Page 1

Palo Alto

Vol. XXXVIII, Number 32

Q

May 12, 2017

City wants people to pay more for parking Page 5

w w w. P a l o A l t o O n l i n e.c o m

Top prep swimmers converge at CCS Championships Page 64

Summer Class Guide Guide 29 29 Spectrum 18 Worth a Look 22 Eating Out 23 Shop Talk 24 Movies 25 Spring Class QArts Exhibit explores Midcentury art and the mass market Page 20 QTitle Pages Novel: witty dialogue, airships, woman with guns Page 27 QHome Filoli orist offers tips for stunning bouquets

Page 32


saturday | may 20 9am-2pm Health Matters is a free community event where you can hear from Stanford Medicine’s world-renowned physicians and health care experts on the latest medical innovations and get tips on healthy living. Topics include: sleep, immunotherapy, vision, heart health, mindfulness, drug addiction, weight control, and more. Register online today at healthmatters.stanford.edu.

F R E E H E A LT H TA L K S

Stanford University | School of Medicine Campus Li Ka Shing Center for Learning and Knowledge 291 Campus Drive, Stanford Page 2 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

I N T E R A C T I V E H E A LT H P A V I L I O N


The DeLeon Advantage @11;:$1-8@E C1;Ŋ1>-?A<1>5;>@1-9;2?<1/5-85?@?C5@4/;9<81@10105/-@5;:@;1D/1<@5;:-8/851:@ care. Our true team environment and incomparable services ensure you will receive the best possible outcome in your real estate experience, whether you are buying or selling a home. ®

Brokerage “X”

Brokerage “Y”

Brokerage “Z”

Yes

Yes

Yes

Yes

Yes

No

No

No

Yes

No

No

No

Yes Yes Yes

No No No

No No No

No No No

Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes

No No No No No No No No No No Yes No

No No No No No No No No No No Yes No

No No No No No No No No No No Yes No

Yes Yes Yes Yes Yes Yes

Yes No No No No No

Yes No No No No No

Yes No No No No No

Yes Yes Yes Yes

No No No No

No No No No

No No No No

EXCELLENCE 1. Experienced, knowledgeable real estate agents 2. Absolute ban against having the same individual agent on both sides of any transaction 3. Waive 100% of the buyer-side commission if the brokerage represents both sides of the transaction 4. Home to the #1 real estate team in Silicon Valley 5. Brokerage wholly owned & run by attorneys 6. 75% of agents hold at least a law degree or an MBA

MARKETING * All listings receive: 1. 2. 3. 4. 5. 6. 7. 8. 9. 10. 11. 12.

Professional photography Customized, informative, non-templated ads Narrated, professionally produced videos TV commercials (the #1 Comcast® advertiser in South Peninsula) 3-D home tours Full-color, 12-page or 32-page brochures A?@;9C1.?5@1?<1/5ŋ/@;1-/4<>;<1>@E Online marketing, including paid Google® & Facebook® ads Advertisement in a minimum of 3 newspapers Featured marketing on 2 Chinese radio shows Hosted broker tours & open houses Extended open house hours with refreshments

CLIENT SERVICES 1. 2. 3. 4. 5. 6.

Cooperation with outside agents to sell and buy homes In-house tax & legal advice at no extra charge Paid property & pest inspections "-50?@-35:3I5:/8A05:3@41ŋ>?@9;:@4;22A>:5@A>1>1:@-8J Complimentary handyman services 3-year home maintenance plan by HomeSmiles, Inc.

TEAM BENEFITS 1. 2. 3. 4.

Salaried wages, not commissioned 1-8@4/->1>1@5>191:@.1:1ŋ@? "-50@591 ;Ŋ Paid opportunities for public service volunteering

* Subject to augmentation or change

6 5 0 . 4 8 8 . 7 3 2 5 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 9 0 3 2 2 4 www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 3


Open to the publ i c

Chili Cook-Off Teams will compete for title of Best Chili & other distingued titles. People’s choice will decide the winners. 100% proceeds donated to local nonprofits.

free parking & admis sion

Touch-a-truck Children of all ages can explore fire trucks, police cars, military & emergency vehicles. Meet the people who build, protect and serve our community.

Farmers Market Craft Beer & Wine Free Kid Zone Cooking Demos Nonprofit Fundraising Live Music by Native Elements & Foreverland Parking Lot 15

Page 4 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Cruise through the decades from vintage classics to modern day automobiles.

Community Celebration of our everyday heroes!

1 Hacker Way, Menlo Park @FacebookFestivals

Car Show

www.FBintheCommunity.com


Upfront

Local news, information and analysis

Under proposed fees, parking will cost much more 2018 fee schedule includes increase of nearly 280 percent for employee permit to park in Evergreen Park by Gennady Sheyner ooking to park in a downtown garage for a day, use the new 3-D printer at the library or pump out groundwater to build a basement? Be prepared to spend more money for the privilege. More than a hundred fees in

L

Palo Alto are set to go up in July, some significantly, as part of the city’s effort to recover costs and support rising City Hall salaries. The increases, which are laid out in City Manager James Keene’s proposed municipal fee schedule for 2018, are set to be reviewed by

the City Council’s Finance Committee on May 18 and approved by the full council in June. As part of Keene’s proposal, most of the fees assessed by the city would go up by 6 percent, the average increase of salaries and benefits for fiscal year 2018, which begins on July 1. But about 120 fees would go up by far more than 6 percent. About half of these are in the Community Services Department and

relate to playing on the Palo Alto Municipal Golf Course (which is now undergoing a major renovation), renting recreational facilities or enrolling in swim classes at Rinconada Pool. Those increases hover around 30 percent or more. Keene’s proposal also calls for increasing 14 fees in Development Services, 12 in the Fire Department, 17 in Planning and Community Environment and 12 in Public Works, according to his report.

Some Public Works fees would go up by more than 40 percent. The lion’s share of the increases for planning department fees pertain to employee parking, both on the streets and in city-owned lots and garages. Downtown employees who park in the Residential Preferential Parking (RPP) zones will see the price of their permits go up from the current level of $466 (continued on page 13)

EDUCATION

School board votes to report weighted GPAs, with one exception To alleviate stress, freshmen grades will not be weighted by Elena Kadvany he Palo Alto school board took a series of actions Tuesday night that will have district-wide impacts, including approving a new mathematics curriculum for the elementary schools; giving staff the green light to enter into a voluntary resolution agreement on a federal civil-rights complaint; and backing a new, long-term practice for reporting high school students’ weighted grade point averages (GPA). Their eventual vote on 10 recommendations from Superintendent Max McGee on weighted grades was unanimous, but not without some disagreement over the specifics first. The board voted 5-0 to report both unweighted and weighted cumulative GPAs for all sophomores, juniors and seniors who earn a C or better in honors and Advanced Placement (AP) courses, starting with the class of 2021. A sticking point among board and community members was that freshmen were not included in this recommendation. Board President Terry Godfrey, Vice President Ken Dauber and board member Jennifer DiBrienza agreed with McGee’s rationale, which was driven by Palo Alto and Gunn high school counselors, teachers and administrators who believe that freshman year is a delicate time of transition, and to start giving ninth-graders weighted grades for advanced courses could increase stress and breed academic competition.

T

Veronica Weber

Going for a ride

Two-year-old Gwennyth Wallace gets a hearty push from her mother, Cheryll Go, while the two play at Johnson Park in Palo Alto on May 10.

COMMUNITY

From Viking traditions to Silicon Valley Sigrid Undset Scandinavian Women’s Club in Palo Alto celebrates 30 years by Sue Dremann f you hear the words “Scandinavian American” and immediately think of large enclaves in the Northern Plains states, think again. The second largest group of Scandinavians — more than 1.5 million — reside in California, just behind Minnesota, according to the U.S. Census, and many live in Silicon Valley. One group, the Sigrid Undset Scandinavian Women’s Club in Palo Alto, is celebrating 30 years of fellowship. The Sigrid Undset group shares Nordic traditions and is passing them down to the next generation: rune making, woodcarving, needlecraft, decorative folk-art painting, music, dance, literature, folklore,

I

genealogy — and of course, traditional food. Lots of food. As many as 39 lodge members ages 17 to 90-plus meet each month at Grace Lutheran Church on Waverley Street for cultural and educational programs. There are presentations on Viking sites in Iceland and Greenland and cooking demonstrations of delicacies such as the Vestlands lefse (Viking bread) and piparkakut, a special cookie. On April 15, member Elderid Everly discussed growing up in a Norwegian-American home in South Dakota in the 1920s and 1930s, and in September the lodge will tour the San Francisco Museum of Modern Art’s exhibit by Norwegian artist Edvard Munch.

Karen Karpen joined after members invited her to demonstrate her traditional piparkakut recipe after seeing it published in a local newspaper several years ago. “A lot of people are bakers. It’s just fun getting together. I was raised in a Scandinavian household. My grandparents came in the early 20th century,” said Karpen, who researches and gives talks on the culture. The lodge is named after Norwegian 1928 Nobel Prize-winning novelist Sigrid Undset, who is best known for her “Kristin Lasvransdatter” trilogy and as an outspoken opponent of Hitler and (continued on page 12)

“For me, the question is: Are we solely a college-prep district or are we a district that has other priorities as well?” DiBrienza asked. “There are lots of different things to do and things to focus on at different times in your school trajectory, and our professionals feel very strongly that freshman year is a time to focus on other stuff.” Board members Melissa Baten Caswell and Todd Collins disagreed, however. The concern that weighting grades for freshmen will create an unhealthy rush toward advanced courses, Collins argued, is at odds with the district’s mission. “The idea that too many students will take an honors course — it seems wrong as a school board member to even utter the words,” he said. GPA reporting is a “tiny” part of the complex equation of why students and parents seek out particular classes and what causes student stress, he added. “It’s like we’re looking through the wrong end of the telescope ... when there’s a whole range of reasons that drive students and parents to certain courses and what creates stress about them.” Baten Caswell agreed, arguing the debate over weighted grades has “made taking risks punitive.” Several parents echoed this sentiment Tuesday, urging the board to be fair and reward all students for taking on academic (continued on page 11)

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 5


Upfront

Healthy Teeth and Gums That Last a Lifetime! • New Patients Welcome! • Free Consultations and Second Opinions • Saturday Appointments Available • Our patients love us on Yelp

Voted Best Dentist Don’t Wait! Call 650.969.6077 for your appointment today!

Best of MOUNTAIN

THE VOICE

2014

VIEW

2016

756 California Street, Suite B 650.969.6077 www.dentalfabulous.com Mountain View 94041

450 Cambridge Ave, Palo Alto, CA 94306 (650) 326-8210 PUBLISHER William S. Johnson (223-6505) EDITORIAL Editor Jocelyn Dong (223-6514) Associate Editor Linda Taaffe (223-6511) Sports Editor Rick Eymer (223-6516) Arts & Entertainment Editor Karla Kane (223-6517) Home & Real Estate Editor Elizabeth Lorenz (223-6534) Assistant Sports Editor Glenn Reeves (223-6521) Spectrum Editor Renee Batti (223-6528) Express & Digital Editor Jamey Padojino (223-6524) Staff Writers Sue Dremann (223-6518), Elena Kadvany (223-6519), Gennady Sheyner (223-6513) Editorial Assistant/Intern Coordinator Anna Medina (223-6515) Staff Photographer/Videographer Veronica Weber (223-6520) Editorial Interns Sarah Mason, Sophie Pollock Contributors Chrissi Angeles, Dale F. Bentson, Mike Berry, Carol Blitzer, Peter Canavese, Chad Jones, Chris Kenrick, Kevin Kirby, Jack McKinnon, Alissa Merksamer, Daryl Savage, Ruth Schechter, Jeanie K. Smith, Jay Thorwaldson ADVERTISING Vice President Sales & Marketing Tom Zahiralis (223-6570) Multimedia Advertising Sales Adam Carter (223-6573), Elaine Clark (223-6572), Connie Jo Cotton (223-6571), Janice Hoogner (223-6576), V.K. Moudgalya (223-6586) Real Estate Advertising Sales Neal Fine (223-6583), Carolyn Oliver (223-6581), Rosemary Lewkowitz (223-6585) Inside Advertising Sales Irene Schwartz (223-6580) Legal Advertising Alicia Santillan (223-6578)

®

ADVERTISING SERVICES Advertising Services Lead Blanca Yoc (223-6596) Sales & Production Coordinators Virida Chiem (223-6582), Diane Martin (223-6584) DESIGN Design & Production Manager Kristin Brown (223-6562) Senior Designers Linda Atilano, Paul Llewellyn Designers Rosanna Kuruppu, Talia Nakhjiri, Doug Young EXPRESS, ONLINE AND VIDEO SERVICES Online Operations Coordinator Kevin Legarda (223-6597)

The DeLeon Difference® 650.543.8500 www.deleonrealty.com 650.543.8500 | www.deleonrealty.com | DeLeon Realty CalBRE #01903224

Premiere window and door resource for the South Bay Area since 1993

New Location

BUSINESS Payroll & Benefits Zach Allen (223-6544) Business Associates Cherie Chen (223-6543), Elena Dineva (223-6542), Cathy Stringari (223-6541) ADMINISTRATION Receptionist Doris Taylor Courier Ruben Espinoza EMBARCADERO MEDIA President William S. Johnson (223-6505) Vice President Michael I. Naar (223-6540) Vice President & CFO Peter Beller (223-6545) Vice President Sales & Marketing Tom Zahiralis (223-6570) Director, Information Technology & Webmaster Frank A. Bravo (223-6551) Marketing & Creative Director Shannon Corey (223-6560) Major Accounts Sales Manager Connie Jo Cotton (223-6571) Director, Circulation & Mailing Services Tatjana Pitts (223-6557) Circulation Assistant Alicia Santillan Computer System Associates Ryan Dowd, Chris Planessi The Palo Alto Weekly (ISSN 0199-1159) is published every Friday by Embarcadero Media, 450 Cambridge Ave., Palo Alto, CA 94306, (650) 326-8210. Periodicals postage paid at Palo Alto, CA and additional mailing offices. Adjudicated a newspaper of general circulation for Santa Clara County. The Palo Alto Weekly is delivered free to homes in Palo Alto, Menlo Park, Atherton, Portola Valley, East Palo Alto, to faculty and staff households on the Stanford campus and to portions of Los Altos Hills. If you are not currently receiving the paper, you may request free delivery by calling 326-8210. POSTMASTER: Send address changes to Palo Alto Weekly, P.O. Box 1610, Palo Alto, CA 94302. ©2016 by Embarcadero Media. All rights reserved. Reproduction without permission is strictly prohibited. The Palo Alto Weekly is available on the Internet via Palo Alto Online at: www.PaloAltoOnline.com Our email addresses are: editor@paweekly.com, letters@paweekly.com, digitalads@paweekly.com, ads@paweekly.com Missed delivery or start/stop your paper? Call 650 223-6557, or email circulation@paweekly.com. You may also subscribe online at www.PaloAltoOnline.com. Subscriptions are $60/yr.

SUBSCRIBE! Contractors and homeowners welcome

Support your local newspaper by becoming a paid subscriber. $60 per year. $100 for two years.

220 State St., Suite 1 • Los Altos • 650.941.0744

Name: _________________________________

Hours: Monday - Friday 9 - 4, Saturday by appointment

Address: ________________________________

Sales: dave@selectwindows.com

City/Zip: ________________________________ Mail to: Palo Alto Weekly, 450 Cambridge Ave., Palo Alto CA 94306

www.SelectWindows.com Page 6 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

QUOTE OF THE WEEK

While I would encourage parents to come hold feet to the fire, we have no one to blame but ourselves. —Todd Collins, Palo Alto school board member, on weighted grades for freshmen. See story on page 5.

Around Town STAMPS OF APPROVAL Palo Alto reaffirmed its 53-year-old bond with Oaxaca, Mexico, this week when it welcomed a group of visitors from its Mexican sister city for a week of activities and a shiny, red parting gift. Following a long sister-city tradition, the city officially handed off one of its decommissioned fire vehicles to Oaxaca, where it will be refurbished and given a second life. On Monday, May 8, city officials presented the title to the quint (a combination fire engine and ladder truck) to Oaxaca Fire Chief Manuel Maza Sanchez and a delegation of visitors, including Lupita de Vargas, president of the Oaxaca Sister City Committee. City Manager James Keene said the quint will arrive in Oaxaca in early June. It is expected to serve residents for the next 10 to 15 years, he said. To further underscore the civic love, local students adorned the fire truck with giant stamps celebrating the relationship with some messages, some said “Unidos por siempre!” which translates to “United forever!” Bob Wenzlau, president of Neighbors Abroad, which coordinates the sistercity relationship, said the group expects to name the quint “Los Danzantes,” Spanish for “The Dancers,” to commemorate the troupe of student folk dancers who in December canceled their scheduled trip to Palo Alto, citing the “sociological-political situation in the U.S.A.” FIGHTING FAKE NEWS ... Palo Alto High School studentjournalists will be the inaugural students in a pilot media literacy class developed by Newseum, a museum in Washington, D.C., to fight the rise of fake news. Launched through Newseum’s education initiative, the class, dubbed “Fighting Fake News: How to Outsmart Trolls and Troublemakers,” is a response to the widespread sharing — and potential impact on public opinion

— of false news stories during the 2016 presidential election, Newseum said in a press release announcing the class. “As concern over fake news rises, NewseumED believes the ability to identify misinformation is an increasingly important skill that needs to be in every student’s media literacy toolkit,” the release states. Newseum staff have noticed students struggling to understand concepts like media ethics, information sources and bias, and more teachers requesting support for how to address fake news in their classrooms. In the class, students will explore “the complexity of digital citizenship, including their active role in the flow of information,” examine case studies and consider possible motivations behind news stories, Newseum said. The classes will take place at Paly on Tuesday, May 16. HIS FINAL ACT ... TheatreWorks Silicon Valley founder and Executive Artistic Director Robert Kelley announced this week that he plans to retire from the the company at the end of its 2019/2020 season, its (and his) 50th. He is believed to be the longest-running artistic director at an American regional theater company, according to TheatreWorks. The cheerful, pony-tailed Kelley founded TheatreWorks in 1970 shortly after he graduated from Stanford University and has directed more than 170 of the company’s 426 productions. TheatreWorks will begin a national search for Kelley’s successor later this year, allowing plenty of time for the transition. “I’m healthy, I still love making theater, and I intend to remain active in support of the company. But I believe the half-century mark is a timely and appropriate moment for TheatreWorks to embrace new leadership to continue our growth into the future,” he said in a press release. Under Kelley’s leadership, TheatreWorks has expanded from an experimental youth troupe to the third-largest theater company in the Bay Area, boasting a number of world and regional premieres (including “Memphis,” which went on to Broadway and won the 2010 Tony Award for Best Musical), an annual new-works festival and educational programs that reach 25,000 students each year.


Upfront LAW ENFORCEMENT

Palo Alto sued over police-dog bite Teen was allegedly mauled by K-9 in ‘unprovoked’ attack by Sue Dremann Palo Alto mother has filed a lawsuit against the City of Palo Alto and the Police Department for civil rights violations after her teenage son was bitten by a police dog, according to a lawsuit filed in U.S. District Court in San Jose. The teen, identified in the lawsuit by his initials, T.M., is African American and was 16 years old at the time of the incident, April 7, 2016. He was allegedly mauled by a police dog while officers stood by and watched, according to the civil complaint. The teen suffered cuts, lacerations and scrapes on his body and deep puncture wounds to his legs and hands. The boy’s mother, Alacia Hafner, filed the lawsuit on May 2 on behalf of her son, who is still a juvenile. It alleges Fourth Amendment violations for police use of excessive force and unlawful search and seizure. The lawsuit also alleges violations of California civil rights laws against hate violence and guaranteeing protection from threats, intimidation, coercion and interference with an individual’s constitutional rights. Other claims include assault, battery, false arrest and imprisonment, intentional and negligent

A

infliction of emotional distress, negligence and violations of the state dog-bite statute. The teen was with friends on April 7, 2016, at about 2 a.m. at the corner of Bryant Street and Bryant Court. Police arrived with their sirens on and stopped their squad cars at the two corners where the teens were located, according to the civil complaint. An officer allegedly pulled up to the boy with her gun drawn. The boy allegedly had his hands raised in the air, did not run and was compliant, the lawsuit claims. He did not have any warrants and was not on probation or parole. A police dog ran out of the back seat of an officer’s vehicle and allegedly attacked the boy, according to the complaint. The teen was eventually taken to a hospital for treatment and was arrested but no charges were filed. The complaint does not mention why he was arrested. Palo Alto police Sgt. David Lee said on Wednesday that he could not release any information about the case. The lawsuit claims there was no reasonable suspicion that the teen had committed any crimes before he was detained and no probable cause to believe that he

had committed any crimes before his arrest. There was also no good cause to exert force, much less the amount of force used against him, the lawsuit alleges. As a result of the dog attack and his injuries, the teen has continued to experience emotional trauma and physical pain, according to the complaint. The lawsuit singles out the City of Palo Alto, interim Chief of Police Ron Watson and officers Marcus Barbour, Paul Burgio, Nicholas Enberg, Daniel Fino, Khalil Tannous, Marianna Villaescusa, Todd Whitehurst and Bradley Young. It does not specify an amount for damages, but an Oct. 4, 2016, claim filed with the city asked for damages in excess of $500,000. The city later rejected the claim. The complaint alleges that the police department does not properly train its officers regarding excessive use of force and that its dogs are trained in bite-and-hold techniques that cause greater injury when subduing individuals suspected of crimes. Officials at the City Attorney’s Office said they had not yet been served with the lawsuit. Hafner’s attorney, Bob Khakshooy, of Beverly Hills did not respond to a request for comment. Q

COMMUNITY

City seeks ideas on separating roads, train tracks

May 20 community meeting to cover potential changes along Caltrain corridor by Gennady Sheyner s Palo Alto braces for potentially transformative changes along its railroad corridor, city officials are preparing to kick off an intense community-engagement process aimed at educating residents and soliciting their ideas on rail design. City transportation staff will host a community workshop on Saturday, May 20, at Mitchell Park Community Center to review existing conditions along the city’s 4-mile stretch of rail and the two major ongoing rail projects — the electrification of Caltrain and the potential implementation of high-speed rail. Staff will also solicit community opinions about the best way to separate the tracks from the streets at the city’s four rail crossings. While the city’s conversation about grade separation is far from new, the effort gained

A

some momentum last November, when voters approved Measure B, a sales-tax measure that allocates $700 million for the effort in Sunnyvale, Mountain View and Palo Alto. While the funds are not sufficient to build a tunnel or a trench for railroad tracks — an option favored by many in Palo Alto — they open up new opportunities for rail improvements. To determine what types of changes the city should pursue, the City Council’s recently reformed Rail Committee decided earlier this year to launch a process known as “context sensitive solutions,” which is often used for statewide highway-construction projects and that emphasizes community engagement. Joshuah Mello, the city’s chief transportation official, told the committee last month that the goal is to introduce the community to the various challenges

and opportunities relating to a potential redesign the rail corridor and to “feel out the tone of the community.” “We don’t want any preconceived notions about what the solutions are or what the problem is,” Mello said at the April 26 meeting. City Manager James Keene noted that the city has many stakeholders in this process. Each will be able to bring their own objectives, knowledge and expertise to the effort. “We have to meet people where they are and listen to any kind of issue or comment that can come up,” Keene said. The workshop will take place from 10 a.m. to 2 p.m. in the Palo Alto Room at the Mitchell Park Community Center, 3600 Middlefield Road. More information is posted at cityofpaloalto.org (search for “railway programs.”) Q

News Digest Palo Alto backs away from business tax

On Monday night, the City Council backed away from a business license tax proposal that it has been contemplating for over a year. By a unanimous vote, the council agreed with a recommendation from City Manager James Keene not to move ahead with its plan to appoint a stakeholder committee that would help construct a potential tax measure and evaluate the projects that the measure would fund. While members acknowledged the plan may be worth pursuing, they agreed that now is not the time. The shift was prompted by Keene’s warning that city staff does not have the capacity to perform the public-engagement work that the tax would require. Though the council had agreed last fall to move ahead with the new committee, Keene asked council members to reconsider that decision. Keene told the council Monday night that while he has not concluded that the tax would be a bad idea, the process the council established is “potentially inefficient.” The council isn’t abandoning the business tax, but after hearing from Keene, Vice Mayor Liz Kniss said she was concerned that the council would be “overreaching” if it were to move ahead with a citizen committee at this time. The council agreed and voted unanimously to defer discussion of the new committee until fall. Several members acknowledged that backing away from the proposed tax raises more questions about how the city plans to pay for its traffic-reduction efforts. Ultimately, however, the council stopped short of delegating this task to the commission and instead asked staff to return in the fall with an analysis of the city’s transportation needs, available revenues and ways to address the gap between the two. Q — Gennady Sheyner

Elderly couple struck by car near library

Two elderly pedestrians were struck by a car near Mitchell Park Library in Palo Alto Tuesday morning, police said. Officers were notified of a car accident along the 700 block of Mayview Avenue near Middlefield Road at about 7:50 a.m., police Agent Ryan Brennan said. Police learned a married couple, a man and a woman in their 80s, were crossing the street when they were hit by a car, Brennan said. The pair was transported to a hospital where they remained late Wednesday afternoon for serious injuries, but it’s unclear whether they were life-threatening, he said. The driver, a woman in her 40s, stayed at the scene and cooperated with investigation, according to Brennan. “There was no reason to believe there was any impairment on the driver’s part,” Brennan said. As of late Wednesday afternoon, the driver hadn’t been arrested or cited, he said. Anyone who witnessed the collision is asked to call police dispatch at 650-329-2413. Q — Jamey Padojino

Meeting on new accessory-housing rules

Palo Alto Neighborhoods, a group of residents, is hosting an informational night about recent changes to the city’s rules on accessorydwelling units (ADUs), also known as “granny,” “in-law” or “secondary dwelling” units. “ADUs: Clearing Up the Confusion” will take place on Thursday, May 25, at 7 p.m. at Mitchell Park Community Center, El Palo Alto Room. Sheri Furman, the chairwoman of Palo Alto Neighborhoods, and Jonathan Lait, the City of Palo Alto’s assistant director at the Planning and Community Environment Department, will speak and answer questions. Palo Alto Mayor Greg Scharff will introduce them. This week, the City Council, prompted largely by changes in state law and Palo Alto’s affordable housing shortage, approved reforms to the city’s accessory-housing ordinance. Among the changes was the elimination of the requirement that limited accessory-dwelling units to lots exceeding the minimum lot size of their zoning district by 35 percent or more. Now, any lot that is 5,000 square feet or larger can have such a unit. The ordinance also now allows the creation of “junior accessory dwelling units” — a bedroom that is converted into a dwelling unit with a kitchenette, like a garage. The council approved a laundry list of additional incentives, including ones that grant extra square footage to both types of units and eliminates parking requirements for ADUs. Council members said they sought to relax the ADU restrictions to encourage residents to build ADUs and increase the city’s housing stock. Among the topics that Furman and Lait will cover are types of ADUs, state and Palo Alto laws, rules about parking, the process for creating an ADU, considerations for historic and Eichler neighborhoods and other areas of concern. Q — Gennady Sheyner www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 7


2017

High Performance Care For High Performance Cars

GO ONLINE AT

paloaltoonline.com/best_of

MAY 29

Deadline to vote:

R ESTAU R A N TS

RETAIL

|

|

439 LAMBERT AVE, PALO ALTO www.ecargarage.com 650-493-7877

FOOD & DRINK

SERVICES

|

FUN STUFF

Please Vote For Us Best Hotel

Thanks so much for all your support in 2016! Please take the time to vote again for your favorite dental office! Thank you for voting us “Best Dentist” in Palo Alto

We appreciate your business 299 CALIFORNIA AVE. STE. 115 | PALO ALTO

www.calave.com 2016

2016

520 Cowper Street Downtown Palo Alto (650) 322 9000 gardencourt.com

2017

VOTE FOR CALAVE 2017

BEST OF

Christine Hansen and Roberta Jurash

Christine Hansen, DDS Roberta Jurash, DDS 2014

2015

2016

416 Waverley Street, #A, Palo Alto, CA 94301 • (650) 326 - 3290 CHRISTINEHANSENDDS.COM

Please Vote for Us Fresh made dough daily Family owned and operated since 2003 We support our schools and community 2016

Best Eyewear

Vote for us!

1805 El Camino Real, Palo Alto 115 HAMILTON AVE., PALO ALTO

650-324-3131

(Between Park & Stanford)

(650) 324-3937 www.luxpaloalto.com

Vote

No Ka ‘oi

STAY CONNECTED, RETIRE IN DOWNTOWN PALO ALTO

(The people say it’s the best.)

APARTMENTS AVAILABLE!

