk penjaga lengkap, laci, cermin, ketam, gunting, pisau Te l p . ( 0 6 1 ) 7 3 2 1 0 9 2 burger dgn syarat : Disiplin, jujur, brtnggung dan lain2 Jl. Perjuangan / pancing TRIMA HP XTRA TINGGI : Terima gadai jawab & Rajin Hub : Sandy 0852760751713 TERIMA HARGA EXTRA PALING TINGGI cukur “Playstation” 1, 2, 3, PSP, PS2 slim/tebal/HDD No.105 Pangkas Mantap Hub : 0815 MILLENIUM MASSAGE: Untuk pria/ HP, camera, laptop, dll. Barang terjamin/proses 3028742 wanita suami/istri. Panggilan 24 jam ke gampang & cepat. Jl. Sei Padang No. 116 depan DIBUTUHKAN : Ass salon pgks Creamb- Segala kondisi!! padam-rusak-standart ok! Hotel Rumah hub : IVAN 081396009405 ath, Facial Baby Liss, Dll. Hub : Salon Yuni Jl. Kemiri 77778469, 0813 6199 9986 (dijemput X-press) JUAL : Cepat 1 unit peralatan Air minum isi OVER KREDIT : 1 unit Kijang Kapsul Gereja 061-77125512, 77576467

LX 2003, warna hijau metalik, sisa angsuran 26 bln. Hub: 0813 6173 2411


VA C U M + T V O I L U S A Spesial bikin besar, panjang, kuat, keras dan TERCECER : 1bh speksi BK 1450 FT. tahan lama. 100% tanpa efek samping

KREDIT HAND PHONE : Spring Bed, dll lajang keristen, bersedia tinggal di tempat LCD, laptop, camera, keyboard, dll. Hub: Zidan Super Mall Binjai. Hub: Surya HP. 0812 0 1 8 9 Harian mingguan dan bulanan hub : 0614550017, HP. 0852 9689 8556, 0813 6159 5225. NB. Gampang dan kilat 2 jam

Juga melayani pijat kebugaran bagi pria & wanita yg tdk sempat pergi kesalon Hub: Mbak Lia/

Dalam 1 bulan turun berat badan 5-12 Kg pasti tanpa efek samping


AYO BELI : Hape modem Rp. 600rb. Gratis Hub: Toko Subur Baru Keramik Jl. SM. Raja Bagus/rusak, slim/tebal ext. tertinggi, Ahli service, ganti seal, oli, as, psg baru, dll. Jl. Pancing No. 271. Hub: 081263692212 dijemput. Hub: 77707678 12 Gb akses internet selama 6 bln, 2 Gbx6 simpang Marendal Medan

DIJUAL : Sedan Mazda thn 90 MB, wrn putih, Edy 061-77613388, 0819 3322 3939


TERCECER : 1bh Dompet berisi SIM an Fiat-X 0813 6165 4445, antar

Motor Jl. Bahagia By Pass No. 35 Mdn HP. 08126326121, 08126326120, 061-7863647 (Jaminan BPKB sp. motor/mobil 15 menit cair)

DIBUTUHKAN : Wanita tamatan SD, SMP, PUSAT PENJUALAN HP SECOND SMU/sederajat, utk menjaga anak, perawat jompo, & GROSIR PULSA TERMURAH : Hub: gaji 500rb s/d 800rb/bulan. Hub: Nilda 061-7737

ac, tape, cd, central lock, tubles, ok harga Rp. 38Jt. Serius hub: 0813 6126 0492 TP

BL.MDN:55111-A an. Peng. Karya Restu. Jl. Bulan No.96 Medan

TERCECER : 1bh speksi BK 7538 LC. BKS:2136. an. CV. Medan Bus Jl. Bahagia ANDA BUTUH UANG KONTAN : Raja LOWONGAN : Dibutuhkan Pembantu YUAN SERVICE : AC, kulkas, m. cuci, By Pas No. 45 B Rumah tangga yang bersedia nginap Hub :

DIJUAL : Suzuki Carry Pick Up thn 2000, w. hitam, BK Medan (panjang) cat body, mesin seksi terawat, mobil siap pakai. Hrg Rp. 41Jt/ nego. Hub: 77978370, 77819614 (Rasit) DIJUAL : Kijang Super ‘87, biru metalic,

berisi KTP, SIM, ATM an. Darmin & Johan pd tgl23/ 1/09di sktrJl.Cirebon.Bagiyg menemukan btlngdikembalikanke 08126048303/77866869

MDN:40492-A. an. PT. RMC Jl. L. Jamin Ginting No. 215

PRIMA PULSA : Server pulsa all operator

Satelit Profesional. Jl. Cik Ditiro No. 17 C. Lubuk Pakam HP. 081370717170, 061-77772221.


DICARI : Tk. pangkas berpengalaman, jaminan 40 rb, ditambah uang makan. Hub: MAJU TEHNIK : Service AC, kulkas, dispenser, mesin cuci. 0813 6140 5337 Telp. (061) 7030118, 76750084 Bergaransi

Melayani antar jemput/pengiriman barang2 khusus dalam kota Medan & sekitarnya (Dengan mobil Pick Up 1,5 ton & 2,5 ton) Hub: 061-77623899, 081370618077

cepat terpercaya, murah friendly. Daftar gratis modal 100rb, online 24jam. Dicari dealer dlm & luar kota. Hub: Jl. Prof. HM. Yamin No. 512 Medan. 061-4148020, 061-76338826

hitam BK 6562 UZ, pemilik Bawadi S. Bagi yg menemukan harap hub: 0813 7068 7734

hari cair. Dana pribadi 1 hari cair. Jaminan SHM/Sk. Camat. 061-8216657, 0852 7097 5809, 0813 9689 5466, 0882 1004 0693 Jl. Ng. Surbakti 72

BUTUH DANA : Jaminan BPKB mobil, sepeda motor anda!!! Proses cepat langsung survey. Hub: Ardy (061-77655880) Budi (061-77935967) Ricardo (081264275190)

dari Malaysia, ahli urat & segala penyakit pria/ wanita. Hubungi : 0812 6040 5462, 76356142. Jl. Ksatria Timur simpang Jl. Negara depan Sekolah Teladan Sanawiyah No. 22

TELAH TERCECER : Satu buah buku panggil ketempat HP. 085262466025

Jhon Ferry Saragih, KTP & Uang Tunai Rp.250 Rb. bg yg menemukan hub : 081362239086

MODAL UNTUK USAHA : Proses bank 2

MEISSY MASSAGE : Berpengalaman

TERCECER : 1bh speksi BK 9652 BN. DICARI : Wanita untuk dipekerjakan jaga JAMAL SERVICE & REPERASI : AC, JKT:544578. an. Lie Jie Sung. Jl. Metal III PELANGSING FATLOSS LOGO No.16 Medan

DIJUAL TANAH KAPLING : Uk. 10x15m, 2 kapling harga 37Jt/kapling nego, SHM, Kapsul ‘02, 2 Xenia ‘08, 1 Renzer ‘96, 1 Carry ‘99, Mocin ‘03 2,8 Jt, Smash’07 6,8 Jt, Shogun 125 ‘05 BISNIS BARU “M2” : Hadir di Medan. FOUR GAMES : Menjual, service, rental, PS1, lokasi Jl. Kongsi Gg. I Marendal. Hub: PS2, PS3, HDD, baru second. Bergaransi. Accesories, 6,8 Jt, Shogun 125 Sp’06 6,8 jt Hub : 77045013


DICARI : Wanita (gadis/janda) dipekerjakan AC TRISAT : Service cuci AC Rp. 20.000,- TERCECER : 1bh speksi BK 8316

JUAL/RENTAL MOBIL : 2 unit Inova ‘06, 2 DIJUAL : Supra X’03 6,2 Jt, Jupiter Z’03 6,2 Jt 1 PT. Nasional ‘95. Hub: CV. Bintang Terang (BT) Telp. 061-77860954 HP. 0812 604 0889

BARUS BILYARD CENTER : Melayani jual-beli meja baru/bekas, menyewakan meja (bola 15 & bola 9) Hrg nego. Hub: Jl. Berlian Sari Gg. Baru (Katamso Km. 7) 7883910-0811645471

DICARI : 2 orang tukang bungkus nasi M E D A N T E K N I K AC : Service kulkas, mesin cuci. dirumah makan, umur ± 28 tahun, diutamakan Bergaransi berpengalaman. Hub: 0813 9687 0471 Hub: 061-7872032, 77059881


Supra V,

kopling, tromol 2003, 4,3Jt. Khusus pemakai. Hub: 0812 6545 330

TV, PS1, PS2, PS3, DVD, tape, ampli, speaker, kulkas, ac, m. cuci,dll. Hub: Trisna Elektronik Jl. Sunggal No. 361 Medan Telp. 8468930, 77596876

