PORTFOLIO PANJI DIWYA UGRANINDITO2021-2022
Main Foreword CurriculumVitaePi Panji Diwya Ugranindito, S.Ars @_panjidu+62panjiugranindito@gmail.comXXXX199987889659018onInstagram Basic IndonesiaInfo- Native English - Fluent Deutsch - Novice Language Skills CorelDRAWAdobeArchiCadAutoCadSketchUp2DPhotoshop Software Skills MicrosoftTwinmotionLumionEnscapeOffice
Architecture is a crucial entity in our daily lives. As an architect, we have a heavy burdens to create an architecture that can provide a better live for the present and future generations. I like architecture because we tend to think differently and try many new possibilities for a better solution. The Path of an architectisfunbutalsochallengingtome.

CurriculumVitaePii 2017Universitas2021 Sebelas Maret (UNS) MajorinArchitecturewithGPA3.72/4.00 Education rd2021 - 3 Winner WEXUGM2021:KembaliSusuriArti 2020 - Participant AYDA2020:Human-centeredDesign 2020 - Participant TheInternationalArchitectureCompetition:Dwelling2100 2019 - Top 15 ArcheventUNS2019:MampirSejenak 2019 - Top 10 ExporivmUKDW2019:IniRumahku 2019 - Top 15 SatuRuangUPH2019:KompetisiDesain Competitions March - June 2022 Junior Architect at studio pppooolll *Involved in Schematic and Build Projects May 2021 - Present Freelance Architect at Tukiliving *Mostly involved in Residential and Interior Projects January - April 2021 17 - Weeks Internship at RAW Architecture *Mostly involved in High-end Residential Projects Working Experiences 2021 - Archevent UNS 2021 International Talk Show “A Sequence to Resilience” Vol. 1 Prologue: Co-Healing through Architecture and Psychology 2021 - ADW UNTAR 2021 Architalk 0.3 Healing Architecture : Improve Productivity and Happiness of Workers in The Office Environment 2020 - Ikatan Arsitek Indonesia Jakarta Heritage Talk 4 New Sarinah, In The Making 2019 - Universitas Trisakti Selasar Arsitektur Generasi Muda Arsitektur 2019 - Critical Context Workshop Jakarta Unit 01 led by Kamil Muhammad and Rifandi Nugroho Workshops and Seminars Archevent2020 UNS 2020 GeneralChief HMA2019 Vastu Vidya (Student Association) StaffofScienceandProfessionDivision Muslim2018 Engineer Festival FT UNS Coordinator of Publication, Design and DocumentationDivision PTAB2018 2018 (Student Orientation) CoordinatorofDocumentationDivision HMA2018 Vastu Vidya (Student Association) StaffofScienceandProfessionDivision Organizational Experiences
TableofContentsPiii CONTENTS CONTENTS CONTENTS
Academic DE’KADEWorks:ASpace Nostalgia HeldbyWEXUGM2021(Mid2021) Kesahajaan Garis Sejarah KotaJakartaMRTStasionDesignCompetition(Early2022)
Curriculum Vitae Jakarta
TableofContents
Integrated
Professional Works
House of Tjandra at Puri Botanical (Early2021) Cluster at Kejaksaan Residence (Mid2021) Rumah Sentul Extension (Early2022) Selasar Pustaka: An Library (Mid2022)
FinalProject(Early2021)
for
Competition Works
Urban Hybrid in South
SkillsBasicPivInfoandExperiences
AcademicWorksP01 Dr. Ir. Mohamad Muqoffa, M.T. Ummul Mustaqimah, S.T. ,M.T. Fauzan Ali Ikhsan, S,T. ,M.T. Ir. Ahmad Farkhan, M.T. Supervisors
The life of a Metropolitan City like Jakarta is very far from the availability of green open space. Is it not green open space is a very important aspect for human physical and psychology? One example is that there are many dense residential areas in Jakarta that lack of green open space. Humans and plants should be interdependent to create a comfortable and beautifulcitylife.
Pedurenan Masjid District, Kuningan, South Jakarta Location Masterplanning, Vertical Housing, Urban Farming, Green and Public Space Typology
A New Paradigm for Housing and Urban Farming Design in South Jakarta
In fact, Jakarta City currently has 9.97% (+/6% Public Green Space, +/- 3% Private Green Space. 20% is difficult to achieve because the government need to change 2their land around 130 Km into green open space. This issue is very problematic because green open space is an entity that verycrucialtoabigcitylikeJakarta.
URBAN HYBRID in South Jakarta
Landcover DKI Jakarta 1982 2000 2013
According to Jakarta City Landcover, the City of Jakarta experienced decrease in the percentage of green open space. World Summit Forum agree that all cities on earth should provide 30% for green open space. the standard of that number is too high for Jakarta City government and they only target asmuchas20%.
AcademicWorksP02