F Family Owned and Operated

Rebates and Senior Discounts Available 850 Webster Street, Palo Alto

650.327.0950

(650) 856-3400

www.PaloAltoPlumbing.net

24-Hr Emergency Service Page 8 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Lic. #797913

inquiry@channinghouse.org Lic #430700136 VO

T E FOR

US

www.ChanningHouse.org


Upfront LAW ENFORCEMENT

Police look to hire communications manager

New position marks shift in Palo Alto departmentâ&#x20AC;&#x2122;s approach to public outreach by Gennady Sheyner s the relationship between police officers and the communities they serve continues to make headlines across the nation, the Palo Alto Police Department is preparing for its own transition in how it interacts with the public. The department, which in recent years has significantly stepped up its social-media efforts, is looking to hire a publicinformation officer this year. The new non-sworn position would mark a change for a department in which the duties have traditionally been distributed among sworn officers, with Capt. Zach Perron playing a leading role since 2010. In addition to his media-relations duties, Perron was also the architect of the cityâ&#x20AC;&#x2122;s socialmedia strategy, which includes a

A

strong presence on Twitter (where the department has about 16,600 followers), Facebook, Instagram, YouTube, Nixle, Flickr and Nextdoor. This year, Perron was tapped to head the departmentâ&#x20AC;&#x2122;s detective division, prompting a search for replacement. The $192,000 public-affairs manager is the only new General Fund position that City Manager James Keene is proposing in his budget for fiscal year 2018, which starts on July 1. On Tuesday night, as the council Finance Committee reviewed the Police Department budget, interim Police Chief Ron Watson made a case for why the addition is necessary. He noted that under Perron, the department has become a national leader in social-media and community outreach, with more than 40,000 followers on

CityView

A round-up of Palo Alto government action this week

City Council (May 8)

Bowman: The council approved a proposal by Bowman International School to merge parcels at 689 and 693 Arastradero Road to enable construction of a new school facility. Yes: Unanimous

Council Finance Committee (May 9)

Police: The committee recommended approving the proposed Police Department budget, which includes a new public-information manager position. Yes: Fine, Filseth, Holman No: Tanaka Fire Department: The committee recommended approving the proposed Fire Department budget. Yes: Fine, Holman No: Filseth Absent: Tanaka Office of Emergency Services: The committee recommended approving the proposed Office of Emergency Services budget. Yes: Filseth, Fine, Holman Absent: Tanaka Planning: The committee recommended approving the budget for the Department of Planning and Community Environment. Yes: Filseth, Fine No: Holman Absent: Tanaka Community services: The committee recommended approving the budget for the Community Services Department. Yes: Filseth, Fine No: Holman Absent: Tanaka

Board of Education (May 9)

Elementary math: The board waived its two-meeting rule and approved Bridges in Mathematics as the elementary schoolsâ&#x20AC;&#x2122; new core math curriculum, with Eureka/Engage New York as a supplementary material. Yes: Unanimous Weighted GPA: The board voted to report both unweighted and weighted cumulative grade point averages for high school sophomores, juniors and seniors (not freshmen), among other recommendations related to weighted grades. Yes: Unanimous Website accessibility complaint: The board waived its two-meeting rule and authorized staff to enter into a voluntary resolution agreement with the federal Office for Civil Rights in response to a complaint alleging the districtâ&#x20AC;&#x2122;s website is inaccessible to people with disabilities. Yes: Unanimous Teaching assignments: The board authorized four teachers to teach in departmentalized classes outside their credentialed teaching area for 2016-17. Yes: Unanimous Classified staff cuts: The board waived its two-meeting rule and approved the elimination of several classified staff positions, but removed an education outreach specialist

social media. Watson told the committee that thanks to existing efforts, the city has the ability to instantly reach 13,000 of the cityâ&#x20AC;&#x2122;s 27,000 households with timely information. He also said that the social-media platforms allow for two-way communication, which benefits not only residents but the department, which gets tips from users during major incidents like the downtown manhunt for hit-andrun suspects in March. â&#x20AC;&#x153;The Police Department public-affairs manager has become a critical position in the Police Department and city not only on day-to-day routine matters, but during high-profile incidents in the field, as well as one of lead folks in Emergency Operations Center any time we have a major incident or natural disaster,â&#x20AC;?

position from the list of cuts. Yes: Unanimous Declaration of need: The board waived its two-meeting rule and approved a declaration of need for emergency and limited assignment permits for certificated employees who do not have appropriate credentials. Yes: Unanimous Paly funds transfer: The board waived its two-meeting rule and approved transferring $1.8 million from Palo Alto High Schoolâ&#x20AC;&#x2122;s Performing Arts Center project to the schoolâ&#x20AC;&#x2122;s reserve. Yes: Unanimous Paly library bid: The board authorized staff to award a contract to Sausal Corporation for construction of Palyâ&#x20AC;&#x2122;s library project. Yes: Unanimous Paly 700 building: The board authorized staff to award a contract Cumiskey Construction Corporation for the renovation of Palyâ&#x20AC;&#x2122;s 700 building. Yes: Unanimous Paly 300A, 400 buildings: The board authorized staff to purchase office furnishings and equipment for Palyâ&#x20AC;&#x2122;s 300A and 400 buildings. Yes: Unanimous Gunn modular buildings: The board authorized staff to award a contract to BRCO Constructors for the installation of seven portables at Gunn High School. Yes: Unanimous Roof repairs: The board authorized staff to award a contract to Brazos Urethane, Inc. to complete roof repairs. Yes: Unanimous Lighting retrofit: The board authorized staff to award a contract to SoLed Solutions Contractors to complete a lighting retrofit. Yes: Unanimous Chief budget officer contract: The board approved a new three-year contract for Chief Budget Officer Cathy Mak. Yes: Unanimous Assistant superintendent for human resources contract: The board appointed Karen Hendricks as the districtâ&#x20AC;&#x2122;s new assistant superintendent for human resources. Yes: Unanimous Minutes: The board approved a series of minutes from July through September 2016. Yes: Baten Caswell, Dauber, Godfrey Abstain: Collins, DiBrienza Minutes: The board approved minutes from January and February. Yes: Baten Caswell, Collins, Dauber, DiBrienza Abstain: Godfrey

Planning and Transportation Commission (May 10)

Capital: The commission reviewed the cityâ&#x20AC;&#x2122;s capitalimprovement program and found it to be compliant with the Comprehensive Plan. Yes: Alcheck, Gardias, Lauing, Monk, Waldfogel Absent: Rosenblum, Summa

Board of Education (May 11)

Budget: The board directed staff to include the following in the proposed 2017-18 budget: to spend $175,000 on additional middle and high school teachers from the districtâ&#x20AC;&#x2122;s reserve; to fund $971,000 in ongoing program additions; and to move $150,000 allocated for Palo Alto Community Child Care from a one-time to an ongoing expense. All decisions were unanimous except the $150,000 allocation, which trustees approved 3-2, with DiBrienza and Godfrey dissenting. Yes: Unanimous

Watson said. Removing the position from the budget would deal a blow to the departmentâ&#x20AC;&#x2122;s community-outreach efforts, he said, effectively halting its social-media activities and reducing press releases by 75 to 80 percent. Not everyone, however, was convinced that the position is necessary. Councilman Greg Tanaka made a motion to tentatively approve the Police Departmentâ&#x20AC;&#x2122;s budget without the publicinformation officer. â&#x20AC;&#x153;I canâ&#x20AC;&#x2122;t see how we need the position,â&#x20AC;? Tanaka said. â&#x20AC;&#x153;I canâ&#x20AC;&#x2122;t see why we would add a socialmedia person for the Police

Department. I cannot support it.â&#x20AC;? Tanakaâ&#x20AC;&#x2122;s motion failed, with his three colleagues agreeing that the budget request is reasonable. Councilwoman Karen Holman acknowledged that hiring a public-information officer could make for â&#x20AC;&#x153;bad opticsâ&#x20AC;? in a community where many people are more concerned about inadequate traffic enforcement, but she stopped short of opposing the request. Councilman Adrian Fine fully supported creating the new position. Having a single point of contact for press and public inquiries (continued on page 11)

CITY OF PALO ALTO

NOTICE OF PREPARATION NOTICE IS HEREBY GIVEN that an Environmental Impact Report (EIR) will be prepared by WPS/ Parsons )YPUJRLYOVÉ&#x2C6; MVY 7\ISPJ >VYRZ ,UNPULLYPUN VU ILOHSM VM [OL *P[` VM 7HSV (S[V MVY [OL 7HYRPUN .HYHNL H[  /HTPS[VU (]LU\L PU [OL +V^U[V^U )\ZPULZZ +PZ[YPJ[ PU 7HSV(S[V 7\ISPJHNLUJPLZHUKTLTILYZVM[OLNLULYHSW\ISPJHYL PU]P[LK [V WYV]PKL JVTTLU[Z PU ^YP[PUN VU [OL ZJVWL HUK JVU[LU[ VM [OL ,09 The 30-day agency and public comment period for this notice will run from May 12, 2017 to June 10, 2017. A copy of the full Notice of Preparation is available to be reviewed at the Development Center, which is located at 285 Hamilton Avenue, Palo Alto, CA. 94301. Please ZLUK ^YP[[LU YLZWVUZLZ I` YLN\SHY THPS [V [OL HKKYLZZ above or by email to HT`MYLUJO'JP[`VMWHSVHS[VVYN (SS 9LZWVUZPISLHUK;Y\Z[LL(NLUJPLZWYV]PKPUNJVTTLU[Z HYL YLX\LZ[LK [V PUJS\KL H JVU[HJ[ WLYZVU MVY [OLPY HNLUJ` ;OL *P[` VM 7HSV (S[V 7SHUUPUN HUK ;YHUZWVY[H[PVU *VTTPZZPVU ^PSS OVSK H :JVWPUN 4LL[PUN [V KL[LYTPUL ^OH[ WV[LU[PHS LU]PYVUTLU[HS LÉ&#x2C6;LJ[Z ZOV\SK IL L]HS\H[LKPU[OL,09;OL:JVWPUN4LL[PUNPZZJOLK\SLK MVY Wednesday May 31, 2017, 6:00 PM, Council Chambers, Palo Alto City Hall, 250 Hamilton Avenue, Palo Alto. ;OL :JVWPUN 4LL[PUN WYV]PKLZ JVTT\UP[` TLTILYZ^P[OHUVWWVY[\UP[`[VVÉ&#x2C6;LY]LYIHSHUK^YP[[LU PUW\[ HIV\[ ^OH[ LU]PYVUTLU[HS PZZ\LZ ZOV\SK IL L_HTPULK PU [OL ,09  *VTTLU[Z VU [OL ,09 HUK 567 TH` IL Z\ITP[[LK H[ [OPZ TLL[PUN VY HU` [PTL K\YPUN [OL W\ISPJ YL]PL^ WLYPVK MYVT 4H`   [OYV\NO 1\UL   The Notice of Preparation, Initial Study, and more information about the project will be available on the Cityâ&#x20AC;&#x2122;s website for this project: ^^^JP[`VMWHSVHS[VVYNKV^U[V^UNHYHNL Jonathan Lait, Assistant Director of Planning and Community Environment (4,90*(5: >0;/ +0:()030;@ (*; (+(. Persons ^P[O KPZHIPSP[PLZ ^OV YLX\PYL H\_PSPHY` HPKZ VY ZLY]PJLZ PU \ZPUN *P[` MHJPSP[PLZ ZLY]PJLZ VY WYVNYHTZ VY ^OV ^V\SK SPRL PUMVYTH[PVU VU [OL *P[`ÂťZ JVTWSPHUJL ^P[O [OL (TLYPJHUZ ^P[O +PZHIPSP[PLZ (J[ (+( VM   TH` JVU[HJ[    =VPJL  OV\YZ PU HK]HUJL VY I` LTHPSPUN HKH'JP[`VMWHSVHS[VVYN www.PaloAltoOnline.com â&#x20AC;˘ Palo Alto Weekly â&#x20AC;˘ May 12, 2017 â&#x20AC;˘ Page 9


Upfront DEVELOPMENT

Bowman scores a victory in expansion bid Private school wins approval for parcel merger to enable new gym, amphitheater

Bowman School

proposal by Bowman International School in south Palo Alto to construct a new building featuring a gymnasium, an art lab and a circular amphitheater scored a victory Monday night, when city officials approved a parcel merger sought by the private school.

A

The City Council’s unanimous approval means that Bowman can combine the two parcels at 689 and 693 Arastradero Road, just 0.2 miles south of its existing location at 4000 Terman Drive. The parcel at 693 Arastradero abuts a bike path and, beyond that, the Alta Mesa Cemetery. The rear

of 689 Arastradero shares a fence with the parking lot of the Terman Apartments, and a church flanks its northern property line. The sites currently include three homes. Joining the two parcels would result in a 54,894-square-foot lot in a zoning district where the maximum allowable lot size of 19,999 square feet. Even with the expansion, Bowman indicated that it will not exceed its existing enrollment cap of 300 students. While Bowman serves grades K-8, most of the users of the new space will be students between the ages of 3 and 5, according to the school. Older students would walk between the existing campus and the new one — the length of three football fields — to use the new spaces, a staff report on the project stated. William McClure, an attorney for Bowman, argued in a letter that the triangular shape of the parcel at 693 Arastradero effectively prohibits Bowman from building the gym without violating the development standards in the city’s zoning code. He noted that the merger pertains to two lots that already exceed the existing zoning code. “The granting of the exception will permit the construction of the School, which could not otherwise be built and which does not result in a home that is out of scale with the surrounding neighborhood,” McClure wrote. “The School, although not a detached dwelling, provides for a strong presence of nature with open space affording valuable opportunities not only for children to play, but to learn.” The new project, he added, will include a “learning circle,” a science garden, exploration yards, patios and walkways. Even though the council generally frowns upon granting zoning exceptions, members agreed that Bowman’s proposal for the site is reasonable and warrants support.

Map courtesy Google Maps

by Gennady Sheyner

Bowman School addition

Bowman International School in south Palo Alto, top right, has secured the Palo Alto City Council’s approval to merge two Arastradero Road parcels, bottom left, so it can construct a new gym, art lab and amphitheater.

Mayor Greg Scharff called it “good use of property” and Councilman Tom DuBois said the project would not be detrimental to the public in any way. Even council members who generally support slow-growth policies supported the project, with both Councilman Eric Filseth and Councilwoman Lydia Kou calling it “reasonable.” Significantly, the project faced no opposition at all from the public during Monday’s brief hearing (this is in sharp contrast to the proposed expansion of Castilleja School, which has galvanized significant neighborhood opposition). Kou said that in Bowman’s case, neighbors had reached out to her even before she joined the council to tell her that this is a good project. “I do know there’s been thought given to every part of this,” Kou said. The only area the council raised concerns about was whether zoning decisions should treat private schools differently from

public school. While planning staff didn’t make any distinction between public and private in evaluating the proposal, the council agreed that the topic warrants further discussion. Penny Ellson, a leading bike advocate who helped spearhead the city’s Safe Routes to School program, encouraged the council not to set a precedent of treating private schools as civic “community center” facilities. Private schools, she wrote, “draw most of their students from out of town, and generally do not offer use of their playground and building facilities for public use as our public schools do outside of school hours.” “Further, unlike local public schools, private schools’ limited TDM (transportation-demand management) efforts have yielded poor results because of the longer distances their families travel,” she wrote. Q Staff Writer Gennady Sheyner can be emailed at gsheyner@ paweekly.com.

Shop the Palo Alto Citywide Yard Sale Saturday, June 3 8am – 2pm

A full-page ad with sale locations and merchandise will be available in the June 2, 2017 edition of the Palo Alto Weekly. Map and sale listings will also be available online in late May at www.PaloAltoOnline.com/yardsale For more information about the Yard Sale PaloAltoOnline.com/yardsale zerowaste@cityofpaloalto.org (650) 496-5910 Page 10 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


Upfront

Public Agenda

School board (continued from page 5)

A preview of Palo Alto government meetings next week CITY COUNCIL ... The council plans to review the draft Natural Environment, Safety and Business & Economics elements in the updated Comprehensive Plan. The meeting will begin at 5 p.m. on Monday, May 15 in the Council Chambers at City Hall, 250 Hamilton Ave. CITY/SCHOOL LIAISON COMMITTEE ... The committee plans to meet at 8 a.m. on Thursday, May 18, in the school district headquarters, 25 Churchill Ave. ARCHITECTURAL REVIEW BOARD ... The board plans to consider a proposal by Bowman School to demolish three single-family homes and construct a new preschool at 689-693 Arastradero Road that would also serve as satellite expansion of the school’s existing Terman Drive campus; and review wireless location/siting criteria for deployment of Verizon wireless communication equipment on utility poles. The meeting will begin at 8:30 a.m. on Thursday, May 18, in the Council Chambers at City Hall, 250 Hamilton Ave. COUNCIL FINANCE COMMITTEE ... The committee plans to review the proposed 2018 Municipal Fee Schedule; the proposed capital budget in the General Fund; and the Utilities Department budget. The committee will also consider proposed changes to utility rates. The meeting will begin at 2 p.m. on Thursday, May 18, in the Council Chambers at City Hall, 250 Hamilton Ave. PUBLIC ART COMMISSION ... The commission plans to consider recommending Charles Sowers as the project artist for the Junior Museum and Zoo; consider allocating funds for re-coating of Albuquerque by Gale Wagner; discuss seven artworks recently identified as most in need of restoration or deaccession; and hear an update about Code:ART. The meeting will begin at 7 p.m. on Thursday, May 18, in the Community Meeting Room at City Hall, 250 Hamilton Ave.

Police (continued from page 9)

will eliminate the need for pulling officers off the street to deal with these tasks and will help the department be more transparent and win community trust.

“You don’t need it until it’s too late,” Fine said. Fine’s proposal to tentatively approve the Police Department’s proposed budget passed by a 3-1 vote, with Tanaka dissenting. The full council will have a chance to review the proposed change when it approves the 2018 budget next month. Q

challenges, with the added safety net of an extra point for weighted grades. They argued there is no evidence connecting weighted grades and academic stress. Other parents and students, however, said they support a freshman year without the added pressure of weighted grades. Collins eventually made a failed motion, supported only by Baten Caswell, to strike the freshmanyear recommendation. All board members agreed, however, that after nine months of heated debate, multiple meetings and hundreds of emails on the weighted GPA topic, they are ready to move on to other pressing issues in the district. A parent delivered a petition on Tuesday night that urged the board to turn its attention to several well-known sources of stress: homework, test and project stacking, grading practices and overloaded schedules. “We should get on to those things,” Dauber said. “I really encourage parents to come and hold our feet to the fire on that as you have to this topic.” Collins countered by saying accountability falls squarely on the board’s shoulders. “While I would encourage parents to come hold feet to the fire, we have no one to blame but

ourselves,” he said. “The fault is not in our stars but in ourselves.” Other related recommendations the board approved include creating a team (including teachers, students and parents) to evaluate the impact of reporting weighted grades over the next several years, standardizing the process by which courses receive honors designation and identifying ways to help more low-income and minority students enroll and succeed in AP and honors classes. In other business Tuesday, the board unanimously agreed on the resolution agreement as the next step in addressing a complaint filed in January by the U.S. Department of Education’s Office for Civil Rights, alleging parts of the district’s website are inaccessible to people with disabilities. The resolution agreement commits the district to a series of corrective steps to bring the website into compliance, including auditing its website, making any necessary improvements and continued reporting back to the Office for Civil Rights. Hailing the elementary math adoption process as transparent and thorough, trustees also voted 5-0 to roll out Bridges in Mathematics as the core math textbook at the elementary schools this fall, with Eureka/Engage New York as a supplementary material. The board also unanimously approved the hiring of a new

assistant superintendent for human resources to replace Scott Bowers, who is retiring at the end of the school year. Karen Hendricks, who is currently serving as interim superintendent in the Carmel Unified School District, will start in Palo Alto Unified on July 1. Prior to her interim role, she was Carmel Unified’s chief human resources officer for two years, according to her LinkedIn page, and worked as assistant superintendent for four years in Santa Cruz City Schools. Hendrick’s base salary will be $205,988, plus an additional “career increment” of about $3,200, according to the district. The board also unanimously approved the elimination of several classified positions as part of ongoing budget cuts but decided to wait to take action on an outreach specialist position at Jordan Middle School. Several parents and students spoke during the open forum section of the meeting about the crucial role that person has filled in supporting students of color at Jordan and serving as a much-needed bridge between the school and East Palo Alto families. The board asked staff to come back with more information about how that role, if cut, could be otherwise filled at the schools. Q Staff Writer Elena Kadvany can be reached at ekadvany@ paweekly.com.

A rare bird has come to life. When Neal and Amy Fraser first saw the earthquake damaged St. Vibiana Cathedral in Downtown L.A., they spotted its potential to be the perfect home for their restaurant. What they needed was the financing to restore the historic landmark. They chose to work with us. St. Vibiana once served as the center of its community. Today, this husband and wife team honors that tradition as guests gather for weddings, social events, and elegant dinners to enjoy Redbird restaurant’s modern American hospitality. See how far we can take you. Visit us at eastwestbank.com/achieve Or call 1.877.828.8963 Equal Housing Lender

Member FDIC

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 11


Upfront

Online This Week

These and other news stories were posted on Palo Alto Online throughout the week. For longer versions, go to www.PaloAlto Online.com/news.

Man convicted in shooting

A 24-year-old Stockton man was found guilty of first-degree murder Wednesday morning by a San Mateo County Superior Court jury in connection with the 2015 killing of a 31-year-old man in East Palo Alto, according to prosecutors. (Posted May 10, 5:27 p.m.)

Men arrested for possessing cocaine base

Two men were arrested after cocaine base, numerous guns and a large amount of money were found in an East Palo Alto home on Friday around 2 p.m. (Posted May 3, 3:12 p.m.)

Sheriffâ&#x20AC;&#x2122;s imposters solicit money

Sheriffâ&#x20AC;&#x2122;s officials in Santa Clara County are warning residents about a phone scam involving fake sheriffâ&#x20AC;&#x2122;s deputies who tell victims they have a warrant and to load money to prepaid card to avoid arrest. (Posted May 8, 11:47 a.m.) Want to get news briefs emailed to you every weekday? Sign up for Express, our daily e-edition. Go to www.PaloAltoOnline.com to sign up.

NOTICE OF PUBLIC MEETING of the City of Palo Alto Historic Resources Board [HRB] 8:30 A.M., Thursday May 25, 2017, Palo Alto Council Chambers, 1st Floor, Civic Center, 250 Hamilton Avenue. Contact Robin Ellner for additional information during business hours at 650-329-2603. NEW BUSINESS 1. 250 and 350 Sherman Avenue [17PLN-00136 and 17PLN-00135]: Historic Resources Board Study Session to discuss a Preliminary Architectural Review application for a new approximately 40,351 sq. ft. Public Safety Building at 250 Sherman Avenue and a new approximately 37,075 sq. ft. parking structure to contain 636 parking spaces on six levels, two of which would be below grade. Public Safety Building site would be developed with three individual buildings and 167 parking spaces for use by the Palo Alto Police Department, 911 Emergency Dispatch Center, Emergency Operations Center, 6É&#x2030;JL VM ,TLYNLUJ` :LY]PJLZ HUK -PYL +LWHY[TLU[ AVUL +PZ[YPJ[! PF; Public Facilities. 2. 303 Parkside Drive [16PLN-00395]: Historic Resources Board formal review of an Architectural Review application requesting an update of the pool and deck, and the construction of an approximately 1,800 square foot community room to be located between the pool and park on the existing Green Meadow community center site within the Green Meadow National Register Historic District. The project includes a Conditional Use Permit (CUP) amendment request. AVUL+PZ[YPJ[!9:":PUNSL-HTPS`9LZPKLU[PHS^P[OZM minimum lot size and Single Story Combining District. 3. 640 Waverley Street [17PLN-00105]: Historic Resources Board Study Session to discuss a Preliminary Architectural Review application for a Mixed Use Building to replace two structures on a Downtown site KL[LYTPULKPULSPNPISLMVYSPZ[PUNHZHOPZ[VYPJYLZV\YJLAVUL+PZ[YPJ[! CD-C(P); Community Downtown-Commercial with Pedestrian Overlay Combining District. 4. Mills Act Program Discussion: Continuation of Discussion from April 27, 2017 HRB Meeting Amy French *OPLM7SHUUPUN6É&#x2030;JPHS The City of Palo Alto does not discriminate against individuals with disabilities. To request an accommodation for this meeting or an alternative format for any related printed materials, please contact the Cityâ&#x20AC;&#x2122;s ADA Coordinator at 650.329.2550 (voice) or by e-mailing ada@cityofpaloalto.org.

Page 12 â&#x20AC;˘ May 12, 2017 â&#x20AC;˘ Palo Alto Weekly â&#x20AC;˘ www.PaloAltoOnline.com

Join us to honor seven distinguished seniors who have made signiďŹ cant professional and community contributions:

Ruth & George Chippendale Dexter Dawes Marion Mandell Judy Sleeth Carol & Terry Winograd

Sunday, May 21, 2017 3:00 - 5:00 p.m. Call (650) 289-5445 or visit www.avenidas.org for tickets and event location.

Nordic (continued from page 5)

the German invasion. Most lodges are named after powerful women figures in Norway, and there are other lodges in Cupertino, San Francisco and Lafayette, member Randi Adams said. The Daughters of Norway, under which the lodges are chapters, was founded in 1905 in Seattle, Washington, to provide a sisterhood for Norwegian immigrant women, assisting them in becoming Americans, yet maintaining and preserving traditional Norwegian heritage, Adams said. Generations of women and men from Scandinavian countries arrived in San Francisco from the Midwest in the 1870s and 1880s; some arrived after an economic depression in Norway, working in shipyards and in construction. Others were merchant seamen, according to a 2007 City of San Francisco report. Additional immigrant waves arrived in the 1900s and after World War II, establishing themselves in the East Bay and the Midpeninsula. Scandinavians were also hired by Hewlett-Packard Company in the early 1960s and â&#x20AC;&#x2DC;70s. The company recruited whole college graduating classes of Norwegian engineers, Adams said. More recently, an influx of Norwegians into Silicon Valley has been supported by the Norwegian governmentâ&#x20AC;&#x2122;s Innovation Norway Program, which opened the Nordic Innovation House in Palo Alto in 2011. The startup incubator located at 470 Waverley St. hosts more than 180 Nordic tech companies, according to its website. Adams is the lodgeâ&#x20AC;&#x2122;s only Scandinavian native these days. She joined the lodge in 1999 and she has learned some surprising things from third-generation descendants of early immigrants. â&#x20AC;&#x153;Their cultures donâ&#x20AC;&#x2122;t exist in Norway anymore, so Iâ&#x20AC;&#x2122;m learning about the Old Norway,â&#x20AC;? she said. Some members carry on the old tradition by wearing bunads, traditional costumes that are no longer worn in Norway. That was one of the surprises for Adams when she walked in the door, she said. In the early days, members only spoke Norwegian and dressed more formally; now everyone speaks English and people dress in jeans, said Ann Bertiglia, an eight-year lodge member and its marketing coordinator. There are attorneys and teachers; a librarian and homemakers; entrepreneurs and professionals in life sciences and seniors and health. Some members are â&#x20AC;&#x153;incredible cooks,â&#x20AC;? Bertiglia said. Lodge President Mallory von Kugelgen joined four years ago after her 14-year-old daughter, Simone, wanted to learn more about her Norwegian heritage on her fatherâ&#x20AC;&#x2122;s side. Von Kugelgen told her daughter that she would only drive her to the door. At the last minute Simone became (continued on next page)


Upfront (continued from previous page)

nervous and urged her mother to come inside with her. Von Kugelgen said she did not plan to attend the meeting. But “everybody was lovely,” she recalled. Adams also has a daughter of the same age and the girls bonded, von Kugelgen recalled. “They just dove in. Randi’s kids added a bonus. It’s not something you are being dragged to; now you are coming to meet your new friends,” she said. And new members are always “velkommen.” They must be 13 years or older; be from Norway, Sweden, Finland, Denmark or Iceland by birth or descent; have or had a spouse born or descended from these countries; or have a relative married to a person of Norwegian birth or descent. One member has an Italian background. “It’s fun to see her in a bunad talking about cannoli,” von Kugelgen said. The lodge meets every third Saturday of the month except for July and August. More information about the Daughters of Norway Sigrid Undset Scandinavian Women’s Club is available at facebook.com/ DofNPaloAlto; online at tinyurl. com/n8tml62 or by contacting Randi Adams, membership chair, at randijorgadams@comcast.net. Q Staff Writer Sue Dremann can be emailed at sdremann@ paweekly.com.

Fees

Parking fees going up?

(continued from page 5)

per year to $280 for six months ($560 annually), a 20 percent hike. A more significant change will hit employees around California Avenue who buy permits to park on the streets of the Mayfield and Evergreen Park neighborhoods. The cost of a six-month permit is set to rise by 276 percent, from the current level of $149 per year to $280 for a six-month period ($560 annually). Low-income workers, meanwhile, will see their permit rate go up from $50 per year to $50 for six months ($100 annually). A daily pass for parking in both downtown and Evergreen Park neighborhood RPPs would go up from $5 to $25, a change that staff says will “bring uniformity and move toward revenues covering program costs.” Meanwhile, an annual permit for a California Avenue garage is set to go up from $149 to $280 per year, an 84.6 percent jump. In downtown, the annual permit cost would go up by 20 percent, from $466 to $560. The price of a daily parking permit for city garages and lots would go up to $25 in both downtown, where the current rate is $17.50, and on California Avenue, where the rate is $8 today. The shift means that the rate for a daily parking pass in a California Avenue garage will jump up by 212.5 percent. The decision to ratchet up the

Permits for Palo Alto’s downtown, California Avenue could cost five times as much RPP zone - annual RPP zone - annual (low-income) RPP zone - day City lot/garage - annual City lot/garage - day

Downtown Now Proposed $466 $560* $100 $100*

California Avenue Now Proposed $149 $560* $50 $100*

$5 $5 $466 $560 $17.50 $25

$5 $149 $8

$25 $280 $25

* Permits sold in six-month increments. Not included: permit fees for residents’ permits in RPP zones. Source: City of Palo Alto

parking rates was driven in large part by a recently completed Downtown Parking Management Study, which recommended a broader switch away from the current system of color zones, which offers free parking with a two-hour limit, to a system of paid parking, whether through parking meters or pay stations. The study also compared the parking rates in surrounding cities and concluded that Palo Alto’s current prices per permit are comparatively low. While the city is proceeding slowly on redesigning downtown’s parking ecosystem, officials are preparing to move swiftly with the rate change. Last week, the city’s Budget Director Kiely Nose told the Finance Committee during an overview of the 2018 budget that funds from the higher parking rates would be used to make “significant investments” in

parking infrastructure. “We’re moving up in terms of permit prices so that we can start to fund some of the critical projects like access controls, paid parking and the parking guidance system (at local garages),” Nose said, referring to technology that will use red and green lights to identify open spaces. Another significant change concerns the fee for groundwater pumping, an activity that has been the subject of sharp criticism over the past year. With residents calling for tighter regulations, if not an outright moratorium, on what’s known as “dewatering,” the council has recently instituted new requirements, including that property owners create “fill stations” so the pumped-out water can be used for irrigation or construction cleanup. The council is also considering adopting even more stringent regulations next year, which

may include a requirement that contractors avoid “broad-area” dewatering techniques in favor of a more targeted approach that requires less pumping. But while these rules are not set to arrive until next year, the city isn’t waiting that long to establish the higher fee for discharging groundwater. The proposal in Keene’s municipal fee schedule calls for raising the fee from the current level of $2,903 to $14,093, a 385.5 percent hike. According to a report from the Administrative Services Department, the increase was made to “adjust for actual costs, including department-specific overhead, and meet Council’s cost-recovery directive.” It also includes the cost for paying consultants to evaluate the impacts of dewatering. Q Staff Writer Gennady Sheyner can be emailed at gsheyner@ paweekly.com.

1492 Webster Street, Palo Alto MAGNIFICENT NORTH PALO ALTO ESTATE Situated on a corner with sprawling grounds, majestic oaks, a grove of birch trees and a dozen-and-a-half Meyer lemon bushes, this remodeled and updated Craftsman-style, three-story home with basement provides the opportunity to split the property and build a second home or guest house. The parcel measures more than 23,000 sq. ft. Enjoy living in one of the largest properties in Palo Alto and build a tennis court, a pool and enjoy your own resort. Or, sell off part of the land for the development of another single-family home. The home also has an 869-sq-ft garage joined to a 470-sq-ft workshop that could easily be converted into a guest house. The verdant landscaped grounds with its large play structure provides a spacious yard for children. This lovely 4,223-sq-ft home has six bedrooms, 4.5 baths plus a basement of approximately 400 sq. ft. Acclaimed Palo Alto Schools, Walter Hays (K-5), Jordan Middle (6-8), Palo Alto High (9-12). Buyer to verify enrollment.

NEW PRICE: $8,445,000 — WWW.1492WEBSTER.COM BY APPOINTMENT ONLY

(650) 475-2030

lhunt@serenogroup.com CalBRE# 01009791

(650) 475-2035

laurel@serenogroup.com CalBRE# 01747147

www.LeannahandLaurel.com This information was supplied by third party sources. Sales Associate believes this information is correct but has not verified this information and assumes no legal responsibility for its accuracy. Buyer should verify accuracy and investigate to Buyer’s own satisfaction.