GAME PRO : Jual beli PS1,PS2,PS3. Slim + Tbl Br/second. Service. Sedia Instal Games Hardis PS2. Bergaransi Hub: Jl. Murai No. 10C. DIBUTUHKAN : Supir yg bisa bawa Komp. Griya Kencana: 8464189-081397570222 Colt Diesel. Syarat: jujur, rajin, tdk merokok, bisa keluar kota. Hub: Toko Subur Baru Kramik JUAL-BELI-SERVICE (PS1, PS2 HD,TV) Jl. SM. Raja simpang Marendal Medan Segala kondisi, Xtra tinggi, langsung dijemput Dewa Games 061-77005470, 08126005470 DIBUTUHKAN SEGERA !!: Beberapa orang anggota doorsmeer mobil. Fasilitas gaji dan ada penginapan. Hubungi langsung Patas SERVICE Doorsmeer Jl. Menteng VII No. 21 Medan Amplas

amp, ps:1,2,3, dll. Hub: Acem 76377367, 0813

Vega RD ‘08 950.000/Dp 410.000/bln Supra Fit ‘06 1.500.000/Dp 371.000/bln Spin S ‘08 1.350.000/Dp 410.000/bln Jupiter Z CW ‘07 1.000.000/Dp 480.000/bln Supra X 125 ‘07 1.300.000/Dp 490.000/bln Revo racing ‘08 1.000.000/Dp 480.000/bln XL-Com Motor Jl. Tuasan 114A Telp. 77879273

kondisi bagus, 1 tangan dari baru, harga


ond! henk, no signal, mati/padam, dll. Hub: 061-91060339, 081260408798

di Hotel Deli Indah Lubuk Pakam, Jl. Besar Lubuk Pakam No. 100 L. Pakam

KREDIT MOTOR BEKAS MURAH BUTUH DANA : Jaminan BPKB kendaraan 9722 2228 Jalan Sikambing No. 15 (Sekip)

ANDA BUTUH MITSUBISHI : Colt 10,5Jt nego. Hub: 0812 6003 5119 Diesel L300, T120SS, Sparta. Cash & kredit, proses cepat (1 hari) data dijemput. Hubungi: Sebayang HP. 0813 7084 7480

TERIMA/BELI HP: Rusak dan sec-

YAMAHA 100% BARU : Dp. termurah angsu T. COMSELL : Server pulsa all operator


bus gran max Dp. 15Jtan angs 2,6x5 thn, full discount NB: bisa tukar tambah. Hub: Syahrul Capela HP. 0816 307 084 data bisa dijemput

3230=850rb, 5310=1,5jt, 3110=900rb 6070=600 rb 2600c=650rb 2310=375rb 5070=550rb 3120 new=1,1Jt 6120=1,5Jt. 2630=650rb 2626=400 rb 3500=1Jt. NB:kondisi HP mulus,grs±10 bln Hub:Gelora Ponsel Plz Millenium Lt.Dsr No.24/ Lt.I No. 61 Tlp. 061-77341757

DP MURAH : Cicilan syariah. Suzuki Spin, TERIMA HP X-TRA TINGGI : Service

DAIHATSU BARU : Termurah bunganya. DODI JAYA MOTOR : 100% baru proses cepat Pick Up Gran Max Dp. 8Jt-an, Minibus Gran Max Dp. 13Jt-an, Xenia, Terios, Sirion. Buruan. Hub: 061-77060301 HP. 0816 312 4916

5300=1,05jt. K530=1,1Jt. N70=1,5jt. 5200=900 rb K770i=1,4jt.7610=900rb.6030=350rb.5000=850rb. 6600=700rb. 6300=1,4jt. EK3201i =550rb

ingin naik/turun brt bdn 5-100 kg(dijamin) psn prdk.061-77882428-081263610666 (diantar)

76371176, 76684498, 7868618 Garansi

WC TUMPAT : Penuh, saluran air, wastafel,

rehab saluran/kamar mandi, pasang keramik. 061-77834141, SMS 081375361983 Garansi

DIHIMBAU Kepada Klien Iklan POSMETRO MEDAN K h u s u s n y a Pemasangan “Iklan Kehilangan/ Tercecer ercecer”” Apabila ada pihak lain yang mengaku telah menemu kannya dan me minta sejumlah uang untuk biaya Pulsa & Transport “Supaya Berhati-Hati”

Himbauaninidisampaikan Divisi Iklan POSMETRO MEDAN


31 Januari 2008

Syarat & Ketentuan Berlaku

KREDIT KOMPUTER TANPA SURVEY AMD Athlon 64 2700 + M.Board Mercury Memory/DDR 512 MB ang Bar Bar u HDD 80 GB % DVD ROOM LG 100 Casing ATX 450 watt Monitor LG 17” Keyboard + Mouse Optic + Speaker Free : Mp3, Games, Mouse Pad, Anti virus, Flash Disc 1 GB, Bluetooth, Card reader

AMD Athlon 64 3000 + M.Board ECS Memory/DDR 512 MB HDD 80 GB DVD ROOM LG Casing ATX 450 watt Monitor LG 17” Keyboard + Mouse Optic + Speaker Free : Mp3, Games, Mouse Pad, Anti virus, Flash Disc 1 GB, Bluetooth, Card reader


Cash & Kredit ??? Cash Back Rp.600.000,Atau Printer Epson T11

Medan - Jakarta

Rp.607.000,Penang US$ 60-65/PP PELNI Rp.360.000,-

CASH Rp.3.575.000,- D/P. Rp.400.000,- CASH Rp.3.680.000,- D/P. Rp.400.000,Rp.287.000,- x 15 bln Rp.296.000,- x 15 bln Rp.248.000,- x 18 bln Rp.257.000,- x 18 bln

Jln. H.M. Yamin (Komp. Serdang Mas) No. B-8 Telp.(061) 4555988 (Hunting)

Coverage Area : Medan - P. Brayan - Mabar - Belawan - Marelan - Binjai Stabat - Tanjung Morawa - L. Pakam - Deli Tua - Pancur Batu

Hubungi :

Atau hubungi : TIMOR TRAVEL (0621) 327711 - Tebing Tinggi

Jl. AR. Hakim No.3B Medan (dpn. Komp. Asia Mega Mas / sebelah Bank BII) Telp. 77815380 - 91077550 - 76290898

LOWONGAN KERJA Membutuhkan : 1. SUPERVISOR Syarat : • Pria & Wanita • Min. SMU/sederajat • Pengalaman 1 tahun 2. MARKETING Syarat : • Pria & Wanita Fasilitas : • Gaji pokok • Jenjang karir • Uang transport • Komisi (bonus tahunan) • Uang makan 3. PRAMUNIAGA/PENJAGA TOKO Hubungi : SINAR ELEKTRONIK Jl. Gatot Subroto Km 8 Kp. lalang (lewat lampu merah ± 10 m sebelah kiri)


Perusahaan Corps Entrepreneur membutuhkan segera : STAFF MARKETING Syarat : • Pria/Wanita • Tamatan min. SMU/sederajat • Ulet, jujur dan bertanggung jawab Fasilitas : • Gaji + bonus penjualan langsung • Jenjang karir - Branch Manager - Assistent Manager • Mess disediakan (dari luar kota) Lamaran diantar langsung ke : Jl. Santun No.43 B Medan Teladan (belakang Kampus Pertanian UISU SM. Raja) Jam 10.00 s/d 16.00 WIB Iklan ini berlaku 2 minggu


Full Musik 24 Jam Pemandian Alam Jl. Jamin Ginting Km.29 Sembahe Membutuhkan karyawan sbb : • Room Boy • Waitres Hubungi : 081260650598 0811632379 081397649747


Wanita tamatan SD, SMP, SMA, SPK, AKPER,/AKBID, Untuk dididik dan di perkerjakan sebagai: Kakak asuh, B. sitter, P. Jompo/P. Pribadi. Gaji bersih Rp. 400 Rb s/d 800 rb/bulan Hub: YAYASAN NATA PERMINA Jl. pancing No. 165 B, Medan telp. 061-77717528/081376249828 NB: Lowongan ini tidak ada batasan waktu.

Syarat & Ketentuan Berlaku

KREDIT KOMPUTER TANPA SURVEY AMD Athlon 64 3200 + M.Board ECS Memory/DDR 512 MB ang Bar Bar u HDD 80 GB % DVD ROOM LG 100 Casing ATX 450 watt Monitor LG 17” Keyboard + Mouse Optic + Speaker Free : Mp3, Games, Mouse Pad, Anti virus, Flash Disc 1 GB, Bluetooth, Card reader

AMD Athlon 64 4200 + M.Board PC-Chips Memory/DDR 512 MB HDD 80 GB DVD ROOM LG Casing ATX 450 watt Monitor LG 17” Keyboard + Mouse Optic + Speaker Free : Mp3, Games, Mouse Pad, Anti virus, Flash Disc 1 GB, Bluetooth, Card reader

Cash & Kredit ??? Cash Back Rp.600.000,Atau Printer Epson T11


CASH Rp.3.785.000,- D/P. Rp.400.000,- CASH Rp.3.980.000,- D/P. Rp.400.000,Rp.306.000,- x 15 bln Rp.323.000,- x 15 bln Rp.265.000,- x 18 bln Rp.280.000,- x 18 bln

Coverage Area : Medan - P. Brayan - Mabar - Belawan - Marelan - Binjai Stabat - Tanjung Morawa - L. Pakam - Deli Tua - Pancur Batu

Hubungi : Jl. AR. Hakim No.3B Medan (dpn. Komp. Asia Mega Mas / sebelah Bank BII) Telp. 77815380 - 91077550 - 76290898 KREDIT NOTE BOOK TANPA SURVEY NEON TVW 812P



Untuk Cash & Kredit??? Cash Back Rp.700.000,atau Printer Epson T11 + Flash Disk 2 GB

Anda seorang muslim, berusia 18-25 tahun, ingin penghasilan tambahan tanpa mengganggu aktivitas anda, ingin berangkat umroh gratis, ingin mendapat bantuan modal usaha ? Ikutilah PELATIHAN MANAJEMEN USAHA. Biaya registrasi Rp.300.000,per orang. Ketik Reg (spasi) Nama (spasi) Alamat, kirim ke : 081362351436. Terbatas untuk 30 pendaftar pertama. Jika tidak berhasil uang kembali 100%.