AcademicWorksP03 Rooftop Garden Public Canteen Café Residence Green Space Office Amphitheater Open Space Urban Farming Program










AcademicWorksP04 “Urban Hybrid in South Jakarta is my manifestation to a new paradigm of housing designtosolvelackofgreenspacesinJakarta. Urban Hybrid mainfunctionishousingandurban farmingthatintegratedwithmanyspaceprogram”

AcademicWorksP05 A B Site Plan C D E Residential Type 1 Occupant Residential Type 2 Occupant Residential Type 4 Occupant Urban Farming Compound Management Office F G H I J Masjid Baitur Rahmah Western Utility Zone Water CafeEasternReservoirUtilityZoneandamphitheater 20 40 80

AcademicWorksP06 Building Typologies











Urban Farming Compound serves to provide food for residents of Urban Hybrid and the surrounding community. This building also provides a public dining area and a space for local food seller.
COMPOUNDFARMINGURBAN
AcademicWorksP07

AcademicWorksP08 Exhaust
FanEvaporation
Pad




AcademicWorksP09
Urban Hybrid aims to provide an Inclusive Public Space that can be access to all Jakarta Citizen. Visitors can enjoy the green spaces in the middle of Metropolitan City.
SPACEPUBLICINCLUSIVE

AcademicWorksP10




AMPHITHEATERCAFÉMASJID
Urban Hybrid also provides many program for residents and local community.
Amphitheater can be function into a place for relaxing and outdoor cinema.
AcademicWorksP11

AcademicWorksP12



AcademicWorksP13 A B C G D E F H Balcony & Urban Farming WorkingBed Table PantryStorageTV& Dining Table Sterilization Room Toilet A CB G D E F H Balcony & Urban Farming 2 Bed 2 Working Table PantryStorageTV& Dining Table Sterilization Room Toilet A B C G D E F H Balcony & Urban Farming Bedroom 1 Bedroom 2 Dining Table ToiletSterilizationLivingPantryRoomRoom A B C G D E F H A B C G D E F H A B C G D E F H



AcademicWorksP14 Residential Type ResidentialOccupant1Type2OccupantResidentialType4Occupant



Alvis Prima Fernando Team Jl. M.H. Thamrin, Kebon Sirih, Menteng, Central Jakarta Location Museum, Sequential Design, Landscape, Interior Typology
Moment is an event experienced by all individuals that occurred before, now or in the future. The previous moment is often used as a flashback for an individual to seek pleasure and gratitude. The moment is also a witness to the history of how an individual was born and shapes his personality in the present. Each individual must have a story of their own struggles in life. There are individuals who have hard struggles, there are also ordinary people, or even those whose lives are filled with pleasure. However, almost everyone likes something that makes them happy, something that entertains them, and something that makes their daily life more enjoyable. The Entertainment World makes every individual who sees it, hears it, feels it as if carried away by the atmosphere which in the end attaches its own pleasure to the individual. Feelings of joy, happiness, informseachaspectsoperas,oneownbeanyoneentertainmentsadness,emotion,longing,andwhateverthegiveswillgivememorytowhoexperiencesitandonedayitwillabeautifulflashback.EachcountryhasitshistoryintheentertainmentindustryandofthemisIndonesia.Startingfromfilms,music,comedy,fashion,andalloftheentertainmentinIndonesia,hasitsownhistory.HistoryiswhatacivilizationoftheentertainmentworldIndonesia.
WEX UGM 2021 1 Massing 2 Sequential Hallway 3 View 4 CompetitionLandscapingWorks
P15 DE’KADE : A Space for Nostalgia