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 13


FINE ART

PARK

L O S A LT O S R O TA R Y ’ S 4 2 N D A N N U A L O P E N - A I R A R T S H O W

May 20-21 10:00 am to 5:30 pm Lincoln Park, Los Altos

FUN FOR THE ENTIRE FAMILY!

Come by and see us some time... we have the open door policy!

• Live entertainment on 2 stages • Face painting for children • Proceeds benefit Rotary charities

Serving the community for over 26 years!

Charlie Porter Farmers® Agency License # 0773991

671-A Oak Grove Ave, Menlo Park cporter2@farmersagent.com

Free parking and shuttle at Los Altos High School, 201 Almond Ave.

www.RotaryArtShow.com Artwork (top l–r): detail from Suzanne at Her Easel by Suzanne Etienne; CT-14 by Richard Starks; detail from The Releasing of the Sorrows by Paul Bond; Thistles on Orange by Erin Hanson. Bottom: A Boy, A Dog, and A Boat and Mendocino Breeze by Anne Klocko. Poster design: Alexander Atkins Design, Inc.

PALO ALTO CITY COUNCIL

GLEIM THE

JEWELER

I

Mom Celebrate!

Happy Birthday

Spring Into Celebration Stop in and toast your celebration at our newly redesigned flagship store ~ Throughout the month of May ~ Champagne and tasty treats served daily!

Stanford Shopping Center and 540 University Avenue, Palo Alto 650-325-3533 / gleimjewelers.com

Page 14 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

A weekly compendium of vital statistics

POLICE CALLS

• Fine art and gifts from 150+ artists • Great refreshments and food

Pulse

CIVIC CENTER, 250 HAMILTON AVENUE BROADCAST LIVE ON KZSU, FM 90.1 CABLECAST LIVE ON GOVERNMENT ACCESS CHANNEL 26 *************************************************** THIS IS A SUMMARY OF COUNCIL AGENDA ITEMS. THE AGENDA WITH COMPLETE TITLES INCLUDING LEGAL DOCUMENTATION CAN BE VIEWED AT THE BELOW WEBPAGE: http://www.cityofpaloalto.org/gov/agendas/default.asp

AGENDA- SPECIAL MEETING–COUNCIL CHAMBERS May 15, 2017, 5:00 PM Consent Calendar 2. Approval and Authorization for the City Manager to Execute Contract Number C17167501 With Daleo, Inc. in the Amount of $5,735,538 for Water Main Replacement Project 26, Capital Improvement Program (WS-12001) in the Downtown North, University South and Old Palo Alto Neighborhoods; and Approval of an Amendment to the FY 2017 Budget in the Amount of $885,976 Along With an Equivalent Decrease in the Water Fund Capital Reserve 3. Adoption of a Resolution Summarily Vacating Public Utility Easement at 144 Kellogg Avenue 4. Approval of Amendment Number One to Contract Number C14152828 With MV Transportation to Extend the Term for two Years for $625,980 to Operate the Palo Alto Free Shuttle Service on the Existing Crosstown Shuttle Route Until June 2019; and Approval of a Budget Amendment in the General Fund Action Items 5. Comprehensive Plan Update: Review of the Draft Natural Environment, Safety, and Business & Economics Elements Recommended by the Citizens Advisory Committee STANDING COMMITTEE MEETINGS The Special City School Liaison Committee Meeting will be held H[[OL7HSV(S[V<UPÄLK:JOVVS+PZ[YPJ[VU4H`H[! AM to discuss: 1) Discussion about Public Employee Housing; 2) Discussion and update about Project Safety Net; and 3) Update on Cubberley Master Plan. The Special Finance Committee Meeting will be held in the Council Chambers on Thursday, May 18, 2017 at 2:00 PM to discuss: 1) May 9th Budget Hearing Continuation; 2) Fiscal Year 2018 Proposed Municipal Fee Schedule; 3) General Fund; 4) Utilities Department; 5)Utility Rate Review and Approval; 6) Utilities Advisory Commission Recommendation That the City Council Adopt 1) a Resolution Approving the Fiscal Year 2018 Electric Financial Plan, and 2) a Resolution Increasing Electric Rates by Amending the E-1, E-2, E-2-G, E-4, E-4-G, E-4 TOU, E-7, E-7-G, E-7 TOU and E-14 Rate Schedules; 7) Utilities Advisory Commission Recommendation That the City Council Adopt a Resolution Approving the Fiscal Year 2018 Gas Utility Financial Plan with no Changes to Distribution Rates; 8) Follow-up Information on Water Utility Rate Comparisons; and 9) Wrap-Up.

Palo Alto May 3-9

Violence related Domestic violence . . . . . . . . . . . . . . . . 1 Family violence . . . . . . . . . . . . . . . . . . . 1 Theft related Commercial burglaries . . . . . . . . . . . . . 1 Fraud . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Grand theft . . . . . . . . . . . . . . . . . . . . . . 2 Identity theft . . . . . . . . . . . . . . . . . . . . . 4 Petty theft . . . . . . . . . . . . . . . . . . . . . . . 1 Vehicle related Driving w/ suspended license. . . . . . . . 3 Driving without license . . . . . . . . . . . . . 1 Hit and run . . . . . . . . . . . . . . . . . . . . . . 3 Lost/stolen plates . . . . . . . . . . . . . . . . . 1 Misc. traffic . . . . . . . . . . . . . . . . . . . . . . 1 Theft from auto . . . . . . . . . . . . . . . . . . . 7 Vehicle accident/minor injury . . . . . . . . 8 Vehicle accident/prop damage. . . . . . . 6 Vehicle tow . . . . . . . . . . . . . . . . . . . . . 13 Vandalism to vehicle . . . . . . . . . . . . . . . 1 Forged registration . . . . . . . . . . . . . . . . 1 Alcohol or drug related Chronic nuisance/drinking in public . . . 2 Drunk in public . . . . . . . . . . . . . . . . . . . 2 Possession of drugs . . . . . . . . . . . . . . . 2 Possession of paraphernalia . . . . . . . . 2 Public nuisance . . . . . . . . . . . . . . . . . . 2 Resisting arrest while drunk . . . . . . . . . 1 Miscellaneous Found property. . . . . . . . . . . . . . . . . . . 6 Lost property . . . . . . . . . . . . . . . . . . . . 1 Man down. . . . . . . . . . . . . . . . . . . . . . . 1 Psychiatric hold . . . . . . . . . . . . . . . . . . 2 Suspicious circumstances . . . . . . . . . . 3 Vandalism . . . . . . . . . . . . . . . . . . . . . . . 2 Warrant/other agency . . . . . . . . . . . . . . 5

Menlo Park May 3-9

Violence related Assault . . . . . . . . . . . . . . . . . . . . . . . . . 1 Assault w/ a deadly weapon. . . . . . . . . 1 Spousal Abuse . . . . . . . . . . . . . . . . . . . 1 Theft related Fraud . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Grand theft . . . . . . . . . . . . . . . . . . . . . . 1 Petty theft . . . . . . . . . . . . . . . . . . . . . . . 7 Vehicle related Auto recovery . . . . . . . . . . . . . . . . . . . . 1 Driving w/ suspended license. . . . . . . . 8 Hit and run . . . . . . . . . . . . . . . . . . . . . . 2 Parking/driving violation . . . . . . . . . . . . 1 Vehicle accident/major injury . . . . . . . . 1 Vehicle accident/minor injury . . . . . . . . 1 Vehicle tow . . . . . . . . . . . . . . . . . . . . . . 2 Alcohol or drug related Driving under the influence . . . . . . . . . . 1 Drug activity . . . . . . . . . . . . . . . . . . . . . 1 Drunk in public . . . . . . . . . . . . . . . . . . . 1 Possession of drugs . . . . . . . . . . . . . . . 2 Possession of paraphernalia . . . . . . . . 3 Sale of drugs. . . . . . . . . . . . . . . . . . . . . 1 Under influence of drugs . . . . . . . . . . . 2 Miscellaneous CPS referral . . . . . . . . . . . . . . . . . . . . . 5 Child custody issue. . . . . . . . . . . . . . . . 1 Disturbance . . . . . . . . . . . . . . . . . . . . . 3 Disturbance/annoying phone calls . . . . 1 Found property. . . . . . . . . . . . . . . . . . . 1 Gang validations . . . . . . . . . . . . . . . . . . 1 Info. case . . . . . . . . . . . . . . . . . . . . . . . 2 Juvenile problem . . . . . . . . . . . . . . . . . 3 Medical aid . . . . . . . . . . . . . . . . . . . . . . 1 Mental evaluation . . . . . . . . . . . . . . . . . 1 Suspicious circumstances . . . . . . . . . . 1 Vandalism . . . . . . . . . . . . . . . . . . . . . . . 4 Warrant arrest. . . . . . . . . . . . . . . . . . . . 2

VIOLENT CRIMES Palo Alto

Curtner Avenue, 5/08, 8:15 p.m.; domestic violence/battery. Transport Street, 5/04, 7:02 p.m.; family violence/misc.

Menlo Park

800 block Coleman Avenue, 5/04, 3:58 p.m.; spousal abuse. 1300 block Madera Avenue, 5/07, 7:38 p.m.; battery. 200 block Terminal Avenue, 5/08, 5:29 a.m.; Assault with a deadly weapon.


G U I D E TO 2017 S U M M E R C A M P S FO R K I D S

n n o e C c t p i o m n a C

For more information about these camps, see our online directory of camps at paloaltoonline.com/camp_connection To advertise in this weekly directory, call: 650.326.8210

ARTS, CULTURE, OTHER CAMPS Art and Soul Summer Camps

Palo Alto

ACADEMICS Alexa Café

ATHLETICS

Stanford, Palo Alto High School

Art, cooking, tinkering, Yoga and mindfulness. We celebrate multiple perspectives and recognize the many ways for our children to interpret their world! Summer Unplugged! Ages 5-13 years. Walter Hays School

Girls ages 10-15 discover technology in a unique environment that celebrates creativity, social activism, and entrepreneurship. Girls learn engineering principles, code games, design websites, explore cyber secuirty, and much more.

www.artandsoulpa.com

www.iDTech.com/Connection

Athena Camps

650.269.0423

Los Altos & San Jose

1.844.788.1858

Castilleja Summer Camp for Girls

Palo Alto

Community building weekly day camps for girls K 8th grade.   A unique combination of sports, art projects and mentorship designed to build confidence. Sports: tennis, volleyball, yoga, fitness, and self-defense and more.  Themes: Connect & Communicate, Love & Express Yourself, Unleash Your Happiness.

Casti Camp offers girls a range of age-appropriate activities including athletics, art, science, computers, writing, crafts, cooking, drama and music classes each day along with weekly field trips.

www.AthenaCamps.com

Harker Summer Programs

408.490.4972

Community School of Mountain View Music and Arts (CSMA) Mountain View 50+ creative camps for Gr. K-8! Drawing, Painting, Ceramics, Sculpture, Musical Theater, Summer Music Workshops, more! Two-week sessions; full and half-day enrollment. Extended care available. Financial aid offered.

www.arts4all.org

650.917.6800 ext. 0

J-Camp at the OFJCC

Palo Alto

With options for every age, schedule and interest, J-Camp has you covered. Traditional camps focus on variety and building friendships, while specialty camps include fantastic options like Robotics, Ceramics, Ocean Adventures, Food Truck Challenge, TV Studio Production and more. We’re looking forward to our best summer ever and want your family to be part of the experience.

www.ofjcc-jcamp.com

Pacific Art League

650.223.8622

Palo Alto

Dive into creativity this summer! Sign up now to reserve a seat in our week-long half- and full-day camps for youth and teens ages 9-16. Topics include painting, printmaking, cartooning, anime, digital art, animation, photography, ceramics and more! Scholarships available!

www.pacificartleague.org/classes 650.321.3891

Palo Alto Community Child Care (PACCC)

Palo Alto

PACCC summer camps offer campers, grades 1st to 6th, a wide variety of fun opportunities! We are excited to announce all of your returning favorites: Leaders in Training (L.I.T.), PACCC Special Interest Units (S.I.U.),  F.A.M.E. (Fine Arts, Music and Entertainment), J.V. Sports and Operation: Chef! Periodic field trips, special visitors and many engaging camp activities, songs and skits round out the fun offerings of PACCC Summer Camps! Open to campers from all communities! Come join the fun in Palo Alto! Register online.

www.paccc.org

Summer at Athena Academy

650.493.2361

Palo Alto

Summer at Athena Academy offers specialized week-long camps for children to EXPLORE their passions, CREATE new memories, BUILD friendships and PLAY to their hearts’ content. Camps include coding, sports & fitness, art, music and more.

www.AthenaAcademy.org/Summer

650.543.4560

TheatreWorks Silicon Valley

Palo Alto Menlo Park

www.castilleja.org/summercamp

650.470.7833

San Jose

Harker summer programs for preschool -  grade 12 children include opportunities for academics, arts, athletics and activities. Taught by exceptional, experienced faculty and staff, our programs offer something for everyone in a safe and supportive environment.

www.summer.harker.org

408.553.5737

iD Tech Camps

Stanford, Bay Area

Students ages 7–17 can learn to code apps, design video games, mod Minecraft, engineer robots, model 3D characters, design for VR, explore cyber security, and more. Students explore campus, learn foundational STEM skills, and gain selfconfidence.

www.iDTech.com/Connection

1.844.788.1858

Mid-Peninsula High School

Menlo Park

Mid-Pen’s Summer Session offers an innovative series of oneweek courses that give students the opportunity to customize their own summer program. These courses go beyond traditional curriculum, giving students the opportunity to enhance their skills while seeking either enrichment or credit repair.

www.mid-pen.com

650.321.1991

STANFORD EXPLORE: A Lecture Series on Biomedical Research

Stanford

explore.stanford.edu explore-series@stanford.edu

Palo Alto Pleasanton

Improve your student’s writing skills this summer at Emerson School of Palo Alto and Hacienda School of Pleasanton. Courses this year are Expository Writing, Creative Writing and Presentation Techniques. Visit our website for more information.

www.headsup.org

Emerson: 650.424.1267 Hacienda: 925.485.5750

We are the Premier youth sports summer camp. We bring the fun to camp and with over 25 years of experience we make sure your child has an experience of a lifetime!!!!

www.hifivesports.com

650.362.4975

Kim Grant Tennis Academy Summer Camps

Palo Alto Monterey*

Fun and specialized junior camps for Mini (3-5), Beginner, Intermediate, Advanced, High Performance and Elite levels. Weekly programs designed by Kim Grant to improve player technique, fitness, agility, mental toughness and all around game. Weekly camps in Palo Alto and sleep away camps at Meadowbrook Swim and Tennis*.

www.KimGrantTennis.com

Nike Tennis Camps

650.752.8061

Stanford University

Junior Overnight and Day Camps for boys & girls, ages 9-18 offered throughout June, July and August. Adult Weekend Clinics (June & Aug). Camps directed by Head Men’s Coach, Paul Goldstein, Head Women’s Coach, Lele Forood, and Associate Men’s and Women’s Coaches, Brandon Coupe and Frankie Brennan.  Come join the fun and get better this summer!

www.USSportsCamps.com

1.800.NIKE.CAMP (1.800.645.3226)

Camp High Five Overnight Camp

La Honda, Pinecrest

Our Camp offers the ultimate combination of sports, adventure and creativity! Coaches bring lots of positive energy and enthusiasm every day.  Each week of day camp features two to three adventures with all other days held at Juana Briones Elementary.  Adventure highlights include climbing tower, archery, dodgeball on the beach, kayaking, Great America and more. Overnight Camp includes kayaking, horseback riding, archery, campfires, sports, crafts and more.  Ages 6-14.  Financial aid available.

Spartans Sports Camp

650.823.5167

Mountain View

Spartans Sports Camp offers multi-sport, week-long sessions for boys and girls in grades 2-7, sport-specific sessions for grades 2-9, color guard camp for grades 3-9, and cheerleading camp for grades pre-K – 8. We also offer a hip hop dance camp for grades 1-7. Camp dates are June 12 through  July 28  at Mountain View High School. The camp is run by MVHS coaches and student-athletes and all proceeds benefit the MVHS Athletic Department. Lunch and extended care are available.

www.SpartansSportsCamp.com

Stanford Water Polo

650.479.5906

Stanford

Ages 7 and up. New to sport or have experience, we have a camp for you. Half day or fully day option for boys and girls. All the camps offer fundamental skill work, scrimmages and games.

www.stanfordwaterpolocamps.com

ATHLETICS City of Mountain View Recreation

Sacred Heart Schools Atherton

www.runforfuncamps.com

EXPLORE biomedical science at Stanford! Stanford EXPLORE offers high school students the unique opportunity to learn from Stanford professors and graduate students about diverse topics in biomedical science, including bioengineering, neurobiology, immunology and many others.

Write Now! Summer Writing Camps

Hi Five Sports Summer Camp

YMCA Summer Camps

650.725.9016

Silicon Valley

Kids who love to act have fun, put on a show, and learn from pros at the acclaimed TheatreWorks Silicon Valley camps for budding theatre enthusiasts. Spring Break camps for K-6. Summer Camps for K-12, plus special teen programs.

Come have a blast with us this summer! We have something for everyone – Recreation Camps, Specialty Camps, Sports Camps, Swim Lessons and more! Programs begin June 5th – register early!

At the Y, children and teens of all abilities acquire new skills, make friends, and feel that they belong. With hundreds of Summer Day Camps at 30+ locations plus Overnight Camps, you will find a camp that’s right for your family.  Financial assistance is available. 

www.theatreworks.org/learn/youth

www.mountainview.gov/register

www.ymcasv.org/summer

650.463.7146

Mountain View

650. 903.6331

408.351.6410

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 15


Marc Bertrand July 23, 1933 â&#x20AC;&#x201C; April 28, 2017 Emeritus Professor of French, Stanford University He is survived by his wife of 45 years, Vida Bertrand, their daughter Ariane, and their two grandchildren, Luc and Sophie. Professor Bertrand was born in Metz, France, completed his Ph.D. at the University of California at Berkeley, and began his career as a professor of French literature and civilization at Stanford in 1966. He was known in the scholarly community for his many articles on contemporary French literature. He taught two generations of undergraduate and graduate students at Stanford, and, in his later years, added courses on French literature and civilization for the broader Palo Alto community through Continuing Studies. In lieu of flowers, the family suggests donations in Professor Bertrandâ&#x20AC;&#x2122;s memory to a charity of your choice.

PAID

OBITUARY

NOTICE OF PUBLIC REVIEW PERIOD AND PUBLIC HEARINGS ON PALO ALTOâ&#x20AC;&#x2122;S COMMUNITY DEVELOPMENT BLOCKGRANT (CDBG) PROGRAM This is to notify the general public and other interested parties that a 30-day public review period of the Draft Annual Action Plan for the allocation of Fiscal Year 2017 Community Development Block Grant (CDBG) funds, will begin on May 15, 2017 and end on June 15, 2017. The Draft Annual Action Plan describes the activities the City may fund under the 2018 CDBG Program. Collec[P]LS`[OLZLHJ[P]P[PLZHYLPU[LUKLK[VTLL[7HSV(S[VÂťZHÉ&#x2C6;VYKHISL housing and community development objectives described in the 2015-2020 Consolidated Plan. Copies of the Draft Annual Action Plan will be available on May 15, 2017 at the Department of Planning and Community Environment, 250 Hamilton Avenue, 5th Floor, Palo Alto, CA 94301, on the Cityâ&#x20AC;&#x2122;s website http://www.cityofpaloalto.org/depts/pln/ advance_planning/cdbg.asp or by calling Eloiza Murillo-Garcia, Senior Planner, at (650) 329-2561. Interested parties are encouraged to submit written comments on the proposed Draft Annual Action Plan during the public review period, or to comment at the public hearings and meetings described below. PUBLIC HEARINGS AND MEETINGS The City of Palo Alto Finance Committee will hold a Public Hearing on June 6, 2017 to review the proposed Fiscal Year 2017 *+). M\UKPUN HSSVJH[PVUZ PKLU[PĂ&#x201E;LK PU [OL +YHM[ (UU\HS (J[PVU Plan. The Public Hearing will be held at 7:00 p.m., or as soon as possible thereafter, in City Hall Community Meeting Room, 250 Hamilton Avenue, Palo Alto. The Palo Alto City Council will hold a Public Hearing on June 19, 2017 to adopt the Annual Action Plan and the associated Fiscal Year 2017 CDBG allocations. The Public Hearing will be held at 6:00p.m., or as soon as possible thereafter, in City Hall Council Chambers, 250 Hamilton Avenue, Palo Alto. Persons with disabilities who require auxiliary aids or services in using City facilities, services or programs, or who would like information on the Cityâ&#x20AC;&#x2122;s compliance with the Americans with Disabilities Act (ADA) of 1990, may contact: ADA Coordinator, City of Palo Alto, 650-329-2550 (Voice) ada@cityofpaloalto.org Page 16 â&#x20AC;˘ May 12, 2017 â&#x20AC;˘ Palo Alto Weekly â&#x20AC;˘ www.PaloAltoOnline.com

Transitions Kenneth Vosti

Kenneth Lee Vosti died at home surrounded by his family on April 26 after an extended illness.

He was born on Sept. 15, 1928, in Modesto, to Henry and Lois Vosti, and grew up in Stanislaus County on a ranch in Salida and later in

NOTICE OF BUDGET ADOPTION PUBLIC HEARING 2017-18

Local Control and Accountability Plan & Budget As required by Education Codes 42103, 42127, and  [OL NV]LYUPUN IVHYK VM 7HSV (S[V <UPĂ&#x201E;LK School District will hold a public hearing to solicit public comment on the 2017-18 Local Control and Accountability Plan and proposed budget of the +PZ[YPJ[WYPVY[VĂ&#x201E;UHSHKVW[PVU The public hearing will be held on June 6, 2017, at !74 The public hearing will be held at: 3VJH[PVU! 7HSV (S[V <UPĂ&#x201E;LK :JOVVS +PZ[YPJ[ (KKYLZZ! *O\YJOPSS(]LU\L7HSV(S[V*(  The Local Control and Accountability Plan and budget can be inspected by the public beginning on June 1, 2017, during the hours of 8:00 AM and 4:45 PM at: 3VJH[PVU!7HSV(S[V<UPĂ&#x201E;LK:JOVVS+PZ[YPJ[ Address: 25 Churchill Avenue 7HSV(S[V*(  5/12/17 CNS-3005677# PALO ALTO WEEKLY

Marilyn Rhoades Hoffman February 5, 1933 â&#x20AC;&#x201C; April 26, 2017 Marilyn Rhoades Hoffman left this world peacefully at the end of April. Daughter of Donald and Dorothy Rhoades, Marilyn grew up in Palo Alto, California, on Washington Ave. She attended Castilleja School, followed by U.C. Berkeley, where she was a member of the Kappa Kappa Gamma sorority. Marilyn (or â&#x20AC;&#x2DC;Mouseâ&#x20AC;&#x2122; as her fellow Cal buddies referred to her), often shared the many special memories about her days at Berkeley. In 1955 she married Ralph Hoffman Jr. and they settled in Menlo Park, California. Marilyn dedicated her life to raising her three daughters: Nancy (of Inverness, CA.), Karen Gilhuly (husband Ned, of Woodside, Ca.) and Sheila Lee (husband Mark, of Cary, N.C.) She is also survived by her twin brother, Donald â&#x20AC;&#x153;Dustyâ&#x20AC;? Rhoades (of Placerville, CA.). She was deeply proud of her six grandchildren, Lauren, Claire, John and Kate Gilhuly and Will and Grace Lee. She was an avid reader, appraiser and dealer of rare books. Marilyn also had a green thumb and enjoyed seeing her garden evolve over the 50 years she lived in her home in Menlo Park. Many of Marilynâ&#x20AC;&#x2122;s happiest memories were made at Lake Tahoe, where she spent her summers with family and friends. Marilyn will be remembered by her dear friends from the many chapters of her journey for her GOP loyalty, quick wit, California Bear pride and inner beauty. In keeping with Marilynâ&#x20AC;&#x2122;s wishes, a private service will be held. Throughout Marilynâ&#x20AC;&#x2122;s life there had always been a canine companion at her side. In honor of her love of dogs, donations can be made to Monterey Bay Labrador Retriever Rescue, PO Box 269, Pebble Beach, CA 93953. PAID

OBITUARY

Modesto. Along with his parents and two brothers, Gordon and Don, he spent every summer camping, backpacking, fishing and hunting in wilderness areas in the Sierra Nevada, along the Klamath River in Northern California and at Tuolomne Meadows in Yosemite. After graduating from Modesto Junior College, he finished his undergraduate degree at Stanford University and graduated from Stanford medical school in 1954. After his internship and residency, he specialized in infectious diseases at the University of Illinois R.E. Hospital and the VA Medical Center in Chicago. He joined the Army and was assigned to the Walter Reed Medical Biomedical Research Unit at Fort Detrick in Frederick, Maryland. In 1959, while he was serving at Fort Detrick, he met and married Anne, his wife of 57 years. Together, they raised four daughters. After two years in the Army, he was recruited to Stanford medical schoolâ&#x20AC;&#x2122;s Division of Infectious Diseases. As a professor of medicine at Stanford, he conducted research, published more than 70 papers and taught generations of students at Stanfordâ&#x20AC;&#x2122;s Medical School. Over the course of his 65-year career, he served as acting chief of Stanfordâ&#x20AC;&#x2122;s Infectious Disease Division, director of Stanfordâ&#x20AC;&#x2122;s Clinical Microbiology lab and as a mentor to students and staff as associate dean of students and associate ombudsperson at Stanfordâ&#x20AC;&#x2122;s Medical School. Though he was a teacher, researcher and clinician, what he loved most was talking with students. According to his family, his abilities to listen non-judgmentally, empathize and offer just the right support and advice were his greatest gifts. In 2013, he was the first recipient of the RISE Award, which recognizes individuals who have demonstrated exceptional dedication to Stanford Medicine and the alumni community through acts of leadership, volunteerism, mentoring and teaching. He also was a passionate supporter of Stanford sports, faithfully rooting for every Stanford sport team, including football, basketball and baseball, and almost never missing a game. He is survived by his wife, Anne; his brother, Gordon Vosti; his daughters, LeeAnne McDermott, Laura Tauscher, Caroline Kohn and Aimee Lehr; 11 grandchildren and one great-grandchild. His family wishes to extend its gratitude to Mission Hospice for its loving and tender care during the past year. A celebration of his life will be held at 3 p.m., June 12, at St. Markâ&#x20AC;&#x2122;s Episcopal Church in Palo Alto. In lieu of flowers, a contribution may be made to an important cause of oneâ&#x20AC;&#x2122;s choice.


Lan Liu Bowling

SUHVHQWV

3487 Bryant Street, Palo Alto COMING SOON! OPEN HOUSE 5/ 19 (9:30–1:00), 5/20 (1:30–4:30), 5/21 (1:30–4:30)

Beautiful New Craftsman in Midtown Lu Luxury and spacious ambiance characterize this light-filled home of more than 4200 square feet with 7 bedrooms and 6 full baths. Designed and built to the highest standard squ – tthe best in fittings and finish, materials and workmanship, beautifully thought-out and implemented. A lovely blend of aesthetics and comfort from the broad covered por porch and patio of the rear yard, gorgeous chef's kitchen & family room with wide glass Na NanaWall joining outdoors and in, to the elegant sky-lit staircase and the walk-out bal balcony of the master suite, plus a large bright basement with home theater, wine closet and superbly equipped wet bar. All in a great Midtown location convenient to Charleston Center and Piazza's Market, Midtown shopping and restaurants, and the new Mitchell Cen Park Library and community center. Excellent Palo Alto Schools: Fair Meadow Par Ele Elementary, JLS Middle and Gunn High School (buyer to verify availability).