• Intel Pentium Dual Core T2390 1.86 Ghz • Intel Pentium Core 2 Duo T5750 2.0 Ghz (1 MB L2 Cache, 533 Mhz FSB) (2 MB L2 Cache, 667 Mhz FSB) • DDR2 Memory 1024 MB • DDR2 Memory 1024 MB NEW WITH CAMERA • HDD Seagate 120 GB SATA 2 • HDD Seagate 160 GB SATA 2 • Wifi - Card Reader - DVD Dual R/RW Super Multi • Wifi - Card Reader - DVD Dual R/RW Super Multi • 1.3 Megapixel Camera - 14,1” Wide TFT XGA • 1.3 Megapixel Camera - 12,1” Wide TFT XGA Glare • Weight 2.4 Kg - Linux • Weight 1.9 Kg - Linux • 1 Year National Waranty • 1 Year National Waranty

AXIOO CASH Rp.8.000.000,- D/P Rp.1.500.000 Rp.587.000,- x 15 bln CASH Rp.6.900.000,- D/P.Rp.1.000.000,Rp.508.000,- x 18 bln Rp.532.000,- x 15 bln Coverage Area : Medan - P. Brayan - Mabar - Belawan - Marelan - Binjai - Stabat - Tanjung Morawa - L. Pakam - Deli Tua - Pancur Batu

Rp.461.000,- x 18 bln

Hub :

Jl. AR. Hakim No.3B (dpn. Komp. Asia Mega Mas / sebelah Bank BII) Telp. 77815380 - 91077550 - 76290898



BANTUAN LANSUNG JADI • Pelaris Ush, Rizki & Keu. • Byr utang & P'jam Meminjam • Bka aura Pemanis & Pemikat • RT.Jodoh,Asihan,Penunduk • PeletCinta,Asmara, PIL/W/L • Lamar kerja.Prestasi.Lls Ujian • L.S.T.U.& Mngbati Sgl Penykt

Dibutuhkan tenaga wanita tamatan SD, SLTP, SLTA, SPK, AKPER untuk menjadi : • Babby Sitter • Perawat Jompo/Pribadi • Kakak Asuh Honor Rp.500 rb s/d 1 juta Hubungi : YAYASAN HARAPAN BUNDA Jl. Setia Budi No.81 D Simp. Sei Belutu T. Rejo, Medan. Hp : 081396444756 Tel : 8219394, 061-77984700

LOWONGAN KERJA Dibutuhkan wanita tamatan SD, SMP, SMU, SPK/ AKPER untuk dilatih & dipekerjakan sbg : • BABY SISTER



Fasilitas : Asrama, makan, pelatihan (gratis), baw a resi/KTP, STTB asli langsung diterima bekerja, gaji 450.000 s/d 1.000.000/bln bersih Hubungi :

YAYA S A N A S U H P R I M A Jl. Pinang Baris No. 111 N

Telp : 061-8476196/08126044516 (di depan Terminal Pinang Baris Medan)

NB : Bila sampai di medan dapat dijemput

Mahar 250 Rb

Jl. Karya Bakti No. 42 Tel.061.7669.9652 HP. 08126048.2435



Dapat mengobati segala macam penyakit : -Pinggang / ginjal -Gula -Lemah syahwat/ -Angin duduk impoten -Belum mendapat -Pasang susuk keturunan -Pelaris -Pelet -Buka aura Hubungi : IBU TINI Hp : 0852 7524 0184 Jl. Seser No. 65 dr Jl. Suluh depan kantor Gubernur Pancing / Wilen Iskandar

• KANADA • TAIWAN • AUSTRALIA • HONGKONG • NEW ZEALAND • SINGAPURA • JEPANG • MALAYSIA TKW / PRT gaji : Rp.4 - 5,5 juta (Non Biaya) Butuh segera tamatan AKPER/AKBID/SPK sebagai tenaga perawat klinik kesehatan di taiwan. Gaji mencapaI Rp.8 juta lebih Hubungi Consultan : IBU ICHA Jl. Tempirai Raya No.8 Comp. Griya Martubung Telp : 061-6842657 Hp.0815-3333 4534 Tebing Tinggi / Sei Rampah : 085 6633 5555 (IKLAN INI TERBIT SEJAK APRIL 2007)

LOWONGAN KERJA Dibutuhkan segera marketing, dengan syarat : • Pria/Wanita • Memiliki kendaraan roda dua & SIM C • Tamatan SMU/sederajat • Jujur dan bertanggung jawab Fasilitas yang diberikan : • Gaji pokok • Komisi penjualan • Uang makan • Uang transport • Bonus tahunan • Jenjang karir Lamaran diantar langsung ke : ROYAL ELEKTRONIK Jl. R.A. Kartini No.1Q Binjai


LOWONGAN KERJA Dibutuhkan wanita umur 17 s/d 40 thn tamatan SD, SMP, SMA, SPK/AKPER sederajat untuk dipekerjakan sebagai : • Babby Sitter • Kakak Asuh • Perawat Jompo/P. Medis Syarat - syarat : KTP/Ijazah, jujur Gaji : Rp.500 rb s/d 1 juta/bln bersih Fasilitas : Asrama, makan gratis Hubungi : YAYASAN BUNDA MARIA Jl. Luku I No.20 Sp. Pos P. Bulan 061-77817707, 061-8361991, 081376874584 NB : • menerima pindahan dari yayasan lain, • gaji disesuaikan, iklan ini tidak ada batas waktu


Jl. Letjend Jamin Ginting KM II No. 53 Samping Wisma Adat Halilintar Simp. Selayang Medan

Perusahaan yg bergerak dibidang pemasaran (ELCB)/pengaman listrik, butuh tenaga pemasaran Syarat : - Surat Lamaran - Berkomunikasi Lancar - Berpenampilan menarik - Menerima Tantangan / Sanggup Bekerja Keras - Sederajat SMU - Umur Max 35 Thn - Bersedia keluar kota/daerah 3 x 1 bulan Fasilitas : - Gaji - Bonus - Transport gratis - Komisi - Pemondokan disediakan - THR untuk 2009 Surat lamaran langsung diantar ke alamat diatas Telp. 061-7762 0122 - 0813 7655 9030 Jam 10.00 s.d 15.00 WIB



Mengobati berbagai macam penyakit saluran pernafasan dan jaringan kepala ; Sinusitis, Polip, Meningitis, Batuk, TBC, Bronchitis, Asma, Migrain, Amandel, Gondok, Pusing Menahun, Melonggarkan pernafasan, Mengeluarkan Flek, Nikotin, Narkoba dalam tubuh, dll. Hubungi : Drs. MAHJUDDIN. Z (Ahli Gurah) Jl. Flamboyan Raya Setia Budi - Flamboyan I, Lor.3 No.13 Komp. Pemda Tk.II Polda Sumut, Tj. Sari - Tj. Selamat Medan Telepon :

Syarat : • Ijazah SLTA sederajat • Pria, SLTA usia min.20 thn maks.27 tahun Penghasilan : • Tahun I Rp.10.400.000/bulan • Tahun II Rp.11.700.000/bulan • Tahun III Rp.13.000.000/bulan • Selesai magang 3 tahun mendapat bonus Rp.78.000.000 + dana pensiun ± Rp.25.000.000 Sertifikat JITCO dari Politeknik Jepang Kampus HIKARI UDNAS Jl. Bromo No.35 Medan Telp : (061) 7364364, 085270087959

061-8216242, 081370945277 Buka Setiap Hari, Pagi - Malam

PERLU UANG TUNAI !!!! Caranya gampang. 3 jam cair, cukup BPKB sepeda motor/mobil anda bisa nama sendiri atau orang lain. BERHADIAH Hubungi : PT. MITRA DANA PUTRA UTAMA FINANCE Komplek Millenium Plaza Blok B-36 Jl. Kapt. Muslim No.111 Medan Telepon : 061-8443306, 8461885 Jl. Pattimura No.22 Pematang Siantar 0622-24170

LOWONGAN KERJA Sebuah Perusahaan Otomotif yang sedang berkembang membutuhkan : MEKANIK MOTOR Syarat : • Pengalaman minimal 5 tahun • Menguasai jenis motor Honda, Suzuki, Yamaha • Tamatan STM atau sederajat • Memiliki SIM C Lamaran ditujukan ke PO. BOX 1443 Medan Paling lambat 10 hari sejak iklan ini diterbitkan

* Isi dari materi iklan diluar tanggung jawab penerbit

BUTUH DANA CEPAT ?? Kami siap membantu Anda...