P16 CompetitionWorks

P17 CompetitionWorks

P18 CompetitionWorks

Pada era 70an era dimana musik semakin berjaya dengan banyaknya para legenda seperti Ebit G Ade, Berlian Hutahuruk dan masih banyak lagi. Tak lupa Berjalan-jalan mengelilingi ruangan sambil melihat poster film kala itu "Ateng".
1971-1980 CompetitionWorks
P19 Menikmati suasana dekade 50an dengan alunan lagu "Nurlela"dari Bing Slamet. Merasakan kembali indahnya dua budaya pada balutan sandang antara adat Jawa dengan sandang khas Eropa. Serta merasakan sejarah awal perfilman Indonesia dengan "Tepi Bengawan Solo".31 1951-1960




P20 42
Berlanjut bernostalgia pada dekade 60an dengan diiringi lagu "Bis Sekolah" dari Sang legenda grup musik Koes Plus. Menikmati suasana didalam mobil sedan kala itu sambil memandangi poster film Laki-laki tak bernama. 1961-1970
CompetitionWorks
Di era 80an sangat merasakan kepopuleran sang legenda perfilman Warkop DKI Dono Kasino Indro. Sambil merasakan jajanan anak berupa selai coklat jadul. Di era ini juga awal kemunculan dan kejayaan sang idola cantik Nike Ardilla dengan lagunya "Bintang Kehidupan". 1981-1990




P21 Selanjutnya memasuki era 90an. Sekelompok anak muda mencoba menggunakan aneka balutan jeans pada masa itu sambil berfoto menonton tayangan sinetron "Si Doel Anak Sekolahan" serta diiringi lagu "Terlalu Manis" dari Slank.75 1991-2000 Sampailah di dekade ke 7. Entertainment disini sudah memasuki berbagai macam platform media sejalan dengan berkembangnya teknologi. Serta karya-karya yang dihasilkan semakin banyak, semakin baik dan kreatif. 2011-2020 CompetitionWorks




Sungguh perkembangan musik dan film pada dekade ini semakin baik.
Pengunjung dapat melihat poster dan standee dari film percintaan remaja terpopuler "Ada apa dengan Cinta?". Tak lupa sambil diiringi lagu "Melompat Lebih Tinggi" dari Sheila on 7. 2001-2010
P22 86
Dan terakhir sampailah di dekade saat ini. Tidak hanya dunia entertainment, tetapi semua aspek kehidupan sedang mengalami kesedihan yang semua orang tau apa itu. Namun, dekade inilah juga sebagai titik balik dan kita semua percaya akan ada hari esok yang indah dan masa depan yang lebih baik. 2021-2030
CompetitionWorks




P23 COMPOUND DESIGN CompetitionWorks 1 Memorial Sculpture1 Connecting Passage2 Main Entrance3 Inner Court4

P24 CompetitionWorks 432




Konektivitas yang bersifat linear mewakili abstraksi lintas waktu dan generasi dari masa lalu hingga kini. Linearitas diwujudkan tegas dengan wujud garis balok yang menopang budaya pecinan dengan ragam generasi dan latar, pun ragam ini berbicara juga tentang ragam pengunjung. Ragam tersebut diwujudkan dalam eksplorasi bentuk
P25 CompetitionWorks
Glodok, sebagai sebuah kawasan pecinan historis di Jakarta, adalah saksi mata sebuah siklus hidup, tumbuh, terdiskriminasi, terhapus, dan terpulihkan kembali. Akibat pengusiran etnis Tionghoa dari Kota Tua sampai kevakumannya selama 32 tahun, budaya Glodok seolah redup namun tak pernah mati dan menjadi sebuah garis historis penting yang terus bertahan, bertransformasi, menua dan menjadi remaja kembali oleh waktu yang tak pernah bisa dihenti. Ia menemukan relevansi yang baru pada setiap zamannya. Glodok bukan saja menjadi nama sebuah tempat---garis historisnya menasbihkan ia sebagai entitas kota Jakarta. Apa adanya. Glodok yang Dalamsahaja. kesehajaannya, wujud bangunan danmenggunakandanstasiunmengadopsibentuklinearyangtegasefektif.Elemendesainpadabangunanprinsipsederhanayakni,garisbidang.
Kesahajaan Garis Sejarah
penutup atap dalam balutan bentuk atap sederhana yang terinspirasi dari langgam arsitektur pasar Glodok lama (atap miring Glodokpelana).adalah cikal bakal lahirnya kawasan organikkenangandapatnilaikuat1740sejakbudayaperanakankotaBatavia(ChinaTown)pembantaianwargaCinaditahunolehVOC.NilaihistorisatausejarahinimemberikanidentitastersendiripadakawasanGlodokyangtidakakanpernahdilepaskan.Halinijustruakanmenjadipahityangmembentuksecararuang-ruangpecinansaatini. studio pppooolll Team Old City of Jakarta, Indonesia Location Masterplanning, Urban Design, Interior Design, Adaptive Reuse, Placemaking Typology Kota Jakarta MRT Stasion Concept and Schematic Design Competition /sa ha ja/ sebenarnya; memang demikian /ber sa ha ja/ a sederhana; tidak berlebih-lebihan
P26 CompetitionWorks SAHAJA GARIS SEJARAH