LISTED AT $4,798,000

Lan Liu Bowling

John Chung Keller Williams

Broker-Associate B

(650) 269-7538

(650) 520-3407 lan@lanbowling.com

johnmc@kw.com

CalBRE # 01248958

CalBRE # 01720510

Ranked Among the Country’s Top 100 Agents by the Wall Street Journal #1 Agent Among 134,000 Kw Agents Worldwide 2015

For more photos and information please visit:

www.3487Bryant.com www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 17


Editorial Beyond weighted GPAs As school board relents to parent pressure, a deeper look at school philosophy is needed

ith a lifeline delicately crafted by Superintendent Max McGee, the Palo Alto Unified School District Board of Education succumbed Tuesday night to relentless pressure from a well-organized group of parents and unanimously approved the reporting of weighted grade point averages on the official high school transcripts of graduating seniors. Given the intensity of the pressure and the other controversies the district has had to navigate in recent months, there was little doubt about the outcome. Opponents to instituting weighted GPAs, both within the district and in the community, had effectively been overwhelmed and silenced by those who believed high-achieving students in Palo Alto should be given every possible competitive advantage in the college application process. What began nine months ago with a single Palo Alto High School student complaining at a board meeting that her ability to obtain a merit scholarship from the University of Oregon was in jeopardy because Paly did not report weighted GPAs morphed into movement to reverse years of grade-reporting policy designed to moderate student competition. When the Oregon problem first surfaced, administrators attempted to contain parent concern by assuring students and parents the district would go to bat for any student with a scholarship eligibility problem by sending letters documenting weighted GPAs to colleges on a case-by-case basis. Palo Alto High School administrators and counselors, supported by McGee, attempted to mount a defense of the practice based on their professional judgment that reporting weighted GPAs would warp class choices, fuel an already hyper-competitive and stressful high school climate, and disadvantage some students. But parents conducted their own research and showed that reporting weighted GPAs was increasingly the norm at other high schools and asserting that Paly students taking AP or honors classes deserved every possible benefit from taking these rigorous classes. (With weighted grading, students enrolled in these classes get their grades bumped up one full point on their transcript.) But it was the discovery that Gunn had been using a different reporting practice than Paly that enraged many parents and put the district and trustees in an untenable position of having conflicting practices at its two high schools. It was yet another example of the harm of so-called site-based decision-making, an uncodified but well-entrenched philosophy that allows individual schools to adopt practices that conflict with each others’. Faced with having to defend an illogical system that had the district’s high schools preparing student transcripts using different GPA calculation methods and an increasingly agitated parent group, McGee went to work preparing the proposal that the board adopted Tuesday night. It implements weighted grading for AP and honors classes taken during all but freshman year of high school, reflecting the strong opinions of Paly and Gunn counselors, teachers and administrators that the transition to ninth grade is difficult enough without adding grading incentives for taking certain classes. It also calls for a full evaluation of the new policy over the next few years, standardization of the process of determining which classes should offer weighted grades and a study on how to encourage and help low-income and minority students enroll and succeed in advanced classes. Given the vociferous protest movement, McGee formulated a reasonable and fair solution that is acceptable to the vast majority of the concerned parents. That said, we believe this debate masks a deep divide in the community that needs attention. As some vocal members of the community push for ever more academic rigor, others feel equally strong that the district is enabling an unhealthy competitive climate that needs to be toned down through such measures as enforcing the homework policy, addressing test stacking, cheating and grading practices and setting limits on AP classes. These differences need to be brought out into the open and carefully discussed so that our district’s educational philosophy doesn’t evolve piecemeal as emotional issues like weighted GPAs surface and upset parents organize. Families with young children move to communities where schools reflect their values, and when we prioritize academic rigor over a more balanced approach, we become more attractive to those wanting those qualities. And gradually the culture changes. These are complex issues demanding thoughtful and deliberate policy-making by the school board and community, and we hope the board will initiate those conversations in the wake of the weightedGPA controversy. Q

W

Page 18 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Spectrum Editorials, letters and opinions

Creating ill will with neighbors

Editor, Castilleja has outgrown its current location, and rather than be a good community institution, it has chosen to turn an R1 neighborhood and Embarcadero Road into its private driveway. The proposed garage was never insisted upon by neighbors, as Castilleja’s PR machine was quoted in the May 5 issue of the Palo Alto Weekly. This should be corrected, and Castilleja should provide proof of this if they wish to maintain this position. I have asked the school directly for this information, and it has not been able to produce it. Castilleja held some private “small working groups” with residents. These groups typically had more Castilleja supporters than residents. Two to three neighbors on Kellogg and Bryant said they would support a garage if it emptied onto Embarcadero. Castilleja spent over a year of the City’s time trying to figure out a way to accomplish this, and they were unsuccessful. Therefore, in June 2016, even after public outcry against the garage in 2015 (see the Palo Alto Weekly article) Castilleja announced its expansion plans with the garage emptying right into the neighborhood at Emerson Street and Melville Avenue. At peak traffic times all cars would be required to enter on Bryant Street (a bike boulevard) and exit onto Emerson, then back onto Embarcadero; one lane of Embarcadero would be allocated for Castilleja’s car traffic. This is about people’s lives and homes. I wholeheartedly support Castilleja’s mission to educate future leaders, but everyone will be better served if they find a location that allows them to expand to whatever size they wish. They have created ill will with neighbors for decades, and it’s time they find a sensible solution that does not divide the community. Jim Poppy Melville Avenue, Palo Alto

Re-envisioning use for public buildings

Editor, “Should we build housing for the homeless?” is not a straightforward question. Should we protect all women from assault? Yes, unequivocally — no ifs, ands or buts. But we don’t have to build the shelters; publicly owned buildings already exist, and almost all of them are empty all night long. Others, such as the US Downtown Post Office, need

only a fraction of their space for their original purpose. It’s only lack of will that prevents them from having sleeping mats brought in at night and properly vetted homeless persons designated to supervise sleepers. “We” doesn’t necessarily mean cities; veterans should be housed by our federal government on surplus military bases. Should we regulate development so as to provide shelter for all income levels? Yes, but again, we don’t have to build all of it. Most could come into being by requiring that large employers build as many residence hoteltype living units as they have employees. Civic incentives and restrictions could be adjusted so that private developers could make a reasonable profit on tiny but attractive units with garden balconies (and retail or public facilities on the ground floor) for retired or SSI recipients with a fixed income. Better-off tenants could also be accommodated by charging the same for space for their possessions and vehicles as

for their lodging. Public buildings such as libraries should be combined with housing on the upper stories, taking advantage of the floorarea ratio provided; parks and open space should be used as a buffer to keep multifamily units at the same level of landscaping as single family homes. Don’t forget public transportation to get residents to work and school. Stephanie Munoz Alma Street, Palo Alto

Not an accurate assessment

Editor, As a Melville Avenue resident near Castilleja School, I would be adversely affected by the proposed underground garage for many reasons — increased traffic, loss of aesthetically pleasing residential block, years of construction and because my street would dead-end into the garage exit. (continued on next page)

WHAT DO YOU THINK? The Palo Alto Weekly encourages comments on our coverage or on issues of local interest.

What’s your opinion of the City of Palo Alto’s proposal to hire a $192,000 non-sworn police public-information officer? Submit letters to the editor of up to 300 words to letters@paweekly.com. Submit guest opinions of 1,000 words to editor@paweekly.com. Include your name, address and daytime phone number so we can reach you. We reserve the right to edit contributions for length, objectionable content, libel and factual errors known to us. Anonymous letters will generally not be accepted. Submitting a letter to the editor or guest opinion constitutes a granting of permission to the Palo Alto Weekly and Embarcadero Media to also publish it online, including in our online archives and as a post on Town Square. For more information contact Editor Jocelyn Dong or Editorial Assistant Anna Medina at editor@paweekly.com or 650-326-8210.


Check out Town Square! Hundreds of local topics are being discussed by local residents on Town Square, a reader forum sponsored by the Weekly at PaloAltoOnline.com/square. Post your own comments, ask questions or just stay up on what people are talking about around town!

Guest Opinion Caltrain’s future: ‘Spadework’ needed for permanent stability by Yoriko Kishimoto altrain’s tortuous path to electrification and modernization has hit another wall with the new president’s administration. The latest information is that $100 million of the $647 million grant — the expected installment for this year’s project budget — was just included in Congress’ budget for this year. But Transportation Secretary Elaine Chao has still not signed the full funding agreement, and her signature is needed to unlock the funding. What now? Caltrain’s challenges are well-known. In a nutshell, Caltrain is the original rail line that served and shaped the historic towns along the Peninsula. It went through a series of crises but was eventually saved by the state, which formed a joint powers authority (JPA) for the three counties to own and operate the regional rail. San Mateo County also saved the Dumbarton rail line, currently unused. In 2010, the Friends of Caltrain was established to rally political support to “save Caltrain” once again when one of the counties was unable to fund its share of Caltrain’s support. Caltrain has no independent tax revenues but depends on three counties to supplement the fare box revenues and on state and federal grants to fund capital needs. Many agencies came together to keep Caltrain going, including

C

Letters (continued from prrevious page)

Castilleja has a history of encroaching into the neighborhood. In the 1970s, Castilleja was buying up private homes adjacent to the school. In 1992, Castilleja received from the City the portion of Melville between Emerson and Bryant streets and merged five residential lots into the school. Now the school wants to tear down two old homes, destroy mature oaks and redwoods and excavate an underground garage, as part of an expansion plan to rebuild the school. The continued re-quoting of the school’s PR machine that they are building an underground garage as a result of input by neighbors is distressing. The school did meet with some neighbors (notably not the neighbor sharing its borders) about expansion, and some of the discussion included a garage, but the extent of the expansion (underground garage exiting into a narrow street, enrollment spike

forging a controversial deal to allow some California High-Speed Rail (CAHSR) trains on Caltrain tracks in return for capital funding. Since 2004, when the express Baby Bullet was established, Caltrain has been an increasing success for its communities, riders, the employers and all the residents of the Peninsula who benefit from express trains, commute choices and less congestion. It covers about 70 percent of its operating costs through fares and other user fees, the highest among commuter rail lines in the U.S. It makes economic development possible along the corridor for key employers and institutions, including Stanford University — its commitment for “no net new trips” for the millions of square feet of expansion it has added would be near impossible without the existence of Caltrain. With the rising economic tide, the highways as well as Caltrain are full to the brim and Caltrain has worked for many years for cleaner, more frequent trains and getting the line extended underground to San Francisco’s Transbay terminal, and for the Dumbarton Rail to re-open. Due to the patchwork of funding Caltrain needs to weave together, year to year, its future is constantly at peril. Its challenge to Peninsula residents to take collective action to save a common treasure is formidable but not without precedent. In the early 1960s, three women saw a challenge that seemed insurmountable. Every year, hundreds of acres of San Francisco Bay were being filled in for economic development or as a garbage dump. It was the result of dozens of decisions made by the many cities ringing the Bay, from

of 30 percent, over five years of construction) was not revealed until June 2016. Revised plans were released to the public last week. Several of us reached out to our neighbors, and many of them signed letters stating that they are strongly opposed to this underground garage for its cumulative negative impact on our quality of life. We submitted letters to Castilleja last week, signed by 47 surrounding households opposing it. It is important in this discussion to take into account the neighborhood’s actual stance regarding the underground garage, to state the facts rather than promulgate the school’s spin that the neighbors wanted it and now support it. This is not an accurate assessment. Andie Reed Melville Avenue, Palo Alto

Beginning a downward spiral

Editor, Forty years ago, my husband took me for drives through his

Berkeley to San Francisco and Palo Alto. It seemed impossible to run around to each city council meeting to argue for protection of the Bay — the natural treasure that defined the eponymous “Bay Area.” Somehow, the three women — Kay Kerr, Sylvia McLaughlin and Esther Gulick — persuaded the state of California to create the first coastal protection agency, the Bay Conservation and Development Commission (BCDC). In 1965, the McAteer-Petris Act was passed to create a temporary state agency; a master plan was written, and the agency was made permanent. I could point to a couple of other examples: Q To preserve our “room to breathe” in the face of what seemed uncontrollable sprawl, Nonette Hanko and her colleagues founded the Midpeninsula Regional Open Space District in 1972 as a special district to purchase a greenbelt of open space. Q When the Golden Gate Bridge had mounting traffic congestion in the 1960s, there was pressure to add a second deck, but transit district officials voted against construction of this second deck until “substantial improvement of mass transportation has been proven unable reasonably to relieve congestion on the Bridge during peak commute hours.” In 1969, authorizing legislation was passed and 21 public hearings were held. Ferries and commute buses were launched to serve the Highway 101/Golden Gate Corridor instead of a second deck. Transportation is a topic that is technically complex, needs significant capital and operating funding, and touches the daily lives and pocketbooks of every person on the Peninsula. We have many bureaucracies and they are great at operational

hometown of Danbury, Connecticut. Back then, one would see eclectic but charming neighborhoods of Victorians, Colonials, Cape Codders, Mid-century Modern design, bungalows and ranch homes. Everyone parked off-street, most parked in garages. It was a lovely blue collar town, back then. Now Danbury is a dump. There are industrial-looking box houses behind and to the side of those original charming homes. You see, a Danbury government that has no pride has allowed the building of second houses on properties with no regard for neighborhood character, architecture, space or privacy. Most cars there park in the street now because there is little requirement for off-street parking. There is a beautiful victorian next to my mother-in-law’s home. Sadly, an ugly barrackslike box house was built behind it on the same lot. There are now six cars in the street associated with that property. A politician in a nearby town

management — or should be. But the decisions we face require broad framing, stakeholder participation, multiple disciplines and design. A way forward might be special legislation, similar to those bills that created BCDC or Golden Gate Transit, that lays out a clear mandate and process to develop a design and financing mechanism for the complex and resilient transportation system we need to support our Peninsula economy while strongly protecting our environment and walkable communities. One structure might be a blue ribbon task force to oversee the process — the framing, creation of alternatives, analysis and the final decisions. Advising them would be a technical team and a diverse stakeholder group. Caltrain will hopefully survive this latest crisis and is proposing to do a business plan that would consider new approaches, including public-private partnerships and value capture financing. We need greater transit capacity, frequent all-day service and seamless connectivity! TransForm has a proposal for the 101 corridor. SPUR has also come out with a Caltrain Corridor Vision Plan. All these are laudable but need higher-level leadership, strategic decision making, and the right management to implement the decision. Caltrain’s future is too important to leave to patchwork deals every year. We need to do the spadework for a permanent solution. Q Yoriko Kishimoto is the board chair for Friends of Caltrain and a former Palo Alto mayor. She serves on the Midpeninsula Regional Open Space District board and can be reached at yoriko12330@icloud.com

runs for office vowing that he will not let Waterbury become another Danbury. With that as his promise, he wins. Palo Alto began the same downward spiral last night. Our City Council approved an ordinance that goes wildly and widely beyond the state mandate for accessory dwelling units. In the future, since there is now no design review for second houses on lots, ugly two-story box houses within 7 feet of property lines will blight the character and architecture of neighborhoods and intrude upon neighbors’ privacy and light. Most importantly of all, streets will be strewn with cars. Some will be garaged there. The parking nightmare has just begun. Neighbors’ enmity will grow. The legacy of the present Palo Alto City Council’s majority will be that they are the council members who ruined Palo Alto. Learn their names. Palo Alto, wake up! CeCi Kettendorf Grove Avenue, Palo Alto

Building a bikeunfriendly city

Editor, Access to Castilleja’s proposed large parking garage will inevitably draw more cars to Bryant Street, our bicycle boulevard. Before school, it’s pretty much a constant stream of two to three Palo Alto High School students riding abreast who turn left at Churchill Avenue. Most drivers carefully slow down and flow with the students, but lately, I’ve noticed a few drivers — seemingly heading to Castilleja — speeding up to pass the bikers on the left, just as the students make a left turn onto Churchill. In the Weekly’s talk with Robert Neff, chair of the Palo Alto Pedestrian and Bicycle Advisory Committee, Ms. Dong asked about the dangers to bikers of increased traffic — the Castilleja garage plan is a good example of not building a bike-friendly city. Wally Whittier Bryant Street, Palo Alto

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 19


Arts & Entertainment A weekly guide to music, theater, art, culture, books and more, edited by Karla Kane

hat do blenders, coffee makers, telephones, typewriters — even the bathroom sink — have in common? They are all products that were, at some point, created by designers and manufactured for mass consumption. In a departure from its usual fine art offerings, the Cantor Arts Center at Stanford University is displaying these quotidian objects because they illustrate, in a very tangible manner, the struggle between the aesthetic values of the artist and the profit-motivated agenda of the corporate world. “Creativity on the Line: Design for the Corporate World, 1950-1975” takes a look back at a very specific time period, postWorld War II, when Americans were enjoying financial security and embracing all things modern. American companies responded by hiring designers, many with art school backgrounds, to create new products that would reflect the ease and convenience of contemporary life. Dr. Wim de Wit, curator of the exhibition, was inspired by his research into the International Design Conference that was held annually in Aspen. “Although the official themes of the conferences changed every year, the conferences of the first 20 to 25 years dealt almost always with the underlying theme of ambivalence that the industrial and graphic designers felt about their work for the corporate world,” de Wit said. The idea of artists working for a patron is certainly not a

new concept; art history is filled with examples of royalty, guilds, churches and wealthy collectors who commissioned art works that we still enjoy today. According to de Wit’s research, however, the designers who worked for corporations like IBM, RCA and Bell Telephone worried that they were “selling out to commerce and thus compromising their status as creative artists.” That viewpoint is succinctly stated by Bernard Berson, who attended the Design Conference in 1961: “Do I want to be honest but broke or do I want to prostitute myself and be loaded?” Berson’s quote is displayed on the wall of the gallery, along with other statements and didactic labeling that flesh out the tension between design/art and product/commodity. The exhibition itself has been staged to resemble a trade-show hall, with large plexiglass display cases holding the two-dimensional objects. Floor stands provide a base for larger pieces, like the sleek Mies van der Rohe tubular chrome chair and the Paul Kjaerholm-designed chaise lounge for Herman Miller. Along the walls are designs for corporate logos and photographs of innovative corporate headquarters, such as John Deere Tractors in Iowa, which strove for a more campuslike setting. But it is the everyday item, the functional object that we scarcely think about, that presented the greatest challenge to the designer. It is repeated like a mantra throughout the exhibition: What can be offered that would be

“most advanced, yet accepted.” In other words, how far would consumer tastes go? Looking at the objects with 21st-century eyes, most of them seem fairly tame (although the Atomic espresso maker, patented by Brevetti Robbiati in the 1950s, is a futuristic Space Age wonder). Objects like the Henry Dreyfuss Model 500 telephone, familiar to those of a certain age who remember what it was like to have to use a rotary dial, might be completely foreign to Stanford students who only know cell-phone technology. de Witt says that was part of his thinking in choosing objects for the exhibition. “I think that especially since we do not know objects such as telephones with rotary dials anymore, we will be more easily able to focus on what the designer tried to do with that object,” he said. The same thinking holds true for another now-obsolete object in the show: the typewriter. What began as a clunky, black mechanism for creating type evolved into a colorful, lightweight tool, as seen in Olivetti’s portable typewriter and case, dated 1969. Form may have followed function in architecture, but it is clear that designers of this period were aware of the importance of appearance, attraction and appeal. A blender for the Hollywood Liquifier Corporation, around 1950, is an aerodynamic sculpture of molded plastic and glass; the Chemex coffee maker, 1941, looks as minimal and contemporary as anything we might see in Sur la Table today.

And the Charles and Ray Eames plastic stacking chair (with table arm), from 1961, is still a classroom staple. So, it is clear that Big Business embraced the work of industrial designers and turned their output into commodities. Was the feeling of ambivalence ever resolved for the artists? de Wit said that it was “a constant struggle, a struggle worth undertaking, but one that was frustrating nonetheless.” History, however, has had the last word. More than 50 years later, some of those former giants of industry (IBM, RCA) have been replaced by companies like Apple and Microsoft that revere the art of design in their products. And, watching a young father explain the workings of a typewriter to his child or hearing an older gentleman say, “These are things

This colorful and portable Olivetti typewriter dates from around 1969.

I never thought I would see in a museum,” indicates that, far from selling out, those midcentury designers created objects that still amaze and intrigue us. Q Freelance writer Sheryl Nonnenberg can be reached at nonnenberg@aol.com. What: “Creativity on the Line: Design for the Corporate World, 1950-1975” Where: Cantor Arts Center, 328 Lomita Drive, Stanford When: Through Aug. 21. Museum is open WednesdayMonday, 11 a.m. to 5 p.m. (Thursdays to 8 p.m.) Cost: Free Info: The museum is also holding a series of gallery talks and films in conjunction with the exhibition. Go to museum. stanford.edu for schedule.

Courtesy of Cantor Arts Center

Page 20 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Charles and Ray Eames designed furniture, such as this molded fiberglass chair with table arm, for Herman Miller, Inc. in the 1960s.

Courtesy of Cantor Arts Center

Courtesy of Cantor Arts Center

Henry Dreyfuss designed this classic rotary phone for Bell Telephone Laboratories.

Courtesy of Cantor Arts Center

by Sheryl Nonnenberg

Function and form combine to make the Brevetti Robbiati “Atomic” espresso maker a Space Age wonder.


Arts & Entertainment RISTORANTE

417 S. California Ave., Palo Alto

Open for or Mother’s Mothe Day May 14

Stephanie Crowley

Call for Reservations (650) 327-9390

Full Bar

Lunch

Dinner

Cocktail

Banquet

Tess Middlebrook and Ariel Aronica play a mother and teen daughter in conflict in the comedy “Stella Wind,” part of this year’s “Pear Slices.”

A smorgasbord of ‘Slices’ Pear Theatre event showcases original works by Karla Kane ountain View’s Pear Theatre is a local treasure, and one reason why is its annual “Pear Slices” festival. “Pear Slices” presents a number of very short plays (eight, this time) in one evening, written by members of its playwrights guild (the existence of such a guild is another reason why Pear is a gem). The short plays vary in topic and style, ranging from pure comedy to somber drama to supernatural story, but all share members of the same seven-actor cast (Briana Mitchell, Alison Whismore, Michael Weiland, Ariel Aronica, Tess Middlebrook, Brian Moriarty and Kyle Smith), who switch to different characters from one act to another with great aplomb. This year’s “Slices” kicks off with Elyce Melmon’s “For Art’s Sake,” about an overbearing, art-loving mother and her technophile son, who bond over a surprising experience involving a painting in a museum. Next is Bridgette Dutta Portman’s “Stella Wind,” a spoof on the teen superhero/vampire-slaying genre in which a high-schooler finds her mom will not be impressed by her galaxy-saving prowess until her algebra grade improves. In Leah Halper’s “Mirror to Face,” a Yiddish theater star in turn-of-the20th-century New York struggles with whether or not to accept a major role on Broadway that perpetuates Jewish stereotypes while his teen daughter harbors theatrical dreams of her own. Things turn a bit spookier in “Anasazi Breakdown,” by Douglas Rees, set in 1946 New Mexico, where a pair of sisters are stranded when their car mysteriously breaks down. An ominous stranger appears and seems certain to stir up trouble. Act two kicks off with “Deuce Cooper: The Bloomfield Case,” a hilarious, farcical take on the

M

REVIEW THEATER hard-boiled, noir detective story, full of double crossing, romantic entanglements and plenty of old-time accents. It’s followed by Susan Jackson’s moving “Aboriginal,” based on the true stories of adoptees reflecting on their experiences, including a member of Australia’s Stolen Generation, and their thoughts on family and identity. Next is a second work by Leah Harper, the quite-sad “Meantime In Between Time,” which explores the different grieving processes of two sisters whose estranged brother, a former addict, dies of AIDS. The show wraps up with the romantic comedy “The Proposal,” by Max Gutmann, about a couple with diverging ideas on what makes an acceptable marriage proposal and who should be doing the proposing, challenging cultural and patriarchal norms in the process. Scenery, costumes and props are, necessarily due to the quickchange format, kept minimal, but that’s part of the charm. The Pear’s tech team does a wonderful job equipping the show with just enough to set the scene(s) (twinkling lights overhead to portray the stars over the Southwestern desert, for example), and actors’ costumes are very cleverly repurposed and slightly tweaked throughout, too. Projected images over each play further help illuminate the settings, as do carefully selected incidental songs. It’s truly impressive watching the actors take on so many unrelated roles in such short a time span. I found Whismore grating in “For Art’s Sake,” for instance, but in “Deuce Cooper: The Bloomfield Case” she shines as the snappy, sassy secretary to Smith’s gumshoe. Aronica nails her portrayal of put-upon teen Stephanie in “Stella Wind,” all exasperated eye-rolls and youthful

enthusiasm, even if the concept, which could make a good “Saturday Night Live” sketch, would wear thin in a longer context. It can’t be easy to write a play tailored to this very short format. Of this year’s slices, “Deuce Cooper: The Bloomfield Case,” seems to be the crowd favorite, and does a marvellous job of packing in a dizzying array of plot twists and jokes: The audience was clearly tickled pink by it on opening night. The only problem, a possible misstep in organizing the evening, was putting it right after intermission, then following it by two very serious, saddening works. The shift in tone felt jarring, and audiences seemed to expect laughs at the start of “Aboriginal.” Perhaps saving the detective farce for the grand finale would work better. The shows and individual performances vary in strengths, but all are engaging and, of course, one of the benefits of seeing a selection of numerous “slices” like this is, if you don’t like one, it will quickly be over and something else will begin. Seeing a succession of such diverse offerings in one sitting is a pleasure, especially knowing that they’re all the fresh fruit (pun intended) of a group of dedicated local writers. Some changes may be in store for the Pear, as founder and Executive Director Diane Tasca has recently announced her retirement. Let’s hope “Pear Slices” keeps growing and nurturing homegrown talent for years to come. Q Arts & Entertainment Editor Karla Kane can be emailed at kkane@paweekly.com. What: “Pear Slices 2017” Where: Pear Theatre, 1110 La Avenida St., Mountain View When: Through May 28, Thursday-Saturday at 8 p.m.; Sunday at 2 p.m. Cost: $28-$32 Info: Go to thepear.org

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 21


Arts & Entertainment

WorthaLook Fine art

Silicon Valley Open Studios Each year for a few weeks in spring, the fine artists of Silicon Valley open the doors to their studios to give the public a peek at their work and workspaces. The annual festival continues this weekend (May 13-14), with studios in the greater Palo Alto/Mountain View/Los Altos area open to visitors. Local artists (around 300) in a variety of media will participate, including Palo Alto painter Lewis Silvers and many others. For a complete list of locations, artists and contact information visit svos.org. Courtesy of SVOS

Theater

Photography

‘Ragtime’

‘The Colors of Hawai’i”

Stanford University’s BLACKstage theater company, which aims to present creative opportunities for people of color as well as tell stories about communities underrepresented in traditional theater, is staging the musical “Ragtime” May 12-14 at Dinkelspiel Auditorium, 471 Lagunita Drive, Stanford. “We chose Ragtime because of how pertinent it is to our current political climate,” BLACKstage’s Vice President Adriana Ganem said. “’Ragtime’ is a reminder that no one should sit silent in the face of injustice. This story was dying to be told a year ago and it is now more pertinent than ever in the wake of the 2016 election.” The show depicts the intertwined lives of several characters in early 20th-century New York: an aristocratic woman, a Jewish immigrant from Eastern Europe and a black musician from Harlem, all pursuing their version of the American Dream. “’Ragtime’ explores themes of police brutality, segregation, privilege, cultural appropriation, classism, immigration, gender roles, among many others that don’t often get featured on stages, both on Stanford campus and beyond,” Ganem said. Performances are free and open to the public, and will be held at 8 p.m. on Friday and Saturday and 2 p.m. on Saturday and Sunday. Go to facebook.com/ StanfordBLACKstage.

A photography exhibition of Hawaiian landscapes, seascapes, flowers and wildlife will be on display during the month of May at the Portola Art Gallery at 75 Arbor Road (Allied Arts Center) in Menlo Park. The exhibition, called “The Colors of Hawai’i,” shows photos from Kaua’i’s remote Napali coast, the Haleakala National Park and wildlife on the Big Island. Frances Freyberg, a Menlo Park resident, is a portrait, wildlife, nature and architecture photographer. Go to francesfreyberg.com.

Above: Palo Alto painter Lewis Silvers is taking part in this year’s Silicon Valley Open Studios. Page 22 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Fine art ‘Art in the Park’ The Los Altos Rotary’s annual Fine Art in the Park festival, involving around 150 artists displaying works in a variety of media; live music; food, familyfriendly activities and more, will be held May 20-21 from 10:30 a.m. to 5 p.m. at Lincoln Park, 199 University Ave., near downtown Los Altos. Local artists involved include Palo Alto potter Joy Imai, Los Altos sculptor Anne Klocko, Menlo Park jewelry maker Soni Bergman and Los Altos painter Stephanie MacLean, among many others. The event kicks off after the annual Los Altos Kiwanis Club Pet Parade, and proceeds go to community-agencies and international-development programs. Free parking is available at Los Altos High School and other locations with shuttle service to and from the park. Go to rotaryartshow.com.


  .QECNYKPGGZRGTVUCFQTG VJGCRRTQCEJCDNG CPFCNNWTKPIRKPMYKPG

Biondivino co-owner Shelly Ryan pours a glass of the Domaine les Luquettes Bandol.

I

by Elena Kadvany | Photos by Michelle Le

t’s hard to imagine a time when rosé did not have the near-cult popularity it enjoys today. Bottles fly off wine shops’ shelves the moment the sun comes out. Festivals have been created in its honor. Hip-hop artists celebrate the pink wine in their songs, while hashtags like “roséallday” and “yeswayrosé” have gone viral on social media. But in the 1980s, when Vin Vino Wine first opened in Palo Alto, no matter what owner Victor Pugliese did to spread the rosé gospel, the wine’s clientele was almost exclusively limited to people who drank the wine in France, where rosé was popularized. A toosweet white zinfandel mass-produced by Sutter Home gave rosé a bad rap, Pugliese said. It wasn’t until the early 2000s that the rosé tide began to change. As it increased in popularity, more wineries outside of France began making more — and better — rosé, Pugliese said. Today, the alluringly fresh, uplifting pink wine is enjoyed by wine connoisseurs and Instagrammers alike. “What I love about both drinking and selling rosé is there’s a lack of pretension,” Pugliese said. “You really don’t need to spend a lot of money for a good rosé. You shouldn’t age it. You should just buy it and drink it. It’s very uncomplicated.” Rosé is essentially a red wine. It’s made from red grapes, but instead of leaving the grape skins in contact with the juice for an extended period of time, which creates more flavor, color and tannin, winemakers take rosé out in a “matter of hours,” Pugliese said. This results in a structure, or acidity, more similar to white wine, he explained. The majority of rosés are made through this process, known as maceration. There are two other methods for making

rosé, said Erika Szot, sommelier for Chez TJ in Mountain View. One, usually limited to high-quality production, is called saignée. Winemakers bleed a certain percentage of grape juice off after limited contact with the skins, and the bled-off juice becomes the rosé. The third method is blending, adding a small amount of red wine to a white wine to get the classic rosé color. Blending is usually limited to making sparkling rosés, Szot said. When buying or ordering rosé, let the grape varietal guide you, she said. “If you have a Sangiovese as the base or a cabernet sauvignon or even pinot noir, they’ll have completely different flavors and smells,” Szot said. As with all wines, rosé made in different regions have distinguishing characteristics. French rosés tend to be lower in alcohol content, Pugliese said, “which makes them more drinkable, less ponderous — and that’s what rosé should be.” French rosé will almost never be sweet, he said. California rosés tend to be light and crisp compared to Italian ones with more body and depth, said Ceri Smith, owner of Palo Alto’s Biondivino Wine Boutique, which focuses on Italian and Eastern European wines. “California has, in general, across the board in their wines ... more fruit, more bright, New World kind of flavors. The Italians have more acidity, more earth, (more) Old World kind of flavors,” she said. She’s currently “geeking out” over an all-natural, slightly fizzy and “funky” Italian rosé, a 2015 Macciocca Passerina Frusinate Rosato ($20). It’s a French rosé, however, that Smith can hardly keep stocked: a 2015 Domaine les Luquettes Bandol ($25). Another customer favorite is the 2015 Chateau Pradeaux Bandol ($38). One of Smith’s favorites is the Chateau

Simone Palette — “goose-bump good” but, admittedly, at much higher price point ($73). Color can also be a flavor guide, but not a hard-line one, Smith said. Lighter-hued rosés do tend to be leaner, but there are some darker ones that can still taste light, she said. A 2016 Austrian rosé, Schlosskellerei Gobelsburg Cistercien ($18), that just came into Vin Vino Wine, is a current favorite of Pugliese’s: “very light, delicate, fresh ... and moderately priced.” Unlike its red and white counterparts, rosé’s drinkability means it goes well with just about any meal. At Chez TJ, Szot pairs rosé with everything from asparagus and root vegetables to salmon, lamb and sashimi. She’s served a 2014 Clos Cibonne rosé from Provence ($80) with lamb and juniper

as well as caviar, but said it would work just as well as a “porch drink” with a barbecue menu like burgers, potato chips and watermelon. Rosé also goes well with anything that has fennel, she said. “The pairing opportunities for rosé are endless,” Szot said. Despite rosé’s warm-weather popularity, Szot and Smith make the case for drinking it year-round. “I know it’s refreshing and finally sunny outside so everyone wants it now, but it truly is in our opinion a necessity to have in the cellar year-round,” Szot said. “We’re trying to break that notion that rosé is only for the spring.” Q Staff Writer Elena Kadvany can be emailed at ekadvany@paweekly.com.