Syarat Mudah: • Jaminkan BPKB Motor Anda • Motor diasuransikan • Pencarian Tanpa Potongan • Proses cepat hubungi: PT. CAKRAWALA CITRA MEGA MULTIFINANCE Jl. Prof. HM. Yamin Kom.Kesawan Deli Centre Blok A No.8/9 Medan TimurSumut 4512 396 - 4512 401 - 4551 766 Jl. Marelan Raya Psr III No.164 Medan Marelan. Telp.(061)6840176

Terbukti mujarab 100%, bikin alat vital secara alami pasti jadi besar, panjang, kokoh dan berotot seumur hidup. (Mahar hanya Rp.150 ribu) Bonus : rahasia jitu kuat sex, tahan lama dalam bersenggama sepuas - puasnya, usia 70 tahunan serasa 20 an. Buktikan !!! / Garansi full Hub : BAMBANG AL-AZIZ (061) 77377370, 081370847253 Jl. Medan - Tg. Morawa Km.12,5 Gg. Sukamulia No.76/kode pos : 20362



31 Januari 2008

Mobil Ini Dijual....! Dijual Cash

Suzuki Vitara ‘93 Warna Hijau Velg racing, AC, Tape, Remote Hub : NUSANTARA MOBIL Jl. AH. Nasution No.100 Medan, 061-76473794

Warna Biru, BK Medan, Harga nego Hub : NUSANTARA MOBIL Jl. AH. Nasution No.100 Medan, 061-76473794

Toyota Great Corolla ‘93

Warna Abu - abu Metalik, ex. dokter

Hub : NUSANTARA MOBIL, Jl. AH. Nasution No.100 Medan, 061-76473794

Toyota Kijang Commando SSX ‘95 Warna Abu Metalik Harga nego Hub : NUSANTARA MOBIL Jl. AH. Nasution No.100 Medan, 061-76473794

Isuzu Panther Hi-Grade ‘95 Warna BIru Metalik BK Medan asli, Harga nego Hub : NUSANTARA MOBIL Jl. AH. Nasution No.100 Medan, 061-76473794

Mitsubishi L300 Sparta ‘05

Warna Biru, BK hitam, Harga nego Hub : NUSANTARA MOBIL, Jl. AH. Nasution No.100 Medan, 061-76473794

Honda Jazz Matic ‘04 Warna Hitam Hub : BM MOTOR Dijual


Toyota Avanza G ‘06

Panther 2,5 LM Smart ‘05

Jl. Tritura No.18 Medan Telp.081362333376, 77012244

Jl. Tritura No.18 Medan Telp.081362333376, 77012244


Dijual Cash

Warna Biru Metalic Hub : BM MOTOR

Warna Silver Hub : BM MOTOR

Toyota Toyota Twincam ‘89

Volkswagon 1,3 ‘74

Warna Hitam Hub : BM MOTOR

Warna Super White, BK Asli Medan, Bodi Kaleng. Harga Rp.40 Jt/nego Hub : 061-76245566/081361668951


Taft Badak ‘81

Carry Pick Up ‘06

Warna Silver Metalik Hubungi : PA R D A MOBIL

Warna Hitam Speksi + BK hidup, Mulus siap pakai Hub : PA R D A MOBIL

Warna Merah Bata, 4 x 4, Tape, Ban baru. Harga 29 Jt/nego, hub : 081802207568 Jl. Rawa No.6 Samp. Terminal Amplas

Toyota Avanza 1300 G ‘06

APV Type X ‘05

Warna Silver Metalik Hubungi : PA R D A MOBIL

Warna Coklat Metalik Hubungi : PA R D A MOBIL

Taft Badak ‘81 Warna Biru, P.S, Siap pakai, Harga Rp.24 Jt Hub : 081396919855 Jl. Ngumban Surbakti No.20 B

Warna Hitam, Mulus, BK asli Medan, Siap pakai. Harga Rp.126 Jt/nego, bisa bantu kredit Hub : 0811602432

Suzuki Sidekick ‘97

W arna Hitam, Siap pakai Tape, A C Harga Rp.30. Juta. Hub : 06177904311, 081264181199 P. Bulan Dijual Cash

Mercy C180 ‘95

Warna Biru, Mulus, Tape power, Harga Nego Hubungi : 061-76705024, Jl. Ngumban Surbakti Psr.VIII Medan

Isuzu Panther ‘03

Warna Merah Metalik Dp.20 Jt, Angs.2,4 Jt x 35 bln Hub : MOSSEC MOTOR

Warna Hitam, Type Hi-Grade LM, AC DB, CL, PW Harga Rp.120 juta/nego Hub : 08126494333

Toyota Kijang LGX Diesel ‘’02

Warna Biru Mika Metalik, VR, Ban cangkul DP.40 Jt, Angs. 4,1 Jt x 35 bln Hub : MOSSEC MOTOR DIJUAL

Dijual Rumah LT.8x15, KT 3, KM. 2, Dapur, Ruang tamu, Ruang keluarga. Jl. Medan Binjai Km.12,5 Taman Permata Hijau - ada ventilator, harga 160 Jt. Hub : 77912655 - 08567209953


Dijual Rocky ‘92 Warna Hitam Hubungi : 081361111004, 061-77410890 Jl. A.H. Nasution No. 54 Medan

Dijual Toyota Kijang Super G ‘94 Warna Abu - abu Hubungi : 081361111004, 061-77410890 Jl. A.H. Nasution No. 54 Medan

Dijual Suzuki Carry Futura 1.5 Pick Up ‘08 Warna Hitam MITRA JAYA MOBIL Jl. Gatot Subroto No. 399 Medan Telp. 4147746 - 77863182

Dijual Daihatsu Espass Pick Up ‘04 Warna Hitam MITRA JAYA MOBIL Jl. Gatot Subroto No. 399 Medan Telp. 4147746 - 77863182


D i j u a l Daihatsu Espass ‘03

Harga 55 Juta/nego Hub : 899 MOBIL

Kijang Krista Diesel ‘01

Warna Silver Met, Lengkap, Mulus Balik Dp.Rp.45 Jt, Angs.3.954.000 x 27 bln Hub : 081370002399

Perumahan Dalu X Indah Lokasi : Jl. Payanibung, Desa Dalu X B, Tanjung Morawa Batang Kuis arah Bandara Kuala Namu, type 45/108 m² dan 36/96 m². Angsuran perbulan Rp.288.750. Hub : 061-76814493 atau 061-77744677

Timor SOHC ‘97

Warna Merah, Kondisi sangat mulus Harga nego (TP) Hub : 0811637306

D i j u a l Isuzu Panther LS ‘00

D i j u a l Kuda Grandia Solar ‘02

Daihatsu Taft Hiline ‘88

Warna HIjau Metalik, Power Steering Hub : 081396919855 Jl. Ngumban Surbakti Medan

D i j u a l Daihatsu Zebra Box ‘05

D i j u a l Suzuki Escudo ‘02

D i j u a l Isuzu Panther LM ‘05

Harga 50 Juta/nego Hub : 899 MOBIL

Harga 55 Juta/nego Hub : 899 MOBIL

Toyota Kijang ‘87

Taft Hiline ‘90

AC, Power steering, siap pakai. Harga nego Hub : Hp.0813 9691 9855 Jl. Ngumban Surbakti No.20 B

Toyota Kijang LGX ‘97 Bensin, Warna Biru Metalik, BK asli Medan, Lampu depan belakang sudah rombak tahun 2003. Rp.92 Juta/nego. Hub : (061) 77698741/08126378815

Taft Hiline Pick Up 4x4 ‘87

Warna Hitam, Body/mesin mulus, Pajak panjang. Hubungi : 08126351209/77572350

Toyota Kijang LGX ‘99 Warna Hijau Met., AC DB, CL, PW, Audio, Asuransi all risk, Mulus siap pakai, BK asli Medan. Harga Rp.112 Jt/nego. Hub : 0812777135

Harga 125 Juta/nego Hub : 899 MOBIL

Warna Silver Harga Rp.135 juta/nego Hub : 081264135746/081362336879

Honda City 1.3 ‘96

Warna Merah, DVD, Sound System, TV, AC Hubungi: 0819 7311 659

Daihatsu Feroza ‘95

D i j u a l Panther Hi Grade ‘95

Warna Hijau Metalik, AC dingin Harga Rp.48 juta/nego Hub : 081362363075

Harga 65 Juta/nego Hub : 899 MOBIL

Dijual Cash


Dijual Cash

Hardtop Pick Up Panjang ‘80

Mesin 2 F timbul, Bensin, Siap pakai, Harga nego Hub : 081370128696, 061-8446172 Jl. Amir Hamzah No.49 Medan Dijual Cash

Taft Badak Pick Up Panjang ‘81

Warna Biru TUa kilat ( baru cat) STNK panjang baru urus, siap pakai. Hubungi : 087868593388

Harga 115 Juta/nego Hub : 899 MOBIL


DEALER RESMI MITSUBISHI Colt Diesel, L 300, T 120, L 200, Triton Dp. Ringan dalam & luar kota Proses mudah Hubungi : (061) 77698741/08126378815

Kijang Diesel Kapsul ‘97

Mesin dan Body bagus Hubungi : 08126575067




Warna Merah Metalik, VR, Tape, Power, AC, CR, BK Medan asli. Harga Rp.37 Jt/nego Hub : ADI (061-76339896)

Dijual rumah, ukuran tanah 20 x 10,5 m, ukuran rumah 9 x 7 m, keramik, harga Rp.90 Jt/nego. Hubungi : DIRMAN, 061-77635052



