Issuu on Google+

KING EDWARD VII SCHOOL MAGAZINE NUMBER 142 2005


Contents From the Headmaster.................................................................................................................................1 Staff..................................................................................................................................................................3 Obituary .........................................................................................................................................................6 Valediction......................................................................................................................................................7 Farewell ........................................................................................................................................................11 Prefects .........................................................................................................................................................19 Merit Honours............................................................................................................................................20 Premier Awards ..........................................................................................................................................21 Summa Cum Laude....................................................................................................................................23 Learners Representative Council ...........................................................................................................27 2004 Matriculation Results ......................................................................................................................28 2005 Prefects Camp ..................................................................................................................................32 Interhouse Phillips Cup.............................................................................................................................35 Memorial Parade ........................................................................................................................................37

English Creative Writing ...................................................................................................................40

Afrikaans Skeppende Werk ..............................................................................................................62

Zulu Creative Writing.........................................................................................................................80

KESFAM.....................................................................................................................................................90

Clubs and Societies Chess.............................................................................................................................................................92 The Choral Society....................................................................................................................................95 Debating and Public Speaking ..................................................................................................................97 Scrabble ..................................................................................................................................................... 101 Dramatic Society..................................................................................................................................... 103 First Aid ..................................................................................................................................................... 112 Pipe Band .................................................................................................................................................. 114


CONTENTS CONTINUED Other Computer Centre and Media Centre ................................................................................................ 116 The Junior City Council ........................................................................................................................ 118 The Annual Matric Farewell.................................................................................................................. 123

Sport Athletics .................................................................................................................................................... 126 Basketball................................................................................................................................................... 134 Cricket....................................................................................................................................................... 144 Cross Country......................................................................................................................................... 161 Golf............................................................................................................................................................. 163 Hockey....................................................................................................................................................... 167 Rowing ....................................................................................................................................................... 178 Rugby.......................................................................................................................................................... 183 Squash ........................................................................................................................................................ 203 Soccer ........................................................................................................................................................ 212 Swimming .................................................................................................................................................. 215 Table Tennis............................................................................................................................................... 217 Tennis ......................................................................................................................................................... 218 Waterpolo................................................................................................................................................. 223

Editorial Staff ....................................................................................................................................... 227

Autographs............................................................................................................................................ 228


From the Headmaster

My arrival at King Edward VII School at the beginning of the second term brought me back DSSUR[LPDWHO\WZHQW\ÀYH\HDUVWRZKHQDVD)RUP,ER\,ÀUVWVHWIRRWLQWKH6FKRRO,ZDVÀOOHG ZLWKDPL[WXUHRIDQ[LHW\DQGH[FLWHPHQWDIHHOLQJRIEHLQJRYHUZKHOPHGE\WKHULFKKHULWDJHRID VFKRROZKLFKKDVSOD\HGVXFKDVLJQLÀFDQWUROHLQWKHKLVWRU\RI6RXWK$IULFD,DPVWLOOÀOOHGZLWKD sense of excitement and pride and I am truly honoured to be the eleventh Headmaster of one of the ÀQHVWLQVWLWXWLRQVLQWKHFRXQWU\,WFHUWDLQO\LVDWUXLVP²´WKHPRUHWKLQJVFKDQJHWKHPRUHWKH\ VWD\WKHVDPH¾7KHIDPLOLDUVRXQGVUHVRXQGLQJIURPWKHFODVVURRPVWKHDUUD\RIIDGHGSKRWRJUDSKV along the outside of the Hall and over a thousand boys in their green blazers surrounding the FHQRWDSK UHà HFW WKH XQLTXHQHVV RI .LQJ (GZDUG9,, 6FKRRO  , DP UHPLQGHG RI WKH ZRUGV RI -DQ +RIPH\UDIDPRXVPDVWHUZKRWDXJKWDWWKH6FKRROIRURYHUIRUW\\HDUVZKHQKHVDLG´2QFH\RX KDYHEHHQDW.LQJ(GZDUG\RXQHYHUUHDOO\OHDYHLW¾DQGKHZDVULJKW The Academic focus of the School continues to be an ongoing challenge and one which demands the best from us all. We must rise to the challenge and ensure that standards are upheld and our learners OHDYHWKH6FKRROZHOOSUHSDUHGWRPHHWWKHIXWXUHZLWKFRQÀGHQFH7RDFKLHYHWKLVYLWDOO\LPSRUWDQW JRDOQHZLGHDVPXVWEHHPEUDFHGDQGDVSHFWVRIWKHROGRUGHUPXVWEHUHOLQTXLVKHG 1


7KLV\HDUKDVEHHQDFKDOOHQJLQJRQHIRUVWDIIOHDUQHUVDQGSDUHQWVDOLNH:KLOHWKHSHULRGRIWUDQVLWLRQ LQRXUFRXQWU\DQGLQHGXFDWLRQLQSDUWLFXODULVODUJHO\RYHUZHDUHVWLOOH[SHULHQFLQJFKDQJHVLQWKH ÀHOGRIHGXFDWLRQDQGWKH6FKRROLVYHU\PXFKDSDUWRIWKHVHFKDQJHV7KHVHFKDOOHQJHVPXVWQRW GHWHUXVEXWVKRXOGEHWDNHQXSEROGO\VRWKDWZHFDQOD\WKHIRXQGDWLRQVIRUDQHZHUDLQWKH6FKRRO which will not only match the greatness of the past but surpass it and in turn build a better South Africa for all. We are fortunate to have talented and hardworking educators who are guardians of our standards. Much time and planning has been spent ensuring that the School keeps abreast of the new demands LQHGXFDWLRQVHHVWKHLPSOHPHQWDWLRQRIWKH)(7V\VWHPLQ*UDGHZLWKHPSKDVLVRQWKH DFTXLVLWLRQRIVNLOOVLQWKHYDULRXVGLVFLSOLQHVDQGOHDUQLQJDUHDV,DPFRQÀGHQWWKDWERWKOHDUQHUVDQG educators will grow from and enjoy this experience. Evidence of change is all around us but at the same time many of the great traditions of the School UHPDLQ7KH6FKRROLVEOHVVHGZLWKPDQ\QHZFXOWXUHVZKLFKUHà HFWRXUVRFLHW\DWODUJH$OOWKDW is best of these cultures is being assimilated into the unique culture that is King Edward: a School which has greatly served the sons of this place for generations and has contributed to the well-being RI6RXWK$IULFDLQPDQ\ÀHOGV The ethos of what is best in King Edward VII School has never been stronger. Any visitor to the 6FKRRO RQ D 6DWXUGD\ EH LW ZLQWHU RU VXPPHU FDQ DWWHVW WR WKH KXQGUHGV RI ER\V UHSUHVHQWLQJ WKH´7HGG\%HDUV¾DQGVXSSRUWLQJWKHLU6FKRRO7KH(DVWHU5XJE\DQG+RFNH\)HVWLYDODZHOFRPH DGGLWLRQWRWKH6FKRROFDOHQGDULVDEO\VXSSRUWHGE\EDQGVRIHQWKXVLDVWLFSDUHQWV2OG%R\VOHDUQHUV and educators showing the King Edward family at its best. Recently a number of Old Boys attended a Friday assembly and later in the quad the School War Cry UDQJRXW$WWKDWPRPHQWDOOWKHJHQHUDWLRQVPHOWHGLQWRRQH²WKDWLVZKDW.LQJ(GZDUG9,,6FKRRO LVDOODERXW²SULGHLQEHLQJVRQVRIWKLVSODFHZLWKDOOWKHULFKJLIWVWKDWWKH6FKRROKDVWRRIIHU Mr M C Fennell Headmaster

2


King Edward VII School Staff Headmaster :

M C Fennell BA (Rhodes) HDE

Acting Headmaster :

R J H Hansen BA (Pretoria) TTHD

Deputy Headmasters :

R J H Hansen BA (Pretoria) TTHD R G Erasmus BA, BEd (Wits) HDE

Heads of Department : W Groenewald BA Ed (UP) R T Craig BA (Wits) HED A J Mania BA (SA) HED (Wits) D L Hudson-Lamb PHd (UP) S Y Eales HDE (JCE) C Finlayson Dip Ed (Rhodesia) E Marx BA Ed (UOFS) S D Thorne (HDE) (JCE)

Academics Marketing & Bursaries Cultural Academics Admissions Director of Coaching Sports Director Hostels

Heads of Subject: W Groenewald BA Ed (UP) M Tabor BAFA (Ed)(Wits) / S Pheiffer NDFA (Vaal Triangle Technikon) M de Kock B Ed (Hons) HDE, FDE (RAU) P Ogier HED (Edgewood) E A Scheepers HED (NKP) A L Meyer BA (Natal) R T Craig BA (Wits) HED S Barnes HED (JCE) A J Mania BA (SA) HED (Wits) S Y Eales HDE (JCE) N S Ndlovu Diploma (HTTC) T Motala BCom (Natal) PGCE CSA

Afrikaans Art Biology Computers Design & Technology English Geography Guidance History & HSS Mathematics Zulu Commerce

Teaching Staff : P Acton BA (Wits) H Dip Ed (JCE) J Aires BA (Hons) RAU I Boardman BA (Rhodes) Hons (Unisa) L W L Bragin H A Charlesworth BA (Natal) HDE L Crous BSc (OVS) B Ed (Hons) (RAU) HDE L Daly B Prim Ed (Wits) N A Drury BAFA (Wits) HDE (Wits) A S du Plessis HED (PU) P J du Plooy HDE (Wits / JCE) A T Gallucci H Dip Ed (JCE) A Grant BSc (Rhodes) N Groenewald NHED (RAU) 4


R Hammond BA (Unisa) M Hancock HDE (JCE) R Holmes HDE (Wits) G Jackson BSc (UCT) HED J K Kyte B Prim Ed (Wits) E le Grange BA Hons (Stellenbosch) A Machos BA (UJ) PGCE (UJ) E B Mahlangu B PAED (Zululand) B Ed (RAU) STD (Zululand) N Malinga HDE (JCE) S Marvell BA Ed (Wits) N Mbele HDE (Wits) J Milasinovich BA (RAU) HED (Wits) L Naidoo BSc Hons (Dbn â&#x20AC;&#x201C; Westville) J Newman BA Ed (Wits) S Parseramen HDE (TCE) J Passmoor BA (Wits) A Schumyn BA (Potch) THED (Potch) J Spain BA Hons (Wits) A Stevens BA (UP) NHD (Pta Tech) M Thorne HDE (JCE) A van Staden BA (Ed) Hons (UP) P Vanko M van Staden BA (UP) HOD (UP) BEd (UP) Y I Wadee BSc (UCT) W J H Wilson BA Hons (Wits) TTHD Administrative Staff : 0HVGDPHV(&DUVWHQV3GH-RQJ((YDQV$,UHODQG3.QLJKW00F&DUWK\'5HLQHNH<5REHUWV and K Wessels. Bursar / Business Manager Mr D Fowlds / Mr I Sim Estate Manager : Mr F Matthee Governing Body : Chairman : Vice-Chairman : Members :

Staff Representatives :

K Whyte I Catt W Davidow J Makgato H Pedro M Roberts I Sim M Thompson

R G Erasmus Mrs A L Meyer R H Hansen 5

Learner Representatives : S Keeling (President) S Gumede C MacRoberts Non-Teaching Staff : Mr D Fowlds Co-opted Members : Mrs N Bucibo J Faber A Vilas Mothers' Committee : Mrs M Smit


Obituary

Tremayne Hope It is with sadness that we remember Tremayne Hope who died tragically at the end of his matric year in 2005. A young man who had his life ahead of him; a bright future with many possibilities. Those who knew him remember Tremayne as the vital person he was with a zest for life. He was pasVLRQDWHDERXWWKH´5HGVÂľSOD\LQJIRUWKH6FKRROLQWKHFRYHWHG5HG¡VMHUVH\ZDVRQHRIWKHKLJKOLJKWV of his school career. +HZRXOGKDYHGRQHDQ\WKLQJIRUKLVIULHQGVDQGWHDPPDWHV2QWKHĂ&#x20AC;HOGKHVKRZHGWHQDFLW\DQG SOD\HGZLWKÂśKHDUW¡:KLOVWPLVFKLHYRXV7UHPD\QHNQHZDQGUHVSHFWHGWKHERXQGDULHV0DQ\WLPHV his even temperament and sense of humour would save the day. Those who were close to him will say that they were privileged to have been his friend. There is PXFKZHZLOOPLVVDERXW7UHPD\QHKLVZDUPWKIULHQGO\VPLOHDQGNLQGKHDUW+HZLOOUHPDLQZLWKXV in heart and mind and will not be forgotten. Mrs Sue Barnes

6


Valediction 2005 Mr Fennell, Ladies & Gentlemen, Matriculants. "There is a destiny that makes us brothers, none goes his way alone. All that we send into the lives of others comes back into our own." (DUOLHUWKLV\HDU,ZURWHDVSHHFKH[SORULQJWKHFRQFHSWRIPRPHQWVLQWLPH²LPDJHVRI\RXWKIUR]HQ in the past. I was inspired by the multitude of photographs around this school. These photographs GHSLFWER\VPXFKRXURZQDJHEXWGDWHEDFNWRDWLPHIRUHLJQWRXV/RRNDURXQG\RXQRZDWWKRVH SKRWRJUDSKV²PRVWZHUHWDNHQDWDWLPHZKHQRXUJUDQGSDUHQWVZHUHQRWHYHQDURXQGOHWDORQH RXUSDUHQWV<HWWKHUHLVVRPHWKLQJLQWULJXLQJDERXWWKHVHLPDJHV²WRPHLWLVWKHHWHUQDO\RXWKWKH RSWLPLVPWKHFRQILGHQFHDQGHYHQWKHQDLYHW\UHIOHFWHGLQWKHIDFHVRIWKRVHER\V The fact is that those boys are not so very different from us. They too stood on the brink of the rest RIWKHLUOLYHVWKH\ZHUHDERXWWRVHWRIILQWRWKHELJEDGZRUOGMXVWDVZHDUHQRZ0RVWRIWKHP DUHGHDGQRZEXWDVPDOOSDUWRIWKHPUHPDLQVLPPRUWDOIRUDVORQJDVER\VSDVVWKURXJKWKLVKDOO WKH\FRQWLQXHWRJD]HSURXGO\RXWZDUGV$QGWKLVEURXJKWPHWRWKHTXHVWLRQ²ZKHQZHOHDYHKHUH will we be similarly immortal? Will a part of us remain etched upon the soul of this school when we DUHORQJJRQH"$QGPRVWLPSRUWDQWO\FDQZHILQDOO\JLYHDQDQVZHUWRWKHTXHVWLRQWKDWLVSRVHGWR HYHU\.LQJ(GZDUGER\²DUHZHDV6RQVRIWKLV3ODFH:RUWK\RIRXU'HDG" 7KHVKRUWDQVZHUIULHQGVLV\HV:HWKH0DWULF*URXSRIKDYHIRUJHGDSODFHIRURXUVHOYHV LQ WKH KLVWRU\ RI WKLV VFKRRO:H KDYH DFKLHYHG JUHDW WKLQJV OHDUQHG D JUHDW GHDO DQG KDYH ZRUQ ZLWKSULGHWKHFUHVWRIWKLV6FKRRO:HKDYHOHDUQWWRZLQZLWKFRPSDVVLRQWRORVHZLWKKXPLOLW\ DQGWRKROGRXUKHDGVKLJKUHJDUGOHVVRIZKDWHYHUFRPHVRXUZD\0RVWLPSRUWDQWO\ZHKDYHEHHQ SUHSDUHGIRUOLIH·VFKDOOHQJHV2XUWLPHKHUHPD\EHDWDQHQGEXWZHDUHZHOOHTXLSSHGWRKDQGOH whatever life throws at us. ,WLVKDUGWREHOLHYHWKLVWLPHLVXSRQXV²ZHKDYHVZHDWHGWKURXJKH[DPVDQGVKDOOFRQWLQXHWRGR so for the next 3 weeks. It seems almost anti-climactic to end our senior school careers this way; IRU\HDUVZHKDYHHQJDJHGLQDOODVSHFWVRIWKHVFKRROKDYHGHYRWHGRXUOLYHVWRLWDQGKDYHEHHQ FRQVXPHGE\WKHZHDOWKRIDFWLYLWLHVRQRIIHU$QGQRZKHUHZHDUHULJKWDWWKHWRSDQGLWUHDOO\ GRHVIHHOVWUDQJH:HDUHDOPRVWUHGXQGDQWUHOHJDWHGWRWKHSDVWPHUHO\IORDWLQJLQDQGRXWWRZULWH H[DPV,FRXOGQRWKDYHLPDJLQHGKRZPXFK,PLVVWKHFODVVURRPEDQWHUWKHXQLTXHDWPRVSKHUH that pervades everything here. 0DQ\H[DPSOHVRIWKDWEDQWHUVSULQJWRPLQGEXWRQHLQSDUWLFXODUFDPHEDFNWRPHUHFHQWO\0DQ\RI XVZLOOUHFDOOWKLVPHPRUDEOH(QJOLVKFODVVLQ*UDGHZKHUHLQWKHPLGVWRIDQDOPLJKW\UHSULPDQG IURP0LVV6NXGRZLW]IRUVRPHRURWKHUPLVGHPHDQRXU6LPRQ&KLWWHQGHQXVHGWKDWLQIDPRXV.LQJ (GZDUGVSRQWDQHLW\WRWXUQWKHVLWXDWLRQRQLWVKHDG$VKHU\HOOLQJUHDFKHGDSRZHUIXOFUHVFHQGR 6LPRQFDOPO\WXUQHGDURXQGDQGDVNHGKHUWRPDUU\KLP-XVWOLNHWKDW1HHGOHVVWRVD\VKHWXUQHG a deep shade of crimson and simply fell silent as the class broke into peals of laughter. What a way to get out of trouble! ,W·VEHHQVRPHMRXUQH\WKRXJK²D.LQJ(GZDUG2G\VVH\:HZHUHWKURZQLQDWWKHGHHSHQGLQ EOLVVIXOO\XQDZDUHRIWKHULJRXUVWKDWOD\DKHDG,I,FRXOGXVHRQHZRUGWRVXPXSWKRVHILUVW IHZZHHNVLWZRXOGEHIHDU²UDZLQVWLQFWLYHIHDURIWKHJRGOLNHSUHIHFWVWKHPHQDFLQJHQIRUFHUV 7


of King Edward law who were charged with bringing us up to speed with how things work around here. Who can forget the morbid anticipation of the new-boys' test (fail on pain of death) or the ILUVWZDUFU\SUDFWLFHZKHUHZHZHUHHQWKUDOOHGE\WKHSHUIHFWXQLVRQRIER\VFKDQWLQJDQG clapping as one? I clearly remember being part of a group that was ruthlessly exploited for the entertainment of the 0DWULFVDWDURXQGWKLVWLPHRI\HDUZKHQZHZHUHPDGHWRIRUPD&KULVWPDVFKRUXVDQGVLQJFDUROV PXFKWRWKHDPXVHPHQWRIWKHUHVWRIWKH6FKRRO7KDWZDVQRWDOOKRZHYHUZHZHUHWKHQPDGHWR stand in the newly-installed pots on the tarmac and "grow like trees" whilst being bombarded with the occasional water-balloon to encourage our "growth". 7KH IHDU GLGQ·W ODVW ORQJ WKRXJK DQG EHIRUH ORQJ ZH ZHUH KRRNHG RQ WKH .LQJ (GZDUG GUXJ WKRURXJKO\DEVRUEHGE\WKHIDVFLQDWLQJFHQWXU\ROGWUDGLWLRQVWKDWFKDUDFWHULVHWKLVSODFH,·OOQHYHU IRUJHWP\ILUVWWULSWKURXJKWKH6FKRROPXVHXPVHHLQJZRQGHUIXODUWLIDFWVIURPWKHSDVWWKDWPDQ\ similar museums would kill to have. Most profound for me was gazing into the misty eyes of the LPPHQVH 6FKRRO7HGG\ %HDU WKDW SULRU WR KLV UHWLUHPHQW KDG VDW LQ HYHU\ SKRWRJUDSK VLQFH WKH 1920s and realizing that we had joined the legion of teddy bears. :HZHUHLPPHQVHO\SULYLOHJHGWRKDYHEHHQSUHVHQWGXULQJWKH&HQWHQDU\\HDUDQGZHUHDEOHWR HQFRXQWHUILUVWKDQGWKHPDQ\IDPRXVROGER\VZKRPZHKDGKHDUGVRPXFKDERXW1RWRQO\WKDW but we enjoyed a bumper year with enough festivals and functions to make our eyes water. And to WRSLWDOOZHJRWWRVDYRXUWKHLQFRPSDUDEOHIHHOLQJRIDYLFWRU\RYHU6W-RKQV DWKRPH 6RZKDWZHUHWKHRXWVWDQGLQJPRPHQWVRIRXUWLPH"7KHUHDUHVRPDQ\WRUHFDOOEXWKHUHDUHD few that stand out for me. Most memorable in the classroom was Jarrod Grantham spontaneously OHDGLQJ WKH FODVV LQ D UHQGLWLRQ RI¶%XWWHUFXS· WR 0LVV 6WHZDUW RQ D UHOLHI SHULRG PXFK WR KHU EHPXVHPHQW7KHQ WKHUH ZHUH WKH LOOLFLW¶VFLHQFH H[SHULPHQWV· ZKLFK ZKLOVW WRWDOO\ LUUHVSRQVLEOH ZHUHJUHDWIXQDVWKRVHLQYROYHGVRXJKWWKHPRVWQR[LRXVFRFNWDLORIFKHPLFDOVWRPDNHWKHPRVW spectacular bang. 3RRUROG(GGLH'X3UHH]QHYHUVHHPHGWRJHWDQ\UHOLHIIRU,FDQYLYLGO\SLFWXUHKLPDV,·PVXUH PDQ\RIXVFDQLQPDQ\DQDZNZDUGVLWXDWLRQ(GGLHKDGDWDOHQWIRUEHLQJEXQGOHGLQWRVPDOOVSDFHV E\KLVIULHQGVDQG,·OOQHYHUIRUJHWWKHVLJKWRIKLPVWXIIHGLQWRDQDUURZORFNHULQWKHWHFKQRORJ\ FHQWUHZKLOHWKHFODVVQRQFKDODQWO\DZDLWHGWKHUHWXUQRIWKHWHDFKHU8QIRUWXQDWHO\IRU(GGLHWKLV trend continued and just last year he was jumped and shut up in the gas extraction cell. This was QRWWKHKHLJKWRIKLVWRUPHQWIRUWRDFFRPSDQ\KLVKHOSOHVVH[SUHVVLRQDQRWLFHZDVSRVWHGRQKLV ¶FDJH·ZKLFKUHDG¶'RQRWIHHGWKHDQLPDO· $OWKRXJKLWPD\QRWVRXQGOLNHLWZHGLGOHDUQDORWLQFODVVDQGDUHQRZXVLQJZKDWZHOHDUQWLQ WKLV ILQDO¶ELJ SXVK· ,W·V FHUWDLQO\ KDUG WR EHOLHYH WKDW MXVW ZHHNV IURP QRZ ZH ZLOO QR ORQJHU EH VFKRROER\VEXWZHOOJURRPHGDQGPDWXUH\RXQJPHQZKRDUHOHDYLQJWRWDNHRQWKHZRUOG²DW OHDVW WKDW·V WKH LGHD 6HULRXVO\ WKRXJK LW LV GLIILFXOW WR WKLQN WKDW DIWHU WKLV , PD\ QHYHU VHH VRPH RI\RXDJDLQ:H·YHVSHQW\HDUVWRJHWKHUWKURXJKWKHURXJKDQGWKHVPRRWKGD\LQGD\RXWDQG QRZLW·VDEUXSWO\HQGLQJ+RZHYHUWKHHQGRIRQHURDGLVWKHEHJLQQLQJRIWKHQH[WDQG,·GOLNHWR WKLQNWKDWLQWKH\HDUVWRFRPHZH·OOVWLOOVHHRQHDQRWKHUDW6FKRROIXQFWLRQVDQGSHUKDSVDV2OG (GZDUGLDQV7KLVFUHVWLVDIWHUDOODEDGJHIRUOLIHDQGWKRXJKZHPD\EHJRLQJRXUVHSDUDWHZD\VLW continues to bind us together. ,WLVLPSRUWDQWWRDFFRUGWKHQHFHVVDU\FUHGLWWRWKHVWDIIZKRKDYHJXLGHGPHQWRUHGDQGWROHUDWHG XV WKHVH ODVW  \HDUV +RZHYHU GLIILFXOW ZH KDYH PDGH \RXU OLYHV KRZHYHU PDQ\ WLPHV ZH KDYH 8


pushed you to the brink of insanity and however many fanciful excuses we have conjured up for KRPHZRUN QRW GRQH ZH UHDOO\ GR DSSUHFLDWH \RXU LPPHQVH FRQWULEXWLRQ WR RXU OLYHV7R WKH FRDFKLQJPDLQWHQDQFHDQGDGPLQLVWUDWLYHVWDIIWKDQN\RXIRUHYHU\WKLQJ $QGVRZHJRIRUWKDQGWKRXJKZHOHDYHZLWKKHDY\KHDUWVZHFKHULVKWKHPHPRULHVWKLV6FKRROKDV JLYHQXV:HDFKLHYHGDOOZHZDQWHG²DOOWKDWUHPDLQVLVWRFRQTXHUWKHVHILQDOWHVWVRIRXUDELOLW\ ,QFRQFOXVLRQ,VD\WRHYHU\ER\LQWKLVKDOO²WKDQN\RXIRUWKHPHPRULHV\RXKDYHJLYHQPH7KDQN \RXIRUWKHSULGHWKHJORU\DQGWKHKRQRXURIVKDULQJP\IRUPDWLYH\HDUVZLWK\RX7KDQN\RXIRU PDNLQJWKLV6FKRROZKDWLWLVDQGIRUFRQWLQXLQJWRXSKROGWKHOHJDF\RI.LQJ(GZDUG7KDQN\RXIRU being the men you are. $IWHU  \HDUV RI EHLQJ LQ WKH FRPSDQ\ RI WKH EHVW IULHQGV RQH FRXOG DVN IRU , FDQ VD\ ZLWK DOO certainty: "Sons of this Place Let this of you be said That you who live Are worthy of your dead." C Mac Roberts Head Boy 2005

9


Farewell Farewell to David Fowlds David Fowlds was enrolled at the Preparatory School in 1939 and Matriculated from the High School in 1949. At King Edward he swam and played rugby. He was a fantastic swimmer. He won the South African Junior Backstroke Championship in Salisbury in 1948 and he was Vice Captain of the Swimming team. 0U+HQQLQJWKH*HRJUDSK\WHDFKHUDWWKDWWLPHRQFHWROG0U)RZOGVWRKDQJRYHUWKHEDOFRQ\WR let the water run out of his ears". After leaving School Mr Fowlds swam and played waterpolo for Old Eds and Transvaal. Mr Fowlds played for the First XV for two years and was captain of the First team in 1949. He received Colours for Rugby and Swimming and was a School Prefect. After leaving School he played rugby for the Old Eds First Team for 10 years and Salisbury Sports &OXEIRUWZR\HDUV+HSOD\HGLQWKH7UDQVYDDOWULDOVLQ7UDQVYDDO6XE8QLRQ4XDJJD5XJE\&OXE and Moshanaland Rhodesia. After retiring from active rugby he refereed in the Eastern Transvaal for \HDUV+HLVFXUUHQWO\VHFUHWDU\RIWKH4XDJJD5XJE\&OXEDQG6RXWK$IULFDQ%DUEDULDQV Mr Fowlds studied through correspondence and became a Cost and Works Accountant. +H ZDV )LQDQFLDO 'LUHFWRU RI 6LJPD 0RWRU &RUSRUDWLRQ WKHQ EHFDPH 0DQDJLQJ 'LUHFWRU RI $VVRFLDWHG(QJLQHHULQJDPRWRUVSDUHVFRPSDQ\DQGWKHQ0DQDJLQJ'LUHFWRURI&URZQ)RRGVD subsidiary of Murray and Roberts. Mr Fowlds joined King Edward VII School as the Bursar in 1992 when he retired from Crown Foods. He served King Edward well in this capacity until his retirement in September 2005. Mr Fowlds has many strings to his bow and he even entertained some Grade 8 classes with episodes from his own history as testimony of King Edward's long-standing traditions and ethos. We wish Mr Fowlds well and hope he enjoys some well-earned rest with his family. Mrs A Mania Since David Fowldsâ&#x20AC;&#x2122; retirement in 2005 the School was saddened by the news of his death on 26 July 2006. The following is a tribute from Mr Tutty Faber and serves as the In Memoriam from the School. %RUQ1RYHPEHU-RKDQQHVEXUJ²'LHG-XO\-RKDQQHVEXUJ Former Bursar of King Edward VII School and Bursar of King Edward VII Preparatory School. 11


First came to the King Edward Schools in 1938 as a Grade 1 pupil. He matriculated at the School in 1949 having been a Prefect and Captain of the First XV and backstroke champion. A Coloursman in both sports. After leaving school he entered commerce that saw him qualify for the Chartered Institute of 6HFUHWDULHVDQGZLWKDGLSORPDLQFRVWDFFRXQWDQF\+HZDVHPSOR\HGE\$IULFDQ([SORVLYHV3KLOOLSV 6$$VVRFLDWHG(QJLQHHUVDQG0XUUD\DQG5REHUWV'XULQJKLVWLPHLQFRPPHUFHKHZDVVWDWLRQHG LQ6DOLVEXU\6RXWKHUQ5KRGHVLDDQG6SULQJVDVZHOODV-RKDQQHVEXUJ+HURVHWRWKHSRVLWLRQRI&KLHI 2IILFHURI&URZQ6SLFHVDVXEVLGLDU\RI0XUUD\DQG5REHUWV:KLOHKLVGDXJKWHUVZHUHDW%U\DQVWRQ High School he served on the Governing Body of that school. He came to work at the King Edward VII Schools in 1992 when the Schools attained Model C status that required rigorous financial management. In spite of his lack of experience in this type of work KHDSSOLHGKLVFRQVLGHUDEOHWDOHQWVWRWKHWDVNDQGDVVLVWHGE\KLVH[WUHPHO\ZLGHFLUFOHRIIULHQGV DQG DVVRFLDWHV KH VHW XS V\VWHPV DQGFRQWUROVWKDWKDYHVWRRGWKHWHVWRIWLPH'HVSLWHDOUHDG\ VXIIHULQJIURPWKHFDQFHUWKDWZDVWRFODLPKLVOLIHKHZDVLPPHGLDWHO\SRSXODUZLWKWKH6WDIIDQG *RYHUQRUVEHFDXVHRIKLVHYHQWHPSHUHGJHQLDODQGZDUPPDQQHUDQGKLVZLOOLQJQHVVWRKHOSDQ\ of his colleagues in any way that he could. He earned the respect and affection of all who worked with him. It was no surprise when the non-educator staff elected him to represent them on the Governing Body. He stepped down as the King Edward VII School Bursar at the end of the third term EXWZDVDOZD\VDYDLODEOHWRDVVLVWKLVVXFFHVVRUDVZDVKLVPDQQHU7KHPRVWUHPDUNDEOHDVSHFW RIWKLVSKDVHRIKLVOLIHLVWKDWKHQHYHUFRPSODLQHGDERXWKLVORWDQGZDVDOZD\VRSWLPLVWLF 7KURXJKRXW KLV OLIH KH SDUWLFLSDWHG LQ VSRUW DQG ZDV SDVVLRQDWH DERXW LW EXW DERYH DOO KH ZDV D VSRUWVPDQ%HVLGHVKLVREYLRXVSURILFLHQF\DWUXJE\ZKLFKH[WHQGHGWREHLQJDOHDJXHUHIHUHHDIWHU KLVSOD\LQJGD\VZHUHRYHUKHZDVDVZLPPHUZKRJDLQHG3URYLQFLDO&RORXUVDQGDILUVWOHDJXHZDWHU polo player. He served a term on the Executive Committee at the Old Edwardian Society. He was DNHHQDQGNQRZOHGJHDEOHVSHFWDWRUDQGKHVHUYHGWKH4XDJJD5XJE\&OXEDVDSOD\HUVHFUHWDU\ and treasurer. +HLVVXUYLYHGE\KLVZLIH&DUROGDXJKWHUV-DQHWDQG0DUJDUHWDQG¶VRQ·&UDLJ(GZDUGVDQGRWKHU grandchildren. Mr Tutty Faber

12


Farewell to Mr Hugh Wilson Much has been written about Hugh Wilson and his contribution to King Edward in recent years. The following tribute is the speech made by Michael Pappas at the Annual Dramatic Society Dinner in 2005. Mr Hugh Wilson: A man who stood up for what he believed in and refused to go with the flow. $PDQZKRKDVVXFKDSUHVHQFHWKHQHZ*UDGH VWKRXJKWKHKDGWREHD+HDGPDVWHU $PDQZLWKVXFKSRZHU\HWIXOORIKXPEOHJUDFH $PDQZKRFRPPDQGHGUHVSHFWEXWQRWRQFHGHPDQGHGLW The icon of King Edward VII School. A man who has stood the test of time. How do we put a value to such an asset? How is it possible for such a great man to exist? All I want to know is: How do you do it? 0U:LOVRQ\RXKDYHLQVSLUHGPH«LQDOOIDFHWVRIOLIH²ZLWK, PVXUHPDQ\RWKHUV<RXDUHWKH XOWLPDWH.LQJ(GZDUGJHQWOHPDQ<RXH[FHHGDOOH[SHFWDWLRQVWKULOOWLPHDQGWLPHDJDLQ<RXDUHVR XQSUHGLFWDEOHVSRQWDQHRXVDQGSXOOLWRIIZLWKVXFKFKDULVPDWLFIODLU:LWK0U:LOVRQHYHU\WKLQJLV perfect; he is by far the most meticulous man I have ever met. You have taught me a lot; how to say "wimen' and not women. And of course ALL I really need to know about women. What is it like to walk in your shoes? Even with your multi-coloured socks! 7KLVLVWKHPDQZKRVLQJOHKDQGLO\LQWURGXFHG+RFNH\WKH&XOWXUDO7LHDQG6XPPD&XP/DXGHMXVW WRQDPHDIHZ$QGWKHXQIRUJHWWDEOH7DQGHP7KHDWUHDQGWKH'UDPDWLFV6RFLHW\'UDPDLVFOHDUO\ \RXUSDVVLRQDQGDOWKRXJK\RXPD\EHOHDYLQJWKH6FKRROZHDUHVRJUDWHIXO\RXDUHQRWOHDYLQJWKH Dramatics Society. <RXDUHWKHEDFNERQHRIWKLVVRFLHW\ZLWKRXW\RX,GRQRWHYHQZDQWWRLPDJLQHZKDWZLOOKDSSHQ 2XUJUDWLWXGHUHVSHFWDQGDGPLUDWLRQIRU\RXLVODUJHUWKDQ\RXUFDUHHUDWWKLV6FKRRO ZKLFKLV relatively long). We will never forget you. 0D\*RGEOHVV\RXDQGXVZLWKDQRWKHU\HDUVLQWKH'UDPDWLFV6RFLHW\ Mr Wilson Mr Chips 0D\\RXUOHJHQGDU\OHJDF\DQGPHPRUDEOHPRPHQWVOLYHRQ« Michael Pappas

13


Farewell to Ms Meredith Tabor Meredith Tabor joined the Art Department in January 1997 and was appointed Subject Head of Art PRQWKVODWHU²ZKLFKSRVLWLRQVKHKHOGXQWLO-XQH'XULQJWKDWWLPHVKHZDVUHVSRQVLEOHIRU FRRUGLQDWLQJWKH$QQXDO$UW([KLELWLRQLQFOXGLQJWKH&HQWHQDU\$UW([KLELWLRQZKLFKVDZWKLVHYHQW move from the traditional venue in the Gymnasium to the Library where it is still held today. 0HUHGLWKKDVEHHQLQYROYHGLQPDQ\DVSHFWVRIWKHVFKRROWKH3KRWRJUDSKLF6RFLHW\WKHPDJD]LQH where her assistance and good humour was invaluable to the Editor. She assisted with the catering at the Rugby after functions and also occasionally helped out with the announcing at Athletics. She was involved in Tennis this year. 0HUHGLWKZDVDSSRLQWHG*UDGH*UDGH7XWRUWZR\HDUVDJRZKHUHKHUSDWLHQFHFDUHDQGJXLGDQFH was of great value to the learners and their parents. Under her guidance the Art Department has grown and there has been a steady improvement in the DFDGHPLFDFKLHYHPHQWVRIWKHVHQLRUDUWOHDUQHUV²ZLWKHDFK\HDURIWKHVHQLRUDUWOHDUQHUV JDLQLQJGLVWLQFWLRQVIRUWKH6HQLRU&HUWLILFDWH([DPLQDWLRQV²LQWKH.LQJ(GZDUG9,,6FKRRO Art Department came first in Gauteng. 0HUHGLWK VH[SHUWLVHKXPRXUDQGZLOOLQJQHVVWRDVVLVWZLOOEHVRUHO\PLVVHGE\WKH6FKRRODQGWKH $UW'HSDUWPHQW².LQJ(GZDUG VORVVLV*UDQWOH\ VJDLQ:HZLVKKHUVXFFHVVIRUWKHIXWXUH Mrs A Meyer

14


Farewell to Mrs Janet Milasinovich Janet Milasinovich has worked at King Edward for eight years and in that time she has made a valuable contribution to the School and to the English Department. Janet has been the Subject Co-ordinator for Grade 8 and 9 since 2003 and in that time she RYHUKDXOHG WKH VFKHPHV RI ZRUN DQG ZDV UHVSRQVLEOH IRU XSGDWLQJ DQG PDNLQJ WKH OHDUQHU¡V UHVRXUFHVPRUHLQWHUHVWLQJYDULHGDQGG\QDPLF6KHKDVDOVRRUJDQLVHGWKH(QJOLVK2O\PSLDGHYHU\ year since 2000 giving the King Edward learners the opportunity to pit their skills against other schools in the country. Janet will also be remembered for her indispensable input into the Cultural side of the school. Janet has been the Educator in Charge of Public Speaking and Debating since 2000 and her dedicated involvement has meant that we have continued our strong reputation as a skilled and formidable team. ,Q DGGLWLRQ WR KHU FRQWULEXWLRQ WR WKH (QJOLVK 'HSDUWPHQW -DQHW ZDV DOVR YHU\ LQYROYHG LQ RWKHU aspects of the School; she was the Grade11 Grade Tutor in 2001 and then went on to become the *UDGH*UDGH7XWRULQDUHVSRQVLELOLW\ZKLFKVKHFDUULHGRXWXQWLOKHUOHDYLQJWKLV\HDU She has also contributed to the School's sporting extra-curricular activities by managing an age group for the Swimming Team and coaching hockey to the U16 age group. Janet will be missed by both her colleagues and the learners and we wish her well in her new venture DW6W0DU\¡V6FKRRO Miss S Marvell

Farewell to Mrs Greta du Plessis This year we bade farewell to Mrs Greta du Plessis. Mrs du Plessis started her teaching career in the Afrikaans Department at King Edward VII School in 1981. At the end of 1982 she left to become Head of the Afrikaans Department at John Orr Technical High School. In 1996 she left John Orr and Johannesburg for the fairer Cape and in 1999 took up an Afrikaans post at Camps Bay High. On KHUUHWXUQWR*DXWHQJLQVKHVHWWOHGLQ3UHWRULDDQGUHWXUQHGRQFHDJDLQWR.LQJ(GZDUG9,, 6FKRRODQGWKH$IULNDDQV'HSDUWPHQWZKHUHVKHUHPDLQHGXQWLODQRSSRUWXQLW\FORVHUWRKRPHDW 3UHWRULD%R\V +LJK6FKRROSUHVHQWHGLWVHOILQ$SULO %HLWLQWKHFODVVURRPRUH[WUDPXUDOO\0UVGX3OHVVLVZDVDOZD\VHQWKXVLDVWLFDQGJDYHRIKHUEHVW 6KHZDVLQYROYHGLQ7HQQLV6ZLPPLQJ6TXDVKDQGWKH&RPSXWHU&HQWUH :H ZLVK KHU WKH EHVW IRU KHU IXWXUH DQG VKH ZLOO EH VRUHO\ PLVVHG HVSHFLDOO\ LQ WKH$IULNDDQV Department. Mrs E le Grange 15


Farewell to Miss Leanne Daly Leanne Daly started her teaching career at the Harvest Christian School. She joined King Edward during 2004 and worked in the Geography and HSS departments. She quickly established herself as a willing contributor to both academic and sports development. Her dedication to Tennis is particularly noteworthy. Leanne was always ready to help and her lovely smile and chatter brightened many people's day. Leanne left King Edward in August to take up a teaching contract in the United Arab Emirates. We wish her well in her new position. Mrs A Mania

Farewell to Mr Reg Hammond Reg Hammond started teaching at King Edward VII School in January 2004. During his first year he taught Afrikaans and was actively involved in extramural activities. He coached U15B cricket and had great success with the 3rd and 4th rugby teams. In his second year he moved into the Physical Education Department and was instrumental in improving the physical conditioning of not only the boys in general but specifically the rugby players. Due mainly to his enthusiasm he was given the responsibility as First Team Rugby coach for 2005 and set about the task as a man possessed. Pre-season training became the norm and the consequent results have been proof of hard work and dedication. Reg was also instrumental in initiating the Argentinean Rugby Tour that was a huge success. 'XULQJ5HJZDVDOVRLQFKDUJHRIWKH)LUVW7HDP*ROIWKDWKDGDJUHDWVHDVRQHQGLQJVHFRQG in the golf league and winning the Madalas Inter College Golf Challenge. Unfortunately his talents have been spotted by other schools and Reg could not refuse an offer from Jeppe High School for Boys. His positive input and great people skills as far as the boys are FRQFHUQHGZLOOVXUHO\EHPLVVHGEXWZHZLVKKLPZHOOIRUWKHIXWXUH Mr E Marx

16


Farewell to Mrs Anne Ireland $QQH ZRUNHG LQ WKH DGPLQLVWUDWLRQ VHFWLRQ RI WKLV 6FKRRO IURP  WR  ² ILUVW LQ WKH PDLQ RIILFH GRLQJ ZDJHV FUHGLWRUV DGPLVVLRQV DQG LQ  VKH ZDV WUDQVIHUUHG WR DGPLVVLRQV IXOO WLPH when she moved to Room 18. She retired from the School in 2001. Anne returned in 2003 for one month to help with the beginning of the year forms. Our new bookkeeper left unexpectedly and thankfully Anne was able to stay on until her retirement in September 2005. We wish her well for the future and know that she will enjoy taking care of her grandchildren ²0DUNDQG7D\O\Q Mrs P Knight

Farewell to Miss N Malinga 0LVV0DOLQJDMRLQHG.LQJ(GZDUG9,,6FKRRO¡VLVL=XOX'HSDUWPHQWLQ7KLVZDVKHUILUVWWHDFKLQJ post after graduating at college. Not only has she been an effective and enthusiastic educator but she has been a mother-like figure to the boys especially those under the SSP. Her unceasing sympathy and patience with them touched some of us too. 6KHLQWURGXFHGLVL=XOXUKHWRULFDQGRXUOHDUQHUVKDYHSDUWLFLSDWHGLQ+LJK6FKRRO3XEOLF6SHDNLQJ DQG'HEDWLQJLQRXU'LVWULFW,WLVWKURXJKKHUKDUGZRUNWKDWRXU6FKRROFDPHILUVWLQWKLV\HDU¡V Public Speaking competition. Miss Malinga has also been the School Choir Mistress assistant for the years 2000 to 2004 and her introduction of ethnic songs was highly appreciated by the choir boys and the School at performances. We wish her success in her new profession. Mrs S Ndlovu

17


Farewell to Mr Jonathan Passmoor Jonathan came in to help out in the History Department in August 2004 when Mr Hansen was acting as Headmaster and in 2005 he very kindly put his studies on hold to assist the English Department. +HKDVEHHQDFWLYHO\LQYROYHGLQFRDFKLQJUXJE\ZDWHUSRORDQGDVVLVWHGZLWKWKHHVWDEOLVKPHQWRI the fledgling Scrabble Club. He adjudicated at the Annual Inter-house Play Festival. +HLVOHDYLQJWRFRQWLQXHZLWKKLVVWXGLHV+LVHQWKXVLDVPZLOOLQJQHVVWRKHOSDQG RIIWKHZDOO VHQVH of humour will be greatly missed. Mrs A Meyer

Farewell to Mrs Michelle Thorne ,WLVZLWKJUHDWVDGQHVVWKDWZHKDYHWRELGIDUHZHOOWRDZHOOORYHGPHPEHURIVWDII0LFKHOOH7KRUQH Michelle started teaching at King Edward VII School in 2004 in the Natural Science Department. She soon showed her prowess in the classroom and this carried onto the sports field. Michelle was involved with Cross Country in 2004 where she was the Educator in Charge and she was a scorer at Athletics meetings. It was her dedicated and enthusiastic involvement with Tennis and as Educator-in-Charge that her finesse and expertise came to the fore. Tennis is now a thriving VSRUWDW.LQJ(GZDUG9,,6FKRROGXHWR0LFKHOOH¡VUHYLYDORIWKLVVSRUWDQG.LQJ(GZDUG9,,6FKRRO now holds its own in the Tennis fraternity and we are now the School to beat. ,QWKHFODVVURRP0LFKHOOHSURYHGWKDWDVHQVHRIKXPRXUJRHVDORQJZD\DQGFDQEULQJPDQ\D lesson to life. She threw herself into her work and was always prepared to go the extra mile for her learners and colleagues. 0LFKHOOH ZDV DOVR LQYROYHG ZLWK .(6)$0 RQ WKH )XQGUDLVLQJ &RPPLWWHH &DWHULQJ &RPPLWWHH ,4066WDII'HYHORSPHQWKHOSHGDWWKH.LQJ(GZDUG9,,6FKRRO5XJE\DQG+RFNH\)HVWLYDODQGZDV involved with Beyers Naude Inter-School relations. Words cannot express our gratitude to this fine young teacher for all her commitment and loyalty WR.LQJ(GZDUG9,,6FKRRO(YHQWKRXJK\RXUVWD\ZDVEULHI\RXPDGH\RXUSUHVHQFHIHOWDQG\RX ZLOOEHVRUHO\PLVVHGE\IULHQGVFROOHDJXHVDQGOHDUQHUV$SDUWRI\RXZLOODOZD\VUHPDLQDW.LQJ Edward VII School as a most valued and treasured member of Staff. Dr Hudson-Lamb

Mr Roddy Adams and Mr Charles Grape left King Edward VII after a short stay to take up positions elsewhere. 18


Prefects

4

12

7

14

1 2

15 3

13

8 9

5 6 10 11 Prefects 2005  :%URFNZD\ 6&KLWWHQGHQ .'HPDUWLQLV 5+XOOH\ 6.DQGXOHOX 6.HHOLQJ  */HHXZ &0DF5REHUWV +HDG%R\  $0D]DLZDQD 'HSXW\+HDG%R\  70RMD  /0ROHWVDQH 61NXQJX '2HORIVH -6PLW %:K\WH 19


Merit Honours 2005 GOLD MEDALS Academic Excellence Awards 7KHUHFLSLHQWVPXVWKDYHEHHQDZDUGHGPHGDOVLQ*UDGHVDQGDVZHOODV$FDGHPLF&RORXUV in Grade 11 and maintained this standard in Grade 12. Gold medals were awarded to the following boys: :%URFNZD\&*RGGDUGDQG5+XOOH\

CULTURAL AWARDS Debating Society Best Speaker of the year: Proxime Accessit: Dramatic Society Best Actor of the year (The Plate): Greatest overall contribution to the success of the Society (The Sword):

C MacRoberts P Thahane

R Aucamp and W Brockway D Koller and C Vounnou

Magazine English: (GLWRU¡V3UL]H Proxime Accesset:

&0DF5REHUWV C Goddard

Afrikaans: Redakteurs Prys:

R Aucamp and C Muller

isiZulu: (GLWRU¡V3UL]H Proxime Accessit:

6.JREH S Ndlovu

Library

No award

SERVICE AWARDS These awards are given for service and loyalty in those areas of the School not recognised elsewhere in the award system: S Kandu-Lelo

First Aid 20


Premier Awards 2005 Desmond Davis and War Memorial Scholarship ,Q 0DUFK  0U + - +RIPH\U &KDLUPDQ RI WKH *RYHUQLQJ %RG\ DQG 0U 'HVPRQG 'DYLV WKH +HDGPDVWHUSURSRVHGWKDWDPHPRULDOEHHUHFWHGWRWKRVH2OG(GZDUGLDQVZKRKDGEHHQNLOOHG on active service during World War One. A magnificent response to the appeal for funds made it SRVVLEOHWRHUHFWWKH:DU0HPRULDOLQWKH6FKRROTXDGUDQJOHDQGOHIWHQRXJKLQWKHIXQGWRILQDQFH D:DU0HPRULDO6FKRODUVKLS$IWHUWKHGHDWKRI'HVPRQG'DYLVLQIXQGVFRQWULEXWHGE\2OG Edwardians in his memory were added to the trust fund of the War Memorial Scholarship. From this fund is made the annual award now known as the Desmond Davis and War Memorial Scholarship. This is the Premier Award of the School. It is worth a total of R120 000-00 over four years. It is awarded to a scholar (i.e. someone with Academic Colours) who has made a significant contribution to many facets of the life of the School. D K Oelofse is the recipient of the 2005 Desmond Davis and War Memorial Scholarship for the following achievements: Academic:

Colours

Cultural: 

Dramatics (House Plays 2004 / 2005) &KHVV´%µ7HDP

Sporting:

Cricket 4th XI Rugby U16C Athletics U16B Squash 2nd Team

Other:

Prefect Head of School House

H J Hofmeyr Scholarships (Proxime Accessit) 0U+-+RIPH\UVHUYHGRQWKH6FKRRO·V*RYHUQLQJ%RG\IURPDQGZDVLWV&KDLUPDQIRUWZHQW\ ILYH VXFFHVVLYH \HDUV  8SRQ KLV GHDWK LQ  PRQH\ ZDV OHIW LQ WUXVW IRU WKH FUHDWLRQ RI D IXQG ZKLFKQRZILQDQFHVWKUHHVFKRODUVKLSVDQGWKUHHEXUVDULHV$IRXUWKEXUVDU\WKH2OG(GZDUGLDQV +-+RIPH\U%XUVDU\LVILQDQFHGSDUWLDOO\IURPWKLVWUXVWDQGSDUWLDOO\E\WKH2OG(GZDUGLDQ6RFLHW\ The three H J Hofmeyr Scholarships are awarded on the same criteria as the Desmond 'DYLV DQG :DU 0HPRULDO 6FKRODUVKLS DOWKRXJK RQH RI WKH UHFLSLHQWV GRHV QRW QHFHVVDULO\ KDYH WR EH D VFKRODU EXW KH PXVW KDYH D )LUVW &ODVV 3DVV  (DFK LV ZRUWK 5  RYHU a period of three years. The recipients of the H J Hofmeyr Scholarships for 2005 are: W J Brockway, R S Hulley and C J MacRoberts. 21


W J Brockway: Academic: 

Colours -XQH([DPLQDWLRQ²)LUVWLQ*UDGH Gold Medal

Cultural:

Dramatic Society Colours Producer 2004 / 2005 Winner House Plays (2005) Highly Commended Debating / Public Speaking

Choral Society Sport: 

Other:

Cricket 2nd XI Hockey 4th XI 2005 5XJE\8%WK;9 Shooting Prefect Final list for JCC

R S Hulley: Academic:

Colours Gold Medal

Cultural:

Dramatics (House Play 2005) Choral Society

Sport:

Rowing First 8 (Colours) Hockey 4th XI Cross Country Athletics

Other:

Prefect Final list for JCC

C J MacRoberts: Academic:

Good First Class Pass

Cultural:

Pipe Band (Colours) Debating (Colours) / Public Speaking (Best Speaker) Young Historian History Olympiad Play Festival (Producer) Highly Commended First Aid

Sport:

Rugby and Cricket in Junior Grades

Other:

Head Prefect Member of Governing Body Junior Mayor of Johannesburg 22


Summa Cum Laude

(Those who have achieved the distinction of holding colours in all three facets of the School's DZDUGV$FDGHPLFV&XOWXUDODQG6SRUW

S D Hansen Academic Debating Swimming

1975 1976 1976

M Stamper Academic Debating Basketball

1987 1987 1988

L van der Walt Academic Dramatics Swimming

1979 1979 1979

N G Elvin Academic Chess Athletics

1988 1989 1989

*C D Hossack Academic Dramatics Athletics Basketball

1980 1980 1980 1980

R Fuller Academic Debating Rugby

1989 1989 1989

Academic Squash Debating

1989 1989 1990

-4XDLO

R J Agar Academic Dramatics Hockey G C Baars Academic Debating Athletics Rugby

1982 1981 1982

1981 1982 1981 1982

*S D Geffen Academic Business Society Waterpolo

1990 1990 1990

I P Kaplan Academic Business Society Table Tennis

1990 1990 1990

D Smollan Academic Business Society Rowing

1991 1990 1991

D Marketos Academic Chess Business Society Basketball Rugby Athletics

1983 1984 1984 1984 1984 1984

B Berridge Academic Debating Basketball Athletics

1984 1984 1985 1985

S Summers Academic Debating Athletics

1991 1991 1991

*C Hallowes Academic Dramatics Hockey

1985 1985 1985

G Dollman Academic Dramatics Cross-Country

1995 1993 1993

23


K A Hofmeyr Academic Debating Waterpolo

1994 1994 1994

T J Carmichael Academic Hockey Dramatics

1996 1997 1997

1994 1994 1994

J R Pietrzak Academic Debating Athletics

1996 1996 1997

P N Laver Academic Debating Rowing

1997 1997 1998

G R Jaspan Academic Athletics Hockey Dramatics

1997 1997 1998 1998

G P Ponte Academic Rugby Athletics Debating

1998 1999 1999 1999

R T Nel Academic Choral Society Rugby G P Basford Academic Cross-Country Debating Dramatics

1995 1995 1996 1996

M G Stewart Academic Swimming Waterpolo Debating Dramatics

1995 1995 1995 1996 1996

R T Wykurz Academic Basketball Athletics Dramatics Business Game

1995 1995 1995 1996 1996

.(=LHUYRJHO Academic Hockey Dramatics R K E Douglas Academic Cross-Country Debating Dramatics W Krzychylkiewicz Academic Basketball Debating

S C Tashe Academic Athletics Debating

1999 1999 1999

1996 1996 1996

J R Ripley-Evans Academic Dramatics Athletics Cricket

2000 1999 1999 2000

1995 1995 1996 1996

S C Cook Academic Cricket Debating

1999 1999 2000

G K Jennings Academic Dramatics Basketball

2000 2000 2001

1996 1997 1997

M C Legg A G Saunders Academic Rowing Debating

Academic Swimming Debating Dramatics

1996 1996 1997 24

2000 2001 2001 2001


M Riba Academic Choral Society Shooting *=6PHUF]DN Academic Dramatics Debating Athletics W Tshabangu Academic Choral Society Athletics Rugby Dramatics