An array of rosé is available at Vin Vino Wine in Palo Alto. The color of a rosé can give a hint about the bottle’s flavor. www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 23


Palo Alto Weekly

ShopTalk ARC’TERYX OPENS IN CALIF. ... Arc’teryx, the Canadian highperformance outdoor apparel and equipment manufacturer, is opening its first California retail store at Stanford Shopping Center (next to AllSaints) on May 19. Until recently, the Arc’teryx brand had been exclusively distributed through specialty outdoor clothing and equipment retailers online and at more than 3,000 stores worldwide, including REI and Nordstroms. The Stanford store will be the company’s 25th brand store worldwide and its third on the West Coast. The company — ranked No. 1 international outdoor brand in 2015, according to a Nielsen study — makes jackets, fleeces, shells and parkas, along with climbing, hiking and running gear, and skiing and snowboarding apparel. The Stanford store also will serve as a venue for local events for the climbing, skiing and outdoor community in the Bay Area, according to a company blog posting. Arc’teryx will celebrate its opening weekend at Stanford with beer and snacks, a meet and greet with climbing athlete Jesse Huey, demo stations and giveaways. Arc’teryx is among a slew of new openings at Stanford this spring that includes about eight retailers at various locations throughout the mall. Other shops that recently have opened or are about to open include: Madewell, a clothing store known for its jeans, soft tees, and slouchy button-downs for young women (opening June 6 across from Michael Kors); CH Premier Jewelers (next to Stella McCartney), The Shade Store (in the space recently vacated by Brandy Melville), Prosepectacles, Going In Style Travel Accessories, Travelex Currency Exchange and The Tailor Maid. — L.T. BANK CLAIMS ABANDONED YELP SPACE ... First Republic Bank is preparing to open its second Palo Alto office in the newly constructed College Terrace Centre where Yelp initially had planned to expand its operations back in 2014 but later pulled out from. Signage for the wealth-management company was mounted last week, and there were job postings on Glassdoor. com, including one for a banking offices assistant manager. The new, 45,472-square-foot office at 2100 El Camino Real is across the street and one block north of First Republic’s existing branch on the corner of El Camino and Cambridge Avenue. The new location will include open office space and conference and data rooms, according to the city’s Planning & Community Environment Department, which issued the bank a use-and-occupancy permit on April 26. Palo Alto developer

Page 24 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Jim Baer, who leases the El Camino/Cambridge space to First Republic, told the Weekly in 2016 he believed the company planned to use the ground-floor at the new site for branch banking and the upper-floor for financial services and professional offices. The new branch is be rumored to opening in June. Greg Berardi, a spokesman for the bank, would not comment on the opening date or whether First Republic plans to move its existing bank branch to the new site. First Republic signed a 10year lease in 2015 for the College Terrace Centre space, according to market analytics company CompStak. — L.T. CHEZ TJ FOREGOES VICTORIAN ... Chez TJ, Mountain View’s highend restaurant serving gourmet dinners in a historic Victorian house on Villa Street, along with neighboring restaurant and brewery Tied House, are moving forward with a joint plan to build a fourstory office building at their sites, according to Chez TJ executive chef Jarad Gallagher. As proposed, the bottom floor of the new building will house a new 3,000-square-foot restaurant on top of several levels of underground parking. Gallagher said he hopes the space will house the next iteration of the Michelinstarred restaurant, though the developer has not yet decided on an operator. George Aviet opened Chez TJ in 1982 with then-partner and chef Thomas J. McCombie in a 1894 home. Gallagher has served as executive chef since 2012, after a series of head chefs cycled through the kitchen and then left to open their own high-end restaurants in the Bay Area. Gallagher said Aviet eventually plans to retire and will turn over the new Chez TJ to Gallagher. Tied House also has deep roots in Mountain View. The microbrewery opened at 954 Villa St. in 1988. Daniel Minkoff of the Minkoff Group, which is developing the project, said that his company has not discussed a vision for the space, a “gastropub” serving modern cuisine, with Chez TJ and Tied House. For Chez TJ, this would mean shifting away from its longtime fine-dining concept. Gallagher said he and Aviet are currently looking for a local space to relocate Chez TJ to while construction is underway on Villa. There, the restaurant’s fine-dining “legacy” will continue as its owner and chef figure out what will “be best for the new spot,” Gallagher said. — E.K.

Compiled by the Weekly staff; this week written by Linda Taaffe and Elena Kadvany. Got leads on interesting and newsworthy retail developments? The Weekly will check them out. Email shoptalk@paweekly.com.


OPENINGS

Courtesy of Warner Bros Entertainment

“King Arthur: Legend of the Sword” attempts to breath new life into the ancient tale.

Lame of thrones

‘King Arthur’ retells the legend for the age of franchises 00 (Century 16 & 20) That most flexible of ancient legends gets a new workout in Guy Ritchie’s “King Arthur: Legend of the Sword,” the first in what’s rumored to be a six-film series — box-office willing. Certainly, this is the first version of the King Arthur story to feature a character referred to as “Kung Fu George”

or a David Beckham cameo, but let’s just say Ritchie’s take on Arthurian legend isn’t going to surprise anyone who knows what’s up at the multiplex these days. A dedicated stylist who got his start with gangster comedies like “Lock, Stock and Two Smoking Barrels” and “Snatch,” Ritchie

Courtesy of The Orchard

The rise and fall of chef Jeremiah Tower, shown here in the kitchen, is examined in the documentary “Jeremiah Tower: The Last Magnificent.”

‘Tower’ing figure

Doc recounts how Bay Area chef made his mark 001/2 (Aquarius) Lydia Tenaglia’s documentary “Jeremiah Tower: The Last Magificent” looks at the life of local chef Jeremiah Tower, who is credited with developing the culinary style known as “California Cuisine” and had ties to Palo Alto during the 1990s when he opened a branch of his famed San Francisco Stars restaurant on Lytton Avenue during the height of his career.

With her documentary, Tenaglia begins by establishing the enigma of her subject: Tower emerged as a superstar chef, reached a pinnacle, then disappeared from the scene. A friend of 40 years maintains, “Nobody knows Jeremiah.” Seen striding alone, Tower himself muses alone in voice over, “I have to stay away from human beings, because somehow I am not one.” The prelude describes a mystery

has become a go-to guy for Warner Brothers’ franchise hopes, first with “Sherlock Holmes” (a hit that spawned a sequel) and then with “The Man from U.N.C.L.E.” (a flop). And so we get a “King Arthur” in which the displaced royal — cast off Moses-like after the murder of and teases another: Will the film you’re watching realize its seeming goal to penetrate that mystery? The answer, alas, is “not really.” But that doesn’t mean the film isn’t worth watching, only that Tower treated his participation in the documentary like everything else in his career: something to be approached strictly on his own terms. The film’s early passages, addressing his apparently loveless upbringing by inattentive socialite parents, help to explain his independence, drive, and need for attentive respect. Once he finds his way into a living as a chef, Tower becomes somewhat more remote as a human being, subsumed into his lifelong obsession with crafting just-so dishes, just-so menus, just-so restaurants. Tenaglia neatly divides Tower’s career into three key stints: first at Alice Waters’ famed Berkeley restaurant Chez Panisse (1972-1978), then as the prime mover of his own restaurant Stars in the Civic Center of San Francisco (1984-1999), and finally, his latter-day comeback bid, at Tavern on the Green in Manhattan’s Central Park (beginning in 2014). Documentary cameras observe Tower’s third act as it unfolds, while the first two acts benefit from compelling archival (continued on next page)

his parents — grows up thinking he’s “the bastard son of a prostitute,” raised in a Londinium brothel to become a gangster with a crew. In Ritchie’s neatest stylistic trick, Arthur’s 20-year journey from boy to man (Charlie Hunnam, who’s serviceable when he doesn’t succumb to shouty mode) takes about two minutes of screen time in a super-charged montage. That’s after a prologue that promises an awful, awe-full lot of spectacle, first with a massive conflagration pitting the supernatural might of mage sorcerer Mordred against the otherwise peaceful kingdom of Arthur’s dad, Uther Pendragon (Eric Bana), and then with the palace coup of villainous Vortigern (Jude Law, Ritchie’s Dr. Watson), enabled by a Faustian deal with a triad of witches. Essentially, Law’s doing a pared-down “Macbeth” in the margins of this movie, and almost making something of the thin scripting through his Shakespearean enthusiasms. Mostly, though, “Legend of the Sword” feels like a rather desperate attempt — in design, music, and even casting — to score some of that sweet, sweet “Game of Thrones” cash. And since “Batman Begins” remains the template for origin-story reboots, “Legend of the Sword” doubles down on traumatized boys and gives Arthur martial-arts training

sourced from the Far East (around the climax, Ritchie whips up some special-effects-enhanced sword fu). There’s the Sword in the Stone (Excalibur, as usual), the Lady of the Lake, a formidable and fetching female mage (Astrid BergèsFrisbey), and multiple bad-dream and vision-quest flashbacks as Arthur reckons with his once and future destinies, all culminating in a video-gamey showdown that wipes away the movie’s best actor (Law) and replaces him with a digital demon. Ritchie’s “Arthur” is more likely to be remembered for the crime-comedy touches he and co-writers Joby Harold and Lionel Wigram have stamped onto it: knockabout “Lock, Stock”-style dialogues, a campaign planned like a heist, a “safe house” (though sensible, the phrase has an anachronistic ring). Despite some striking visuals (including sweeping use of Welsh and Scottish locations) and the occasional evocation of “Robin Hood: Prince of Thieves,” this newfangled “Arthur” comes up short on grandeur or even oldfashioned matinee adventure, trading them in for cosmetic “Game of Thrones” grot. Rated PG-13 for sequences of violence and action, some suggestive content and brief strong language. Two hours, 6 minutes. — Peter Canavese

®

Historic MacArthur Park is now accepting reservations for our beautiful and bountiful

Brunch and Dinner Sunday May 14th Brunch 10:00 am to 2:30 pm, Dinner 4:30 pm to 7:30 pm Adults $52, Children 6 - 12 $27 Children Under 5 years FREE 27 University Ave., Downtown Palo Alto 650-321-9990 • macpark.com

Sign up today at www.PaloAltoOnline.com www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 25


â&#x20AC;&#x153;AN ABSOLUTE, DROP-DEAD MASTERWORK.â&#x20AC;? - Richard Brody, THE NEW YORKER

â&#x20AC;&#x153;ONE OF THE MOST MESMERIZING FILMS OF THE YEAR.â&#x20AC;?

â&#x20AC;&#x2DC;Jeremiah Towerâ&#x20AC;&#x2122; (continued from previous page)

- Jordan Hoffman, VANITY FAIR

â&#x20AC;&#x153;A HAUNTING PORTRAIT OF EMILY DICKINSON.â&#x20AC;? - John Powers, VOGUE

â&#x20AC;&#x153;CYNTHIA NIXON IS MARVELOUS.â&#x20AC;?

- Keith Ulrich, SLANT MAGAZINE

2017 A FILM BY TERENCE DAVIES MUSICBOXFILMS.COM @MUSICBOXFILMS

PaloAltoOnline.com/best_of

Movies

STARTS FRIDAY, MAY 12

footage and photographs, as well as reminiscences by Tower and other interviewees. (N.b.: Tower opened his Stars branch in Palo Alto in 1995, but it closed by 1997, becoming a branch of Wolfgang Puckâ&#x20AC;&#x2122;s Spago.) Interviewee Martha Stewart sums up Tower as â&#x20AC;&#x153;a father of the American cuisineâ&#x20AC;? â&#x20AC;&#x201D; although heâ&#x20AC;&#x2122;s more specifically associated with the California Cuisine movement. Tenaglia recounts Towerâ&#x20AC;&#x2122;s complicated relationship with local legend Waters, a heady rush

of culinary creativity, compatible personality, romance and sex (despite Towerâ&#x20AC;&#x2122;s otherwise homosexual identification) that imploded in a dispute over credit for Chez Panisse and its menu. Stars allowed Tower to conjure up his ideal of â&#x20AC;&#x153;a cafĂŠ society where everything is charming and perfect,â&#x20AC;? like the ocean liners that introduced him to cuisine in his childhood. Batali describes 1984 as the moment â&#x20AC;&#x153;the energy became as important as the food,â&#x20AC;? and the celebrity chef emerged from the kitchen. In addition to Batali and Stewart, talking heads include Puck, Ruth Reichl, Anthony Bourdain (also an executive producer of

the film) and a few of Towerâ&#x20AC;&#x2122;s closest friends. But Tower only reveals what heâ&#x20AC;&#x2122;s willing to reveal, and his personal life and gay identity go largely unexplored, with Tenaglia repeatedly suggesting that Tower is a lonely soul. When Tenaglia does go there, itâ&#x20AC;&#x2122;s just enough to whet our curiosity for answers sheâ&#x20AC;&#x2122;s never able to get out of her subject. Still, the focus should remain, and does, on the food itself, and the tenacious, productively persnickety, beautiful mind it took to serve it up. Rated R for language. One hour, 43 minutes. â&#x20AC;&#x201D; Peter Canavese

MOVIES NOW SHOWING A Quiet Passion (PG-13)

Aquarius Theatre: Fri. - Sun.

Baahubali 2: The conclusion (Not Rated)

Century 16: Fri. - Sun.

Beauty and the Beast (PG) ++ Century 16: Fri. - Sun. Century 20: Fri. - Sun. Century 20: Fri. - Sun. The Boss Baby (PG) ++1/2 Century 16: Fri. - Sun. Born in China (G)

The Circle (PG-13)

Century 16: Fri. - Sun.

Century 20: Fri. - Sun.

Century 20: Fri. - Sun.

The Fate of the Furious (PG-13) Century 16: Fri. - Sun. Century 20: Fri. - Sun. The Fifth Element: 20th Anniversary (PG-13) +1/2 Get Out (R) +++1/2 Gifted (PG-13)

Century 20: Sunday

Century 20: Fri. - Sun.

Century 20: Fri. - Sun. Century 20: Fri. - Sun.

Going in Style (PG-13) +1/2

Guardians of the Galaxy Vol. 2 (PG-13) ++1/2 Century 16: Fri. - Sun. Century 20: Fri. - Sun. How to be a Latin Lover (PG-13) Century 16: Fri. - Sun. Century 20: Fri. - Sun. Jeremiah Tower: The Last Magnificent (R) ++1/2 Aquarius Theatre: Fri. - Sun. King Arthur: Legend of the Sword (PG-13) ++ Century 16: Fri. - Sun. Century 20: Fri. - Sun. The Lost City of Z (PG-13) Century 20: Fri. - Sun. Palo Alto Square: Fri. - Sun. Lowriders (PG-13)

Century 20: Fri. - Sun.

The Metropolitan Opera: Der Rosenkavalier (Not Rated) Century 16: Saturday Century 20: Saturday Palo Alto Square: Saturday Norman: The Moderate Rise and Tragic Fall of a New York Fixer (R) +++ Guild Theatre: Fri. - Sun. Roman Holiday (1953) (Not Rated) Stanford Theatre: 7:30 p.m., Fri., 3:15 & 7:30 p.m., Sat. & Sun. Sabrina (1954) (Not Rated) Snatched (R) The Wall (R)

Please RSVP online or by email info@kensingtonplaceredwoodcity.com or call 650-363-9200

Palliative Care? Hospice? Whatâ&#x20AC;&#x2122;s the DiďŹ&#x20AC;erence?

With Angela Mouton, Silverado Hospiceâ&#x20AC;&#x2122;s New Administrator

0$<Ä&#x161;30Ä&#x161;5()5(6+0(1766(59('

Century 20: Fri. - Sun.

Palo Alto Square: Fri. - Sun.

The Zookeeperâ&#x20AC;&#x2122;s Wife (PG-13)

Aquarius Theatre: Fri. - Sun.

Aquarius: 430 Emerson St., Palo Alto (For recorded listings: 327-3241) tinyurl.com/Aquariuspa Century Cinema 16: 1500 N. Shoreline Blvd., Mountain View tinyurl.com/Century16 Century 20 Downtown: 825 Middlefield Road, Redwood City tinyurl.com/Century20 CineArts at Palo Alto Square: 3000 El Camino Real, Palo Alto (For information: 493-0128) tinyurl.com/Pasquare Guild: 949 El Camino Real, Menlo Park (For recorded listings: 566-8367) tinyurl.com/Guildmp Stanford Theatre: 221 University Ave., Palo Alto (For recorded listings: 324-3700) Stanfordtheatre.org Find trailers, star ratings and reviews on the web at PaloAltoOnline.com/movies

+ Skip it ++ Some redeeming qualities +++ A good bet ++++ Outstanding

Angela Mouton brings 25 years of clinical

FROM THE WRITER-DIRECTOR OF â&#x20AC;&#x153;FOOTNOTEâ&#x20AC;?

and administrative expertise and was the lead

RICHARD LIOR HANK H STEVE CHARLOTTE MICHAEL DAN JOSH GEREE AS ASH KENAZI AZARIA AZ ASHKENAZI BUSCEMI GAINSBOURG SHEEN STEVENS CHARLES

on creating the palliative care program for

â&#x20AC;&#x153;RICHARD GEREâ&#x20AC;&#x2122;S PERFORMANCE IS AMAZINGLY FUNNY.â&#x20AC;?

NORMAN -A.O. Scott, THE NEW YORK TIMES

the Silverado Hospice in San Diego. Come learn how both seniors and their families can beneďŹ t from support through a chronic or

RCFE License 415600964

terminal condition. (/&$0,125($/5(':22'&,7<&$

Stanford Theatre: 5:25 & 9:40 p.m., Fri. - Sun.

Century 16: Fri. - Sun.

www.KensingtonPlaceRedwoodCity.com

The Moderate Rise and Tragic Fall of a New York Fixer

NOW PLAYING

WRITTEN AND DIRECTED BY JOSEPH CEDAR

CALL THEATRE FOR SHOWTIMES

VIEW THE TRAILER AT WWW.NORMAN-MOVIE.COM

Page 26 â&#x20AC;˘ May 12, 2017 â&#x20AC;˘ Palo Alto Weekly â&#x20AC;˘ www.PaloAltoOnline.com


Book Talk COMING OF AGE IN SILICON VALLEY... YA contemporary author Misa Sugiura will release her comingof-age debut novel “It’s Not Like It’s a Secret,” which celebrates the culture of Silicon Valley as well as the diversity of families who live and work here, at 7 - 9 p.m., Friday, May 12, at Kepler’s Books. Sugiura is a high school English teacher. During her years in the classroom, she met many students who inspired her to write her novel. The book follows 16-year-old Sana Kiyohara, who’s already dealing with family and school issues when she discovers that she might have a crush on her best friend. Kepler’s is located at 1010 El Camino Real, Menlo Park.

‘STRANGE CONTAGION’ IN PALO ALTO... in his new book “Strange Contagion,” Palo Alto resident Lee Daniel Kravetz uses his experience as a psychologist and science journalist to look at how a teen suicide cluster in 2009 could have developed in Palo Alto. Kravetz draws on research and insights from experts worldwide to unlock the mystery of how ideas spread, why they take hold, and offers thoughts on our responsibility to one another. “Strange Contagion,” published by Harper Wave, is set for release on June 27 and will be available on Amazon.com. FAKE NEWS AND ‘JEOPARDY!’... Award-winning journalist Angie Coiro will talk to five-time undefeated “Jeopardy!” champion Tom Nichols about his new book “The Death of Expertise: The Campaign Against Established Knowledge and Why it Matters,” which looks at the dangers of fake news and the instantaneity of information, at 7:30 p.m., Wednesday, May 24, at Kepler’s Books. Nichols, a professor of National Security Affairs at the U.S. Naval War College, looks at how websites like Wikipedia and WebMD have made arm-chair experts and living-room doctors out of all of us and brings to light the real danger that amateur experts can bring.

A monthly section on local books and authors

‘Guns Above’: witty dialogue, airships, woman with guns Mountain View scientist’s steampunk fantasy inspired by Poe by Michael Berry

W

ith a view of Moffett Field from her apartment, Mountain View author Robyn Bennis has airships on her mind. Her preoccupation is not only due to the proximity to the former home of the Akron and the Macon, two of America’s largest airships from the ‘30s. Lighter-than-air warfare is the subject of her debut fantasy novel, “The Guns Above,” published by Tor Books on May 2. Set in an alternate version of pre-Industrial Age Europe, “The Guns Above” follows Josette Dupre, the first female airship captain in the Garnian Air Corps. Newly installed aboard the Mistral, considered a untested deathtrap, she patrols the front lines as Garnian troops battle their Vizhalian counterparts. The motley crew doesn’t respect her, and to make matters worse, she’s being spied upon by Lord Bernat, a foppish royal reluctantly placed aboard the vessel by his scheming uncle. Bennis, 37, grew up reading “hard” science fiction by Arthur C. Clarke (“2001: A Space Odyssey”) and Frank Herbert (“Dune”), before discovering humorous fantasy by Terry Pratchett (“Discworld”) and Mark Twain. While in college, she encountered the work that would have the greatest impact on her own fiction, Patrick O’Brian’s Aubrey/ Maturin naval historical novels, including “Master and Commander” and “The Far Side of the World.” The 21-volume series is set during the Napoleonic Wars. “The series is funny. It’s action-packed,” Bennis said. “It is amazingly historically accurate. You really feel like you’re on the deck of a sailing ship in the early 19th century.” Bennis said that she knew immediately that was the kind of writing she wanted to do at some point.

‘The series is funny. It’s action-packed. It is amazingly historically accurate.’

Robyn Bennis In addition to O’Brian, Bennis took inspiration for her characters and plot from Edgar Allan Poe’s “The Balloon-Hoax.” In 1844, Poe published in the New York Sun a literary prank about an English airship that had supposedly crossed the Atlantic. According to Bennis, the piece offered “interesting, detailed scientific explanation of how the ship worked and the obstacles it had to overcome on the way.” She said, “It inspired me to make something along the same lines, a hard steampunk story with airships you almost could believe would really work and that you might build in your backyard.” The airships in “The Guns Above” are made out of plywood and wicker, which sounds far-fetched, until you learn that the Schutte-Lanz company actually made wooden airships in the early 20th century. “They built them out of aspen wood,” Bennis said, “and they flew quite well. They were actually competitors of the Zeppelin Corporation.” Bennis has a day job in biotech, as a consultant for Twist Bioscience in South San Francisco. A Florida native, she moved to Boston to work for company Millennium Pharmaceuticals

Courtesy Robyn Bennis

SOIL ‘REVOLUTION’... David R. Montgomery, a Palo Alto native who is now a professor of Earth and Space Sciences at the University of Washington in Seattle, will celebrate the release of his new book “Growing a Revolution: Bringing our Soil Back to Life” at 7 p.m., Friday, June 9, at Book’s Inc. In his book, Montgomery provides readers an expose on how food is grown and looks at how regenerative farming can revive the world’s soil, increasing food production, boosting cost effectiveness and slowing climate change. Books Inc. is located at 74 Town & Country Village, Palo Alto.

Title Pages

—Robyn Bennis, author

after attending Florida State University. She followed another company, eventually known as Cellective DX, to San Diego and then moved to the area about 10 years ago, when it set up shop there. Her current employer, Twist, is in the business of rapid, genelength synthesis of DNA. According to Bennis, they provide long DNA sequences to order for pharmaceutical research, data storage and chemical production. “My job at Twist is mostly about breaking things. That’s not a joke, and yes, it can sometimes be as fun as it sounds. You’ll usually find me stress testing proposed new methods and equipment, seeing where the weak points are before they’re integrated into the production line.” Although she definitely dislikes the rent, she appreciates the camaraderie she finds at places such as Clocktower Coffee Roasting Company, the cafe where she wrote much of “The Guns Above.” “Wonderfully eclectic group of people in there,” she said. “They’re all friendly and they all have wonderfully diverse backgrounds. You don’t get that in Boston. I enjoyed Boston, but the people are grumpy all of the time.” “Grumpy” is an apt adjective to describe the protagonist of “The Guns Above.” “Josette Dupre is a stonefaced, cold-hearted soldier,” Bennis said. “She’s been stuck in the auxiliary corp of the air

service for some time. Which means that she is not supposed to participate in any activity which might threaten her life.” The nation of Garnia does not want to rely on women in battle. But aboard an airship there’s no such thing as a safe position. There’s no such thing as being behind the lines. Dupre runs into many instances where people dismiss her. They don’t think of her as a valid voice at the table. “I’ve been through that, as a woman in biotech,” Bennis said. “It was a gratifying to write scenes where Josette was able to do what I’ve never been able to do — which is just to say, ‘OK, then forget you, too.’ Brush them off and move on with your life.” Lord Bernat, by contrast, is a fop and a womanizer. Relentlessly rude and naïve, he was born into nobility. But as a second son, he’s never going to inherit his father’s lands and has no other way of supporting himself. “He was just a delight to write,” Bennis said. “A lot of his most viciously childish and sexist moments are based on things people have done to me. In real life, they never got their comeuppance, but I give some to Bernat.” Dupre and Bernat will return in “The Fire Above,” a sequel to “The Guns Above,” to be published next year. But Bennis and her publisher will have to gauge the success of the first volume before committing to further adventures. Publishing a debut novel is all a little precarious, like building an airship out of wicker. “It feels like my entire future prospects as an author are hanging on this moment, so it’s a little frightening,” Bennis said. “But it is also very wonderful.”Q “The Guns Above” is available at Amazon.com. For information about book tour dates, go to www.robynbennis.com.

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 27


september 30, 2017 palo alto, ca

register today! canarychallenge.org

Join the fight!

FundraisE foR cancer earlY detectioN research

DJ/ENTERTAINMENT • FOOD TRUCKS • KIDS ZONE SPIN TO WIN • SATURDAY NIGHT PARTY

Page 28 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


W

ith summer right around the corner, the possibilities seem endless, just like the length of those long, long days. With seemingly more time, and quite possibly more energy, the time is ripe for trying your hand at something new and exciting or finessing a talent you never knew you had.Who knows? You might learn something new about yourself along the way — maybe you’ll discover your inner dancer or learn that, actually, you can do a headstand in that yoga class. The skies (dances, yoga poses and other metaphorical horizons) are the limit, which of course means that there is no ceiling to your own personal growth. Indeed, this could be the start of something new for you!

The Class Guide is published quarterly by the Palo Alto Weekly, The Almanac and the Mountain View Voice.

Health & Wellness

Advantage Aviation 1903 Embarcadero Road, Palo Alto, 650-437-8964, info@advantage-aviation.com, advantage-aviation.com With many instructors, Advantage Aviation has a selection of flying classes that train new pilots as well as help more experienced ones acquire needed licenses. Ananda Palo Alto Ananda Temple, 2171 El Camino Real, Palo Alto, 650-323-3363 ext. 0, inform@anandapaloalto.org, anandapaloalto.org Ananda Palo Alto classes and

events cover various topics including yoga, meditation and spirituality. Equinox 440 Portage Ave., Palo Alto, 650-319-1700, equinox.com/clubs/ northern-california/paloalto Equinox’s Palo Alto location offers a variety of fitness and wellness activities including cycling, Pilates, yoga, barre, conditioning, Zumba and more. It also hosts dance-based fitness classes by Danceation, which encourage movement, positivity and community. Integrated Healing Arts 4153-4161 El Camino Way, Palo Alto, 650-493-7030, iha@integratedhealing.org, integratedhealing.org Integrated Healing Arts instructors teach ongoing classes on meditation, self-development,

self-realization, tai chi, qigong and spiritual health. Kim Grant Tennis Academy 3005 Middlefield Road, Palo Alto, 650-752-8061, admin@kimgranttennis.com, kimgranttennis.com The Kim Grant Tennis Academy organizes an array of tennis classes and programs for adults and children, as well as those with special needs. Registration for summer camps is now open, with classes held from June 5 to Aug. 11. Taoist Tai Chi Society of the USA Unity Church, 3391 Middlefield Road, Palo Alto, St. Mark’s Episcopal Church, Parish Hall, 600 Colorado Ave., Palo Alto, Mitchell Park, The Bowl, 600 E. Meadow Drive, Palo Alto, 650-396-9244, taoist.org/usa The Taoist Tai Chi Society of the USA, a charitable organization with nationally accredited volunteers, holds classes designed to improve balance, strength, flexibility, relaxation and health. Beginner classes are held a few days each week. YogaWorks Palo Alto 440 Kipling St., Palo Alto, 650468-2929, yogaworks.com/location/ palo-alto With locations across the nation, YogaWorks studio holds classes on

yoga fundamentals; vinyasa, Hatha and Iyengar styles; restorative yoga; and circuit training.

Music, Arts & Crafts

Art with Emily 402 El Verano Ave., Palo Alto, 650-856-9571, emilyjeanyoung@ gmail.com, artwithemily.com Emily Young teaches mixed-media and multicultural art classes in small groups for children and adults at her studio in Palo Alto, as well as individual lessons. Art & Soul Webster Street Studio, 2326 Webster St., Palo Alto, 650-269-0423, 650-316-9208, artandsoul.paloalto@gmail.com, artandsoulpa.com Art & Soul runs after-school art clubs throughout the week at Walter Hays and Ohlone elementary schools as well as Gideon Hausner Jewish Day School. Additionally, it hosts a club on Wednesdays at Hoover and Barron Park elementary schools. Programs allow children to explore drawing, painting and sculpture techniques, as well as develop their observational skills. Art & Soul also offers Art & Wine events for private groups.

Dance Connection Cubberley Community Center, L-5, 4000 Middlefield Road, Palo Alto, 650-285-2633, danceconnectionpaloalto.com Dance Connection offers a preschool combination class for preschool-age children (beginning at age 3), graded classes for youth and adults, and other programs to meet dancers’ needs. Ballet, jazz, hip-hop, lyrical, Pilates and more are available for students at various levels of ability. Deborah’s Palm 555 Lytton Ave., Palo Alto, 650-473-0664, info@deborahspalm.com, deborahspalm.com Deborah’s Palm is a nonprofit community organization that aims to provide a warm and supportive environment for all women. Its class offerings range from workshops on compassion and stress management to classes on job strategy, knitting, goal setting and art. Palo Alto Summer Strings First Lutheran Church, 600 Homer Ave., Palo Alto, 650-766-5084 This summer camp offers a chamber music workshop during which (continued on next page)

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 29


Summer Class Guide

Catch up, get ahead, or try something new this summer. Join us for a summer semester! Fusion Academy is an accredited private school for grades 6 through 12. We provide a comprehensive learning solution for students of all ages, on their terms, ďŹ t to their schedule, and crafted to support their unique learning style. We offer academic tutoring, enrichment, and classes for credit - all just one teacher and one student per classroom.

-\ZPVU7HSV(S[V -\ZPVU:\TTLY*SHZZJVT 

TENNIS! Summer Camps (Palo Alto)

Week Long Camps June 5 - August 11 Ages 3.5 to 18 Morning (9:00am-1:00pm) â&#x20AC;˘ Afternoon (2:00-6:00pm) Evening (6:00-8:30pm) CertiďŹ ed Coaching Team Providing Consistent Improvement with Tons of FUN!