D i j u a l Kuda Diamond ‘02

Dijual Cash

Suzuki Carry Futura Adiputro ‘94

Warna Merah, Asli Medan, Pajak Baru Harga Rp.42,5 Jt/nego Hub : 081265242619

Dijual Cash

Dijual Cash

Warna Hijau Metalik, 1 tanagan, AC, T/R, Mulus, Harga Rp.38 Juta/nego, Jl. HM. Joni Gg. Aman I No.19 Medan (belakang ITM Teladan)


Luas total 300 m², tanah ± 35m x 36m, 4 KT, 3 KM, Telp, Listrik, Tanah Sertifikat Camat, Harga nego. Hub : 08126466244. Jl. Persatuan Psr.IX No.920 Tembung (dekat arah Kuala Namo) Dijual/Dikontrakkan

Jual Cepat Murah Secara KPR, DP Bisa tanah / rumah yang lebih kecil. Lokasi Jl.Kongsi / Jl.Pantai Halim No.201 Marendal Dalam.Ukuran LT=208m , LB=190m , 4KT, 2KM, Garasi, Full Keramik, Plafon, Gybsum, Atap Genteng Beton. Harga Nego (Ada Komisi Buat Agen). Hub : 06191034955, 081396544077



Ukuran 10 x 18,5 m di Jl. Lantasan, Patumbak, 4 KT, SK. Camat, Harga Rp.130 Jt/nego, bisa tukar tambah dengan mobil Hubungi : 7352926, 081263244941

Dijual Cepat Rumah, Ukuran 4 m x 18 m, 2 1/2 lantai, PAM, Telepon, PLN, SHM.Harga Rp.400 Jt/ nego. Hubungi : 087868236834, 081370349635. Jl. Keladi No.77-DD Medan


2 pintu ruko 2 tingkat, SHM, PLN, PAM di Jl. Cengkeh Raya, Harga damai, bisa beli 1 pintu. Hubungi : 061-76487344, 08126020493

Luas 17 x 18,5 ; 3 KT, R. Kel, Keramik, Carport, Harga Rp.160 Jt/nego. Jl. Pasar Sidomulyo Delitua, dekat perumahan Deli Permata Biru, 5 menit dari RS. Sembiring Delitua. Hubungi : 085262322600, 081361922200, 081264099493


Dijual Rumah 31/2 Tingkat Ukuran 13 x 5,20 m, Lb : 11 x 5, 20 m, 4 KT, 2 KM, 2 RT, Teras, Fass : Listrik, PAM, Lt. Keramik, SK. Camat, Harga nego. Telp : 081375100428, 061-91296488 Alamat : Jl. Binjai Km.10 Gg. Damai Lr.5 No.3A

Jl. Medan Tenggara II No.16, Sertifikat hak milik (SHM), Keramik PLN, PAM + sanyo, Garasi, Sisa tanah, ± 2 m di depan, 3 KT, 2 KM. Harga Rp.350 Jt/nego. Hub : 081376544088, 081382965427, 081533868837


Ruko ini disewakan/dikontrakkan. Jl. Bawang Putih, samping Pajak/Pasar Santi Tebing Tinggi Hubungi : 08126555565 DIJUAL



Jl. Irian Gg. Pembangunan dalam No.142 dibelakang Mesjid . Kota T.Morawa, 3 KT, 2KM, 11/2 tingkat, Grs, Harga murah, bisa kredit, ada komisi agen. Hub : 061-91034955/081396544077



Toyota Vios G ‘03 Warna Hitam, Over Kredit, Mobil sangat mentah, Langsung pemakai, Pajak Full 1 tahun, Dp.62 Jt/nego, Angsuran 3.300.000 x 22 bln, K.meter 29 ribu. Hub : 08126382744/77738782

Daihatsu Feroza ‘94

Harga 123 Juta/nego Hub : 899 MOBIL

Dijual Cash

Suzuki Adventure ‘95

Kijang Krista ‘02

Honda Civic ‘86/’85 Warna Hitam, BK Medan, AC, PS, Sound system, Cantik terawat. Hub : 77323114, Jl. Karya Jaya/Gg. Eka Budi No.9 Gd. Johor. Harga 25 Jt/nego (tidak kecewa)

Dijual Cash

Harga 120 Juta/nego Hub : 899 MOBIL


Dijual Cash

Dijual Cash

Timor SOAC/DOAC ‘97 BK Medan, Warna Silver, Komplit, Siap pakai. Harga Nego Hub : 77933823/081265242619

Harga 118 Juta/nego Hub : 899 MOBIL

Dijual Cash

Dijual Cash

Dijual Cepat

D i j u a l Feroza Jeep ‘96

Telp.76574889 - 30367682 Telp.4554945 / 061.76574889

Dijual Cash

Dijual Cash

Pintu belakang Biru, Mulus, Tape, VR, BR, Jok kulit. Harga Rp.34 Jt/nego Hub : 08126578790/4556765

Jl. Gatot Subroto No.311 E Medan (depan PWS)

Dijual Cash


Dijual Cash

Umuran 35 x 20 m, 40 kamar, 40 K.mandi, keramik, PLN, Cocok utk showroom, doorsmeer, Rumah sekolah, Rumah sakit, mesjid tinggal bikin kubah. Harga 2,5 M/nego Hub : 081361123035/061-8212257. Jl. Setia Budi Gg. Karya Indah Psr. V Tanjung Sari Simp. jalan baru Ngumban Surbakti

Dijual Isuzu Panther Deluxe ‘96 Warna Hijau Metalik MITRA JAYA MOBIL Jl. Gatot Subroto No. 399 Medan Telp. 4147746 - 77863182

Dijual Cash


Dijual Cash

Toyota Kijang LSX ‘01 Warna Biru Tua Metalik, SL, PW, VR 15 Inch, Ban cangkul, Dp.35 Jt, Angs.3,4 Jt x 35 bln Hub : MOSSEC MOTOR

Dijual Mitsubishi Pick Up L300 Diesel ‘01 Warna Coklat MITRA JAYA MOBIL Jl. Gatot Subroto No. 399 Medan Telp. 4147746 - 77863182

Pemakaian ‘88, Warna Hitam, AC, Tape, Jarang pakai, Mesin terawat, Cantik Mulus, Ban baru, Harga Rp.37 Juta/nego. Hub : 8473134, 08163136850. Jl. Pinang Mas I Blok A No.34 Perumahan Villa Palem Kencana, Medan - Binjai KM 12


Dijual Cash

Peugeot 206 XR ‘01/’02

Warna Merah Metalik, VR 16 Inch Dp.15 Jt, Angs.1,5 Jt x 35 bln Hub : MOSSEC MOTOR

Dijual Great Corolla ‘93 Warna Abu - abu Hubungi : 081361111004, 061-77410890 Jl. A.H. Nasution No. 54 Medan

Dijual Cash

Toyota Kijang PU ‘94

Warna Merah Metalik, Dp.25 Jt, Angsuran 2,9 Jt x 35 bln Hub : MOSSEC MOTOR

Dijual Cash

Timor DOHC ‘98

Dijual Honda Genio ‘93 Warna Hijau Hubungi : 081361111004, 061-77410890 Jl. A.H. Nasution No. 54 Medan

Warna Hijau Metalik, Tape, AC, CL, BR, PR. 1 tangan, BK Medan asli Harga Rp.67 Jt/ nego. Hub : 08126464331

Suzuki Carry Futura 1,3 Alexander ‘93

Suzuki Katana ‘89

Warna Silver Metalik Dp. 20 Jt, Angs. 2,4 Juta Hub : MOSSEC MOTOR

Dijual Toyota Kijang New LX Bensin 1.8 cc ‘04 Warna Coklat Metalik MITRA JAYA MOBIL Jl. Gatot Subroto No. 399 Medan Telp. 4147746 - 77863182

Dijual Cash

Dijual Cash

BMW 320i ‘95

Dijual Isuzu Panther LV 25 Limited ‘01 Warna Hijau Metalik MITRA JAYA MOBIL Jl. Gatot Subroto No. 399 Medan Telp. 4147746 - 77863182

Dijual Cash

Dijual Cash

Kijang Krista ‘00


Cukup SMS ke : 061-77711074 Kami Datang Memfoto

Dijual Cash

Jl. Tritura No.18 Medan Telp.081362333376, 77012244

Kijang Innova G ‘05


Dijual Cash

Dijual Cash

Mitsubishi Lancer ‘82

Pasang Iklan Jual Mobil, Rumah dan Ruko

Iklan Mobil

Rumah SK. Camat, harga 88 damai, uk.4,5 x 22 m, lantai keramik, dapur keramik, bangunan baru 3 tahun, siap huni. Jl. Beringin - Tembung Kota, Psr.7 Gg. Semangka No.17-A (mobil bisa masuk). Hubungi : 081265410988

Luas 11x18 m, KT 4, KM 2, RT 3, 2 garasi, full keramik, ada kolam ikan, SHM, PLN, PAM, Kondisi rumah sangat indah, harga 275 Jt/nego tanpa perantara. Hub : 081362139613, 081396423289, Jl Denai Ujung Psr.3 No.4 Medan


Perumahan Villa Mutiara

Jl. Bajak V Blok F 10 sudut, depan Hotel Sahid type 45. Lt.144 m², 2 KT, 1 KM, SHM, PLN, PAM, keramik. TP/Hubungi : 08126355287