D McHendrie Academic Waterpolo Dramatics Debating

2000 2000 2001 2000 2000 2001 2001

2002 2002 2003 2003

,=KDQJ Academic Choral Society Shooting

2001 2001 2001 2002 2002 *This distinction obtained in his Grade 11 year

25

2002 2002 2003


The Learners Representative Council

7KH5&/LVDYHU\LPSRUWDQWSDUWRIWKH6FKRRODVLWLVWKHOHDUQHUV YRLFHEULQJLQJWRJHWKHULGHDV from all the boys in the School on how to improve the School in all aspects. 7KLV\HDUWKH5&/KDVVHHQWKHLQWURGXFWLRQRIIDQVLQWRWKH6FKRRO+DOOXQGHUWKHJDOOHU\WRSURYLGH more air to all the boys standing there during assemblies. The tuckshop was a popular point of discussion and was talked about at many meetings; even including Mrs Parkin (who runs the tuckshop) in one of the RCL meetings to discuss the variety and quality of foods as well as the prices of the merchandise in the tuckshop. This proved to be helpful and new merchandise is now available from the tuckshop. Mrs Groenewald also joined us at one of our RCL meetings to talk to us about the introduction of WKH1HZ)XUWKHU(GXFDWLRQ7UDLQLQJ )(7 LQVRWKDWDOOWKHER\VFRXOGXQGHUVWDQGZKDWZDV required concerning the new syllabus. The new syllabus will see the introduction of new subjects to WKH6FKRROVXFKDV&RPSXWHU6FLHQFH$FFRXQWLQJDQG,QIRUPDWLRQ7HFKQRORJ\WKXVDOVRIDFLOLWDWLQJ the introduction of new teachers. REPRESENTATIVE COUNCIL OF LEARNERS - (RCL) 2005 Members of the Body President : Vice-President : Secretary :

S Keeling R Aucamp K Moriri

Grade Grade Grade Grade Grade Grade Grade

12 A 12 B 12 C 12 D 12 E 12 F 12 G

R Aucamp K Moriri E S Mazibuko L Motoumisi S Gumede S Keeling K Gotha

Grade Grade Grade Grade Grade Grade Grade

11 A 11 B 11 C 11 D 11 E 11 F 11 G

K Motsomai D Koller V Meyer T Ndaba M Pappas M Groenewald R Maclachlan

Grade Grade Grade Grade

10 A 10 B 10 C 10 D

C van Heerden M Middleton D Rimmer D Conradie

Grade 10 E Grade 10 F Grade 10 G

G Gutu C Morrison G Smith

Grade Grade Grade Grade Grade Grade Grade

9A 9B 9C 9D 9E 9F 9G

D Cross C Ponnusamy B Borsboom A Padi A Costa D Haydock M Smith

Grade Grade Grade Grade Grade Grade Grade

8A 8B 8C 8D 8E 8F 8G

R de Almeida D Whyte C Larbi M Mojo R Chalklen A Leuner S Dlamini

C MacRoberts (ex officio) Members of the Governing Body S Keeling S Gumede C MacRoberts 27


Matriculation Results 2004 First Class Pass (*Scholars) *Botha IM Bannatyne CI Blasbalg YY Brown GE *Chan W-H

Christodoulou DM Cox JJ Cross AC 'DZLGRZLF]5= Diana M *Duarte SF Dunn TM Ferreira NT *Govan K

*Hurvitz GD

*Hammond AM *Henson MK Hitge CA Hyam KTR

Ilunga KN Jones B Kayembe O *Le Roux DS

English, Afrikaans, Science, History, Art Afrikaans, Geography Science, Biology

*Leggett BAG English, Afrikaans, Mathematics, Science, Biology, Geography, Computer Studies English, History English, Afrikaans, Biology, History Afrikaans English, History, Geography English, Geography English, Afrikaans, Geography, Art Mathematics, Science English, Biology, Geography English, Afrikaans, Mathematics, Science, Biology, Geography English, Afrikaans, Mathematics, Science, History, Geography English, Biology, History English, Afrikaans, History, Art Afrikaans English, History

Longridge J Mare F Masson PI Matsimela SR McClelland DE McCoy CL Mente NS Moodley R Mosuoe OKR Nicolson M Odendaal PS Overton MK *Park NJ *Peyper TW Rafferty MJ Roberts AM Scott GR Shunn DD Stroucken ML Swain WL Van Wyngaard MGD Viring GD Wasson GS White S Wilson BJ 28

English Afrikaans, History English, Afrikaans, Biology, History English, Afrikaans, Biology, Geography Biology, Geography History Geography

English, Geography History Biology Mathematics History English, Afrikaans, History, Geography Mathematics, Science English, Afrikaans, History, Geography English English English, History English, History, Geography English, Science, Biology Biology Geography


6HQLRU&HUWLĂ&#x20AC;FDWHZLWK(QGRUVHPHQW

Anderson RJF Beckett DR Bell SB Beukes HBD Bwalya N Cameron R Catt AP Cham L Chaoane T Dai W Das Neves RC Delacovia KG Devlin SA Di Falco M Dirnberger SW Dunn MC Edwards CA (OFRWW73 Engelbrecht JB Gapare BTM Gertenbach MS *LEVRQ3/ Govender M Gwilt WH Hamilton S-L +DUGRQ0 Haverly DD Herbert BWM Hood GR Howard DT Ingram DG -DPHV-' Johnston MB Kern LD Kgoale TL Khoza SX .LGVRQ4; Koller MO Lavery DR Lavery DD

Legoabe L /RQJULGJH- Lopes PADM Maake S Madasa M Makgato DD Marolen HP Martin AM Matjiu MB Mgiba NM Milne G Milne M Ndlovu JM Nkuna AK Nyanda NM Philip G 3LNH&-

Afrikaans Science (SG)

Chinese

Art

(QJOLVK$UW Afrikaans

Pinheiro BVDS Pratt G Rapoone JL Redl M Richmond MRN Rossouw NW 6FKURGHU%1 Scott JS Slighting JD Smallman J 6QLMPDQ.+ Stapleton BJ Swain GM Swart D Tasker RM Tloubatla AT 7RPXU'- Trickett RJ Van Niekerk DL 9DQ=\O0& Vunandlala N Webster PBA Woods MN

$IULNDDQV Geography

(QJOLVK$IULNDDQV

English History *HRJUDSK\$UW

29

%LRORJ\*HRJUDSK\

History History

History History

(QJOLVK0DWKHPDWLFV Geography History

(QJOLVK$IULNDDQV Biology

(QJOLVK+LVWRU\$UW

(QJOLVK+LVWRU\ History +LVWRU\


6HQLRU&HUWLĂ&#x20AC;FDWH

Mazaiwana AT Mnygandu NL Moagi KS Molotsane R Momoti T Murugan T Must CA Naude SJ Ncube LP Nicolson A Pitout FP Shilubane AB Silima AN Tsoai K Van der Sluys MR 9DQ=\O%* Vichhi VK Wheeler TA

Beukes SD Bush RM De Wee R Afrikaans De Wet HR Els C Afrikaans Gandy CS Gordon DR Gray MJ Hack R Hermanus MG JanseVan Rensburg JK Kau TR Khoury MG Khumalo ST Kock KR Kunene-Mtlaisane K Madigoe KF Mafela JJ

30

Afrikaans


Prefects Camp 2005

Travelling on a large bus with only 21 school boys and one master on a very hot day to a place somewhere in the mountains was something we had not even considered. The expectations of this camp were of a high morale with a few surprises in-between. The road off the empty highway was a surprise; a narrow dirt road that a was a difficult undertaking for the bus. Getting off the bus in our red tracksuits we were very eager to find some place cool to rest and get something to drink. Our guides showed us the way to our lodging and told us to put on something cool which was our first priority. We had 5 minutes to change and meet at the lecture tent for a few rules and leadership skills. At this point in time we were very hungry and we had hamburgers for lunch. After lunch the challenges began with the task of collecting markers on the farm which represented different parts RIRXUJRFDUWEXWWKHUHZDVDFDWFKWRWKLVZHKDGWRFROOHFWDOORXUPDUNHUVEHIRUHRXUWLPH was up or we would not get any meat for our meal! This was the driving force between each of the teams to complete the challenge. Every team completed the challenge successfully but then it ZDVWLPHWRSXWRXUFRQWUDSWLRQVWRWKHWHVW:HKDGWRUDFHWKLVKRPHPDGHZKHHOHGURSH FRQWUROOHGOHJSRZHUHGVSHHGPDFKLQHDURXQGDWUDFNWKDWZDVH[KLODUDWLQJWRORRNDWEXWLWZDV not for the feint of heart. It was up to each team to make a plan to get the driver around the track in the fastest time. After that marvellous event we had a chance to break the track record. Our team did us proud but they managed to crash just around the 2nd 360 degree corner which cost the team some time but we made it up and we were two seconds off the record. This did not affect us too much because all we had our sights on was what was for supper. In the eating area were two buckets of vegetables and potjie pots on the table. The biggest surprise was that we had to cook our own food. We were given instructions on how to cook our food and then they left us to fend for ourselves. This was no problem. Too many chefs actually helped this time! After supper we had some more lectures on leadership. We were very tired after our physical day and most of our eyes were closing long before bed time. We had not thought that it could be this busy and hard. We thought the rest of the two days were going to be easy. The next morning was an early start for most of us. We started the day with some leadership skills WKHQZHZHUHJLYHQRXUSODQIRUWKHPRUQLQJ:HKDGWRFRPSOHWHDUGXRXVWDVNVRIVNLOOEDODQFH muscle and teamwork. We had a chance to reflect on every challenge so that we could decide which was the easier way to finish each objective successfully. After lunch we were told that we had to go to the obstacle course or 'the gauntlet' as most of us would call it after it was finished. This involved FURVVLQJULYHUVRYHUFDUJRQHWWLQJJHWWLQJRYHUPHWHUKLJKSROHVVZLQJLQJDFURVVULYHUVMXPSLQJ UXQQLQJFOLPELQJZRRGHQZDOOVDQGILQDOO\VXEPHUJLQJRXUVHOYHVLQDGLUW\SRRORIZDWHU:HWKHQ had to shout a song of our choice to complete the challenge. We had to freshen up with a shower and get ready for supper which we had to cook. Unexpectedly we were told that we had to get the things we needed for a night hike. Thanks to Mr Erasmus and Mr Thorne we had the "running commentary" of which animals we would be "running" in to. We weren't allowed to shine our torches which would blind the guide for the night who said that he had never been around that side of the mountain at night. We got to our sleeping site under the stars in one piece. After we had set up our camp site we walked to a hollow in the ground where we played stalk the lantern. There were a few winners. After that we made our way back 32


to our campsite to sleep because we were told that we were going to be woken up at sunrise. The fresh air was refreshing and we fell asleep easily. Maybe it was to rest our weary bodies. Day 3 we woke up with the sparrows. The fresh air was just what some of us needed. After breakfast we went off to some challenges that earned our team's points. Each task had to be completed successfully to get all the points. Each team performed to the best of their ability. We then had to run the gauntlet again for the record. We didn't match the record but we all got shoulder deep in a dirty pool of water saying our war cry. After that we had to get ourselves back up to camp to shower and freshen up before we had a chance to visit the tuck shop to buy some snacks for the trip back to the school. We all had a chance to thank our guides for their hard work and felt that we had left something of ourselves behind. On behalf of all the prefects I would like to thank Mr Erasmus and Mr Thorne for coming with us and taking us to this wonderful place. I would also like to thank Mr Fennell and everyone involved for allowing us to leave school and go on this camp. R Boatwright

Grade 11 Knights of Pendragon Leadership Camp 2Q)ULGD\0D\0LFKDHO3DSSDVDQG,0DWKDEDWKD6H[ZDOHDORQJZLWKDQXPEHURIRWKHUOHDUQHUV IURP RWKHU VFKRROV HPEDUNHG RQ D OHDGHUVKLS FDPS RUJDQLVHG E\ WKH 5RWDU\ .QLJKWV RI WKH Pendragon. This is an annual camp for learners in Grade 11 with Prefect potential and its purpose is to teach leadership skills to the youth. The previous Friday we were assigned to groups of seven. Points were awarded to groups depending on how well they did at given activities. Groups with the highest number of points would win at 33


the end of the camp. Everyone was given caps with the colour of their group and nametags which were worn at all times. After a long bus ride we arrived at the camp near Hartebeespoort Dam. We were shown to our dormitories at 18:00 and told to get ready to be at the eating hall as soon as possible. At the hall we were told to find a name for our group and establish a warcry. $IWHURXUZDUFULHVZHKDGVXSSHU$VVRRQDVVXSSHUHQGHGZHZHUHWROGDERXWWKH5RWDU\&OXE KRZLWVWDUWHGWKHDLPVRIWKH&OXEDQGWKHSXUSRVHRIWKHFDPS:HWKHQKDGDOHFWXUHJLYHQE\D motivational speaker on how to keep a positive attitude; physiology and how to make fair decisions without gaining negative results. We then went back to our dorms and slept. 7KHUHZDVQRWKLQJTXLWHOLNHWKHFULVSILYHR FORFNGHZRUWKHIUHH]LQJIURVWSDUDO\]LQJRXUKDQGV ZKLOHZDVKLQJGLVKHV%XWLW¡VDOOIRUDJRRGFDXVH During the weekend we learnt the power of our minds which gave meaning to the saying 'mind over PDWWHU ,WLVQRWPHUHO\DVLPSOHFOLFKpIRUZHIRXQGHYLGHQFHWRSURYLGHWKLVZLWKWKHDFWLYLWLHV SODQQHGIRUXV)RUH[DPSOHZHFRXOGQRWIRUJHWKRZZHOHDUQWWRHVFDSHDVKLSZUHFNE\EXLOGLQJ DPDNHVKLIWKHOLFRSWHUSLW\LWZDVRQO\WKHVL]HRIP\DUP We realised interesting ethics with a hypothetical exercise: if you and your friends were stranded LQDGU\GHVHUWZKHQ\RXUSODQHFUDVKHGDQGDOO\RXDUHOHIWZLWKLVDPLQLPDODPRXQWRIZDWHUD KXJHUHGDQGZKLWHSDUDFKXWHDQGDODUJH\HOORZUDLQFRDWZRXOG\RXZDONLQVHDUFKRIDYLOODJHRU stay and wait to be seen by a passing plane? What would you do? The majority when asked would stay put. :HZHUHWDXJKWWRWKLQNEH\RQGWKHXVXDOERXQGDULHVWRWKLQNODWHUDOO\DQGQRWOLPLWRXUWKRXJKWV and ideas. On Saturday evening we were treated to a delicious braai and a great deal of camp side stories were told around the blazing bonfire which helped us to bond as a group. We even tested our vocal VNLOOV$GHOLJKWIXONDUDRNHDYHQWXUHPDQ\RIXVVKRXOGQHYHUH[SDQG%XWVWLOOYHU\HQWHUWDLQLQJ DQGJRRGIXQZLWKIULHQGVZHZLOOQHYHUIRUJHW Sunday was the last day. After our morning routine we attended more lectures. This time they ZHUHRQWUXVWODWHUDOWKLQNLQJDQGWKHFULWHULDRQKRZWRPDNHGLIILFXOWGHFLVLRQV2XWVLGHDFWLYLWLHV WKHQIROORZHGRQHLQYROYHGIDOOLQJRIIDPKLJKSODWIRUPEDFNZDUGVLQWRWKHKDQGVRIRXUZDLWLQJ friends and another one where we had to navigate our group members through an artificial spider web. Once the activities ended we had lunch and were given time to pack and to finish off organising our group shows. Back at the eating hall we performed our shows. One last lecture to sum up was given and we also said our thanks to the Rotarians and everyone involved in the organisation of the camp. :HZRXOGOLNHWRWKDQN0UV0DQLD0U)HQQHOODQG0U+DQVHQIRUFKRRVLQJ0LFKDHO3DSSDVDQGPH to represent the School at the camp. M Sexwale & M Pappas 34


35


Memorial Parade

Memorial Parade 2004 Officer Commanding

J Grantham

Second in Command

N Gerber

Company Sergeant Major

S Chittenden

Platoon Commanders

J Smit L Moletsane

Colour Party Flag Officer Colour Sergeant-Major Colour Sergeants

Commander Sentries

G Leeuw B Whyte T Brewer E Mazibuko G Borthwick

Marker

S Keeling

Wreath Orderlies

W Brockway D Oelofse T Manentsa S Nkungu C Chilvers P Pinheiro

Aide de Camp

R N Barnard C T Pearton

Sentries

R Boatwright C London B Borsboom M Groenewald

Aide de Camp

D Carstens D Erasmus

Marker

L Harris

Wreath Orderlies

A Rodrigues M Pappas P Mokobodi W Chalklen S Mamorare K Mkhonza

A Mazaiwana K Demartinis T Moja A Kucharski

Sentries

Memorial Parade 2005 Officer Commanding

J Hamann

Second in Command

K Peyper

Company Sergeant Major

M Mbuya

Platoon Commanders

M Rachidi A Fraser

Colour Party Flag Officer Colour Sergeant-Major Colour Sergeants

M Steinhobel G dos Santos B Harris R Maclachlan

Sentries Commander

O Holland 37


38


"Through the Eyes of a Window" Tau Chokoe Grade 12 A


English Creative Writing

Editor's Prize : Proxime Accessit :

C MacRoberts C Goddard

The English Patient $WWKLVPRPHQWLQWLPHWREHKRQHVWWKLVLVZLWKDOOGXHUHVSHFWOLNHDEVROXWHO\WKHPRVWLUULWDWLQJ VHQWHQFH,FRXOGZULWH%DVLFDOO\,KHDUZKDW\RXDUHVD\LQJEXWDWWKHHQGRIWKHGD\JRLQJIRUZDUG OHW·VWRXFKEDVHDQGDSSO\VRPHEOXHVN\WKLQNLQJWRWKLVODQJXDJHWKLQJ\ 7KHUH \RX KDYH LW ² DQ DVVRUWPHQW RI WKH WHQ PRVW GHVSLVHG DQG LUULWDWLQJ SKUDVHV LQ WKH (QJOLVK ODQJXDJH DVDVVHPEOHGLQ DSROOE\WKDWFRQQRLVVHXURITXDOLW\7KH7LPHVRI/RQGRQ,WLV hackneyed phrases such as these that are responsible for a crippling assault on the English language. 7KH (QJOLVK 3DWLHQW ² LW OLHV EORRGLHG DQG ZHDN D YLFWLP RI D UHOHQWOHVV and brutal assault by clangorous FOLFKpV JUXHVRPH JUDPPDU SXHULOH punctuation and sordid spelling. English has been bastardized and abused in UHFHQWWLPHVFRUUXSWHGE\WKHUDYDJHV of modern living. 7DNH SXQFWXDWLRQ IRU H[DPSOH Punctuation marks have been called the traffic signals of language; they WHOOXVWRVORZGRZQQRWLFHWKLVWDNH D GHWRXU DQG VWRS ,I WKLV LV WKH FDVH then it is patently obvious that the streets of English are in utter chaos. It is impossible to go anywhere without spotting a glaring punctuation error ²WKH\DERXQGRQELOOERDUGVIO\HUVLQ shops and on menus. In response to these crimes against (QJOLVK D IHZ OR\DO GHIHQGHUV RI WKH

"Know Hope" Tau Ckokoe Grade 12 A 40


ODQJXDJH KDYH FUHDWHG WKH$SRVWURSKH 3URWHFWLRQ 6RFLHW\ ZKLFK UXWKOHVVO\ URDPV WKH VLGHZDONV RI %ULWDLQ$UPHG ZLWK SHUPDQHQW PDUNHUV DQG RFFDVLRQDOO\ HYHQ SDLQW LWV PHPEHUV JR DERXW correcting pathetic punctuation on advertisements across the country. They have even threatened WR GHYHORS D PLOLWDQW ZLQJ LQ RUGHU WR SURWHFW (QJOLVK DQG GHVFULEH WKHPVHOYHV DV SXQFWXDWLRQ vigilantes". ,ISXQFWXDWLRQLVEDGVSHOOLQJLVDWURFLRXV)URP3KLOHPRQ²3DQWLQJ3DYYLQJ7LOOLQJWRWKHKRUURUV RI606VKRUWKDQGDQGQHWFKDWURRPVLWVHHPVWKDW(QJOLVKIDFHVDQDOPRVWLQVXUPRXQWDEOHDPRXQW of vicious opposition. ,Q3KLOHPRQ·VFDVHWKLVLVSHUKDSVH[FXVDEOHJLYHQLOOLWHUDF\ZKLFKLVSUREDEO\QRWKLVIDXOW1RWKH greatest threat to our patient emerges in the First World. People who have received an education DUHODUJHO\WREODPHJLYHQWKHXQIDWKRPDEOHGHVLUHWRDEEUHYLDWHWKHLUHYHU\ZRUG)URPFXOHU VSHOWZLWKD¶F·D¶X·DQGDVWUDWHJLFDOO\SODFHG¶·WRWKHDYHUDJHXVHUUHYLHZRQ$PD]RQFRPWKH trend to systematically annihilate English abounds. 7HFKQRORJ\DVLGHLWLVIDLUWRVD\WKDWRXUDSSURDFKWRODQJXDJHLVLQIOXHQFHGJUHDWO\E\WKHPHGLD :KDW KRSH GR ZH KDYH WKHQ ZLWK VXFK OLQJXLVWLF SRZHUKRXVHV DV WKH 6$%& LQIOLFWLQJ JULHYRXV grammatical harm to English on a daily basis? Combine this with the ridiculous jargon we are constantly exposed to and you have a recipe for disaster. Listen to any politician talking about DQ\WKLQJ IURP KRXVLQJ WR KHDOWK DQG \RX ZLOO IDVW UHDFK D FRQFOXVLRQ ² WKDW JRYHUQPHQW DFWLYHO\ HQIRUFHVDVWHHSMDUJRQTXRWDRQDOORILWVFRPPXQLFDWLRQ2QDYHUDJH\RX·OOKHDUVRPHWKLQJOLNH this: "we are conscientiously endeavouring to address this issue by broadly implementing nationwide structures as part of a concerted initiative to achieve sustainability and embrace the spirit of ubuntu". 5HDOO\ZHGRQ·WVWDQGDFKDQFH 7KLVLVRIFRXUVHDJOREDOSUREOHPWKDWH[WHQGVWRHYHU\SDUWRIWKH(QJOLVKVSHDNLQJZRUOG2QHRI WKHJUHDWHVWLVVXHVLVWKDWRI¶FRUSRUDWHVSHDN·,VQ·WLWDPD]LQJKRZHYHU\RQHIURP\RXUORFDOSDVWRU WRWKLVYHU\VFKRROVHHPVWRKDYHD¶PLVVLRQVWDWHPHQW·WRXWLQJWKHLU¶FRUHYDOXHV·",WLVODPHQWDEOH WKDWWHDFKHUVDUHQRZ¶HGXFDWRUV·DQGOLEUDULDQVDUH¶LQIRUPDWLRQQHHGVLGHQWLILHUV·3URGXFWPDQXDOV KDYH EHFRPH LQGHFLSKHUDEOH WR WKH FRQVXPHU ² WDNH WKH -RKQ 'HHUH WUDFWRU VDIHW\ QRWLFH IRU example. It warns users to lock the brake or "unexpected non-powered tractor movement may RFFXU,QRWKHUZRUGVSXWWKHKDQGEUDNHRQRU\RX·UHEXJJHUHG 6RLVRXUSDWLHQWWHUPLQDOO\LOO"5HJUHWWDEO\,GRQ·WKROGRXWPXFKKRSH3HUKDSVLW·VWLPHWRVWDUW SUHSDULQJWKHHSLWDSK²(QJOLVK²DJUHDWODQJXDJHVODXJKWHUHGE\DSDWK\ Chris MacRoberts Grade 12F This was the speech presented at the Best Speakers Competition.

41


A Reflection on Five Years at King Edward ,·OOEHIUDQN7KLVLVZULWWHQFROORTXLDOO\²GHDOZLWKLW)XUWKHUPRUHDV¶IUDQN·WKHUHDUHQ·WDQDZIXOORW RISHRSOHWKDW,SDUWLFXODUO\OLNHDQGDQDZIXOORWRIWKRVH,GRGRQ·WFRPHIURP.LQJ(GZDUG 1RZ DV &KDG ,·OO WHOO \RX WKDW .LQJ (GZDUG KDV QHYHU JUDQWHG PH DQ\WKLQJ ,·YH DFWXDOO\ ZDQWHG KRZHYHUE\WKHVDPHWKDQNIXOO\VHOILVKKDQGLWKDVQHYHUJLYHQPHDQ\WKLQJ,GLGQ·WZDQW,·YHQHYHU ZDQWHGWREHSRSXODU,·YHQHYHUZDQWHGWREHXQLYHUVDOO\DFFHSWHG,·YHQHYHUZDQWHGWREHIULHQGV ZLWKHYHU\ERG\,·YHQHYHUZDQWHGWRIHHOOLPLWHG,·YHQHYHUZDQWHGWREHWUHDWHGOLNHDFKLOG,·YH QHYHUZDQWHGWRGUHDGWKHGD\WKDW,KDYHWROHDYHVFKRRO,·YHQHYHUZDQWHGWRIHHORXWRISODFHRU HQWLUHO\LQSODFHHLWKHU7KHUH·VDORWRIVWXIIWKDW,·YHQHYHUZDQWHG )RUDOORIWKHWKLQJVWKDWWKHVFKRROKDVRUUDWKHUKDVQ·WJLYHQPH,ZLOOEHHWHUQDOO\JUDWHIXOIRUDV PXFKDV,ZRXOGOLNHWRGHQ\LW,ZRXOGQ·WEHWKHSHUVRQ,DPZLWKRXWDOORIWKHVHWKLQJVRUZLWK DOORIWKHVHWKLQJV:KLOHWKDWSHUVRQPLJKWQRWEHZLWKLQDOLJKW\HDU·VVFRSHRISHUIHFWLRQRUHYHQ YDJXHGHFHQF\,DPFRQWHQWZLWKLW$OWKRXJK,VKDOOEHJUDWHIXO,VKDQ·WIHHOLQGHEWHG²VDYHRQH WKLQJ WKH VFKRRO KDV RU KDVQ·W JLYHQ me: When two of my friends and I PHW P\ JLUOIULHQG·V IDWKHU KH DV D WHDFKHUDWDULYDOVFKRROLQVWLQFWLYHO\ asked us which schools we attended. 8SRQKHDULQJP\UHSO\KHVRPHZKDW VXUSULVLQJO\ GHFODUHG $K .LQJ Edward. Brilliant school!". My friend ZKRZHQWWR6W'DYLG·VGLGQ·WUHFHLYH nearly such an impressed response and the reply given to my mate who DWWHQGV +\GH 3DUN ZDV VLPSO\ ´,W·V not your fault son." After this I was welcomed into his house while my friends were jokingly told to â&#x20AC;&#x2DC;bugger RII· After considering the school in LWV HQWLUHW\ , ZLOO QRZ FRQVLGHU WKRVH ZKR FRQVWLWXWH LW ² WKH ER\V Presumably the correct manner of KDQGOLQJDUHWURVSHFWLYHVXFKDVWKLV would require a good rattling off of various boys in my class and the traits which make them particularly PHPRUDEOH,FRXOGWDONDERXW7ZDOD·V KDLU &KDQJD·V SXVKEDFN DIUR RU 0LND·VVLQXVSUREOHPVEXW,·GUDWKHU QRWWDONDERXWDQ\RIWKHP,DOVRGRQ·W want to talk about Serge (the most VWDQGXS EORNH \RX ZLOO HYHU PHHW  Eddie (not quite the most standXS EORNH \RX ZLOO HYHU PHHW   6XOD ZKR JRW VFUHZHG ERWK ZD\V  0R (thanks for the tippex) or Andrew (who continues to propagate the rumour that I am the exact shade

"Document" Chad Goddard Grade 12 A 42


of tippex). Nor do I want to talk about Gerber (for future reference German Measles is contagious) RU5XGL ZKRIRXQGWKDWRXWILUVWKDQG ,·OOGHILQLWHO\QHJOHFWWRPHQWLRQWKDWLIFKLUSLQJZDVGRQHLQ GXHOIRUPDWZLWKSLVWR·V0DUN&RXUWHQD\ZRXOGEHWKHODVWPDQVWDQGLQJDQG,UHIXVHWRPHQWLRQ 6KLQJL \RXNQRZ\RXZRXOGQ·WPHQWLRQPH  At this point I should stop because although I have not yet mentioned everyone I need to amend my initial statement. As it turns out I realise that an awful lot of the people that I do like actually do come from King Edward. All of these blokes and everyone else at King Edward as well as all of my collective experiences have left me with this conclusion. ,·YH ORRNHG IRUZDUG WR JRLQJ WR VFKRRO HYHU\GD\ ,·YH EHHQ DEVHQW HYHU\ RWKHU GD\ ,·YH HQMR\HG LW ,·YHEHHQXWWHUO\ERUHGZLWKLW,·YHNQRZQJUHDWSHRSOH,·YHNQRZQIRROV,·YHEHHQDIRRO,·YHPDGH IULHQGV)ULHQGVKDYHPDGHPH,·YHSOD\HGVSRUWV,·YHEHHQDWHQSDVWWZRZDUULRU,·YHEHHQPRVW SURGXFWLYHKHUH,·YHQHYHUDUULYHG,·YHQHYHUOHIW,W·VEHHQJUHDW,W·VEHHQDZIXO,WZDVIXQ,WZDVVDG ,·YHOHDUQW DOEHLWYHU\OLWWOHLQWHUPVRIPDWKHPDWLFV ,·YHIRUJRWWHQ,·YHORYHGLW,·YHKDWHGLW$QG HYHQLI,FRXOG,ZRXOGQ·WFKDQJHDQ\WKLQJDERXWLW%HFDXVHQRPDWWHUZKDW\RXVD\ZKDW\RXKHDU RUZKDW\RXEHOLHYHLQQRERG\·VH\HVEXWPLQH.LQJ(GZDUGZDVSHUIHFWDQGWKHIDFWWKDW,FDQVD\ that simply proves it. Chad Goddard Grade 12A

Untitled Everything in our universe and beyond into infinity is made of energy that is vibrating. Everything is made of energy vibrating at different speeds or different frequencies. If something is not vibrating it cannot exist. :HOLYHLQDIUHTXHQF\UDQJHRIYLEUDWLQJHQHUJ\WKDWRXUILYHVHQVHVFDQDFFHVVDQGSHUFHLYHEXW LQILQLW\FRQVLVWVRIDQLQILQLWHQXPEHURIIUHTXHQFLHVDOOYLEUDWLQJLQDQGVKDULQJWKHVDPHVSDFH7KXV ZHFDQRQO\VHHWKDWWLQ\IUDFWLRQRILQILQLW\WKDWLVYLEUDWLQJWRWKHIUHTXHQF\ZHFDQVHHKHDUWDVWH touch and smell. On our planet we have roughly six billion people all living their lives and perceiving WKHLUZRUOGLQVL[ELOOLRQGLIIHUHQWZD\VDOORQVL[ELOOLRQGLIIHUHQWIUHTXHQFLHV²VRPHIUHTXHQFLHVPD\ be very close and others very far apart in terms of vibrations. +RZHYHUHDFKSHUVRQEHOLHYHVKLVSHUFHSWLRQRIWKHZRUOGWREHUHDOLW\DUHDOLW\WKDWLVEHLQJ SHUFHLYHGE\WKHILYHVHQVHV%XWLIZHUHDOL]HWKDWRXUVHQVHVDUHRQO\DQLOOXVLRQLWEHFRPHVDSSDUHQW WKDWUHDOLW\LWVHOILVRQO\DQLOOXVLRQ:KDWZHH[SHULHQFHZLWKRXUILYHVHQVHVLVRQO\DQLOOXVLRQ²LW LVDUHIOHFWLRQRIRXUVHOYHVWKHZD\LQZKLFKFRQVFLRXVQHVVFDQREVHUYHLWVHOIZKLFKLV,EHOLHYHWKH SRLQWRIRXUEHLQJKHUHEHLQJDOLYH We are living inside a five-sense prison cell because we are so trapped within the illusions of the five senses that we believe that this is all that exists. It is our only reality. A reality that is made up of illusions that are being constantly manufactured and manipulated. This belief that our "reality" is DOOWKDWH[LVWVLVIXUWKHULQJUDLQHGE\WKHHGXFDWLRQV\VWHPWKHPHGLDVFLHQFH·DQGUHOLJLRQDOORI which are dominated by the belief that the world of our five senses is all that there is. Recent studies have concluded that we can only perceive 0.5 percent of our universe; that percentage WKDWUHIOHFWVOLJKWDQGFDQEHDFFHVVHGE\RXUILYHVHQVHV\HWZLWKRXWNQRZOHGJHRIWKHRWKHU SHUFHQWRIMXVWRXURZQXQLYHUVHOHWDORQHLQILQLW\WKHUHDUHSHRSOHPDNLQJGHILQLWHMXGJHPHQWVDQG proclaiming certainties about the nature of life and creation. 43


:H KDYH WKH SRWHQWLDO IRU LQILQLWH NQRZOHGJH ZLVGRP H[SHULHQFH DQG ORYH DV ZH DUH DOO RQH FRQVFLRXVQHVVH[SUHVVLQJLWVHOIVXEMHFWLYHO\7KHUH¡VQRVXFKWKLQJDVGHDWKOLIHLVMXVWDGUHDPDQ illusion and we are only the imagination of ourselves. But the fact is that we as a group are not H[SORLWLQJ RXU SRWHQWLDO ² ZH DUH EHLQJ WUDSSHG LQ RXU PHDJHU ILYHVHQVH UHDOLWLHV:KHWKHU ZH believe we are trapped in this by a global conspiracy of bad men trying to control the world or that ZHRXUVHOYHVKDYHSODFHGXVLQWKLVOLPLWLQJSRVLWLRQWKHIDFWUHPDLQVWKDWZHDUHOLYLQJLQLVRODWLRQ from all that is out there and it is only through opening our minds and allowing our illusions not to cloud the truth that we can ever experience all that is out there. ,QRXUZRUOGRIJURWHVTXHVHOIGHFHSWLRQ the man who has the courage to question and challenge his beliefs as well as those LPSRVHG XSRQ KLP E\ WKH PHGLD UHOLJLRQ HGXFDWLRQVFLHQFHHWFLVWKHRQO\PDQZKR will ever be free. Chad Goddard Grade 12A

â&#x20AC;&#x2DC;Tis a mad world, my masters They say we learn from our mistakes. They say that history is the greatest teacher. They say that retrospect is paramount in developing a society. But what have we learnt from the past? And what will our descendants learn from us? It is undoubtedly a mad world in which we live. Society has been turned on its head by an excessive EOHQGRILGHDOVDQGPRUDOVDQR[LRXVFRFNWDLORIULJKWV and responsibilities. We have become intoxicated by a heady combination of factors that are rapidly fusing to initiate a meltdown of catastrophic proportions. In a society where everyone is on the frontline of current affairs DQGRSLQLRQDQGZKHUHZHDUHDOOHQWLWOHGWRRXURZQEHOLHIVDUH "Ancient Dunes" ZHQRWH[SHULHQFLQJDVHQVRU\RYHUORDGRILQIRUPDWLRQDJOXWRI Claudio Sousa over-awareness? The world has become vastly more complicated Grade 10 F ZLWK WKH UHOHQWOHVV RQVHW RI JOREDO PHGLD WR WKH H[WHQW WKDW WKH news has virtually become unavoidable. This has subjected us to a dangerous amount of media influence and we increasingly find ourselves enslaved by the tempestuous undercurrents of world affairs. Where these affairs were the VROHSUHPLVHRISROLWLFLDQVDQGVWDWHVPHQLQDVLPSOHUDJHZHKDYHQRZDOOHYROYHGLQWRDUPFKDLU experts on the situation in Kashmir or the latest car-bombing in Iraq. 2IFRXUVHWKLVKDVFRQWULEXWHGWRDPXFKJUHDWHUJOREDODZDUHQHVVDQGPDNHVJUHDWFRQYHUVDWLRQ DWGLQQHUEXWLVLWQRWLQVRPHZD\GHWULPHQWDO":K\VKRXOGZHDOORZRXUEORRGSUHVVXUHWREH sent sky-high by the latest political blunder from the liberated zoo creature that doulbles as the US President? The answer is that this invasion of mass media has become unavoidable. 44


:H DUH FRQVWDQWO\ PDGH DZDUH RI WKH GDQJHUV RI SURSDJDQGD LQ KLVWRU\ DQG WKH JHQHUDOO\ consequential results of a single-minded society. We are aware of our individual rights and are told WKDW ZH OLYH LQ D IUHH DQG HTXDO VRFLHW\ EXW LQ JHQHUDO ZH XQTXHVWLRQLQJO\ DFFHSW WKLV DV JRVSHO +RZHYHU WKLV PHGLD GRPLQDWLRQ RI RXU OLYHV KDV RSHQHG XV XS WR SURSDJDQGD RI D SUHYLRXVO\ unknown sort. :H DUH FRQVWDQWO\ H[SRVHG WR WKH VKDPHOHVV SURPRWLRQ RI JRYHUQPHQW LQ WKH PHGLD D VXEWOH exploitation of public opinion to further the interests of the ruling party. Society has become warped by the senseless promotion and acceptance of euphemisms and political correctness to PDVN RXU RZQ VKRUWFRPLQJV ,Q WKLV PDG ZRUOG RI RXUV ZH KDYH IDOOHQ SUH\ WR WKH HYHUSUHVHQW dangers of single-mindedness. People have submitted to the cowtowing and mindless approval of the SRZHUVWKDWEHWRWKHQRQVHQVLFDODFFHSWDQFHRIRXUOHDGHUV·VKRUWFRPLQJVDQGIDLOXUHV:HKDYH UHDFKHGDSRLQWZKHUHZHKDYHJLYHQXSFULWLFL]LQJWKHLU$,'6SROLF\RUWKH=LPEDEZHFULVLVRUWKH widespread corruption of parliament. 7KHLQFLSLHQWPHGLDRQVODXJKWKDVQXPEHGRXUVHQVLELOLWLHVGDPSHQHGRXULQVWLQFWLYHUHDFWLRQWR criticize the establishment. In what reasonable society would a Health Minister as ineffective as ours be allowed to ignore the existence of one of the worst epidemics in history and then address it only by prescribing olive oil and potatoes? ,WLVTXHVWLRQDEOHZKDWRXUGHVFHQGDQWVZRXOGOHDUQIURPXV²SHUKDSVWKHJUHDWHVWOHVVRQLVWR EHYLJLODQWDJDLQVWWKHVFRXUJHRIVLQJOHPLQGHGQHVV,QWKLVPDGPDGZRUOGRIRXUVSHUKDSVRXU greatest failure is simply not to criticize. Chris MacRoberts Grade 12F

"Famish" Thabiso Molefe Grade 12 F 45


All Who Care Spears of diamond-javelin drops Falling from on high Come to sate the dying crops And cool what once was dry Lords of Earth and Lords of Sky Have come and met and wed Now they see what sure must die And soft above it tread $QGIURPWKLVIRRWSDWKKRO\PDGH &RPHVZDWHUJRRGDQGFOHDU And to the earth it then is bade /LNH6N\/RUG¡VIDOOLQJWHDU 6RJRRGDQGFOHDQDQGWUXHDQGVWURQJ The rain comes soaring in 7RVLQJWRPHQLWVFOHDUVZHHWVRXQG An everlasting sin Sung for all but sung for none It roars about the air 6XQJIRUPDQ\VXQJIRUVRPH Sung for all who care. Mark Heydenrych Grade 11E

46

"Painting" Kimeshen Pather Grade 8 A


Hopeful Sunset, Doomed Sunrise LORYHWKHHIDLUVXQVHW\RXUSXUSOHVSOLQWHUVDQG\RXU yellow-white shrapnel. WKHVSHFNVRISLQNWKHYLYLGRUDQJHDQGWKHVWUHDNVRI JROGVSODVKHGRQWRDFDQYDVRIQLJKW JRRGE\HGDUNGD\LELGWKHHIDUHZHOOLDZDNHWR sunset and the brightness of her dreams. RKEHDXWHRXVQLJKWWKHMR\RI\RXUGUHDPLWSXOVHV WKURXJKP\VRXOOLNHDKHDYHQO\EHDWSOD\HGE\DQ orchestra of angels. PRUHYLEUDQWWKDQWKHEORRGLQP\YHLQVPRUH exciting than a kill on the savannah. RKVXQVHWZK\GR\RXWHPSWPH"\RXFDOOP\QDPH \RXZKLVSHU\RXUVHFUHWV\RXUWKRXJKWV\RXUGUHDPV \RXFDOOPHLQWR\RXUUHDOPRILOOXVLRQLWSULFNOHVP\ mind and swirls my heart like a pool of gossamer threads within a delicate montage of the unknown. LVLWDW\RXUGRRUVWHSOLVWHQLQJLQWHQWO\\RXDUH P\GUXJP\KLJK\RXVLQJDPLOOLRQWLPHVDQGVWULQJPH OLNHDKDUSRKVXQVHWZK\DUH\RXVRFUXHO"\RX taunt my senses and steal my reality. you caress my WKRXJKWVDQGLVXUUHQGHUWRWKHLUVXUUHDOWRXFKRK VXQVHWZK\GR\RXKXUWPHVR"KDYH\RXQRKHDUW" \RXFDOODQGFDOOLIDOODQGIDOO\RXWRXFKDQGWRXFK i dream and dream. why do you make me dream? you PDNHPHVHHDQHDUWKRIJUHHQDSODWHDXRIEOXHDQG a sea of brown. i look far beyond at this tainted illusion and i reach out and try to touch the soil or smell the white IRDPRUKHDUWKH rustling leaves of june. i dream of earth. why do you tease me? my high becomes ORZP\PLUDJH EHFRPHVUHDOLW\P\ pleasure becomes my poison; my hopeful sunset becomes my doomed sunrise. Imran Khan Grade 11E 47

"Painting" Lungisani Maseko Grade 8 C


Helena â&#x20AC;&#x2DC;Twas once upon a summer morn I saw 0\ORYHP\EHDXW\PHUHO\VWDQGLQJ There The mists of passion swirling round Her face :KLOHVXQOLJKWEULJKWOLJKWLJQLWHVDOO Her hair Perfection showing in her blushing cheeks And love upon those lips that part To smile 7KDWPHP¡U\FOHDUDVGDZQLQJ Yesterday 5HPDLQVLQP\PLQGEULJKWYLYLG And clear Reminding me of all that I have lost And telling me of all that I still have So now I thank you my fair Helena $QGELG\RXJRRGGD\JRRGQLJKWDQG Fair sleep.

"Painting" Murray Baxter Grade 9 F

Mark Heydenrych Grade 11E

A Glimpse Closer to Heaven May your hair like the lightning The rain and the clouds Be my pulse and my beat And my soul. May your eyes like the sun And the moon and the stars Be the bright light in which I now thrill. $QG\RXUVRIWOXVWURXVVNLQRK So pale golden light Be the sweet air I love As I breathe. <HVP\VZHHW\RXDUHP\ZRUOGDQG You are all that I need You sustain me and with You I grow Yet without you I wilt like The Earth without sun You are my life and my love And my heart. Mark Heydenrych Grade 11E 48


Vampires ,VLWDWP\GHVNZLWKP\KDQGLQP\KDLU Oblivious to me they prowl and stare. ,NQRZZKDWWKH\·UHWKLQNLQJ,FDQVHQVHWKHLUKXQJHU 7KH\ORQJWRDWWDFNWRWHDUPHDVXQGHU ,FOXWFKWKHEUDYHU\HVFDSLQJP\PLQG +RSLQJVKH·OOVWD\RQFHDJDLQE\P\VLGH The dark ones approach. ,FDOOIRU*RGWRDQVZHUP\SUD\HUV 7RKHOSPHRXWWREHP\GDUNQHVVVOD\HU +HQHYHUDQVZHUVZKHQ,QHHGKLPPRVW *RQHDUHIDLWK+RSHDQG*UDFHDQG,DPOHIWPRURVH ,ORQJWREUHDNGRZQJLYHLQDQGFU\ Gone are my tears; my eyes are forever dry. The pain I feel cannot be felt; the wound I suffer cannot be healed. The screams I sound cannot be heard. My emotions are congealed. Their war cries resonate in the chasms of my HPSW\KHDUW Yearning to fight a battle I did not start. 7KH\SXVKVKRXWPRFNWHDVH A terror no song can appease. 7KH\VFDWWHUDURXQGPHDQGGULQN·WLOOWKH\·UH full. They suck out my joy and my happiness. :KHQZLOOWKH\HQG"+DYHQ·WWKH\KDGHQRXJK" 7KLVLVQRWOLIHVRFUXHOVRWRXJK $QGLILWPD\EH² Then what awaits us that we cannot yet see? 'HDWK·VYRLFHLVZKLVSHULQJLQP\HDU +HVRXQGVVRKXPEOHVRSDWLHQWDQGGHDU +H·VNQRFNHGRQP\GRRUDWLPHRUWZR I never really answered; I never knew what to do. ,ZLOOOHDYHWKLV·OLIH·DQGQHYHUUHWXUQ And the ones who drank me will look for another. I bless their souls and forgive their doings For they are the ones who are indeed ORVLQJ« Imran Khan Grade 11E "Bermuda Pentagon" Mothei Letlabika Grade 11 C 49


Was it all worth it? ,ZRQGHUHGZDVLWDOOZRUWKLW to have blood running in my eyes seeing men dying IRUDQRWKHUPDQ¡VSUL]H Was it all worth it? To run from a yellow mist to have my insides exploding. Would I be next on the List? Was it all worth it? To lie in a wretched trench trying to mend my open wounds to vomit from the sickening stench. Was it all worth it WRVHHP\EHVWIULHQGG\LQJ WKHQWRNLOOVRPHRQHHOVH¡VEHVWIULHQG 7RVHHJURZQPHQFU\LQJ Was it all worth it? To get a bullet in my brain and live a few more seconds in excruciating pain. Was it all worth it to leave my children without a father or should I have been named a coward and lived happily ever after? Dale Christelis Grade 10B

"Sins of the Father" Lazarus Mabaso Grade 12 A 50


Will you? I talk to you <RX'21·7UHVSRQG I HATE you ALL I HATE YOU FOR YOUR HATE OF ME I HATE THE WORLD AND THAT IT MAKES ME TURN FROM ME AWAY FROM love AND TOWARDS HATE AWAY FROM hope TOWARDS MY DEATH AND FROM beauty TO UGLINESS I HATE MY HATE AND HATE MY DEATH AND UGLINESS I HATE THE WORLD I HATE YOU MORE I HATE YOU ALL! (but I still wish you would answer me) Mark Heydenrych Grade 11E "All dried up" Phillip Dube Grade 12 G

Oh Heart ,QDQJXLVKLVWKHUHKRSH" ,QVRUURZ\HWDVPLOH" Can heart of song Still linger on When soul is in exile? ,QGHDWKFDQWKHUHEHOLIH" ,QKDWHFDQORYHEHWUXH" &DQKHDUWVRORQJ Seen naught but wrong Still not be worn through?

,QDQJXLVKWKHUH·VQRKRSH ,QVRUURZQH·HUDVPLOH <HWKHDUWSRRUKHDUW 0DNHVSXUHLWVDUW ¶(UHGHDWK¶HUHKDWH 7RZDUGGDUNQHVVWRZDUGIDWH While soul waits in exile. Mark Heydenrych Grade 11E

,QGDUNQHVVOLJKWLVGHDG But light proves living still. )RUKHDUWRKKHDUW Must play its part 7RLQWKHEULJKWQHVVWKULOO 51


"Painting", Theo Cheung, Grade 8 B

What is Love? /RYHORYHLVDQLOOXVWUDWLRQSDLQWHGE\WKHKHDUW An iridescent canvas of emotion. /RYHLVQDWXUDODQXQWDPHGIRUFHWREHUHFNRQHGZLWK To think of love is to think of midnight strolls On dusty white shores. 7RNQRZORYHLVWRNQRZRIWLPHOHVVEHDXWLHV Endless perfections and boundless joy. The difference? There is none because love is what love is $.LQGUHGVSLULWQHLWKHUNQRZQQRUWKRXJKWRI Merely existent. /RYHLVDJOLPSVHRIKRSHZKHQQRKRSHFDQEHIRXQG /RYHLVDUD\RIOLJKWLQDUHDOPRIGDUNQHVV Love is moonlit twilight over a deep velvet lake; /RYHLVFRQWHQWLRXVDQLPPRUWDOIODPH Burning with the passion of the sun. What is love? Love is a distant land of splendour and enticement A new mirage in an old reality. Love is a conqueror amidst the conquered. /RYHLVDQDXWXPQ·VEUHH]H &DUU\LQJZLWKLWWKHOHDYHVRISDVVLRQXQLW\DQGVDFULILFH /RYHLVIXOILOOPHQWLQDQHPSW\H[LVWHQFH A glistening pearl in a sea full of hatred. What is love? /RYHLVDIORZHUEORRPLQJLQWRHWHUQLW\·VVXQULVH /RYHLVIRUHYHU« Imran Khan Grade 11E 52


"Religious Crime" Tau Chokoe Grade 12 A

beCAUSE OF WAR 7RILJKWZKHQSDLQLVVXFKDQJXLVK WRNLOOZKHQ\RXYDOXHOLIHPRVW to consume and destroy just for power that is something that I would not boast. So then why do we fight for one nation when the world is a nation of men? :KDWLI\RXZHUHERUQRI\RXUHQHP\ would you then fight a friend or a foe? <RXVD\LW¡VWKHGXW\RIDPDQ WRJREROGO\DQGGLHIRUWKLVODQG But this duty you give us is meaningless OLNHDQGKRXUJODVVWKDW¡VORVWDOOLWVVDQG œ<RX¡UHDPDQ*R)LJKW:HQHHG\RX (YHU\PDQPDNHVDGLIIHUHQFH¡\RXVD\ :HOO,¡OOVKRZ\RXKRZWRPDNHDGLIIHUHQFH ,¡PQRFRZDUGZKHQ,FKRRVHWRVWD\ ,FKRRVHKRSHDQGMR\QRWGHVSDLU I shall not murder another for he and you are hard to compare. You give me a feather as a traitor when it belongs to the birds in the sky. to me it symbolises freedom DQGDVDIUHHPDQ,DVN\RX Why? Jay Salmon Grade 10B

53


The Price Death was all around me I saw it every day The memory of our anguish The price I need to pay. The sound of that boy screaming His pleading and last breath Will fill my head forever +H·VDJKRVW,·OOQHYHUIRUJHW 7KH\VDLGWKH\·GEULQJXVJORU\ But all we got was pain Like pigs to the slaughter Our comrades were all slain. It eats you from the inside It wastes away your life The memories will always be there Piercing like a knife. They sat safe in their houses Dictating what would be done These cowards were made heroes When our war was won. ,·PFRQVWDQWO\DZDUHQRZ Death lurks ‘round every bend. ,·OOQHYHUEHWKHVDPHDJDLQ These wounds will never mend. Jamie Cripwell Grade 10B

"Joan of Arc" Mahudu Nkadimeng Grade 12 F 54


It was the best of times, it was the worst of times $V,VLWGRZQWRZULWHWKLVHVVD\LWLVYHU\ hard to decide what to include. How do I put into words the best five years of my life? Do I go all sentimental and mushy about my school career? Or do I mask my elation at having ridden this emotional rollercoaster? 7KH FKDQFHV DUH WKDW \RX WKH UHDGHU ZLOO be unable to fully relate to my evolution at .LQJ(GZDUG²LW·VYHU\KDUGWRXQGHUVWDQG LI \RX KDYHQ·W EHHQ WKHUH ,·OO GR P\ EHVW QRQHWKHOHVVWRGHVFULEHWR\RXWKHMRXUQH\ ,·YH WDNHQ DQG WKH DGYHQWXUHV ,·YH KDG 6R VLWGRZQNLFNEDFNDQGHQMR\:HOFRPHWR my world. ,·OO VWDUW DW WKH EHJLQQLQJ ,W EHJDQ RQ D Tuesday in January 2001. Little did I know WKDW WKLV ZDVQ·W DQ\7XHVGD\ ² LW ZDV WKH VWDUWRIVRPHWKLQJJUHDW,GLGQ·WDSSUHFLDWH WKDWDWWKHWLPHWKRXJKIRU,ZDVJULSSHGE\ IHDURYHUZKHOPHGE\WKHVZDUPVRIROGHU ER\V ORRPLQJ DURXQG PH7KLV GLGQ·W ODVW "Still-life" ORQJ WKRXJK IRU , VRRQ LPPHUVHG P\VHOI Ngcebo Ndolu in the wealth of activities the school had Grade 10 D WR RIIHU DQG LQ WKH SURFHVV PDGH QHZ friendships. It was hard to comprehend the almost religious fervour that the older boys had for this school; the intangible but ever-present spirit that is present in every boy who passes through these halls. Come rugby season we too were infected as the electrifying sight of 1000 boys screaming in unison held us spellbound beside the First Team battleground. We were hooked on ¶5HG6SLULW· ,W·V YHU\ GLIILFXOW WR QHJRWLDWH WKH SLWIDOOV RI WKLV H[SORVLRQ WXUQLQJ LQWR \HW DQRWKHU UDKUDK SLHFH W\SLFDORIDOPRVWHYHU\.LQJ(GZDUGER\ZKRKDVDQ\WKLQJWRVD\DERXWKLVVFKRRO3HUVRQDOO\,·YH WULHGWRVHWWKLVDSDUWE\SUHVHQWLQJLWIURPDSHUVRQDOSHUVSHFWLYHDVRUWRI¶KLJKOLJKWVSDFNDJH·RI my High School career. Although it by no means encapsulates what it means to belong to the King (GZDUGIDPLO\LWZLOOKRSHIXOO\SURYLGHVRPHLQVLJKWLQWRWKHFKDUPHGH[LVWHQFH,KDYHHQMR\HGWKHVH last five years. )RUPV,DQG,,ZHUHXQGRXEWHGO\IRUPDWLYH\HDUV²,PDGHDQGORVWIULHQGVIRXQGP\QLFKHLQWKH Pipe Band and Debating Society and was privileged to experience the Centenary celebrations in 2002. I learnt of the multitude of fascinating traditions that are woven into the fibre of this school ²RIWKHFORFNWRZHUOHJHQGRIPDWURQ·VJKRVWRIWKHPHDQLQJEHKLQGWKHZRUGVRIWKHZDUFU\, GHYHORSHGDGHHSURRWHGORDWKLQJIRURXUWUDGLWLRQDOULYDOV6W-RKQ·V&ROOHJHDQGFDPHWRDSSUHFLDWH 55


WKHKLHUDUFK\WKDWXQGHUSLQVWKHVFKRRO,WZDVQ·WDOOSODLQVDLOLQJWKRXJK²RXUJURXSKDGDKLJKUDWH of attrition and I saw many friends leave the school for various reasons. This came as a blow and it took a while for me to adapt to a new group of friends. ZDVZKHQWKLQJVUHDOO\WRRNRIIIRUPH²,ZDVE\WKHQDVHQLRURIWKHVFKRROQRORQJHUD minnow at the beck and call of the matrics. I had forged strong bonds with my peers and was in a class of achievers. Everything changed when I became a Junior City Councillor and the Junior Mayor RI-RKDQQHVEXUJ1RORQJHUZDVVFKRROP\RQO\FRQFHUQEXW,ZDVFKDUJHGZLWKOHDGLQJWKH\RXWK RI-RKDQQHVEXUJDVDQDPEDVVDGRU,ZDVUHVSRQVLEOHIRURIWKHFLW\·VILQHVW\RXWKUHSUHVHQWDWLYHV and reported to the Mayor and Councillors of Johannesburg. The pressure was considerable and it ZDVYHU\GLIILFXOWWREDODQFHWKDWUROHZLWKP\DFDGHPLFZRUNORDG,PDQDJHGWKRXJKDQGDOWKRXJK I believe I could have done better in terms of results I gained immense satisfaction from being able to make an impact on the welfare of the city. Matric has undoubtedly been the most bitter-sweet year of my life. As Head Prefect I have been under immense pressure to ensure that the student body conforms to what is expected of it. It has been H[FHSWLRQDOO\FKDOOHQJLQJWRDFWDVDJREHWZHHQEHWZHHQWKHVWDIIDQGWKHER\VDQGLQPDQ\FDVHV, KDYHEHHQIRUFHGWRFRPSURPLVHWRP\RZQGHWULPHQW,KDYHHQFRXQWHUHGDODFNRIXQGHUVWDQGLQJ LJQRUDQFHHYHQIURPER\V,FRXQWHGDVIULHQGVDQGKDYHORVWIULHQGVDVDUHVXOW7KURXJKLWDOOWKRXJK ,KDYHHQMR\HGWKHH[SHULHQFHDQGZRXOGQ·WWUDGHLWIRUDQ\WKLQJ1RWKLQJEHDWVWKHIHHOLQJRIVWDQGLQJ RQVWDJHEHLQJJUHHWHGE\DWKXQGHURXVURDURIDSSUHFLDWLRQDVRQHRIP\VSHHFKHVKDVWKHGHVLUHG effect. It is a great reward for the effort I have put in! My years at King Edward have been the most satisfying and rewarding time of my life. The greatest RXWFRPH,IHHOLVWKHPDQ\IULHQGVKLSV,KDYHPDGHKHUH,QWKHFRXUVHRIILYH\HDUV,KDYHJDLQHG brothers who are the most loyal companions one could ask for. I know that although there is very OLWWOH WLPH OHIW IRU XV DV VFKRROER\V LQ \HDUV WR FRPH ZH ZLOO VWLOO EH DWWHQGLQJ VFKRRO IXQFWLRQV UHPLQLVFLQJRQWKHJUHDWWLPHVZHVSHQWWRJHWKHU2XUXQPLVWDNDEOHERQGDV¶7HGG\%HDUV·JXDUDQWHHV DWLPHOHVVXQHUULQJSOHGJHRIOR\DOW\ ,WZDVWKHEHVWRIWLPHV²QRWMXVWIRUILYH\HDUVEXWIRUWKHUHPDLQGHURIP\OLIH Chris MacRoberts Grade 12F