GET "UY THE RD WEE " K U RECE Y AT S Activities Include:  IVE WE WEE EK OFF â&#x20AC;˘ Structured Games â&#x20AC;˘ Point/Match Play K S &2% â&#x20AC;˘ Lessons of the Day â&#x20AC;˘ Fitness/Agility % Register Today Online

www.KimGrantTennis.com 3005 MiddleďŹ eld Road, Palo Alto (behind Winter Lodge)

(continued from previous page)

students will experience playing in a trio or quartet. Each five-day session includes coachings, a masterclass and a Friday concert. At least one year of private lessons is required, and the first session starts on June 12. Lingling Yang Violin Studio Middlefield Road and East Meadow Drive, Palo Alto, 650456-7648, linglingviolin.blogspot. com, linglingy@gmail.com This studio offers private violin instruction to children ages 7 and up and adults of all levels. Enrollment is offered year-round and auditions are required for intermediate and advanced violin players. Classes are taught by a classically trained violinist and experienced violin teacher whose students include award winners at violin competitions and members of PACO, CYS and ECYS. The Midpen Media Center 900 San Antonio Road, Palo Alto, 650-494-8686, info@midpenmedia.org, midpenmedia.org The center offers workshops for a range of media arts, including video production, photo enhancement, studio work and more. The center suggests starting with one of its free hour-long orientation sessions. Palo Alto Art Center 1313 Newell Road, Palo Alto, 650-329-2366, cityofpaloalto.org/ gov/depts/csd/artcenter Palo Alto Art Center classes and workshops â&#x20AC;&#x201D; teaching children, teens and adults â&#x20AC;&#x201D; cover such areas as ceramics, painting, drawing, jewelry, sculpture, Adobe PhotoShop and more. Sur La Table Cooking School Town & Country Village, 855 El Camino Real, #57, Palo Alto, 650289-0019, cooking073@surlatable. com, surlatable.com Sur La Table offers hands-on cooking classes, guiding students in making regional cuisines, themed meals or special foods like bread, croissants and baked goods. Classes for kids, teens and adults are available.

Parenting

Childrenâ&#x20AC;&#x2122;s Health Council 650 Clark Way, Palo Alto, 650-326-5530, info@chconline.org, chconline.org Childrenâ&#x20AC;&#x2122;s Health Council holds a

variety of classes touching on childbehavior issues, dyslexia, anxiety and depression, attention deficit hyperactivity disorder, autism and other topics related to encouraging all childrenâ&#x20AC;&#x2122;s success. Parents Place 200 Channing Ave., Palo Alto, 650-688-3040, parentsplaceonline. org/location/peninsula A resource center for parents, Parents Place on the Peninsula offers workshops on subjects ranging from sibling rivalry to building a childâ&#x20AC;&#x2122;s self-esteem and confidence. Parent and child activity groups are also organized.

Education

Gideon Hausner Jewish Day School 450 San Antonio Road, Palo Alto, 650-494-8200, hausner.com Instructing children in kindergarten through eighth grade, Gideon Hausner Jewish Day School provides strong academics, instruction in Jewish studies and the Hebrew language, enrichment opportunities and after-school programs. HeadsUp! Child Development Center 2800 W. Bayshore Road, Palo Alto, 650-424-1221, pacdc@headsup.org, headsup.org/headsup HeadsUp! Child Development Center serves infants, toddlers and preschoolers (to age 6) with a fullday program, year-round. The Montessori curriculum focuses on building thinking skills and personal values. A bilingual Chinese-English preschool classroom is also available. Kehillah Jewish High School 3900 Fabian Way, Palo Alto, 650-213-9600, kehillah.org This college-preparatory high school (grades nine through 12) features modern science and computer labs, art and music studios, a drama program, a full range of academic courses with small class sizes, sports teams and more. Living Wisdom High School of Palo Alto 4000 Middlefield Road, Palo Alto, Cubberley Community Center, 650-646-1066, kabir@livingwisdomhighschool.org, LivingWisdomHighSchool.org Living Wisdom High School serves ninth through 12th grade, and

650.752.8061

at Monterey Bay

BEACH CAMP - Sleep Away Camp (Monterey Bay)

Weekly Camps June, July, August Activities include: â&#x20AC;˘ Pickle Ball â&#x20AC;˘ Tennis â&#x20AC;˘ Horsebackriding â&#x20AC;˘ Swimming â&#x20AC;˘ Kayaking â&#x20AC;˘ Baseball â&#x20AC;˘ Golf â&#x20AC;˘ Basketball

MeadowbrookSwimAndTennis.com FUN! FUN! FUN! %NQUIRIESHELLO MEADOWBROOKSWIMANDTENNISCOM - Limited Openings Page 30 â&#x20AC;˘ May 12, 2017 â&#x20AC;˘ Palo Alto Weekly â&#x20AC;˘ www.PaloAltoOnline.com

Inspiring Global Citizens ie Sci rts ld en Sp o s Tri ce y ps m g M o Inte usic Art Technol Progra rnati onal Exchange

Meadowbrook Swim & Tennis

offers a strong emphasis on personalized learning as well as projectbased, experiential, in-depth study rooted in creativity, inner development, compassion, critical thinking and problem-solving. Additionally, daily yoga and meditation instruction is included, and curriculum includes a balanced approach to academics and well-being through outdoor adventures and field trips abroad. The school will open in the fall of 2017. Living Wisdom School of Palo Alto 456 College Ave., Palo Alto, 650462-8150, info@livingwisdomschool.org, LivingWisdomSchool.org TK-8th grade. See 6-minute video at LivingWisdomSchool.org. 24 years of proven success with new high school opening fall 2017 (see listing or ad). Offering daily yoga and meditation and experiential, project-based learning, Living Wisdom School has 24 years of proven success and serves grades TK through eighth grade. It offers a 1:6 teacher-student ratio in kindergarten; an integrated arts program which includes music, theater, art and dance; a balanced approach to technology; and after-school care. Oshman Family JCC Leslie Family Preschool 3921 Fabian Way, Palo Alto, 650223-8788, earlychildhood@paloaltojcc.org, paloaltojcc.org/preschool The Oshman Family JCCâ&#x20AC;&#x2122;s award-winning preschool program provides an atmosphere for building healthy and positive learning experiences. The Yad Bâ&#x20AC;&#x2122; Yad program is for children 12 to 18 months of age. Parent/caregiver participation programs are available for children 12 to 23 months old. Meira Academy 3921 Fabian Way, Palo Alto, 650-485-3589, office@meiraacademy.org, meiraacademy.org Meira Academy is a traditional, all-girls Jewish high school devoted to academic excellence in general and incorporates Jewish studies as well as seminaries in Israel with an overarching goal of preparing its students for college. Milestones Preschool 3864 Middlefield Road, Palo Alto, 650-618-3325, preschool@abilitiesunited.org, abilitiesunited.org Milestones Preschool offers a year-round, project-based program

F

GISSV students learn in a multicultural, dual-language immersion environment that promotes responsibility, critical and imaginative thinking and academic excellence. Our programs culminate in U.S. and German diplomas, preparing our graduates for worldwide opportunities.

PRESCHOOL - GRADE 12 AT THREE LOCATIONS IN THE BAY AREA

WWW.GISSV.ORG


Summer Class Guide that fosters the social, emotional, cognitive and physical development of children ages 2 to 5. Mustard Seed Learning Center 2585 E. Bayshore Road, Palo Alto, 650-494-7389, info@mustardseedlearningcenter.org, mustardseedlearningcenter.org The Mustard Seed Learning Center is an after-school tutoring and care program that teaches local youth to speak Mandarin Chinese, in addition to emphasizing social development and excellence in mathematics, science, arts and music. It also has a preschool program. Sand Hill School 650 Clark Way, Palo Alto, 650688-3605, info@sandhillschool. org, sandhillschool.org As part of the Children’s Health Council, Sand Hill School teaches children from kindergarten through eighth grade with language-based learning differences, and assists with the attention and social difficulties that go along with them.

classes — and many other offerings — are available through the Palo Alto Adult School. Registration for the summer session begins on May 26, and classes start on June 5. Stanford Continuing Studies Littlefield Center, 365 Lasuen St., Stanford, 650-725-2650, continuingstudies@stanford.edu, continuingstudies.stanford.edu Stanford Continuing Studies organizes classes in liberal arts and sciences, creative writing and professional and personal development. Courses are held in the evenings or on Saturdays. Stanford Continuing Studies also presents lectures, performances, conferences and other events. Class Guides are published quarterly in the Palo Alto Weekly, Mountain View Voice and the Almanac. Descriptions of classes offered in Palo Alto, Stanford, Menlo Park, Mountain View, Atherton, East Palo Alto, Los Altos, Los Altos Hills, Portola Valley and Woodside are provided. Listings

are free and subject to editing. Due to space constraints, classes held in the above cities are given priority. To inquire about submitting a listing for the next Class Guide, email Editorial Assistant Anna Medina at amedina@paweekly. com or call 650-223-6515. To place a paid advertisement in the Class Guide, call the display advertising department at 650-326-8210.

Advertiser Directory CodeREV Kids, Mountain View Emerson School, Palo Alto German International School, Mountain View Write Now!, Palo Alto Fusion Academy, Palo Alto HeadsUp!, Palo Alto Kim Grant Tennis, Palo Alto Palo Alto Adult School, Palo Alto Ventana School, Los Altos

For Adults

Avenidas 450 Bryant St., Palo Alto, 650289-5400, avenidas.org Avenidas offers a plethora of classes, as well as lectures and workshops, for seniors focusing on topics such as general health, physical fitness, languages, humanities, computing, music and writing. Membership costs, fees and class descriptions are listed on the website. Bay Area Friendship Circle 3921 Fabian Way, Suite A023, Palo Alto, 650-858-6990, bayareafc.org, info@BayAreaFC.org The Bay Area Friendship Circle offers programs for kids and teens with special needs ages 2 to 22 year round as well as winter and summer camps. Trained teen volunteers provide one-on-one friendship and support. This year’s summer camps start on July 31. To register for programs or camp visit their website. CareerGenerations 2225 E. Bayshore Road, Suite #200, Palo Alto, 650-320-1639, info@careergenerations.com, careergenerations.com CareerGenerations offers group workshops and programs to meet the career needs of a variety of individuals, including college students looking for internships, graduates looking for employment and those reentering the market. Language classes at the Palo Alto Adult School Palo Alto High School, Tower Building, 50 Embarcadero Road, Palo Alto, 650-329-3752, adultschool@ pausd.org, paadultschool.org/class/ world-languages Classes are offered in Spanish, French, Italian and Mandarin Chinese. The classes cover beginning and advanced skills and sometimes literature and arts. Palo Alto Adult School 50 Embarcadero Road, Palo Alto, 650-329-3752, adultschool@ pausd.org, paadultschool.org Computer, language, cooking, writing, art, outdoor and finance

Emerson School

CULTIVATING ASTONISHING POTENTIAL!

SUMMER WRITING CAMPS July 10 - July 28, 2017

Give yourself the gift of learning

WRITE NOW!

• Expository Writing • Creative Writing • Presentation Techniques

for Grades 2-8

For applications and information: writenow@headsup.org www.headsup.org

Writing Academy • Art • Cooking • ESL • Career Training • Music • Photography • Home & Environment • Parenting • Computer Skills World Languages • Woodworking, and more • A Reggio-inspired Episcopal School • Art infused curriculum • Project based experiential learning • Specialists teachers in art, music, STEM and tinkering, PE and Spanish • Teacher framed, student led collaborative learning

PALO ALTO ADULT SCHOOL REGISTER NOW!

PAAdultSchool.org / (650) 329-3752

Now enrolling Preschool and Elementary Grades K-5

Call 650.948.2121

Summer Camp Registration Open!

Learn more at VentanaSchool.org www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 31


Home&Real Estate

OPEN HOME GUIDE 60 Also online at PaloAltoOnline.com

A weekly guide to home, garden and real estate news, edited by Elizabeth Lorenz

Home Front BIRD WALKS ... The Filoli estate in Woodside is offering four bird walks with member of the Audubon Society as well as Friends of Filoli this spring. Walks are from 9 a.m. to noon on Saturdays, May 20 and June 17, and Thursdays, May 11 and June 8. Hundreds of migrating birds visit Filoli each year on their way from Central and South America to their breeding grounds farther north. To register, go to filoli.org. FILOLI GARDEN TOUR ... Docents at Filoli will host several hikes on the property from 10 a.m. to noon on Sundays, June 11, Aug. 6 and Oct. 1, and Fridays, June 23 and July 21. Discover how the families lived at Filoli and used what is now the Nature Preserve. This hike covers approximately 2 miles of trails with steep inclines. To register, go to filoli.org. NEW WAYS TO ARRANGE ROSES ... Joan Sanders will teach a class on how to use roses and other foliage to create a fresh arrangement on Wednesday, June 21, 9:30-11:30 a.m., at Gamble Garden,1431 Waverley St., Palo Alto. The fee is $10 for members, $35 for nonmembers. To register, go to gamblegarden.org. ASK A GARDENER ... Both San Mateo and Santa Clara counties offer free garden/ pest advice through the UC Master Gardeners program (affiliated with the department of agriculture and natural resources for the University of California). The San Mateo County Helpline is open Mondays and Thursdays from 9 a.m. to 4 p.m. Call 650276-7430 or send an email to mgsmsf@ucanr.edu. For Santa Clara County, contact master gardeners Monday through Friday 9:30 a.m. to 12:30 p.m. at 408-282-3105 or visit 1553 Berger Drive, San Jose. Also, Fridays from February through November, 1-4 p.m., you can call 650-329-1356 x205 or visit Gamble Garden in Palo Alto.

Nyna Dolby takes apart a store-bought bouquet and spreads it out by color. She then puts the flowers together and inspects them.

N

101

Filoli floral expert offers tips for making stunning bouquets by Sarah Mason photos by Veronica Weber

yna Dolby works with cut flowers from the Filoli estate’s gardens when she arranges bouquets for the historic Woodside property. But, you don’t have to have acres and acres of floral options at your disposal when Costco or Safeway will do. Currently part of the team of arrangers who puts together the weekly flower arrangements at the estate, Dolby has some tips and tricks to make the perfect bouquet for Mother’s Day.

on them from the top, but that’s not how they will look when opened on a tabletop. Dolby recommends unwrapping the flowers when you get home. “Sort the materials in the bunch into some type of order — sort by type of flower or color of flower or size of flower,” Dolby said. “Then recombine the bunch with the flower stems at different lengths, so that each can be seen and positioned in the way they naturally grow.”

Transform a supermarket bouquet

Pick a vase and a location

Dolby warns that flower bouquets in stores are often made and selected by looking down

Prepare the flowers

Send notices of news and events related to real estate, interior design, home improvement and gardening to Home Front, Palo Alto Weekly, P.O. Box 1610, Palo Alto, CA 94302, or email elorenz@ paweekly.com. Deadline is one week before publication.

READ MORE ONLINE

PaloAltoOnline.com

There are more real estate features online. Go to PaloAltoOnline.com/ real_estate.

When selecting flowers at the store, begin thinking about the vase they will go into and where the vase will be placed. Are they going into a simple glass vase? Or a large extravagant one? “The location not only dictates the height, but also if it will be viewed from all sides,” Dolby said. For example, if the vase will be placed as a centerpiece on the dining room table then it needs to be low, so the flowers don’t block the conversations of the guests. Dolby loves all flowers, but she says that some long-lasting ones are lilies, gerbera daisies, roses, and hydrangeas. Her favorite “filler” is foliage found in the garden.

This bouquet will include foliage Dolby has picked from her own garden.

Page 32 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Dolby mixes each flower stem with greenery.

After cutting the flowers, give them warm water to drink right away, with only clean stems in the water. A splash of 7-Up — not a whole can— in the water helps give the flowers a little fertilizer and fructose to drink. Dolby also said to “condition” the flowers before putting them in water. This is a process of checking the flowers and stripping unnecessary leaves and debris off of them. If there (continued on next page)


Home & Real Estate

Once Dolby picks off leaves and makes sure the stems are clear, she trims all of the stems evenly. (continued from previous page)

are too many leaves left on the stems under the water line, bacteria will begin to grow in the water, shortening the life expectancy of your flowers. Her favorite projects are making bouquets for weddings. She always puts parts of the wedding and the personality of the bride into the arrangements. At one event where she was the keynote speaker, she invited six close friends to support her. She made a wedding-inspired bouquet onstage with flowers inspired by each one of her friends. “I started my talk

S JU

TL

E IST

D!

The next step is to place the flowers and greenery into the vase.

describing my childhood as “ordinary, and myself as an ordinary grocery store bouquet,” Dolby said. “I took a small bouquet and used it as the center of the hand-tied bouquet.” She added green hypericum berries for her friend Linda; tuberose for her college roommate Jan. The deep and lingering fragrance of that flower also reminded her of the deep conversations they have enjoyed together. The next was a hydrangea for her friend Jo. Dolby picked lavender for her friend Suzanne, who she has been friends with since their days in Seattle as young moms. “Holly was a garden rose, as her

Here’s the finished, transformed bouquet.

life has been thorny yet she brings the fragrance of love and laughter wherever she is,” Dolby said. Her sixth friend was Kimbra, who is 18 years younger than she is, and is like her much younger sister. She chose baby spray roses for her. Dolby has had an interest in gardening since she was a little girl when she found her peace in the garden. Her father and grandfather spent much of their time gardening, and she would follow them while they tended to their plants. Her interest in gardening expanded into her adult life when she studied environmental studies and physical geography at the University

of California, Santa Barbara. After she got married and had children, she lived in Seattle, where she took a sixweek flower-arranging class. The family moved to Los Altos in 1993 where her husband grew up. Soon after they moved back, Dolby’s mother-in-law told her about Filoli and she went for a job interview and joined Filoli in 1993. Committee members asked if she had any experience with flower arranging. Dolby recalled saying, “Actually, I took a flower arranging class.”Q Editorial Intern Sarah Mason can be reached at smason@paweekly.com.

3452 Cowper Ct Palo Alto

Open House: Saturday & Sunday 1:30 – 4:30 Tucked away on a peaceful cul-de-sac, this light-filled brandnew home is conveniently located in one of Palo Alto’s most desirable Midtown neighborhood, within walking distance to all Midtown facilities, schools, and 21-acre Mitchell Park that offers a wealth of active recreational opportunities.The moment you step into this exquisite home, you’ll be overcome by its loveliness and comfort, classic beauty and contemporary sophistication, and modern amenities that satisfy your every need. • 6 bedrooms, 5.5 baths, plus an office and a detached studio offers flexibility for a variety of needs, including office, hobbies, or fitness. • According to architect plans, total of 3,628 sq.ft., including a detached 1-car garage on approx. 9,200 sq.ft. lot. • Beautiful solid hardwood floors throughout. • Superbly equipped kitchen with garden window by the sink, large central island, beautiful granite countertops, top-of-the-line appliances, 48” Thermador vent hood and cooktop, 42” refrigerator and ample custom-built cabinetry; breakfast nook w/large windows & window seats. • Two tank-less water heaters; two furnaces, and two A/C units. • CAT-6 Ethernet data and dual coaxial for cable & satellite. • Surround sound with 5 built-in speakers; security system with 8 surveillance cameras and DVR system can be set up and controlled for easy home monitoring from anywhere with internet access. • Within walking distance of excellent Palo Alto schools & 21-acre Mitchell Park.

JUDY SHEN

Offered at $4, 980,000 For more photos, visit www.3452CowperCt.com

Coldwell Banker

650-380-8888 | 650-380-2000 CalBRE # 01272874

Jshen@cbnorcal.com | www.JudyShen.com www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 33


Home & Real Estate HOME SALES

Home sales are provided by California REsource, a real estate information company that obtains the information from the County Recorder’s Office. Information is recorded from the deeds after the close of escrow and published within four to six weeks.

Atherton 151 Almendral Avenue Group III 31 to Martin Trust for $11,710,000 on 04/07/17; built 1999, 6bd, 6,890 sq.ft.; previous sale 06/02/2006, $7,495,000

East Palo Alto

212 Azalia Drive A. Calderon to M. & I. Zamek for $808,000 on 04/05/17; built 1951, 4bd, 1,310 sq.ft.; previous sale 09/12/2003, $495,000 864 Donohoe Street J. Hall to S. Dhanam for $770,000 on 04/05/17; built 1979, 3bd, 1,110 sq.ft.; previous sale 04/05/1996, $180,000 480 East O’Keefe Street #208 I. Ambite to D. Wu for $620,500 on 04/05/17; built 1981, 1bd, 911 sq.ft.; previous sale 08/31/2010, $168,000

Los Altos

1684 Alexander Way R. & M. Campbell to M. Vandevoorde for $2,952,000 on 04/17/17; built 1968, 4bd, 2,536 sq.ft.; previous sale 04/1970, $59,500 944 Aura Court Bondy Trust to Chen Trust for $3,004,500 on 04/10/17; built 1956, 4bd, 2,549 sq.ft.; previous sale 05/06/2003, $935,000 261 Biarritz Circle Falkner Trust to J. & G. Tait for $3,017,500 on 04/12/17; built 1963, 3bd, 2,293 sq.ft. 1627 Christina Drive Hiatt Trust to Suzuki Trust for $2,500,000 on 04/12/17; built 1953, 3bd, 2,204 sq.ft.; previous sale 06/25/1982,

$155,500 631 Manresa Lane J. & D. Withers to Saper Trust for $2,995,000 on 04/14/17; built 1988, 3bd, 3,408 sq.ft.; previous sale 04/05/2005, $1,950,000 721 Orange Avenue C. & A. King to G. & K. Bryan for $3,303,000 on 04/14/17; built 1984, 4bd, 2,700 sq.ft.; previous sale 04/05/2013, $2,400,000 62 South Clark Avenue A. Beringer to A. Bernard for $3,600,000 on 04/10/17; built 2012, 5bd, 3,212 sq.ft.; previous sale 04/05/2012, $2,720,000 752 South El Monte Avenue I. Mitrevics to Avimadi Trust for $2,490,000 on 04/17/17; built 1952, 3bd, 2,397 sq.ft.; previous sale 04/09/2004, $602,500 395 South Gordon Way A. & A. Faaborg to Lee Trust for $3,850,000 on 04/10/17; built 1987, 4bd, 3,500 sq.ft.; previous sale 05/04/2015, $3,900,000 25 Stuart Court Norton Trust to A. & U. Lee for $2,700,000 on 04/10/17; built 1962, 3bd, 1,904 sq.ft. 280 Valley Street Mcintyre Trust to K. & V. Smilak for $4,675,000 on 04/12/17; built 2001, 5bd, 4108 sq.ft. (Previous Sale 08/01/2013, $3,500,000) 2055 Wooded Glen Drive Hwang Trust to J. Wang for $2,900,000 on 04/10/17; built 1955, 5bd, 2,831 sq.ft.; previous sale 06/14/2007, $1,842,000

Los Altos Hills

27408 Deer Springs Way Douglas Trust to J. & A. Erdmann for $3,200,000 on 04/14/17; built 1975, 5bd, 3,576 sq.ft.; previous sale 07/19/1974, $29,500 25255 La Loma Drive Furman Trust to Singh Trust for $3,151,000 on 04/10/17; built 1967, 3bd, 2,577 sq.ft. 28190 Radcliffe Lane

Taborek Trust to Salah Trust for $3,867,000 on 04/17/17; built 1974, 5bd, 2,764 sq.ft.; previous sale 08/22/1996, $1,019,500

Menlo Park 1982 Camino A Los Cerros Ronaghi Trust to E. Okeeffe for $5,005,000 on 04/05/17; built 2009, 5bd, 4,190 sq.ft. 1120 Hobart Street Mcdevitt Trust to Birch Tree for $3,751,500 on 04/10/17; built 1951, 4bd, 2,470 sq.ft.; previous sale 06/29/2012, $2,601,000 1035 Middle Avenue J. & G. Binkley to Robichaud Trust for $2,600,000 on 04/10/17; built 1949, 3bd, 2,045 sq.ft.; previous sale 06/18/2003, $750,000 298 Stanford Avenue J. Quan to D. Li for $4,600,000 on 04/05/17; built 1948, 3bd, 1,290 sq.ft.; previous sale 07/28/2015, $2,300,000

Mountain View

3386 Awalt Drive DRVO Builders to Mcconnell Trust for $2,925,000 on 04/11/17; built 1965, 3bd, 1,954 sq.ft.; previous sale 10/05/2016, $1,825,000 242 Bonny Street S. Julka to M. Binde for $2,625,000 on 04/11/17; built 1950, 4bd, 1,565 sq.ft.; previous sale 10/23/2015, $1,150,000 331 Deerwood Court #1202 Crose Trust to D. Saik for $1,326,000 on 04/10/17; built 1988, 3bd, 1460 sq.ft. (Previous Sale 06/16/1995, $240,000) 183 Easy Street S. Prathuru to V. Khanderia for $1,300,000 on 04/14/17; built 1985, 2bd, 1328 sq.ft. (Previous Sale 05/22/2012, $570,000) 211 Elmwood Street Sandoval Trust to Lam Trust for $787,000 on 04/12/17; built 1930, 2bd, 792 sq.ft. 260 Lassen Avenue P. Nissley to Siddall Trust for $1,850,000 on

04/14/17; built 1955, 3bd, 1280 sq.ft. (Previous Sale 04/28/2000, $610,000) 819 Montgomery Street Block Trust to N. Fan for $1,200,000 on 04/14/17; built 1979, 2bd, 1232 sq.ft. (Previous Sale 03/11/2005, $626,000) 162 Oberg Court Paderta Trust to H. Wang for $1,400,000 on 04/14/17; built 2006, 3bd, 1369 sq.ft. (Previous Sale 08/04/2006, $697,000) 400 Ortega Avenue #208 P. Koskelainen to Y. Chen for $828,000 on 04/14/17; built 1975, 2bd, 939 sq.ft. (Previous Sale 10/24/2012, $425,000) 71 Paul Avenue GuerraDelaossa Trust to S. Reinauer for $2,005,000 on 04/11/17; built 1956, 3bd, 1500 sq.ft. (Previous Sale 10/28/2014, $1,367,500) 661 Pettis Avenue E. Young to S. & J. Sommer for $2,435,000 on 04/10/17; built 1924, 3bd, 2428 sq.ft. (Previous Sale 10/01/2009, $1,250,000) 2071 Plymouth Street #E L. Xue to Y. Choe for $1,080,000 on 04/14/17; built 1983, 2bd, 1078 sq.ft. (Previous Sale 09/05/2014, $725,000) 612 Sierra Vista Avenue #K Y. Wong to C. Ye for $1,160,000 on 04/11/17; built 1979, 2bd, 1276 sq.ft. 182 Thompson Square A. Fiedler to I. & B. Bishara for $1,800,000 on 04/13/17; built 1956, 3bd, 1302 sq.ft. 925 Valencia Avenue A. Bernard to T. Lue for $2,905,000 on 04/10/17; built 2009, 4bd, 2,438 sq.ft.; previous sale 11/06/2013, $2,000,000 2268 West El Camino Real Bash Trust to LMV Mountain View Holdings for $3,900,000 on 04/11/17; built 1938, 3bd, 1590 sq.ft. (Previous Sale 06/25/2004, $2,800,000)

500 West Middlefield Road #153 E. Friedman to R. Tseng for $835,000 on 04/11/17; built 1971, 2bd, 1136 sq.ft. (Previous Sale 02/27/2008, $430,000) 333 Whisman Station Drive P. Liao to X. Mei for $1,332,000 on 04/17/17; built 1998, 3bd, 1390 sq.ft. (Previous Sale 06/30/2011, $645,000)

Palo Alto

101 Alma Street #804 B. Franks to I. Matsushima for $1,030,000 on 04/10/17; built 1960, 1bd, 913 sq.ft.; previous sale 07/24/2014, $975,000 1833 Edgewood Drive K. Robe to L. Weng for $2,600,000 on 04/14/17; built 1950, 4bd, 1,951 sq.ft. 3133 Emerson Street Clark Trust to R. & N. Parab for $2,350,000 on 04/12/17; built 1950, 3bd, 1,524 sq.ft. 4214 Juniper Lane C. Wong to M. Warren for $2,550,000 on 04/14/17; built 2007, 3bd, 2,873 sq.ft.; previous sale 11/15/2012, $1,540,000 2883 Kipling Street D. Hale to W. & J. Cao for $3,100,000 on 04/12/17; built 1948, 3bd, 2,288 sq.ft.; previous sale 09/07/1984, $222,000 3884 Magnolia Drive J. Schreiner to Z. Yan for $2,550,000 on 04/17/17; built 1947, 3bd, 1,569 sq.ft.; previous sale 11/03/2006, $1,100,000 224 North California Avenue Z. Trailer to T. Trailer for $757,000 on 04/13/17; built 1934, 2bd, 824 sq.ft.; previous sale 12/06/2005, $550,000 3783 Starr King Circle Ratner Trust to L. Zhang for $2,100,000 on 04/17/17; built 1952, 3bd, 1,664 sq.ft. 764 Sutter Avenue Cayne Trust to R. Wang for $4,060,000 on 04/17/17; built 2002, 4bd, 2,668 sq.ft.

1050 Waverley Street Strong Trust to A. Whitney for $1,900,000 on 04/17/17; built 1926, 2bd, 900 sq.ft.

Portola Valley

207 Westridge Drive Mitic Trust to Samstophe Trust for $3,700,000 on 04/10/17; built 1952, 5bd, 2,770 sq.ft.; previous sale 10/15/2013, $2,800,000

BUILDING PERMITS

2724 Cowper St. Demolish existing garage 2242 Louis Road Remove existing shake roof; install new decking; install new asphalt shingles. $9,025 1501 California Ave. Lot 21: New two-story single-family home, 2,489 sf, area of garage 513 sf, and area of porches 230 sf. $433,820 941 Emerson St. Replace main water line from meter 470 Marion Ave. Replace meter socket and fuse panel to meter main 3496 Bryant St. Sewer line spot repair 31105 Page Mill Road Install new sewer clean-out at foundation 3401 Hillview Ave. Vmware: remove and replace air-conditioning at (shipping & receiving). $141,441 355 University Ave. Design within reach: commercial rebuild (8,110 sf) and second-story addition (2,596 sf) basement perimeter walls (3 sides) to remain, new slab foundation and remove basement from below the sidewalk. Seismic rehabilitation of existing structure. $2,038,400 749 Wildwood Lane Remove and replace boiler. 3110 David Ave. Relocate electric service by 6-feet and upgrade electric service to 200 amps 1332 Parkinson Ave. Replace air conditioning unit.

300 SAND HILL CIRCLE, SUITE 205, MENLO PARK 3 BEDROOMS

|

2 B AT H R O O M S

Premier, expansive views of the Sharon Heights Countr y Club Golf Course.

|

Q uietest

LISTED - $2,195,000 side of the Circle. Open floor plan for Easy Enter taining.

gracious home boasts a Large master suite with double sinks , walk-in closet and 2nd private balcony. Large Living Room with Fireplace.

Separate Dining room with wall of glass .

This

Light, ef ficient kitchen with break fast nook .

Dining room , living room and 3rd bedroom (currently an of fice) face a

large covered patio overlooking the course. Secure underground parking (2 designated spaces) with storage unit and elevator to each floor. Heated Community Pool and Spa . Visitor parking. Midway between 2 Major Airpor ts , close to 28 0. Adjacent 30 0 0 Sand Hill Road, Rosewood Hotel, Restaurant and Spa . Close to Stanford University, Hospital and Shopping Mall. E xcellent Las Lomitas Schools . Rare Oppor tunity – Single Level in this location .