P27 CompetitionWorks Jalur pedestrian Jalur sepeda Tepian hijau Lajur BusTJ Archetype pelana sebagai awalan gubahan massa Pasar tradisional Glodok, sebagai pusat kegiatan mobilitas publik, menjadi rujukan tipologi. Dua garis balok utama sebagai penyangga Bubungan atap ditekan ke celah di antara dua balok utama Permukaan atap memiliki porosity untuk pergerakan angin dan cahayaAreamedian 6,0 ~ 12,0m 1,5m 1,2m 4,0m 0,00m3,40m3,40m 8,0m Rongga sirip atap berfungsi untuk penghawaan alami dan pencahayaan tidak langsungAirhujantertampung melalui talang kaca (tempered) yang melintang secara menerus di tengah, dan disalurkan ke bawah melalui pipa turun. Rongga untuk jalur servis, elektrikal, dan balok. 17:00 WIB 21 3 4 5 Drain SISTEMDIAGRAMBANGUNANMASSA








P28 CompetitionWorks MATERIAL 7:00 WIB Menuju lantai B1 AluminiumpanelcompositeCONCOURSEGROUNDFLOORB1PERON Timber batten Beton tekstur Beton tekstur Batu andesit Kaca temperedBetonEpoxyekspos Teraso poles Epoxy Lajur BusTJ Tepian hijau Jalur sepeda Jalur pedestrian 6,0 ~ 12,0m1,5m1,2m4,0m Modul sirip atap dua lapis alu. composite panel BalokVouteH-beambeton komposit Cross bracing 12:00 WIB Drain














Dari melihat ke turun
menuju MRT Entrance 1 Pandangan dari balkon bangunan sekitar
Galeri
P29 CompetitionWorks GLODOK STREET 1 4321 Pagelaran barongsai di area Panggung Warga
gang Pintu Besar Selatan I Suasana tangga

P30 CompetitionWorks 432




P31 CompetitionWorks MRT STASION INTERIOR 4321 Lantai Concourse: Paid Area Lantai Concourse: Area ticketing gate Lantai B1 Unpaid Area: Komersil Lantai Peron: Paid area 1

P32 CompetitionWorks 432




P33 ProfessionalWorks House of Tjandra at Puri Botanical This Project is a residential type that can be categorized as a high-end residential project. This House has 3 level and a roof floor that can be use for vegetation and solar panels. There is also a lift that can connect people from ground floor to second floor for private areas. carvedsee,Therematchingcolor.likeTheconceptofthehouseisusedmildcolors,deepred,cremecolor,beigeandsandColorsthataretendertoseeandareeasilyandwellonewithanother.arefineshapesthatareapleasuretonaturalmotifslikefloraldetailsonhandfurnitureandpanels. Interior Design, Rendering, Drafting, Site Supervisor Jobdesk Puri Botanical Residence, Joglo, West Jakarta Location High-end Residential Typology