The Indian Family 7KH ,QGLDQ IDPLO\ ZKHWKHU WUDGLWLRQDO RU PRGHUQ LQ LWV YLHZV LV ZHOO HQGRUVHG DV EHLQJ D VWURQJ XQLWHG GLVFLSOLQHG DQG IXQFWLRQDO XQLW XSKROGLQJ PRUDO YDOXHV SURPRWLQJ HQFRXUDJHPHQW DQG furthering its position on the success meter. ,W·VLPSRUWDQWWRFRQVLGHUWKDWZKHQ,VD\IDPLO\,PHDQDOOWKHIDPLO\QRWMXVWDIDWKHUPRWKHUDQG WKHLUFKLOGUHQEXWDOOWKHLUFXWWLQJV7KHIDWKHUDQGPRWKHU·VJHQHUDWLRQ²VLVWHUVEURWKHUVFRXVLQV DQGWKHLUOHJDFLHVLQFOXGHG-XVWIURPWKLVLW·VFOHDUWKDWZKDWZDVRQFHWKRXJKWRIDVDVLPSOHIDPLO\ "get together" by the rest of the normal world is in fact non-existent in the party planning of the Indian Family. There are certain advantages with regard to having nine uncles and aunties; there are always VKRXOGHUV WR FU\ RQ ,W·V QRW WKDW EDG DIWHU DOO ZKHUH ZRXOG WKH IXQ EH ZLWKRXW WKH VFDQGDOV WKH 56


schemes and the feeling of living a PLGGD\ VRDS RSHUD WKH\ ZRXOGQ·W EH WKHUHLIZHGLGQ·WZDWFKWKHPULJKW"

6XUH ,QGLDQV DSSHDU WR EH VLPSOH DQG FRSLQJZLWKWKHLUOLYHVEXWWUXWKEHWROG ZH·UHDVFRPSOLFDWHGDVWKHUHFLSHVRI the food we eat. One of the major WRSLFV RI GLVFXVVLRQ SDUWLFXODUO\ RQ D sunny Sunday afternoon in a Fordsburg OLYLQJ URRP LV PDUULDJH 2I FRXUVH topics differ between sips of tea and ELWHVRIELVFXLWVEXWPDUULDJHVHHPVWR be the only one to prolong a sip (a sign RI LQWHUHVW LI WKH\ NHHS GULQNLQJ \RX know your nuptial tales are positively ODFNLQJ ,·YHQRWLFHGWKDWLWLVJHQHUDOO\ the older ladies that engage in these conversations. The younger ones are either too busy or already married. I find it fascinating. Weddings are also occasions where bored housewives whip out their extraVHQVRU\ FXSLGHQKDQFHG ELQRFXODUV and scout the surroundings for eligible EDFKHORUVVLQJOHZRPHQLQWKHFURZG DQG MXVW IRU D WRSLF RQ WKRVH 6XQGD\ DIWHUQRRQV D EXOJH XQGHU WKH EULGH·V KHDY\PXOWLOD\HUHGZHGGLQJGUHVV The stronger influence comes "Hidden Agendas" SUHGRPLQDQWO\IURPP\IDWKHU·VVLGHRI Michael St Dare Grade 10 F the family. With six brothers and three VLVWHUVZKRFDQDUJXH")URPWLPHWRWLPHIROORZLQJWKHVXUIDFLQJRIDQHZGLOHPPDRULVVXHWKH family orchestrates a large meeting where all the brothers and sisters come together to discuss the WRSLFDWKDQG2IFRXUVHJRLQJRQWKHOLQHVRIWKH&KLFDJR0DILDFLUFOHVQRVSRXVHVRUFKLOGUHQDUH HYHUDOORZHGOHDYLQJWKHVHPHHWLQJVDVVWULFWO\IDPLO\EXVLQHVV 5HIHUULQJWRWKHVWHUHRW\SHRIWKHQXPEHURISHRSOHLQYLWHGWRDQHYHQWRQHZLOOILQGWKDWLWLVLQIDFW not so stereotypical in its approach after all. Indians are very sensitive when it comes to invitations. ,QYLWLQJRQHEURWKHUWRDFHUHPRQ\DQGOHDYLQJDQRWKHUEURWKHURXWLVDVNLQJIRUWURXEOHEHFDXVH JHQHUDOO\ERWKZRQ·WJRLIWKHRWKHUGRHVQ·W :KHQLQYLWDWLRQVDUHOHIWDWRQHFHQWUDOSRLQWIRUDODUJHIDPLO\LW·VDFFHSWHGEXWQRWHQFRXUDJHG KDQGGHOLYHUHGSHUVRQDOO\DGGUHVVHGLQYLWDWLRQVDUHVPLOHGXSRQDQGWKHKRVWKDVDOUHDG\FUHDWHG a good impression of the festivities to come. The number of people at a function shows how much PRQH\RQHKDVDQGRQH·VSRSXODULW\ZKLFKLVDJRRGVLJQRIRQH·VFKDUDFWHU 0\EHVWIULHQG+DVKLPLVLQDUHDOSLFNOHRUDWFKDDU\RXFKRRVH+LVROGHUEURWKHU=DLQUHFHQWO\ EURXJKWKRPHDZKLWHJLUODQGWKLVLVKLVUHFROOHFWLRQRIHYHQWV0LFKHOOHLVD\RXQJVW\OLVKMRXUQDOLVW ZLWKORYHO\H\HVDQGDIDEXORXVSHUVRQDOLW\2QHSUREOHP+DVKLP·V'DGVDZKHUVNLQFRORXUEHIRUH DOOHOVHDQGKHZDWFKHGLQJUHDWWUHSLGDWLRQDVKLV'DG·VYHLQVSRSSHGRXWIDVWHUWKDQDQ\HDU 57


Indian shop keeper advancing on a toddler nicking some bubblegum. He remembers the scene like it ZDVWZRPRQWKVDJR«0LFKHOOHFDXWLRXVO\ZDONHGLQORRNLQJDVLID%HQJDOWLJHUZDVDERXWWRSRXQFH RQKHUXQH[SHFWHGO\VKHJD]HGDURXQGDWWKHVKLQ\RUQDPHQWVDQGGHFRUDWLRQVDQGVPLOHGWRJUHHW KLVIDWKHU+DVKLPDQGKLVSDUHQWVNQHZWKDWVRPHRQHZDVFRPLQJWRGLQQHUDZKLWHVRPHRQHQHYHU FURVVHGWKHLUPLQGVWKRXJK+LV0XPZDONHGLQDQGDOPRVWFROODSVHGIOLQJLQJKHUGHOLFDWHO\FUDIWHG 6XQGD\%LVFXLW%HVWVDOORYHUWKHFRIIHHWDEOHKLV'DGORRNHGDVLIKHZDVKDYLQJDVWURNHDQG+DVKLP just smiled back for inside he knew; he was now the good son! (YHU\RQHDWHFDOPO\VSHDNLQJQRZDQGWKHQDQG+DVKLP·VPXPVHHPHGWREHWKHRQO\RQHPDNLQJ an effort at civilized conversation. Have you ever watched those movies where two guys in a tight VSRWDVNLIWKHLUVLWXDWLRQZRXOGHYHUJHWZRUVHDQGLWUDLQV":HOOLWZDVDERXWWRSRXU -XVWDVWKH\WKRXJKWWKHFRDVWZDVFOHDU+DVKLP·VJRVVLS\DXQWZKRVHPRXWKPRYHVIDVWHURQWKH SKRQHWKDQDQDXFWLRQHHUZDONHGLQXQLQYLWHG:KLOH,·PRQWKHWRSLFLWLVFRQVLGHUHGE\,QGLDQVWR be too western to call before one visits and one should expect them to unexpectedly pitch up in the worst of times. A word of warning to all with Indian friends! 7KHWHQVLRQGLHGGRZQHYHU\RQHVSRNHSOHDVDQWO\+DVKLP·VGDGZDVZDUPLQJWRKHUDQGWKH\DOO left happily. 7KHQH[WPRUQLQJ« (YHU\RQH LQ +DVKLP·V HQWLUH IDPLO\ QRZ NQHZ WKDW KLV GDG KDG D VRQ ZLWK D ZKLWH JLUOIULHQG KH NQHZWKLVEHFDXVHKLVVLPSOHDXQWWKRXJKWKHGLGQ·WNQRZDQGSKRQHGWRWHOOKLPDQGDVNZKHQWKH engagement was going to take place. +HZDVVWLOOVPLOLQJ« ,QGLDQVKDYHUHDOO\PDGHLWELJLQ6RXWK$IULFDHYHU\ZKHUH\RXORRNWKHUH·VDFDIpVHOOLQJVDPRRVD·V DQ,QGLDQGRFWRUDQGZHDOONQRZRXUORFDOFHOHEULWLHV6FKDELU6KDLN'RQRYDQ0RRGOH\DQG5DMHVK RQ,VLGLQJR,IWKHUH·VRQHWKLQJWKDW,QGLDQVFDQGRZHOOLWVFURZGV(YHUEHHQWRWKH=RR/DNHRQ D6XQGD\"2UWKH=RQHDW5RVHEDQNRQD6DWXUGD\QLJKW"$IULHQGRQFHFRPSDUHGWKH=RR/DNHWR DEDWWOHVFHQHLQ7KH/RUGRIWKH5LQJVPRYLHVMXVWZLWKFHOOSKRQHVIRUVZRUGV%0:·VIRUKRUVHV and armour by Gucci! 8OWLPDWHO\LWERLOVGRZQWREHLQJD'XUEDQLWH7KH\ UHORXGFUDVVORYHWRSDUW\DQGFDQJHWORVWLQD GDUNURRPYHU\HDVLO\$SDUWIURPEHLQJDGRUQHGZLWKNLORJUDPVRIWKHILQHVWJROGFKDLQVJROGWHHWK JROGWRRWKVOLWVDQGEDQJOHVIRUDYLVLWWRWKH6SDUGRZQWKHURDGRQHQHHGVDGHJUHHWRXQGHUVWDQG what they are saying. If you've ever seen an authentic Durbanite go down to the coast and drive to WKHEHDFKGXULQJ(DVWHU\RX OOVHHZKDW,PHDQ :H·UHSURXGO\,QGLDQSURXGO\VFDQGDORXVDQGSURXGO\VHFUHWLYHVRLI,GLVDSSHDUDIWHUZULWLQJWKLV SOHDVHGRQ·WSDQLF,DPRQO\EHLQJIL[HGXS$QGDOO Imran Khan Grade 11E

58


"Divine Opression" Mahudu Nkadimeng Grade 12 F

No Access beyond This Point :RUGVRIDFUDFNGHDOHU« ,RSHQP\PRXWKWRVFUHDP« P\OLSV²VHZQVKXW ,JHWUHDG\WRUXQ« 0\IHHW²PDQDFOHG ,ZDQWWRFU\DZD\WKHSDLQ« My eyes blind to the world I mouth silent hatred at the sign Invoking the wrath of gods or devils ,WVWDUHVXQZDYHULQJO\EDFN «FRPSOHWHFRPSRVHG²LPPXWDEOHLQLWVLPPRUWDOLW\ 7KHKROHLQP\MDFNHWVDSVP\VRXOSURIDQLQJP\HOXVLYH sense of justice 0DOLFHULSVPHOLPEIURPOLPEWKHKDWUHGFKDVWLVLQJDQG mocking ,FDVWGRZQWKHEDQHRIP\H[LVWHQFHDVFUHDPLQJ symbol of my entrapment 6XGGHQO\P\FUDQLXPEXUVWVLQWRDPLOOLRQVKDUGV² cracked open by a mystical hammer - the voices - the voices - pent up for so long jostle for release 6RPHRQH·VVFUHDPSXQFWXDWHGWKHLPPLQHQWGDZQ :KRLVVFUHDPLQJ",WLVQ·WPH,FDQVFUHDP Daniel Erasmus Grade 11E 59


THE MINERS DEEP WITHIN THE MURKY EARTH THE MEN WHO EVISCERATE METAL FROM SOIL 72,/$1'6:($7²$&2167$17)($5 '$<,61,*+7$0217+$<($5 FEEBLE BEAMS OF WAVERING LIGHT DISCERN THE SHADOWS FROM THE NIGHT )257+(<$5(,1(;3/,&$%/<-2,1(' ¶7(5525·,67+(7(507+(0,1(56·&2,1(' %8767,//7+(<6/$9(,17+(($57+·6%(/2: &205$'(6²)$7(675,&.(1)(//2:6 ),9(,17+(0251,6:+(17+(<:$.( AND NOT FROM COLD DO THEY SHAKE. %,57+(')5207+(:20%$7),9($1(: %52.(1)520$0$1&5(: FOR THESE ARE THE BIOGRAPHIES OF THE CHOSEN )(::+27+(681/,*+7+$7+1(9(5.12:1« 7+(0(1'((3:,7+,17+(7811(/6$1'',57<)$&(6 WITH SWEAT-RUN FUNNELS. Daniel Erasmus Grade 11E

"Painting" Kgabe Molepo Grade 8 B 60


"Still-life" Tau Chokoe Grade 12 A


Afrikaans Skeppende Werk Stemme agter die tronkdeure Die kamer: koud en stil. Oë wat styf na my staar. My polse so vinnig soos â&#x20AC;&#x2DC;n jagluiperd. Die sweet warm onder my armholtes soos asyn in â&#x20AC;&#x2DC;n oop wond. /HZHQVODQNVNUHHGLHUHJWHU0\KDUWLQP\ NHHOP\VSDQQLQJE\EUHHNSXQWHQGLHZRRUGH ZDWKDUGLQP\RUHNORS«0\OLJJDDPLQGLH tronk. 'LHWURQNVHOLVNRXHUDVGLHKRIVHO²HONHEHHQ vries in my liggaam. Hel op aarde. ¶Q%HG¶QWRLOHW¶QZDVEDNP\MXZHOH+RH kon ek so onnosel wees? Ander mense kom GDDUPHHZHJKRHNRPQLHHNQLH":DWJDDQQRX gebeur? 6WHPPHVWHPPHZDWLQP\NRSZHHUJDOP0\ JHOLHIGHVZRQGHUOLNHYURXSUDJWLJHGRJWHUWMLH Die trane begin van my geskeerde wange loop. Ek sal hulle nooit weer sien nie. Partykeer hoor HNGLHPRQVWHUVWHPYDQGLHNRQVWDEHOZRRUGH soos â&#x20AC;&#x2DC;n duisend vliegtuie wat oor my kop vlieg. 'LHWUDQHEHJLQZHHUYU\OLNORRS²HNZLOQHW huis toe gaan.

"Get Me Out!" Amu Maluleke Grade 10 E

7RHVNLHOLNKRRUHNGLHVWHPYDQP\GRJWHUWMLH haar eerste dag by die skool. Ek sien haar voor P\VWDDQ'LHZLQGZDWVDJJLHVZDDLKDDUJOLPODJVREUHHGVRRV¶QUXJE\YHOG0\RsVWDDUQDQLNV QLH0\JHGDJWHVNHHUVNLHOLNWHUXJQDGLHZHUNOLNKHLGWRH²YRRUP\·QNORPSNRXHWUDOLHV (NEHJLQRQUXVWLJRSHQDILQGLHWURQNVHOORRS6WHPPHDOZHHUVWHPPHPDDUQLHGLHZDUP SUDJWLJHVWHPPHYDQP\JHOLHIGHVQLH²DOZDWP\QRJOHZHQGLJKRX+LHUGLHNHHULVGLWGLHVWHP YDQP\VODJRIIHUKRRIS\QYHUVNULNOLNHKRRIS\Q6\ZRRUGHEUDQGVNHUSLQP\EUHLQVRRV¶QZDUP PHVGHXUERWWHU(NZRUGEDQJYUHHVOLNEDQJ

(NEHJLQKXLOEDLHKXLO'LHWUDQHZDWVRRVZDWHUYDOOHRRUP\JHVLJORRS0\ZRQGHUOLNHYURX P\GRJWHUWMLHP\KXLVP\ZDUPEHGZDUPNRV²DOOHVZHJJHJRRL+LHUGLHVWHPPHPDDNP\JHN Eers goeie stemme dan slegte stemme. Ek begin hard skree. 'LHVWHPPHLQP\NRSVRRVVNHUSPHVVHGHXUP\EUHLQGLHVWHPPHZDWP\GDDJOLNVJHNPDDN daagliks doodmaak. Die stemme wat my ses voet ondergrond sal neem. Rudi Aucamp Graad 12A

62


Drome +DUGHJHOXLGHZDWGLHSLQP\EUHLQSRPS+XLVZHUNKRSHKXLVZHUNZDWRSP\OHVVHQDDUOr0\ SROVVW\JVRRVÂśQWHUPRPHWHURSÂśQVRPHUVGDJ+LHUGLHLVP\OHZHP\ZDUHOHZHQVW\O Skielik is alles beter. My bloeddruk is normaal. Skielik voel dit asof my hele liggaam dryf. Ek voel VRNDOP(NKHWJHHQEHNRPPHUQLVVHQLH7RHKHWGLWP\JHWUHI²HNLVLQÂśQGLHSVODDSP\GURPH KHWP\QDP\GURRPZrUHOGWRHJHQHHP (NKRXEDLHYDQP\GURPHZDQWKXOOHUHGP\YDQVSDQQLQJZDWHNJHGXUHQGHGLHGDJNU\+XOOH YDWP\QDP\JXQVWHOLQJSOHNNHHQODDWP\DOW\GWXLVYRHO,QP\GURPHNDQHNHQLJHLHPDQGZHHV enige iets doen. Ek kan die president van Amerika wees en die kaptein van die Springbokke. My drome laat my sterk voel. Ek is die man van die oomblik. My geliefkoosde drome is die drome waar ek in â&#x20AC;&#x2DC;n bos is. Die pragtige sonsondergange wat my asem wegslaan. Die soet reuk van die mĂ´re wat diep in my neus opslaan. Skielik sien ek â&#x20AC;&#x2DC;n pragtige koedoe wat water drink. Die ou bul drink sy water met geen kwellinge nie. Hy lyk sterk en gesond. Sy pragtige horings wat soos â&#x20AC;&#x2DC;n trap na die hemel lyk. 'LHERVLVP\HHQSOHNZDDUHNWXLVYRHO'LHERVODDWP\OHZHQGLJYRHO$VHNLQP\ERVLVKHW ek geen bekommernisse nie. My drome red my van spanning. Maar ek besef dat ek nie altyd na â&#x20AC;&#x2DC;n GURRPZrUHOGKRHIWHJDDQQLH0\ lewe saam met vriende en familie is beter as enige droom! Rudi Aucamp Graad 12A

"Painting" Dane Steinhobel Grade 8 A 63


Vryheid Voete. My voete. Op groen gras wat swaai van kant tot kant met die asem van die Weste wind. :DDU¡VHN"/\NVRRVGLH1DWDOVH0LGGHOODQGHPDDUKRHLVGLWPRRQWOLN" 'DDULQGLHGXLVWHUQLVÂśQVNUDSLHERGLHKRULVRQGDDUVN\QLHWVGLWVN\QVRRVÂśQGXLVHQGVWHUUHRS â&#x20AC;&#x2DC;n pikswart aand. Dit gee lig en lewe aan alles wat dit raak. (NVWDDQGDDUHQEHZRQGHUGLHOHZH2PP\QHWZDDUHNN\NO\NDOOHVQHWSHUIHN$OOHVLVLQ harmonie met die res van die doek. 0\RsN\NOLQNVHQVLHQPDVVLHZHEUXLQPRQXPHQWHJHNOHXUPHWVSURHWHYDQJURHQEHUJH0\Rs GZDDOGDQVLHQHNGLHVNLWWHUHQGHEORXZDWHUZDWYDQGLHULYLHUNUXLS My

spring gedagtes

! rond

gaan Wat

aan?

Die lig. Dit is lig. Ek kan nie genoeg van die lig kry nie. Dit trek my al hoe nader. Wat is daardie lig? (NWUHNP\VSLHUHVW\ZHUHQEHJLQORRSORRSLQGLHRPJHZLQJYDQGLHVWUDOHQGHOLJ(NYHUQLHOGLH JUDVPDDUQLNVPDDNQRXVDDNQLHEHKDOZHGLHOLJ Ek is amper daar. Ek haal nou vinnig asem. Kan nie my oĂŤ van die interessante lig afneem nie. Ek VWHHNP\NDDOEHZHQGHKDQGHXLW(NVWUHNP\OLJJDDPRPE\GLHOLJXLWWHNRP:DWLVGDDUGLH lig? Amper daar! Twintig sentimeter! Vyftien sentimeter! Vyf sentimeter! 1LNVVZDUWSLNVZDUW:DWJDDQDDQ":DDULVGLHOLJ"$VHPNU\DVHPÂśQ'URRPGLWZDVQHWÂśQ droom. Party vrae het geen antwoorde nie. :DWÂŤZDVGDDUGLHOLJ" Carl Muller Graad 12F

64


Suid-Afrika Suid-Afrika met ons reĂŤnboognasie is vol verskillende kulture. Hierdie ODQGYDQP\JHERRUWHKHWDOEDLH deurgemaak. Ons land se demokrasie is nou tien jaar oud en ons het EDLHSUHVWHHU6XLG$IULNDLVÂśQEDLH interessante land. Ek geniet dit om hier te bly. Suid-Afrika het nege provinsies en almal is baie uniek. Vanaf Limpopo tot Kaapstad is daar baie mooi plekke om te besoek. Daar is ook fantastiese vakansiebestemmings soos X6KDNDLQ'XUEDQ*ROG5HHI&LW\LQ Johannesburg en die Kruger Wildtuin in Mpumalanga. Maar ons land is nie heel sonder Robin Eiland nie. Meeste van ons land se geskiedenis het hom hier afgespeel. Ons land het een van die beste leiers LQGLHZrUHOGHQVDDPPHWRQVYRULJH SUHVLGHQWZHUNKXOOHRP6XLG$IULND te bou. Ons sport is ook van die EHURHPGVWHLQGLHZrUHOG2QV krieketspan tel onder die bestes en ons rugby bloei op die oomblik. Ons swemspan het ons nasie trots gemaak met hulle optrede in die Olimpiese Spele. In gholf het ons Ernie Els en Retief Goosen wat die SuidAfrikaanse vlag hoog hou.

"Sista Afrika" Shingi Nkungu Grade 12 A

2PÂśQ6XLG$IULNDQHUWHZHHVLVQLH DOW\GPDNOLNQLHPDDURQVPDDNGLH beste van ons situasie. Ons land besit so baie kulture en gelowe. Ons LVVRYHUVNLOOHQGPDDUDOPDOKHW dieselfde gees. Suid-Afrika se mense is van die vriendelikste mense in die ZrUHOGHQPHHVWHPHQVHKLHUNRP met mekaar oor die weg. Viva Suid-Afrika! Gladwyn Leeuw Graad 12F

65


Die belangrikste oomblik in my lewe Die saal was doodstil. Die hoof het my naam gelees. My hart het soos â&#x20AC;&#x2DC;n duisend dromme geklop. 'LHJHOXLGYDQWZHHGXLVHQGKDQGHZDWNODSKHWGLHKHOHVDDOGRRIJHPDDN'LHRRPEOLNZDDURRU HNP\KHOHOHZHJHGURRPKHWKHWZDDUJHZRUGÂŤÂŤ My bene was soos sagte malvalekkers en my hart het baie hard geklop. Ek het uiteindelik my akademiese das ontvang. My drome het waar geword. Dit was die belangrikste dag in my lewe. Ek het my rooi das met trots gedra. 'LWKHWDOODQNJHOHGHEHJLQWRHHNGHXUGLHÂśJURRW¡KHNNHYDQ.LQJ(GZDUG9,,6FKRROJHVWDSKHW (NZDVNOHLQPDDUP\GURRPZDVJURRW1RXYLHUMDDUODWHULVGLHKHNNHNOHLQHQHNJURWHUPHW my droom in my sak. Is God nie fantasties nie! Hoeveel mense se drome word waar? Ek voel WURWVJHOXNNLJHQEDLHGDQNEDDUWHHQRRUGLH+HUH Maar dit het nie maklik gekom nie. Dit was baie harde werk en dit het baie toewyding gekos van my kant af. My naweke was nie PHHUÂśP\¡QDZHNHRPWHMROQLHGLW was vir skoolwerk. Maar ek het sport aanhou speel en tog ook â&#x20AC;&#x2DC;n bietjie uitgegaan. 1RXHHQZHHNODWHUKHWHNYDQGLH wonderlike hoĂŤ wolke aarde toe geglip. Met â&#x20AC;&#x2DC;n knal moet ek weer hard werk en my punte in skool hoog hou. 'LHWRHNRPVLVODQNHQGDDUOrEDLH groot stene in die pad. Met elke GURRPHQGRHOLQP\OHZHPRHW HNEHSODQQLQJHQGLVVLSOLQHKr1HW VRRVGLHKHPHOYROZRONHLVLVP\ OHZHYROGURPHÂŤ Mohamed Ismail Graad 12A

"Still-life" Claudio Sousa Grade 10 F 66


"Still-life" Lesego Vorster Grade 11 B

â&#x20AC;&#x2DC;n Onvergeetlike oomblik 0\KDUWNORSYLQQLJHUP\SDOPVVZHHW ek sukkel om asem te haal. Sy staan YRRUP\VRRVXLW¶QGURRP+LHUGLH PHLVLHLVYHUVNLOOHQGV\ZDVDQGHUVDV DQGHUPHLVLHV6\GRHQLHWVPHWP\V\ ODDWP\EHVRQGHUVYRHO²GLVKRHNRP ek haar gekies het. 'LHZRONHKHWJHVNHLGDDUZDV¶QJORHG GLWZDV¶QHQJHO6\ZDVSHUIHNPRRL VNLWWHUHQGZXOSV'DDULVQLHJHQRHJ ZRRUGHLQGLHZrUHOGRPKDDUWH beskryf nie. Ek is seker jy kan sien dat ek verlief is. (NKHW*RGJHYUDZDWHNPRHVGRHQ maar ek het geen antwoord gekry nie. (NZRXPHWKDDUSUDDWPDDUHNNU\ geen antwoord nie. Ek wou met haar SUDDWPDDUHNZDVWHEDQJHQWHVNDDP (NZDVVRVHQXZHHDJWLJPDDUM\NDQ nie my die skuld gee nie. As jy â&#x20AC;&#x2DC;n godin VRRVKLHUGLHPHLVLHVLHQVDOM\RRN sukkel om enige iets te doen. $OPDOVrGDDULVQHWHHQPHLVLHYLUHONHPDQ%DLHPHQVHVRHNKXOOHKHOHOHZHYLUKLHUGLHSHUVRRQ ek het myne gevind en ek is net sewentien. 'LWLVQLHJRHGJHQRHJRPQHWGLWWHVrQLH(NPRHVYLQQLJRSWUHHHQKDDUODDWZHHWKRHHNYRHO (NKHW¶QSODQJHPDDNPDDUQHWYRRUHNJHQRHJPRHGE\PHNDDUJHUDDSKHWZDVV\ZHJ0\NDQV P\HQLJVWHNDQVRPPHWP\HQJHOP\JRGLQWHSUDDWZDVZHJ (NZDVKDUWVHHUHNKHWJHGLQNP\OHZHVRXRSKRX(NKHWJHGLQNGDWHNP\HQJHOODDW weggaan het. 1HWYRRUHNRSJHKRXKHWRPKDDUWHVRHNKHWHN¶QVWHPJHKRRUGLWZDVVRRV¶QKDUSLH6\KHW P\JHVRHNV\KHWP\JHYLQGV\KHWGLHVHOIGHJHYRHOV\ZDVRRNYHUOLHI'LHUHVZDVJHVNLHGHQLV Elke pot het sy eie deksel en ek het myne gevind. Warren Brockway Graad 12A

67


Liewe dagboek Liewe dagboek Hoe gaan dit?

Ek weet nie of ek in ‘n droom is nie Dit kan nie wees nie Wat is verkeerd met my???? Ek dink ek is verlief Daar is net een meisie wat so pragtig en skitterend kan wees. Daar is net een meisie wat ‘n persoonlikheid kan hê soos sy. Daar is net een tipe meisie soos sy en dit is my meisie. Dit is Kirsty ….. !!!!!!!!!!!! Kirsty Wag ‘n bietjie – ek is dors – ek sal nou-nou terug wees. Waar was ek? O ja, …. Kirsty!!!

Can

x dice x Kirsty

Daar is nie woorde wat haar behoorlik kan beskryf nie. Sy is perfek net soos sy is. Wade Peterson Graad 12A

68


Drome 'LHJURZZHYHOYDQGLHNURNRGLORQGHUMRXEHGGLHXUHZDDUM\LQGXLVWHUQLVYDOGLHGDHZDDUM\ VNLHOLNZDNNHUZRUGM\OrGDDUWXVVHQVZHHWHQEO\VRHNQDDVHP-RXNRSVrYLUMRXGDWGLWQHW MRXYHUEHHOGLQJLVPDDUGLWYRHODVRIGLWDOOHVUHJWLJJHEHXUKHW My verbeelding is gewoonlik baie aktief en dit word moeilik om die verskil tussen drome en die werklike lewe te sien. 'URPHLVP\RQWVQDSSLQJYDQGLHOHZHZDWYROSUREOHPHHQIRXWHLV,QP\GURPHLVDOOHVSHUIHN ek kan enige iets doen en enige iemand wees. %DLHPHQVHGURRPYDQJRHLHW\HZDWKXOOHJHKDGKHWÂśQJRHLHYDNDQVLHRISDUW\WMLH7HUZ\OM\ GURRPNDQM\LQMRXNRSQDGDDUGLHSOHNNHJDDQ1LNVNDQP\NHHUQLH(NNDQYLQQLJHUDVÂśQ motor hardloop en hoĂŤr as â&#x20AC;&#x2DC;n berg spring. 0\OHZHLVJHZRRQOLNÂśQJHPRUVHNKHWVRYHHOZDWLQP\OHZHDDQJDDQHQHNNDQGLWSDUW\NHHUQLH hanteer nie. Baie verskillende goed eis my tyd en ek moet gewoonlik soos â&#x20AC;&#x2DC;n mal haas rondhol. 6NRROHQVNRROZHUNQHHPPHHVWDOYDQP\W\GLQEHVODJPDDUZDWYDQP\W\GRRUEO\PRHWHN WXVVHQGRHGHOVDNRUNHVZHHUPDJRUNHVPXXUEDONHUNHQYULHQGHGHHO'LWLVDVRIHNQLHPHHU beheer oor my lewe het nie. 'URPHLVÂśQPDQLHURPYUHGHPHWGLHZUHGHZrUHOGWHPDDN0HQVHRQWKRXQLHDOW\GKXOOH GURPHQLHPDDUDOPDOZRUGJHZRRQOLNZDNNHUVRQGHUYUHHVHQEHNRPPHUQLVVH Drome is belangrik om van my probleme ontslae te raak en dit te laat verdwyn tussen goue OLJVWUDOHÂŤÂŤ Ivan Pieterse Graad 12F

"Training Day" Ngcebo Ndlovu Grade 10 D 69


Lewenslange vennootskap: My skool 0\VNRRO.LQJ(GZDUG9,,6FKRRO â&#x20AC;&#x2DC;n Skool met passie en deursettingsvermoĂŤ. â&#x20AC;&#x2DC;n Skool soos my skool is in â&#x20AC;&#x2DC;n klas van sy eie en my vennootskap met KES sal definitief lewenslank wees. .(6GRHQYHUVNULNOLNJRHGLQDOOHDVSHNWH RIGLWQRXDNDGHPLHNXOWXXURIVSRUWLV Maar dis nie waar KES stop nie. By KES leer jy om alles wat jy doen uit jou hart te doen en saam met jou vriende te werk. Al die leerders in die skool het â&#x20AC;&#x2DC;n sekere vehouding met mekaar wat onmoontlik is om te breek. Jonger leerders by KES het respek vir ouer leerders wat aan die einde van die ketting â&#x20AC;&#x2DC;n sterk hierargie maak. Elke leerder het respek vir volwassenes wat ook â&#x20AC;&#x2DC;n asemrowende indruk op besoekers maak. Dit is wat King Edward VII School anders as ander skole maak.

"Perspective Storm" Jed Aylmer Grade 10 D

'LHEHODQJULNVWHNZDOLWHLWZDWE\.(6JHNZHHNZRUGLVVHOIUHVSHNHQVHOIGLVVLSOLQH(ONHSHUVRRQ in ons skool is trots om daardie groen baadjie aan te trek met die wapen digby jou hart. Elke persoon hou die rooi gees naby sy hart. Maar daar is â&#x20AC;&#x2DC;n hartseer deel aan die storie. KES is besig om agteruit te gaan. Die moderne lewe steel respek. 2QVNDQHJWHUZHHUGLHUHVSHNWHUXJVWHHO²NRPRQVVSDQVDDPHQJHEUXLNRQVKDUWHRPRQVSDG te wys; die pad na die rooi gees toe. Kom ons maak ons matriekjaar â&#x20AC;&#x2DC;n sterk een. 5('²KLHUNRPRQV Barry Cilliers Graad 11F

70


â&#x20AC;&#x2DC;n Spookstorie 'LWZDVÂśQNRXHZLQWHUVDDQGGLHODDVWHGDJYDQGLHVNRROYDNDQVLH'LWKHWEDLHKDUGJHUHsQHQGLH weerlig het die hemel geel gekleur. 2SKLHUGLH9U\GDJLVHNQDÂśQSDUW\WMLHLQ+RXJKWRQJHQRRL(NZRXHHUVQLHJDDQQLHPDDUP\ vriend het my gesmeek om saam met hom te gaan. Oppad partytjie toe het ek slegte prentjies in my kop gesien. (NKHWÂśQVOHJWHJHYRHORRUGLHSDUW\WMLHJHKDGPDDUHNZRXQLHP\PDDWLQGLHVWHHNODDWQLH7RH HNQDKRPJHN\NKHWKHWHNJHVLHQGDWV\NHHODIJHVQ\ZDVHQGLHGHUPVKDQJE\V\NHHOXLW(N KHWP\RsWRHJHPDDNGLWZHHURRSJHPDDNHQDOOHVZDVZHHUQRUPDDO Ons het by die partytjie uitgekom. Ons het na die hek toe geloop en die hek het outomaties oopgegaan. Die tuin was vuil en onversorg. Daar was mensbene en liggaamsdele oral. Die gras was aan die brand en uit die vuur het â&#x20AC;&#x2DC;n spook vol bloed op ons afgepyl. Ons het na die huis JHKDUGORRS²GLHHUJVWHQDJPHUULHKHWZDDUJHZRUG 'DDUZDVEDLHPHQVHE\GLHSDUW\WMLHPDDUKXOOHZDVDOPDONDDOHQKXOOHZDVYROEORHGJHYHUI0\ vriend het mal geword: sy vel gesny en sy hart uitgehaal. Die vrouens het sy bloed begin drink ²GLWKHWJHO\NDVRIKXOOHÂśQNRXH glas bier drink. Ek het begin sweet en my hart het honderd myl in my borskas geklop. Ek was verskriklik bang. Al die mense het ewe skielik in my rigting gekyk. Hulle het stadiger ÂŤVWDGLJHUQDGHUJHORRS(NKHW omgedraai en begin hardloop. Die aarde het gekraak en daar het meer GXLZHOVXLWJHNRP'DDUZDVEORHG bene en vrot vel orals. Die reĂŤn het in bloed verander. Toe ek by die voorhekkie van vrede JHNRPKHWKHWHNJHVWUXLNHOHQ geval. Dit het gevoel of rotte my verorber. My oĂŤ het oopgegaan en HNKHWJHVNULN²GLWZDVDOOHVQHW dagdromery. Claudio-Rossi Block Graad 11F

"The Voodoo Lesson" Dimitri De Kachtrou Grade 12 F 71


Hedendaagse gesin $V6DORPRPRHWVLHQZDWYDQYDQGDJVHJHVLQQHZRUGVDOK\VHHUVHNHUOLNÂśQKHOHERHNZ\VKHGH net hieroor kon skryf. Ons hedendaagse gesinne is besig om inmekaar te tuimel. Ouers baklei met mekaar terwyl kinders toekyk en luister. Die kinders volg hierdie voorbeeld en probeer mekaar vermoor voordat hulle nog uit hulle doeke is. Die kostes van die hedendaagse lewe YHUKRHGGDWJHVLQQHJURHL²KXOOHZRUG kleiner omdat dit so duur is om kinders groot te maak. Ouers moet sonder ophou werk om hierdie gesinne aan die gang te hou. En wat is die gevolg hiervan? Ouers het nie meer tyd vir mekaar en hulle gesinne nie. Hulle is emosioneel en liggaamlik so moeg as KXOOHE\GLHKXLVNRPGDWKXOOHJHHQ geduld oorhet om na hulle kinders en hulle probleme te luister nie. Die jeug van vandag is emosioneel arm en uitgehonger. Tegnologiese ontwikkeling neem nou familietyd in die aande oor. Wat het van die goeie ou gesinsete om die eetkamertafel geword? Nou gryp elkeen net â&#x20AC;&#x2DC;n bord kos en gaan kruip agter die flikkerende skerm weg. Omdat ouers nie meer kwaliteittyd aan kinders kan spandeer nie - word hulle oorlaai met geskenke en hope geld. Ouers probeer KXOOHJHZHWHVXVPDDUKXOOHEHVHIQLHGDW net tien minute elke dag van onskatbare waarde kan wees nie. Moet my egter nie verkeerd verstaan nie. 2QVGLHMHXJLVQLHVRQGHUVRQGHQLH Ons sien elke swakpunt in ons gesinne raak en buit dit uit. Om op jou ouers VHJHYRHOWHVSHHOLVLHWVZDWHONHNLQG van kindsbeen af geleer het. Kinders wil YDQGDJQHWRQWYDQJHQKrPDDURQVOHHU nooit om daarvoor te werk nie. Ons het gemaksugtig en selfsugtig geword.

"Painting" Luca Pontiggia Grade 9 G

Ek wonder watter wysheid ou Salamo vir ons sou gee? Les Salmon Graad 11F 72


Die plattelandse droom (NYRHOGLHNRXHVDQGRQGHUP\YRHWH van die vroeĂŤ oggend dou. :DQWGLHEORHNRPERPHKRXWURX die eerste tekens van lente. (NVLHQGLHODNVPDQYDQNRULQJ hardwerkend in sy roem. Kan hy vir ons hulde bring? Ons op ons name noem? Net die lusern weet van GLHZLQGVHIOXLVWHU die son vlak in die rand. (QQHWVRXLWGLHGXLVWHU besef ek dis hemel op die platteland. Barry Cilliers Graad 11F

"Painting" Matthew Osbourn Grade 8 B

Raad aan Claudette AAN: Claudette â&#x20AC;&#x2DC;n Persoon met morele waardes sal weet dat dit absoluut oneties is dat â&#x20AC;&#x2DC;n leerder en opvoeder meer as net dit kan wees. Om UHJWHPRUHOHZDDUGHVWHKrLVHHQYDQGLH belangrikste karaktereienskappe.

Julle is albei besig om julle lewens te verwoes en omver te gooi as dit rugbaar gaan word. My raad aan jou is om dit so gou as moontlik WHVWRSYRRUGDWGLWWHYHUNDQJDDQ-RXKHOH OHZHOrQRJYRRUHQPRHQLHQRXGDWMRX emosies met jou weghol nie. Die besluit kan DOOHVZDDUYRRUM\QRJZLOZHUNEHOHPPHU

As jy gaan toelaat dat hierdie opvoeder VDWLVIDNVLHJDDQNU\VDOM\MRXWRHNRPVSODQQH en al jou doelwitte moet prysgee. Ek glo nie dat dit werklik die moeite werd sal wees nie.

2QWKRX9URHJU\SYURHJYURW

Groetnis: Marc Middleton Graad 10B 73


Ek die wenner Ek kan my oĂŤ nie glo toe ek die nommers van die Lotto in die koerant sien nie. Ek het gewen! 2SP\RXGHUGRPLVHNÂśQPLOMRHQrU0\PDVDOP\VHNHUQRXYHUJHZHGDWHNGLHNDDUWMLHJHNRRS KHWLQSODDVYDQGLHEURRGZDWV\ZRXKr 'LHHHUVWHGLQJZDWHNVDOGRHQLVRPÂśQYDNDQVLHKXLVE\GLHVHHLQ%DOOLWRYLUP\JHVLQWHNRRS 'DQVDOHNWZLQWLJGXLVHQGUDQGYLUP\NHUNVNHQN9HUGHUVDOHNYLUP\PDSDHQEURHUEDLH JHVNHQNHNRRS9LUP\VHOIVDOHNGLHPRRLVWHPRWRUILHWVZDWEORXHQVLOZHULVNRRS0LVNLHQ YROJHQGHMDDUVDOHNÂśQVQHOERRWNRRSHQHNVDODOP\YULHQGHQRRLRPVDDPPHWP\ÂśQYDNDQVLHWH geniet. Die res van die geld sal ek in die bank sit om iewers die hoogste rente te verdien. (NLVVREO\GDWHNYLUP\HLHVWXGLHVVDONDQEHWDDOGDQNDQPDHQSDGLHJHOGYLULHWVDQGHUV JHEUXLN(NPRHWHJWHUÂśQELHWMLHYHUVLJWLJZHHVZDQWQRXZLODOPDOP\YULHQGZHHVYHUDO RQEHNHQGHSHUVRQH(NZHHWGDWHNGLHVHOIGHSHUVRRQVDOEO\GDWHNQLHVDOYHUDQGHUQHWRPGDW ek nou ryk is nie. Ek is dankbaar dat ek hierdie geld gewen het. Jason Lumsden Graad 9G

"Painting" Dominic Booth Grade 9 E 74


"Hidden Facial Bones" Ciaran Haynes Grade 10 D

My ouers Familie is baie belangrik en ek is dankbaar vir my ouers. (NLVEDLHJHOXNNLJZDQWP\RXHUVLV en was nog altyd daar vir my. Hulle ondersteun en help my in alles wat ek doen. My ouers staan by my deur dik en GXQJRHLHHQVOHJWHW\H0\SDLVP\ grootste ondersteuner in alles wat HNDDQSDNYHUDORSGLHVSRUWYHOG+\ spoor my aan om ten alle tye my beste te gee en om positief deur moeilike tye te bly. Hy laat my goed voel ook as ek nie â&#x20AC;&#x2DC;n goeie vertoning OHZHUQLH2PWHZHQLVQLHDOW\GGLH belangrikste ding nie. Hoe meer tyd HNVDDPPHWP\SDGHXUEULQJKRH EHWHUZRUGRQVYHUKRXGLQJZDQWHN leer deur sy voorbeeld te volg en goed vir ander mense te wees. My ma is â&#x20AC;&#x2DC;n perfekte voorbeeld YDQ¶QOLHIGHYROOHVRUJVDPHHQ ondersteunende persoon. Sy is altyd daar om my moed in te praat as die lewe te veel word. Sy ZHHWSUHVLHVZDWRPWHVrRP¶QJOLPODJRSP\JHVLJWHSODDV6\VSDQGHHUDOKDDUW\GQHWDDQ KDDUJHVLQ²P\VXVVLHHQHN²HNZHQVV\ZLORRNW\GDDQKDDUVHOIVSDQGHHU²GLWVDOP\EDLH gelukkig maak. (NZHHWGDWP\PDDOW\GGDDUVDOZHHV²YDQ¶QWRRQVWDPSWRW¶QOHNNHUWRHEURRGMLH Christopher Snow Graad 10B

75


#13 Bevry jou verbeelding (NORRSGHXURQVVWUDWH(NZRUGPHWJHOXLGHRPKHOVPDDUKLHUGLHLVQLHJHOXLGHYDQEO\GVNDS of gelukkigheid nie. Hierdie is geluide van moord en misdaad. Ek word omsingel deur haat en NRUUXSVLH0DDULQP\NRSEO\GUDDLGLHYUDH+RHNRPLVGLHPHQVVRÂśQEDUEDDU"+RHNRPGRHQ ons soveel onreg aan ons mensdom? Daar is â&#x20AC;&#x2DC;n tyd en â&#x20AC;&#x2DC;n plek vir alles en soms is jy op die verkeerde plek op die verkeerde tyd. Maar daar is geen rede hoekom â&#x20AC;&#x2DC;n klein onskuldige drie-jarige verkrag moet word nie. Dit is tyd om ZDNNHUWHZRUGHQGLHNRIILHWHUXLN'LWLVW\GRPKLHUGLHRQUHJKDDWHQPLVGDDGVWRSWHVLW Die lewe is te kort om dit te mors. Gewoonlik is daar â&#x20AC;&#x2DC;n lig wat ons probeer lei. Maar in ons daaglikse lewe is ons te besig om net vir â&#x20AC;&#x2DC;n oomblik stil te sit en te dink wat ons van ons reguit pad aflei. Jare gelede is â&#x20AC;&#x2DC;n voorbeeld gestel. DiĂŠ voorbeeld kan al hierdie aardse dinge uitroei. As RQVQHWKLHUGLHYRRUEHHOGYROJ VDORRUORsQLHEHVWDDQQLHGLH mensdom sal weer suiwer wees. Dit is tyd om terug te keer na ons basiese beginsels en ons lewe te herlaai met goeie vaardighede. 'LWLVW\GRPHHUGHURSWHERX as om af te breek. Dit is tyd RPGLHZrUHOGWHKHUERXRSGLH vaste grond van ons Hemelse Vader. Want dit is dan wanneer HONHGLHUWMLHYRsOWMLHHQPHQVÂśQ doel het om te bestaan. Jean Hamann Graad 11E

"Still-life" Mothei Letlabika Grade 11 C

76


Help! Heatherlaan 345 Lilianton Durban 1654 22 Februarie 2005 Liewe Iemand HELP!HELP!HELP! Ek haat myself! Ek haat my lewe! Ek smag na ‘n koue koeël wat my verwoeste lewe gaan beëindig. Ek haat myself! Ek haat my lewe! Ek smag daarna om hierdie gevoelens en negatiewe aspekte te verbrand. Ek haat myself! Ek haat my lewe! Die lewe het nie meer sin nie, die lewe is soos ‘n swaar wolk wat my liggaam insluk. Dit skep ‘n atmosfeer waar niemand jou meer vertrou nie en jy vind dat die lewe niks meer beteken nie. Die mense gee nie mense wat hulleself blameer, ‘n kans nie. Hierdie gedagte gee my die krag om die lang loop teen my kop te druk soos ‘n dief wat geen waarde vir lewe het nie. Ek is ‘n redelose dier wat nie meer die reg het om te lewe nie. My hart pomp oortyd, ek raak gespanne en sweet breek op my kop uit……. Ek trek die sneller …… en …….. Jammer ek is selfsugtig, as ek maar net nog een kans kon kry ……. ek smeek uit die diepte van my hart ……………. HELP!

HELP!

Help!

Jean Hamann Graad 11E

"Life on Drugs" Rory Diale Grade 11 B 77


Vriende Mainlaan 200 Ferndale Randburg 2026 20 Februarie 2005 Beste Brandon Ek is baie dankbaar dat jy deel van my lewe was. Hierdie vriendskap sal die afstand oorleef, al het jy na ‘n ander skool gegaan. Onthou jy hoe ons vriende geword het? Ons het elke dag die bus net-net verpas – altwee te lui om te hardloop om betyds te wees. Jy was daagliks by my huis na skool en het begin om my baie goed te ken. My ma het gesê dat jy so dikwels by ons huis was, dat jy een van die dae huur moes betaal. Jy was een van ons gesin – soos ‘n broer vir my. Ons het dieselfde dinge geniet en het dieselfde vriende gehad. Ek het baie respek vir jou omdat jy jou nie aan ander mense se menings oor jou steur nie – jy is gelukkig net soos jy is. Dankie vir jou vriendskap en die feit dat jy altyd daar vir my was. Deur dik en dun. Jy was die rede vir die glimlag elke dag op my gesig. As ek net na jou gekyk het, het ek geglimlag. Ek mis jou noudat jy in Pretoria woon. Dit voel asof ‘n deel van my afgeskeur is. Ek is nie hartseer nie omdat ek weet dat ek jou nog baie gaan sien. Ons sal nog pret hê – soos in die ou dae. Groete Westly Westly McLaughlin Graad 11E

"Self-portrait" Jed Aylmer Grade 10 D 78


"THEM" Solly Molla Grade 10 G


Zulu Creative Writing

Isilwanyana sami ,VLOZDQ\DQDVDPL\LQMD,JDPDOHQMD\DPLQJX*LUL,QMD\DPLLWKDQGDXNXJLMLPDIXWKLLWKDQGDXNXJ[XPD nami. Inja yami igijima kakhulu. Inja yami ithanda ukuhamba nami. Inja yami ilala endlini. Inja yami LWKDQGD LNDPHOR ODPL LWKDQGD XNXDODOD QDPL,QMD \DPL \HVDED DPDQ]L ,QMD \DPL \L6WDIIL ,QMD \DPL ithanda ukugijimisa amakati. Inja yami iyalalela. Inja yami inesitsha sayo. Inja yami iyhanda ukudlala ibhola. Yona ithanda inyama. Igama lenkosikazi yenja yami ngu-Alley. Mina ngithanda inja yami. Zwelibanzi Sisilana Grade 8D

Izinja zami Nginezinja ezimbili. Kukhona emnyama QHSKX]L $PDJDPD D]R QJX=HXV HQ\H nguVesta. Eyodwa yinduna eyodwa yinsikazi. Uzeus uneminyaka emibili. UVesta unonyaka owodwa. Izinja zami ziziphatha NDKOH =L\DEDWKDQGD DERPQGHQL ZDPL =LQJLJDGD NDKOH 8=HXV QR9HVWD EDQRODND olukhulu. Ngihamba nazo wonke amalanga. =LQDPDQGOD DPDNKXOX 8PD QJL]LNKX]D ]L\DODOHOD =R]LPELOL ]LGOD NRQNH XNXGOD ngenyanga. Ngiyakujabulela ukudlala nezinja ]DPL =RQD ]LODKOD ]RQNH L]LQWR ]RNXGODOD 1JL\DEDWKDQGDR=HXVQR9HVWD Mohammed O Sherrif Grade 8A

Isilwane sami Isilwane sami yingwe. Ineminyaka engu4. Ingwe yami inemibala emibili. Imibala yakhona imnyama noluphuzi. Igama lesilwanyana sami nguSpotty. USpotty XWKDQGD XNXJLMLPD 8GOD NDNKXOX XGOD "Flaming Shingsta" Shingi Nkungu Grade 12 A inyama yenkomo kuphela. USpotty uthanda ukuya ephakini ukuyogijimisa amakati. Yena uthanda ukudla nezinja ezinye. Yena uvuka ekuseni ngo6. Umama akamvumeli ahlale endlini. USpotty unendlu \DNKHQJDSKDQGOH86SRWW\X\DEDWKDQGDDEDQJDQHEDPLNRGZDERQDED\DPHVDED$QJLTRQGLXNXWKL EDPHVDEHODQL QJRED L\LQJZH NXSKHOD 86SRWW\ DNDWKDQGL XNXVKD\ZD XPD XPVKD\D X]RNXOXPD 86SRWW\QJLPWKDWKHH-RKDQQHVEXUJ=RR Israel Mhandana Grade 8A 80


Inja yami Inja yami nguGeorge. UGeorge umhlophe. UGeorge uthanda ukudlala engadini. UGeorge uyalala kakhulu. Ebusuku uGeorge ulala egalaji. Inja yami idla kakhulu. Yena uGeorge uyahlupha. UGeorge uthanda ukukhonkotha. Uvusa abantu ebusuku. Ababntu basaba uGeorge. UGeorge unomzimba omkhulu. UGeorge akalumi. UGeorge uluma umuntu omhluphayo. UGeorge unamazinyo amancane. UGeorge uyasinakekela. Mina ngithanda uGeorge. Neo Nkwe Grade 8C

Umemulo wesiPedi Uma umphakathi uthi uyindoda kufanele uye entabeni. Una uzoya entabeni umndeni wakho ufanele uhlabe izimbuzi ezimbili ukutshela amadlozi ukuthi uya entabeni. Uma uzoya entabeni uzohla amaviki amane. Uma ubuya entabeni kufanele ume emasangweni XWVKHOH XPQGHQL ZDNKR XNXWKL XEX\LOH HQWDEHQL .X]RED QRPVHEHQ]L RPNKXOX XEDEHND]L nomalue bazohlangana nawe emasangweni. Kufanele ubatshele ukuthi ubuyile entabeni futhi usukhulile. Emphakathini uba yindoda uma usuneminyaka engamashumi amabili nanye. Kulo msebenzi uma ubuya entabeni uthola izipho nemali eningi uma ungena esangweni. Ucula izingoma lezi obuzicula entabeni. Manje uma unomsebenzi ungahlala nabo baba futhi nabangane bakho. Uma ubuye entabeni umndeni wakho kufanele uhlabe izimbuzi ezimbili ukutshela amadlozi ukuthi usubuyile entabeni. Umemulo wamaTsonga Uma umfana noma intombazana iba neminyakaengamashumi amabili nanye HVLNZHQL OHWKX NXNKRQD LQWR HVLPHQ]HOD yona. Patrick Mokhanda Grade 9E

"Self-portrait" Ngcebo Ndlovu Grade 10 D 81


"Painting" Keenan Mayet Grade 8 C

Umemulo wamaTsonga Abafana esikweni lethu benzelwa umsebenzi omhkulu. Lo msebenzi awenzelwa kubo kodwa wenzelwa kubo kayise. Kuthengwa inkomo futhi kuphekwa ukudla kwesintu kuphela. Inkomo siyihlabela amadlozi ukuze siwabonge ngoba ekunakekele. =L\DWKDWKZDL]LQJXER]DNKRH]LQGDODEHVHXWKHQJHOZDH]LQWVKDH]LJTRNZDQJREDED$EDIDQDDEDQFDQH kunawe kufuneka ukuthi bakubize ngo bhuti noma baba. Emakhaya ethu kukhona indawo lapho kuhlala ubaba kuphela. Uma usuneminyaka engamashumi DPDELOL QDQ\H XQJXPIDQD  XQJDQJHQD NXOH\RQGDZR X\RKODOD QDPDQ\H DPDGRGD QJRED QDZH XVXV\LQGRGD8PDVHQLTHGLOHXNXKODEDLQNRPR\RNXERQJDDPDGOR]LNXIDQHOHXNXWKLNXKDQMZHNX\LZH emethuneni kuyovakashelwa amadlozi. Uma sifika emathuneni umfana owenzelwa umsebenzi kufanele akhulume nawo amadlozi wakhe DZDWVKHOHL]LILVR]DNKHDSKLQGHDZDERQJH8PDVHVLEX\LOHNX\DGOLZDNXSKX]ZHNXEHPQDQGLZRQNH umuntu azithokozise. Umfana uphuziswa utshwala besintu aphiwe izipho alungiselwe netafula elinokudla kwakhe kuphela. 1JDOHORODQJDORPIDQDXSKDWKZDQMHQJHQNRVL\DPDNKRVL Theodore Khoza Grade 9E 82


Umemulo wamaNgisi Osukwini lokuzalwa lwamashumi amabili nanye ngizoba nomkhosi Ngizoba nomkhosi ngoba ngizoba yindoda ngalolosuku. Umthetho kahulumeni uzongivumela ukuba QJLEH QJXPXQWX RVHNKXOLOH /HVR VLNKDWKL ngizobiza wonke umndeni wami. Umndeni wami uzofika ekhaya lami. Thina sizodla ukudla okuhle futhi okumnandi okunjengamakhekhe namaswidi. Sizophuza utshwala obuncane. Umndeni wami uzonginika izipho ezinhle. (PXYD NZDORNKR QJL]REDILVHOD XNXKDPED RNXKOH (PHPXOZHQL ZDPL  DEDIDQD bazosokwa ekuzalweni. Dominic Booth Grade 9E

Usizo lwemfuyo Imfuyo isiza ngezinto eziningi futhi ziningi L]LQKORER ]HPIX\R .XQH]LQNRPR L]LPYX nezimbuzi.