Type 54/96, 77/102, 45/102, 54/102, 63/102, 58/104, 81/107. Perumahan Villa Palem Jari Asri Jl. Persatuan II Desa Mulyo Rejo / Jl. Medan Binjai Km. 11,5. Harga Promosi (Ada Komisi buat Agen). Hub: 061 9103 4955 / 081396544077, 081375165156



metro sport sambungan



Gelar Pertandingan Persahabatan

Dibidik Madrid Perburuan terhadap pemain timnas Brazil itu sepertinya akan menjadi jawaban nasib Michel Salgado, yang selama ini menjadi pelapis Sergio Ramos. Performa Salgado sudah menurun dan dikabarkan bakal dilepas di pengujung musim nanti. Marca merilis, manajemen El Real telah bernegosiasi dengan agen Maicon. Kebetulan saat ini hubungan pemain 27 tahun itu dengan pelatih Jose Mourinho tengan renggang. Sementara itu, ambisi El Real untuk mendapatkan winger Antonio Valencia dari Wigan Ath-

letic mendapat saingan berat. Sebab, dalam perkembangan terakhir, anggota skuad timnas Ekuador itu didekati juara Premier League dan Liga Champions musim lalu, Manchester United. Daily Mirror melansir Wigan mematok harga 19,5 juta Euro bagi siapa saya yang berniat memboyong Valencia dari JJB Arena. Sir Alex Ferguson, manajer Manchester United dikabarkan bersedia membayar harga yang diinginkan Wigan. Sedangkan El Real menyodorkan opsi peminjaman.(ali/jpnn)

Terancam Sanksi Dalam selebrasinya, penyerang sayap Chelsea asal Pantai Gading itu menyilangkan kepalan tangannya di dada. Disinyalir, aksi Kalou itu merujuk kepada Antoine Assal Tiemoko, seorang aktivis yang baru bebas dari hukuman penjara bertahun-tahun di Pantai Gading. Dugaan itu makin kuat karena Didier Drogba, pemain Chelsea lainnya asal Pantai Gading, ikut menggelar selebrasi serupa. Namun, baik Kalou dan klubnya (Chelsea) buru-buru mengklarifikasi tuduhan itu. Kalou menyatakan jika selebrasi itu sekadar ekspresi kebahagiaan belaka. “Orang-orang selalu merasa curiga dengan sesuatu yang Anda lakukan, padahal tidak ada maksud tersembunyi sama sekali,” ungkapnya kepada Setanta Sports. “Saya hanya tengah bergembira. Saya bahkan tidak mengenal orang itu (Antoine Assal Tiemoko). Jika saya tidak kenal, kenapa saya harus merayakan gol untuknya?,” imbuh

pemain yang bergabung dengan The Blues - sebutan Chelsea - sejak 2006 itu. Hal senada ditegaskan juru bicara Chelsea. “Salomon (Kalou) hanya ingin mencoba selebrasi baru dengan menyilangkan lengan. Dia terkadang juga menaruh tangan di depan muka seperti topeng,” terangnya kepada The London Evening Standard. Terlepas dari sanggahan Kalou dan Chelsea, FA tetap akan menggelar investigasi. “Dari tayangan televisi, ada indikasi kuat jika selebrasi itu dilakukan tidak sewajarnya. Jadi, kami tetap akan bertindak,” kata juru bicara FA sebagaimana dilansir Sky Sports. FA memang dikenal sangat cermat terhadap selebrasi atau gerakan tubuh yang aneh dari pemain di lingkup sepak bola Inggris. Sejak 2002, FA membuat regulasi dan sanksi bagi pemain yang dianggap menggelar selebrasi dengan kepentingan di luar sepak bola seperti politis. (dns/jpnn)

Pembalap Terseksi wanita sensual dan hot itu kini menjadi bintang perburuan pengendara motor paling seksi untuk membentuk tim promo Bennetts Babes. Nicola adalah selebritas dengan nama paling menjulang yang sudah menandatangani kontrak. Dia mengikuti jejak Lucy Pinder, Kayleigh Pearson dan Danielle Lloyd yang sebelumnya memimpin perburuan itu. Akankah dia bisa menuai

sukses. Banyak pihak yang percaya. Pasalnya, Nicola McLean, gadis Page 3 itu, kecuali memiliki bakat luar biasa, juga postur yang mempesona. Maka, pada kesempatan pertama pun, Nicola McLean sudah unjuk gigi. Dia tampil dengan kostum yang seronok sambil wira-wiri. Apapun, kini Nicola McLean menjelma jadi ‘pembalap wanita paling seksi’.(Int)

Yonif 122/TS Bantai Polres Sergei SERGAI Polres Serdang Bedagai (Sergai) dan Yonif 122/TS, Kompi Dolok Masihul diharapkan dapat saling mendukung dan semakin mempererat hubungan kekeluargaan yang baik, ibarat lepat dengan daun.

HAL itu ditegaskan Danki C, Kapten Inf ST Batee, dalam sambutannya mewakili Danyonif 122 /TS, pada acara kegiatan olah raga bersama antara Polres Sergai dengan Batalion 122 /TS, Kompi Dolok Masihul, kemarin di halaman Mapolres Persiapan Serdang bedagai. Karenanya, jangan ada yang mencoba “memanfaatkan” sehingga hubungan diantara kita menjadi tidak

baik, ujarnya sembari mengucapkan terima kasih atas terwujudnya hubungan silatuhrahmi lewat kegiatan olah raga yang difasilitasi oleh Polres Sergai. Hadir pada kegiatan tersebut, Danki B Kapten Inf Harry Susilo, Lettu Inf Misnan, Lettu Inf P Girsang, Letda InfAbdullah, Lettu Inf Gus Harianto serta 114 prajurit. Kemudian dari Polres Sergai, Kapolres AKBP Drs Iswyoto Agoeng, Waka Polres, para Kabag, Kasat, Kapolsek, perwira staff dan seluruh personil. Sementara, Kapolres SergaiAKBP Iswyoto Agoeng mengatakan, kegiatan olahraga bersama yang dilaksanakan adalah merupakan implementasi dari program ke 5 yaitu, kerjasama antar departemen dalam

rangka membina hubungan yang harmonis dengan TNI pada program kerja akselerasi transformasi Polri menuju Polri yang mandiri, profesional, dan dipercaya masyarakat. “Dengan kegiatan seperti ini, bisa mewujudkan hubungan harmonis. Sehingga kalau bisa, kegiatan ini diupayakan 1 bulan sekali”, tandasnya. Kegiatan yang dilaksanakan pada hari itu antara lain, senam bersama, pertandingan volley persahabatan antara Persit KCK dengan Bhayangkari Polres, kemudian antara Putra TNI dengan Polri, yang dimenangkan oleh TNI dengan skors 2-0. Acara juga dimeriahkan dengan lucky draw. Hadiah pertama satu unit TV dimenangkan oleh anggota dari Yonif /122.(Malik)

cia. Klub promosi ini memang punya tengah terseok-seok. Hingga jornada ke-20 Numancia terperosok ke bibir jurang degradasi, peringkat ke17 klasemen sementara. Tapi, skuad Sergo Kresic ini punya rekor kandang bagus. Dari 9 kali laga laga home, Numancia memetik kemenangan 5 kali, seri, 2 kali dan kalah 2 kali. Salah satu kemenangan kandang Rojillos (sebutan Numancia) adalah dengan menjungkalkan Barcelona 1-0 di laga perdana. Itu menjadi satu-satunya kekalahan Barca musim ini. Jika ingin meraup poin penuh di

Los Pajaritos, Soria, El Real harus kerja keras. Sebab, saat menjamu Numancia di Santiago Bernabeu, markas El Real, di putaran pertama lalu, Raul Gonzalez dkk dipaksa bermain ketat untuk mengakhiri pertandingan dengan skor 4-3. Sementara itu, untuk meraup poin penuh di kandang, entrenador Sergio Kresic sudah menyiapkan kejutan untuk Real Madrid. Harian Marca melansir bahwa dalam sepekan terakhir Numancia menggelar latihan tertutup, dengan harapan lawan tidak bisa mendapat bocoran strategi yang akan diterapkan. (ali/jpnn)

Jaga Mimpi Champions lebih mudah daripada mempertahankan gelar liga (Primera),” kata Raul Gonzalez (foto), kapten Real Madrid seperti dilansir AFP. “Bukan hal tidak mungkin untuk bisa menyusul defisit 12 poin. Tapi jika Barca tidak kehilangan poin, tidak mungkin mengejar mereka,” sambungnya. Selain berharap Barca tersandung, Los Merengues (sebutan Real Madrid) juga harus bisa membendung serangan tim-tim lain. Dinihari nanti (siaran langsung RCTI pukul 04.00 WIB), lawan berat sudah menanti. Yaitu tuan rumah Numan-

Mereka dihukum oleh komite olimpiade Italia karena dinilai lalai melakukan tes doping dan terbukti doping. Tapi, keputusan itu ditentang BadanAnti Doping Dunia (WADA). Mereka pun melanjutkan kasus itu ke BadanArbitrase Olahraga (CAS). Ternyata, Badan Arbitrase Olahraga memberi keputusan yang berat bagi kedua pemain. Mereka diskorsing selama setahun dari lapangan hijau. Keputusan baru itu langsung ditentang Asosiasi Pemain Sepak Bola Italia (AIC). Dari kubu Mannini dan Possanzini juga menentang keras hukuman

085361125367 : Wanita Chinese, single, cantik dan menarik, umur 25 thn. ingin mencari pendamping hdp yg mapan. humoris, thank pm. 081263565696 : Co 23th, cr tmn. 085270030007 : Cow Duda 41 thn, Pengusaha, mapan, cari teman Muslim No Mc.