P34 ProfessionalWorks

P35 ProfessionalWorks Ground Floor First Floor 2 6 12


P36 ProfessionalWorks Second Floor Roof Floor 1. Carport 2. Garage 3. Visitor&ExerciseRoom 4. Innercourt 5. SwimmingPool 6. SwimmingShower 7. Storage 8. WetKitchen 9. MaidQuarter 10. MaidBedroom 11. MaidBathroom 12. Elevator 13. EntranceFoyer 14. LivingRoom 15. DiningRoom 16. PowderRoom 17. FoodStorage 18. DryKitchen 19. TerraceDeck 20. GuestBedroom 21. GuestBathroom 22. MasterBedroom 23. HiddenStorage 24. WalkinCloset 25. MasterBathroom 26. DryingArea 27. Bedroom 28. Bathroom 29. MultifunctionRoom 30. ServiceStair Legend

P37 ProfessionalWorks GROUND FLOOR 1 Swimming Pool1 View to Pool from Service Area2 View from Pool to Service Area3 Visitor and Exercise Room4

P38 ProfessionalWorks 432




P39 ProfessionalWorks FIRST FLOOR 1 Dining Room1 Entrance Foyer2 Guest Bedroom View 13 Guest Bedroom View 24

P40 ProfessionalWorks 432




P41 ProfessionalWorks SECOND FLOOR 1 Master Bedroom1 Multifunction Room2 Parents Bedroom3 Kids Bedroom4

P42 ProfessionalWorks 432




P43 ProfessionalWorks Cluster at Kejaksaan Residence A cluster located in residential complex. This cluster consists of 6 houses and 1 vacant land which will be built for the owner's house. The design approach of this project is quite simple, only using a modern tropical with the cluster.postcubicTheuseofagableroofandaminimalistfacade.cluster,whichcoversanareaof1100meters,hasaparkingarea,securityanda5meterwidthroadwithinthe In the front area of each house unit there is a carport and a small green space for vegetation. The vegetation can also reduce the temperature in the terrace area because Alloftheafternoonsunheat.ofthehouseisfacing to the west, to prevent the heat, the house uses a wood plastic composite secondary skin to reduce thesunradiation. Exterior Design, Modelling, Rendering Jobdesk Kejaksaan Residence, Larangan, Tangerang City, Banten Location Cluster House, Residential Typology 2Total Area: 1100 m 2111 m Parking Area Security Post Additional House

P44 ProfessionalWorks

P45 ProfessionalWorks

P46 ProfessionalWorks

P47 ProfessionalWorks 1 Gate View1 House Unit View2
TROPICAL DESIGN
MODERN

P48 ProfessionalWorks 2


A villa renovation project located in Sentul. This Villa is located in a cluster that use a mediterranean concept. This Project is not a full renovation project but the changes only in the crucial area such as the garden and the service area. The first step to develop this project is identify the existing material that still can be use and the material that need to be change. The Garden is most powerful area in this project. The Existing Vegetation contains a lot of different types of plant. The Idea to improve this area, we simply just add a outdoor dining thedesign,slickaareaandjustusetheexistingtreethatprovideniceshadowing.Fortheexterior,tocreateadesignandmaintainthemediterraneanwechangethepinkpainttowhitesocolorissuitablewiththeexistinggreenery.
Site Survey, Documentation, Modelling, Drafting, Material Specification, Sanitair Specification, Lighting Specification Jobdesk Jl. Pajajaran 49-107, Cijayanti, Babakan Madang, Bogor, West Java Location Villa, Residential Typology ATHENS, GREECE CATANIA, ITALY MARSEILLE, FRANCE TANGIER, MORROCO TUNIS, TUNISIA CYPRUS MEDITERRANEAN CONTINENT
P49 ProfessionalWorks Rumah Sentul Extension

P50 ProfessionalWorks

P51 ProfessionalWorks CONTEXT. Identify the Material Existing 1 Clay Roof1 2 3 4 5 6 7 Pink Kamprot Wall2 White Paint Wall3 White Kamprot Wall4 White Wooden Plank5 Elephant Type Grass6 Brush Stone7

P52 ProfessionalWorks

P53 ProfessionalWorks NORTH GROUNDFLOORPLAN 1 2

P54 ProfessionalWorks Before After


P55 ProfessionalWorks MEDITERRANEAN DESIGN 1 Kitchen View 11 Kitchen View 22 Ground Floor Toilet3