"There's more to me . . ." Jed Aylmer Grade 10 D

Imfuyo isiza abalimi ngohwebo ngoba benza imali. Imfuyo yenzela abantu umsebenzi ngoba kudingeka DEHOXVLDED]RKROHOZD,]LQNRPR]LVL]DQJRELVLHVHQ]DQJDORXVKL]LQRNXQ\HXNXGOD,]LQNRPRL]LPYX QH]LPEX]L]LVL]DXPDVLQRPVHEHQ]LWKLDDEDQWXDEDPQ\DPDQJREDNXIXQHNDLQ\DPD Izifuyo ezingenhla zisiza uma sithethela ( ukukhuluma namadlozi ) uma sidinga usizo noma sicela emadlozini. Isikhumba sembuzi sona sibekwa phezu kwendlu uma sithethela. Isikhumba semvu sisetshenziswa ukwenza Ingulube yona isiza ngokuletha inyama ebiza kakhulu futhi yenza izinhlobo eziningi zenyama. Izinja zona ziyasisiza ngokugada abathakathi nezigebengu ebusuku. Izinja zisiza izimpumputhe ukuthi zihambe kahle emgwaqweni ukuze zingashayiswa yizimoto. Konke lokhu kubonisa ukuthi kumele sinakekele imfuyo ngazozonke izindlela ngoba iyasisiza ngezindlela eziningi. T Luthuli Grade 9 E 83


Isigwebo sentambo masibuye! 1JLWKL PDVLEX\H OHVL VLJZHER VHQWDPER QJRED VL]RVL]D XNXQFLSKLVD XEXJHEHQJX IXWKL VLQFHGH ukuphepha kwesizwe. 1RPD XPWKHWKRVLVHNHOR XWKL ZRQNH XPXQWX XQHOXQJHOR ORNXSKLOD WKLQD VL\D\H VLNKRKOZH XNXWKL sinesibopho sokungasukeli abanye abantu. Wonke umuntu waseNingizimmu Afrika angathanda XNXSKLOD H]ZHQL HOLQJHQDER XEXGORYD LQ]RQGR QREXJHEHQJX .RGZD ORNKX DNXVR]H NZHQ]HND LVLJZHER VHQWDPER VLQJDNDEX\L QJRED DNXVL\H ZRQNH XPXQWX ZDNXOHOL RODOHOD IXWKL RODQGHOD umthethosisekelo ngoba kukhona labo abangawulandeli. Uma isigwebo sentambo singabuya abadlwenguli bangacabanga kabili ngaphambi kokuba bayodlwengula. Obulala omunye kumele athathelwe ilungelo lakhe lokuphila emhlabeni ophephile. Uma lesi sigwebo singabuya singabona izinga lobugebengu lehlangendlela emangazayo. UHulumeni DQJRQJD LPDOL HQLQJL HVHWVKHQ]LVZD XNXJFLQD L]LSKXODPWKHWKR QRNXNKRNKHOD RQRJDGD DED]LJDGD\R Uma iziboshwa zigwetshwe iminyaka engaphezulu kwemihlanu kumele zibulawe ngoba zimosha imali yabakhokhi bentela. Kodwa kungani uHulumeni wethu angenzi iziboshwa zakuleli lizwe zizizwe ]LVHMHOHKKD\LHPDNKD\D8PDHQ]DORNKXQH]LQJDOH]LERVKZDOLQJHKOD,QDQLODEDQWXDEDKODODODSKD lingehla futhi impilo nokuphepha kwabantu kungaphucuka. Kodwa uma isihlobo sakho VLQJDEXODZHOZDLQWRHVLQJD\HQ]DQJD ubungavuma wean ukuthi isigwebo sentambo sibuye? Ngiyazi uzovumelana nami uma ngithi: "Masingabuyi!" Ngikusho lokho QJRED VRQNH VLQJDEDQWX IXWKL VL\DZHQ]DDPDSKXWKDVLGLQJDLWKXED OHVLELOL HPSLOZHQL 2NZHVLELOL XPD amaphoyisa engalwenzanga uphenyo ngendlela eyiqiniso kungabulawa XPXQWX RQJHQHFDOD QJRED bemakhele uzungu. Noma izinga lobugebengu OL\RNZHKODQMHNXPHOHVLFDEDQJLVLVH kahle ukuthi kumele sibuye noma VLQJDEX\L LVLJZHEL VHQWDPER QJRED uma sibuya sizophepha kuyoyonke LQGDZR XPD VLQJDEX\L NXPHOH kusetshenziswe ezinye izindlela zokwehlisa ubugebengu eNingizimu Afrika. Lerato Mpila Grade 10C "Virgin Rambo: 1 of 3" Lazarus Mabaso Grade 12 A 84


Mhla ngiqala ngqa ukulala ejele Ngangijuluke ngimanzi te! Ngiqalaza ngapha nangapha njengenyoni. Kwakungavumi ngisho nokuthi QJLKDPEHNRGZDEDQJLGRQVDQMHQJHVDND+DZX1NRVL\DPLQJHPSHODOLQJLVKRQHOHQDPKODQMH %DQJLSKRQVDHMHOHQH]LERVKZDH]L\LQJR]L1JLILNDQMHNZH]DLQGRGDHPQ\DPDQMHQJHPIHQH\DQJLEX]D ukuthi ngingubani. Ngokuphazima kwesi izicathulo nebhande lami kwase kuhambile. Bangibamba inkunzi ngingakabatsheli nokuthi ngingubani. Kwakukhona ezinye izinsizwa eziyisikhombisa kuleli JXPEL (Q\H \DOH]L ]LQVL]ZD \D\LFRQVD LJD]L XEXDR ERQNH NZDQJLFDFHOD XNWKL LTHGD NXVKD\ZD kabuhlungu. Amaphoyisa afika abuza ukuthi kwenzenjani kulona oconsa igazi. Iziboshwa zathi uwilw washayeka SKDQVL DPDSKR\LVD DKOHND DMLND DKDPED D\LVKL\D NDQMDOR OH\R QGRGD /(QGRGD HWVKHOD DPDSKR\LVD NDQMDOR\D\HVDWVKZDIXWKLLKORQLVKZDNZDNXVREDODXNWKLLQHVLNKXQGODHVLWKLOHODSKDHMHOH.:DNXNXEL QJHPSHOD XPD XVKR LQWR HQJDWKDQGZD \LOHQGRGD \D\LNXVKD\D QJHPSDPD HVKLVD\R L]H LNXIDNH nonyawo. Uma uthi uyaphendula noma uyalwa ikubuyisela ngempama. Lezi ezinye iziboshwa zazisukuma zikushaye nazo. Kwakumele ngenze yonke into abayishoyo uma ngifuna ukuphuma ngisaphila kusasa. .XWKH NXVHQMDOR NZDQJHQD HQ\H LQGRGD QD\R ED\LEX]D XNXWKL LQJXEDQL  <DSKHQGXOD QJHQGOHOD HQJLQJDND]H QJL\L]ZH QJDSKDPELOL ,]LERVKZD H]LQ\H ]D]L\LODOHOD ]LYXPD QRPD \LQL  H\LVKR\R ,VLNKXQGOD VREXKROL VDWKDWKZD \LOHQGRGD HTHGD NXQJHQH PDQMH OHQD HELSKHWKH \DKODOD SKDQVL 6DFXOLVZDVDGDQVLVZDQDWKLVDNZHQ]DORNKR ngoba kwakusobala ukuthi uma singakwenzi sasizolimala kabuhlungu. Ngangikaze ngibone LQWR HIDQD QDOHQD HPSLOZHQL \DPL LQGRGD ebisesikhundleni iculiswa njengathi nayo sebeyishaya ngempama beyifaka nonyawo. 8PD VHQJLSKXPD QJHPDOL \HEKH\OL HNXVHQL ngabuza elinye lamaphoyisa ngalento ebiyenzela. Langichazela ngezikhundla zeziboshwa emajele futhi langitshela nangamaqembu eziboshwa abizwa ngezinombolo ezahlukene. Yingakho ezinye L]LERVKZD ]LQHDLNKXQGOD \LODZD PDTHPEX ezinombolo. Lobu busuku bami ejele bangenza ngazethembisa ukuthi angeke ngibuyele ejele esikhathini esiseduze. Sibusiso Dlamini Grade 11A "Virgin Rambo: 2 of 3" Lazarus Mabaso Grade 12 A 85


Yini ngempela eyenza abafundi abasezikoleni ezinezidingo zonke bafeyile? Yini ngempela eyenza abafundi abasezikoleni ezinezidingo zonke bafeyile? Mina njengomfundi RQJHQD HVLNROHQL HVLVH]LQJHQL HOLSKDNHPH ODSKR kukhona zonke izidingo zabafundi ukuze benze XEXQJFRQR EDER NX\DQJLPDQJD]D XPD QJLERQD DEDQ\HDEDIXQGLEHIH\LOD1JHPSHODNX\HQ]HNDORNKX NRGZDNZHQ]LZD\LQL":RQNHXPXQWXXSKLZHLVLNROH siphethe konke ukuze ubonise ukuhlakanipha kwakho QMHQJRPIXQGLPDQMHNZDODSKL"

"Stippling" Dane Steinhobel Grade 8 A

Abafundi abaningi bazivikela ngokuthi umsebenzi RZHQ]LZD H]LNROHQL ]H]LQJD HOLSKH]XOX ODSKR NKRQD ]RQNH L]LGLQJR ]LNKRQD XQ]LPD /DER EDIXQGL EDWKL kuyakhuphukela yingakho benza ngendlela abenza ngayo. Kuyiqiniso ukuthi imisebenzi ayifani ezikoleni H]DKOXNHQH NRGZD PLQD QJLWKL %FDVKD QJHVLWKXSKD Ayikho into enzima uma uzimisele. Inkinga ukuthi abafundi uma befika esikoleni bakhohlwa ngukuthi bezeleni lapha! Bakhangwa yizinto ezingaphathelene nesikole nekusasa labo. Abafundi uma befika esikoleni ED\DGODOD  EDQHWKH]HNH  QDEDQJDQH HVLNKXQGOHQL sokuthi bafunde.

$EDIXQGL DEDIH\LOD H]LNROHQL ODSKR NKRQD NXQH]LGLQJR ]RQNH XPIXQGL DQJD]LVHEHQ]LVD EHQ]LZD ZXEXYLODNXSKHOD$EDIXQGLDEDVHEHQ]LED\DIH\LODEHVHEDMLNHEDWKLNXQ]LPD81NXOXQNXOXEDWKLXVL]D R]LVL]D\RXPDX]LPLVHOHHPVHEHQ]LQLX1NXOXQNXOXX]RNXYXOHODDPDVDQJRDNXEXVLVHIXWKLDEHQDZH empumelweni yakho. Abafundi abaningi bayakhohlwa ukuthi basukaphi nokuthi bayaphi. Uma befika esikoleni babheka ukuthi bayokwenzani enkundleni yemidlalo badlulise okumele kwenzeke emakilasini. .XQJFRQR DEDQRPGODQGOD ZRNXVHEHQ]D ED]LVKD\H ERQD QJRED DEDVHEHQ]L XPD EHILND HVLNROHQL $NXPHODQJDEDFDVKHQJH]LWKXSKDED]LYLNHOHQJRNXWKLXPVHEHQ]LXQ]LPDNRGZDEHORNKXEHGODOD $NX\L QJRNXWKL XPD XQJHQD HVLNROHQL HVLQH]LGLQJR ]RQNH IXWKL HVLQHPLSKXPHOH HPLKOH XPD XQJDIXQGL X]RSKDVD NDQMDOR =LKRQD L]LQJDQH H]LWKRODNDOD H]LNROHQL H]LQJHQ]R ]RQNH L]LGLQJR NRGZD ]L\DSKXPHOHODH]LIXQGZHQL$NX\LQJHVLNROHNRGZDQJRNX]LPLVHODNZDNKR3KHODNXWKLZD8QJDOL\LVD LKKDVKLHPIXOHQLNRGZDDQJHNHXOLSKRTHXNXWKLOLSKX]H Kusizangani ukuthi use ingane esikoleni sezinga eliphakeme uma ingazimisele ifike ifeyile? Abafundi bamele bahlele kahle izinto zabo ngokubalileka kwazo qha! Sibusiso Majola Grade 11G 86


Kutheni abesimame beqhakaza kanje, thina sikhona? <LQL H\HQ]H L]LQWR ]LVKLQWVKH NDQJDND"$NXSKL DPDGRGD QDNKRQD XPD HNKRQD HQ]DQL XPD HERQD omame bephumelela libalele nje? Kudala abesimame bebehlezi ezindlini ezithengwe ngamadoda. Bebenza imisebenzi yabo eyokuhlanza L]LQGOX XNXSKHND QRNXEKHND DEDQWZDQD $NHNKR RNH ZDEDEX]D DEHVLPDPH XNXWKL OH PLVHEHQ]L abayenza ekhaya kusukela liphuma lize liye ngakunina nje bayayithanda le misebenzi na? Akekho oke wababuza ngezifiso zabo.Wonke umuntu uvele walandela umqondo wokuthi indawo yowesifazane LVHNKD\DEHODQGHODQDQDEDQFLQGH]HOLDED\LERDEDVXQJXOHORPTRQGRRVKL\HDEHVLPDPHEHQJDMDEXOLOH neze. Abaphathi besizwe badidekile gnoba abasazi Ukuthi kwakhala nyonini. Namhlanje sewuthola inhloko \RPX]LLVLEKHNHQHQDEDQWZDQDXPID]LH\RSKDQGHODXPQGHQL=LGOXOLOHOH]R]LQVXNXODSKRRZHVLOLVD ubethola umsebenzi kalula nje ngoba egoke ibhulukwe. Iphutha lenziwe yithi madoda ngokukhohlwa ukuthiabesimame banezingqondo ezifana ncamashi nezethu. .XGDOD EHVLSKHWKZH DPDGRGD DKODNDQLSKLOH DPDGRGD DQHLTRQGR HKOX]HNLOH LPSHOD DQMHQJR1HOVRQ Mandela nomahatmaGhandi. Okubuhlungu Ukuthi aseyilihlo lentwala afana nalawa ashintshe izimpilo ]HWKX DVHEHQ]HOD 8NXWKL RPXQ\H XPXQWX DSKLOH LPSLOR HWKH [D[D1DPKODQMH VLKROZD QJDPDGRGD DQMHQJR*HRUJH%XVKD]LFDEDQJHOD\RNXSKHODDEDQJDJTL]HTDNDODQRPDEHEXODODDEDQWXDEDPVXOZD $EHVLPDPH ²NH VHNXERQDNDOD NX\LER DED]L XNXSKDWKD NDQJFRQR QJRED EDQHVLKH IXWKL EDSKLZH ekuhlelekeni. Imisebnezi emihle enziwa ngabesimame yenza baphumelele. Yibo abasiza abantwana DED]LQWDQGDQD DEDODOD QJHQGODOD QDEDJXOOD\R basanaka nammanje kodwa umehluko yikuthi sebekwenzela umphakathi. Namhlanje usubathola noma kuphi emphakathini QDVHPLQ\DQJZHQLNDKXOXPHQLEHKRODEHMXOXND ukuze ilizwe lethu liqhakaze. 2NXVXND NXPDQJDOLVH 8NXWKL QRPD RPDPH VHEHOLSKHWKH LOL]ZH QMH LPL]L \DER LVDTLQLOH %D\DSKHND ED\DKODQ]D IXWKL EDEKHND nabantwana. Ukuthi bakwenza kanjani konke lokho kungiqeda amathe.Engikawziyo nje Ukuthi akekho owesilisa ongenza lokho okwenziwa ngabesimame mihla ngemihla. Abesimame bayaqhakaza? Isizathu silula kabi. %DWKROHLQNXOXOHNRPDQMHED\D\LVHEHQ]LVDXNX]H ERQDLPL]L\DERNDQ\HQHVL]ZHVRQNHVLTKTND]H 0DGRGDYXNDQLQJREDXPDQLQJDTDSKHOLQL]RVDOD emuva omama beya phambili. Sabelani Ndlovu Grade 12G

"Strong Black Woman" Tau Chokoe Grade 12 A 87


Ukusoka +HZX.ZD]HNZDEDEXKOXQJXXNXEDXPIDQD QRPD LWKL QJLWKL NZD]H NZDEDEXKOXQJX ukuba yindoda. Uyangena esibhedlela uzimisele ukwenza lento ezokwenza ube yindoda ephelele. Ubuliswe ngamazinyo amhlophe qhwa.Onesi bakubheka sengathi bayakubhuqa ngoba bazi Ukuthi uma ujabulilengalisosikhathi akuzukudlula imizuzu eminingi kuphele injabulo yakho. Uyalaliswa embhedeni uvuke ungafisi lutho. Umthondo uzwakkala ngathi kukhona owuvulile wawuthela utswayi emva kwalokho wawugcobisa ngespiriti. Uthi uzama ukuzihlalisa kahle uvele uncinzeke XPSKDPELOL,QWRRQJD\HQ]DL\RGZDNXSKHOD ukubiza unesi. Uba namahloni ngoba sekufanele ubonwe ngumuntu wesifazane ongasinanyoko. "Self-portrait" Otsile Mokgatle Grade 10 D

Ekhaya noma usukhululekile usunomndeni ZDNKRXEXKOXQJX EXVDVHNKRQD ,EKXOXNZH likude emcabangweni wakho. Usuzungeza indlu ugqoke isikipha noma igawuni. Nasekugezeni lapha awungeni ngomzimba wonke emanzini.

Uma sebuphelile ubuhlungu kuqala ukuphola. Lokho akushintshi lutho ngoba kusamele uye kudokotelaesibhedlela ayokukhipha izititshi. Uma ekwenza kahle ubuhlungu buba nganeno kodwa uma enesihluku ubuhlungu bubuya kabusha. Baqinisile abadala uma bethi ezibuhlungu azipheli. 1RPDNXEXKOXQJXNDQJDNDXNXVRNZDNXPHOHVLTLQHPDGRGDVL\RVRNZDNX]LVLVL]DNXVDVD Masiko Baai Grade 12 G

88


KESFAM

KESFAM is an organisation within the school that encourages students and educators to strive for awareness of the needs of others as well as to develop in all of us a social conscience that makes us willing to do our best to help those in need. Fund raising projects this year included: Â&#x2021; 9DOHQWLQHURVHV²GULYHQE\WKH*UDGHOHDUQHUVZKRWDNHPXFKGHOLJKWLQWKHGHOLYHULQJRI URVHVWRWKHJLUOV·VFKRROVLQRXUDUHD Â&#x2021; 5DIIOHV²GULYHQPDLQO\E\WKH*UDGH·VZKHUHWKH\UDIIOHGWLFNHWVIRUWKHFODVKEHWZHHQ6RXWK $IULFDDQG$XVWUDOLDDQGDVWD\DZDNH²ZKHUHWKH\UHFHLYHGVSRQVRUVKLSIRUWKHDPRXQWRIKRXUV they could keep awake. Â&#x2021; 0RWKHU·V'D\²6HOOLQJRISRHPVLQDIUDPH Â&#x2021; 6HOOLQJRIPHPRUDELOLD²XPEUHOODVPXJVNH\ULQJVVFKRROEDJVHWF Â&#x2021; 5D]RU SURMHFW ² DQ DQQXDO SURMHFW ZKHUH ER\V ZKR FRPH WR VFKRRO XQVKDYHQ FRQWULEXWH WR KESFAM by buying a razor and shave before being allowed into class. Â&#x2021; 6HOOLQJRI.(6)$0JROIVKLUWV²*UDGH Â&#x2021; 0RQH\PLOH²GULYHQE\*UDGH$SURMHFWZKHUHGRXEOHVLGHGWDSHLVVWXFNWRWKHIORRUDQG donations are stuck to the tape. This was successfully done during home rugby matches. Â&#x2021; ´6KDUH WKH VSLULWµ EUDFHOHWV ² EDVHG RQ WKH´$UPVWURQJµ EUDFHOHWV WR HQFRXUDJH D VHQVH RI EHORQJLQJDQGXQLW\DPRQJVWSXSLOVVWDIIDQGROGER\V7KLVZDVZHOOUHFHLYHG 7KH´VKDUHWKHVSLULWµEUDFHOHWVZHUHDPDMRUIXQGUDLVHUIRUXVWKLV\HDU:HZRXOGOLNHWRWKDQNDOO those who contributed to this project as well as to all our endeavours over the year. KESFAM profits after we supported various charities stood at R18 000-00. Those that we helped over the year were very appreciative of the King Edward generosity. Some of the charities included: Â&#x2021; 0DULD .ORSSHUV &KLOGUHQV· +RPH ² 'RQDWLRQ RI clothing and food. Â&#x2021; 6DOYDWLRQDUP\²'RQDWLRQRIEODQNHWV Â&#x2021; +RVSLFH²$GRQDWLRQWRWKH7UHHRI/LJKWV Â&#x2021; 1NRVL·V+DYHQ²'RQDWLRQRIIRRG Â&#x2021; 9DULRXV$LGV 2USKDQV ² 'RQDWLRQ RI FORWKLQJ DQG food. In order for KESFAM to continue it is important that we all remain focused and willing to give. The support and generosity of the entire King Edward family is indicative of the tradition with which we are accustomed. Mrs M Thorne, Mrs A Gallucci and Mr Ogier

90


"Landscape" Claudio Sousa Grade 10 F 1


Chess Educator in Charge: Captain:

Mrs L Crous W McLaughlin

The success of the 2005 chess season was reflected by the growth in membership numbers. The club has increased in size to such an extent that King Edward VII School now includes a B team in the Gauteng High School Chess League. This new team is dedicated and motivated and despite their poor performance they will strive to achieve improved results next year. The A team once again played exceptionally well in the Gauteng High School Chess League. They ZHUHSODFHGVHFRQGWR6W-RKQ VORVLQJE\RQO\IRXUSRLQWVLQ=RQH The results of the yearâ&#x20AC;&#x2122;s matches are as follows: 5-a-Side Tournament Results:

5-a-Side Individual Results [A Team]:

92


Gauteng High School Chess League Results:

League Individual Results [A Team]:

7KH FKHVV FDSWDLQ IRU WKH  VHDVRQ :HVWO\ 0F/DXJKOLQ LV FRPPHQGHG RQ KLV H[FHOOHQW performance. He achieved chess colours. I would like to thank Miss du Plessis for her time and effort. She was the Educator in Charge of chess IRUPDQ\\HDUVDW.LQJ(GZDUGDQGLWLVDSOHDVXUHWRKDYHKHUEDFNDVP\DVVLVWDQW2XUFRDFK0U /DXUHQFH%DOOHQVXUHGWKDWWKHER\VZHUHHTXLSSHGZLWKWKHNQRZOHGJHDQGVNLOOVUHTXLUHGWRZLQ Thank you for your contribution Mr Ball. Mrs L Crous

93


A few words from the Captain: 2005 was yet another great year for the chess team. We began the season a little despondent and ZHDU\KDYLQJORVWWZRRIRXUWDOHQWHGSOD\HUVWRHPLJUDWLRQEXWHYHQWKLVFRXOGQRWGDPSHQRXU spirits. After our first match we tasted the familiar sense of success and victory. We wanted victory DQGZHUHJRLQJIRUJROGQRWKLQJHOVHZRXOGGR:HNQHZLWZDVJRLQJWREHKDUGEXWZHDOOSXWLQ WKHKRXUVSUDFWLVLQJDQGSHUIHFWLQJRXULQGLYLGXDORSHQLQJVPLGGOHJDPHVDQGHQGJDPHWKHRU\:H knew that in order to win we had to be as disciplined and obedient as the army of chess men we played against. With games on Monday (that could last for hours on end) and training on Friday from 14:30 to 16:30 we were kept very busy. +RZHYHUZHH[SHULHQFHGVRPHKDUGWLPHVWRRDVZHFDPHXSDJDLQVWVRPHYHU\VWURQJRSSRQHQWV ZKRIRROLVKO\XQGHUHVWLPDWHGXVDQGEHOLHYHGWKDWWKHRQO\WKLQJD.LQJ(GZDUGER\FRXOGGRZHOO ZDVNLFNDEDOO,WZDVDORQJDQGKDUGJULQGEXWWKURXJKSHUVHYHUDQFHPHQWDOVWDPLQDDQGGLVFLSOLQH ZH VKRZHG WKHP ZH FDQ NLFN EXWW  H[WUHPHO\ ZHOO WRR ,W ZDV KDUG EXW WKLV RQO\ PDGH XV ZDQW YLFWRU\PRUHDQGKHOSHGXVWRIRFXVRQWKHSUL]H8QGHUWKHZDWFKIXOH\HRI0LVVGX3OHVVLV0UV &URXV DQG RXU H[WUHPHO\ NQRZOHGJHDEOH DQG H[SHULHQFHG FRDFK 0U %DOO ZH PDQDJHG WR GHIHDW DOORSSRVLWLRQDQGQRWRQO\SURYHZHDUH.LQJ(GZDUGER\VEXWDOVR .LQJV RIWKHEODFNDQGZKLWH board! W McLaughlin

94


The Choral Society 2005 has been yet another year where the choir was kept on its toes as it had to perform at QXPHURXV IXQFWLRQV:KDW , IRXQG PRVW HQFRXUDJLQJ DERXW WKLV \HDU·V JURXS LV WKDW LW KDG WDOHQW FUHDWLYLW\DQGGHGLFDWLRQ7KH\HQMR\HGHYHU\SDUWRIWKHLUUHKHDUVDOVPDNLQJLWHDV\IRUXVWRWUDLQ them effectively. $OWKRXJK ZH SHUIRUPHG DW$VVHPEOLHV WKH ILUVW DQG VHFRQG WHUPV ZHUH RXU EXVLHVW DV ZH ZHUH preparing for the Tirisano Choir Competitions in May. Our Choir came first in the Cluster and the 'LVWULFWFRPSHWLWLRQVLQWKH3UHVFULEHG0DOH&KRLUV·VRQJ²&RPUDGHVLQ$UPV²DORQJDQG quite challenging song. We proceeded to the Provincial Competitions in Krugersdorp where we came 9th out of 13 High School Choirs singing the same song . The boys were very disappointed E\WKHUHVXOWVEXWFRQVLGHULQJWKDWLWZDVWKHLUILUVWWLPHWRJHWWKDWIDU,ZRXOGOLNHWRFRQJUDWXODWH them for doing their best. Our biggest setback was our inability to find a regular pianist who could practise with us as often as we needed to. As a result we did not harmonise well at this performance. 3LDQLVWVRXWWKHUHSOHDVHFRPHWRRXUUHVFXHDQGFRQWDFWWKH6FKRROLI\RXDUHLQWHUHVWHGLQKHOSLQJ us next year as most of the competition songs need piano accompaniment. Our Annual Music Festival in August is the climax of all our performances as we get the opportunity to sing more songs in one performance and to listen to other choirs from invited schools. Our guests for this year were Parktown Girls' School Choir and Dr Beyers Naude School Choir and Gumboot 'DQFHUV%RWKWKHVHVFKRROV·SHUIRUPDQFHVZHUHHODWLQJDQGRXUDXGLHQFHZDVZHOOHQWHUWDLQHGE\ WKHP2XUVFKRROSRSEDQG²7KH,QFDUQDWHSLDQLVWVYLROLQLVWDQGSRHWVZHUHHTXDOO\EULOOLDQW

The Choir 2005 )URQW5RZ OHIWWRULJKW  00EX\D37VKDEDODOD$0EDWKD5+XOOH\7:RQGHUOLN  60DPRUDUH.0DIX'$UHQGVH %DFN5RZ OHIWWRULJKW  01NDELQGH70DREHOR:%URFNZD\$)UDVHU6.KR]D  &8QDPDFD$0DWKHEXOD%:DUG 95


We were also invited to sing at Parktown Girls' School Cultural Day towards the end of August. In 6HSWHPEHUZHYLVLWHG1NRVL·V+DYHQLQ%HUHDDQG6LIXQGR.JREHKDVWKHIROORZLQJUHSRUWRQRXU visit. Mrs N Ndlovu

Nkosiâ&#x20AC;&#x2122;s Haven 2QWKH2FWREHUWKH.LQJ(GZDUG9,,6FKRRO&KRUDO6RFLHW\WRJHWKHUZLWKWKHPHPEHUV RI.(6&2YLVLWHG1NRVL·V+DYHQLQ%HUHD .(6&2LVDSURMHFWUXQE\OHDUQHUVWRKHOSWKRVHLQ need and to create awareness on issues relating to welfare and charity initiated by the School's two RIILFH EHDUHUV RQ WKH -RKDQQHVEXUJ -XQLRU FLW\ &RXQFLO 3XVR7KDKDQH DQG:DUUHQ &KDONOHQ 7KH main objective of the visit to the home was to hand over food packets and a few articles of clothing collected by KESCO. 2QRXUDUULYDODWWKHKRPHZHZHUHLQWURGXFHGWRVRPHRIWKHFKLOGUHQDQGPRWKHUVOLYLQJDWWKH home. They answered our numerous questions on the initiation of the home and its basic upkeep. The School Choir provided entertainment in the form of song and dance. We were then given a tour of the home. This served us with primary insight on the living standards and conditions of the KRPH·VRFFXSDQWV $V RXU WLPH DW WKH KRPH GUHZ WR D FORVH WKH HODWLRQ ZLWK ZKLFK ZH ZHUH JUHHWHG VHHPHG WR GLVVLSDWHLQWRGLVDSSRLQWPHQW2QHRIWKHKRPHV·GHOHJDWHVKDQGHGRYHUWRXVDKDQGFUDIWHGGROODV a reminder of our association with the home. 7RPDQ\RIXVWKHIRRGSDUFHOVDQGWKHFORWKHVKDQGHGRYHUWRWKHKRPHKDYHYHU\OLWWOHEHDULQJRQ RXUIXQFWLRQLQJ\HWWRWKHRUSKDQHGFKLOGUHQRI1NRVL·V+DYHQWKH\JRDORQJZD\2XUYLVLWWRWKH home was a very special one that holds a place in the hearts of many of the involved individuals. $VSHFLDOWKDQNVWRWKH&KRUDO6RFLHW\0UV1GORYX3XVR7KDKDQH:DUUHQ&KDONOHQDQG.(6&2 on the organisation and success of this initiative. The little that we were able to give left a touch of WUDQVLHQWMR\LQWKHKHDUWVRIWKHSHRSOHOLYLQJLQ1NRVL·V+DYHQ 'XULQJWKHIRXUWKWHUPRXUFKRLUDOVRSHUIRUPVDW9DOHGLFWLRQ0DWULF0RWKHUV 7HDDQGWKH0HPRULDO Parade. )LQDOO\ , ZRXOG OLNH WR WKDQN WKH WZR HGXFDWRUV ZKRVH FRQWULEXWLRQ WR WKH FKRLU ZDV PXFK appreciated : Miss Machos (for conducting the choir at Tirisano Competitions) and Mr Bragin for training the choir whenever he was able. S Kgobe

96


Debating and Public Speaking

Debating 2005 proved to be a year full of new experiences in the world of debating. As it was my first year RI6$&((GHEDWLQJ,GLGQ WNQRZZKDWWRH[SHFW )LUVWWKRXJKVRPHLQVLJKWLQWRGHEDWLQJDW.LQJ(GZDUG7KHUHDUHWZRPDLQVW\OHVRIGHEDWLQJZH SDUWDNHLQ7KHILUVWLVWKHDSWO\QDPHG.LQJ(GZDUG/HDJXHZKLFKLVDVLPSOLILHGYHUVLRQRI6$&(( VW\OHGHEDWLQJ7HDPVFRQVLVWRIWKUHHVSHDNHUVHDFKZLWKWKHILUVWWZRSUHVHQWLQJWKHWHDP VFDVH and the third rebutting the other team's case. There is both a senior and a junior league. Though LWLVDOHVVHQJDJLQJFRQIURQWDWLRQDOVW\OHRIGHEDWLQJWKDQWKH6$&((VW\OHLWGRHVSURYLGHDJRRG JURXQGLQJIRUQHZGHEDWHUVDQGJRRGSUDFWLFHIRUPRUHH[SHULHQFHGRQHV1HYHUWKHOHVVZKHWKHU WKHPRWLYHLVDJHQXLQHLQWHUHVWLQGHEDWLQJ OHDVWOLNHO\ WKHFKDQFHWRJHWIUHHIRRGLQWKHLQWHUYDO PRUHOLNHO\ RUMXVWWRJHWRXWRISUHS PRVWOLNHO\ WKHGHEDWHVDUHDOZD\VZHOOVXSSRUWHGE\WKH boarders. Their presence is always most appreciated 7KHVHFRQGPDLQVW\OHRIGHEDWLQJLVWKH6$&((VW\OH7HDPVVWLOOFRQVLVWRIWKUHHGHEDWHUVHDFK EXWIRXUVSHHFKHVDUHSUHVHQWHGE\HDFKWHDPZLWKWZRRIWKHPEHLQJZULWWHQZKLOVWWKHGHEDWH takes place. And they say men can't multi-task! This is a far more interesting and engaging style of GHEDWLQJZLWKGLUHFWFRQIURQWDWLRQDPRQJVWVSHDNHUV2QO\VHQLRUVSDUWDNHLQWKH6$&((GHEDWHV 7KH6$&((WHDPLVEDVLFDOO\WKHVFKRRO VSUHPLHUWHDPDQGFRQVLVWHGRIP\VHOI 5REHUW3HFKp 3XVR 7KDKDQH&KULVWRSKHU0DF5REHUWVDQG0DUN&RXUWQD\ $VWKHVW\OHZDVQHZWRERWKP\VHOIDQG3XVRDGHEDWLQJZRUNVKRSZDVKHOGHDUO\LQWKH\HDUWR help us. It was well attended by the school's debaters and proved to be invaluable. The first round in the SACEE league was against King David Linksfield. The boarders were stuck in SUHSWKDWQLJKWEHFDXVHLWZDVDQDZD\GHEDWH7KHPRWLRQZDV7+%7 7KLV+RXVH%HOLHYHV7KDW  )DUPVXEVLGLHVLQGHYHORSHGFRXQWULHVVKRXOGEHHOLPLQDWHGLPPHGLDWHO\ZLWK.LQJ(GZDUGRSSRVLQJ WKHPRWLRQ$YHU\FRPSOH[PRWLRQDQGPDGHHYHQPRUHVRE\WKHLQH[SHULHQFHGWHDPRIP\VHOI Puso and Chris. It was there that I saw Chris' true brilliance. Watching Chris debate is quite an H[SHULHQFHDQGKHGHILQLWHO\ZRUNHGKLVPDJLFWKDWQLJKW:HZRQWKHGHEDWHDQGRXUFRQILGHQFH increased dramatically. 7KH VHFRQG URXQG VDZ XV DJDLQVW 6DFUHG +HDUW LQ DQRWKHU DZD\ GHEDWH 7KH PRWLRQ ZDV7+%7 Democracy cannot be imposed in the Middle East. With modern events giving us the short end of WKHVWLFNDQGDQDGMXGLFDWRUZKRZHIHOWZDVYHU\RQHVLGHGLWZDVQHYHUJRLQJWREHHDV\([FXVHV DVLGHWKHWHDPRI7KDWR0RMD&KULVDQG0DUNIRXJKWKDUGEXWWKHGHEDWHZDVDZDUGHGWR6DFUHG Heart. :LWKPL[HGUHVXOWVZHZHQWLQWRWKHWKLUGURXQGLQQHHGRIDZLQ7KHWHDPRI&KULV3XVRDQG 0DUNZHQWXSDJDLQVWDGHYHORSPHQWWHDP7KHGHEDWHZDVRYHUSUHVVIUHHGRPDQG.LQJ(GZDUG crushed the opposition in a completely one-sided affair. :HTXDOLILHGIRUWKHILQDOVZKLFKZHUHKHOGDW&RQVWLWXWLRQ+LOOLQ3DUNWRZQ7KHSUHVHQFHRIWKH &RQVWLWXWLRQDO&RXUWDQGWKHROGMDLOQRZDPXVHXPSURYLGHGDJUHDWVHWWLQJIRUWKHILQDOV7KH 97


URXQGVZHUHKHOGRQ)ULGD\6HSWHPEHU7KH6$&((WHDPRIP\VHOI3XVR&KLVDQG0DUNDVZHOO DVWZRUHVHDUFKHUV0LFKDHOGH9LOOLHUVDQG0LFKDHO3DSSDVDOODWWHQGHG,QWKHSUHOLPLQDU\VHFWLRQ WKUHHURXQGVZHUHKHOGRQWKH)ULGD\DQGWZRRQWKH6XQGD\ 7KHGHEDWHVZHUHDOOLPSURPSWXLQZKLFKWHDPVKDGRQO\DQKRXUWRSUHSDUH7KLVPD\VRXQGOLNH DORWEXWP\KRZWLPHIOLHVZKLOH\RX UHIUDQWLFDOO\WKLQNLQJ7KHILUVWGHEDWHZDVDZLQE\GHIDXOW DVRXURSSRQHQWVQHYHUDUULYHG7KHVHFRQGGHEDWHZDVDJDLQVW6DJHZRRGDWHDPRIJLUOV ILQDOO\  7KHGHEDWHZDVRYHUYLYLVHFWLRQDQG.LQJ(GZDUGKDGWRGHIHQGLWVXVH$V,DPYHU\PXFKDJDLQVW WHVWLQJRQDQLPDOVWKLVSURYHGWREHP\JUHDWHVWWHVW\HW,I,KDGSUHYLRXVO\WKRXJKW&KULVZDVD JRRGGHEDWHU,QRZUHDOLVHGWKDWKHZDVSULFHOHVV+HOHGWKHWHDPDQGWRRNXVWKURXJKWRZLQ what turned out to be a fairly simple debate. The third debate saw us drawn against St Stithians. The St Stithians team were nothing short of EULOOLDQW+DUGO\XVLQJWKHLUQRWHVWKH\VSRNHFRQILGHQWO\DQGEULOOLDQWO\WREHDWXV$GLVDSSRLQWLQJ HQGWRWKHGD\EXWWKHUHZDVVWLOOKRSHRITXDOLI\LQJIRUWKHTXDUWHUILQDOV (YHU\RQHZHQWKRPHRQO\WRUHWXUQRQWKH6XQGD\PRUQLQJ1RZEHDULQJLQPLQGWKDWWKHVHDUH DOOVHQLRUKLJKVFKRROSXSLOVD6XQGD\PRUQLQJZDVSUREDEO\QRWWKHEHVWWLPHIRUGHEDWLQJ

Public Speaking 2005 )URQW5RZ OHIWWRULJKW 

((PPDQXHO:%URFNZD\$)RN37KDKDQH

%DFN5RZ OHIWWRULJKW 

37VKDEDODOD,.DKQ0'H9LOOLHUV(0RNRERGH 98






7KHSUHYLRXVQLJKWOHGWRDORWRI=RPELHVZDONLQJDURXQGWKHQHZYHQXH-&(,QWKHHQWLUH.LQJ (GZDUG V WHDP WKH VXP WRWDO RI RXU FRPELQHG KRXUV RI VOHHS VWUXJJOHG WR PDNH GRXEOH ILJXUHV %DWWOLQJEUDYHO\RQKRZHYHUZHKDGRXUILUVWGHEDWHRIWKHGD\DJDLQVW6W(GQDV'HVSLWHDGLVWLQFW ODFNRIHQHUJ\DPRQJVWWKHWHDPZHSXOOHGWRJHWKHUDQGSURGXFHGDZLQ :LWKWKUHHZLQVDQGRQHORVVZHZHUHFRQILGHQWRIJRLQJLQWRWKHILQDOURXQG$PD]LQJO\ZHZHUH once again drawn against St Stithians. A complex motion relating to the tripartite alliance saw us in WURXEOHDJDLQ+RZHYHUWKHWHDPSXWXSDJUHDWILJKW:HGLGDEHWWHUMREWKDQLQWKHGHEDWHRQ WKH)ULGD\EXWZHORVW\HWDJDLQ 7KDQNVWRWKDWORVVZHIDLOHGWRTXDOLI\IRUWKHTXDUWHUILQDOVRQO\PDQDJLQJWRILQLVKHOHYHQWK1RW DEDGSHUIRUPDQFHIRUD\RXQJWHDPWKRXJKDQGWKHH[SHULHQFHJDLQHGZLOOQRGRXEWSURYHXVHIXO in 2006. 2XUVLQFHUHWKDQNVJRWR0UV0LODVRQLYLFKZKRVSHQWPDQ\KRXUVWLUHOHVVO\KHOSLQJXVDQGPDNLQJ sure everything was organised. We wish her all the best for the future as she leaves the King Edward family. Thanks are also due to Mrs MacRoberts who was always ready to assist in any way possible DQGDOZD\VFDPHWRVXSSRUWXV/DVWO\,KRSHWKDWZLOOVHHDQRWKHUVXFFHVVIXO\HDUIRUWKH 'HEDWLQJ6RFLHW\'HEDWLQJFHUWDLQO\LVZHOOZRUWKWKHHIIRUWDQG,KRSHLWZLOOFRQWLQXHIRUPDQ\ years at King Edward. ,QWUXHGHEDWLQJIDVKLRQ,OHDYH\RXZLWKDTXRWH, YHLQYHQWHGP\VHOI "The art of debating is not defending a motion you personally agree with; it is defending one that you disagree with." R PechĂŠ

Public Speaking Public speaking began early this year with the annual Speech and Drama (SA) Festival. This year was particularly refreshing and challenging as a completely young and fairly inexperienced though enthusiastic Grade Eleven team was chosen to participate in the esteemed 'Trophy' team FRPSHWLWLRQ7KHWHDPFRQVLVWHGRI3XVR7KDKDQH0LFKDHO3DSSDVDQG,PUDQ.KDQ7KHWRSLFWKDW ZDV FKRVHQ ZDVœ0\VWHULRXV 0DQ¡:H ZRUNHG ORQJ DQG KDUG EUXVKLQJ XS RQ RXU VSHHFKHV DQG polishing our delivery. The standard of the speeches on the night was no less than brilliant. Even though we only achieved a B+ symbol the experience that we gained at the competition was invaluable and would prove crucial to our success in the King Edward VII School and SACEE debating leagues as well as the Best 6SHDNHU¡V&RPSHWLWLRQ7KHUHVXOWVSURGXFHGWKLV\HDUZHUHRIKLJKVWDQGDUGIRUZKLFKWKHHQWLUH society can be proud. 6LQFHUHWKDQNVWR0UV0LODVLQRYLFKIRUDOOKHUWLPHDGYLFHDQGVXSSRUWDQGFRQWLQXHGGHGLFDWLRQ &RQJUDWXODWLRQVWR&KULVWRSKHU0DF5REHUWVWKH%HVW6SHDNHUIRU ,ORRNIRUZDUGWRQH[W\HDU¡VFRPSHWLWLRQVZKHUH.LQJ(GZDUG9,,6FKRROZLOORQFHDJDLQVKRZFDVH its exceptional speaking talent. P Thahane 99


Public Speaking Results Individual Best Speaker:

C MacRoberts

B

Guild Trophy Team:

M Pappas I Khan P Thahane

B-

Prepared Teams Grade 12

Grade 11

Grade 10

Grade 9 

Grade 8

M Courtnay K Gotha A Fok E Emmanual

B

A Youngman A Tau W Brockway S Kgobe

B

M Groenewald R Peche K Ntshakala W Chalklen

C+

M de Villiers N Gordon P Tshabalala E Mokabodi

B

D Rimmer T Tsotsotso N Tytherleigh M Mojapelo

A

J Townsend T Maphike D Cross O Mokgatle

A

L Leshabo D Allan ='HGORZ A Nizetich

B+

K Owusu C Soligram T Basson A Costa

B

K Biassoni M Knott D Whyte K Mayet

A

C Eddey J Pandora J Chauhan M Cheeseman

B+

100


Scrabble

SPOKE (Scrabble Players of King Edward) (DUOLHUWKLV\HDUWKH(QJOLVK'HSDUWPHQWGHFLGHGWKDWZHVKRXOGEHJLQD6FUDEEOH&OXEDWWKH VFKRRO$IWHUVRPHWDONWKH&OXEZDVRIILFLDOO\VWDUWHG7KHUHZDVVRPHUHVLVWDQFH²QRWDFWLYH UHVLVWDQFH\RXXQGHUVWDQGQREXUQLQJRI6FUDEEOHERDUGVDQGSURWHVWVMXVWDJHQHUDOODFNRI SDUWLFLSDWLRQIURPWKHVFKRRO%XWWKRVHZKRZHUHLQWHUHVWHGDWWHQGHGDQGWKDQNVWRWKHYDOLDQW HIIRUWVRI0UV0H\HUDQG0U3DVVPRRUWKHFOXEJUHZIURPWKUHHWRVHYHQPHPEHUV $OOJDVS LQDZH $OWKRXJKWKLVDWWHQGDQFHPD\QRWEHKLJKLQFRPSDULVRQWRDFWLYLWLHVVXFKDVUXJE\\RX PXVWUHPHPEHUWKDWWKLVLV6FUDEEOHDWDQDOOER\VVFKRRO,W·VGRRPHGWREHOHVVSRSXODUWKDQWKH PRUH¶PDQO\·SDVWLPHV 2IFRXUVHP\WKDQNV DQG,VSHDNIRUDOOWKH6FUDEEOHSOD\HUV PXVWJRRXWWRWKH*DXWHQJ $VVRFLDWLRQRI6FUDEEOH3OD\HUV *$63 IRULWZDVWKH\LQWKHLUPDJQLILFHQFHZKRVXSSOLHGXVZLWK Scrabble boards and the official Scrabble dictionary. They were obviously more enthusiastic than ZHZHUHIRUWKH\VHQWDGR]HQERDUGVZKLOHDWRXUEHVWDWWHQGHGSUDFWLFH\HWZHXVHGRQO\WZR $WSUHVHQWLWLVDYHU\LQIRUPDOFOXEZLWKSUDFWLFHVDQ\WLPHWZRRUPRUHRIXVJHWWKHXUJHWKH FDOORIWKRVHZHOOVSRNHQVLUHQV²KPP6,5(16VL[SRLQWV²IRUJLYHPH,GLJUHVV,ZDVVD\LQJWKDW LWLVDWSUHVHQWYHU\LQIRUPDOEXWZHKRSHLQWRLPSOHPHQWVRPHIRUPDOLW\VRPHVHPEODQFH of order and discipline such as is only seen at Swiss train stations. The punishment for nonattendance will be an hour on the rack. :HZLOODOVRKRSHIXOO\PDQDJHWRHQFRXUDJHJUHDWHUDWWHQGDQFHDQGDOVRILQGRWKHUVFKRROVZKR play so that we can hold inter-school competitions. M Heydenrych

101


Dramatic Society

"Rashoman" by Fay and Michael Kann

7KLVSOD\SUHVHQWVYHU\LQWHUHVWLQJJOLPSVHVLQWRWKHQDWXUHRIWUXWKDQGKRZLWLVSHUFHLYHGWKURXJK the eyes of different individuals. The story itself is a simple one: a samurai and his wife are travelling WKURXJK WKH ZRRGV ZKHUH WKH\ HQFRXQWHU D EDQGLW 7KH VDPXUDL LV NLOOHG $ FRXUWFDVH IROORZV LQ ZKLFK ZH HYHQWXDOO\ KHDU IRXU GLIIHUHQW YHUVLRQV RI WKH HYHQWV ² IURP WKH VDPXUDL WKURXJK D PHGLXP IURPWKHZLIHIURPWKHEDQGLWDQGILQDOO\IURPDZRRGFXWWHULQWKHIRUHVW(DFKYHUVLRQ GLIIHUV VRPHZKDW IURP WKH SUHYLRXV VKRZLQJ KRZ LQ HDFK VWRU\ WKH GHDWK RI WKH VDPXUDL LV DW GLIIHUHQWKDQGV$SURIRXQGVHWRIWDOHV7KHSOD\WDNHVSODFHLQWKUHHDUHDVWKHIRUHVWWKHFRXUW room and at the Rashomon gate. It is this technique of telling and retelling the story that helps blur the lines of truth: each narrator sincerely believes that he knows what happened. , HQMR\HG ZRUNLQJ ZLWK WKH FDVW YHU\ PXFK LQGHHG SDUWLFXODUO\ DV WKH\ GHYHORSHG LQWR D WLJKW FRKHVLYHXQLW,WKLQNZHDFKLHYHGJRRGDWPRVSKHUHLQDOOWKHVHVFHQHVEXWWKHRQHWKDWVWDQGVRXWLQ P\PLQGLVWKHFRXUWURRPZKHUHWKHPHGLXPLVEURXJKWLQWRFRQYH\WKHZRUGVRIWKHVDPXUDL Mr H Wilson

'XHWRP\XQIRUWXQDWHOLYLQJFRQGLWLRQV,EHOLHYHWKDWP\SHUIRUPDQFHZDVEHWWHUWKDQDKRPHOHVV SHUVRQOLYLQJLQ+ROO\ZRRG0\IDQFOXEWKHFRUSVHVZHUHUHDOO\SURXGRIP\SHUIRUPDQFH7KH\ believe that I'm their hero. Rudi ("Wigmaker") Aucamp

,EHOLHYHP\SHUIRUPDQFHDVDQREOHKLJKFODVVFLWL]HQZDVH[FHOOHQWFRQVLGHULQJWKDW,ZDVGHDGIRU more than half the play. Corpses were made to look inferior by my outstanding acting. Warren ("Samuri") Brockway

The enormity of the world has many beliefs. It's up to you what you choose to perceive. The truth must be seen. Or forever hold our being. An open mind must be free. To believe what truly can be. Michael ("The Priest") Pappas

It was with great fortune that I came across Tajimaru lying in the sand. I saw it as a good opportunity to gain power in my career. It appears that Tajimaru is not the all-powerful and all-feared bandit that he makes himself out to be. It was with great ease that I captured him. Nicholas ("The Deputy") Gerber 103


5DSHGWZLFH"1RWEDGJRLQJIRUDO\LQJFKHDWLQJNLWFKHQPDLG VGDXJKWHUDQGDOOWKLVWLPH,WULHG somehow to save face when I was told to lie back and think of England. Ha! Warren ("The Wife") Chalken Playing the woodcutter in the action-packed play THE RASHOMON was great fun. There was DOZD\V WLPH IRU D ODXJK DIWHU WKH VHULRXV VWXII RI FRXUVH  2QH RI P\ KLJKOLJKWV ZDV LQ WKH ODVW performance. Three girls were sitting directly in front of me where I deliver the line "It's a lie" but very loud and straight after a very soft intense scene. So what I did was jump right at the one girl and shouted as loud as possible "It's a lie". Needless to say she got a huge fright and I got a good laugh (and memory). Wayne ("The Woodcutter") van Zyl 0\FKDUDFWHU7KHPRWKHUWULHVWRPDNHKHUGDXJKWHU.LQXPHVRXQGOLNHVXFKDSHUIHFWJLUOZKR deserves the best. The mother doesn't want to accept the fact that she is a servant's maid. She is very grateful to have such a daughter. She over-exaggerates her daughter's qualities and makes her sound amazing. She gives the audience some past information about Kinume. Robert ("The Mother") Scott 7DMXPDUXWKURZQIURPDKRUVH+$ "Well you can always put her back in the kitchen." /DWHDIWHUQRRQVVDZWKHFRPSOHWLRQRIDTXDOLW\\HWFRQIXVLQJSOD\,QRUGHUIRUWKLVWRKDSSHQLW took a very grumpy and tired Mr Wilson to handle the disillusioned cast. All-in-all a total success and will definitely be one of the things I'll miss about King Edward. Tato ("The Samurai") Mojo

104


WINTER PRODUCTION "The Real Inspector Hound" by Tom Sheppard This winter we chose to produce one of the original plays of what is called the "Theatre of the $EVXUG7KH5HDO,QVSHFWRU+RXQGLVDGHOLJKWIXOSOD\EDVHGRQWKHSUHPLVHRIWKHROG$JDWKD &KULVWLH PXUGHUV  D VHW RI KRXVHJXHVWV LQ D FRXQWU\ PDQRU FXW RII IURP WKH RXWVLGH ZRUOG E\ VWRUPV DQG PDUVKHV D PXUGHU ² ZHOO DFWXDOO\ IRXU 7KLV LQWHULRU SOD\ LV ZDWFKHG E\ WZR FULWLFV ZKR KDYH WKHLU RZQ SUREOHPV RI VWDWXVDQGSDVVLRQ7KHSOD\VWDUWVIDLUO\QRUPDOO\XQWLOWKHFULWLFV themselves become involved in the action of the 'inner' play. The ORJLFVHHPVWRYDQLVKLQDPL[WXUHRIFRQIXVLRQP\VWHU\PD\KHP and extra-marital affairs. ,HQMR\HGSURGXFLQJWKLVSOD\YHU\PXFKDQGHQMR\HGZRUNLQJDJDLQ with basically the same cast as "Rashomon". 7KH ILQDO HYHQLQJ HQGHG DV XVXDO ZLWK LQGXOJHQFH LQ VKRUWEUHDG Greek cookies and glßhwein. Mr H Wilson

106


107


40TH ANNUAL INTER-HOUSE PLAY FESTIVAL - 2005 Adjudicators :

Mr J Passmoor & Mr R Dalton

General Secretary :

Richard Boatwright

General Stage Manager :

Jean Hammond

Lights: 



Front of House : 



&KULV9RXQQRX'DUU\O.ROOHU&KDUO5DGHPDQ Mark Dunn



7LP%DOODQW\QH-DPHV+D\QHV6PDUW%HQ/DYLQ

Sale of Tickets :

Marco Athanasopoulos

Refreshments :

Mrs Brockway

CROFTS

"Happy Days for Harrison Gumedi" by Ronald Byron Producer : Lazarus Mabasa

HILL

"What are You Doing Here?" by David Campton Producer : Simon Chittenden

DAVIS

from "The Cane Mutiny Court Martial" by Herman Wouk Producer : Warren Chalklen

HOFMEYER

"Sunday Costs Five Pesos" by Josephine Niggli Producer : Moshe Rachidi

SCHOOL

"Flyboy" by Yvonne Adrian Producer : Thato Mojo

ANDERSON



=RRODQGHUDGDSWHGE\5XGL$XFDPS Producer : Rudi Aucamp

GRIMMER

"Royal Hunt of the Sun" (Act II) by Peter Shaffer Producer : Warren Brockway

ROBINSON

"Picnic on the Battlefield" by Fernando Arrabal Producer : Christopher MacRoberts 108


40th Annual Inter-House One-Act Play Festival 2005 Results

1. Best Play :

"Royal Hunt of the Sun" (Grimmer) produced by Warren Brockway

2. Proxime Accessit :

"Sunday Costs Five Pesos" (Hofmeyr) produced by Moshe Rachidi

3. Best Actor in a Major Role :   

5XGL$XFDPSDV=RRODQGHULQ =RRODQGHU $QGHUVRQ



Highly Commended : • Mlungisi Mkhize as Bertha in "Sunday Costs Five Pesos" (Hofmeyr) • Warren Brockway as Atahuallpa in "Royal Hunt of the Sun" (Grimmer) • Nicholas Strucken as Pizarro in "Royal Hunt of the Sun" (Grimmer) • Thato Moja as Dad in "Fly Boy " (School)

4. Best Actor in a Supporting Role :



Robert Scott as Lt. Maryk from "Caine Mutiny Court Martial" (Davis)

Highly Commended : • Michael Pappas as Mom in "Fly Boy" (School) • Ngcebo Ndlovu as Elizabeth Gumedi in "Happy Days for Harrison Gumedi" (Crofts) • Christopher MacRoberts as Monsieur Tépan in "Picnic on the Battlefield" (Robinson) ‡ &DUO0XOOHUDV=DFKDU\LQ)O\%R\ 6FKRRO

• Gareth Corder as Sally in "What are you doing here?" (Hill) • Ryan Lombard as Wally in "What are you doing here?" (Hill)

5. Best Costumes : 

$QGHUVRQ VSURGXFWLRQRI=RRODQGHU produced by Rudi Aucamp

6. Best Set / Use of Stage :

School's production of "Fly Boy" produced by Thato Moja 109


List of previous winners Year 1966 1967 1968 1969 1970 1971 1972 1973 1974 1875 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004 2005

House Anderson Hill Hofmeyr Crofts Robinson School Anderson Anderson Grimmer Hofmeyr Anderson Grimmer Anderson Davis Hill Robinson Hofmeyr School Hill Robinson Hofmeyr Davis Grimmer Robinson Davis Hofmeyr Crofts Robinson Crofts Crofts Grimmer School School Crofts Davis Robinson Hill Hill Davis Grimmer Crofts Grimmer

Play The Marat / Sade by Peter Weiss Hewers of Coal by Joe Corrie The Happy Journey by Thornton Wilder Tail of Fire by T B Morris The Commission by Margot Jay Battle of Wits by N Williams The Bald Prima Donna by Eugene Ionesco The Effect of Gama Rays on Man-in-the-Moon MarigoldsE\3DXO=LQGHO The Death of Bessie Smith by Edward Albee People are Living There by Athol Fugard Picnic on the Battlefield by Arrabel It Should Happen to a Dog by W Mankowitz Hope is a Thing with Feathers by R Harrity Fool's Errand by Chaucer / Margaret Wood The Laboratory by David Campton Ball Boys by David Edgar Story Theatre by Paul Silke From Equus by Peter Schaffer From The Birthday Party by Harold Pinter Hope is a Thing with Feathers by R Harrity The Death of Bessie Smith by Edward Albee Playmaker by Colin Hossack From Hamlet by William Shakespeare Fear of Heaven by John Mortimer Royal Hunt of the Sun by Peter Schaffer Pyramus and Thisbe by William Shakespeare The Real Inspector Hound by Tom Stoppard From The Crucible by Arthur Miller From Biloxi Blues by Neil Simon From A Few Good Men The Room by Harold Pinter Story Theatre by Paul Silke Fool's Errand by Chaucer / Margaret Wood The Three Knaves of Normandy by Constance Cox Flyboy by Yvonne Adrian From A Resounding Tinkle by N F Simpson The Real Inspector Hound by Tom Stoppard Royal Hunt of the Sun by Peter Schaffer Reunion by W St John Taylor Playmaker by Colin Hossack Goodbyee by R Curtis and B Elton Royal Hunt of the Sun by Peter Shaffer 110


Colours The following were awarded their Colours last year : R Aucamp W Brockway This year Colours were awarded to : W Chalklen D Koller T Mojo M Pappas C Vounnou

Premier Awards of the Society Best Actor of the Year (The Plate):

Warren Brockway and Rudi Aucamp for many years of consistent enthusiasm and great ability in the Society.