085297239809 : Cewek 28 thn, cr org Bengkulu yg ada di medan, khususnya org rejang. Hubungi saya. PM tlg di muat y. Trims.

085262521718 : Cwok 35 thn, mencari tmn yg gemuk dan

085361135371 : Cew, pengen knalan ama cow to cew zmz pti d

085276650645 : Khusus cowok 20thn k bawah, ada yg mo knalan? aq rudi 30thn klo ada SMS sj. 081375404593 : Santi, cwk 20 thn, pengn crk cwk umr 26-40 yg yg bs membt ag snng. 081376032778 : Wanita mencri pasngan umr 25 -35 thn. ccok jdi tmn hdup kusus, muslim. Trmksi PM.

yang dijatuhkan Badan Arbitrase Olahraga. Penyebabnya, mereka merasa sudah pernah menjalani hukuman dari Komite Olimpiade Italia atas kelalaian mereka. “Itu sangat mengejutkan dan putusan yang sangat tidak bisa dipercaya. Mannini dan Possanzini telah diperiksa. Mereka tidak pernah memakai zat-zat doping. CAS tahu itu,” ucap Mattia Grassani, pengacara Mannini, seperti dikutip Reuters. Sedangkan, dari kubu AIC, melalui ketuanya Giancarlo Abete juga melakukan pembelaan kepada kedua pemain. (ham/aww/jpnn) 081265852070 : H aq ald0. Cow j0mbl0. cR CS N PCr Ni. tlFn 9we yo broe...!

blz. Thank PM. 081396106931 : W co cinez cr tmn cinez yg baek, co n ce, bbs usia. call or mez j y. just cinez medan people. thnx PM.

081376785000 : Hai., aQ morgan 19 thn, (khusus) buat cwe maniezz. aQ tggu yacH. 085361099789 : Awi 35thn, Jkt, bth gds yg bnr2 serius mau jd pdpg hdpku, no iseng, dll, tlp/sms dbls, PM thx. 081219756530 : Aq duda anak 2, cr istri gadis, umur 25-30th, kristen, domisili siantar sms ya, thanks PM. 081377177637 : Sy cow 28 thn, mau cari cewek yg manis n baik. 081362238943 : Aku Riyan, duda 35 thn, mencari wanita 25-30 thn, bgi yng ada minat, silakan cal atau sms, pasti di bls ok. 081376126391 : Pria 30 thn. Cari wanita cantik. Jnd, wanita karir boleh. Saling ngerti-memahami. Nnm.

081361616307 :Hai.. saya andry, cari cewk ato jnd, trutama berdominisil d wilayah medan. call ato sms langsung d blz. 081265795195 : Co chn mencari ce yg bth tmn curhat (diutamakan tgl di medan dan serius). 081375006946 : Nama aq Ari, umr 24th, aq mencari jodoh wnta umr 19-22th, klo ada yg minat sms aja kesini. 085297204978 : Duda mapan cari istri, gadis cantik menarik kulit putih serius sms. 085262903166 : Gw cow, khus buat cew/jnd, 30 s/d 50th, pngn crhat sms ja. aerh mdan-pkam. thanks PM. ttap jaya. 081260208651 : Pria umur 20 mencari tmn cew. 087868396206 : Sy pria berdarah


PUSA T PENGOB ATAN PUSAT PENGOBA SPESIAL ALA T VIT AL ALAT VITAL DITANGANI LANGSUNG BPK. HARYONO ASLI DARI BANTEN Gelar terapi alat vital paling spektakuler Langsung Besar dan panjang di tempat no suntik / silicon , terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup Satu Kali pengobatan khasiatnya luar biasa dijamin ....... !!! Puas, paten dan permanen untuk selamanya. Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural / doa, yang sudah di pandukan melalui ramuan khusus unluk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup Satu kali pengobatan khasiatnya luar biasa. dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuakan dengan ukuran yang di inginkan: Panjang 15 Cm, diameter 3 cm, Panjang 17 cm, diameterya 4 Cm, panjang 20 cm diameternya 5,5 cm.Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat / doping, Dijamin Faten !!! Menyembuhkan impotent, Iemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, Di jamin Nornal kembali !! Batas Usia 80 Thn. Terapi alai vital Bapak Haryono Sudah puluhan Tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, Beliau pakar kejantanan asli asal Banten. Yang paling Pertama menemukan cara terapi tradisional dan hasil ditempat. llmunya sudah dipatenkan. Menangani bekas suntik.,silicon, ingin cepat Dapat keturunan, sperma encer dan menangani yang gagal dari tempat lain. Ditangani secara tuntas. Untuk. penanganan Serahkan pada ahlinya. Mahar Rp. 500 Rb Bergaransi dan sudah teruji dan terbukti. Khusus umum Melayani Antara lain: Susuk berlian ,susuk intan, susuk emas, susuk banyu, juga melayani pelet, jodoh, menyatukan / memisahkan PIL/WIL. Untuk membuka aura Kecantikan, ketampanan, dikagumi banyak Orang, sangat cocok: bagi penyanyi ataupun Meloby. • Problem Rumah Tangga Antara lain : mengembalikan keharmonisan suami - istri yang ditinggal Suami / istri, dll. Alamat Praktek Tetap JL SM. RAJA / Yuki Simp Raya , Masuk Jl. Amaliun Gg. Kesatuan No. 4. Hp. 0813. 7660. 6663 NB, MOBIL BISA MASUK/ GARASI PAKEM. B-346/ DSP.5/11 /2008



Saatnya Bangkit DAVID Trezeguet, momen yang tepat untuk bangkit.


TURIN JUVENTUS nyaris saja mendekati capolista (pimpinan klasemen sementara) Inter Milan. Mereka sempat tertinggal tiga poin. Tapi, kekalahan dari Udinese pada giornata (pekan) ke-21 membuat mereka harus tertinggal enam angka. Karena itu, Bianconeri (julukan Juve) harus kembali bekerja ekstrakeras. Sebab, kalau mereka kembali tergelincir, bukan hanya akan menjadikan selisih angka mereka dengan Inter kian menjauh, tapi juga terancam disalip AC Milan. Di saat Juve berupaya untuk bangkit dari kekalahan dari Udinese, mereka justru harus menghadapi tim yang sedang menawan penampilannya. Juve bakal menjamu Cagliari di Olimpico, Turin, dinihari nanti. (Siaran Langsung Trans7, Pukul 02.30 WIB) Ya, di atas kertas, berdasarkan hasil yang diraih Cagliari sejak libur musim dingin lalu, tidak mudah bagi

Nyonya Tua (julukan Juve) untuk menaklukkan mereka. Isolani (julukan Cagliari) memenangkan 3 dari 4 laga yang dilakoninya, yakni menang atas Udinese (2-0), Lazio (4-1), dan Siena (1-0). Sisanya mereka menahan imbang Inter 1-1 di Giuseppe Meazza, 11 Januari lalu. Problemnya, allenatore Claudio Ranieri masih terancam kehilangan tukang gedor andalan sekaligus ikon Juve Alessandro Del Piero. Kalau Del Piero belum pulih. Striker asal Prancis David Trezeguet punya peluang besar untuk tampil sebagai starter mendampingi Amauri Carvalho. Tapi, dia harus bersaing dengan Vincenzo Iaquinta juga berada dalam kondisi fit. Sedangkan, Cagliari yang sedang berada dalam kondisi terbaiknya, tetap berusaha merendah. Meski sekarang berada di posisi kesembilan klasemen sementara, tapi mereka tetap tidak berani sesumbar untuk menembus papan atas. (ham/jpnn)

Tanpa 2 Pemain Asing

Diskorsing Setahun Kehilangan Mannini bakal mengurangi daya gedor Napoli. Sebab, selama ini, selain Marek Hamsik, dia menjadi bagian penting dari skema Pelatih Napoli Edoardo Reja di lini tengah. Sanksi atas kasus serupa juga dijatuhkan kepada striker Brescia Davide Possanzini. Mannini dan Possanzini absen dari tes doping ketika masih membela Brescia di Serie B musim lalu. Atas kejadian itu, mereka sudah pernah mendapatkan sanksi berupa selama 15 hari pada Maret tahun lalu karena absen dari tes doping saat melawan Chievo Verona, Desember 2007.