O P E N S U N DAY 1 - 4 J ENNY P OLLOCKK A TRADITION

650.867.0609 LIC# 01215021 Page 34 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

D EANNA A T ARR OF

TRUST

415.999.1232 LIC# 00585398


Award-Winning Health Care FOR 15 YEARS

n l o ia cti y ily ec Se b am d Sp ut ce d F ter n o u ll- d oo Ce Pu pronsw lth v e ea Ra H

PROVIDING

SPRING 2017

Celebrating 15 years of service at Ravenswood’s 15th Anniversary Gala. Ravenswood Board with Dr. Priscilla Chan (back row from the left): Melieni Talakai, Elizabeth Salas, Sherri Sager, Dr. Priscilla Chan, Marcelline Combs, CEO Luisa Buada, Senseria Conley, Gordon Russell, and Vernal Bailey; (front row from the left): Julio Garcia, Manuel Arteaga, and Adrian Amaral. Photo: Frederica Armstrong

CenteringPregnancy® to be Offered at Ravenswood Dear Friends,

CenteringPregnancy has been shown to reduce the likelihood that women will deliver babies with low birth-weight, ensuring that their children are less likely to suffer from numerous adverse health outcomes later in life. This program improves women’s well-baby visit attendance and their children’s immunization rates, generating a profoundly positive impact on their children’s life trajectories. Overall, CenteringPregnancy has the potential to EHQHƓWRXUHQWLUHSUHQDWDOSDWLHQW population of more than 580 women in the coming year. We are looking forward to this exciting new beginning!

On behalf of all of us at Ravenswood: Happy Mother’s Day to every one of you who is a “Mom” to someone special in your life! Luisa Buada, RN BSN MPH &KLHI([HFXWLYH2IƓFHU

Photo: Scott Buschman

As we approach Mother’s Day, we are pleased to announce a new program at Ravenswood Family Health Center: CenteringPregnancy. This program, licensed through the Centering Healthcare Institute, is a group-based model of prenatal care visits that connect women who will be delivering in the same month. During these visits, in addition to receiving routine medical attention, women can comfortably ask questions and explore social and emotional issues in facilitated discussions. Women in this program learn about healthy pregnancy and good infant care practices, such as the importance of breastfeeding, and recommended health screenings for FKLOGUHQ3DUWLFLSDQWVEHQHƓWIURPWKLV program by developing a strong support network of other expecting mothers, as well as Ravenswood staff; in turn, creating

relationships that will continue even after the birth of their children.

“All that I am or ever hope to be, I owe to my mother.”

–Abraham Lincoln

Ravenswood Family Health Center | 1


Our Mission To improve the health of the community by providing culturally sensitive, integrated primary and preventative health care to all, regardless of ability to pay or immigration status, and collaborating with community partners to address the social determinants of health.

Board Of Directors

Melieni Talakai, Chair Marcelline Combs, Vice Chair Julio Garcia, Treasurer Jonathan Lindeke, Secretary Manuel Arteaga, Parliamentarian Nancy Alvarez Adrian Amaral Vernal Bailey Senseria Conley Siteri Maravou Elizabeth Salas Raymond Mills, Board Liaison Sherri Sager, Board Liaison

Gateway to Motherhood: Comprehensive Perinatal Services Program Our staff at Ravenswood Family Health Center understands that every woman is special and has unique needs during pregnancy. The Comprehensive Perinatal Services Program (CPSP), offered through the Womenâ&#x20AC;&#x2122;s Health department at Ravenswood, has provided expecting mothers with individualized care since 2004. Services provided to pregnant patients between conception and 60 days postpartum include nutrition and health education, psychosocial assessments, referrals, and follow-up care in conjunction with standard obstetric and preventative care. Isabel QuiĂąonez, Womenâ&#x20AC;&#x2122;s Health Program Manager, oversees Ravenswoodâ&#x20AC;&#x2122;s CPSP program and all reproductive KHDOWKVHUYLFHVZLWKLQWKHGHSDUWPHQW+HUWHDPRIFHUWLĆ&#x201C;HG Comprehensive Perinatal Health Workers (CPHW) works closely with pregnant women to learn about their medical histories, needs, and challenges in order to better understand the barriers women experience which can directly affect their health.

Advisory Council

Patricia Bresee, Chair Maya Altman Greg Avis Caretha Coleman Chris Dawes Greg Gallo Lily Hurlimann Rose Jacobs Gibson Dr. Ross Jaffe Jim Koshland Dr. Phil Lee Dr. Richard Levy Gordon Russell John A. Sobrato Dr. Frederick St. Goar Jane Williams

One of Ravenswoodâ&#x20AC;&#x2122;s CPHWs, Ms. Sonia Cardenas, grew up LQ(DVW3DOR$OWRDQGZLWQHVVHGĆ&#x201C;UVWKDQGWKHFKDOOHQJHVRI her community. She meets with women one-on-one to assess and determine the types of services they require. She

Sonia Cardenas, CPHW (left), with Isabel QuiĂąonez, Womenâ&#x20AC;&#x2122;s Health Program Manager (right). Photo: Brian Leahy

then constructs an individualized care plan for each woman. â&#x20AC;&#x153;Each care plan is tailored to the circumstances of each patient,â&#x20AC;? explains Ms. Cardenas, â&#x20AC;&#x153;I assess and decide if expectant mothers need genetic counseling, ultrasounds, additional obstetric appointments, and counseling services during their pregnancy.â&#x20AC;? Ms. Cardenas often reminds her patients that their common goal is for the mother to give birth to a healthy baby. She truly enjoys working closely with women from her community so that they can obtain the care and services they need at Ravenswood. â&#x20AC;&#x153;This is my community. Seeing the resources given to them through this clinic, itâ&#x20AC;&#x2122;s a big deal [to me]!â&#x20AC;?

Lactation: A Motherâ&#x20AC;&#x2122;s Superpower As the in-house lactation specialist at Ravenswood, Nikki Gallegos, a Registered Nurse and International Board &HUWLĆ&#x201C;HG/DFWDWLRQ&RQVXOWDQWZRUNVWLUHOHVVO\WRSURPRWH breastfeeding. â&#x20AC;&#x153;I work with women so that they can believe in themselves and their bodies and their ability to provide the nutrition their babies need,â&#x20AC;? says Ms. Gallegos.

Nikki Gallegos, Lactation Specialist and RN Photo: Brian Leahy

Moms attend a 60-minute one-on-one lactation session with Ms. Gallegos within a week after giving birth. Ms. Gallegos begins each session by weighing the baby. She then observes the feeding and weighs the baby again to determine how much milk was consumed. If a mom has GLIĆ&#x201C;FXOW\EUHDVWIHHGLQJ0V*DOOHJRVZLOODVVHVVWKH motherâ&#x20AC;&#x2122;s breasts, and examine the babyâ&#x20AC;&#x2122;s mouth for anomalies that may prevent milk transfer. She also

demonstrates alternative positioning and latch techniques to try during feeding to help reduce a motherâ&#x20AC;&#x2122;s discomfort and improve her babyâ&#x20AC;&#x2122;s milk consumption. To ensure successful lactation, Ravenswood directs moms to resources for breast pumps and information on how to create milk reserves. If the QHZERUQLVXQDEOHWRWDNHPRWKHUĹ?VPLONVXIĆ&#x201C;FLHQWO\0V Gallegos discusses supplemental milk options. Ms. Gallegos strongly believes in a motherâ&#x20AC;&#x2122;s innate potential DVDQDWXUDOSURYLGHURIQXWULHQWVLQKHUEDE\Ĺ?VĆ&#x201C;UVW\HDU â&#x20AC;&#x153;Knowing that I am promoting something that is natural and normalâ&#x20AC;&#x201D;I want to remind women how powerful they are. They can actually sustain another human life, not just in the nine months of gestation, but in the nine or twelve months afterwards.â&#x20AC;?

Photo: Brian Leahy

2

| Ravenswood Family Health Center

15 Years Of Helping Fam


Our Vision

What We Do

Our patients will be educated, engaged and empowered to actively manage their health and become advocates for healthy living within their family and the community, inspiring

PRIMARY MEDICAL CARE

Pediatric & Adolescent Medicine Adult Medicine • Prenatal Care • Screening & Immunizations • Women’s Health • Referrals to Specialty Care • Optometry & Optical Services • Pharmacy • General X-ray • Ultrasound • Mammography • •

others to value that good health is true wealth.

Baby Blues: Addressing Post-Partum Depression in Parents Motherhood can be an overwhelming transition, especially when combined with post-partum depression. This complex condition may manifest within one month to a year after the birth, pregnancy, or loss of a child. Dr. Joanna Zygmont, Clinical Director of the Integrated Behavioral Health Services (IBHS) department at Ravenswood, works with mothers to identify and address the underlying issues contributing to the condition.

risk even when other areas of her life are in turmoil.

Post-partum depression may consume a mother with the desire to withdraw from her baby or unconscious thoughts of harming her child. Fathers may also develop depression and adjustment disorders. Dr. Zygmont recalls a case where a mother did not feel she had her husband’s support, but he did not know how to help her. Dr. Zygmont worked with the couple and encouraged them to communicate and be each other’s support system. “The experience of parenthood is shared, and should be shared,” says Dr. Zygmont.

“Bearing witness to somebody’s struggle and adding value,” Dr. Zygmont says, is what makes her work ZRUWKZKLOH3DWLHQWVRIWHQGURSE\KHURIƓFHMXVWWRWHOOKHU how well they are doing and to share stories of how their children are achieving feats beyond their expectations. “One of the perks of my job,” says Dr. Zygmont “is being able to see the babies grow and thrive!”

Although post-partum depression cannot always be prevented, Ravenswood’s IBHS department works to address it through therapy and medication management. Dr. Zygmont also works with patients to set realistic goals for raising their children and to accept that no one is a perfect parent.

Integrated Behavioral Health Services Clinical Director, Dr. Joanna Zygmont, Psy.D.

“A lot can be done while the mom is pregnant,” says Dr. Zygmont. An expectant mother can participate in interventions to help foster a healthy attachment to her unborn child. A strong bond to her child reduces a mom’s

Photo: Brian Leahy

INTEGRATED BEHAVIORAL HEALTH SERVICES • Crisis

Intervention Counseling • Pediatric & Adult • Social Service Referral • Parenting Support • Domestic Violence Counseling • Short-term

CENTER FOR HEALTH PROMOTION • Chronic

Disease Management Coaching • Health Coverage Enrollment • Health

RAVENSWOOD FAMILY DENTISTRY • Pediatric

& Adult Dental Care • Restorative & Periodontal Care • Crowns, Bridges & Dentures • Oral Surgery • Emergency Dental Services • Oral Health Education • Preventive Dental Care in 31 San Mateo County Pre-Schools • Preventive

Eriana’s Story: A Journey in Maternity Born and raised in Palo Alto, Eriana had never heard of Ravenswood until she met one of our Comprehensive Perinatal Health Workers (CPHW) at a Black History Month Celebration in Daly City. Eriana had previously felt like she was just another number at other facilities when she began seeking prenatal care. After speaking with Ravenswood’s CPHW she was convinced to give Ravenswood a try. Eriana was not disappointed in her decision. Since she became a patient in February 2017, Ravenswood has provided Eriana with all of the support and resources she QHHGVWRGHOLYHUDKHDOWK\EDE\JLUO(ULDQDōV&HUWLƓHG Nurse Midwife, Christine Ludwick, meets with her regularly Eriana and husband, Myles (right) with Sheila Castrillo-Hodgson, RN (left).

RAVENSWOOD FAMILY HEALTH CENTER

1885 Bay Road East Palo Alto, CA 94303 Tel: 650.330.7400 CENTER FOR HEALTH PROMOTION

Eligibility & Enrollment 1805 Bay Road East Palo Alto, CA 94303 Tel: 650.330.7416 RAVENSWOOD FAMILY DENTISTRY

1807 Bay Road East Palo Alto, CA 94303 Tel: 650.289.7700

Continues on back cover

Photo: Brian Leahy

milies Grow And Thrive.

Photos, bottom row: Federica Armstrong & Kathleen Alexander

www.RavenswoodFHC.org | 3


Erianaâ&#x20AC;&#x2122;s Story

Celebrating Ravenswoodâ&#x20AC;&#x2122;s 15 Year Anniversary! With over 400 guests in attendance, Ravenswood celebrated 15 years of community commitment on March 3, 2017. The banquet hall, situated within the spacious walls of the Computer History 0XVHXPLQ0RXQWDLQ9LHZZDVĆ&#x201C;OOHGZLWKHFKRHV of yesterdayâ&#x20AC;&#x2122;s accomplishments and visions of brighter tomorrows. The theme of the Gala was â&#x20AC;&#x153;It Takes A Villageâ&#x20AC;?â&#x20AC;&#x201D;a UHĹ´HFWLRQRIWKHFRPPXQLW\VSLULWDQG partnerships that have ensured Ravenswoodâ&#x20AC;&#x2122;s success since its conception. Since its humble beginnings, Ravenswood has grown in size and ambition, successfully accommodating an increasing number of patients while continuing to provide a comprehensive scope of health care services including pediatrics, adult medicine, integrated behavioral health, womenâ&#x20AC;&#x2122;s health, dentistry, optometry, pharmacy, mammography, ultrasound, x-ray, lab, patient health education, and enrollment. Ravenswoodâ&#x20AC;&#x2122;s Village was represented by LQĹ´XHQWLDOFRPPXQLW\OHDGHUVLQFOXGLQJ3DVWRU Paul Bains, head of the Project WeHope Shelter in East Palo Alto; Dr. Frederick St. Goar, Director of the Fogarty Institute for Innovation and valued Ravenswood Advisory Council Member; and Dr. Priscilla Chan, Co-Founder of the Chan Zuckerberg Initiative and CEO of The Primary School. Ravenswoodâ&#x20AC;&#x2122;s CEO, Luisa Buada, presided over the awards ceremony, honoring individuals who have been with the organization from the start. A 15th Anniversary Celebration video featured interviews with Ravenswood patients, staff, Board 0HPEHUVDQGFRPPXQLW\EHQHĆ&#x201C;FLDULHVZKR

attested to the unique ties the health center has created within the community. For their continued dedication to Ravenswoodâ&#x20AC;&#x2122;s mission and vision since its beginning, three inaugural Board Membersâ&#x20AC;&#x201D;Julio Garcia, Melieni Talakai, and Sherri Sagerâ&#x20AC;&#x201D;and six Ravenswood staffâ&#x20AC;&#x201D;Amy Wolfe, Lisa Lestishock, Christine Ludwick, Tayischa Deldridge, Quynh Tran, and Verenice Escarsegaâ&#x20AC;&#x201D;were recognized for their pivotal support. Special recognition was bestowed upon philanthropist, Gordon Russellâ&#x20AC;&#x201D;former Ravenswood Board Member and current Advisory Council Memberâ&#x20AC;&#x201D;as well as health care partner, Sutter Health/Palo Alto Medical Foundation. Each honoree was introduced through individualized videos, and was gifted with special public commendations SURYLGHGE\Ć&#x201C;YHHOHFWHGRIĆ&#x201C;FLDOVĹ&#x2039;6DQ0DWHR County Board of Supervisors Member Warren Slocum, State Senator Jerry Hill, State Assemblyman Marc Berman, and Congresswomen Jackie Speier and Anna Eshoo.

(ULDQD ULJKW ZLWK&HUWLĆ&#x201C;HG1XUVH Midwife, Christine Ludwick (left)

(Continued from inside) for prenatal visits where they discuss the progression of her pregnancy, complete routine tests, review lab results, and address questions and concerns. Eriana had attended college to become a nurse midwife herself, so having a partner in care who went through the same WUDLQLQJPDNHVKHUIHHOFRPIRUWDEOHDQGFRQĆ&#x201C;GHQW

The evening concluded with a Fund-A-Need auction to raise funds for Ravenswoodâ&#x20AC;&#x2122;s new Early Childhood Development Initiative. Ravenswoodâ&#x20AC;&#x2122;s goal was to raise $100,000, and within 15 minutes, $125,000 had been pledged and donated to support the initiative and its programs! Ravenswoodâ&#x20AC;&#x2122;s 15th Anniversary Gala was made possible thanks to the generous support of FRPPXQLW\VSRQVRUVDWWHQGHHVHOHFWHGRIĆ&#x201C;FLDOV and their representatives, Ravenswood staff, donors, and well-wishers. Only together, as a Silicon Valley Village, can we achieve our goal of raising healthy children who are motivated to dream big and accomplish great things.

In addition to making sure that Erianaâ&#x20AC;&#x2122;s baby is healthy, Ms. Ludwick reminds her to look after her own health as well. Eriana embraced her nurse midwifeâ&#x20AC;&#x2122;s advice, and underwent a vision screening and a physical exam. After a thorough physical exam and lab tests, Eriana learned that she was anemic. She was worried about how her condition could affect her babyâ&#x20AC;&#x2122;s health and how it could affect her energy once her child was born. Working together with Ms. Ludwick has eased her fears. â&#x20AC;&#x153;It means a lot,â&#x20AC;? Eriana says, â&#x20AC;&#x153;when you are pregnant, and you already have so many emotions going on, for someone to say â&#x20AC;&#x2DC;hey I see you and acknowledge youâ&#x20AC;&#x2122;.â&#x20AC;?

Photo: Kathleen Alexander

YES!

Iâ&#x20AC;&#x2122;D LIKE TO JOIN THE CARE TEAM $100 pays for one patientâ&#x20AC;&#x2122;s lab work $250 pays for one optometry visit

Photo: Brian Leahy

Eriana is not overwhelmed by feelings of uncertainty now that she has support from Ravenswood. She takes each day as it comes and celebrates every beautiful moment that brings her closer to the birth of her child. Eriana remembers WKHĆ&#x201C;UVWWLPHVKHKHDUGKHUEDE\Ĺ?VKHDUWEHDWĹ&#x2039;Ĺ?, started crying because thatâ&#x20AC;&#x2122;s the most beautiful music I have ever heard.â&#x20AC;? Erianaâ&#x20AC;&#x2122;s husband, Myles, often attends appointments with her. He shares his wifeâ&#x20AC;&#x2122;s appreciation for the high-quality care she receives at Ravenswood. Myles feels that he is an equal partner in Erianaâ&#x20AC;&#x2122;s prenatal care, and often speaks with Ms. Ludwick to discuss his wifeâ&#x20AC;&#x2122;s pregnancy. â&#x20AC;&#x153;Ms. Ludwick is amazing and always has an answer for each question!â&#x20AC;? he says.

$500 pays for one potentially life-saving mammogram $1,200 pays for one motherâ&#x20AC;&#x2122;s prenatal care $2,000 pays for one year of care for a diabetic patient Other: $_____________________

Donate online: RavenswoodFHC.org Donate via text: text RAVENSWOOD to 41444

OR

Mail check with this slip to: Ravenswood Family Health Center 1885 Bay Road, East Palo Alto, CA 94303

5DYHQVZRRG)DPLO\+HDOWK&HQWHULVDWD[H[HPSW F  QRQSURĆ&#x201C;WDJHQF\

4 | Ravenswood Family Health Center

With the birth of their baby girl only a few months away, Eriana and Myles are eagerly anticipating their next steps as parents. â&#x20AC;&#x153;I canâ&#x20AC;&#x2122;t wait to see our daughter in his arms,â&#x20AC;? says Eriana, smiling at her husband. Myles is excited to see which of his and his wifeâ&#x20AC;&#x2122;s features his daughter develops as she grows. â&#x20AC;&#x153;We are excited to see everything!â&#x20AC;?

Questions?&RQWDFWWKH'HYHORSPHQW7HDPDW'HYHORSPHQW#5DYHQVZRRG)+&RUJRU

www.RavenswoodFHC.org


12008 Adobe Creek, Los Altos Hills Offered at $5,988,000

659 Tennyson Avenue, Palo Alto Offered at $4,488,000

Rich Living, Alluring Serenity

Distinguished Home in Prestigious Old Palo Alto

www.12008Adobe.com

www.659Tennyson.com

We don’t get great listings. We make great listings.

DeLeon Realty

At DeLeon Realty, we are not limited to accepting only turn-key, luxury-grade listings. Our innovative team of specialists enables us to transform every one of our listings into a truly must-have home. Let us show you what we can do for your home. www.DELEONREALTY.com

650.488.7325 | info@deleonrealty.com | www.deleonrealty.com | CalBRE #01903224 www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 35


®

HOW BROKERAGES HANDLE IN-HOUSE DEALS Typical Brokerage “X”

DeLeon Realty ®

3% DeLeon Listing Agent

2.5 %

0% DeLeon Buying Agent

B k Brokerage ““X” X” Listing Agent

TOTAL COMMISSION

2.5% Brokerage B k “X” Buying Agent

TOTAL COMMISSION

3% (2.5% SAVINGS)

*5% (NO SAVINGS)

DeLeon Realty will waive the buyer-side commission on any new offer on a DeLeon listing submitted by a DeLeon buyer agent. For terms and conditions, please visit www.deleonrealty.com

*(NOTE: Commissions vary from agent to agent and should be negotiated based on the level of marketing and service provided by agent)

- SEMINAR -

Transparency in Real Estate

and What To Ask When Negotiating A Listing Agreement

Palo Alto Hills Golf & Country Club, Grand Ballroom 3000 Alexis Drive, Palo Alto

Thursday, June 1, 2017 6:00 - 8:00 p.m.

To RSVP, please contact 650.543.8500 or by email at RSVP@deleonrealty.com Seminar is for prospective clients only, no outside real estate professionals permitted.

6 5 0 . 4 8 8 . 7 3 2 5 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 9 0 3 2 2 4

Page 36 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


Open Sat, May 13 & Sun, May 14 (Mother’s Day!) 1:00 to 5:00 pm

Enjoy the Tranquility of this Gorgeous Woodside Home with Stunning Bay Views

17507 Skyline Boulevard Woodside

• 5 bedrooms / 4 bathrooms • Newly remodeled main house

Offered at $2,395,000

• Private guest cottage with full kitchen and bathroom

For virtual tour and more information, go to

• Conveniently located minutes away by car from Sand Hill Road and Stanford University

www.17507Skyline.com

• Award-winning Portola Valley schools: Ormondale School, Corte Madera School (Buyer to verify enrollment.)

(415) 317-3036 – Direct Veronica.Kogler@CBNorcal.com BRE #01788047

Coldwell Banker • 1377 El Camino Real • Menlo Park, CA 94025 www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 37


COMPLETELY RENOVATED GROUND FLOOR CONDO IN DOWNTOWN PALO ALTO

544 EVERETT AVENUE, PALO ALTO .SMRYWJSV0-:)197-' 3TIR,SYWI7EXYVHE] 7YRHE]TQTQ

To View the Video Tour, Additional Photos and/or Information on This Property, Go to: 544Everett.com

SCHOOL OVERVIEW

PROPERTY OVERVIEW

Addison Elementary (K-5) Jordan Middle (6-8) Palo Alto High (9-12)

FIHVSSQWSJÆ&#x192;GIFEXLWSRSRIPIZIP %TTVS\WUJXSJPMZMRKWTEGI 7TEGMSYWPMZMRKVSSQ[MXLÆ&#x192;VITPEGISYXPMRIHMR QEVFPIERHEXVEHMXMSREPQERXPITMIGI *SVQEPHMRMRK[MXLEGGIWWXSKEVHIRTEXMS 6IQSHIPIHOMXGLIR[MXL5YEVX^GSYRXIVXSTW 'SRGIEPIHPEYRHV]EVIE[MXLWMRO 4VMZEXIFVMGOTEXMSERHWQEPP]EVH

(Buyer to Verify Enrollment Eligibility)

OFFERED AT $1,598,000

650.218.4337 Square footage, acreage, and other information herein, has been received from one or more of a variety of different sources. Such LQIRUPDWLRQKDVQRWEHHQYHULÆ&#x201C;HGE\$ODLQ3LQHO5HDOWRUV,ILPSRUWDQWWREX\HUVEX\HUVVKRXOGFRQGXFWWKHLURZQLQYHVWLJDWLRQ

Page 38 â&#x20AC;¢ May 12, 2017 â&#x20AC;¢ Palo Alto Weekly â&#x20AC;¢ www.PaloAltoOnline.com

www.JOHNFORSYTHJAMES.com john.james@apr.com | License# 01138400


SCENIC. SECLUDED. PRIVATE. CENTRAL.

280 Family Farm Road, Woodside |7‫ٺ‬MZMLI\ !!!

OPEN HOUSE SUNDAY | May 14, 1:30 – 4:30 pm

W

hether it’s the delicate morning rays of sun

mature trees, beautiful gardens, and a host of birdlife,

greeting you over adjacent Jasper Ridge

this compound in the award-winning Portola Valley

or the dramatic wisps of fog peeking over

School District boasts an updated 4-bedroom, 4.5-bath

the Western Hills at sunset, there are stunning views in

main home, two 1-bedroom guest houses, pool, spa, and

every direction at this quiet, private sanctuary in Central

cabaña. Make coming home the best part of your day!

Woodside. Situated on 6+ acres of rolling grounds,

HELEN & BRAD MILLER

www.280FamilyFarmRoad.com Come See this Spectacular Property!

#1 Team in Woodside, 2013 – 2016

HELEN MILLER 650.400.3426 | helenhuntermiller@gmail.com | BRAD MILLER 650.400.1317 | bradm@apr.com | www.HelenAndBradHomes.com

License# 01142061 License# 00917768

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 39


n Su & 0 t Sa 4:3

en Op :30

1

481 San Luis Avenue

Los Altos



Offered at: $2,495,000 www.481sanluis.com

 Ideal family home just a short walk to Los Altos Village  4 bedrooms & 2.5 baths with extensive updating throughout  Top Los Altos schools

t Sa 0 n e :3 Op - 4

0

1:3

1068 Sonoma Avenue

Menlo Park

 Remodeled 3 bed, 2 bath home on expansive 9,500 sqft lot  Light-filled and fluid floor plan with separate family room  Top Menlo Park schools

billy mcnair



Offered at: $1,649,000 www.1068sonoma.com

broker associate | attorney | mba

#54 in the nation per Wall Street Journal rankings www.mcnairgroup.com | Cell: 650.862.3266 | billy@mcnairgroup.com www.facebook.com/mcnairgroup | twitter.com/billymcnair CalBRE#01343603

Information deemed reliable but not guaranteed. Buyer(s) should review any and all information to their complete satisfaction. Square footages are approximations received from a variety of sources and have not been verified.

Page 40 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


Unparalled Panoramic View in Central Woodside

OPEN SUNDAY | May 14, 1:30 – 4:30pm

970 Mountain Home Road | Woodside 7‫ٺ‬MZMLI\  www.970MountainHome.com

Large Stylish Traditional Woodside Home with Views

OPEN SUNDAY | May 14, 1:30 – 4:30pm

340 Jane Drive | Woodside 7‫ٺ‬MZMLI\  www.340JaneDrive.com

HELEN & BRAD MILLER #1 Team in Woodside, 2013 – 2016

HELEN MILLER 650.400.3426 | helenhuntermiller@gmail.com | BRAD MILLER 650.400.1317 | bradm@apr.com | www.HelenAndBradHomes.com

License# 01142061 License# 00917768

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 41


OPEN HOUSE 7%8792 

3414 PLATEAU DR, BELMONT

Offered at $1,398,000

1SZIMRVIEH]FIHVSSQFEXLVSSQLSQI[MXLERSTIR¾SSVTPERRIWXPIHMRWSYKLXEJXIV&IPQSRX,MPPW8LIWTEGMSYWPMZMRKVSSQ LEWTPERXEXMSRWLYXXIVWERHE½VITPEGI[MXLFVMGOWYVVSYRH8LIOMXGLIR[MXLKVERMXIGSYRXIVWWXEMRPIWWWXIIPETTPMERGIWERHEWO]PMKLX STIRWXSXLIHMRMRKVSSQ[LMGLMWWLS[IVIHMRREXYVEPPMKLXJVSQXLIKPEWWWPMHIVWXLEXPIEHXSXLI¾EKWXSRITEXMS%HHMXMSREPJIEXYVIW MRGPYHILEVH[SSH¾SSVWVIGIWWIHPMKLXMRKJVIWLTEMRXERHEREXXEGLIHGEVKEVEKI0YWL QEXYVIPERHWGETMRKMRGPYHMRKRYQIVSYW QETPIXVIIWERHERI\TERWMZIVIEVPE[R)\GIPPIRXWGLSSPWEGGIWWXSGSQQYXIVSYXIW GPSWITVS\MQMX]XSEQYPXMXYHISJPSGEPWXSVIW

VIWXEYVERXW,SQIWUJX0SXWUJX

This information was supplied by third party sources. Sales Associate believes this information is correct but has not verified this information and assumes no legal responsibility for its accuracy. Buyer should verify accuracy and investigate to Buyer’s own satisfaction.

BRIAN CHANCELLOR (650) 303-5511 brianc@serenogroup.com CalBRE# 01174998 Page 42 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Enjoy the tour at brianchancellor.com


BY APPOINTMENT ONLY

126 Kellogg Avenue, Palo Alto

2IIHUHGDW

CHARMING SHINGLE-SIDED CRAFTSMAN-STYLE HOME IN OLD PALO ALTO WITH LUXURIOUS HIGH-END AMENITIES AND TIMELESS ELEGANCE Â&#x2C6; FIHVSSQWERHJYPPFEXLVSSQW[MXLSTIRžI\MFPIPMZMRKEVIEYTWXEMVW GSYPHFIYWIHEWXLFIHVSSQ Â&#x2C6; )PIKERXPMZMRKVSSQ[MXLFVMGO½VITPEGIERHPSZIP]JSVQEPHMRMRKVSSQ[MXL*VIRGLHSSVW Â&#x2C6; 0MKLX FVMKLXOMXGLIR[MXLFE][MRHS[7YF^IVSJVMHKI8LIVQEHSV4VSJIWWMSREPWXSZI[MXLHYEPSZIRW 1MIPIWXIEQSZIR Â&#x2C6; *ERXEWXMGPMKLXWSEOIHJEQMP]VSSQ[MXL½VITPEGIZEYPXIHGIMPMRKERH*VIRGLHSSVWXSXLIVIEVHIGO Â&#x2C6; 7XYRRMRKQEWXIVFIHVSSQWYMXI[MXL[EPOMRGPSWIXW*VIRGLHSSVWXSXLIVIEV]EVHERHEKSVKISYWFEXLVSSQ[MXLGSZIHGIMPMRK Â&#x2C6; 9TWXEMVWPMZMRKEVIELEWZEYPXIHGIMPMRKWEREFYRHERGISJFYMPXMRFSSOGEWIWERHWXSVEKIWTEGISJ½GIWTEGI[MXLFYMPXMRHIWOERH *VIRGLHSSVWXSEFEPGSR]SZIVPSSOMRKXLIVIEV]EVH Â&#x2C6; (MZMHIHPMKLX[MRHS[WLMKLFEWIFSEVHWERHLEVH[SSHžSSVMRKXLVSYKLSYX Â&#x2C6; 0YWLERHTVMZEXIVIEV]EVH[MXLPEVKI[SSHIRHIGOVEMWIHžS[IVFIHWERHEXVIPPMWGSZIVIHTEXMS[MXLGPMQFMRKVSWIWERH[MWXIVME JSVEPJVIWGSHMRMRK Â&#x2C6; 4EVXMEPFEWIQIRX[MXLWXSVEKIPEYRHV]VSSQERHEGEVHIXEGLIHKEVEKI Â&#x2C6; ,SYWIWUJX0SXWUJX Â&#x2C6; 8VIIPMRIH WXVIIX MR GPSWI TVS\MQMX] XS8S[R  'SYRXV]:MPPEKI TEVOW HS[RXS[R 4EPS%PXS 'EPMJSVRME%ZI 'EP8VEMR  7XERJSVH 9RMZIVWMX] Â&#x2C6; )\GIPPIRXWGLSSPW;EPXIV,E]W)PIQIRXEV].SVHER1MHHPI4EPS%PXS,MKL This information was supplied by third party sources. Sales Associate believes this information is correct but has not veriďŹ ed this information and assumes no legal responsibility for its accuracy. Buyer should verify accuracy and investigate to Buyerâ&#x20AC;&#x2122;s own satisfaction.