The Greatest Overall Contribution to the Success of the Society (The Sword): C Vounnou and D Koller for their great    FRQWULEXWLRQWRVXFFHVVRIDOORXUSOD\VIURP their loft in the lights box. Nothing has been too much for them.

Dramatic Dinner :HQHHGKHUHWRSD\VSHFLDOWULEXWHWR0UV%URFNZD\IRUORRNLQJDIWHURXUQHHGVGXULQJWKH\HDU 1RWKLQJKDVEHHQWRRPXFKIRUKHUDQGIRUWKLVZHDUHWUXO\JUDWHIXO7KH\HDUHQGHGDVXVXDOZLWK D 'LQQHU LQ WKH7DQGHP D VSOHQGLG IHDVW DW ZKLFK ZH ZHUH HQWHUWDLQHG E\ GLYHUVH VSHHFKHV DQG HQWHUWDLQPHQWV$QGVRZHSXWWKHVRFLHW\WREHGIRUWKH\HDUÂŤ Hugh Wilson

109


First-Aid

Master in Charge :

Mr N Mbele

First Aid is a field in which you can never stop learning. This past year it was wonderful to see how keen some of the junior boys were to join and to learn more about what the senior boys were doing. $VLQWKHSDVWWKH)LUVW$LGJURXSKDVEHHQLQYROYHGLQSURYLGLQJDYHU\YDOXDEOHVHUYLFHDWDOO UXJE\KRFNH\DQGDWKOHWLFVKRPHJDPHV2XUFDSWDLQ6HUJH.DQGXOHORZDVUHZDUGHGZLWKD trophy for his much appreciated contribution to First Aid over the years. :HDUHWUXO\JUDWHIXOWRWKHWUDLQHGSHUVRQQHO0U6SHHFKO\DQG0LVV+DUULVIRUWKHLUVXSSRUW which was invaluable. )LQDOO\ZHZRXOGOLNHWRWKDQNWKH6FKRROIRUWKHLUVXSSRUWZKLFKUHVXOWHGLQWKHSXUFKDVHRI much needed stock and further training being undertaken. Mr N Mbele

First Aid 2005 112


Pipe Band

Educator in Charge:

Dr D Hudson-Lamb

2005 has once again been a year of great success for the Pipe Band. Andrew Fok has excelled at his duties as Pipe Major and he was well-supported by a group of fine young gentleman. I DPYHU\SURXGWREHDVVRFLDWHGZLWKWKHVHGHGLFDWHGOR\DODQGKDUGZRUNLQJ\RXQJPHQ7KHLU perseverance has certainly paid off and the Band came First in the Regional Championship and First in the Champion of Champions Competition. Once again these results are only possible ZLWKWKHH[SHUWLVHRIRXU7XWRUV&KULV0XOOLQGHU&UDLJ+HUZLOODQG3HWHU%RQG:HDUHWUXO\ indebted to them and as always it has been a pleasure to work with these dedicated Tutors who always go beyond the call of duty. King Edward VII School hosted the Sandy Mallen and the Junior 100 Guineas Competitions again this year with good results.

Pipe band results in the novice junior competition: The Amanzimtoti trip was once again a highlight and a big thank you to Mr Hancock for accompanying the Band to the South Coast Gathering. This is fast becoming a yearly pilgrimage! Cultural Colours have been awarded to: 7%DOODQW\QH$+DQLRWLV-+D\QHV6PDUW6.DQGX/HORDQG46WH\Q Dr D Hudson-Lamb

114


Pipe Band 2005 )URQW5RZ OHIWWRULJKW 

91DUDQ56WHSKHQVRQ$)RN6.DQGX/HOR6+LOO

%DFN5RZ OHIWWRULJKW 

$+DQLRWLV-+D\QHV6PDUW7%DOODQW\QH46WH\Q-$GGLQJWRQ

115


Computer Centre and Media Centre

Educator in Charge:

Mrs H A Charlesworth

7KH0HGLD&HQWUHKDV\HWDJDLQEHHQWKHYHU\KXERI.LQJ(GZDUG9,,6FKRRO/HDUQHUV HGXFDWRUVSDUHQWVDQGWKHFRPPXQLW\KDYHPDGHXVHRIWKLVIDFLOLW\,QWKHDIWHUQRRQ conscientious learners complete their homework in the quiet of the Media Centre and evening meetings are held by parents in the convenience of the Centre. Visual literacy and educational videos are regularly shown in the Media Centre viewing room and YDULRXVFODVVURRPVZKLFKDUHHTXLSSHGZLWKPRQLWRULQJXQLWV Fiction and non-fiction books are purchased from local booksellers for both educators and learners as requested. There is a Library Prize for the one who has read the most books during the year. The ever popular Photostat machine is most useful when information from reference books is required for projects. Glossy magazines and daily papers encourage pupils to frequent the Media Centre during breaks. Once a year the Library is tastefully transformed into an Art Gallery to display art work produced by learners during the year at an Art Exhibition in November. Our thanks are extended to Mr P Ogier for the computerisation of the Library Resources and we look forward to a bank of computers being installed in the Media Centre for Project purposes in the forthcoming year. Congratulations to our matriculants E Mazibuko and S Ngobe who have served in the Media Centre since Grade 8 and thus deserved to share the Library Trophy for 2005. 0\WKDQNVDUHH[WHQGHGWRDOOWKH0RQLWRUVDQG6WDII0UV$FWRQ0UV%DUQHVDQG0UV0DKODQJX for their untiring assistance during the year. Mrs H A Charlesworth

116


The Junior City Council

Educator in Charge : Councillors :

Mrs A Mania P Thahane and W Chalklen

King Edward VII School has always prided itself on the high calibre of its junior councillors. This was UHLQIRUFHGZKHQLQ0D\3XVR7KDKDQHZDVHOHFWHGDVWKHQHZ-XQLRU0D\RUIRU thus keeping this important position within our ranks. Puso and Warren have shown great dedication to their community and established a youth outreach programme at King Edward (KESCO) to include other like-minded learners to join in their charity drives. I applaud their successes and initiative. Their unfailing dedication and enthusiasm are without equal and I wish them a productive and rewarding term of office. Mrs A Mania

Junior City Council From left to right: :&KDONOHQ &KDLUPDQ:HOIDUH  &0DF5REHUWV -XQLRU&LW\&RXQFLO0D\RU  P Thahane (Junior City Council Mayor 2006) 118


Johannesburg Junior City Council Report ´, DP XQZULWWHQ , FDQ W UHDG P\ PLQG , P XQGHILQHG , P MXVW EHJLQQLQJ WKH SHQ V LQ P\ KDQG ending unplanned.â&#x20AC;? This is how I ended my first speech as the newly appointed Junior Mayor of Johannesburg for the term 2005/2006 which marks a mile as the eightieth year of council. I have been allowed the honour of being Junior Mayor of Johannesburg serving on the Junior City &RXQFLODGHOHJDWLRQRIUHSUHVHQWDWLYHVIURPIRUW\VFKRROVDOODURXQG-RKDQQHVEXUJ$VWKHRIILFLDO \RXWKZLQJRIWKH0HWURSROLWDQ&RXQFLOZHUHSUHVHQWWKH\RXWKLQRXUFLW\UDLVLQJWKHOHYHORIVRFLDO FRQVFLHQFHDQGDZDUHQHVVRQWKHIDFWRUVDIIHFWLQJDOOFLWL]HQVHVSHFLDOO\ZLWKLQWKH\RXWK:HDUH SULPDULO\FKDULW\RULHQWDWHGDQGVWULYHWROHQGDKHOSLQJKDQGDQGEULQJOLJKWORYHDZDUHQHVVDQG good fortune to those less privileged than ourselves. The Council is comprised of approximately 80 pupils each assigned a responsibility in the FRPPLWWHHVRUVHFWLRQ VZLWKLQ WKHFRXQFLO7KHVHPDQDJHPHQWFRPPLWWHHVLQFOXGH:HOIDUH &LYLF$ZDUHQHVV&RQWDFW&XOWXUH<RXWK$ZDUHQHVV6SRUWVDQG5HFUHDWLRQDVZHOODVDXQLTXHWK birthday committee. These committees undertake various projects during the course of our term. As Junior Mayor I have the humbling duty of leading the executive committee and the council as a whole. &RXQFLO KDV WDXJKW VR PXFK DERXW WKH FLW\ LWV EHDXWLHV LWV LQIUDVWUXFWXUH LWV FRJV DQG JHDUV DQG HVSHFLDOO\ LWV IXHO DQG HQJLQH WKH SHRSOH ZKR DUH WKH GULYLQJ IRUFH EHKLQG LWV GLYHUVLW\  , KDYH FRPHWREHPRUHDSSUHFLDWLQJRIP\SULYLOHJHGSRVLWLRQWKURXJKP\HQFRXQWHUVZLWK$LGVRUSKDQV GLVDGYDQWDJHG FRPPXQLWLHV VHQLRU FLWL]HQV EXVLQHVV RIILFLDOV SROLWLFLDQV DQG HYHQ FHOHEULWLHV DOO RI whom have been in some way or another involved in our projects. \HDUV&RXQFLOYRLFHV,JRDO7KLVLVWKHPRWWRWKDWFKDUDFWHULVHVWKHHWKRVZLWKZKLFKZH have undertaken our projects. Some of the highlights of my term have been: â&#x20AC;˘ A tour of Soweto where we visited HIV and Aids orphans at the Othandweni Children's Home. Â&#x2021; $WRXURI&DSH7RZQZKHUHOLIHORQJERQGVZHUHPDGHDQGDIILOLDWLRQZLWKWKH3DDUODQG&DSH Town Junior Councils strengthened. â&#x20AC;˘ A television interview which gave me my fifteen minutes of fame and much appreciated exposure for council. Â&#x2021; $OLEUDU\H[HUFLVHZKHUHZHFROOHFWHGERRNVVWDFNHGVKHOYHVDQGSDLQWHGDOLEUDU\DW)UHHGRP Primary School in Eldorado Park. â&#x20AC;˘ Kids Carnival where we treated more than 600 orphaned children to a day of fun and entertainment held at King Edward VII School. Â&#x2021; 0UDQG0LVV-R EXUJSDJHDQWDQLJKWRIJODPRXUWKHSURFHHGVRIZKLFKZHQWWR.LGV+DYHQ Â&#x2021; 7KH$QQXDO +DQG LQ +DQG SURMHFW D 'D\ GHGLFDWHG WR WKH VHQLRU FLWL]HQV RI -RKDQQHVEXUJ organised by the Bnei Brith organisation. %HLQJ RQ &RXQFLO KDV WDXJKW PH SDWLHQFH DSSUHFLDWLRQ DQG WLPH PDQDJHPHQW  ,W KDV JLYHQ PH an introduction to the "real" world where time is as rare a commodity as money. Council has presented me with so many opportunities and taught me invaluable lessons. The insight I have gained on the unending need for a helping hand in the community is truly priceless. , ZRXOG OLNH WR WKDQN .LQJ (GZDUG9,, 6FKRRO IRU \RXU FRRSHUDWLRQ DQG VXSSRUW D VSHFLDO WKDQN \RXWR0UV0DQLDIRUKHULQILQLWHVXSSRUWDGYLFHDQGFRQVLGHUDWLRQGXULQJRXUWHUP7KDQN\RXIRU 119


KHOSLQJPHUHDOLVHP\SRWHQWLDO7KDQNVDOVRJRRXWWR:DUUHQ&KDONHQQRORQJHUP\FRFRXQFLOORU but rather a life long friend. This has been one of the most rewarding and humbling years of my life. I wish all future JCC VXFFHVVRUV UHSUHVHQWLQJ .LQJ (GZDUG9,, 6FKRRO VXFFHVV LQ WKHLU WHUP RI RIILFH  +DYH D EODVW serve your term with minds wide open because today is where your book begins. The rest is still unwritten. Puso Thahane

Johannesburg Junior City Council Report %HLQJD-XQLRU&RXQFLOORUKDVEHHQDOLIHFKDQJLQJLQGHVFULEDEOHH[SHULHQFHRIKDSSLQHVVZKHUH, KDYHOHDUQHGDERXWDQGPHWVRPDQ\QHZSHRSOH,KDYHDOVRUHDOLVHGWKDWRXUFRXQWU\QHHGVXVDV the youth to stand tall and be counted. ,OHDUQHGRQRXUWULSWR&DSH7RZQWKHYDOXHRIWROHUDQFHIRUJLYHQHVVDQGPRVWRIDOOWKHYDOXH of friendship and teamwork. I was honoured to be selected as the chairperson of the welfare committee for this year and our vision is to always do what we can to uplift the lives of people by spreading the message of 'ubuntu'. I have gained knowledge about the challenge of time-management and prioritisation. I have come to admire and respect those living with Aids. Through the 'Hand in Hand' project whereby we entertained 500 senior citizens I learnt to never underestimate the will for life of the young at heart. ,Q 6HSWHPEHU .LGV &DUQLYDO was an event whereby we interacted with 600 abused and abandoned children on our soccer fields. This taught me how important it is to have such a strong support EDVHLQ0UV0DQLD0U)HQQHOO Puso and my family because organising such an event is hard work and we say thank you for allowing us to use the fields for such an amazing day to take place. KESCO visit to Nkosi's Haven Our goal as councillors is to make people aware of the "grass-root" problems facing our country such as Aids and high illiteracy; by creating a higher social awareness within our School. A new SURMHFW.(6FRPPXQLW\RXWUHDFK .(6&2 EHJDQRIILFLDOO\RQ6HSWHPEHUWRKHOSLQFOXGH community-minded learners who want to give of their own time to help those less fortunate to EHFRPHÂŤ There are many challenges facing us as councillors but we shall do so with a smile. Council has 120


WKHPRVWDPD]LQJH[SHULHQFHLQP\OLIHDQGP\GUHDPIRUFRXQFLOLVWKDWLWQHYHUORVHVLWVSXUSRVH and that King Edward boys will always fly our banner high. To our future councillors: flourish in the DFWRIKHOSLQJSHRSOHPHHWLQJSHRSOHDQGRIFRXUVHUHSUHVHQWLQJRXUIHOORZOHDUQHUV:HZLVK\RX all the best for the future. 7KDQN \RX WR 0UV 0DQLD 0U )HQQHOO /HUDWR &KULV RXWJRLQJ FRXQFLOORUV  DQG DOO WKH VWDII DQG pupils of King Edward who have supported us in our endeavours. Thank you to our mayor Puso ²UHPHPEHU :HDUHXQZULWWHQ

Warren Chalklen

Junior City Council â&#x20AC;&#x201C; KESCO Report .(6&2 LV D FRPPXQLW\ RXWUHDFK SURJUDPPH ZKLFK ZDV VWDUWHG E\ WKLV \HDU·V -XQLRU &LW\ &RXQFLOORUV3XVR7KDKDQHDQG:DUUHQ&KDONOHQWRHVWDEOLVKDUHODWLRQVKLSEHWZHHQ.LQJ(GZDUG VII School learners and the disadvantaged people in Johannesburg. The first project that we as KESCO undertook (in September 2005) was to work with our choral VRFLHW\RQDQDPD]LQJ¶KDQGVRQ·SURMHFWZKHQZHYLVLWHG1NRVL·V+DYHQ 1NRVL·V+DYHQLVDKRPHVLWXDWHGLQ<HRYLOOH-RKDQQHVEXUJZKLFKFDWHUVIRUFKLOGUHQDQGPRWKHUV OLYLQJZLWK+,9DQG$,'6,WZDVIRXQGHGLQ-XQHE\*DLO-RKQVRQDYHU\SDVVLRQDWHDQGFDSDEOH and entertaining woman (who looked after Nkosi throughout his battle with AIDS). 2XUILUVWREMHFWLYHXSRQDUULYDODWWKHKDYHQZDVWRSDFNWKH¶OXFN\SDFNHWV·WREHGLVWULEXWHGWRWKH FKLOGUHQWKHVHZHUHNLQGO\GRQDWHGWRXVE\.(6)$0 WKDQN\RXYHU\PXFK 7KHOXFN\SDFNHWV FRQVLVWHG RI FKLSV VZHHWV IUXLW DQG WUHDWV 7KLV DORQJ ZLWK WKH HQWHUWDLQLQJ VRQJV E\ WKH FKRLU made the day extra special for all who were involved. This was followed by an interaction with the FKLOGUHQDQGWKHPRWKHUVDQH[SHULHQFHZKLFKDOORZHGXVWRDVNTXHVWLRQVDQGWROHDUQDERXW+,9 and AIDS on a social level. The feeling of satisfaction and the yearning to create a better future for those less fortunate than RXUVHOYHVZDVDVWRQLVKLQJ,EHOLHYHWKDWZHUHSUHVHQWHGWKH6FKRRO.(6&2WKH&KRUDO6RFLHW\ and ourselves with pride and dignity. I would like to extend a huge thank you to my co-councillor Puso for his efforts in organising the SURMHFW,ZRXOGOLNHWRWKDQN.(6)$00UV1GORYXDQGWKH&KRUDO6RFLHW\IRUDOORZLQJXVWRZRUN together to make a difference. Thank you also to Mrs Mania and Mr Fennell for making council great and our dream for KESCO possible. One more thank you must go to all the members of KESCO. 2QEHKDOIRI3XVRDQGP\VHOIWKDQN\RXIRUDOO\RXUVXSSRUW0D\ZHJURZLQVWUHQJWKDQGQXPEHUV ZKLOHHPEUDFLQJWKHSULQFLSOHRIXEXQWX²WKHVSLULWRIVKDULQJFDULQJDQGGRLQJZKDWZHFDQWRJLYH hope to those who need it most. Warren Chalklen Junior Councillor 121


The Annual Matric Farewell

Matric Dance 2005 It was with a great deal of enthusiasm and excitement that the third term began for the Matric JURXS7KHKRWWRSLFZDVRIFRXUVHWKH0DWULF'DQFHZKLFKIRUPDQ\ZRXOGSURYHWREHWKH KLJKOLJKWRIRXU\HDU:HHNVRIDQWLFLSDWLRQSUHFHGHGWKHELJGD\ZLWKFRQYHUVDWLRQFHQWHUHGILUPO\ DURXQGZKRZDVZHDULQJZKDWZKDWZDVWUDQVSRUWLQJHYHU\RQHDQGPRVWLPSRUWDQWO\ZKRZDV bringing who! +HOGLQWKH,QMDEXOR5RRPDWWKH,QGDED+RWHORQWKHWKRI$XJXVWWKHGDQFHWUXO\H[FHHGHG HYHU\RQH·VH[SHFWDWLRQV7UXHWRIRUPWKHJHQWOHPHQRI.LQJ(GZDUGDUULYHGLQVW\OHLQOLPRXVLQHV /RQGRQFDEVDQGHYHQDVWUHWFKHG-HHS1DWXUDOO\HDFKDQGHYHU\FRXSOHFDPHHOHJDQWO\DWWLUHG and the astounding array of dresses was enough to impress even the trendiest fashionista. 7KHWKHPHZDV&KLFDJRDQGZHZHUHJUHHWHGE\DVLJKWWKDWZDVQRWKLQJVKRUWRIPDJQLILFHQW 8SRQDUULYDOHDFKJXHVWZDVJLYHQWKHUHGFDUSHWWUHDWPHQWDQGPHWE\DQDUP\RIHDJHU photographers and scantily-clad ushers clamouring for the attention of each couple. A saxophonist FDSWLYDWHGWKHJXHVWVDVWKH\VZHSWLQWRWKHURRPDQGWKHPHODQFKRO\UK\WKPVRI¶%DNHU6WUHHW· KHLJKWHQHGWKHPRRG7KHGpFRUZDVRSXOHQWZLWKDVW\OLVKUHGDQGEODFNORRNFRPSOHPHQWHGE\ superb murals courtesy of the art department. We were immersed in the elegance and decadence RI V&KLFDJRWUDQVSRUWHGWRDQHUDWKDWRR]HGVW\OHDQGVRSKLVWLFDWLRQ 7KHVLJQLILFDQFHRIWKLVXQIRUJHWWDEOHHYHQLQJGDZQHGRQXVDVZHOLVWHQHGWRWKHVSHHFKHVDQG ZHZHUHDEOHWRUHIOHFWRQWKHMRXUQH\ZHKDGWDNHQWKURXJKRXU\HDUVDW.LQJ(GZDUG7KLVZDV RIFRXUVH0U)HQQHOO·VILUVW0DWULF'DQFHDWWKH6FKRROVLQFHKLVRZQLQDQGLWLVIDLUWRVD\ that he was overwhelmed by the atmosphere of the occasion. 7KHPRXWKZDWHULQJVHOHFWLRQRIIRRGZDVHQRXJKWRVDWLVI\DQ\SDODWHDQGZDVPDGHHYHQEHWWHU by a sizzling troupe which set the dance floor alight with a Chicago routine. The prefects were VRPHZKDWOHVVVFLQWLOODWLQJEXWQRQHWKHOHVVPDGHWKHEHVWRIDILHU\GDQFHZLWKWKHWHDFKHUVDQG ZHUHJUHHWHGZLWKWXPXOWXRXVDSSODXVH,WZDVIRUWXQDWHKRZHYHUWKDWWKHPHDOZDVZHOODQG WUXO\RYHUEHIRUHWKHDXGLHQFHZDVH[SRVHGWRWKHVLJKWRI0U3DVVPRRU·VVZD\LQJKLSV« 6DGO\WKLVPDJLFDOHYHQLQJFRXOGQRWODVWIRUHYHUDQGDVWKHPXVLFZRXQGGRZQWKHJURXSFDPH together to perform a final rousing warcry. This was without doubt the most moving part of the HYHQLQJ²WKHIORRUVKRRNDQGWKHZDOOVUHYHUEHUDWHGDVWKHPHQRI.LQJ(GZDUGOHIWWKHLUPDUN 6LQFHUHWKDQNVWR0UV*URHQHZDOG0UV3KHLIIHU0UV,UHODQG0UV.QLJKW0UV:HVVHOV0UVGH -RQJ0LVV6WHYHQVDQG0LVV6SDLQDQGDOOWKHRWKHUFRQWULEXWRUVWRWKLVPDJQLILFHQWHYHQLQJ C MacRoberts

123


128


Athletics

Master in Charge: Captain: Vice-Captain:

Mr S Eales K Demartinis S Nkungu

Yet again King Edward enjoyed a highly successful athletics season. The season began with a tough fixture against Jeppe and Pretoria Boys'. The boys stepped up and turned in some remarkable performances to comprehensively beat our traditional rivals and set the tone for Athletics 2005. Unfortunately luck was not with the A team on the day and they were to come up just short to their WUDGLWLRQDOULYDOV3UHWRULD%R\V LQWKHILQDOPHHWLQJRIWKHVHDVRQ7KLVZDVRQO\WKHVHFRQGWLPH that the King Edward Athletics Team lost in the last eighteen meetings. The team did exceptionally well comprehensively winning five out of their six meetings including beating Pretoria three times before the Inter-High meeting. Led from the front by the open age group with some excellent sprinting and middle distance running the Athletics Team showed all the potential to go unbeaten. But this was not to be. The season began quite compressed with heats and championships taking place in 5 days. The heats and FKDPSLRQVKLSVZHUHYHU\ZHOOUHSUHVHQWHGHVSHFLDOO\ E\ WKH MXQLRU DJH JURXSV DQG WKH 8 DJH JURXS D sign that Athletics is still a popular choice at King Edward. The following Friday the traditional Inter+RXVHUHOD\WRRNSODFH7KHHYHQWZDVHQMR\HGDQGD definite highlight of the day was the Masters beating the Boarders in the Tug of War (well done team). The meeting was won comprehensively by Davis House. The Open age group can be proud of their SHUIRUPDQFHV WKURXJKRXW WKH VHDVRQ OHDGLQJ WKH team from the front and showing the juniors how athletics should be done at King Edward. After losing 0DOHNDHDUO\LQWKHVHDVRQWKHRWKHU2SHQVSULQWHUV came to the fore with some fine relay running and individual sprints. Demartinis led the field well and can be a proud captain for his efforts and dedication to King Edward athletics. The boys had given five good years to King Edward athletics and it seemed a shame that they should lose their last Invitation meeting. The U17 age group can be extremely proud of their achievements. This age group was always very well represented at both practice and on the track. The U17 relay can best be described as XQVWRSSDEOHFRQVWDQWO\UXQQLQJDQGEHORZ7KHDJHJURXSJDYHPRUHWKDQFDQEHH[SHFWHGDQG KDVQXPHURXVKLJKOLJKWVIRU8QGRXEWHGO\DPRQJWKHEHVWPXVWEH6XOXSKD·VUHFRUGEUHDNLQJ P DW WKH %R\V  ,QYLWDWLRQ PHHWLQJ 'HWHUPLQHG PLGGOH GLVWDQFH UXQQLQJ DQG WRS VSULQWLQJ represented the age group well. Highly competitive and a strong will to win gives great promise for the 2006 season. The U16 age group was vastly improved from their previous year. Good sprinting and throwing kept the age group highly competitive and showed the age group is moving in the right direction. 126


sign was the new faces in the age JURXS ZKLFK KDYH QRW SDUWLFLSDWHG in previous years. This definitely helped to strengthen the age group and improve their consistency. Should they continue to show these improvements their age group and King Edward will definitely benefit. The U15 age group was the most disappointing: a highly talented group in all aspects of track and ILHOG D FRPPLWPHQW WR SUDFWLFH ZRXOG HQVXUH WKDW WKLV DJH JURXS ZRXOG RYHUZKHOP ZKDWHYHU the opposition could muster. Unfortunately few boys in the age group showed this commitment. Although they always performed well at the meetings much more will be expected from this talented age group. Special mention must be made of Sellwood who broke both the School high jump and shot put records. With a solid nucleus they have the ability to turn it around. Let's hope it happens. 7KH 8¡V WXUQHG RXW LQ IXOO IRUFH IRU WKH &KDPSLRQVKLS DQG VKRZHG WKDW WKHUH LV GHILQLWHO\ D strong talent base within the age group. After some early season commitment issues the age group settled down and trained hard and turned in some very fine performances especially on the track. 7KHLUQXPEHUVLQFUHDVHGWKURXJKRXWWKHVHDVRQZKLFKKHOSHGIRUPDIRUPLGDEOHDJHJURXSZKLFK consistently out-performed competitors from all schools. The future looks bright and one can only hope they take their enthusiasm and improved commitment into the higher age groups. The King Edward boys have shown that in Athletics they are still a force to be reckoned with. Through their commitment and effort they have continued to keep Athletics at King Edward at a high level. Athletics at King Edward is alive and well. Be Proud of an excellent Athletics season men. Well done. My thanks go to Mrs E Evans and all the mothers for their splendid catering. 0HVVUV7KRUQH 6FKHHSHUV +DQFRFN GH .RFN +DQVHQ )DEHU 0DU[ +DPPRQG 3DUVHUDPHQ 0LVV YDQ6WDGHQ0UV0DOKDQJXDQGWKHVWXGHQWFRDFKHV:LWKRXW\RXUKHOSHIIRUWVDQGDVVLVWDQFHWKLV successful athletics season would not have been possible. My thanks to Mrs Meyer for her announcing and the recording and scoring team of Mrs Newman and Mrs Thorne. Mr Matthee and his ground staff for the many long hours spent working on the track and ensuring that our facilities were always of the highest standard on fixture days. The boys of School House for their help with the hurdles and many other tasks you were required to do during the season. K Demartinis and the Open Age Group for leading by example. Mr S Eales 127


Results Inter House Relay Championship 1st Davis

301

Victor Ludorum:

K Demartinis

2nd Hill

235

Runner up:

S Nkungu

3rd School

212

U17 Champion:

C Vounnou

4th Robinson

206

U16 Champion:

K Moorcroft

5th Grimmer

181

U15 Champion

N Dlamini

6th Hofmeyr

179

U14 Champion:

A Leeuw

7th Anderson

153

8th Crofts

143

School Meetings King Edward 459, Pretoria Boys’ High 427, Jeppe High School for Boys’ 170 (at Jeppe) $7RXJKRSHQLQJIL[WXUHIRU7KHER\·VSHUIRUPHGZHOOLQDFORVHO\FRQWHVWHGPHHWLQJ King Edward 660, Parktown Boys’ High 359 (at King Edward) Sheer class. King Edward were too good on the day. King Edward 522, Parktown Boys’ High 297, Jeppe High School for Boys 247 (at Jeppe) A great performance. King Edward never looked back from the first event. King Edward 531, Pretoria Boys' High 482 (at King Edward) King Edward and Pretoria showed the traditional fighting spirit expected by both schools in a closely contested meeting until tea. The U14 Age Group were unstoppable on the day and firmly beat the opposition. King Edward 276, Pretoria Boys’ High 229, Afrikaanse Hoër Seunskool 209 (at Pretoria) A good performance on a Wednesday in Pretoria. Very close between all three schools until half way through the meeting. King Edward were able to pull away to a comfortable victory. 128


"A" Invitation at Parktown Boysâ&#x20AC;&#x2122; High Pretoria Boysâ&#x20AC;&#x2122; High 521, King Edward VI School 497, Afrikaanse HoĂŤr Seunskool 475, Parktown Boysâ&#x20AC;&#x2122; High 344, Jeppe High School for Boys 324, St Johnâ&#x20AC;&#x2122;s College 251, St Albanâ&#x20AC;&#x2122;s 227, St Davidâ&#x20AC;&#x2122;s Marist 227, St Stithians College 170 Another closely contested Invitation meeting. The morning VWDUWHGDVDWKUHHKRUVHUDFHEHWZHHQ3UHWRULD.LQJ(GZDUG DQG$IILHV ZLWK .LQJ (GZDUG ILQGLQJ RXUVHOYHV LQ WKLUG IRU most of the early morning. After the early middle distance HYHQWV $IILHV IHOO DZD\ DQG LW EHFDPH D VWUDLJKW FRQWHVW between King Edward and Pretoria. King Edward closed WRZLWKLQDIHZSRLQWVEXWSRRUILHOGUHVXOWVDQGDGURSSHG baton allowed Pretoria a comfortable win on the day. An excellent meeting and showing of boys' school athletics. The boys must be complemented on their efforts.

"B" Invitation at King Edward VII King Edward VII School "B" 205, Pretoria Boys' High "B" 204, St Alban's "B" 153, Parktown Boysâ&#x20AC;&#x2122; High "B"114 $Q H[WUHPHO\ FORVH PHHWLQJ WKH ZD\ DWKOHWLFV should be. King Edward Open Relay won the final race to ensure victory. Well Done. Thanks WR 0U 0DU[ 0U (UDVPXV DQG 0U +DQVHQ IRU taking time to co-ordinate the "B" Invitation and manage the â&#x20AC;&#x2DC;B" side.

129


Athletics Records 2005

130


Athletics Results Championships 2005

131


132


Basketball

Master in Charge : Coaches : Head Coach : 



Mr S Thorne Mrs J Newman and Mr N Mbele 0U4'HQ\VVHQ

Last year I bemoaned the fact that King Edward Basketball players had all the attributes when KROGLQJFDUU\LQJGULEEOLQJGULYLQJDVZHOODVSDVVLQJWKHEDOO+RZHYHURXUSUREOHPZDVVKRRWLQJ outside of the key. Well there is no point moaning about the problem and not doing anything about it. The coaches identified the problem and worked on it for the 2005 season. Work was done across the board with all the teams and hence our shooting outside the key as well as from the three-point OLQHKDVLPSURYHGGUDPDWLFDOO\2XUUHVXOWVFRQVHTXHQWO\LPSURYHGDJUHDWGHDODVZHOODQGLWKDVQRW become easy to defend against our teams anymore. King Edward VII School has therefore become less predictable to play against. Participation was again high at King Edward VII and we had 9 Basketball teams. Sadly we could have SURGXFHGWHDPVTXLWHHDVLO\KRZHYHUZHVWUXJJOHGWRILQGRSSRVLWLRQIRURXUORZHUVLGHV0DQ\ schools do not have a second team let alone a third team. Some of our opposition did not even have teams at certain age groups. Needless to say our U14C team managed to play two games and the U14B and U15B teams were able to play a game or two. The Second Team unfortunately had very few games; this is surprising as they normally have the same amount as the First Team. Basketball at school level is still struggling as I believe it is not growing as quickly as it should. More VFKRROVDUHSOD\LQJKRZHYHUKRZGRHVRQHNHHSDFKLOG¡VLQWHUHVWJRLQJLIRQHFDQQRWJHWDPDWFK to play? Furthermore the systems that are currently in place are not adequate as the sport does not seem to be growing as fast as it should. Worldwide it is growing quickly and it has become a global JDPHKHQFHZHKDYH$UJHQWLQDDVWKHFXUUHQW2O\PSLFFKDPSLRQV/LWKXDQLDWKHUXQQHUXSVDQGWKH United States of America in third place. Despite this negativity it seems that the professional league ZLOOJHWVWDUWHGDJDLQWKLV\HDULQ-RKDQQHVEXUJDQGIRU%DVNHWEDOO VVDNHZHKRSHLWWDNHVRIIEHFDXVH WKLVZLOOJLYHWKHVSRUWWKHQHFHVVDU\NLFNVWDUWLWQHHGVEXWLIZHFDQFDVWRXUPLQGVEDFNDIHZ\HDUV we can remember that the professional league started but failed due to legal battles. A great deal of thanks must go to Mrs Newman for all her organisation for home and away matches DVZHOODVWKHWRXUWR'+67R0U0EHOHWKDQN\RXIRUPDQDJLQJDQGFRDFKLQJWKH8JURXSWKLV VHDVRQDQGIRU\RXUHQWKXVLDVPLWZDVJUHDWO\DSSUHFLDWHG7RDOOWKHFRDFKHVWKDQN\RXIRU\RXU WLPHDQGHQWKXVLDVP7R0U0DWWKHHDVZHOODVWKHJURXQGVWDIIWKDQN\RXIRUWKHXSNHHSRIWKH FRXUWVDVZHOODVDOOWKHJD]HERVFKDLUVDQGWDEOHVGXULQJJDPHGD\)XUWKHUWKDQNVWR0UV(YDQVIRU all the catering. A special thanks to Mr Hansen as Acting Headmaster for all his support. Finally to 0U0DU[RXU6SRUWV'LUHFWRUDVLQFHUHWKDQNVWR\RXIRU\RXUDVVLVWDQFHDQGVXSSRUW A great deal of thanks and sincere gratitude from the First Team also goes out to Mr and Mrs S Hannie from Trends clothing for all their support as well as sponsorship of clothing for the First Team on their tour to the prestigious DHS Tournament. Mr S Thorne

134


First Team Basketball Manager: Coach:  Captain: Vice-Captain:





Mr S Thorne 0U4'HQ\VVHQ S Nkungu L Moletsane

:HOOGRQHRQDJUHDWVHDVRQ$ZLQUDWLRLVDQH[WUHPHO\JRRGRQHHVSHFLDOO\LQWKHOLJKWRIWKH IDFWWKDWZHSOD\HGLQWZRWRXUQDPHQWV7KHILUVWEHLQJWKH:LWV,QWHU6FKRRO7RXUQDPHQWZKLFKZH happened to win and the second being the DHS Tournament where we won four out of six games. I DPXQDEOHWRFRPPHQWRQSURYLQFLDOUHSUHVHQWDWLRQDVDWWKHWLPHRIZULWLQJWKLVDUWLFOHQRWULDOVRU VHOHFWLRQKDYHEHHQPDGH+RZHYHU,FDQPDNHFRPPHQWDERXW%URZQDVKHZDVVHOHFWHGDV0RVW Valuable Player at the Wits Basketball Tournament and Nkungu who was selected for the DHS AND1 Tournament's All Star team. This team epitomised what team work was all about and credit must go to them for all the work that they have done in the season and the platform that they have laid for the junior players with regards to work ethic. The boys had a never-say-die attitude and always gave of their best on and off

First Team Basketball 2005 Front Row (left to right):

*/HHXZ0&KDQJD61NXQJX &DSWDLQ 70DUHQWVD A Kurcharski

Back Row (left to right):

60DVHNR:%URZQ-%URZQ 135


Their behaviour at games was excellent and on tour was excellent and they never let themselves or their School down. The First Team always took pride in who they were as well as the school they represented. Their dedication to the School and their team-mates was out of the top drawer. The highlights in the season were numerous; the first being the winning of the Wits Tournament. The reason for this is that it was played at the end of 2004 which is the start of our season; however all WKHWHDPVWKDWHQWHUHGKDGWKHLU0DWULFVDQGHYHQSRVW0DWULFV:HRQWKHRWKHUKDQGGLGQRWSOD\ our matrics and had only our Grade 10 and Grade 11 boys; needless to say we won our pool and EHDW+LJKODQGV1RUWKLQWKHILQDO7KHRWKHUKLJKOLJKWZDVWKHILUVWJDPHRIWKHVHDVRQZKLFK,DOZD\V believe sets the tone for the season. This game was our first league match and against our neighbours St John's who had â&#x20AC;&#x2DC;sorted us out' the previous season. Be that as it may it was a new season and we were looking to turn things around. We managed to beat them in a close and exciting game and thereafter we never looked back. Beating St Albans in a return fixture was also a delight as their team was riding the crest of a wave and had not lost a game until they played us in the return fixture. :LWK WKH KLJKV FRPH WKH ORZV7KH ILUVW EHLQJ ORVLQJ RXU ILUVW JDPH DJDLQVW 6W$OEDQV WKH VHFRQG ORVLQJWR6W%HQHGLFW V+RZHYHUFUHGLWWRWKHWHDPDVWKH\PDQDJHGWRVHHNUHYHQJHDWWKH'+6 WRXUQDPHQWV E\ EHDWLQJ WKHP KDYLQJ OLWHUDOO\ MXVW JRW RII WKH EXV 'HVSLWH ZLQQLQJ IRXU RXW RI VL[

136


at the DHS AND1 Tournament the team was knocked out early and only managed a seeding of ninth place out of fifteen schools. Our consolation was the fact that we managed to win the plate. Where can the team improve or what were the mistakes that were made in the season? Well firstly we need to cut down on the fouls as this cost us points as well as the fact that players were getting fouled out of the game. Secondly we also needed to make sure of our free throws. Case in point was WKH'+6$1'7RXUQDPHQWZKHUHZHPLVVHGIDUWRRPDQ\IUHHWKURZV6R\HVRXUVKRRWLQJKDV LPSURYHGEXWZHQHHGWREHDEOHWRWDNHRXUIUHHWKURZVXQGHUSUHVVXUHDVWKH\DOOFRXQW As players go we did not have it all. When I say this I mean that we were not possessed with great KHLJKW LQ WKH WHDP:H GLG KDYH VRPH WDOO SOD\HUV EXW ZH VRRQ UHDOLVHG WKDW KHLJKW ZDV QRW RXU VWUHQJWK7KLVZDVHYLGHQWZKHQZHSOD\HG6W$OEDQVDVWKH\KDGVRPH VHULRXVO\ WDOOSOD\HUV Nkungu as captain was one of the most competitive players and captains I have ever seen on a court RUVSRUWVILHOG+HKDGDQHYHUVD\GLHDWWLWXGHZKLFKGLGODQGKLPLQœWURXEOH¡VRPHWLPHVIRURYHU ]HDORXVSOD\DQGRQRFFDVLRQVKHZDVIRXOHGRXW1HHGOHVVWRVD\DOWKRXJKKHODFNHGKHLJKWKHKDG DQDEXQGDQFHRISDFHVNLOOMXPSDQGKHDUWDQGOHGE\H[DPSOHLQKLVSOD\1NXQJXKDVDSDVVLRQIRU EDVNHWEDOODVZHOODVVNLOODQG,KRSHKHZLOOFRQWLQXHZLWKWKHJDPHDIWHUKHPDWULFXODWHV0ROHWVDQHDV WKHYLFHFDSWDLQZDVDJUHDWSDUWQHUWR1NXQJXRQDQGRIIWKHFRXUW+HKDGELJPDWFKWHPSHUDPHQW DQGZDVWKHœWKUHHSRLQWNLQJ¡DWVFKRROKLVWKUHHSRLQWHUVZHUHHQRXJKWRULSWKHKHDUWRXWRIWKH opposition. His general play was excellent and he was also lightning quick around the court. Brown did not receive MPV at the Wits Tournament for nothing and was always able to out-muscle the opposition. He was excellent in winning the rebound and was never outplayed on the court. Ferreria ZDVDUHYHODWLRQDVKHKDGQRWSOD\HGIRUWKH)LUVW7HDPEHIRUH+RZHYHUKHPDGHKLVSUHVHQFHIHOW and was extremely quick on the breakaway and had the ability to read the game and play the role of an outlet like a seasoned poacher. Kucharski and Bwalya were great team men who troubled the opposition with their height and skill. Kucharski will always be remembered for being a person who gave his all on the court for his School. Changa gave the team a relaxed complexion and he had the ability to slow the game down whereas Manentsa was always able to liven things up with his skill and blistering pace on the court. The Gray twins always gave of their best and never disappointed; I will never forget the impact that they had on the Bishop Bavin game. A great deal will be expected from WKHPQH[W\HDU%URZQZDVDQH[WUHPHO\FRPSHWLWLYHSOD\HUZKRKDVWKHDELOLW\WRILQLVKZHOODQGD great deal will also be expected from him next season. Special thanks must go to Leeuw who came into the team on merit halfway through the season; this was due to a player leaving at the end of 2004. He never shirked his responsibility and gave of his best and was the ultimate team man. It is a pity that KHGLGQRWJHWPRUHFRXUWWLPHEXWWKDQN\RXIRUVWDQGLQJXSDQGEHLQJFRXQWHG Mr S Thorne

Colours were awarded to : :%URZQ&)HUUHLUD/0ROHWVDQHDQG61NXQJX Team-Blazers were awarded to : -%URZQ%%ZDO\D-HURPH*UD\-DUHG*UD\$.XFKDUVNL0&KDQJDDQG70DQHQWVD The following boys represented the First Team : - %URZQ : %URZQ % %ZDO\D 0 &KDQJD & )HUUHLUD -DUHG *UD\ -HURPH *UD\ 7 0DQHQWVD /0ROHWVDQH 9LFH&DSWDLQ 61NXQJX &DSWDLQ */HHXZDQG$.XFKDUVNL 137


Second Team Basketball Manager: Coach: Captain:

Mr S Thorne O Ndlovu L Mabaso

There were limited opportunities for the Second Team. This was due to the fact that our opposition VHOGRP VHH WKH YDOXH LQ FUHDWLQJ GHSWK ZLWKLQ WKHLU VSRUW +RZHYHU ZH DW .LQJ (GZDUG9,, SULGH ourselves in the fact that we are effectively able to produce a probable Third Team. A great deal of thanks goes to the Second Team squad who tirelessly came out to practice day after GD\ZLWKRXWHYHQDJDPHZLWKLQWKDWZHHN+RZHYHUWKDWLVZKDWZHKDYHFRPHWRH[SHFWIURP.LQJ Edward VII Scholars. We are truly spoilt at this School by this sort of commitment. In this half of the season the Second Team had only three games in the season as opposed to the ten RIWKH)LUVW7HDPDQGWKLVH[FOXGHVWKHIXUWKHUQLQHJDPHVWKHILUVWWHDPSOD\HGLQWRXUQDPHQWV,W was hard to tell them at the end of the week that the opposition were unable to produce a second WHDP+RZHYHUWKH\FDPHEDFNVPLOLQJIRUWKHQH[WSUDFWLFHLQWKHKRSHRIJHWWLQJDJDPH$OWKRXJK they only had three games they were able to win all three in this part of the season. So well done RQDZLQQLQJUDWLR The following boys were part of the Second Team. ,VD\WKLVHYHQWKRXJKQRWDOOWKHER\VSOD\HGWKH\GLGVDFULILFHDJUHDWGHDODWDOOSUDFWLFHVDQGQRW even being rewarded with a game. $$QDWKDSROX.%DSHOD&%RUWKZLFN--XOOLHV/0DEDVR.0DIX.0EXNX.0ODPER 70RJDSL/1NXKOX'1NXVL&3HWHUV=5LFKWHU%6LEL\D$6SHHFKO\DQG37VKDEDODOD

138


U16 Basketball Coach : Captain :

K Ilunga M Rachidi

This is a team that is improving year by year. So if this continues great things will be expected of WKHPZKHQWKH\DUHLQ0DWULF+RZHYHUWKH\GLGORVHJDPHVWKDWWKH\VKRXOGQRWKDYHDQGWKH\ KDGDWHQGHQF\WRSDQLFZKHQWKLQJVJRWWRRFORVH7KHLUORVVHVWR6W$OEDQV$PHULFDQ,QWHUQDWLRQDO DQG6W%HQHGLFW VDOOZHUHFORVHDQGZLWKUHJDUGVWRWKHODWWHUZHFDQVD\WKDWGHIHDWZDVVQDWFKHG from the jaws of victory. On their victories we must look to a hard fought win against Bishop Bavin and congratulate them on a 100 pointer against St Peters. The other victories can be viewed in the results sheet that is provided. $VDQRYHUYLHZWKHWHDPSOD\HGPDWFKHVZLQQLQJDQGORVLQJZKLFKFRXOGKDYHJRQHHLWKHU ZD\7KHUHIRUHWKH\HQGHGXSZLWKDZLQUDWLRZKLFKFRXOGKDYHEHHQDERYHLIWKH\GLGQRW ORVHWKHLUQHUYHDWYLWDOVWDJHV$VDQDJHJURXSWKH\GRKDYHWKHDELOLW\WRGRPLQDWHWKHRSSRVLWLRQ even those that beat them. However this has to translate into points and they must remember that they cannot afford to get rattled. The U16 team has great potential and they have knitted well as a unit.This team has a core of players that the other boys are able to play around. They have all the physical attributes as a team and gave of their best at practice as well as during the game. They do get a bit frustrated at times and they must learn to be patient in the build up and realise that a team cannot always look to one or two players to get the job done. As a team they were well balanced as they had height as well as skill. You are not going to find many boys taller that McCoy or White at U16 level. These boys were not only tall but skilled as well. 0DVHNRZDVDSUROLILFSRLQWVVFRUHUDQGH[WUHPHO\DWKOHWLFDURXQGWKHFRXUWKHQFHKLVFDOOXSZLWK McCoy to the First Team for the DHS tour. Rachidi captained the side well and was unlucky not WRJRRQWRXUZLWKWKH)LUVW7HDPWR'+6KRZHYHUDJUHDWGHDOZLOOEHH[SHFWHGIURPKLPQH[W year. Moloi has come a long way this year - he has improved each and every season. Maghoma was a solid team man who was quick around the court and never shied away from the physical contact of the game. Gqoloma also never shied away from the physical aspect of the game and always gave of his best; although not tall enough for position of post he never let his opposite number get the EHWWHU RI KLP:HOO GRQH WR:KLWH ZKR KDV LPSURYHG HDFK VHDVRQ KRZHYHU KH QHHGV WR EHOLHYH more in himself as well as his athletic ability as he has a great deal to offer. Many others had limited RSSRUWXQLWLHVGXHWRWKHODFNRIGHSWKIURPWKHRWKHUVFKRROVVRWKDQN\RXYHU\PXFKIRUDOO\RXU KDUGZRUNDQGGHGLFDWLRQ5HPHPEHUGRQ·WJLYHXSDQGZHOOGRQHRQ\RXUFRQWULEXWLRQWR.LQJ Edward VII School Basketball. K Ilungo The following represented the U16A team throughout the season: -)LVKHU;*TRORPD**XWX+.DWXORQGL00DJKRPD$0DOXOHNH/0DQDQD60DVHNR.0F&R\ & 0RORL . 0RUJDQ 3 1LX 0 1WVKDQJDVH * 3HOOH 0 5DFKLGL &DSWDLQ  % 6DQJZHQL< 6NDDS A Sloth-Nielson and A White. 139


U15 Basketball Manager: Coaches: Captain: Vice-Captain:

Mr S Thorne Mr U Maquina & Mr S Thorne B Klassen D Allan

What a turn around for this Team! The reason for this is that as an U14 team at the end of 2004 WKH\ORVWDOOEXWRQHRIWKHLUJDPHVZKHUHDVZLWKLQRQHPRQWKWKH\PDQDJHGWRWXUQWKHLUVHDVRQ DURXQG7KH87HDPZHQWIURPZLQQLQJRQO\RQHWRORVLQJRQO\RQHJDPHJLYLQJWKHWHDPDQ ZLQUDWLRZKLFKLVH[FHSWLRQDO:HOOGRQHWRWKLVJURXSRIER\VZKRZHUHDEOHWRSLFNWKHPVHOYHV up after a disastrous season prior to the start of 2005. $JDLQDVODPHQWHGLQRWKHUWHDPV FRPPHQWVDORWRIWKHRSSRVLWLRQZHUHXQDEOHWRILHOGDQ8$ Team let alone an U15B Team. The U15A Team only managed to play six games when there were potentially 10 on offer. Needless to say the U15B Team only played once. It is hard to keep these ER\VPRWLYDWHGIRUDQHQWLUHVHDVRQZKHQWKHUHLVRQO\RQHJDPHRQRIIHU+RZHYHUZHOOGRQHRQ your outstanding commitment. Klassen proved to be an inspirational leader as he was able to turn a game and lead from the front. +HZLOOEHVRUHO\PLVVHGQRWMXVWEHFDXVHRIKLVSOD\EXWKLVFDSWDLQF\DVZHOO:HZLVKKLPDOOWKH best with his emigration overseas. 1RGD0NKL]HDQG'HGORZZHUHYDVWO\LPSURYHGFRPSDUHGWRWKHLUSUHYLRXVVHDVRQ7KH\SURYHG too strong in the air and were able to compete well with the physical aspect of the game. Thank \RXIRUDJUHDWVHDVRQ*LOEHUWVRQ·VVHDVRQZDVFXUWDLOHGE\SRRUOXFNDQGLQMXU\KRZHYHUKHKDV WKHSRWHQWLDOWRJRIDUDOEHLWZLWKDJUHDWGHDORIZRUNDQGGHWHUPLQDWLRQ.HDWLQJ VVHDVRQZDVDOVR FXUWDLOHGE\LQMXU\KRZHYHUKLVWDOHQWLVXQGHQLDEOH$JUHDWGHDORIZRUNQHHGVWREHGRQHIRUWKH QH[WVHDVRQHVSHFLDOO\LQWKHVKRRWLQJGHSDUWPHQWLIKHZDQWVWRPDNHWKHJUDGHDVDORWZDVPLVVHG out on. Grote as well as Buthelezi were greatly improved and gave of their best when called upon. +DQQLHKDV¶JURZQXS·DJUHDWGHDODQGWKHUHIRUHKLVJDPHKDVLPSURYHGDQGDORWZLOOEHH[SHFWHG QH[W\HDUDVDQ8$OODQLVDFOHYHUSOD\HUDQGVHHPVWRKDYHWLPHRQWKHFRXUW7KLVZDVFRXSOHG with the fact that he arguably had the best shot in the age group. He was always an automatic choice LQWKHVWDUWLQJOLQHXS.HHSZRUNLQJRQ\RXUVKRRWLQJ0DUROHQ0NKL]HDQG6LPHODQHZHUHUHDO¶EDOO KDQGOHUV·DQGJDYHDORWWRWKHVLGHLQVKHHUVNLOODVZHOODVSDFHDQGIRRWZRUN$OOKRZHYHUQHHGWR work on their shooting in order to become the complete player. Mr S Thorne The following boys represented the U15A Team during the season: '$OODQ6%XWKHOH]L='HGORZ-*LOEHUWVRQ.*URWH.+DQQLH..HDWLQJ%.ODVVHQ 70DUROHQ00NKL]H60NKL]H71GORYX61JZHYHOD31RGDDQG16LPHODQH The following boys were part of the U15B Squad: $%RJGDQRY0&ROEHFN0*UDKDP*0DJKRPD70EHOH00QLVL70RMDQDJD 00RQDJKDQ,6HIXPH)6ORWK1LHOVRQ*7UDFH\57KRPDVDQG0:DJJLH

140


Basketball Results 2005

Wits Tournament: First Team only

Winners of Tournament

DHS Tournament: First Team only

Won plate final and were placed 9th overall out of 15 schools

141


U14 Basketball Master in Charge : Coach : Captain :

Mr L Mbele J Bugugu J Jennings

2Q EHKDOI RI WKH .LQJ (GZDUG9,, 6FKRRO V %DVNHWEDOO PDQDJHPHQW WHDP ZH ZRXOG OLNH WR WKDQN all the U14 basketball players for 2005. The U14 players took to heart the example set by the senior players where hard work and determination are very evident. The players were an extremely PRWLYDWHGJURXSRI\RXQJER\VDOOGHGLFDWHGWRJDLQWKHPD[LPXPEHQHILWIURPWKHH[FHOOHQFHRI King Edward. A special thank you to the U14B's and U14C's; their willingness to practice long and hard certainly contributed to their success. They only played a few games but their enthusiasm and commitment were outstanding. They won all of their games with excellent results. )XUWKHUPRUHZHZRXOGOLNHWRWKDQNWKHFRDFKHVWKHHGXFDWRUVWKHRIILFLDOVDQGWKHSDUHQWVIRUWKH contribution they have made to the development of basketball in our School. Their team spirit was a fine example and we would like to thank them for their lively support. This team has the talent and is capable of developing into a really outstanding team in future. The big challenge to all U14 players is that success costs hard work and effort. Mr L Mbele The following boys represented the A Team : --HQQLQJV &DSWDLQ (0JKRPD10ZDO//HNJDQ\DQH9-RER*0DWODZHQJ'&RWWHU/0DVHNR /$EVDORP55DELQGD3*ROXERYLFKDQG11NZH The following boys represented the B & C Teams : 00RMD/.XSD06KXSLQJ-36WX\0&ROODLG-&DVWHO7&KHXQJ70DWODOD+(GZDUG<$UHII +/LDP/7KDEDQJ-0S\DQD-'DYLG00RORWR$/HHXZ00RSKRVKR=1RUWRQ&/DUEL *YDQ=\O7&KLXUD&,GOHDQG70DVXJD

142


Cricket

First Team Cricket Coach: Captain:

Mr E Marx J Smit

,QVLPLODUYDLQWRWKHSUHYLRXVVHDVRQWKH)LUVW&ULFNHW7HDPRIVWDUWHGRIIOLNHDKRXVHRQ fire with the "old boys" trying their best to book a place in the provincial team. Still on a high from their Johnny Waite triumph at the Wanderers the previous season our "old" First team won seven of WKHLUWHQPDWFKHVRQHRIWKHPKDYLQJEHHQUDLQHGRXWZKLOHHQURXWHWRDJRRGZLQ The first match was at the Michaelmas Week against Michaelhouse. Having lost the toss King Edward was sent in to bat first on a damp wicket and weather conditions that favoured the bowlers. We were soon in trouble but good courageous batting by Madiseng with 47 and an excellent match saving 64 by Carstens secured us a score of 209/9. Bowling conditions remained favourable and &DPHURQERZOHGVXSHUEO\IRUKLVIRUDEO\DVVLVWHGE\'DV1HYHVZLWKIRUIURPKLVRYHUV Michaelhouse was bowled out for 175. King Edward won by 34 runs. The second match at the Week against Hilton College saw King Edward batting again in poor conditions against some great fast bowling from Simpkins. King Edward struggled to 35 for 5 when some great determined batting from Das Neves with 45 and attacking batting from Cameron with 56 saw us through to 213 all out after 47 overs. Hilton College lost wickets at crucial times and Das Neves with 2 for 16 in his ten overs quietly strangled their progress. In a match where the teams had WROHDYHWKHILHOGRQQXPHURXVRFFDVLRQVGXHWREDGZHDWKHUWKHPDWFKZDVFDOOHGRIIDIWHURYHUV LQWR+LOWRQ·VLQQLQJV7KH\ZHUHVWLOOFKDVLQJUXQVIURPRYHUVZKLFKOHIWRXUSOD\HUVZLWKDQHPSW\ feeling of what could have been under better conditions. Match drawn. In the third match of the week against St Charles College King Edward lost a crucial toss and was asked to bat on a tricky pitch against some extraordinary bowling. Facing an uphill battle at 14 for 4 we could never recover and a quick 13 runs at the death secured a meagre score of 58 all out. Our bowlers started off well and applied the pressure but in the end the score was too small to defend. St Charles made the score with the loss of only 4 wickets. King Edward lost by 6 wickets. The true character of the team was apparent as they bounced back in the fourth match against Maritzburg College and their beloved Goldstones. Batting first after winning the toss Maritzburg struggled to 34 for 4 from which they never recovered. Due to excellent bowling from Peyper with 3 IRUDEO\DVVLVWHGE\'DV1HYHVZLWKIRUDQG'H:HHZLWKIRU0DULW]EXUJZDVUHVWULFWHG to 131 for 6 in their allotted overs. King Edward did not have the ideal start and slumped to 41 for 4 and the danger lights were flickering. Cameron with a well-struck 61 and Carstens with 28 not out steered King Edward to a memorable win. King Edward won by 6 wickets.