P56 ProfessionalWorks 2 3



P57 ProfessionalWorks Selasar Pustaka: An Integrated Library Statistik menunjukan bahwa tingkat literasi dan pendidikan warga Kab. Bekasi masih cukup rendah -- sekitar setengah dari responden hanya selesai di pendidikan setingkat SMP. Sedangkan lebih dari dankesenian,macamkegiatanliterasidesainSelasarsecaraBekasidalambonusanak-anaksepertigawarganyamasukkedalamkategoridanremaja(0-19tahun).Sebuahdemografi.Inimerupakantantangangerakanliterasimasyarakat.Kab.diisiolehberbagaiorganisasiliterasi,partikelirmaupunterstruktur.Pustakaadalahsebuahkonsepintegratedlibrarydimanakegiatanmenjadibagiandarikesehariananakmuda:melaluiberbagaiprogramdanaktifitaspendidikan,diskusikritis,olahraga,spiritual,lain-lain. Dinamakan Selasar Pustaka karena desain ruang pustakanya yang bersifat linear, yang kemudian dapat disambungkan (plug) ke modul fasilitas-fasilitas penunjang seperti ruang baca, toilet umum, ruang diskusi, ampiteater audio visual, dll. Selasar ini menyelubungi sebuah halaman tengah yang dapat menjadi lapangan futsal/olah raga, Pendekatanatausekedartamanterbuka.modularini memberikan fleksibilitas yang tinggi untuk perencanaan dan adaptasi di kemudian hari. Fleksibilitas ini diperlukan mengingat lokasi dan tapak dari desain ini yang belum dapat dipastikan. Modul-modul tersebut dapat dikembangkan bersama melalui partisipasi dan diskusi bersama para pegiat literasi dengan harapan dapat menemukan program-program dan wadahnyaditempatini. Data Research, Modelling Jobdesk Location Library, Public Space, Green Open Space Typology


P58 ProfessionalWorks


Di tapak relatif luas. Di area urban relatif padat. Di tapak berkontur. Di tapak dengan fitur alam yang menarik. Di area urban relatif luas. Di area luas dengan banyak program dan ruangan. P59 ProfessionalWorks KONFIGURASI YANG FLEKSIBEL Desain ini memiliki berbagai kemungkinan untuk mengikuti luasan tapak dan kontur yang bervariasi.






P60 ProfessionalWorks 8 1 11 10 3 4 6 7 9 5 2 SELASAR PUSTAKA SELASAR PUSTAKA Legenda 18 10 11 2597643 Tempat RuangRuangPlaza/tempatparkirpertunjukkanaudiovisualtoilet/shower(bawah), R. pertemuan (atas) Kebun bersama Ruang kelas & membaca Selasar Lapanganpustakafutsal, olahraga, dan kegiatan besar JoggingTribun Bangunantrackservis & utilitas












P61 ProfessionalWorks
MODUL PROGRAM adalah rak untuk melakukan kegiatan di perpustakaan. Modul ini berbentuk rak berukuran 2,4 x 2,4 m yang dapat digunakan untuk berbagai fungsi, mulai dari rak buku,meja,ruangkecil,tempatbermain,sampaitribun.
MODUL RUANG untuk kegiatan-kegiatan yang butuh naungan dan ruang yang lebih besar untuk kelompok kegiatan utama seperti belajar, performance, kelas, dan sebagainya. Modul ini berukuranbebasnamuntersambungkemuka2,4x2,4m.
MODUL PLUG IN MODULRU MODULPRO M



TempakbacadudukberundakTempatbukubesar TempatbukusimpanbesarTempatduduknookdudukpanjang
Ruang Rakkecilbacabuku3Perosotan MODUL PROGRAM MODUL RUANG
Ruang baca Ruang Pertemuan Ruang Audio Viual Area
P62 ProfessionalWorks Rak buku Rak buku 2 masukAkses Area














P63 ProfessionalWorks INTEGRATED LIBRARY 1 Front Elevation1 Sports Field2 Selasar Pustaka: Corridor3 Side Elevation4

P64 ProfessionalWorks 432





THANK YOU