Forum Komunikasi dan Penyembuhan Alternatif Indonesia IZIN DINKES NO.448/15830 IZIN KEJATI NO. B270/DSP 5.08 Buka Tiap Hari dari Jam 08 pagi - 11 malam


OFFICE : Jl. SM Raja masuk Jl Puri ± 300 M dari RM Family, No. 57 F Medan Hub : 0813 6246 7777 - (061) 76781087

Kedua pemain dimaksud adalah MarioAlejandro Costas dariArgentina dan Juan Daniel Salaberry asal Uruguay. Dengan kehadiran pemain ini, maka ‘Ayam Kinantan’ julukan PSMS Medan telah memiliki lima pemain asing dan sudah memenuhi kuota yang ditentukan BLI. Tiga pemain yang sudah dikontrak sebelumnya adalah Zada, Esteban Julien yang direkrut dari Persikota Tangerang, serta pemain baru Mario Pinto. Sebelumnya pihak manajemen telah memulangkan empat pemain asing yang ikut seleksi. Mereka adalah Lamoze Conteh (Afrika), Benoit Lumineau (Prancis), Etougou Mar-

corland (Camerun) dan Mohameda Daka (Bangladesh), karena dianggap tidak memenuhi persyaratan. Absennya dua pemain baru itu belum sedikit mempengaruhi kekuatan PSMS Medan yang menargetkan akan memenangkan pertandingan. “Mereka masih belum bisa diturunkan, karena masih mengurus suratsurat ijinnya,” ujar Liestiadi pelatih kepala PSMS Medan kepada POSMETRO MEDAN. “Berada di posisi kedua dasar klasemen sementara, menjadi ujian berat . Namun dengan kerjasama tim yang baik segala rintangan akan bisa diatasi,” yakinnya.(sormin/jpnn)

india. Baik hati dan lugu. Cr tmn ce yg baik dan humoris. Sms pasti d bls.

081370401118 : Hai w co chinese 29thn cr ce chinese cantik baek2 umur 24 keatas no miscal

085760515487 : Q cw0 Umr 17th,msh Skul..imut,9tg,tggi,kren,perfect deh..m0 cr Tmn.

081264397872 : Aq cow pengen cari pendamping hidup.

085762534773 : Hai w pria tngg !70 pth hobi dugem tjr bagi yg mau knln atau apa aja bs hub/sms

081260474008 : Cr knln cewe, onLy MeDaN 17-20thn.. Sms aja,jgn CuMi !!

081260183423 : Pria chinese,36 th,khusus cewek chinese.

081264253976 : Pria dewasa dah meried asal jogya lg kerj di mdn cari teman yg ramah.

085762834529 : Cow tinggi gantenk pth dn mapan mncr cew yg cntik pth kerja dn dwasa jgn m.C.Sms pst d blz 081265521788 : Ag pria 40 th.buat cri ce ag sms ya,soalnya ag lagi susah. 081265848109 : Nm sy,Gigih. Umr 38 th (duda). Tggi 182 bb 80, ingn cr yg statusny jnd, umr 35-37 th. Yg gemuk/tggi bsr. 081361352578 : Saya Rudi, 27thn, islam,buat yg ingin curhat silakan sms/call sy.Sy tunggu lo

085760977682 : W cowok chinese pengen kenalan dgn gadis2. 081370556268 : Aq Pria singel umr 20Th. pinggin cari C wek yg cantik. sederhana end penggertian. Call Online 24 jm 085658282134 : Hai, Aq Fery, cow sngle 27, btuh tmen curhat wanita. Aq tngu ya. Thanx PM,jaya trus 081375087497 : P.Ginting 36 thn,bth tmn crht kusus wanita 25-35 tnggu ya! Tanks PM.




Dibidik Madrid MADRID SETELAH menambah amunisi baru di lini depan dan tengah, area pertahanan kini menjadi perhatian Real Madrid. Untuk menambah solid benteng pertahanan, juara Liga Primera itu kini membidik bek kanan Inter Milan, Maicon.  Baca Halaman 15

MANCHESTER Rivalitas Manchester United, Chelsea dan Liverpool di papan atas Premier League memang seru. United memang memimpin dengan 50 poin dari 22 laga, dibayangi Chelsea dan Liverpool dengan 48 poin dari 23 pertandingan. Tapi, akhir pekan ini, keberuntungan lebih berpihak pada The Red Devils - julukan United. ITU tak lepas dari pertemuan Liverpool versus hanya terjadi jika kami bisa mengalahkan EverChelsea Minggu nanti (1/2). Di saat kedua rivalnya ton,� kata Rio Ferdinand, defender United, kepada saling jegal, United harus bisa memaksimalkan Manchester Evening News. keuntungan saat menjamu Everton di Old Trafford Ya, dengan asumsi United menang atas dinihari nanti (siaran langsung Star Sports-Aora Everton, sedangkan bentrok Liverpool dan pukul 00.30 WIB). Chelsea berakhir seri, gap United dengan “Apa pun hasil Liver- rivalnya bisa bertambah lebar. Di sisi lain, pool lawan Chelsea, kalau pun ada pemenang antara Liverpool kami akan diun- dan Chelsea, The Red Devils tetap diuntungkan. Tapi, itu tungkan karena itu berarti salah satu rival tertinggal dalam perburuan poin. “Momentum kebangkitan tim kami adalah sejak pulang dari Jepang (usai memenangi Piala DuniaAntarklub) akhir tahun lalu. Dan, kami akan menjaganya,� tambah Ferdinand yang



Terancam Sanksi LONDON KEGEMBIRAAN Salomon Kalou usai memborong dua gol kemenangan Chelsea atas Middlesbrough Rabu lalu (28/1) bisa berganti kesedihan. Sebab, cara Kalou merayakan gol dalam laga di Stamford Bridge itu dituding bermuatan politis. Imbasnya, pemain 23 tahun itu terancam sanksi dari Federasi Sepak Bola Inggris alias FA.

sempat absen di sembilan laga United sejak dari Jepang karena cedera punggung. Ferdinand sudah main kala United menang besar 5-0 atas West BromwichAlbion Selasa (27/1) lalu. Selain Ferdinand, Wes Brown yang absen lama karena operasi engkel sejak awal November 2008, juga sudah main lawan West Bromwich. Kembalinya dua defender timnas Inggris itu sekaligus menandai kekhawatiran pelatih United Sir Alex Ferguson, yang sempat kehilangan 12 pemain pilarnya pekan lalu. Sebab, saat menjamu Everton, ada dua pilar United yang kemungkinan besar menyusul bisa dimainkan. Yakni bek kiri Patrice Evra yang pulih dari cedera engkel dan winger Nani dari kendala pangkal paha. Dengan kembalinya Evra dan Nani, berarti daftar pemain cedera United tinggal diisi Wayne Rooney dan Rafael da Silva (keduanya hamstring), Jonny Evans (engkel), Anderson (lutut), Fabio da Silva (betis) serta Danny Welbeck (engkel). Satu pemain lagi, Owen Hargreaves, sudah divonis absen hingga akhir musim karena menjalani operasi di kedua lututnya. Sementara itu, dari kubu tamu, lawatan di Old Trafford sepertinya hanya menjadi sasaran antara Everton. Sebab, The Toffees - sebutan Everton - cenderung lebih fokus menghadapi laga ulang (replay) menjamu Liverpool di putaran keempat Piala FA Rabu nanti (4/2). EVERTON Hal itu diakui langsung pelatih Everton David Moyes.

Curi Untung MAN UNITED v

Dengan menghadapi tiga klub big four dalam sepekan, Moyes realistis jika timnya sulit bisa meraih hasil optimal jika tidak mengorbankan salah satu laga. “Kami baru saja bermain habis-habisan lawan Arsenal Rabu lalu (imbang 1-1 pada 28 Januari 2008, Red) dan sudah ditunggu dua tim besar lainnya. Itu bukan jadwal yang ideal bagi kami,� kaya Moyes kepada Daily Telegraph.(dns/jpnn)

 Baca Halaman 15 DUEL Carlos TĂŠvez (kanan) dan pemain Everton, Marouane Fellaini dipertemuan pertama 25 Oktober lalu.

e-mail :



Nicola McLean

Pembalap Terseksi

TOMMY Williams hanyalah pemain klub tak ternama Inggris, Peterbrough United. Prestasinya pun tak menonjol. Yang menonjol adalah dia punya pacar yang seksi luar biasa pada Nicola McLean. Nicola kian melambung namanya setelah ikut dalam acara televisi I’m A Celebrity. Berkat sukses di acara tersebut pula, kini dia mendapat tawaran pekerjaan yang kian banyak. Salah satunya,

 Baca Halaman 15


Tanpa 2 Pemain Asing ELIE Aiboy, siap memberikan kemenangan bagi PSMS.


MEDAN LAGA perdana PSMS Medan melawan PSIS Semarang di putaran kedua Liga Super Indonesia (LSI) yang akan digelar sore ini di Stadion Siliwangi Bandung belum bisa diperkuat dua pemain asing yang baru direkrutnya.


 Baca Halaman 15





Diskorsing Setahun NAPLES NAPOLI sedang berjuang untuk tetap bersaing di papan atas Serie A Liga Italia. Sayang, mereka kehilangan salah seorang pilar utamanya, gelandang Daniele Mannini. Dia dihukum skorsing setahun akibat absen tes doping.  Baca Halaman 15


Jaga Mimpi SORIA REAL Madrid belum menyerah. Tertinggal 12 poin dari FC Barcelona, Los Merengues masih terus berusaha mengejar sambil berharap rival abadinya itu terpeleset. Posisi El Real Madrid untuk mempertahankan gelar memang sangat sulit. Selain gap perolehan poin yang jauh, performa Barca juga san-


gat stabil. “Melihat performa Barca, saat ini mungkin untuk menjuarai Liga  Baca Halaman 15




Edisi 31 Januari 2009

Read more
Read more
Similar to
Popular now
Just for you