144


First XI Cricket 2005 Front Row (left to right): 

*9LODV'3DWULFLR-&DUVWHQV 9LFH&DSWDLQ -6PLW &DSWDLQ  .'HPDUWLQLV70DGLVHQJ

Back Row (left to right):

:/DQGVGDOH*7KRPVRQ'-DFREV'0DUVKDOO G van der Vyfer

$IWHURQHGD\¡VUHVWWKH)LUVW7HDPVWDUWHGWKHLUILYHPDWFKFDPSDLJQDWWKHDQQXDOBeckwith Week. The first match was against the Sandton Area TeamSOD\HGDW6W-RKQ¡V%ILHOG.LQJ(GZDUGEDWWHG ILUVW(YHU\RQHFKLSSHGLQZLWKDFRQWULEXWLRQ:RRGVVFRULQJ+RZHYHULWZDV6PLW¡VEOLVWHULQJ not out in the last ten overs that secured an excellent score of 256 for 5 after 50 overs. Good bowling HDUO\ RQ IURP 'HPDUWLQLV DQG:RRGV VHW .LQJ (GZDUG RQ FRXUVH EXW H[FHOOHQW ERZOLQJ IURP 'DV Neves with 3 for 9 and Peyper with 2 for 8 finally broke the back of the Sandton batting line-up. They were finally bowled out for 104. King Edward won by 152 runs. The Lions Development Team came up against King Edward on our main field in the second match of the Week. Batting first the Lions could only score 147 for 8. Woods with 0 for 17 and Das Neves with his 1 for 17 in their allotted 10 overs each restricted the Lions well. Woods then went on to score an unbeaten 58 to help King Edward reach the total for the loss of only 4 wickets. King Edward won by 6 wickets. The third day of the Week saw King Edward play against St StithiansRQFHDJDLQRQRXUPDLQILHOG6W 6WLWKLDQVVWDUWHGRIISRRUO\DQGQHYHUUHFRYHUHGEHLQJERZOHGRXWIRUUXQV$OOERZOHUVSHUIRUPHG ZHOOZLWK'H:HHWDNLQJIRUVWDQGLQJRXWRQDJRRGGD\IRURXUERZOHUV:RRGVZLWKDQG Carstens with 25 were both still at the crease when King Edward passed the score with only 2 wickets down. King Edward won by 8 wickets. 145


The fourth match was played against the Vaal A Area Team at King Edward. Vaal batted first and scored 148 for 5. All bowlers contributed to restricting the Area Team but Woods with 2 for 28 IDLUHGEHVW,QWKHUXQFKDVHWKDWFRVW.LQJ(GZDUGZLFNHWV&DPHURQH[FHOOHGZLWKDILQHDJJUHVVLYH unbeaten innings of 55. King Edward won by 5 wickets. The last match was played against a team from the Far West Rand. Woods with 3 for 18 and Thompson with 1 for 15 bowled well to help restrict Far West Rand to 143 for 8. In a slow run-chase King Edward managed to score the required runs with the loss of 5 wickets. Madiseng with 35 and Woods with 33 batted well but gave their wickets away near the end in an attempt to end the match. Cameron then wrapped it up with a quick 23 not out. King Edward won by 5 wickets. This wrapped up a successful 9 cricket days within the space of 11 days. An extraordinary feat for a team that was dedicated and determined to do well. Three players reaped the benefit of the good SHUIRUPDQFH RI WKH WHDP GXULQJ WKH VHDVRQ 'DV 1HYHV:RRGV DQG &DPHURQ ZHUH VHOHFWHG IRU the Gauteng u/19 Team that played at the annual Kaya Majola Coca-Cola Cricket Week in Pretoria. Das Neves captained the Gauteng team and was selected for the SA Schools Colts Team at the end of the Week. He was also included in the SA U/19 Squad from whom the Junior World Cup Team will be selected at the end of the year. Well done to these three cricketers and a special word of congratulations and thank you to Das Neves for a job well done as skipper of a team that started their WHUPZLWKDIHZKLFNXSVEXWHQGHGZLWKJORU\%HVWZLVKHVIRU\RXUEULJKWFDUHHULQFULFNHW 7KH)RXUWK7HUPVDZVRPHVHQLRUSOD\HUVKDQJLQJDURXQGWRJXLGHWKH\RXQJVWHUVLQWKHQHZVHDVRQ but the first match was still played with the "old team" against Pretoria Boys·LQ3UHWRULD3UHWRULD Boys batted first and reached 71/2 after 25 overs. Morris batted well and accelerated the run rate and KHOSHG3UHWRULD%R\VWRUHDFKZLWKKLVJUHDWNQRFNRI6KDZDIWHUEHLQJGURSSHGRQEDWWHG well to score 63. Peyper bowled well with his 3 for 22. King Edward started off slowly and had 73/3 after 25 overs. They never really accelerated and were bowled out for 153. Carstens with 36 and Smit with 25 contributed best with the bat. King Edward lost by 54 runs. The second match of the new term saw the inexperienced King Edward take on Alberton Schools at Alberton High. King Edward batted first on a damp wicket and got off to a good start with Carstens batting well. After 25 overs we were well poised with 104/3. King Edward lost 3 quick wickets and could never fully recover. Jacobs batted superbly for 57 runs. Alberton Schools started slowly and were 85/4 after 25 overs. They accelerated well after tea with Nixon scoring a quick 53. The last wicket put on a partnership of 23 runs to win the game. Thompson bowled well for his 3 for 30. King Edward lost by 1 wicket. The third match was played against Krugersdorp High on the main field. Krugersdorp was asked to bat first and struggled to get bat to ball in the first 8 overs. Demartinis and Thompson bowled very well and beat the bat on numerous occasions. Marshall initiated the breakthrough and almost got his hat-trick with some great bowling. Burton batted well for his 52. King Edward started off like a house on fire and had 27 after 3 overs. A run out and some loose shots put us under pressure but Vilas with QRWRXWDQG3DWULFLRZLWKVWHHUHGXVWRYLFWRU\/LHEHQEHUJDQG=ZHHEERZOHGSDUWLFXODUO\ZHOO for Krugerdorp. King Edward won by 2 wickets. .LQJ (GZDUG·V IRXUWK PDWFK ZDV DJDLQVW Afrikaanse Hoër Seunskool Pretoria at King Edward. King Edward batted first and scored 200/10. Patricio with 55 and Smit with 40 batted well but lost their wickets at a crucial stage in our innings. Affies never looked in trouble and a well played 100 from Jordan and a quick 50 from Hewitt finished off the game. King Edward lost by 7 wickets. The last match of 2004 saw King Edward play against a determined if not over-aged Development 146


team. King Edward batted first and struggled to 187 all out against some good and controlled bowling. Smit with 37 and Penaluna with 31 gave some respectability to our innings. Development reached King (GZDUG¡VVFRUHZLWKZLFNHWVGRZQ0DGLVHQJEHLQJWKHEHVWERZOHUZLWKIRU.LQJ(GZDUGORVW by 4 wickets. 7KH<HDUVWDUWHGRIIYHU\ZHWZLWKDOOWKUHHRIRXUILUVWPDWFKHVEHLQJUDLQHGRXW:DWHUNORRI *UH\&ROOHJHDQG6W$QGUHZ¡V%ORHPIRQWHLQ When the first match of the new year eventually got under way against Pretoria Boys¡.LQJ(GZDUG was sent in to bat first and scored 225/8. Madiseng batted superbly for his 89 and was unlucky not WRVFRUHKLVFHQWXU\UDWKHURSWLQJWRSOD\IRUWKHWHDPWKDQEDWWLQJIRUKLPVHOI+HZDVDEO\DVVLVWHG by Patricio with 37 and Smit with 30. Pretoria Boys' started off shakily when Demartinis (4 for 29) took two quick wickets and never really recovered. Cartsens showed some promise with his off spin ERZOLQJFODLPLQJIRULQRYHUV3UHWRULD%R\V¡ZDVHYHQWXDOO\ERZOHGRXWIRU.LQJ(GZDUG won by 82 runs.

St Stithians CollegeZDVVRRQLQWURXEOHDIWHUHOHFWLQJWREDWILUVWLQ.LQJ(GZDUG¡VVHFRQGPDWFK RIWKHQHZ\HDU7KH\ZHUHERZOHGRXWIRU7KRPSVRQZLWKIRUDQG&DUVWHQVZLWKIRU bowling superbly. van der Vyver with his 2 for 5 showed that there was a lot more to be expected of KLPWKHUHPDLQGHURIWKHVHDVRQ.LQJ(GZDUGWKHQPDGHWKHUXQVFRPIRUWDEO\ZLWKZLFNHWVGRZQ Madiseng making 51 not out. King Edward won by 8 wickets. ,QRXUWKLUGRXWLQJIRUDQGZKDWWXUQHGRXWWREH.LQJ(GZDUG¡VRQO\-RKQQ\:DLWH.QRFNRXW IL[WXUH.LQJ(GZDUGEDWWHGILUVWDJDLQVWJeppe Boys¡DQGEDWWHGVORZO\XSWRDIWHURYHUV Demartinis then played a quick innings of 22 to push the score up in the last 5 overs to 148 for 10. Jeppe started slowly and had 68/4 after 20 overs and King Edward looked to have the match sown up. +RZHYHUWKH\RQFHDJDLQPDQDJHGWRJUDVSGHIHDWIURPWKHFOXWFKHVRIYLFWRU\ZKHQ+H\QVZLWKD blistering 56 changed the game and Jeppe won on the second last ball of the match. King Edward lost by 1 wicket. ,QDVHDVRQZKLFKZDVFKDUDFWHULVHGE\ZLQQLQJDQGORVLQJVWUHDNV.LQJ(GZDUGFRQWLQXHGLQWRD match losing streak when we hosted St Albanâ&#x20AC;&#x2122;s College on the main field. Batting first King Edward VFRUHGDOORXWZLWK9LODVPDNLQJDSDWLHQW6W$OEDQ¡VWKHQVWUXJJOHGLQLWLDOO\EXWDJXWV\LQQLQJVE\ YDQ=\OFOLQFKHGWKHPDWFKIRUWKHPWKHLUHQGWRWDOEHLQJIRU.LQJ(GZDUGORVWE\ZLFNHWV In the fifth match of the year King Edward sent St John's College in to bat and after 25 overs St John's had 67/2. After tea Schultz made a quick 38 from 23 balls and Tayler made a well-paced 55 from 72 EDOOV6W-RKQ¡VHQGHGXSZLWKIRU&DUWVHQVZLWKIRUDQGYDQGHU9\YHUZLWKIRUERZOLQJ VXSHUEO\.LQJ(GZDUGKDGDIWHURYHUVEXWDIWHU6PLWZHQWIRUDQG&DUVWHQVIRUZHORVW 8 wickets in 14 overs which saw us ten runs short at 189 for 9. King Edward lost by 10 runs. 147


In a change to the ordinary Saturday fixtures King Edward went to Pretoria to play against Menlopark HoÍrskool in a day/night match. King Edward won the toss and elected to bat. We were soon in trouble with the score at 10/2. Smit and Carstens then batted very well to take the score to 99/3 when Carstens lost his wicket. Smit batted superbly for his 91 from 104 balls. King Edward scored 221 for 9. Menlopark batted under lights and struggled with the run rate from the start. Demartinis and Thompson bowled well at the start and conceded 17 runs from the first 10 overs. Marshall with 2 for 17 bowled well ably assisted by Carstens and van der Vyver with 2 for 37. Menlopark was bowled out for 82. King Edward won by 139 runs. In a second encounter with Jeppe they won the toss and batted first. Arnold batted well for his 50 but was caught on the boundary by Thompson which put pressure on their lower order. Haynes scored well in the end for his 45 helping Jeppe to 191 for 8. King Edward only lost Jacobs with the score on 14 and then never looked back. Patricio batted superbly for his century and Smit batted responsibly for his 70. For the first time in the season the batsmen who were in stayed in and batted through. King Edward won by 9 wickets. In the last match of the season against Parktown Boys¡.LQJ(GZDUGZRQWKHWRVVDQGGHFLGHGWREDWILUVW:HJRWRIIWRDJRRGVWDUWDQGSXWRQ runs in the first 7 overs. Jacobs batted well. In the middle order Landsdale with 64 and Thompson with 55 batted excellently. Peyper scored quickly at the death with 27 off 22 balls. Parktown started slowly and lost their first wicket on 42. Wickets tumbled regularly and they never came back into the game being bowled out for 130. Carstens with 4 for 29 and Marshall with 2 for 8 bowled well. King Edward won by 126 runs. In general I believe that the team underperformed and lost some matches from a winning position. On WKHSRVLWLYHVLGHWKH\KDYHUHFWLILHGWKHLUHDUO\PLVWDNHVDQGOHDUQHGWKHKDUGZD\FRPLQJEDFNVWURQJO\ at the end of the season. A positive end which should motivate them to excel in the fourth term. A special word of thanks goes out to Mr Frikkie Matthee who prepared nets and pitches under very wet and difficult circumstances.You and the ground staff did a great job! Mr Roy Webber from Old Eds needs to be mentioned in this regard. King Edward was privileged to use one field on a Wednesday at Old Eds and we trust that the good relationship will continue for many years to come. Thank you to Mr Rolf Hansen for his continued support and for Mr Streene Parseramen for his tasks performed as manager. Mrs Anne Vilas from Opal Sports supported us on numerous occasions and her support and sponsorship are highly appreciated. The mothers once again did a magnificent job with the lunches and teas; something that has always EHHQWKHQRUPDWRXU6FKRRO7KDQN\RXWRHYHU\PRWKHULQYROYHGHVSHFLDOO\WKHPRWKHUVZKRWRRN FKDUJHGXULQJWKHVHDVRQ9LYLHQQH'DV1HYHV0LFKHOOH6PLWDQG$QQH9LODV Mr E Marx The following boys played: 5 'DV 1HYHV &DSWDLQ  5 &DPHURQ - &DUVWHQV . 'HPDUWLQLV 5 GH:HH & +LWJH ' -DFREV : /DQGVGDOH 7 0DGLVHQJ ' 0DUVKDOO ' 3DWULFLR * 3HQDOXQD . 3H\SHU  7 3H\SHU - 6PLW *7KRPSVRQ*YG9\YHU*9LODV*:RUWKDQG0:RRGV 148


Match summaries: Fourth Term 2004 vs Michaelhouse .LQJ(GZDUG Michaelhouse175/10

&DUWHQV0DGLVHQJ Cameron 4/13

Won by 34 runs

vs Hilton College .LQJ(GZDUG Hilton College 158/5

&DPHURQ'DV1HYHV Das Neves 2/16

Match rained out

vs St Charles King Edward 58/10 St Charles 59/4

Lost by 6 wickets

vs Maritzburg College .LQJ(GZDUG Maritzburg College 130/8

&DPHURQ&DUVWHQV Peyper 3/17

Won by 4 wickets

vs Sandton Area .LQJ(GZDUG Sandton 104/10

6PLW :RRGV Das Neves 3/9

Won by 152 runs

vs Lions Area King Edward 149/4 Lions 147/8

Woods 58 Peyper 2/44

Won by 6 wickets

vs St Stithians .LQJ(GZDUG St Stithians 87/10

:RRGV &DUVWHQV De Wee 3/16

Won by 8 wickets

vs Vaal A Area King Edward 149/5 Vaal A 148/5

Cameron 55* Woods 2/28

Won by 5 wickets

vs Far West Rand .LQJ(GZDUG Far West Rand 153/10

0DGLVHQJ:RRGV Woods 3/18

Won by 5 wickets

vs Pretoria Boysâ&#x20AC;&#x2122; .LQJ(GZDUG 3UHWRULD%R\V¡

&DUVWHQV6PLW 3H\SHU:RRGV

/RVWE\UXQV

vs Alberton Schools King Edward 213/10 $OEHUWRQ

Jacobs 57 7KRPSVRQ&DUVWHQV

/RVWE\ZLFNHW

149


vs Krugersdorp .LQJ(GZDUG .UXJHUVGRUS vs Affies .LQJ(GZDUG Affies 201/3 vs Development .LQJ(GZDUG Development 187/6

9LODV 3DWULFLR 7KRPSVRQ0DUVKDOO

:RQE\ZLFNHWV

3DWULFLR6PLW Lost by 7 wickets 6PLW3HQDOXQD Madiseng 2/28

Lost by 4 wickets

Played 14, won 8, lost 5, drew 1

First Term 2005 vs Pretoria Boysâ&#x20AC;&#x2122; .LQJ(GZDUG 3UHWRULD%R\V·

0DGLVHQJ3DWULFLR 'HPDUWLQLV&DUVWHQV

vs Jeppe King Edward 148/10 Jeppe 150/9

:RQE\UXQV

Lost by 1 wicket

vs St Stithians King Edward 85/2 6W6WLWKLDQV

Madiseng 51* YDQGHU9\YHU7KRPSVRQ

:RQE\ZLFNHWV

vs St Albanâ&#x20AC;&#x2122;s King Edward 174/10 6W$OEDQ·V

Vilas 54 

/RVWE\ZLFNHWV

vs Menlopark .LQJ(GZDUG 0HQORSDUN

6PLW&DUVWHQV 0DUVKDOOYDQGHU9\YHU

:RQE\UXQV

vs St Johnâ&#x20AC;&#x2122;s .LQJ(GZDUG 6W-RKQ·V

6PLW&DUVWHQV &DUVWHQVYDQGHU9\YHU

/RVWE\UXQV

vs Jeppe .LQJ(GZDUG -HSSH

3DWULFLR 6PLW &DUVWHQV7KRPSVRQ

:RQE\ZLFNHWV

vs Parktown .LQJ(GZDUG 3DUNWRZQ

/DQGVGDOH7KRPSVRQ &DUVWHQV0DUVKDOO

:RQE\UXQV



Played 8, won 5, lost 3, drew 1 Season: Played 22, won 13, lost 8, drew 1 150


Second Team Cricket Coach: Captain:

Mr S Parseramen T Moja

By King Edward standards one might call the Second Team season an indifferent one; one littered with faltering performances when it came to the crunch. Putting up some kind of opening SDUWQHUVKLSZDVDUDULW\HYHQZLWKMXJJOLQJWKHOLQHXSRQPDQ\RFFDVLRQV$OORUGLQDU\RSSRVLWLRQ was brushed aside though as the team was always on top against teams they had confidence over. Their temperament came under a heavy test in the first round of the John Waite Shield: drawn against Jeppe was never going to be easy. Setting a formidable total with some big KLWWLQJ WKDW UXVWOHG WKH RDNV D FRQILGHQW batting performance turned into an almost nightmare in the field. Jeppe had their backs to the wall at the start but we allowed them to get back in it as we fell DVOHHS EXW HYHQWXDOO\ D ZLQ ZDV VHFXUHG That created a wake-up for the team which resulted in a rather clandestine URDGWRWKHILQDO+DYLQJWRSOD\6W-RKQ¡V at home after an easy win the Saturday EHIRUH VSHOW GLVDVWHU  7KH WHDP¡V RYHU confidence got the better of them. Losing WKH WRVV ZDV WKH ILUVW FKDSWHU WKRXJK LW did not bother a team that set targets all season; they rolled over the opposition ZLWK HDVH KDYLQJ GULOOHG WKH VD\LQJ RI ´ the toss only determines in what order you play wellâ&#x20AC;? into them. For the fist time WKH\FUXPEOHGDVQRSDUWQHUVKLSFRXOGEHHVWDEOLVKHGDQGDOOLQFRPLQJEDWVPHQVHWLQWRDSDQLF rather than settling the innings. They had ideas of scoring as quickly as possible with disastrous results. It was a day when no shot came off and all catches went to hand. A disappointing loss ended the season which looked to have some promise. The team can be proud of achieving their place in the final. 7KDQNVPXVWJRWR0U0DU[IRUKLVLQYDOXDEOHLQSXWGXULQJWKHVHDVRQ0U0DWWKHHDQGKLVVWDIIIRU SUHSDULQJH[FHOOHQWIDFLOLWLHVERWKIRUSUDFWLFHVDQGJDPHVDQGPRVWLPSRUWDQWO\WKHPRWKHUVIRU their wonderful lunches at home games. Mr S Parseramen The following boys played: 70RMD &DSWDLQ 1*RQVDOYHV6.RODULN66SRRQHU:%URFNZD\5$XFDPS-1LHOVHQ.3H\SHU 2+ROODQG*YDQGHU9\YHU&&KLOYHUV*3HQDOXQD-5LOH\DQG*:RUWK 151


Results: vs St Albans .LQJ(GZDUG St Albans 200/10 vs St Johnâ&#x20AC;&#x2122;s College King Edward 97/5 6W-RKQ¡V vs Noordhuewel .LQJ(GZDUG Noordheuwel 141/10

3H\SHU+ROODQG Won by 5 wickets





:RQE\ZLFNHWV 

0RMD1LHOVHQ 3H\SHU Won by 59 runs

vs St Johnâ&#x20AC;&#x2122;s College 6W-RKQ¡V King Edward 108/10

Lost by 7 wickets

vs Jeppe High School for Boys: Jeppe 98/10 King Edward 80/10

Lost by 18 runs

Third XI Cricket Master in Charge: Captain:

Mr G D Jackson S Kolarik

The Third Team carried on with their unbeaten efforts of 2004 with another extremely impressive unbeaten run in  FRPSOHWLQJ  ZLQV RXW RI  JDPHV SOD\HG 7KH team successfully defended the Johnny Waite Trophy that they won in the 2004 season by beating a competitive St Stithians team in the final. The success of the team can be attributed to a wealth of KLJKO\ WDOHQWHG FRPPLWWHG DQG HQWKXVLDVWLF SOD\HUV ZKR always played as a team. The team was led from the front by Kolarik who was an excellent captain. He led by example and always enjoyed full support from his players. The team ZDV D KDSS\ RQH DOZD\V HQWKXVLDVWLF DQG HQFRXUDJLQJ RI each other on and off the field. This team certainly proved that a happy team of friends is a successful team. Most victories were emphatic. No batsman can be singled out for his individual contribution to any game as all the batsmen contributed consistently throughout the season. The bowling attack was well balanced with consistent line 152


DQGOHQJWKERZOLQJIURPRXUIDVWRSHQHUV0DUDLVDQG'LDOHVHDPERZOHUV.RODULNDQG2HORIVHDQG ably supported with controlled spin from Vassan. The fielding of this team was outstanding. The players were always focused and sharp. They put much pressure on the opposition batsmen by great ground fielding and catching. 7KHWHDPGLVSOD\HGVWURQJILJKWLQJGLVSOD\VLQDIHZJDPHVWKDWZHUHWLJKWQRWDEO\DJDLQVW3UHWRULD %R\V  +LJK ZKHQ GHIHQGLQJ D YHU\ PRGHVW WRWDO RI  WKH\ PDQDJHG WR ZLQ E\  UXQV  ,Q WKH Johnny Waite final against St Stithians they recovered from 64 for 5 to post a competitive total of 161 and won the game by 21 runs. 2YHUDOOWKHDFKLHYHPHQWRIWKLVJUHDW7KLUG7HDPZLOOEHGLIILFXOWWRUHSHDWDIHDWWKDWFDQRQO\EH emulated by an outstanding team. It was always a pleasure to be associated with these team players. ,WLVKRSHGWKDWWKLVWHDPZLOOEHDPRWLYDWLRQDQGLQVSLUDWLRQWRQH[W\HDUV¡7KLUG7HDP Mr G D Jackson The following boys played: 6.RODULN &DSWDLQ 51DUDQ-+RVNLQJ-9DVVDQ%0DUDLV16WURXFNHQ 0&RRPEHV-3ULP-5LOH\23DWHO'2HORIVHDQG5'LDOH

U16B Cricket Master in Charge : Coach : Captain :

Mr R Hammond R Cameron Y Fredericks / B Saunders

The U16B Cricket Team had a reasonable season. This is a group of sportsmen whose enthusiasm knows no limits. The spirit in the team was awesome and the players really enjoyed themselves. We beat St John's in our first game of the season. Batting first we managed to get to 110/5 on a very slow outfield. We then restricted them to 64 all RXW&KULVWHOOLVVFRULQJDQGWDNLQJIRUZDVRXWVWDQGLQJ We then had a 'humdinger' against Pretoria Boys'. They scored 114/8 off their allotted 30 overs. Our players were outstanding in the field. We WKHQRQO\PDQDJHGDJDLQVW3UHWRULD%R\V GLVFLSOLQHGDWWDFNORVLQJ WKHJDPHE\UXQV%DGUHVXOWJUHDWJDPHRIFULFNHW Against St Stithians the players were out to prove themselves. Restricting St Stithians to 133/8 off 30 overs we reached the target with 3 wickets in hand. Wiggett scoring a memorable 42. Karim was the best of the bowlers with 3/23. :HZHUHWKHQRXWSOD\HGE\DFODVV\6W-RKQ VVLGHLQWKHUHWXUQIL[WXUH losing by 4 wickets. We ended the season on a high note beating Jeppe by 16 runs and then Parktown by 58 runs. Top scorer against Jeppe was Fredericks with 44 153


DQG:LJJHWWZLWK$JDLQVW3DUNWRZQ6HDUOHDQG6QRZERWKVFRUHGLQWKHWKLUWLHVDQG&RFNLQJ and Christellis each took 3 wickets. 7KDQN\RXWRWKHSOD\HUVIRUWKHLUFRPPLWPHQWWKHSDUHQWVIRUWKHLUVXSSRUW5LFKDUG&DPHURQIRU his efforts and Mr Marx for his guidance and support. 7RWKHSOD\HUVJRRGOXFNIRUQH[WVHDVRQ.HHSXSWKHJRRGZRUN Mr R Hammond The following boys played : <)UHGHULFNV &DSWDLQ '6HDUOH&6QRZ%6DXQGHUV &DSWDLQ <.DULP6:LJJHWW'&KULVWHOOLV '0DUWLQ.0DUVKDOO6+RHSSHU%&RFNLQJ%)RXULHDQG0$GDPV

U15 A Cricket Master in Charge: Captain:

Mr C Finlayson J Scott

,QWRWDOMXVWRIWKHVFKHGXOHGPDWFKHVZHUHSOD\HGLQWKHILUVWTXDUWHUGXHWRLQFOHPHQWZHDWKHU Credit must go to this team who had to work hard for their success doing well to win all 6 of their JDPHV$VWKHWHDPSURJUHVVHGLWZDVSOHDVLQJWRQRWHDVWHDG\JURZWKLQWKHDSSOLFDWLRQGLVFLSOLQH and maturity of the players. The batting of the side seldom rose above the level of mediocrity as the top order struggled to post big scores. Too many batters gave their wickets away with little more than a whimper and a lot more application is required in this aspect of the game. 6FRWW 0F*LOOLYUD\ DQG &DUVWHQV HPHUJHG DV WKH leading run-scorers weighing in with some significant and timely contributions. Undoubtedly the well-balanced bowling attack was the strength of the side capable of causing uncomfortable moments in the opposition ranks. They maintained a consistently good line and length with none of the regular bowlers having an economy rate above three. Medium pace Scott and left-arm VSLQQHU&RUQVZHUHWKHFKLHIZLFNHWWDNHUVWDNLQJ and 12 respectively. There was sufficient variety and thought in their bowling while the rest of the attack provided good back-up. A lot of time was spent on improving the fielding aspect of the game. Generally it was enthusiastic and DW WLPHV TXLWH SROLVKHG  YDQ 5KHHGH V HQHUJ\ ZDV refreshing and he demonstrated athleticism and flair 154


LQWKHILHOGZKLFKZDVUHIUHVKLQJ%HKLQGWKHVWXPSV0F*LOOLYUD\KDVSOHQW\RISRWHQWLDODQGZLWK hard work and concentration he can do well in the future. This team demonstrated the value of teamwork enabling them to edge out the opposition in a number of close encounters. They proved to be marginally sharper than their opponents and will need to maintain this focus as some tough games lie ahead in the last term. The U15A team trained with purpose enduring some testing conditioning gym sessions as well as VKRZLQJWKHQHFHVVDU\GLVFLSOLQHDQGDSSOLFDWLRQDWQHWDQGILHOGLQJSUDFWLFHV,QFORVLQJFUHGLWPXVW go to Scott who led from the front and whose enthusiasm played an important part in the success of the team. Well done to you all. Mr C Finlayson The following boys played: -6FRWW &DSWDLQ 1%DLNLH0&DUVWHQV5&RUQV7-DPHV6/DQVGDOH00F*LOOLYUD\ =1HHWKOLQJ/3RZHOO66HOOZRRG$YDQ5KHHGHDQG*YDQ:\N

Match Summaries: vs Pretoria Boys' High .LQJ(GZDUG 3UHWRULD

/DQVGDOH&DUVWHQV0F*LOOLYUD\ /DQVGDOH&RUQV1HHWKOLQJ

:RQE\UXQV

vs St Stithians College 6W6WLWKLDQV .LQJ(GZDUG

3RZHOOYDQ:\N6HOOZRRG %DLNLH&DUVWHQV 6FRWW  

:RQE\ZLFNHWV

vs St Albans 6W$OEDQV .LQJ(GZDUG

/DQVGDOH6HOOZRRG&RUQV 6FRWW %DLNLH 

:RQE\ZLFNHWV

vs St John's College 6W-RKQ V .LQJ(GZDUG

6FRWWYDQ5KHHGH &DUVWHQV /DQVGDOH



:RQE\ZLFNHWV



:RQE\UXQV

vs Jeppe High School for Boys .LQJ(GZDUG 0F*LOOLYUD\3RZHOO -HSSH 6FRWW&RUQV

vs Parktown Boys' High .LQJ(GZDUG 6FRWW0F*LOOLYUD\%DLNLH-DPHV 3DUWRZQ 6FRWW3RZHOO&RUQV  155

:RQE\UXQV


U15B Cricket Master in Charge: Captain:

Mr T Craig L Adriaanse

The U15B Cricket Team was blessed with talent and a number of genuine cricketers. A very strong DJHJURXSOHGWRVRPHSOD\HUVUHSUHVHQWLQJ.LQJ(GZDUGDW%WHDPOHYHOZKLOHDWDQ\RWKHUVFKRRO WKHUHLVQRGRXEWWKDWWKH\ZRXOGEH$WHDPSOD\HUV'HVSLWHWKLVIDFWWKHWHDPQHYHUTXLWHSOD\HG to their full ability. 7KHILUVWPDWFKRIWKHVHDVRQZDVDJDLQVWDQXQGHUVWUHQJWK3UHWRULD%R\V¡+LJK6RPHZRQGHUIXO bowling and superb fielding (the catch of the season goes to Ralph) allowed us to knock them over for a very modest 67. We achieved this score with only three wickets down. Then came the disappointment of the season. St Stithians was our worst effort of the season. We won the toss and elected to bat. After 13 overs we had a paltry 31 runs. Our openers had been unable to push the run rate having seen off the opening bowlers. The middle order made an attempt to rectify the situation and we finally reached

156


UXQV7KHTXHVWLRQZDVZRXOGWKLVEHVXIILFLHQW":HERZOHGZLWKGLVFLSOLQHDQGILHOGHGUHDOO\ well. The required run rate was always in the vicinity of 4.5 per over and they were always there RUWKHUHDERXWV7KH\QHHGHGRIIWKHODVWRYHUEXWZLWKZLFNHWVLQKDQGWKHEDODQFHZDVDOZD\V LQWKHLUIDYRXU7KH\HYHQWXDOO\JRWLWZLWKWZREDOOVWRVSDUH,QDRYHUJDPHWKHVORZVWDUWZDV our death. A very disorganised Hill High were the victims of the backlash and we piled on 186 off 25 overs WKH\KDGORWVRIH[HUFLVH 7KH\ZHUHERZOHGIRUH[WUDVEHLQJWKHKLJKHVWVFRUH1HLJKERXUV 6W-RKQ·VDQG3DUNWRZQZHUHEHDWHQE\UXQVDQGUXQVUHVSHFWLYHO\7KH\ZHUHVLPSO\QRW good enough. $ VDWLVIDFWRU\ VHDVRQ \HW LI WKH SOD\HUV DUH KRQHVW ZLWK WKHPVHOYHV ZH VKRXOG KDYH GRQH EHWWHU 7KHORVVWR6W6WLWKLDQV·ZDVYHU\SRRU7KLVZDVDWHDPWKDWFRXOGFRPSHWHZLWKPRVW$WHDPV in Johannesburg. To lose even one game where we should have won comfortably is unsatisfactory. We need to live up to the high standards to which we have become accustomed and standards that need to be maintained. Mr T Craig The following boys played: &:HVVHOOR<-DMED\$/RW]-/XPVGHQ13RJJHQSRHO*5DOSK/$GULDDQVH &DSWDLQ 0/HZLV %5HLG96FKROO70DJRUDQG*YDQ:\N

157


U14 A Cricket Master in Charge: Captain:

Mr S Eales K Biassoni

True to form large numbers of boys turned out for the 2005 U14 cricket trials. It was clear from the outset that this was a talented age group gifted with both batsmen and bowlers. With the side chosen WKH8$·VSUHSDUHGWRSOD\:DWHUNORRI8QIRUWXQDWHO\WKH-DQXDU\UDLQDUULYHGDQGFRQWLQXHGIRUD number of weeks. Fixtures against Grey College and St Andrews School were also washed out and we began to wonder if we ever would fulfil a fixture in the first term. Eventually the rains stopped and sun shone and the U14 side could finally show their metal and UHSUHVHQWWKHLUVFKRRO7KHER\VSOD\HG3UHWRULD%R\V LQWKHLUILUVWIL[WXUHZKLFKLVQHYHUDVLPSOH IL[WXUH HVSHFLDOO\ DV WKH ILUVW KLJK VFKRRO JDPH  %XW WKH\ GLG WKHPVHOYHV SURXG DQG SURGXFHG D comfortable six-wicket win. The second fixture against St Stithians was a different affair. King Edward did not produce enough runs and failure to take our chances and dismiss their key batsmen saw the U14 side lose their only fixture for the first term. 7KH\ERXQFHGEDFNVXSHUEO\DQGSURGXFHGZLQVDJDLQVW6W$OEDQV E\ZLFNHWV $OEHUWRQ6FKRROV E\UXQV 6W-RKQ V E\IRXUZLFNHWV -HSSH E\ZLFNHWV DQG3DUNWRZQ E\ZLFNHWV 7KHVLGH showed they had a number of batsmen who could see the side home and a solid bowling attack to subdue the opposition. Better fielding would have seen the side win even more comprehensively and this was to be an area of weakness throughout the year. September arrived and so too did the Annual Charl van Rooyen Cricket Festival. This is an excellent platform for the boys to pit their skills against boys from around the country. King Edward started slowly and on the first day allowed Maritzburg to score 260. Poor fielding was a large contributor. We replied with 140 for the loss of five wickets. The match was drawn and the side survived to face another day. On day two King Edward set a respectable 225 against Durban High School. Again poor fielding and scoring too slowly in the beginning of our innings saw DHS win the fixture with 3 overs to spare. The side was not to be disheartened and although poor fielding allowed Kearsney and Selborne to score 220 plus on the following two match days the side's strong batting line up saw us home twice for the loss of three and four wickets respectively. The side returned to Johannesburg and eagerly awaited the start of the fourth term season. Wins DJDLQVW5DQGEXUJ+RsU$OEHUWRQ6FKRROV3UHWRULD%R\V DQG6W'DYLG·VDQGDYHU\FORVHORVVDJDLQVW St John's saw this King Edward side develop into a very well oiled unit. There were a number of fine EDWWLQJSHUIRUPDQFHVRYHUWKH\HDUDQGWRPHQWLRQHDFKLQGLYLGXDOO\LVQRWSRVVLEOHEXWFRQJUDWXODWLRQV WRDOOWKHER\VZKRPDGH·VDQG·V7KHERZOHUVDOVRSHUIRUPHGZHOOZLWKDQXPEHURIER\V consistently taking 3 or more wickets. An improvement in fielding will certainly strengthen this side. The side of 2005 definitely showed that there are a number of good players for the future and King (GZDUGFULFNHWKDVPXFKWRORRNIRUZDUGWR)XOILOOLQJWKDWSRWHQWLDOLVKRZHYHUHDVLHUVDLGWKDQGRQH but with hard work and dedication the sky is the limit. Well done men. Mr S Eales The following boys played : .%LDVVRQL &DSWDLQ 01RIDO5:HOOV6'LFNVRQ-&ULFKWRQ.0D\HW$0DFGRQDOG 5*DUGHQHU0*LOO3%LQGRQ&6XJGHQ$0DUWLQVDQG0*DUUXQ 158


U14B Cricket Master in Charge : Captain :

Mr R Erasmus B Vilas

The U14B Team had a good start to their cricketing career at King Edward. A positive and enthusiastic spirit meant that the cricket season was enjoyable and productive. Good batting and bowling was backed up by enthusiasm on the field. The team was very well captained and despite the fact that there were a few disappointing results the team showed a lot of promise for the future. I believe that many of the players in this team will go on to play "A" team cricket at King Edward. One of the strengths of this team was the bowling. The attack was a varied one and the opposition was seldom able to dominate. The batting was also good however a tendency to 'give away' wickets needs to be addressed. The fielding was good and often put pressure on the opposition. My â&#x20AC;˘ â&#x20AC;˘ Â&#x2021; â&#x20AC;˘

thanks go to the following people : Mr Matthee and his staff for the facilities. Mr Marx for his organisation. 7KHSDUHQWVIRUDOOWKHVXSSRUWHVSHFLDOO\WKHSDUHQWVZKRZHUHZLOOLQJWRVFRUHIRUXV And a special thanks to the players; your positive attitude made the season a very enjoyable one.

Mr R Erasmus The following boys played regularly : %9LODV &DSWDLQ $0F'RQDOG-%HHKDQ*%U\FH'0\EXUJK9*DVSDULV:&URVV%1DQD 0*LOO3.DOLV$/HXQHU-7KRPDV63LYHWHDXDQG0*DUGLQHU

159


Cross Country

Educator in Charge:

Ms S Marvell

The 2005 Cross Country Season was a very successful and highly enjoyable one. Once again we had a small but very talented and dynamic team who worked exceptionally hard to achieve an outstanding result. The Junior age group are to be particularly commended for their determination and endurance. Although the team only comprised a loyal core of five runners there is a vast amount of talent and this talent made them a formidable team. It is also encouraging to know that these runners will be coming up through the ranks and will maintain King Edward's place in the Cross Country arena. They achieved excellent results in all their races and were finally placed first out of nine schools in the Junior League Division. These boys made their school very proud. ,W ZDV DOVR DQ H[FLWLQJ DQG KLJKO\ FRPSHWLWLYH VHDVRQ IRU WKH 6HQLRUV  WKH LQMHFWLRQ RI \RXQJHU runners who moved up from the Juniors gave them a fresh burst of energy. The old stalwarts OLNH+XOOH\'RV6DQWRV5RGULJXHVDQG)UDVHUVKRZHGWKH\ZHUHVWLOODIRUFHWREHUHFNRQHGZLWK especially Rodrigues who ran in his inimitable way and achieved an overall second place by only .24 of a second. It was a nail-biting finish that saw us lose the Senior League Championship to Pretoria Boys' High by one point only. A very hearfelt thank you to every single boy who participated in the Cross Country Season this year. It was a very rewarding experience and the boys who took part in Cross Country deserve an honourable mention for their dedication and unwavering enthusiasm. It was a pleasure to be their manager. Ms S Marvell The following boys participated : Juniors :  2.DEDQJR6)UDVHU$/HHXZ:0DWODNXKODDQG$+RZLH Seniors:  $5RGULJXHV.:ULJKW*'RV6DQWRV$)UDVHU5+XOOH\'&URVV::DNHILHOG and M Singh.

161


Golf

Masters in Charge :

Mr R Hammond and Mr E Scheepers

Our season started off slowly with a loss against St Dunstans. This was our only loss. After this setback the players came back very well. Through hard work and determination the players secured JRRGZLQVDJDLQVW6W-RKQ V.LQJ'DYLG&%&%RNVEXUJ'HYHORSPHQWDQG0DULRQ :HILQLVKHGWRSRIWKHORJ²6RXWK*URXS7KLVWRRNXVLQWRWKHVHPLILQDOVDJDLQVW&RUQZDOO+LOO runners up in the North Group. The golfers lifted their games once more to defeat their opponents ² We played St Stithians in the final at Houghton Golf Club. Our players put up a good performance EXWLWZDVQRWJRRGHQRXJKWRXSVHWRXURSSRVLWLRQ6W6WLWKLDQVZRQ²%RWKPDWFKHVORVW were close encounters. J Raphunga and W Peterson halved their match. *RRGOXFNWRRXUWKUHH*UDGH V-5DSKXQJD:3HWHUVRQDQG&&OD\WRQ:HKRSHWRKHDUDORW more of you in the years to come. $ VSHFLDO WKDQNV WR -RKDQQHVEXUJ&RXQWU\&OXERXUKRPH&OXEIRUPDNLQJWKLVUHPDUNDEOHJROI course available to us and to Mr Marx for his guidance. :HKDYHLQ$OODQDQG0DWWKHZ9HUVIHOGWZRYHU\WDOHQWHG\RXQJVWHUVLQ*UDGH'HILQLWHO\QDPHV to look out for in the future. The numbers of boys joining our social golf on Wednesdays more than doubled from 2004. King Edward golf is definitely on the right track and we are looking forward to 2006. Mr R Hammond

The following boys played : -5DSKXQJD:3HWHUVRQ0'DQLHO-7ULSS$9HUVIHOGDQG09HUVIHOG Reserves : C Clayton and R Fensham.

International Schools Golf Tournament 2005 2Q  WR $XJXVW 6W -RKQ V &ROOHJH LQ DVVRFLDWLRQ ZLWK )LUVW 1DWLRQDO %DQN KHOG WKHLU DQQXDO ,QWHUQDWLRQDO6FKRROV*ROI7RXUQDPHQW7KH7RXUQDPHQWZDVSOD\HGRYHUGD\VXWLOLVLQJWKHWZR Gary Player designed golf courses at the Sun City Resort. 7KHWZR9HUVIHOGEURWKHUV$ODQDQG0DWWKHZ0DWWKHZ'DQLHODQG-RQDWKDQ5DSKXQJDUHSUHVHQWHG King Edward VII School at the Tournament. The competition format is laid out in the table below and the tournament rules were in accordance ZLWKWKRVHVHWRXWE\7KH5R\DODQG$QFLHQW*ROI&OXERI6W$QGUHZV6FRWODQG 163


First Team Golf 2005 Front Row (left to right):

0'DQLHO:3HWHUVRQ-7ULSS

Back Row (left to right):

$9HUVYHOG09HUVYHOG

164


Date 24/8 25/8 26/8 27/8

Course Gary Player Lost City Gary Player Lost City

Competition Betterball Stableford Betterball Stableford Combined Stableford-three Scores to count Combined Stableford-three Scores to count

2XUER\VSOD\HGVRPHLPSUHVVLYHJROI:HILQLVKHGWKRYHUDOORXWRIWHDPVLQFOXGLQJDOOWKHWRS VFKRROVIURP6RXWK$IULFDWHDPVIURPWKH8.DQG=LPEDEZH0DWWKHZ9HUVIHOGILQLVKHGWKRXW of 124 golfers. Well done! 2QWK6HSWHPEHUZHSOD\HGLQRXUODVWWRXUQDPHQWRIWKH0DGDOD V&XSDW%OXH9DOOH\*ROI DQG&RXQWU\(VWDWHLQ0LGUDQG7KHIRUPDW,QGLYLGXDOSRLQWVVWDEOHIRUGVFRUHVWRFRXQW7KH.LQJ (GZDUGWHDPFRPSULVLQJRIVWXGHQWVDQGWZRVWDIIPHPEHUV 0U(6FKHHSHUV0U5+DPPRQG- 5DSKXQJD:3HWHUVHQ$:HLU-7ULSS09HUVIHOGDQG$9HUVIHOG ZDONHGDZD\ZLWKWKH0DGDOD V&XS DQGWKHILUVWSUL]HDFKHTXHRI5,QWKHLQGLYLGXDOVHFWLRQZHILQLVKHGILUVWDQGVHFRQG$ODQ Versfeld and Wade Petersen both shot brilliant 73's. A special thank you to the boys for their hard work and dedication throughout the season. Good luck for the 2006 golf season. Mr R Hammond

165


Hockey

First XI Hockey Educator in Charge : Coaches : Captain :

Dr D Hudson-Lamb Mr J Coombes M Coombes

$œFRDFKLQJUHSRUW¡SURYLGHVDQRYHUYLHZRIœGLIILFXOWLHV¡LQDFKLHYLQJKLJKHVWJRDOVDVDWHDPDQGZKDW is required to make this happen as a team on and off the field. Teamwork is critical to achieving the end result of transferring play into the opponent's circle in order to score. Teamwork might be best described as "the ability to work together toward a common vision. The ability to direct individual accomplishment toward organisational objectives. It is the fuel that allows common people to attain uncommon results". The 'coaching report' hopefully assists you in appreciating where and how you contributed or LPSDFWHGQHJDWLYHO\EXWLPSRUWDQWO\LWDVVLVWV\RXWRDSSUHFLDWHDQGXQGHUVWDQGDQGJURZIURP the experiences of learning in 2005. 7RWKRVHVWLOODURXQGLQWKHDLPPXVWEHWRœUDLVHWKHEDU¡LQUHVSHFWRI\RXUNQRZOHGJHRISOD\ and team dynamics to improve 'teamwork'. To summarise 2005: appreciating that a team sport will always have complexities of numbers of SOD\HUVFRPELQLQJVR LVVXHV WKHUHZLOODOZD\VEH$SSUHFLDWLQJDVZHOOWKDWLQJDPHVLQDVHDVRQ WKHUH ZLOO EH XSV DQG GRZQV  WKHUH ZLOO EH ORZV WKHUH ZLOO EH GLVDJUHHPHQWV WKHUH ZLOO EH EDG DQGJRRGJDPHVDQGVRRQWKHQWKLVWHDPKDVRYHUFRPHPRVWKLFFXSVDQGSOD\HGJRRGKRFNH\ throughout. My heartiest congratulations to the King Edward Hockey 'Club' and especially the U16A's and the )LUVW7HDPRQWKHLUUHVXOWVDQGLQWKLVLQVWDQFHWKH)LUVW7HDPVTXDGVSHFLILFDOO\:HOOGRQH The results document at the end of the report reflects the last 5 years' results and comparatively LVWKH EHVW SHUKDSVHYHULQWKHFRQWH[WRIWKHQXPEHURIJDPHVDQGRSSRVLWLRQ Played 31 Won 26 Lost 3 Drew 2 Goals for 108 Goals against 23 Goal average per game 3.48 / 0.74 ZLQUDWH  ORVVUDWH  &RQVLGHUDVZHOOWKHœ1DWLRQDO5DQNLQJWKURXJKWKHVHDVRQRIUG²WKHKLJKHVWHYHU 167


,OHDYHLWWR\RXWRVWXG\DQGFRPSDUHUHVXOWVDQGORRNEDFNDQGUHIOHFWRQZKDWKDVEHHQ,EHOLHYH a highly successful 2005 hockey year. Those of you who are leaving we hope will continue to feel part of the King Edward hockey family and will follow the next group and join us whenever you can. The 2006 group have a hard act to IROORZLQDELOLW\FKDUDFWHUSDVVLRQFRPPLWPHQWDQGHQMR\PHQWRIWKHJDPHDQGFRQWULEXWLQJWR.LQJ Edward Hockey as the 2005 group undoubtedly have done in their 5 years at the school. :HOOGRQHWKDQNVIRUVRPHILQHWLPHVDQGJUHDWKRFNH\DQGWKDQN\RXIRU\RXUFRQWULEXWLRQWR.LQJ Edward hockey and the 2005 First Team.

Thank Youâ&#x20AC;&#x2122;s The Headmaster ZKRDWWHQGHGDOPRVWHYHU\JDPHDQGHYHQDWWHQGHGSUDFWLFHVDQGHQWKXVLDVWLFDOO\ÂśWULHG¡WROHDUQ what this game is about. Mr Hugh Wilson - for his unwavering support of King Edward hockey and for supporting the First Team. Mr Eugene Marx - well done on a difficult task as the Sports Director; hockey certainly appreciates your efforts and contribution. Marq Roberts RUJDQLVRURIWKH.LQJ(GZDUG+RFNH\)HVWLYDOSDUH[FHOOHQFHDIDQWDVWLFFRQWULEXWLRQWRSXWWLQJ King Edward hockey on the map. Yvonne Roberts - for the superb organisational qualities of catering for hockey. Derron van Eeden - for the King Edward Festival and generally in the marketing of hockey and the School: a fantastic effort and superb job well done. Dr Denise Hudson-Lamb - Perhaps most thanks for last as without the "Doc" I have no doubt hockey would not be where it is WRGD\DW.LQJ(GZDUGDQGLWLVWKDQNVWRWKH'RFDQGKHUSDVVLRQWLPHHIIRUWDQGFRPPLWPHQWWR WKH6FKRROKRFNH\DQGWKHER\VDVZHOOKHURSHQPLQGHGQHVVDQGYLVLRQWKDW.LQJ(GZDUG+RFNH\ is on the up. On behalf of King Edward First Team hockey and King Edward Hockey generally "thank you" one and all. Mr J Coombes 168


Players having represented, in a match, the First Team 2005: &RQJUDWXODWLRQVWR0&RRPEHV.'HPDUWLQLVDQG*7DYHQHU6PLWKRQSOXVJDPHV Caps M Muller (Gk) S Roberts G Taverner-Smith K Bapelo M Coombes (Captain) D Koller S Sutherland D Bini J Prim M Middleton B Gasparis (Gk)

30 60 100 15 100 40 50 10 5 3 1

Caps

+ + + + + + + + + + +

B Marais K Demartinis (Vice-Captain) M Loseby N Gonsalves J Hosking M Wiggett B Britz S Spooner R Fensham S Wiggett

20 100 20 50 60 50 60 10 10 2

First Team Hockey 2005 Front Row (left to right): 

0:LJJHW*7DYHQHU6PLWK0&RRPEHV &DSWDLQ  .'HPDUWLQLV 9LFH&DSWDLQ 66XWKHUODQG-+RVNLQJ

Back Row (left to right):

1*RQVDOYHV'.ROOHU.%DSHOD%%ULW]%0DUDLV65REHUWV 169

+ + + + + + + + + +


170


U16A Hockey Coach : Captain :

Mr A Da Mata M Middleton

Season Record: Played 26; Won 2; Drawn 2; Lost 3; Goals For 104; Goals Against 14. A very successful record for a team that developed as the season progressed. Undoubtedly the highlight of the season for me as coach was the way in which each player developed not only in the physical VLGHRIKRFNH\EXWPRUHLPSRUWDQWO\LQWKHPHQWDOXQGHUVWDQGLQJRIKRZWKHJDPHZRUNV We had a slow start to the season losing 3 of our first 7 games. This included the Ascension Festival ZKHUHZHKDGJRRGZLQVRYHU.HDUVQH\DQG*OHQZRRGDKDUGIRXJKWGUDZDJDLQVW+LOWRQDQGD QDUURZEXWH[FLWLQJ LIORVLQJFDQEHH[FLWLQJ ORVVDJDLQVW0DUWL]EXUJZKLFKLURQLFDOO\ZDVSUREDEO\ our best game of the season. $IWHUWKH$VFHQVLRQ)HVWLYDOWKHWHDPH[FHOOHGZLQQLQJRIJDPHVDQGGUDZLQJ:HVHHPHG WRJURZLQFRQILGHQFHHVSHFLDOO\LQDWWDFNFUHDWLQJPDQ\RSSRUWXQLWLHV7KLVFRXSOHGZLWKDQHYHU LPSURYLQJ GHIHQFH ZKR XQGHUVWRRG WKH YDOXH RI NHHSLQJ D FOHDQ VKHHW PHDQW ZH FRXOG RQO\ JHW EHWWHUZLWKHYHU\JDPHZKLFKZHGLG:HKDGJRRGUHVXOWVDJDLQVW-HSSH  '+61RUWKZRRG 6W'DYLGVDQG.LQJVWRQ*UDPPHU DOO 3DUNWRZQ  6W%HQHGLFW VDQG3UHWRULD%R\V  ERWK 1-0). The team highlight of the year was the winning and retaining of the Boden Cup. We eased through the pool games scoring 30 goals in 4 games. In the quarterfinals we quickly found ourselves 1-0 down to Trinity House eventually grinding out a difficult 4-2 win. We beat St John's on penalty flicks LQWKHVHPLILQDODIWHUGUDZLQJLQDWHQVHJDPH,QWKHILQDOZHPHW6W%HQHGLFW VZKRPZHKDG EHDWHQ  ZHHNV HDUOLHU :H IRXQG RXUVHOYHV RQ WKH EDFN IRRW IRU PXFK RI WKH ILUVW KDOI EXW ZH VORZO\ZRUNHGRXUZD\EDFNLQWRWKHJDPHDQGILQLVKLQJWKHVWURQJHURIWKHWZRWHDPVZHZRQ We never played our best hockey during the knock-out stages but showed character to produce something when it was required. &RQJUDWXODWLRQVWRWKHIROORZLQJER\VZKRGHVHUYHGO\PDGHSURYLQFLDOWHDPV6:LJJHWW5)HQFKDP % *DVSDULV  0 0LGGOHWRQ 6RXWK *DXWHQJ$  0 6PLWK$ /RW] 6RXWK *DXWHQJ % : /DQVGDOH * Geritts South Gauteng C. Special Mention to S Wiggett and R Fencham who were selected for the South African Schools U16 Squad. 171


Congratulations to all the boys who represented the team this year and I look forward to watching you all develop in years to come. With a little dedication and a bit of "SWEAT" many of you WILL have exciting futures on the hockey field. Mr A Da Mata The following boys played : 00LGGOHWRQ &DSWDLQ 6:LJJHWW 9LFH&DSWDLQ %*DVSDULV&%DUUHWW60DVHNR **HUULWWV3*RQWVH.)ULW]HQNRWWHU5)HQFKDP$/RW]:/DQVGDOH0$GDPVDQG M Pochee.

U16B Hockey Coach : Captain :

W Smith K Motsoko

The U16B side had a very good season with an impressive set of results. The side improved over the five month hockey season and learnt to play more as one unit with the extra time they were spending together in both practice and matches. Two games that stand out in particular were the 8-0 thrashing of St David's and a memorable 1-0 victory over St John's. The side is full of talent and potential which hopefully will be fulfilled in years to come. With 11 JDPHVZLQVGUDZVDQGORVVHVLWKDVEHHQDQHQMR\DEOHDQGVXFFHVVIXOVHDVRQ,ORRNIRUZDUG to seeing the boys out on the field next year. W Smith The following boys played : .0RWVRNR &DSWDLQ 71HO 9LFH&DSWDLQ -$GGLQJWRQ6+RRSHU<6NDDS %6DQJZHQJ%&RFNLQJ'/OR\G56FRWWDQG6=XQJD 172


U16C Hockey Coach : Captain :

B Schroder L Manana

8QIRUWXQDWHO\WKH8&KRFNH\WHDP VVHDVRQLVDVKRUWVKDUSRQH7KHER\VRQO\SOD\DKDQGIXO RIPDWFKHVEXWHYLGHQWO\HQMR\WKHH[SHULHQFHQRQHWKHOHVV 7KHVHDVRQZDVQRWUHZDUGLQJEXWWKHER\VPDGHXSIRUWKLVZLWKWKHLURYHUZKHOPLQJHQWKXVLDVP DQGGHILQLWHZLOOWRZLQHYHQWKRXJKZHVWUXJJOHGDQGZHUHXQOXFN\DWWLPHV2XUWURXJKRISRRU SHUIRUPDQFHV LV GHILQLWHO\ RYHUVKDGRZHG E\ VROLG JDPHV DJDLQVW 6W$OEDQ V 3UHWRULD %R\V  +LJK School and St John's College. ,ZRXOGOLNHWRWKDQNWKHER\VIRUWKHLUWUHPHQGRXVHIIRUWDQGQHDWQHVVDWPDWFKHVWKHLUGHGLFDWLRQ to practices and ultimately to their positive attitudes on and off the field. They are an ambitious team of hockey players who enjoy playing the game. Well done on the season. B Schroder The following boys played: /0DQDQD &DSWDLQ 16WHSKDQRX17\WKHUOHLJK05REVRQ $0DOHOHNH91DUDQ-6DOPRQ60RNZHQD11GORYX .7ODGL66LIRU/&KDRDQG77VRWVRWVR

U15A Hockey Coach : Captain :

R Demartinis T Patricio

The 2005 U15 hockey season was a great success. This can be seen by the good results the boys DFKLHYHG WKURXJKRXW WKH VHDVRQ :LWK WKH ORVV RI WKUHH FUXFLDO SOD\HUV IURP WKH SUHYLRXV \HDU WKHWHDPTXHVWLRQHGWKHLUFDSDELOLWLHVDQGZLWKWKLVWKHUHZDVDVRPHZKDWVKDN\VWDUWWRWKHILUVW game. They soon grew in their abilities to both play as a team and as individuals. By the end of the St Alban's Festival the team was playing at a very high level; they dominated almost every game they SOD\HGDQGZHUHVRPHWLPHVXQOXFN\QRWWRZLQGXHWRWKHLULQDELOLW\WRVFRUHZKHQFUHDWLQJWKH opportunities. Halfway through the season we were rejoined by one of the players whom we had lost at the beginning of the season; this further strengthened and balanced the side. 7KHUHZHUHWZRJDPHVWKDWUHDOO\VWRRGRXWIRUPHGXULQJWKHVHDVRQWKHVHJDPHVHSLWRPLVHGWKH team's capabilities and passion. The games were against St John's and Parktown. Against St John's WKHER\VPDQDJHGWRFRPHEDFNIURPDGHILFLWDWKDOIWLPHWRGUDZWKHPDWFKWKHODVWJRDO 173


being scored at the final whistle. Parktown were a very strong opposition who went 1-0 up until the last five minutes of the game. Once again the boys showed great character and scored two goals in quick succession to win the game 2-1. Both of the games were thrilling to watch and be a part of. , ZRXOG OLNH WR WKDQN DOO WKH ER\V ZKR PDGH WKLV \HW DQRWKHU HQMR\DEOH VHDVRQ DW WLPHV LW ZDV frustrating but overall a great success. R Demartinis The following boys played : 73DWULFLR &DSWDLQ 66FRUJLH 9LFH&DSWDLQ 06PLWK%5HLG1'RZQ.:DUPEDFN & 3RQQXVDP\ 6 /DQVGDOH 5 %LGGOHFRPEH7 -DPHV 5 *DVVPDQ % 3LHWHUVRQ 0 *UDKDP 5 &RUQV and A Lotz.

U14A Hockey Educator in Charge: Coach : Captain :

Ms J Kyte W Plessie T White

The 2005 season started at a rapid pace by our having to select a team for the Ascension Festival; having to choose 13 boys from a possible 100 unseen boys was no easy task. The festival was our first look at the team against some really strong opposition and considering that no one had played WRJHWKHU EHIRUHKDQG ZH VKRZHG D ORW RI SURPLVH IRU WKH XSFRPLQJ GRPHVWLF VHDVRQ $OWKRXJK WKHUHVXOWVVKRZRWKHUZLVHZHSOD\HGVRPHJRRGKRFNH\DQGZKHQZHVWXFNWRRXUSODQVZHSXW together patches of really attractive hockey. At the beginning of the domestic season a couple of results did not go our way despite the good hockey we played while trying to find our best combinations. When we eventually 'found our feet' DQG DIWHU ORQJ KRXUV RI KDUG SUDFWLFH ZH KDG HYHU\RQH FRPPLWWHG WR WKH FDXVH DQG PDGH WKH progress throughout the season fun and successful. 174


7KHKLJKOLJKWRIWKHVHDVRQZDVWKHYLFWRU\DJDLQVW6W%HQHGLFW VZKHUHDUHDOO\JRRGWHDPHIIRUW and the hunger to win the game saw us through to the end with a 2-1 victory. I still believe had ZHWDNHQDIHZPRUHRSSRUWXQLWLHVLQRWKHUPDWFKHVRXUHQWLUHVHDVRQZRXOGKDYHKDGDGLIIHUHQW complexion. I believe that King Edward hockey has a very bright future ahead and I look forward to working with the boys next year if I'm granted the opportunity. I would like to thank Mark Demartinis and Tashreeq Chota for taking time off from their hectic VFKHGXOHV WR KHOS HQKDQFH WKH VNLOOV DQG RIILFLDWH RQ WRXUV 'U +XGVRQ  /DPE DQG 0U 0DU[ IRU organising the matches and finally Miss Kyte for her commitment to the respective teams. W Plessie The following boys played: 7:KLWH &DSWDLQ *0DWODZHQJ.0DNKDQ\D-%DUQHV0*LOO6'LFNVRQ9*DVSDULV -%HKDQ%:LOOLDPV%9LODV::UHGH.%LDVVRQLDQG*9DQ=\O

U14B Hockey Educator in Charge : Coach: Captain: Vice-Captain:

Miss J Kyte T Chota M Laird S Piviteau

The King Edward VII U14B Hockey Team had a very good season. This was a team of highly competent and talented players. Many of the boys had played hockey before and those who had not fitted in extremely well. The necessities of a successful team are not the abilities of individual SOD\HUVEXWUDWKHUKRZSOD\HUVSHUIRUPDVDXQLWDQGWKLVZHDFKLHYHGULJKWIURPWKHRQVHWRIWKH season. The boys were focused and determined at every practice and match. The team showed lots of strength and courage and this was reflected in the achievement of a number of great results. The WHDPZDVH[WUHPHO\ZHOOOHDGE\/DLUGDLGHGE\WKH9LFH&DSWDLQ3LYLWHDX&RQJUDWXODWLRQVRQD very successful season gentlemen. ,¡GOLNHWRH[WHQGP\JUDWLWXGHWR'U+XGVRQ/DPEDQG0LVV.\WHIRUWKHLURXWVWDQGLQJFRQWULEXWLRQ DQGRUJDQLVDWLRQDQGLQH[KDXVWLEOHVXSSRUWDVZHOODVWRDOOWKHER\VDQGWKHLUSDUHQWV T Chota The following boys played: 0/DLUG &DSWDLQ 63LYLWHDX 9LFH&DSWDLQ 3%LQGRQ'*RRVHQ/0RUULV&(GZDUGV '+DUWH*9DQ=\O7)HUJXVRQ0+HPSHO63DXOR&:HQW]HO:0DUVKDOO*%U\FH K Hlophe and J Castel. 175


U14C Hockey Educator in Charge: Coach: Captain:

Miss J Kyte T Chota L Mokobodi

The King Edward U14C Hockey Team had a good season. The majority of these boys had never SOD\HGKRFNH\EHIRUHEXWWKDWGLGQ¡WVWRSWKHPIURPVWULYLQJIRUVLJQLILFDQWO\QHZKHLJKWVLQWKHLU sporting careers. This team was unfortunate in that they sometimes did not have fixtures because other schools do not have the depth that we have. The boys' attitude and perseverance was outstanding and they consistently attended practices and matches. This team could easily have matched any other school's B team. With hard work and dedication these boys can make a name for themselves in the forthcoming years. Congratulations on a very successful season gentlemen. ,¡GOLNHWRH[WHQGP\JUDWLWXGHWR'U+XGVRQ/DPEDQG0LVV.\WHIRUWKHLURXWVWDQGLQJFRQWULEXWLRQ DQGRUJDQLVDWLRQDQGLQH[KDXVWLEOHVXSSRUWDVZHOODVWRDOOWKHER\VDQGWKHLUSDUHQWV T Chota The following boys played : 6.KDQ/0RNRERGL &DSWDLQ 63RFKHH<3RFKHH.YDQGH/DDU$6LOLIDQW6.HVZD -&DVWHO55DQNLQ01[DVDQHDQG7-RQHV

176


Rowing

Open Rowing Master in Charge : Coach :

Mr M Hancock R Gilfillan

7KHVHDVRQNLFNHGRIIWRDJRRGVWDUWZLWKDZHOOGULOOHGWUDLQLQJFDPSLQ2FWREHU7KHER\·VKDUG work through the off-season paid off to help them get on with pulling out the best they could on the GD\0DWWKHZ&KLWWHQGHQ·VKDUGZRUNGXULQJWKHSUHVHDVRQSDLGGLYLGHQGVDVWKH)LUVWIRXUFDPH ILUVWDW*DXWHQJ&KDPSVDQGWKLVODLGDJRRGIRXQGDWLRQIRUWKHUHVWRIWKHVHDVRQ 7KH6FKRROV·ERDWUDFHSURYLGHGPDQ\RIWKHZDWHUDQWLFV%HLQJSXVKHGRXWRIWKH$ILQDOE\DIHZ seconds to some local coastal crews proves that winning on away water can be more demanding. )LQLVKLQJWKHUHJDWWDLQDKLJKHUSRVLWLRQWKDQDQ\RWKHU*DXWHQJ6FKRROSURYHGWKHER\V PHQWDO toughness which they applied throughout the season. The rest of the season's highlights are as follows: The Parktown Regatta provided a much needed assessment of the December and January preparation. The eight finished a close second behind arch ULYDOV6W-RKQ·VZKLOHWKHFR[HGWRRNVWRFNRIWKHUDFHDVPRUHZRUNZRXOGEHUHTXLUHGWREHDW 6W-RKQ V7KLVUHJDWWDVDZWKH)LUVW4XDGSXVKWKURXJKWKHILHOGWRZLQ7KLVSURYHGWKDWWKH4XDG and the boys did have winning potential. 7KH9/& UHJDWWD KHOG RYHU P FUHDWHG PL[HG UHVXOWV DV WKH ER\V GLGQ·W UDFH LQ WKHLU QRUPDO ERDWV5DFLQJRYHUPZDVQRWWKHER\·VIRUWHEXWSURYLGHGIRUJRRGUDFLQJH[SHULHQFH Luck of the draw and beating St Andrews (Grahamstown) saw the first eight finish as the top school ER\FUHZLQWKH(ULF)UDVHUFKDOOHQJHDWWKH5LYLHUD9DDO5HJDWWDRQO\WREHNQRFNHGRXWLQWKHVHPL ILQDOVE\DZHOOSUHSDUHG2OG(GV·6HQLRU%&UHZ7KHTXDGKDGDWRXJKKHDGUDFHDQGIDLOHGWRPDNH the racing stages of the regatta by a mere 2 seconds. This year saw the boys decide not to compete at Buffalo and opt for some solid training at Roodeplaat Dam. Due to a poor turn out from other open DJHJURXSVIURPRWKHUVFKRROV the Wemmer Pan Regatta was also substituted for training and fine-tuning for SA Champs. The boys would like to thank Chris King for the use of the Lin Jian (Legavan). This boat being more suited to the boys provided the necessary mental 178


boost and confidence that was required to bring the boys the accolade of Winners of the Boys Open 7URSK\DWWKH6RXWK$IULFDQ6FKRROV¡&KDPSV7KLVDFKLHYHPHQWZDVDOVRVSXUUHGRQE\VWSODFHLQ WKHVFXOO .HHOLQJ DGHDGKHDWIRUILUVWLQWKHFR[HGIRXU +XOOH\ DQGVHFRQGLQWKH4XDG 3HDUWRQ  and lastly second in the eight. Colours were awarded to O Phakate for showing the worth of a well-drilled and commanding Coxswain. Presently there are three boys in the Gauteng provincial squad with their goals set high on competing at the Junior World Rowing Championships in August. I wish these boys the best in their qualifying regattas and to the rest of the boys all the best in their future endeavors. R Gilfillan

Rowing First Eight 2005 Front Row (left to right): 

23KDNDWKL5+XOOH\6&KLWWHQGHQ6.HHOLQJ

Back Row (left to right):

$*LWWHQV&3HDUWRQ*'RV6DQWRV

Absent:

53DQLV60XUUD\ 179




Rowing First Four 2005 Front Row (left to right):

5+XOOH\6&KLWWHQGHQ

Back Row (left to right):

6.HHOLQJ23KDNDWKL

U16 Rowing Coach :

D Kearns

The 2004/05 season was a season of mixed results for the U16 age group. We had a very slow start to the season and really struggled to get anywhere near the medal placings during pre-season racing! +RZHYHUZLWKDJUHDWDPRXQWRIFRPPLWPHQWDQGFKDUDFWHUDVKDVEHHQFRQWLQXRXVO\VKRZQZLWK WKLVJURXSRIER\VZHPDQDJHGWRPDNHHQRUPRXVLPSURYHPHQWVHDFKZHHNDQGVWDUWHGFORVLQJ the gaps between the strong St Benedict's and St John's crews and ourselves! 180


,WZDVQRHDV\WDVNZLWKWUDLQLQJ sessions increasing in intensity DQG WLPH  +RZHYHU DOO WKH boys took it in their stride and trained even harder than was expected with their response always being "We want to win SA Champs!" It was this neversay-die attitude that turned a potentially dismal season into a great one! 7KH$QHYHUUHDOO\JRWJRLQJ with just not enough time spent LQ WKH  GXULQJ WUDLQLQJ EXW they still had the race of their season during the heats at SA Champs where they managed to secure themselves a place in the A Final. The quad was a difficult crew to get going with constant changes occurring due to selections. The TXDGVWDUWHGUDFLQJLQ-DQXDU\LQWKH%[HYHQWZKHUHWKH\EHJDQWRGRPLQDWHVRE\6$&KDPSV they were racing in the A 4x where the crew also managed to secure a place in the A final and had a really good race in the final. Wright was consistent in the single scull with very impressive victories throughout the season. He went on to win gold at SA Champs by a very comfortable margin of approximately 15 seconds. The coxed four showed the greatest improvement this season. From Gauteng Champs where they PDQDJHGWRPDNHWKH$ILQDODQGILQLVKHGILIWKEXWZHUHUDWKHUIDURIIZLQQLQJSDFHWRZLQQLQJD bronze medal at SA Champs and even beating the St Benedict's 4+ who had dominated the whole SUHVHDVRQ(YHQZLWKWKHLUWKLUGSODFHLQWKHILQDOWKHFUHZPDQDJHGWREUHDNWKHSUHYLRXVUHFRUG for the event along with St John's and Grey College. $IWHUVXFKDVORZVWDUWLQJVHDVRQWKHER\VDOOGLGWKHPVHOYHVSURXGE\HQVXULQJWKDWDOOFUHZVZH entered qualified for A finals in their respective events. Bigger and better things can be expected of this group of boys next season when they move into the open age group. Thanks for a great season! D Kearns

181


Rugby

First XV Rugby Master in Charge : Coaches: Captain : Vice-Captain :

Mr R Erasmus Mr R Hammond & Mr E Scheepers G Thomas J Smit

One can look back on the 2005 season and confidently say that 'the Reds' are back on the map. After WKHGLVDSSRLQWLQJVHDVRQWKHER\VZHUHRXWWRSURYHWKDW.LQJ(GZDUGUXJE\ZDVDOLYHDQGZHOO A group of 50 players were announced at the end of October 2004 to attend a training camp. :LWKWKHKHOSRI$QGUH5LFKDUGVRQ )LWQHVVDQGFRQGLWLRQLQJFRDFKRIWKH&DWVWKH*ROGHQ/LRQV DQG2WDJR+LJKODQGHUVLQ1HZ=HDODQG DQG&KULVYDQ/RJJHUHQEHUJ )LWQHVVDQGFRQGLWLRQLQJ JXUX  who worked with the Springboks and Stormers) the boys were put through some strenuous sessions and were pushed to the limit. 7KHJURXSZHUHFXWWRSOD\HUVZKRXQGHUZHQWYDULRXVILWQHVVVSHHGDQGVWUHQJWKWHVWV(DFKER\ received a programme to work on his weaknesses that were identified. We went on a teambuilding weekend to "Nyati" Sports School in Brits. This was a huge success. In our two friendly matches we played against club sides and the boys showed a lot of SURPLVHEHDWLQJWKHLUROGHURSSRQHQWVZLWK HDVHVFRULQJQROHVVWKDQSRLQWVLQWKHVH two matches. In preparing for our Festival we played St $OEDQV &ROOHJHDWKRPH,QDJDPHSOD\HGLQ SRXULQJUDLQZHIDLOHGWRLPSUHVV:HZHQW down 17-12. The boys showed a lot of character after this disastrous start. They refused to lie down and worked even harder. Then came the Festival. In our first game we struggled to beat lowly ranked Woodridge College from the Eastern Cape. The score was 22-7. The second game saw us come up against a highly motivated Pietersburg side. We managed to defend our try line for the ten minutes the game mysteriously continued after the 60 minutes of normal playing time. We won 16-10. ,QRXUWKLUGDQGODVWPDWFKQRWHYHQWKHKXJHVXSSRUWZHUHFHLYHGIURPWKH2OG%R\VDQG.LQJ Edward faithfuls could save us from going down against HTS Middelburg. Ranked in the top 10 in the FRXQWU\WKLVZDVPD\EHWRRPXFKWRRVRRQ 183


:HZHUHXQEHDWHQLQRXUQH[WHLJKWJDPHVDYHQJLQJODVW\HDU VORVVHVWR3RWFKHIVWURRP+LJK6FKRRO IRU%R\V6W'DYLG V,QDQGDDQG6W%HQHGLFW V7KHER\VJDLQHGFRQILGHQFHWKH\VWDUWHGSOD\LQJWKH NLQGRIUXJE\WKDWDWWUDFWHGFURZGVWRJDPHVDWKRPHDQGDZD\:HWKHQZHQWRQWREHDWDUFKULYDOV -HSSHLQD)1%FODVVLFFODVKE\SRLQWVWR On the 20 April we took a train trip down to Durban. We won both fixtures against DHS and Northwood. Our visit to Pretoria saw the end of our unbeaten streak. Pretoria Boys' won the game 21-7. We undertook an unforgettable tour to Argentina and Uruguay in the July holidays where we came XSDJDLQVWVRPHTXDOLW\VLGHVDQGOHDUQHGDORW Coming back from South America we played Westville in Durban. We lost 8-6 through a last minute penalty kick by SA Schools' fullback Chris Mickelwood. The Reds of 2005 had character! Your 'never-say-die' attitude and your will to win made us successful. You made us proud!

First XV Rugby 2005 Front Row (left to right): 

*7UR[OHU16KHOYHU-6PLW 9LFH&DSWDLQ *7KRPDV &DSWDLQ  6.RODULN%:K\WH'6WRZH

Middle Row (left to right): 

'5XWKHUIRUG&0XOOHU-&DUVWHQV$+DOH\90H\HU 53DUNLQVRQ&.RODULN5%DUQDUG

Back Row (left to right):

7+RSH7%UHZHU'-DFREV7'HQQ\ 184


In our last game of the season we beat Parktown 17-16. This meant we finished the season in the top 30 in the country. We didn't feature in the top 150 at the end of 2004. This made us the most improved side in the country. Well done boys. :HZRXOGOLNHWRWKDQN0U)HQQHOORXU+HDGPDVWHUIRUKLVVXSSRUWDQGZLVHZRUGVGXULQJWLPHV RIFULVLV$OVRDVSHFLDOWKDQNVWRWKH0DVWHULQ&KDUJHRI5XJE\0U(UDVPXVIURPZKRPZHOHDUQW D ORW 7KDQN \RX WR 0U 0DU[ IRU KLV RUJDQLVDWLRQ 2RP  )ULNNLH IRU SUHSDULQJ WKH ILHOGV DQG WKH SDUHQWVDQG2OG%R\VIRUWKHLUVXSSRUW<RXZHUHVXSHUEDQGDOORIWKLVPDGHRXUMREVDVFRDFKHV so much easier. 7RWKH0DWULFVJRRGOXFNZLWK\RXUH[DPVDQGWKHMRXUQH\O\LQJDKHDG7DNHZLWK\RXZKDW\RX YH OHDUQWWKLV\HDUVKRZWKHVDPHFRPPLWPHQWWROLIHDQG\RXZLOOEHVXFFHVVIXO We are proud to be a part of this 'awesome' School and privileged for the opportunity to work with such an amazing group of boys. The following players were awarded Colours: '5XWKHUIRUG*7UR[OHU%:K\WH$+DOH\6.RODULN*7KRPDV'6WRZDQG-0DOHND The following players were awarded Team Blazers: &0XOOHU'-DFREV&.RODULN16KHOYHU53DUNLQVRQ7+RSH-6PLW90H\HU%0F&DQQ and J Carstens. Mr R Hammond The following boys played: &0XOOHU'5XWKHUIRUG*7UR[OHU%:K\WH$+DOH\6.RODULN*7KRPDV &DSWDLQ  '-DFREV'6WRZ&.RODULN-0DOHND16KHOYHU53DUNLQVRQ7+RSH-6PLW 9LFH&DSWDLQ  90H\HU%0F&DQQ7%UHZHU-&DUVWHQV5%DUQDUG7'HQQ\DQG60ODPER Results : Against St Alban's College Woodridge (EP) Pietersburg HTS Middelburg Potchefstroom High School Jeppe High School Durban High School Northwood St David's Inanda St Stithians St Benedict's Pretoria Boys' High Westville Parktown Boys' High

Result Lost Won Won Lost Won Won Won Won Won Won Won Lost Lost Won

Score 19-12 22- 7 16-10 7-37 34- 5 30- 7 20-17 27- 3 71-10 15- 9 34- 5 7-21 6- 8 17-16 185


Critique of players: C Muller (Team Blazer) A highly skilled prop who formed an integral part of a very strong front row. His dedication and passion for the game contributed to the dominance of the pack of forwards. Good luck for 2006. D Rutherford (Colours) A real find this season. Excelled in all facets of the game. His physical presence contributed greatly WRRXUVXFFHVV0XFKZLOOEHH[SHFWHGRIWKLVWDOHQWHGKRRNHULQ:HOOGRQH\RXUKDUGZRUN will be rewarded. G Troxler (Colours) An extremely strong scrumager. He really put heart and soul into the season. He is a very dedicated and reliable player. Thank you for your commitment. B Whyte (Colours) A very mobile lock that excelled in both lineouts and broken play. The "Reds spirit" flows through his veins. Thank you for your dedication and hard work. A Haley (Colours) 2QH RI WKH WHDP V XQVXQJ KHURHV $ WUXH WHDP PDQ  $OZD\V IRXQG KLPVHOI FORVH WR WKH DFWLRQ hitting one ruck after another. Well done on an excellent season. S Kolarik (Colours) A hundred games in the Reds' jersey for this hugely talented loose forward. His experience proved vital on numerous occasions throughout the season. Almost always won the race to the loose ball. His number 6 jersey was always prominent. Well done. G Thomas (Colours) 'The Reds' Captain always led by example. His support play was outstanding. This â&#x20AC;&#x2DC;tough as nails' ORRVHIRUZDUGDOZD\VJDYH+LVFRPPLWPHQWDQGGHGLFDWLRQPDGHKLPDYHU\SRSXODUOHDGHU A season to be proud of! D Jacobs (Team Blazer) A very promising start to his First Team career. His attitude is extremely positive. He has a great feel for the game and his decision-making is outstanding. Definitely a player for the future. Believe in yourself. B McCann (Team Blazer) A very versatile player. His commitment to the team was beyond question. Never afraid of the SK\VLFDOVLGHRIWKHJDPH$OZD\VJDYH+HZDVRQHRIWKHILWWHVWSOD\HUVLQWKHVTXDG T Brewer Could always be relied on to give of his best. Very good impact player. His pace and technique in the lineouts made him a force to be reckoned with. J Carstens (Team Blazer) A very physical player. One of the finds of the Argentinean Tour. His handling skills and vision made him a valuable member of the squad. Watch out for this player in 2006. Good luck! 186


V Meyer An extremely talented player. Scrummed well and is never afraid to take the game to the opposition. His driving-play was excellent. 2006 will be a big year for him. Good luck! D Stow (Colours) Using his speed and side-stepping ability he made many an opponent look silly. Giving good service to the back line he helped them to look dangerous at times. His 'cockyness' might have helped to upset his opposite number but it had a negative side as well. Good luck at the Sharks. C Kolarik (Team Blazer) Being only in Grade Ten and being in a very difficult position he lifted himself to a higher standard to be DEHWWHUSOD\HU1RWEHLQJVFDUHGWRWDFNOHRUWDNLQJWKHEDOOLQKHVKRZHGWKDWKHKDVWKHPDNLQJRID great player. Looking forward to seeing him in the following season. J Maleka (Colours) 16 tries in one season. What more needs to be said about this exciting little speedster. We are going to miss those exciting 30 PHWUHVSULQWVDQGWKHVSHFWDFXODUILYHWULHV against St David's. I am sure they would like to. All of the best for any future plans that you have. N Shelver (Team Blazer) With big strong runs he managed to break the line of the defence on many occasions. His cross defence stopped a lot of the tries that other teams tried to score. We will miss him on the field next year. R Parkinson (Team Blazer) Certainly a player to keep an eye on in the future. With lots of speed and the ability to read the game he is certainly a valuable player in the team. With still a lot to learn about his preferred SRVLWLRQKHZLOOGHILQLWHO\EHFRPHDEULOOLDQWUXJE\SOD\HURQFHKHKDVPDVWHUHGWKHDUHDVKHVLPSO\ is only good in. T Hope (Team Blazer) Not always getting the amount of space that he needed as a wing he managed to do a lot of work LQ RWKHU DUHDV ZKHUH \RX ZRQ¡W DOZD\V ILQG D ZLQJ WR GR WKH MRE RI DQRWKHU SOD\HU  (YHQ VR KH managed to use his leg strength to make a lot of metres in tight situations. A safe player that will never let his team down. Thank you for that. J Smit (Vice-Captain) (Team Blazer) :HQHYHUUHDOO\KDGWRZRUU\DERXWKLPEHLQJDWWKHEDFN*RRGXQGHUWKHKLJKEDOODQGMRLQLQJ the line he showed moments of brilliance. His defensive ability was tested on a few occasions and he always passed with flying colours. Who can forget the telling tackle made on giant Nkosi in the game against St Stithians? Whoever takes over that position has huge boots to fill. 187


Second XV Rugby Coaches: Assistant Coach: Captain:

Mr E Scheepers and Mr R Hammond D Howard J Carstens

Starting early last year with training and conditioning helped us to achieve one of the most successful UHVXOWVLQDORQJWLPHRQO\ORVLQJRQHJDPHQDUURZO\DQGGUDZLQJDQRWKHUWKHSOD\HUVFDQEHUHDOO\ proud of their effort and performances. This team will be remembered as the team that played their hearts out every game and produced some spectacular running rugby at certain times. With so many boys knocking RQWKHGRRUWREHLQWKHVWDUWLQJOLQHXSIRUWKH)LUVW7HDPDORW RIRWKHUSOD\HUVZRXOGKDYHJLYHQXSDORQJWLPHDJREXWWKH\ kept on trying. This showed the true character of this team. I can say for certain that a lot of these boys would walk into other schools' first teams without a doubt. With a lot of the players remaining behind next year we are hoping that they will carry on with their commitment and help build an even better first team next year. It was a real pleasure working with these boys and I am looking forward to working with them again. To WKH UHVW JRRG OXFN IRU \RXU UXJE\ YHQWXUHV LQ WKH IXWXUH DQG once again thank you. Mr E Scheepers The following boys played: 90H\HU%%RUVERRP&)HUUHLUD7%UHZHU26FKXEDFK 5&URPHU:LOVRQ%0F&DQQ-&DUVWHQV &DSWDLQ &/RQGRQ 7'HQQ\5%DUQDUG60ODPER/0ROHWVDQH.0DULUL and C Vounnou. Results: Against St. Albans Pochefstroom Boys' High Highlands North (1st team) Jeppe High School for Boys Durban High School Northwood St David's Inanda St Stithians St John's College Fourways(1st team) St Benedict's Pretoria Boys' High Westville Boys' High Parktown Boys' High

Result Won Won Won Won Won Won Won Won Won Won Won Lost Draw Won

Score 14- 9 22- 6 54- 3 22- 7 15- 6 40- 9 25- 9 19-13 19- 5 36- 0 48- 0 0- 3 17-17 25- 6 188


Third & Fourth Team Rugby Coaches : Captains :  

 

Mr R Erasmus Mr U Maqina 7KLUG7HDP²0*LOILOODQ )RXUWK7HDP²0*LEVRQ

Both the Third and Fourth Teams enjoyed good seasons this year; the Third Team losing two games and the Fourth Team only losing one game during the season: certainly records that both teams FDQEHSURXGRI7KHVXFFHVVRIWKHVHDVRQKRZHYHUJRHVEH\RQGVLPSO\ORVLQJRUZLQQLQJWKHVH teams both enjoyed their rugby and were extremely committed. At times some really good rugby was played with some really good support play often causing opponents real difficulty. There were many highlights this season. Some of these boys may have been disappointed not to have made higher teams but they never let any disappointment show and were determined that their teams would not be easily beaten. One of my fondest memories of the season was the two away ZLQV DJDLQVW :HVWYLOOH UHDO GLVSOD\V RI FKDUDFWHU Another highlight was the Fourth Team win against St Benedict's. The opposition were big and strong but our Fourths gave an excellent display of what can be achieved through teamwork. One of the Third Team's finest displays was reserved for the last game of the season - an excellent display of hard running and good support play. Overall both teams have reason to be very proud RIDMREZHOOGRQHWKH\ZHUHQRWRIWHQWKHELJJHVW players on the field but their skills and strong commitment made up for any physical disparities. To all the Grade 12 boys who played in the Third and Fourth Teams I would like to say thank you for the effort that you put in this year and the contribution that you have made to King Edward rugby over the last five years. To the Grade 11's and 10's - much will be expected of you next year as you have set high standards for yourselves. I would also like to thank Mr Marx for all his organisation as well as Mr Matthee for the preparation of the grounds. Mr R Erasmus The following boys played throughout the season for the Third and Fourth Teams: 0 *LOILOODQ$ +LFNV - 5LOH\ & %RUWKZLFN$ .XFKDUVNL ' 0HLULQJ 5 /RQGRQ * /HHXZ7 /HJDH ' )HUUHLUD . 3H\SHU *7KRPSVRQ 6 1NXQJX7 0DQHQWVD - +DPPDQ 3 3LQKHLUR ' 3DWULFLR / 5REHUWVKDZ & &KLOYHUV . 3DUNLQ ' +DUULV 0 6FURRE\ 1 *HUEHU 0 *LEVRQ 0 *URHQHZDOG 5 3DQLV$ 6SHHFKOH\ & %RDWZULJKW (:HLQEHUJ - /LWKJRZ: 3HWHUVRQ % &LOOLHUV / 0RNRHQD -1LHOVRQ66LPRQV%+DUULV70DORSH.$VLHQGX'DUNZDK/3KDNDWKLDQG0*ORVV 189


Results : Against 3rd

4th

St Alban's

57-0

52-0

Potchefstroom

29-5

46-3

Jeppe

38-0

38-0

*Northcliff

20-3

15.0

St David's

47-0

75-0

*de la Salle

29-12

40-0

St Stithians

9-14

12-7

St John's

7-5

14-0

St Benedict's

75-0

10-0

Pretoria

7-22

7-17

Westville

21-19

28-5

Parktown

37-7

17-10

*denotes played against higher opposition

Fifths - Sevenths Rugby Master in Charge : Coaches : 

Mr M de Kock 0U*-DFNVRQ0U0+DQFRFN1'LDQDDQG$$XFDPS

The results table shows that all the teams had a very successful season. Many of the games played were against other schools' Second or Third Teams and some tough opposition was sometimes H[SHULHQFHG 7HDP IRU WHDP WKH )LIWKV RQO\ ORVW DJDLQVW 3%+6 RQH RI WKH WUDGLWLRQDO PRQDVWLF schools which we always compete against. Therefore a great season with some exciting rugby. The backs had great talent with creativity and speed. Some really great tries were scored from innovative moves by the backs. The defence sometimes let them down but it improved as the season progressed. A lot of depth in the backs with great talent which makes it easy for the coach to train. Heart and determination are great words to describe this group of boys. Mention needs to be made of the forwards: commitment at practices and the tremendous heart and fighting spirit that was shown in many closely-matched games. There were a few memorable JDPHVWKDWZHQWGRZQWRWKHZLUHLQZKLFKJXWVSULGHDQGGHWHUPLQDWLRQHQVXUHGYLFWRU\E\QDUURZ margins. Great progress was made in the tighter phases of the play during the season. These teams were aided by an abundance of highly mobile and skilled loose forwards. There were relatively few LQMXULHVGXULQJWKHVHDVRQDQGDOVRDQDEXQGDQFHRIIRUZDUGVWRFKRRVHIURPVRFRPSHWLWLRQIRU game time was keen. A great team spirit prevailed and many players were very sporting in being prepared to play half matches only. It was a privilege to coach and be part of a group of boys who gave of their best and continued to attend practices throughout the whole season. Well done and may you enjoy your rugby for many years to come. 190


Many boys formed the nucleus of this group and many were promoted to higher teams. You know who you are and we are proud of you. 0\WKDQNVJRWRWKH0RWKHUV &RPPLWWHHIRUWKHHDWVWKHJURXQGVWDIIDQGWKHSDUHQWVIRUWKHLU VXSSRUW7KHFRDFKHV² VROLG  FDPDUDGHULH  HQWKXVLDVWLF DUHRQO\VRPHRIWKHZRUGVZKLFKFRPH to mind. Thank you. Mr M J de Kock Results:

191


U16A Rugby Coaches: Captain: Vice-Captain:

Mr T Craig and Mr S Eales L Oosthuizen C McIntyre

The season began in late January and with the added incentive of a tour to Argentina and Uruguay WKHER\VWXUQHGRXWLQIXOOIRUFH$QDJHJURXSWKDWKDGORDGVRISRWHQWLDOEXWQHHGHGWRGHYHORS their core handling skills. They embraced each drill and exercise with vigour and enthusiasm in SXUVXLWRIRXUJRDOWREHFRPHEHWWHU.LQJ(GZDUG5XJE\SOD\HUV1HYHUZDVRQHPRUHWRRPDQ\ the boys just knuckled down and did the extra. They were a pleasure to coach and always keen to learn and try new combinations or plays. (LJKWZLQVDQGIRXUORVVHVDOORXWVLGHRI-RKDQQHVEXUJVKRZHGWKDWWKH8.LQJ(GZDUGVLGHZHUH a force to be reckoned with in Johannesburg. Unfortunately poor performances and discipline were often the cause of defeat as the team lost focus on our objectives on the field. This was all too true DJDLQVW'XUEDQ+LJK6FKRRODQG3UHWRULD%R\V ERWKJDPHVZHFRXOGKDYHZRQ:HVWYLOOHZDVDQ H[WUHPHO\ WRXJK JDPH HVSHFLDOO\ as we had just got off the train. The boys did themselves proud and the result could have easily gone our way. None-theless it was a vastly improved performance on last year. Our total distraction with the referee against Northwood cost us. We were by far a much better team EXW GLG QRW WDNH RXU FKDQFHV became frustrated and lost focus; hopefully this is a lesson well learned. The season began with comfortable wins against St $OEDQV 3RWFK %R\V DQG -HSSH the Jeppe game shortened due to lightning. With each game the side developed and good forward play and some excellent scrumming and line outs established a good platform to score points. The cleaning of rucks improved with each game and confidence grew. The DHS game was much anticipated and the boys were well focused when the game began. DHS had a highly skilled side and handled the ball more than capably. We played our game plan for long periods and dominated with the forwards. Unfortunately we did not convert all the pressure into enough points. When the game became tight we lost focus and this cost us victory. $IWHUDORVVWR1RUWKZRRGZHUHWXUQHGWR-RKDQQHVEXUJWRIDFH6W'DYLG¡V7KH6W'DYLG¡VIO\KDOI GRPLQDWHGWKHILUVWKDOIVKLIWLQJRXUSDFNRIIRUZDUGVDURXQGWKHSDUN,QWKHVHFRQGKDOIKHZDV effectively shut down and we could begin to play to our game plan. This was a good victory in a KDUGIRXJKWSK\VLFDOJDPH([FHOOHQWGLVSOD\VDJDLQVW6W6WLWKLDQV6W-RKQ VDQG6W%HQHGLFW¡VVDZ .LQJ(GZDUGVFRUHWKUHHYHU\FRPIRUWDEOHZLQVIROORZHGE\DORVVWR3UHWRULD%R\V LQDFORVHO\ 192


FRQWHVWHGSK\VLFDOHQFRXQWHU3RRUGHFLVLRQPDNLQJDWFULWLFDOWLPHVVDZXVFRPHXSVKRUWDJDLQVW well organised opposition. The July holidays arrived and the team jetted off to Argentina and Uruguay with the First Team. $OWKRXJK ZH QDUURZO\ ORVW WKUHH RI WKH IRXU WRXJK IL[WXUHV WKH H[SHULHQFH JDLQHG E\ RXU ER\V should prove invaluable in the future. We returned to School in August physically and mentally prepared to face Westville. A tough EUXLVLQJIL[WXUHHQVXHGDQGDOWKRXJKZHSOD\HGZHOOZHZHUHEHDWHQRQWKHGD\:HILQLVKHGWKH season on a high note with a good victory over Parktown. In all the boys developed remarkably over the season as both their handling and appreciation for WKHJDPHLPSURYHG2QHKRSHVWKH\FDQWDNHZKDWWKH\KDYHOHDUQWWKHLUHQWKXVLDVPDQGUHQHZHG commitment into open rugby. If so King Edward rugby has a bright future. Mr S Eales The following boys played: '-RRVWH/2RVWKXL]HQ &DSWDLQ 70DGLER':DWWUXV.0F&R\'5LPPHU0&URQMH%%ZDO\D -$UQROG.-RVHSK&0F,QW\UH 9LFH&DSWDLQ *&RUGHU.0RRUFURIW-0F&UXGGHQ$6ORWK1LHOVRQ and S Manton. Results YV6W$OEDQV YV3RWFKHIVWURRP YV-HSSH YV'+6 YV1RUWKZRRG YV6W'DYLG·V YV6W6WLWKLDQV YV6W-RKQ·V YV6W%HQHGLFW·V YV3UHWRULD YV:HVWYLOOH YV3DUNWRZQ

²  ²  ²  ² ²  ²  ² ²  ²  ² ² ² 

193


U16 Rugby Tour to Argentina Match 1 - Cardenal Newman 30 June 2005 The first game of the tour could not have come quickly enough. This was after all why we were here. 7KHHIIHFWVRIMHWODJEHLQJLQDIRUHLJQFLW\DQGSUDFWLFHGLVUXSWLRQVGXHWRWKHH[DPLQDWLRQVZHUH VRRQWRWDNHWKHLUWROO8SRQDUULYDODWWKHPDWFKWKHRSSRVLWLRQZHUHGUHVVHGLQZKDWZHZRXOG WHUP WR EH SRRU SOD\LQJ NLW7DSHG XS MHUVH\V MHUVH\V RI GLIIHUHQW FRORXUV DQG VRFNV WKDW GLG QRW match as well as numbers of no particular sequence. This gave us a very false sense of security and we were quick to learn that the quality of opposition would in no way reflect their appearance. This team was able to string phases together similar to the Brumbies due to their superior handling skills. On the counter attack they were lethal and on numerous occasions they made us pay dearly for missed touch kicks. The pace and aggression with which they ran was quite something to behold. Our poor tackling allowed them to take full advantage of this aspect of play. Far too much jersey grabbing to have any measure of effectiveness. They beat us to the ball with superior speed and FRPPLWPHQW,QWHUPVRIFRPSHWLQJDQGUHWDLQLQJWKHEDOOZHZHUHODFNLQJ$VDUHVXOWRIWKLVZH were unable to string sufficient phases of play together to get enough of a foothold in the game. We went down 12-29. Not the kind of start we wanted on tour.

Match 2 â&#x20AC;&#x201C; Duendes 3 July 2005 We got just the start we wanted to this match by opening with a try within the first five minutes. They soon hit back with two tries of their own through sloppy defence on our part. Nothing more. We simply had not organised the defensive patterns that were required. For a team to concede tries on first phase ball is unacceptable. This was the passage of play that would now last for the better SDUW RI WKH JDPH:H ZHUH VLPSO\ QRW DEOH WR GR WKH GHIHQVLYH EDVLFV FRUUHFWO\ DOWKRXJK LW PXVW EHVDLGWKDWZKHQWDFNOHVZHUHPDGHWKH\ZHUHDKXQGUHGSHUFHQWLPSURYHPHQWRQWKHSUHYLRXV game. With ten minutes to play something changed. Perhaps the boys realised that what had happened was beneath their ability. We ran with purpose into space and suddenly scored three tries through good basic rugby. We retained our own ball and defended according to the required pattern. From 27-5 194


down we clawed our way back to 22-27. Too little too late. A great pity because if we had played for WKHPLGGOHILIW\PLQXWHVRIWKHJDPHWKLVZRXOGKDYHEHHQFRPIRUWDEOH Match 3 â&#x20AC;&#x201C; Jockey Club 6 July 2005 :H KDG SOD\HG VRPH LQH[FXVDEOH UXJE\ LQ RXU ILUVW WZR JDPHV ,Q WKH ILUVW JDPH ZH ZHUH QRW VXIILFLHQWO\ SK\VLFDO LQ WKH WDFNOH QRU DW WKH EUHDNGRZQ ZKLOH LQ WKH VHFRQG JDPH RXU GHIHQVLYH pattern had gone awry. The boys were asked to "put their hands up" and play as they were capable of playing. Suddenly there was a passion and a will to win that they can be proud of. Unfortunately the quality of opposition was up to it. $OODVSHFWVRIWKHJDPHZHUHHTXDOO\FRQWHVWHGEXWLQUXJE\LWLVRIWHQWKHVLGHZLWKPRUHEHHIWKDW HYHQWXDOO\WULXPSKV'HVSLWHWKLVFRQVLGHUDEOHZHLJKWDGYDQWDJHLQWKHEDFNVDQGIRUZDUGVRXUER\V QHYHUTXLW7KH\ZHUHLQWKHJDPHULJKWXSXQWLOWKHODVWPLQXWHDQGSRVVLEO\FRXOGKDYHZRQWKH game had it not been for two dubious tries early in the game. This was a game of rugby at its finest. +DUGSK\VLFDODQGXQFRPSURPLVLQJ\HWDWWKHFRQFOXVLRQRIWKHPDWFKWKHUHZDVDZRQGHUIXOVSLULW RIFDPDUDGHULHDPRQJVWWKHSOD\HUV3KRWRVZHUHWDNHQMHUVH\VVZDSSHGKDQGVVKDNHQDQGIULHQGV made. The score was a 15-19 loss but this was irrelevant in the context of the game. Match 4 â&#x20AC;&#x201C; CASI 14 July 2005 5XJE\LVDJDPHRIWZRKDOYHV²DIDPRXV1DDV%RWKDSHDUORIZLVGRP:HOOLQWKLVSDUWLFXODUFDVH there could be no more apt description of the proceedings. The first half consisted of King Edward 9,,6FKRROGRPLQDWLQJLQDOODVSHFWVRISOD\WKHUHE\VFRULQJILYHWULHVWRWKHLURQH7KHUXJE\ZDV IDLUO\VFUDSS\EXWWKLVLVZKDWFDQKDSSHQZKHQRQHSOD\VDJDLQVWOLPLWHGRSSRVLWLRQ7KHKDOIWLPH score was a comfortable lead of 27-5 for King Edward VII. CASI received applause for their efforts GXULQJWKHKDOI2IIWKH\WUXGJHGSUHVXPDEO\WRJHWUHIUHVKPHQWV The second half saw CASI bring on a whole new team. They had taken the meaning of super-sub to WKHOLPLW+DYLQJSOD\HGIRUWKLUW\ILYHPLQXWHVDQGWKLVEHLQJWKHODVWJDPHRIWKHWRXULWZDVDVLIZH had been dealt a knockout blow. The boys already had one foot on the plane and mentally were not really up to the task of lifting themselves to the level of play that was required to be competitive in WKHKDOI1RQHWKHOHVVWRWKHLUFUHGLWWKH\PDQDJHGWRVFRUHDZHOOZRUNHGWU\ZKLFKJDYHXVDODUJH enough margin to defend. This we did despite the half lasting for forty five minutes. We eventually ran out 32-29 winners. The Tour was a wonderful experience for the boys both in terms of the experience of visiting a foreign country as well as learning some valuable rugby lessons. These lessons will hopefully stand them in good stead for the remainder of their rugby careers at King Edward VII School. It was a growing up experience second to none and a tour of this nature brings home to the boys just how GLIILFXOWLWLVWRWRXUDIRUHLJQFRXQWU\DQGWREHDZD\IURPWKHFRPIRUWVRIRQH·VKRPH:HOOGRQH ER\V\RXGLG\RXU6FKRROSURXGERWKRQDQGRIIWKHILHOG Mr T Craig

The following players formed the Argentina/Uruguay tour party: 00DGLER/2RVWKXL]HQ'-RRVWH':DWWUXV.0F&R\1'HDOH0&URQMH%%ZDO\D -$UQROG.0RRUFURIW-0F&UXGGHQ*&RUGHU.-RVHSK$6ORWK1LHOVHQ'&KULVWHOLV '+D\GRFN*:K\WH&+D\QHV'5LPPHU$:KLWH/6FKPLGW60DQWRQ'0DUWLQDQG B Holtzhausen. 195


U16B Rugby Coaches: Captain:

Mr T Craig and Mr S Eales C Pratt

A great season was had by the U16B rugby side winning ten of their twelve fixtures. A number of these victories were by large scores in excess of 50 points. An excellent win against Pretoria Boys' capped off a fine season. A better performance in the first half against DHS could have seen an even better record. Heavily depleted by injury when they played Westville the boys were soundly beaten but they did their school proud and never gave up. A number of these boys came on as replacements for the A side and never looked out of place. Ten of the team had the good fortune RIWRXULQJWR$UJHQWLQDDQH[SHULHQFHQHYHUWREHIRUJRWWHQ7KHLUFRPPLWPHQWDQGGHWHUPLQDWLRQ to learn never wavered. Well done men on a fine season. Mr S Eales The following boys played : '&KULVWHOOLV'+D\GRFN=*LQFDQD60DQWRQ%6DQGHUV/6FKPLGW&9DQ+HHUGHQ '6LOFRFN1'HDOH%+ROW]KDX]HQ'0DUWLQ$:KLWH*:K\WH.+D\QHV(%X\V '+D\GRFN,0DJKRPDDQG/3LHWHUVH Results YV6W$OEDQV YV3RWFKHIVWURRP YV-HSSH YV'+6 YV1RUWKZRRG YV6W'DYLG¡V YV6W6WLWKLDQ¡V YV6W-RKQ¡V YV6W%HQHGLFW¡V YV3UHWRULD YV:HVWYLOOH YV3DUNWRZQ

²  ²  ²  ² ²  ²  ²  ² ²  ² ² ² 

U15A Rugby Coaches: Captain:

Mr C Finlayson and L Jacobs G van Wyk

$QDQDO\VLVRIWKHUHVXOWVUHIOHFWVDGLVDSSRLQWLQJVHDVRQLQZKLFKWKHWHDPXQGHUDFKLHYHG²WKHLU ordinary success rate did not do justice to their capabilities. On a positive note they demonstrated that they could play the game. There were the plucky and committed performances in narrow away losses to DHS and Westville and an almost textbook GLVSOD\DJDLQVW6W6WLWKLDQV2QWKHVHUDUHRFFDVLRQVWKHUHZDVHYLGHQFHRIUHVROXWHGHIHQFHHIILFLHQW implementation of the basics by the pack as well as backline enterprise and finesse. During the season a handful of players put their hands up demonstrating a zest for the game and meeting the physical requirements. 196


For the most part of the season the team stumbled from one mediocre performance to another with little of the commitment to the cause associated with the School teams. Too often their SK\VLFDOIUDLOWLHVZHUHH[SRVHG²VDGO\WKHUHZDVVRPHWKLQJGLVWLQFWO\XQ.LQJ(GZDUGDERXWWKHLU efforts. The majority of the losses were self-inflicted and by narrow margins which can be turned around next year. Some players in the lower ranks have developed and an injection of new personnel coupled with real commitment will enable this group to reverse many of the losses. A lot more is expected from this group next year. Mr C Finlayson Regular members of the A team were: -%DUQDUG'&URVV&*XQQLQJ3+DUYH\..ULHO70DJRU10RUULV/0YXODQH31RGD73KRWROR *5DOSK-6DXQGHUV-6FRWW06KDP$6PLWK66HOOZRRGDQG*YDQ:\N &DSWDLQ 

U15 B Rugby Coaches : Captain :

Mr C Finlayson and L Jackson A Nizetich

The Under 15B side enjoyed an extremely successful season notching up an impressive 397 points ensuring 11 of 13 victories. 7KHUH ZHUH PDQ\ KLJKOLJKWV GXULQJ WKH VHDVRQ QRQH EHWWHU WKDQ WKH QDUURZ YLFWRULHV DJDLQVW WKH FRPSHWHQW 3UHWRULD %R\V  DQG RWKHUZLVH XQEHDWHQ )RXUZD\V VLGHV ² KHUH WKH\ GHPRQVWUDWHG WKH commitment and spirit expected of King Edward teams. The forwards were always competitive holding their own in the tight and loose phases supplying ball for the backline. Generally the backs showed pace and flair running in some well worked and spectacular tries. 197


Many of these players have outstanding skills and once they match up to the required physical DVSHFWVRIWKHJDPHWKH\ZLOOSURJUHVVWRDKLJKHUOHYHO6SHFLDOPHQWLRQWRWKH&DSWDLQ1L]HWLFK ZKRDOZD\VOHGIURPWKHIURQWLQVSLULQJKLVWHDPWRJUHDWHUKHLJKWV,QFRQFOXVLRQLWZDVDVHDVRQLQ which this side can look back on with a large amount of satisfaction; they endeavoured to play an attractive brand of rugby providing good entertainment. Well done! C Finlayson Regular members of the B team were: '%LDQL-%RWKD0&DUVWHQV'&XUWD\QH1'ODPLQL++HQVRQ(-DQXDU\0/HZLV 70DMDQDJD70DUROHQ-0DWKLDV00F*LOOLYUD\00NKL]H$1L]HWLFK &DSWDLQ  '3HWHUVRQ16HPDODQHDQG09LFHQWH Summary of Results A 36-0 12-0 64-0 3-7 22-15 8-12 8-0 29-0 27-3 13-17 8-7 18-7 3-19 6-13 6-8

vs St Albans vs Potchefstroom vs Highlands North (A) vs Jeppe vs Northcliff (A) vs Durban High School vs Northwood vs St David's College vs St Stithians College vs St John's College vs Fourways (A) vs St Benedict's vs Pretoria vs Westville vs Parktown

B 43-0 50-7 42-0 13-15 13-15 23-10 34-7 35-5 36-12 12-5 0-26 15-0

U 15C, D and E Rugby Master in Charge : Coaches:  



Mr J D Passmoor %/HJJHWW5&DPHURQDQG0'XQQ

This season was quite an eventful one for the U15 lower teams. The season began with the usual trials and initial matches during which we sorted out our first decisions regarding team placement. After experiencing some losses in our first outing we were forced to go into the holiday break and re-examine our position. Fresh after the holiday the boys were looking fit and eager for the approaching season and grasped WKHRSSRUWXQLW\WRSHUIRUP:LWKWKHH[SHUWFRDFKLQJIURP%\URQ/HJJHWW5LFKDUG&DPHURQDQG 0DWW'XQQWKHSOD\HUVEHJDQWRH[FHODQGILQGWKHPVHOYHVDVUXJE\SOD\HUV1DWXUDOO\VRPHER\V felt that they were playing out of position but the coaching staff began to choose the player in the position that best suited their natural game. This began to show the results we desired as the teams all began to work in units of fifteen rather than individuals running amuck. Soon a structured game plan developed with the assistance of Marc Percival and we were well on our way to becoming a very successful squad. 198


7KH¶&·WHDPSODWIRUPIRUVXFFHVVWKLVVHDVRQZDVEDVHGRQDVWURQJSDFNRIIRUZDUGVWKDWZRXOG confidently secure first phase ball and excellent recycling that meant speedy wingers had no trouble in finishing off the hard work with rewards. 7KH¶'·WHDP·VJDPHSODQEHJDQWRHYROYHLQWRRQHWKDWZDVEDVHGPRUHRQEDFNVWKDWUDQLQFLVLYHO\ and constantly attacked the gain line. In essence they knew only one word - "go-forward". When DEO\VXSSRUWHGE\DSDFNRIPRELOHIRUZDUGVDEUDQGRIH[FLWLQJUXJE\TXLFNO\GHYHORSHG 7KH¶(·WHDPLQ8LVQRUPDOO\PDGHXSRISOD\HUVQHZWRWKHJDPHWKLV\HDUZDVQRGLIIHUHQW7KLV KRZHYHU ZDV LQ QR ZD\ D KLQGUDQFH$IWHU OHDUQLQJ TXLFNO\ D SDVVLRQDWH WHDP EHJDQ WR SOD\ KDUG ¶EDVLFUXJE\·WKDWHDUQHGWKHPWKHUHVSHFWRIPDQ\RIWKHLUSHHUVDQGRSSRVLWLRQZKLFKZDVRIWHQ a higher team - producing a string of victories. Players began to demonstrate their ability which was only overshadowed by their intense enthusiasm IRUWKHJDPHSOD\HUVOLNH%DVVRQZKRZRXOGRQO\HYHUOHWDQDVWKPDDWWDFNWDNHKLPRIIWKHILHOG RU-RXEHUWZKRJUHZLQWRRQHRIWKHRXWVWDQGLQJORFNVRIWKHVHDVRQHYHQWKRXJKWKLVZDVQRWKLV preferred position. The end of the season was an enjoyable affair as the coaches and I were able VD\WKDQN\RXDQGSUHVHQWVRPHVSHFLDODZDUGV,QWKLVVHQVH6FRWW:HVVHORZDVWKH¶&·SOD\HURI WKHVHDVRQGXHWRKLVYLWDOOLQHRXWDELOLWLHVWKDWPHDQWZHZHUHFRQVWDQWO\LQSRVVHVVLRQ7KH¶'· player was young Bryson Borsboom. The little man with the biggest heart constantly contributed to the team with performances and an attitude that reminded us constantly that rugby is fun. Many other players deserve mention and recognition but if I were to do that I would have to go on for much longer. 0\ WKDQNV JR WR P\ WKUHH VXSSRUWLQJ FRDFKHV %\URQ /HJV /HJJHWW 0DWW 7XNV 'XQQ DQG 5LFKDUG&DPHURQZLWKRXW\RXUKHOSWKLVVHDVRQZRXOGQRWKDYHEHHQWKHKXJHVXFFHVVWKDWLWZDV Mr Finlayson for the constant expertise and advice. Most importantly the players deserve my thanks DQG DGXODWLRQ IRU ZLWKRXW WKHP DQG WKHLU LGLRV\QFUDVLHV WKLV VHDVRQ ZRXOG KDYH EHHQ PXQGDQH mediocre and unmemorable - thank you. Mr J D Passmoor The following boys played: 7%DVVRQ/0QLVL*7UDF\--RXEHUW6:HVVHOR-)LVKHU0-DQXDULH$+RZLH0/HZLV &YDQ5RR\HQ.5DPDNKRDVH.6FKHHSERXZHU0&KDPEHUV-%RWKD/0KODXOL0&KULVWRSKHUV 96FKROO%0XQJZH*3UHWRULXV6$UHLQJWRQ.+DQQLH67HUEODQFKH//HWVKDER%%RUVERRP 61JZHYHOD0&KLOYHUV-'RGG30RNKDQGD.0NKL]H70DVHPXOD5&ROEHFN='HGORZ /6WHYHQV0-RUGDDQ76WHPHOD00RQDJKDQ'$OODQ:/HGZDER60NKL]H-5RGGD.5RJHUV &6ROLJUDP.&DPSEHOO6*RXJKDQG50DUWLQV 199


U14 Rugby It has been a long time since the rugby players of this age group at the School have returned such a sparkling set of results. More important than the results was the manner of rugby played. Blessed E\DWOHDVWVHYHQWDOHQWHGZLQJHUVWKHJURXSHPEUDFHGDSOD\LQJVW\OHWKDWVSUHDGWKHEDOOZLGHRQ almost every occasion incorporating all 15 players into the game. This is also borne out by the fact WKDWGHVSLWHKDYLQJUHDVRQDEOHNLFNHUVWKURXJKRXWWKHJURXSSHQDOW\JRDOVZHUHYHU\PHPRUDEOH The group as a whole practised assiduously and it says much for the commitment of the 23 E and )WHDPSOD\HUVZKRZLWKQRFKDQFHRIDJDPHLQWKHODVWIL[WXUHWXUQHGRXWIRUWKHODVWSUDFWLFH RIWKHVHDVRQ&RQWUDVWWKDWWRWKHSOD\HUVZKRVWDUWHGWKHVHDVRQEXWGLGQ WHQGLWSOD\LQJ, think they missed far more than they possibly gained. 7KH$WHDPKDGDYHU\JRRGVHDVRQPDWXUHO\DQGLQVSLUDWLRQDOO\OHGE\-DGHGH%UXLQ8QGHUKLV leadership the talented backline developed into a potent force both defensively and offensively with all players having good seasons. He and his fellow backs nearly snatched victory from defeat at Westville. I have high expectations for the future if these boys continue to develop at the rate WKH\GLGWKLVVHDVRQ$OOJRWRQWKHVFRUHVKHHWUHJXODUO\EXWSULGHRISODFHDVWRSWU\VFRUHUJRHV WR6LKOH1NRVLZKRZDVDOZD\VGDQJHURXVZLWKWKHEDOOLQWKHKDQGJRLQJIRUWKHFRUQHU/HVVVR when chipping ahead or cutting inside too early. The A Team forwards did not inspire a lot of confidence at the VWDUWRIWKHVHDVRQEXW they surprised with their commitment and development and at season's end were only outplayed in the first half of the game against Westville. They scrummed effectively and their lineouts were secure. Following the example of their captain they developed into a very effective unit at the SRLQW RI EUHDNGRZQ PDLQO\GXHWRWKHPLGILHOGSOD\HUVDQG0RWKDVL6KXSLQJ7KHORRVHWULRZDVH[FHSWLRQDOO\WDOHQWHG and the front row solid with touches of genius from Mentor. Vincent Jobo can be very satisfied with his exemplary leadership of the pack and effective general play. Specifically the team only had WZREDGKDOYHVDOOVHDVRQ7KHILUVWKDOIDJDLQVW6W6WLWKLDQVZKHQWKH\ORVWIRFXVDQGWKHILUVWKDOI DJDLQVW:HVWYLOOH SHUKDSV D OHJDF\ RI WKH WUDLQ MRXUQH\ $JDLQVW 6W 'DYLG V WKH\ ZHUH DZHVRPH  The hallmark of this team was the unfailing close support of the ball carrier which was ultimately their greatest strength. It is to the player's credit that they managed to curtail the indiscipline that crept into their game at mid-season and by the end of the season the penalty count in matches was something like 50/50. 200


7KH%7HDPKDGDQH[FHOOHQWVHDVRQXQWLOWKHEHJLQQLQJRI-XQHZKHUHDIWHUWKH\FRQWULYHGWRORVH their last three games. They were the authors of their misfortune by falling into the trap of trying to play the opponent's type of game against both Pretoria and Westville. Despite their performance DJDLQVW%HXOLHXDQG-HSSHWKH\GLGQRWKDYHWKHSDFNRIIRUZDUGVWRDFFRPSOLVKWKDW7KHLUVWUHQJWK ZDV RXW ZLGH WKHLU JDPH SODQ ZDV WR VSUHDG LW ZLGH :KHQ WKH\ GLG QRW WKH\ FRXOG ORRN YHU\ RUGLQDU\,QWKHODVWJDPHWKH\VXIIHUHGDFRXSOHRIXQNLQGUHIHUHHGHFLVLRQVEXWWKH\FRPSRXQGHG WKHLUSUREOHPZLWKDOHWKDUJLFKDOISODFHGSHUIRUPDQFHWKDWGLGWKHPQRMXVWLFH$VPHQWLRQHGWKH wings were good offensively and I expect much in the future from McDonald and Kurensky in the backline and Gussenhoven and Pereira amongst the forwards. The A and B players benefitted from the conditioning programme they participated in. Their ILWQHVVDQGDELOLW\WRWDNHWKHKDUGNQRFNVZDVDIHDWXUHRIWKHVHDVRQ,QMXULHVLQWKHJURXSZHUH inconsequential. Two of the C Team's losses were to A Teams of the opponents. The team had a potent backline in all seven positions with the forward pack not far behind. A pleasing set of results flowed from the combination. Many of the players only lack playing experience or physique. When they catch XSWRWKHLUSHHUVWKHOLNHVRI/HZLV2RVWKX\VH*DUUXQ/HXQHUDQG:HQW]HOFDQORRNIRUZDUGWR pressurising for positions in the higher teams in future seasons. The same applies to the D team with one of their losses to an A team. Significantly injuries were far more frequent and severe in this group who did not have access to the conditioning programme due to limited equipment. 7KH ORW RI DQ ( DQG ) WHDP SOD\HU DW .LQJ (GZDUG LV QRW D KDSS\ RQH  ,QIUHTXHQW JDPHV QHDUO\ DOO DJDLQVW KLJKHU UDWHG WHDPV RI WKH RSSRQHQWV WRJHWKHU ZLWK DQ XQVHWWOHG WHDP DIIHFWHG E\ unavailability and injuries and sicknesses in the higher teams. Nevertheless the 2005 boys stuck to LW7KH(7HDP VILQHVWKRXUZDVDYLFWRU\RYHUWKH5RRVHYHOW3DUN$7HDPDQGWKHLUSRRUHVWDJDLQVW DQRWKHU$WHDPIURP&RUQZDOO+LOO7KH\ZHUHQHYHUGLVJUDFHGXQOLNHWKH)7HDPWKDWPDQDJHGWR implode under the pressure of the St John's Prep School's first team. As mentioned earlier in my report I admired the commitment of this group of players to the game and the practices. Well played and many of you can aspire to higher teams in future seasons with this spirit and dedication. Under 14 is just the beginning. Bryan Habana started his rugby in the E team at this school nine short years ago. Look where he is now. 0\WKDQNVJRWR0HVVUV7KRUQHGX3ORR\7DVKH7VKDEDQJXDQG&DOH\IRUFRDFKLQJDQGLQVSLULQJWKH SOD\HUV7KHDJHJURXS VSDUHQWUHSUHVHQWDWLYH0U0H\HUDQGDOOWKHRWKHUSDUHQWVZKRSURYLGHG responsible and positive support for the players both at home and away. The Grounds staff under 0U0DWWKHHWKHUHIHUHHVWKH0RWKHU V&RPPLWWHHDQGWKH)LUVW$LGHUV But mostly to you the players A: 2ZXVX 0HQWRU &DOLW] 1RIDO .XQQHNH 6KXSLQJ -RER 9LFH&DSWDLQ  0\EXUJ 3DLG &ULFKWRQ GH%UXLQ &DSWDLQ 0H\HU1NRVL0ZDOHDQG:HOOV B: :K\WH +RQH\ 9LFH&DSWDLQ  3HUHLUD *XVVHQKRYHQ 2DNHV 2YHUWRQ 0DUWLQV 0RQWJRPHU\ +RSJRRG %HUUDQJH .XUHQVN\ &DSWDLQ  /HHXZ 0F'RQDOG &RWWHU 0RMD YDQ :\QJDDUGW DQG Mhkize. C: (GG\ 2RVWKX\VH GD &RVWD7DUU7URPS 'DGH /HZLV &DSWDLQ  *DUUXQ /HXQHU 9LFH&DSWDLQ  5HWLHI:HQW]HO6LQJR5DELQGD1NZHDQG0DWODNXOX 201


D:6]HQGHL0DEDVR'LVPRU1DLGRR2WWR &DSWDLQ *RUGRQ-DQVVHQV0RUULV2VERUQ6WHLQKREHO /HNJDQ\DQH 0ROHIH &KDONHQ &URVV 0RORW 1RUWRQ 'HDFRQ (VWHUKXL]HQ 1JZDQH '\HUV 9LFH Captain) and Matlala. E:0DKDUDM%UDFN7D\ORU&URVOH\-DQVHYDQ5HQVEXUJ/RZHGX3OHVVLV=DPEHWWL)DUUHU1HZPDQ %HFNHWW0RNRHQD0DVHNRYDQ:\QJDDUGWDQG0DELWVHOD F:3XUEKRR0XOOHU/HJJHWW0F$UWKXU.JDIHOD.XSD0DVRJD0ROHSD0RWDSDQ\DQH0S\DQD5\DQ 1RUWRQ1HZPDQ1HZPDQ6WDSOHWRQ6FKDOOHQ<DQJX\D%ODFNEXUQ&ROODUG+DUULV3DOPHU-HQQLQJV /HWKHR0NKZDQD]L0ELVKH6LJDPRQH\0RSKRVRDQG,GOH Mr J Faber Results:

202


First Team Squash 2005 Front Row (left to right):

:'DQLHOV'6ODZVRQ0'XQQ

Back Row (left to right):

'5XVVHOO$%RWKZHOO6.XEKHND-+D\QHV6PDUW 203


Squash

Coach: Master in Charge: Captain:

Mr D Hendriks Mr E Marx DJ Slawson

The 2005 season has been a hugely successful one of which the players can truly be proud. For the second consecutive year the First Team has won both the Gauteng league as well as the Gauteng 7RS6FKRROVWRXUQDPHQWDIWHUZKLFKWKH\UHSUHVHQWHG*DXWHQJDWWKH6$7RS6FKRROVWRXUQDPHQW DW(SZRUWK3LHWHUPDULW]EXUJ$WWKLVSUHVWLJLRXVWRXUQDPHQW.LQJ(GZDUGHQGHGWRSRIWKHLUJURXS EXWXQIRUWXQDWHO\ORVWERWKWKHQH[WWZRSOD\RIIPDWFKHVFDXVLQJWKHPWRHQGDUHVSHFWDEOHWK place overall.

St Andrewâ&#x20AC;&#x2122;s Squash Festival Coaches: Captain: Manager:





.'RXJKHUW\'+HQGULFNV DJ Slawson Mr E Marx

.LQJ(GZDUG9,,6FKRRO)LUVW6TXDVK7HDPWRRNSDUWLQWKHWK6W$QGUHZ¡V6FKRRO6TXDVK)HVWLYDO from Friday 11 February to Sunday 13 February 2005 in Bloemfontein. We left School at 07:30 on Friday morning and arrived back at School on Sunday afternoon at 15:30. 7KH WHDP ZDV DFFRPPRGDWHG LQ WKH ERDUGLQJ HVWDEOLVKPHQW DW 6W$QGUHZ¡V 6FKRRO DQG DOO WKH boys behaved exceptionally well on and off the squash court. During some matches their patience ZDV UHDOO\ WHVWHG E\ VRPH YHU\ SK\VLFDO SOD\ E\ WKHLU RSSRQHQWV EXW WKHLU EHKDYLRXU ZDV DOZD\V exemplary and true to King Edward tradition. 2QDUULYDOZHZHUHVXUSULVHGE\WKHWHDP¡VSUHYLRXVFRDFK.\OH'RXJKHUW\ZKRDWWHQGHGDOORXU matches and guided the players through their matches. He was very impressed by their improvement DVKHKDGODVWVHHQWKHPSOD\GXULQJ,WLVREYLRXVWKDWWKHQHZFRDFK'HYLQ+HQGULFNVKDV done a great job in preparing them and that the boys have grown into stronger competitors. Our first match was scheduled against Menlopark HoÍrskool at the Virgin Active Gymnasium. +RZHYHUZHZHUHQRWDOORZHGWRHQWHUWKHJ\PQDVLXPDVSDUHQWDOSHUPLVVLRQPXVWEHJLYHQIRU entry into a gymnasium. Our School indemnity forms were produced but turned down. Eventually the match got underway at the Municipal courts and we promptly beat a slightly cocky Menlopark team 4/2. A great effort considering the fact that they beat us 6/0 last year.Wesley Daniels performed well by beating the number 8 u/19 player in South Africa. Our second match of the evening saw us beating Dale College 5/1. This was a toughly contested PDWFKLQWUXH%R\V¡6FKRROWUDGLWLRQ Saturday morning proved a difficult time to play as the players were tired and not yet fully rested. ,Q D WRXJK PDWFK ZH WLHG WKH PDWFK  DJDLQVW 3UHWRULD %R\V¡ +LJK 6FKRRO %WHDP RQO\ WR ORVH RQ QXPEHU RI JDPHV ZRQ  2Q 6DWXUGD\ DIWHUQRRQ ZH SOD\HG DJDLQVW:\QEHUJ %R\V¡ +LJK 204


RQDJODVVFRXUWLQWKH6DQODP3OD]D2QFHDJDLQWKHPDWFKHVZHUHWLHGDOORQO\WRVHHXVORVH RQJDPHVZRQ+RZHYHUWKHKLJKOLJKWVZHUHGHILQLWHO\WKHH[SHULHQFHRIWKHJODVVFRXUWDQG:HVOH\ Daniels beating the number 3 u/16 player in the country. On Saturday evening we attended a formal dinner in the dining hall and the boys enjoyed an evening out. Sunday morning we played against St Charles College from Pietermaritzburg and tied the match 3/3 and 10/10. A true tie indeed! My sincere thanks to Mr White who drove the other car and helped with drinks and general administration. A special word of thanks to Kyle for his unselfish support and help over the weekend. If this is an indication of what we can expect for the rest of the year I am looking forward to an exciting and fruitful season!

Gauteng U/19 Super League At the start of the second term our First Team was ready to perform to their best. The first two matches saw the team play without its regular number 1 as Daniels could not play due to a virus. ,QWKHILUVWPDWFKDJDLQVW1RUWKFOLII'XQQDQG.XEKHNDERWKSOD\HGH[FHOOHQWVTXDVKWREHDWWKHLU opponents in matches where our boys had to play one position up because of injury to Daniels. King Edward won 5/1. The same situation repeated itself in our second match against Westridge where Campbell came in as a reserve to win his match and King Edward won 5/1. 7KH IROORZLQJ WKUHH PDWFKHV SRVHG QR WKUHDW DV 'DQLHOV ZDV EDFN DQG WKH WHDP EHDW (GHQJOHQ %U\DQVWRQDQG6W-RKQ¡V&ROOHJHRQWKHWURW7KHUHVXOWLQHDFKRIWKHVHPDWFKHVZDV 205


Hyde Park showed some form of resistance in our match against them (5/1) while St Stithians posed PRUHRIDSUREOHPSXVKLQJRXUSOD\HUVLQWLJKWPDWFKHV.LQJ(GZDUGHYHQWXDOO\FDPHRXWRQWRS 5/1. 2QFHDJDLQLQWKHUXEEHUDJDLQVW3DUNWRZQ%R\V¡ZKLFKZRXOGGHWHUPLQHWKHOHDJXHZLQQHUVRXU boys played well and King Edward won 5/1; a somewhat flattering score for some hard-fought matches. Florida forfeited the last match of the league season and King Edward had successfully defended our league title. &RQJUDWXODWLRQVWRDJURXSRIER\VWKDWSOD\HGH[FHOOHQWVTXDVKDWWHQGHGDOOSUDFWLFHVDQGVXSSRUWHG one another like brothers. Long live the Red Spirit!

Gauteng Top Schools Squash Tournament Coach: Captain: Manager: Players: 





D Hendricks DJ Slawson E Marx :'DQLHOV05'XQQ'-6ODZVRQ6-.XEKHND JC Haynes-Smart and J Hardy

King Edward VII School First Squash Team took part in the annual Gauteng Top Schools Tournament from Saturday 28 May to Sunday 29 May 2005.This is a tournament that determines which school will represent Gauteng at the annual Top Schools tournament in Pietermaritzburg. King Edward entered a team that was a little under strength as two players were injured at the time. In the first match we played against Northcliff High School and won 19/4. The second match was played against Hyde Park and King Edward won 18/3. St Stithians did not pose a threat either as we won the third match 17/3. 7KHODVWDQGGHFLGLQJPDWFKZDVDJDLQVW3DUNWRZQ%R\V¡$IWHUIRXUPDWFKHVWKHUXEEHUZDVWLHGDQG the result of the Top School tournament was up to the last match. Daniels was up against a player 206


KHKDGQ¡WEHDWHQLQWZR\HDUVDQGZDVVRRQGRZQJDPHVWRQLODQGSRLQWVWRQLO,WZDVWKHQWKDW we watched the biggest come back of the year. Daniels slowly clawed his way back to 2/2 and with the match delicately poised at 7/7 in the last game tensions ran high. He eventually won the 5th game ZKLFKVHFXUHG.LQJ(GZDUGWKH7RS6FKRROV¡WURSK\LQ*DXWHQJDQGDWULSWR3LHWHUPDULW]EXUJ ,WLVREYLRXVWKDWWKHFRDFK'HYLQ+HQGULFNVKDVGRQHDJUHDWMRERQFHDJDLQLQSUHSDULQJWKHER\V for this prestigious tournament and our appreciation and heart-felt thanks go out to him for a job well done!

Top Schools Squash Tournament Report Coach: Captain: Manager: Players: 



D Hendricks DJ Slawson E Marx :'DQLHOV05'XQQ'-6ODZVRQ6-.XEKHND'5XVVHOODQG AD Bothwell



King Edward VII School First Squash Team took part in their second consecutive Top Schools Tournament from Friday 5 August to Tuesday 9 August 2005 held at Epworth in Pietermaritzburg.This is a tournament in which the top squash schools in each of the 9 USSASA regions take part. We left School at 07:45 on Friday morning and arrived back at School on Tuesday evening at 19:30. The team was accommodated in the boarding establishment at Epworth and all the boys behaved exceptionally well on and off the squash court.They were congratulated on their behaviour and dress E\7RXUQDPHQW'LUHFWRU0UV6DOO\:KLWH'XULQJVRPHPDWFKHVWKHLUSDWLHQFHZDVUHDOO\WHVWHGE\ VRPHYHU\GXELRXVFDOOVE\WKHLURSSRQHQWVEXWWKHLUEHKDYLRXUZDVDOZD\VH[HPSODU\DQGWUXHWR King Edward tradition. On arrival we were shocked to find ourselves in the Group of Death as we were paired with Wynberg %R\V¡:HVWYLOOH%R\V¡DQG4XHHQV&ROOHJH$OOWKHVHVFKRROVKDGEXLOWDUHSXWDWLRQDVRXWVWDQGLQJ squash schools at the previous Top Schools tournaments and at Inter-Provincial tournaments. 207


2XUILUVWPDWFKZDVVFKHGXOHGDJDLQVW:\QEHUJ%R\V¡+LJK6FKRRODWWKH9DUVLW\FRXUWV7KHWHDP was given momentum by reserve player Bothwell who promptly won his match 3/1. This eased the nerves of the other players and our team went on to beat Wynberg by 3 matches to 2; resulting in a match score of 15 points to 8. Dunn (no. 2) and Russell (no. 5) were impressive with their wins in which they did not concede a game. A great effort considering the fact that Wynberg beat us earlier LQWKH\HDUDWWKH6W$QGUHZ¡V)HVWLYDO Saturday afternoon provided a bye and the boys enjoyed an afternoon of leisure at the beach; watching the Springboks upset the All Blacks at Newlands and impressing the girls of Highlands North who accompanied them during the afternoon. 2XUVHFRQGPDWFKRIWKHWRXUQDPHQWVDZXVSOD\LQJODVW\HDU¡VUXQQHUVXS4XHHQV&ROOHJH7KLV time it was Kubheka (no. 4) and once again Russell who won without conceding a game. With only 1 player losing a match King Edward won the rubber 4/1; giving us 18 points to 5. A great win for our young team! Sunday afternoon proved a difficult time to play as the players were tired and the unexpected heat RI3LHWHUPDULW]EXUJVWDUWHGWRWDNHLWVWROO,QDWRXJKPDWFKDJDLQVW:HVYLOOH%R\V¡+LJK6FKRROZH saw Daniels (no. 1) dig deep to beat the South African u/19 no. 3 player 3 games to 0. Russell once again scored an impressive victory of 3/0 and Kubheka started a 47 point run in which he did not ORVH D VLQJOH SRLQW ZLQQLQJ  DIWHU FRQFHGLQJ WKH ILUVW  SRLQWV RI WKH PDWFK 0RQGD\ PRUQLQJ provided some breathing space as King Edward cruised to a 5/0 and 20 games to 2 victory over .LPEHUOH\%R\V¡+LJK6FKRRO$OORXUSOD\HUVH[FHSW'DQLHOVPDQDJHGWRZLQDJUHDWUHVXOWWKDW VHFXUHG.LQJ(GZDUGWKHILUVWSRVLWLRQLQ3RRO7KH:LWQHVVORFDOQHZVSDSHULQ.ZD]XOX1DWDO rightly described the heroics of our team as follows: "Giant-killers King Edward (Gauteng) will play Wynberg (Western Province) for a berth in the finals." Even though they had their teams wrong ²ZHZHUHVFKHGXOHGWRSOD\6W$QGUHZ¡V%ORHPIRQWHLQLQWKHVHPLILQDOV²RXUER\VVXUHO\ZHUH giant killers! 7KH VHPLILQDO DJDLQVW 6W$QGUHZ¡V 6FKRRO SURYLGHG VRPH H[FLWLQJ DQG QHUYHZUDFNLQJ PRPHQWV Our middle order could not sustain their outstanding form that took us into the semi-finals and at 2 games all in the third tie Slawson finally succumbed to his opponent and lost a long and hard-battling match 2/3. Russell won his match in usual fashion and Daniels provided another upset in beating the South African u/16 no. 2 player 3/2. Our team went down 2/3 in the semi-finals to a more disciplined DQGOHYHOKHDGHG6W$QGUHZ¡VWHDP7KHJLDQWNLOOHUVKDGUXQRXWRIDPPXQLWLRQ 2QWKHILQDOPRUQLQJZHRQFHDJDLQSOD\HGDJDLQVW:\QEHUJ%R\V¡+LJK6FKRROIRUWKHQRVSRWDW WKH7RXUQDPHQW7KHRUGHURISOD\ZDVFKDQJHG\HWRQFHDJDLQZHZHQWXSLQPDWFKHV5XVVHOO and Kubheka doing what they do best; demolishing the opposition. In surely the most heart-breaking PDWFKRIWKH7RXUQDPHQWIRU.LQJ(GZDUG'DQLHOVORVWWRWKHQRXSOD\HULQWKHFRXQWU\ JRLQJ GRZQ   DQG  LQ DQ H[FLWLQJ PDWFK WKDW SURYLGHG VNLOO ILQHVVH DQG RXWULJKW JXWV Wynberg eventually won the final tie to secure third place with a match score of 3/2. ,IDQ\RIRXUSOD\HUVZHUHRIIHUHGDIRXUWKSODFHILQLVKDWWKHEHJLQQLQJRIWKH7RXUQDPHQWWKH\PRVW SUREDEO\ZRXOGKDYHWDNHQLWDVDERQXV+RZHYHULQUHWURVSHFWRXUER\VSOD\HGVXSHUEO\DQGZHUH slightly unfortunate not to play in the final. In the end it proved a bridge too far but provided enough motivation for a tremendous effort next year. We have tasted victory but shall not rest until we have DFKLHYHGRXUJRDO²WREH7RS6FKRROV&KDPSLRQLQ6RXWK$IULFD 208


,WLVREYLRXVWKDWWKHFRDFK'HYLQ+HQGULFNVKDGGRQHDJUHDWMRERQFHDJDLQLQSUHSDULQJWKHER\V for this prestigious tournament and our appreciation and heart-felt thanks go out to him for a job well done! My sincere thanks go out to Mr White and Mr Russell who drove the other cars and helped with drinks and general administration. A special word of thanks to our boys who were true ambassadors RIRXU6FKRRODQGWKHSULGHRI*DXWHQJ7KDQN\RXWRRXUFDSWDLQ6ODZVRQIRUKLVOHDGHUVKLSDQG support during the weekend. If this is an indication of what we can expect from squash in the next few years it is going to be an exciting ride!

Grey College Squash Festival Coach: Captain: Manager:

D Hendricks W Daniels Miss J Aires

The First Squash Team rounded off their exciting and highly successful season by taking part in the Grey College 150th celebrations in Bloemfontein where they performed superbly. They beat all the VFKRROVZKRSDUWLFLSDWHGEDU6W$QGUHZ¡V6FKRRO%ORHPIRQWHLQ,QWKHPDWFKDJDLQVW6W$QGUHZ¡VWZR of the matches were decided in the fifth and last games. 209


'DQLHOV ZRQ DOO KLV PDWFKHV DW QXPEHU  WKH RQO\ WRS UDQNHG SOD\HU WR EH XQGHIHDWHG IRU WKH tournament! What was especially pleasing was the phone call our School received from Grey College commending the boys on their exceptional behaviour and dress during the festival. Well done to our players and especially Miss Aires who accompanied the First Team. A special word of thanks must go to Old Edwardians for allowing our School to make use of their excellent facilities during the year with a special mention to Anne Pratt who is always on hand to help and assist. The following boys were selected to represent Gauteng at the annual IPT Tournaments: MR Dunn u/19B no 1; DJ Slawson u/19B no 2; SJ Kubheka u/19B no 3; W Daniels u/16A no 1 and D Russell u/16A no 3 (Easterns). National selection: W Daniels SA u/16 no 5 School awards were given to the following players: 2004 Position: Colours Team Blazer

DJ Slawson W Daniels

New Awards 2005: Team Blazer

MR Dunn

Mr E Marx

210


Soccer

Masters in Charge: Coach: Captain:

Mr N Groenewald & Mr S Parseramen Mr K Peyper J Motsamai

7KLVVRFFHUVHDVRQZDVDWXUQLQJSRLQWIRUVRFFHUDWWKHVFKRRO/DVW\HDUZHTXDOLÀHGIRUERWKWKH *UH\%ORHPIRQWHLQÀQDODQG6W'DYLG·V,QDQGDUHVSHFWLYHO\EXWORVWRXWRQSHQDOWLHV+RZHYHUDIWHU DORQJDQGVHULRXVWDONZLWKWKHSOD\HUVWKH\UHDOLVHGWKDW.LQJ(GZDUG9,,6FKRRO·VUHSXWDWLRQZDV DWVWDNH7KXVLQWKH6W'DYLG·V,QDQGD7RXUQDPHQWZHPHWLQWKHVHPLÀQDOVDW1RUNHP3DUNDQG LWZDVDWKULOOHU6FRULQJÀUVWZHJUHZPRUHUHOD[HGDVWKHPDWFKSURJUHVVHG7KLVGLGQRWGHWHU 1RUNHP3DUNDQGMXVWWZRPLQXWHVEHIRUHWKHÀQDOZKLVWOH6LPRQV²DUHSODFHPHQWNHHSHU²SXOOHG off a spread-eagle one-on-one save! ,QWKHÀQDOVZHVWHSSHGXSDJHDUDQGSHUIRUPHGLQWUXH.LQJ(GZDUGVW\OH,QWKHÀUVWKDOIZH SUHVVXULVHGRXURSSRQHQWVDQGLQUHWXUQVFRUHGWZRJRDOV+RZHYHUWKH\UHVSRQGHGLPPHGLDWHO\ *RLQJLQWRWKHVHFRQGKDOIZHJDLQHGFODULW\DQG0RWVDPDLWKHFDSWDLQVFRUHGDEOLVWHULQJJRDOORZ SDVWWKHNHHSHU7KHÀQDOZKLVWOHEOHZZLWKWKHVFRUHOLQH.LQJ(GZDUG6W'DYLG·V,QDQGD

Cup Games( North Rand Cup) 7KLVZDVRXUÀUVWWLPHSOD\LQJLQWKH1RUWK5DQG'LVWULFWJLYLQJRXUVFKRRODQRSSRUWXQLW\WRSOD\ IRU*DXWHQJ2XUÀUVWFKDOOHQJHZDVDJDLQVW6DQGULQJKDP7KH\VFRUHGÀUVWEXWZHZRXOGQRWEDFN GRZQ$IWHUDMLWWHU\VWDUWZHHYHQWXDOO\VFRUHGE\SOD\LQJFRQVWUXFWLYHVRFFHUDQGÀQGLQJWHDPPDWHV ZLWKFULVSSDVVLQJ7KHPDWFKHQGHG7KHVHFRQGURXQGZDVDJDLQVW*OHQYLVWDZKLFKZHZRQ ,QWKH´VHPL·VµZHORVWWR+LJKODQGV1RUWKWKHHYHQWXDOZLQQHU1RQHWKHOHVV6HLWDVFRUHG WKHEHVWJRDORIWKHVHDVRQRQHPHWUHDZD\IURPWKHFRUQHUÁDJFXUOLQJLQDVXSHUEVWULNHIRROLQJ the keeper and players (and possibly himself). )LQDOO\DVD6FKRROZHZRXOGOLNHWRWKDQN0U3H\SHUIRUKLVXQVHOÀVKFRQWULEXWLRQVWRWKHÀUVWWHDP $OVRDZRUGRIWKDQNVWR0HVVUV3DUVHUDPHQ6LOLPD0EHOHDQGVWXGHQWFRDFKHVIRUKHOSLQJDQGDV sisting the different teams.

212


Colours were awarded to : <4ZDEDVD.6HLWD66LPRQVDQG7/HJDH Team Blazers were awarded to :  : %URZQ ) GD 6LOYD 0 - 0EX\D 6 0QJRPD7 0RUXGX     00RVHODNJRPR$1NRVLDQG.53H\SHU Results :  

Played 

won 

lost 

drew 

percent 

Mr N Groenewald

First Team Soccer 2005 Front Row (left to right):

PGD&RVWD0U1*URHQHZDOG<4XDEDVD0U.3H\SHU &RDFK  -0RWVDPDL &DSWDLQ 0U63DUVHUDPHQ 0DQDJHU .3H\SHU

Back Row (left to right): 

00EX\D70RUXGX6$FKDU\).DODPXOD66LPRQV:%URZQ .6HLWD7/HJJDH$YDQ+HHUGHQ00RVHODN\RPR61JRPD A Nkosi

213


Swimming

Educator in Charge: Coaches: Captain:

Miss J Kyte Mr P Ogier & Miss J Aires C Watt-Pringle

The swimming team of 2004/2005 enjoyed an earlier than usual pre-season start. This was made possible by having a heated pool. Once again the team showed courage and heart in the face of a challenging time. Results achieved throughout the season were inconsistent as we experienced both wins and losses against our closest rivals. The strength of the A team lies within the freestyle relays which were won across all age groups at most of the Gauteng meetings. The B team continued to be successful this season emerging amongst the top of their league. Winners of Championship trophies in 2005 Senior Championship Trophy Junior Championship Trophy 200m Championship Freestyle Trophy 100m Breaststroke Championship Trophy 400m Championship Trophy 100m Freestyle Championship Trophy 100m Open Backstroke Trophy 200m Breaststroke Championship Trophy 100m Butterfly Championship Trophy Individual Medley Championship Trophy 200m Backstroke Championship Trophy

C Watt-Pringle G Tune C Watt-Pringle C Watt-Pringle G Tune C Hutchinson C Brand C Watt-Pringle C Watt-Pringle B Borsboom C Brand

Swimming continues to produce both provincial and national representatives. A special mention must go to Garth Tune for his outstanding performance. He broke the South African records for the 50m and 100m Backstroke as well as the 100m Butterfly record which had stood since 1986. Garth has been selected to participate with some of the best swimmers in South Africa in the Mare Nostrum Swimming Tournament in Spain and France as well as in Canada. Team Blazers were awarded to:7%UHZHU%%RUVERRP90H\HU00XOOHU02YHUWRQ.3DUNLQ and G Tune. $VSHFLDOWKDQNVJRHVWR0UV(YDQVWKHPRWKHUVVWDIIPHPEHUVDQGFRDFKHVZKRVXSSRUWHGWKH team as well as to all the swimmers who put in hours of effort and training. Miss J Kyte

215


Table Tennis

Master in Charge: Coach: Captain:

Mr N Groenewald Ms N Pennell M Ismail

,PSURYLQJ RQ ODVW \HDU·V UHVXOWV ZDV D UHDO FKDOOHQJH (YHU\ SUDFWLFH VHVVLRQ ZDV FRQVLGHUHG D SHUVRQDO PLOHVWRQH7KH WHDP·V DWWLWXGH DQG PLQGVHW ZDV LQ DOLJQPHQW ZLWK WKHLU JRDOV7KLV ZDV reflected in the consistent performance they achieved during the Third term. Looking at their overall results it reflected their willingness to win. ,QGLYLGXDOO\0DXYLVUDQNHGQXPEHURQHVKRXOGEHFRQVLGHUHGDSOD\HUWKDWZLOONHHS.LQJ(GZDUG·V QDPHKLJK)LUVWO\KHLVQRWDJJUHVVLYHEXWLVYHU\SDWLHQWZKHQKHSOD\VDJDLQVWKLVRSSRQHQWV, ZRXOGGHVFULEHKLVVW\OHRISOD\DVGHIHQVLYHVHWWLQJXSDOORSSRQHQWVLQSOD\LQJDSUHSODQQHGPRYH )XUWKHUPRUH3DWHODQG,VPDLODOVRLPSURYHGFRQVLGHUDEO\SOD\LQJWKHIRUHDUPVKRWDQGWDFWLFDOO\ outsmarting their opponents. The team played very well together and planned every move against their opponents. The number one ranked player would first play their number 3 ranked player. Against King David Linksfield and .LQJ'DYLG9LFWRU\3DUNWKHWHDPQDUURZO\ORVWUHVSHFWLYHO\+RZHYHUDJDLQVWWKHRWKHUWHDPV they won by far showing their collective improvement. )LQDOO\DZRUGRIWKDQNVWRWKHFRDFK0V13HQQHOOIRUKHUFRQWULEXWLRQDQGFRPPLWPHQWGXULQJ the course of the term. Colours: Team Blazers:

M Ismail and O Patel Y Carrim and A de Freitas

Inter House Competition:

Hill House

School Championship:

E Mauvis

Mr N Groenewald Team results:

217


Tennis

Educator in Charge: Captain: Coach:

Mrs M Thorne R Machlachan Mr J Nel

$VHDVRQRIH[WUHPHKLJKVDVZHOODVORZV7KHVHDVRQVWDUWHGRIIEDGO\IRUWKH)LUVW7HDPILUVWO\E\ losing our number one Carl Kushka to the Tennis Academy and subsequently being relegated to the VW/HDJXHIURPWKH3UHPLHU/HDJXH+RZHYHULQWUXHœ5HG¡IDVKLRQWKHER\VERXQFHGEDFNE\GRLQJ ZHOOLQWKH3UHWRULD3UHPLHU/HDJXHJRLQJRQWRXUDQGHQGLQJWKH\HDUE\ZLQQLQJWKHVWOHDJXH against determined opposition to regain our position in the premier division.

First Term 2005 :H VWDUWHG EDGO\ DQG ORVW WR WHDPV ZH VKRXOGQ¡W KDYH 7KH WHDP WRRN WKH ORVV RI WKH QXPEHU RQH SOD\HU EDGO\ EXW \RX DUH MXVW DV JRRG DV \RXU GHSWK  1R H[FXVHV  ZDV WKH PRWWR DQG KLV replacement was more than competent. The early losses to opposition that we should have beaten took its toll and we struggled through the season winning only one of six games. The losses that we suffered during the season put us at tie last place with St John's and due to a VXSHULRUJDPHGLIIHUHQFH6W-RKQ VVWD\HGXSDQGZHZHUHUHOHJDWHGWRWKHVWOHDJXH7KLVZDV unfamiliar territory for us and the team took it badly. However we put it aside and looked forward WRWKHœEUHDN¡GXULQJWKHZLQWHUDQGZHUHORRNLQJIRUZDUGWRULJKWLQJWKHZURQJVLQWKHIRXUWKWHUP and fighting our way back to the premier league. The results from the first term were as follows:

Result: Relegated to First League

Second and Third Term 2005 There is only one constant in life and that is change. For the first time King Edward VII was allowed to play in winter during the rugby and hockey season. This had to happen in order to keep up with the rest and in order to get back into the premier league we had to start taking tennis seriously. We ZHUHLQYLWHGLQWRWKH3UHWRULD3UHPLHU/HDJXHDIDUVWURQJHUOHDJXHWKDQWKDWRIWKH-RKDQQHVEXUJ league. We put our setbacks behind us and moved forward. We were not going to lie down. We went into the league and equipped ourselves well. We were only outplayed once and that was against 218


+LJK6FKRRO:HPDQDJHGWRGRZHOODQGEHDWWZRVLGHVRQHRIWKRVHVLGHVZDV6W'DYLGVZKRP ZHWKUDVKHGDQGDVOXFNZRXOGKDYHLWWKH\UHSODFHGXVLQWKHSUHPLHUOHDJXH Not only did we play in the Pretoria league but we 'piggy backed' on the Rugby and Hockey tours to Durban where we as a First Team were able to share a bit in the limelight and travel with the larger sporting codes. Here we played the Durban Schools and managed to win two of the three fixtures WKDWZHSOD\HG$JDLQEUHDNLQJQHZJURXQGE\SOD\LQJLQZLQWHUDQGWRXULQJZLWKWKHœ5HGV¡

Third and Fourth Term 2005 Playing in the 1st league was new territory for us and every team was hungry to win for promotion into the premier. Were we able to lift ourselves after our disappointing first term? The games started off well and it looked as though it was going to be a breeze. However we underrated Parktown Boys' and squeaked home by the narrowest of margins. We now realised that this was not going to be easy and the first two easy victories were misleading. Northcliff were our next opponents who had a good season and were also looking to move on up. After closely tussled games we again showed great character and clinched another narrow victory. We were then off to Pretoria to play an Affies second team who have not lost in three years.

First Team Tennis 2005 Front Row (left to right): 

50DFKODXJKOLQ05RSHU

Back Row:

J Alfred-Smith 219




were unbeaten and had swept all opposition in front of them away. Winning was a tough ask and we NQHZZHKDGWRGRLWWKHTXHVWLRQZDVFRXOGZH"7KHER\VFDPHRXWILULQJDQGZHPDQDJHGWR beat them by a bigger margin than we expected. The boys dug deep and gave of their best. 7ZRGD\VODWHUZHZHUHRIIWR6DKHWLIRURXUODVWPDWFKDQRWKHUZHKDGWRZLQLQRUGHUWRJHWEDFN into the top flight. That we did with ease and the boys can hold their heads up high after some great games and matches. It was a long road to get back into the Premier League but with hard work in the winter season the boys did it in true King Edward fashion. The results are as follows:

Result: VWSODFHLQ)LUVW/HDJXHSURPRWLRQWR3UHPLHU/HDJXH Colours: R Machlachlan. Team Blazers:  05RSHU-$OIRUG6PLWKDQG/+DUULV 2XUWHDPVIDUHGYHU\ZHOOWKLV\HDU$OOWHDPVPDQDJHGWRVWD\LQWKHLUOHDJXHVDQGIRXUWHDPVZHQW up a league. Every boy who made the effort to be at practice and to represent the school has made me so SURXG.HHSXSWKHHQWKXVLDVPNHHSXS\RXUVSLULWDQGQHYHUORVHWKHHQMR\PHQWRIWKHJDPH,W LVHQFRXUDJLQJWRVHHWKRVHER\VZKRGLGQRWPDNHDWHDPLQWKHEHJLQQLQJRIWKH\HDUUHWXUQLQ the third term to make up our teams. It was very touching to see the number of boys who turned out for practices. )RUWKHILUVWWLPHRXU8ER\VWRRNSDUWLQDWRXUQDPHQWKHOGDW$IILHV7KHER\VKDGLQWHQVH games and did the School very proud. 7KH$QQXDO,QWHU+RXVH7HQQLV7RXUQDPHQWZDVKHOGDWWKHEHJLQQLQJRIWKHWKLUGWHUPDQGZDVZHOO attended. The Senior section was won by Davis and the Junior section by Hill. The overall winner was Davis House. The Junior Championship was between Nic Bester (Gr 9) and Luke Powell (Gr 9). It was a very exciting match that went to 3 sets. Bester managed to save 2 match points against him to go on to clinch the title. The Senior Championship was between the School number 1 and 2 seeds. Richard Maclachlan (Gr 11) and Marc Roper (Gr10). The tennis was of an extremely high standard and both boys exhibited excellent sportsmanship. Congratulations to Roper on winning the match. 220


$ELJWKDQN\RXWRWKHWHDFKHUVZKRKHOSHGPHZLWKWHQQLVWKLV\HDUQDPHO\0LVV6SDLQ0LVV6WHYHQV 0UVOH*UDQJH0UV:DGHHDQG0LVV0DOLQJD0U0DU[ZKRKHOSHGWRFRQILUPDOOPDWFKHV/DVW EXWFHUWDLQO\QRWOHDVWWR0UV((YDQVDQG5RJHU0DEDVDIRUWKHFDWHULQJDQGKHOSZLWKWKHVHWWLQJ up of home matches. 7RRXUFRDFKHV-RKDQ1HODQG1DDV)HUUHLUDDJUHDWELJWKDQN\RXIRUDOO\RXUWLPHDQGHQHUJ\\RX put into our School. The growth in numbers is surely indicative of your expertise and enthusiasm. Mrs M Thorne The following boys played : ..XVKND50DFKODFKODQ05RSHU-$OIRUG6PLWK/+DUULV1%HVWHU%&DPSEHOODQG R Calvert.

219 1


Waterpolo

First Team Water Polo Master in Charge: First Team coach: Second / Third Team coaches:

Mr R Adams Mr P Vanko Mr R Adams and G Venning

First Team 7KHRSHQDJHJURXSZHUHDYHU\HQWKXVLDVWLFJURXSYHU\NHHQWRSOD\PDQ\JDPHVDQGWRVWULYHWR achieve good results. The First Team did a lot of swimming under the regime of 'Peter the Great' who achieved success with all his hard work. One of the problems experienced by the First Team which was evident in the Grey Bloem and First Team tournaments was one of narrow defeats. This was a season that was played with character and with the incumbent youngsters moving into the VLGHWKHIXWXUHIRU.LQJ(GZDUGZDWHUSRORORRNVSURPLVLQJ

First Team Waterpolo 2005 Front Row (from left to right):

'5LPPHU02YHUWRQ%%RUVERRP%5\DQ'2RVWKXL]HQ

Back Row (from left to right):

.5\DQ0&URQMH*:K\WH(%X\V/2RVWKXL]HQ

Absent:



&:DWW3ULQJOH &DSWDLQ &/RQGRQ06WHLQKREHO D Carstens (Vice-Captain) 223


The First Team Festival was once again the ultimate success to round off a promising future that saw victories against tough opposition. Again the parents of water polo need to be congratulated and thanked for their tireless energy in WKHVXFFHVVRIWKLVWRXUQDPHQW²FHUWDLQO\WKHEHVWER\V WRXUQDPHQWLQWKHFRXQWU\ Congratulations to C Watt-Pringle on being awarded full Colours and to all other team members on receiving their Team Blazers. We also need to congratulate T Wheeler who was selected to play in the U19A Gauteng team for the SA Schools Tournament played in December 2004; D Shunn who played for the U19B Gauteng team in the same tournament and B Borsboom who played in the U19C Gauteng team. Congratulations to B Borsboom on being selected as Captain for the 2005/2006 season and to ' &DUVWHQV DV9LFH&DSWDLQ $OVR FRQJUDWXODWLRQV WR % %RUVERRP ' 5LPPHU DQG 0 6WHLQKREHO on being selected for the U19A provincial side to play in Pretoria in December 2005. We also FRQJUDWXODWH'&DUVWHQV%5\DQDQG(%X\VIRUEHLQJVHOHFWHGWRWKH8$SURYLQFLDOVLGHDQGWR L Oosthuizen and G Whyte for being selected to the U17B provincial team. The following boys played : &:DWW3ULQJOH &DSWDLQ &%UDQG'2RVWKXL]HQ&/RQGRQ%%RUVERRP06WHLQKREHO 02YHUWRQ.5\DQ'5LPPHU*:K\WH%5\DQ/2RVWKXL]HQ0&URQMHDQG7'HQQ\

Second Team 7KH 6HFRQG7HDP ZDV D WHDP RI JUHDW SRWHQWLDO ZKR DFKLHYHG JRRG UHVXOWV EXW ZHUH DW WLPHV disappointing. The motto of the team was one of 'fun under no pressure' and this was portrayed throughout the whole season where the majority of players came from the Grade 12 group who just wanted to play polo and have fun but the talent shown by the team was of a high quality. Some QRWDEOHYLFWRULHVZHUHWKRVHRYHUWRXJKRSSRVLWLRQLQFOXGLQJ6W6WLWKLDQV3UHWRULD%R\V¡+LJK6FKRRO DQG3DUNWRZQ%R\V¡+LJK6FKRRO *RDOVFRUHUVLQFOXGHG66XWKHUODQG0*ORVV*7KRPDVDQG-+DUYH\ The following boys played: *DUHWK7KRPDV &DSWDLQ *UDKDP7KRPDV66XWKHUODQG0*ORVV-+DUYH\5/RQGRQ %:K\WH7%UHZHU'&ROOLQV7%DOODQW\QH'9LULQJ%0F&DQQ'6WRZ0*LOILOODQ.3DUNLQ90H\HU 0*LEVRQ6&OLIWRQDQG-+DPPDQ

Third Team As usual during the first term King Edward is fortunate to put together a Third side who played entertaining polo and also achieved some decent results against their opposition. This group of players always ensure that there is always a strong open side with loads of talent to filter through. The following boys played: - 0DSKLND 5 &URPHU:LOVRQ - /LWKJRZ / 6DOPRQ * :ULJKW  69RV '9DUHWWD 1 'HDOH DQG C Herholdt. Mr R Adams 224


U14 Water Polo Master in Charge: U14A Coach:  U14B/C Coach:



Mr P du Plooy .2¡%UHLQ G Shields

A Team At the end of 2004 we had to say farewell to Scott McHendrie who was the coach for the last 4 years and who imparted invaluable skills to all who were fortunate to come under his wing. We are going to really miss his knowledge and the skills that he imparted over the years. 7KDQNIXOO\ZHZHUHIRUWXQDWHWRKDYHDQHTXDOO\WDOHQWHGFRDFK.HYLQ2¡%UHLQZKRWRRNWKH$VLGH and groomed them to such skill that they ended runners up in the Ken Short Tournament as well as ending First in the Gauteng U14A Tournament. In fact the side had a really successful term by not losing any games in their regular fixtures. A remarkable feat. This bodes really well for the future of the sport in the years to come. We look forward to the 4th term and a good result in the Grey Bloem Tournament. Due to this success we have entered 11 of the squad to participate in the Gauteng trials to represent the province in the SA Schools Tournament at the end of the year. We also need to congratulate G Prout who was selected to play in the U14A Gauteng team for the SA Schools Tournament played in 'HFHPEHU'%LDQQLZKRSOD\HG for the U14B Gauteng team in the same tournament and L Letshabo and L Mvulane for playing in the U14C Gauteng team. Congratulations to J de Bruin for been selected to the U15B provincial side. The following boys played: - /HZLV - GH %UX\Q 7 :KLWH ' :K\WH 3 1HZPDQ . GD &RVWD * 0F&DQQ * 0RQWJRPHU\ '2YHUWRQ65\DQ'6WHLQKREHODQG-.XUHQVN\

B Team The B team had a mixed season but again with a lot more practice and hard work the team can only go from strength to strength and we hope that the season ahead will bear fruit. Again the team ZHOFRPHGDQHZFRDFK*UHJ6KLHOGVZKRVKRZHGDORWRIHQWKXVLDVPDQGZKRLPSDUWHGDZHDOWK of skills to the boys. The team had good victories over their opposition. The following boys played: 3&DOLW].0RUULV.GX3OHVVLV/0RUULV*-DQVHYDQ5HQVEXUJDQG$*RUGRQ 225


C Team The school is fortunate to play a C side who are learners that hail from the Preparatory School and who wish to persue a new and exciting sport. The School is now considering offering water polo as an additional sport to the learners and it is because of this that the future of water polo at King Edward looks really promising. The School has already produced players in the likes of C Watt3ULQJOH%5\DQDQGDKRVWRIRWKHUSOD\HUVZKRKDYHEHQHILWWHGIURPVWDUWLQJSRORLQWKHLU*UDGH 7 year. The School is also recognising players with talent and for the first time in 2004 offered full Colours to boys now playing in the A side: D Overton and D Whyte. This group of players always ensure that there is a strong U14 side with loads of talent to filter through. Boys who played for the C team 2005: $ :DWW3ULQJOH 1 5RGGD 3 &XSLGR 5 .OLQWZRUWK 5 &KDOPHUV & %DLUVWRZ - 6SULQJHU DQG G Milasinovich. Mr P du Plooy

226


Editorial Staff

Editor:

Mrs A Meyer

Assistant Editor:

Mrs A Mania

Editorial Committee: (QJOLVK:ULWLQJ

0UV$0H\HU0V60DUYHO0V-$LUHV and Mr J Passmoor

Afrikaans Writing:

Mrs W Groenewald

=XOX:ULWLQJ

0UV11GORYX

Clubs & Societies:

Mrs A Mania

Sport:

Mrs A Meyer and Ms M Tabor

Art:

Ms S Pheiffer

3KRWRJUDSK\

0V07DERU0U*9HQQLQJ0U32JLHUDQG Mr D Stapleton

Typing:

Mrs P Knight

Layout:

Mrs A Meyer and Ms M Lavin

227


Autographs

228


King Edward VII School Magazine 2005