BRIAN CHANCELLOR (650) 303-5511 EULDQF#VHUHQRJURXSFRP

(QMR\WKHWRXUDW brianchancellor.com

&DO%5( www.PaloAltoOnline.com â&#x20AC;˘ Palo Alto Weekly â&#x20AC;˘ May 12, 2017 â&#x20AC;˘ Page 43


®

OPEN HOUSE

Saturday & Sunday, 1 - 5pm

Complimentary Refreshments

MODERN STYLE NEAR DOWNTOWN 31 Artisan Way, Menlo Park Sophistication blends with functionality in this incredible 3 bedroom, 3 bath townhome of over 1,400 sq. ft. (per county). Built in 2014, this home boasts high-end amenities such as updated dual-zoned climate control, a tank-less water heater, and dimmable lighting throughout, while the inviting layout flows with abundant natural light. Residing within the highly-desired Allied Arts neighborhood, this lovely residence is within strolling distance of vibrant Santa Cruz Avenue, Caltrain, Nealon Park, and the Allied Arts Guild, while Stanford Shopping Center is also easily accessible. Exceptional schools, including Oak Knoll Elementary (API 961), Hillview Middle (API 950), and Menlo-Atherton High, are all nearby (buyer to verify eligibility).

Offered at $1,488,000

For video tour & more photos, please visit:

www.31Artisan.com

6 5 0 . 4 8 8 . 7 3 2 5 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 8 5 4 8 8 0

Page 44 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 45


®

OPEN HOUSE

Saturday & Sunday, 1 - 5pm

Complimentary Refreshments

SUN-LIT RESIDENCE WITH OPEN FLOORPLAN 1187 Portland Avenue, Los Altos Abundant sunlight flows throughout this incredible 6 bed, 4.5 bath home of over 5,300 sq. ft. (per county) on 12,500 sq. ft. (per county) of property. Large gathering areas are enhanced with sophisticated features like trey ceilings, two fireplaces, a lower-level recreation room, extensive windows, and multiple points of French-door access to the backyard. Though privately located, the home’s central neighborhood is within strolling distance of McKenzie and Heritage Oaks Parks, while Rancho Shopping Center is made easily accessible. Excellent schools such as Oak Avenue Elementary (API 987), Blach Intermediate (API 958), and Mountain View High are within biking distance (buyer to verify eligibility).

Offered at $3,998,000

For video tour & more photos, please visit:

www.1187Portland.com

6 5 0 . 6 9 0 . 2 8 5 8 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 9 0 3 2 2 4

Page 46 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


OPEN HOUSE SAT & SUN 1–4PM

The Perfect Entrée into Los Altos Hills 11523 Summit Wood Road, Los Altos Hills Offered at $2,695,000 | 4 Bedrooms | 2.5 Bathrooms | Home ±2,950 sf | Lot ±44,355 sf

Beautifully sited on a gently sloped, wooded knoll surrounded by heritage oaks, this Santa Barbara style ranch is the perfect entrée into Los Altos Hills. Although just minutes from downtown Los Altos and in close proximity to Silicon Valley’s tech and venture capital centers, the serene setting feels worlds away. Retreat up the hill to this tranquil and very private spot in the prestigious Pink Horse Ranch neighborhood. The arched entry walkway, terra cotta tile roof, dramatic rustic beamed ceilings and richly-colored tile

flooring create an understated Southwestern aesthetic to this original four bedroom, two and a half bath home. Custom built for the current owners in 1970, the spacious, welldesigned floor plan lends itself to reimagining for the way we live, work and play today. Come see this inviting property and plan the updates that will make it your own. Exceptional Los Altos Schools and easy access to the 24 miles of hiking trails at Rancho San Antonio Preserve round out this special offering.

Colleen Foraker 650.380.0085 colleen@colleenforaker.com CalBRE 01349099 Co-listed with Judy Bogard Tanigami 650.207.2111 | CalBRE 00298975 Each Office is Independently Owned and Operated.

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 47


A Luxury Collection By Intero Real Estate Services

2088 Green Oaks, Pescadero

5 Betty Lane, Atherton

$27,500,000

$26,800,000

$11,488,000

Listing By: Dana Cappiello & Derek Cappiello, Lic.# 01343305 & 01983178

Listing Provided by: Greg Goumas Lic.#01878208

Listing Provided by: Greg Goumas & John Reece, Lic.#01878208 & 00838479

0 Spanish Ranch Road, Los Gatos

27466 Sunrise Farm Rd, Los Altos Hills

19239 Bountiful Acres, Saratoga

10440 Albertsworth Lane, Los Altos Hills

$9,187,000

$8,750,000

$4,698,000

Listing by: Matthew Pakel & Craig Gorman, Lic.#01957213 & Lic.#01080717

Listing Provided by: Greg Goumas, Lic.#01878208

Listing Provided by: Michael Kaufman Lic. #00861006

106 Sacramento Avenue, Capitola

981 Saint Joseph Court, Los Altos

8715 Leavesley Road, Gilroy

$4,498,000

$3,999,950

$3,499,888

Listing Provided by: Jennifer Cosgrove, Lic.#01334273

Listing by: Albert Garibaldi & Matt Dapolito,,Lic.#01321299 & Lic.#2015668

Listing Provided by: Joe Velasco, Lic.#01309200

See our entire luxury collection at www.InteroPrestigio.com ©2017 Intero Real Estate Services Inc., a Berkshire Hathaway affiliate and a wholly owned subsidiary of HomeServices of America, Inc. All rights reserved.

Page 48 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com All information deemed reliable but not guaranteed. This is not intended as a solicitation if you are listed with another broker.


8715 Leavesley Road, Gilroy | $3,499,888 | Listing Provided by: Joe Velasco Lic. #01309200

www.8715LeavesleyRoad.com Customized to the unique style of each luxury property, Prestigio will expose your home through the most influential mediums reaching the greatest number of qualified buyers wherever they may be in the world. For more information about listing your home with the Intero Prestigio International program, call your local Intero Real Estate Services office. Woodside 1590 Cañada Lane Woodside, CA 94062 650.206.6200

Menlo Park 807 Santa Cruz Avenue Menlo Park, CA 94025 650.543.7740

Los Altos 496 First Street, Ste. 200 Los Altos, CA 94022 650.947.4700

www.InteroRealEstate.com www.InteroOpenHomes.com ©2017 Intero Real Estate Services Inc., a Berkshire Hathaway affiliate and a wholly owned subsidiary of HomeServices of America, Inc. All rights reserved. • All information deemed reliable but not guaranteed. This is not intended as a solicitation if you are listedwww.PaloAltoOnline.com with another broker.

Palo Alto Weekly • May 12, 2017 • Page 49


®

UPDATED HOME ON DESIRABLE LOT 5244 Shady Avenue, San Jose This extensively renovated 3 bedroom, 2 bath home of approx. 1,300 sq. ft. (per county) resides on a generous corner lot of 7,900 sq. ft. (per county). The accommodating central floorplan has been revitalized with new hardwood flooring and colors, while the updated kitchen and baths have been granted modern luxury with desirable amenities. Fine dining and shopping await nearby at Westgate Shopping Center, while local recreation at Saratoga Creek Park is just a stroll away. Also close by are fine schools, including Country Lane Elementary (API 942), Moreland Middle, and Prospect High (buyer to verify eligibility).

Offered at $1,298,000

For video tour & more photos, please visit:

www.5244Shady.com

( 6 5 0 ) 6 9 0 . 2 8 5 8 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 9 2 1 7 9 1 Page 50 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


PA LO A LTO

1 1

P H I L L I P S

R O A D

OPEN HOUSE SATURDAY & SUNDAY

MAY 13 & 14 • 1:30 PM - 4:30 PM • Just-completed, stunning Craftsman with masterfully modern interiors • 6 bedrooms, 6 full baths, plus 2 half-baths • Approximately 6,413 square feet • Open concept floor plan with fully retractable glass doors to the rear terrace • Soaring ceilings, expansive windows/skylights providing an abundance of natural light • Recreation room, fitness center, office, and customized wine cellar • Private rear yard plus spacious front and rear terraces • Lot size of approximately 9,750 square feet • Outstanding Palo Alto schools Offered at $8,798,000

GREG CELOTTI Realtor, QSC, RELO APR President’s Club Top 1% of Realtors

|

11Phillips.com

650.740.1580 greg@apr.com www.GregCelotti.com License# 01360103

Information deemed reliable, but not guaranteed.

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 51


®

OPEN HOUSE

Saturday, 1:30 - 4:30pm

CAPTIVATING VILLA WITH PRIVACY AND CONVENIENCE 21311 Sarahills Drive, Saratoga

Elegantly perched atop a generous 26,000 sq. ft. (per county) of property is this French chateau-inspired villa of over 4,300 sq. ft. (per appraisal), offering 3 bedrooms, an office, and 3 full and 2 half baths. Constructed by renowned builder David Flick, this home features oversized picture windows showcasing stunning hillside vistas while pouring abundant light into the palatial spaces. Modern luxuries include surround sound, dual-zone heating and cooling, and a surveillance system. Surrounded by verdant hillsides, local recreation can be found nearby at Foothill Park, while shopping at Argonaut Shopping Center and fine dining in The Village are just minutes away. Exceptional schools, including Foothill Elementary (API 934), Redwood Middle (API 966), and Saratoga High (API 938) are also close (buyer to verify eligibility).

Offered at $3,988,000

For video tour & more photos, please visit:

www.21311Sarahills.com

6 5 0 . 6 9 0 . 2 8 5 8 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 9 2 1 7 9 1

Page 52 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


®

OPEN HOUSE

Saturday, 1:30 - 4:30pm

UPGRADED LIVING IN DESIRABLE LOCATION 21724 Regnart Court, Cupertino Stunning views of rolling hills surround this extensively remodeled 5 bed, 4.5 bath home of nearly 3,400 sq. ft. (per county) which reaches almost 17,700 sq. ft. (per county) of property, and provides a three-car garage and a potential sixth bedroom. Elegant comfort is displayed in the free-form pool, enchanting outdoor areas, and entertainment-friendly spaces, while other luxuries include multiple fireplaces, exquisite marble elements, and detailed trimwork. Nearby recreation includes expansive Linda Vista Park, Cupertino Hills Swim and Racquet Club, and Deep Cliff Golf Course. Fantastic schools like Regnart Elementary (API 976), Kennedy Middle (API 987), and Monta Vista High (API 956) are easily accessible (buyer to verify eligibility).

Offered at $2,998,000

For video tour & more photos, please visit:

www.21724Regnart.com 6 5 0 . 4 8 8 . 7 3 2 5 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 9 0 3 2 2 4

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 53


®

OPEN HOUSE

Saturday & Sunday, 1 - 5pm

Complimentary Refreshments

QUIET ELEGANCE BLOSSOMS FROM RICH CHARACTER 404 West Meadow Drive, Palo Alto Abounding in timeless beauty is this 3 bedroom, 2 bath home of almost 1,700 sq. ft. (per county) on a property of nearly 5,600 sq. ft. (per county). Thoughtfully updated spaces are airy and bright with features like hardwood floors, detailed trimwork, and charming built-in amenities that evoke Old World character throughout. Local recreation at Robles Park, and fine dining along El Camino Real can be reached in an easy stroll, while excellent schools such as Barron Park Elementary, Terman Middle (API 968), and Gunn High (API 917) are also located close by (buyer to verify eligibility).

Offered at $1,788,000

For video tour & more photos, please visit:

www.404WestMeadow.com

6 5 0 . 5 1 6 . 7 5 0 6 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 8 8 4 0 0 7

Page 54 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


®

STUNNING HOME BOASTS CUSTOM STYLE 3428 South Court, Palo Alto This custom-designed 4 bed, 3 bath home of almost 2,400 sq. ft. (per appraisal) rests on almost 6,300 sq. ft. of property (per county). Sky-lit and stylish spaces establish indoor-outdoor living with multiple points of outdoor access while stainless-steel accents and highend amenities showcase chic style. Intriguing outdoor retreats include a courtyard with a fireplace. A desirable location puts this home within strolling distance of Robles and Mitchell Parks and excellent schools like Fairmeadow Elementary (API 953) and JLS Middle (API 943), while Charleston Shopping Center and Gunn High (API 917) are within close proximity (buyer to verify eligibility).

Offered at $3,498,000

For video tour & more photos, please visit:

www.3428SouthCourt.com

6 5 0 . 6 9 0 . 2 8 5 8 | i n f o @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 9 2 1 7 9 1 www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 55


//

Alain Pinel Realtors®

FIND YOUR PLACE ATHERTON $9,800,000

MENLO PARK $7,998,000

PALO ALTO $7,250,000

PALO ALTO $5,998,000

120 Toyon Road | 5bd/5+ba Laura McCarthy | 650.941.1111 BY APPOINTMENT

1050 Louise Street | 6bd/9ba Joe Parson 650.462.1111 BY APPOINTMENT

2130 Byron Street | 5bd/4.5ba John Forsyth James | 650.323.1111 BY APPOINTMENT

2188 Byron Street | 5bd/4ba Sherry Bucolo | 650.323.1111 BY APPOINTMENT

WOODSIDE $5,995,000

PALO ALTO $3,698,000

LOS ALTOS $3,695,000

PORTOLA VALLEY $3,498,000

199 Hardwick Road | 4bd/4.5ba Mary & Brent Gullixson | 650.462.1111 BY APPOINTMENT

1655 Middlefield Road | 4bd/2ba Jean-Luc Laminette | 650.323.1111 OPEN SAT & SUN 1:30-4:30

434 Orange Avenue | 4bd/3.5ba Kathy Bridgman | 650.941.1111 BY APPOINTMENT

180 Bear Gulch Drive | 4bd/3.5ba Dean Asborno | 650.529.1111 BY APPOINTMENT

PALO ALTO $2,988,000

LOS ALTOS $2,898,000

PALO ALTO $2,588,888

PALO ALTO $2,300,000

2451 Ross Road | 5bd/4ba J. Tsai Law/K. Tsai 650.462.1111 BY APPOINTMENT

975 Parma Way | 4bd/3ba Jeff Stricker | 650.941.1111 OPEN SAT & SUN 1:30-4:30

168 Lois Lane | 4bd/2ba Shirley Bailey | 650.941.1111 OPEN SAT & SUN 1:30-4:30

555 Byron Street #410 | 2bd/2ba M. Corman/M. Montoya | 650.462.1111 BY APPOINTMENT

STANFORD $2,285,000

REDWOOD CITY $1,649,000

PALO ALTO $1,495,000

PALO ALTO $1,495,000

753 Mayfield Avenue | 6bd/3.5ba Shari Ornstein | 650.323.1111 OPEN SATURDAY 1:30-4:30

1036 Silver Hill Road | $1,649,000 Holly Stockman | 650.529.1111 OPEN SUNDAY 1:00-4:00

548 Everett Avenue | 2bd/2ba Zach Trailer | 650.304.3100 BY APPOINTMENT

224 N California Avenue | 2bd/2ba Tim Trailer | 650.304.3100 BY APPOINTMENT

APR.COM

Over 30 Offices Serving The San Francisco Bay Area 866.468.0111

Page 56 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


Exclusive Off-MLS Opportunity

1245 Hamilton Avenue, Palo Alto Exquisite Luxury in Crescent Park Captivating gardens trim this recently remodeled 5 bedroom, 4.5 bath residence of over 4,100 sq. ft. (per plans) that provides a poolhouse -:0018534@2A83>;A:0?;2UV TTT?= 2@ I<1>/5@EJ :6;E-Ĺ&#x152;1D5.81 C-87 ;A@8;C1>81B18-:0?;;@45:3 ?A: 85@?<-/1? 5:/8A05:3-:1813-:@ 3;A>91@75@/41: .A>?@5:3C5@4/8-??5//4->9-:09;01>:-91:5@51? :A<<1><-@5;;B1>8;;7?@41<;;8?501>1@>1-@ C4581-B->51@E;22>A5@ @>11?->12;A:0@4>;A34;A@@41C>-<->;A:03->01:? %7E 85@-:0B1>?-@581 @41<;;84;A?1;Ĺ&#x160;1>?-C1@.->-:0-C-88 .10 %@>;88@;<;<A8-> ':5B1>?5@EB1:A1 81-:;>"->011"->7 -:0AB1:1/78191:@->EI"]YZJI.AE1>@;B1>52E18535.585@EJ

For video tour & more photos, please visit:

www.1245Hamilton.com Offered at $7,988,000

6 5 0 . 4 8 8 . 7 3 2 5 | m i c h a e l r @ d e l e o n r e a l t y. c o m | w w w. d e l e o n r e a l t y. c o m | C a l B R E # 0 1 9 0 3 2 2 4 www.PaloAltoOnline.com â&#x20AC;˘ Palo Alto Weekly â&#x20AC;˘ May 12, 2017 â&#x20AC;˘ Page 57


17 MILE DRIVE PEBBLE BEACH OCEANFRONT ESTATE Offered at $44,888,000 | 4 Bedrooms | 6 Bathrooms | Guest House 17MILEESTATE.COM

14700 MANUELLA ROAD, LOS ALTOS HILLS Offered at $3,998,000 / Home: 3 Bedrooms | 2.5 Bathrooms | ±3,285 sf | Lot ±22,800 sf Artist Studio ±835 sf / Guest House ±345 sf / Wine Room ±170 sf / 2-Car Garage ±580 sf 14700MANUELLA.COM

Michael Dreyfus Broker 650.485.3476 m.dreyfus@ggsir.com License No. 01121795

Noelle Queen, Sales Associate 650.427.9211 n.queen@ggsir.com License No. 01917593

Ashley Banks, Sales Associate 650.544.8968 a.banks@ggsir.com License No. 01913361

Downtown Palo Alto 728 Emerson Street, Palo Alto | Downtown Menlo Park 640 Oak Grove Avenue, Menlo Park GoldenGateSIR.com | Each Office is Independently Owned and Operated.

Page 58 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com


ColdwellBankerHomes.com Woodside

$14,995,000

Woodside

$14,995,000

Woodside

$6,995,000

Atherton

Sat 1 - 4

$5,495,000

1250 Canada Road Postmodern master-piece on approx. 5 acres in Central Woodside, complete with a working equestrian center. Co-listed w/Michael Dreyfus. 4BR/6.5BA Sean Foley 650.851.2666

155 Kings Mountain Rd Extraordinary home/setting/value on 5 level acs. Guest house, pool,tennis ct, 8-stall barn 5 BR/4 full BA + 2 half Erika Demma 650.851.2666

100 Phillip Rd Craftsman-style estate in Central Woodside. Apprx. 3 flat sunny acres w/pool. Studio apt. 5 BR/4.5 BA Erika Demma 650.851.2666

399 Atherton Ave Carriage House from the 1900’s restored & updated. Original charm. Private serene acre. 5 BR 4.5 BA Sue Crawford 650.324.4456

CalBRE#0087112

CalBRE#01230766

CalBRE#01230766

CalBRE#00587710

Palo Alto

Sat/Sun 1:30 - 4:30

$4,980,000

Redwood City

$3,595,000

Palo Alto

Sun 1:30 - 4:30

$2,998,000

Menlo Park

Sat/Sun 1:30 - 4:30

$2,995,000

3452 Cowper Ct 3452 Cowper Ct Brand-new home on a peaceful cul-de-sac. 6 BR, 5.5 BA plus an office on large lot 6 BR/5.5 BA Judy Shen 650.325.6161

9 Colton Ct Private gated villa on 1/2 ac resort lot w/ pool. Huge custom open flrpln. Sep in-law ste. 5 BR 4.5 BA Sam Anagnostou 650.851.2666

685 Loma Verde Midtown contemporary about 2300 sf, great floor plan, backyard is an entertainer’s delight 4 BR 3 BA Julie Lau 650.325.6161

128 Hillside Avenue Charming 2500 sq. ft. 3 level home in West Menlo. 4 bed, 2 full and 2 half bath. 4 BR 2 full + 2 half BA The Loveless Team 650.325.6161

CalBRE#01272874

CalBRE#00798217

CalBRE#01052924

CalBRE#00444835

Menlo Park

$2,958,000

Half Moon Bay

$2,195,000

Menlo Park

Sat/Sun 1 - 5

$2,150,000

Menlo Park

Sat/Sun 1 - 4

$2,050,000

2165 Prospect St Updated 4/2 on a 13,000sf lot nestled at the end of quiet cul-de-sac. Las Lomitas Schools 4 BR 2 BA Camille Eder 650.324.4456

116 Spyglass Ln Large lot, Steps to Ritz and beach, Casual Elegant! 5 BR/3 BA

CalBRE#01394600

CalBRE#011789986

Portola Valley Sat/Sun 1:30 - 4:30 $1,998,000

Foster City

101 Pecora Way Vintage mid-century modern home in original condition. First time on market 3 BR 3 BA

1116 Halsey Blvd Spacious, updated 4BD/2.5BA plus office/den/possible 5th BD, lots of upgrades. 4 BR 2.5 BA Elaine White 650.324.4456

1433 Virginia Ave Cape Cod Retreat w/ One Bedroom Cottage! Lots of updates! www.1433VirginiaAve.com. 4 BR 3 BA Doug Gonzalez 650.324.4456

1068 Sonoma Ave Remodeled 3 bedroom/2 bath w/ separate family room on large 9,500 sq. ft. lot. MP schools. 3 BR 2 BA Billy McNair 650.324.4456

CalBRE#01182467

CalBRE#00895924

CalBRE#01343603

Colleen Cooley

650.325.6161

CalBRE#70000645

Woodside

Sat/Sun 1:30-4:30

$1,495,000

Judy Byrnes

650.851.2666

Sat 1 - 4/Sun 2 - 4

San Mateo

Sat/Sun 1 - 4

$1,795,000

$1,350,000

1385 Altschul Ave 1,740sf +790 garage & basement. Family rm, private backyard, hwd flrs. Las Lomitas schools 3 BR 2 BA Cristina Bliss 650.324.4456

13 Artisan Way Fabulous, spacious 4 BD/2.5 BA, 2 car garage, close to downtown, train, & commute routes! 4 BR 2.5 BA Tory Fratt 650.324.4456

CalBRE#01189105

CalBRE#01441654

Redwood City

Menlo Park

Sat 1 - 4

Sat 12 - 5/Sun 2 - 5

$1,698,000

$1,025,000

Menlo Park

Menlo Park

Sat 1:30 - 4:30

Sat 1:30 - 3:30

$1,649,000

$730,000

135 Alta Vista Road 1928 cottage in the Glens! 1,110 sq ft (2 beds/1 bath) w/ guest unit. Lot 9,853 sq ft. 2 BR 1 BA Mia Banks 650.575.9037

1122 Hawthorne Dr New carpets, freshly painted, updated windows, newer heating system & a beautiful pool. 4 BR 2 BA Glenn Bartkowiak 650.324.4456

1985 Euclid Light & bright townhouse w/2 parking spaces. Easy commuter access to hwy101.1985Euclid. com 3 BR 2.5 BA Brett Caviness 650.324.4456

2140 Santa Cruz Ave C304 Private & bright end unit. Rarely available penthouse-2 sunny balconies-tree views. 1 BR 1 BA Beth Leathers 650.324.4456

CalBRE#01890669

CalBRE#01934275

CalBRE#01935984

CalBRE#01131116

californiahome.me |

/cbcalifornia |

/cb_california |

/cbcalifornia |

/coldwellbanker

©2017 Coldwell Banker. All Rights Reserved. Coldwell Banker® is a registered trademark licensed to Coldwell Banker Real Estate LLC. An Equal Opportunity Company and Equal Housing Opportunity. Each Coldwell Banker Residential Brokerage Office is Owned by a Subsidiary of NRT LLC. This information was supplied by Seller and/or other sources. Broker has not and will not verify this information and assumes no legal responsibility for its accuracy. Buyers should investigate these issues to their own satisfaction. Real Estate Licensees affiliated with Coldwell Banker Residential Brokerage are Independent Contractor Sales Associates and are not employees of NRT LLC., Coldwell Banker Real Estate LLC or ©2013 Coldwell Banker Real Estate LLC. All Rights Reserved. Coldwell Banker® is a registered trademark licensed to Coldwell Banker Real Estate An Equal Opportunity Company. Housing Opportunity. Each Coldwell Banker Residential Brokerage Office is Owned by a Subsidiary of NRT LLC. BRE License #01908304. Coldwell BankerLLC. Residential Brokerage. CalBRE LicenseEqual #01908304.

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 59


Your best choice to sell your home

WEEKEND OPEN HOMES

EXPLORE OUR MAPS, HOMES FOR SALE, OPEN HOMES, VIRTUAL TOURS, PHOTOS, PRIOR SALE INFO, NEIGHBORHOOD GUIDES ON www.PaloAltoOnline.com/real_estate

JENNY TENG

DELIA FEI

ቹ՛ᘱ

඘ऻጞ

650.245.4490 jteng@apr.com

650.269.3422 dfei@apr.com

RAY HOGUE

650.964.3722 rhogue@apr.com www.rhogue.apr.com License# 01980343

UNLESS OTHERWISE NOTED, ALL TIMES ARE 1:30-4:30 PM 4 Bedrooms

ATHERTON 4 Bedrooms

84 Edge Rd Sun Alain Pinel Realtors

5 Bedrooms

685 Loma Verde Av $4,985,000 462-1111

399 Atherton Ave Sat 1-4 Coldwell Banker

$5,845,000 324-4456

40 Selby Ln Sat/Sun Coldwell Banker

$5,880,000 324-4456

BELMONT 3 Bedrooms

3414 Plateau Dr Sat/Sun Sereno Group

$1,398,000 323-1900

CUPERTINO 5 Bedrooms

21724 Regnart Ct Sat Deleon Realty

1116 Halsey Blvd $1,795,000 Sat 1-4/Sun 2-4 Coldwell Banker 324-4456

LOS ALTOS

®

2140 Santa Cruz Av #C304 Sat 1:30-3:30 Coldwell Banker

2 Bedrooms

Our comprehensive online guide to the Midpeninsula real estate market has all the resources a home buyer, agent or local resident could ever want and it’s all in one easy-to-use, local site!

• Interactive maps • Homes for sale • Open house dates and times • Virtual tours and photos

• Prior sales info • Neighborhood guides • Area real estate links • and so much more.

Explore area real estate through your favorite local website: TheAlmanacOnline.com MountainViewOnline.com PaloAltoOnline.com And click on “real estate” in the navigation bar.

TheAlmanacOnline.com

MountainViewOnline.com

Page 60 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Alain Pinel Realtors

101 Pecora Way Coldwell Banker

1390 Westridge Dr Sat

Coldwell Banker

Sat 1-4

Coldwell Banker

Sat/Sun 2-4

Coldwell Banker

324-4456

$1,649,000 324-4456

$508,888 325-6161

3 Bedrooms 5244 Shady Av Deleon Realty

$1,298,000 543-8500

SAN MATEO 4 Bedrooms

$1,649,000 324-4456

1385 Altschul Av Sat/Sun 1-5 Coldwell Banker

$2,150,000 324-4456

Sat

31 Artisan Way Sat/Sun 1-5 Deleon Realty

$1,488,000 543-8500

WOODSIDE

3 Bedrooms - Condominium

300 Sand Hill Cir #205 $2,195,000 Sun 1-4 Pacific Union International 314-7200 1985 Euclid Av $1,025,000 Sat 12-5/Sun 2-5 Coldwell Banker 324-4456

Sat/Sun 1-4

Coldwell Banker

21311 Sarahills Dr Deleon Realty

135 Alta Vista Rd Sat/Sun

Coldwell Banker

$3,988,000 543-8500

$1,495,000 851-2666

4 Bedrooms 970 Mountain Home Rd Sun

Alain Pinel Realtors

65 Roan Pl

13 Artisan Way Sat/Sun 1-4 Coldwell Banker

$2,050,000 324-4456

618 Manzanita Way

PALO ALTO

324-4456

2 Bedrooms

$2,995,000 325-6161

$6,800,000 324-4456

$1,350,000

3 Bedrooms

128 Hillside Av Sat/Sun Coldwell Banker

$11,550,000 529-1111 $3,695,000

Sat/Sun 1-4

Coldwell Banker

Sun 1-4

Coldwell Banker

650 Woodside Dr Sat 1-4

Coldwell Banker

851-2666 $7,995,000 851-2666 $2,998,000 851-2666

5 Bedrooms

2 Bedrooms - Condominium

544 Everett Av $1,598,000 Sat/Sun 1-5 Alain Pinel Realtors 323-1111 404 West Meadow Dr Sat/Sun 1-5 Deleon Realty

$3,595,000

0 Bedroom - Condominium

1068 Sonoma Av Sat Coldwell Banker

625 Hobart St Sat/Sun 2-4 Coldwell Banker

325-6161

4 Bedrooms

Sat/Sun 1-5 $730,000 324-4456

$1,998,000

REDWOOD CITY

SARATOGA

5 Bedrooms

323-1111

4 Bedrooms

$3,199,000 400-8707

4 Bedrooms

325-6161

3 Bedrooms

739 Fremont St Sun Menlo Realty

3 Bedrooms PaloAltoOnline.com

Sat/Sun

88 E. San Fernando St #506

3 Bedrooms - Townhouse

:HRσHUWKHRQHRQOLQHGHVWLQDWLRQWKDWOHWV\RXIXOO\H[SORUH

$8,798,000

1122 Hawthorne Dr

3 Bedrooms

462-1111

11 Phillips Rd

Coldwell Banker

$1,598,000 462-1111

2323 Blueridge Ave Sat/Sun Alain Pinel Realtors

$6,588,000 $4,980,000

Sat/Sun

SAN JOSE

1 Bedroom - Condominium

$16,999,000

3452 Cowper Ct

$3,998,000 543-8500

MENLO PARK

Are you staying current with the changing real estate market conditions?

Alain Pinel Realtors

1433 Virginia Av

13070 S. Alta Ln $8,188,000 Sun Morgan Lashley Distinctive Properties 387-5224

650.543.8500 | www.deleonrealty.com | DeLeon Realty CalBRE #01903224

Sat

$2,898,000 543-8500

5 Bedrooms

650.543.8500 www.deleonrealty.com

175 Tennyson Ave

975 Parma Way Sat/Sun Deleon Realty 1187 Portland Av Sat/Sun 1-5 Deleon Realty

325-6161

Sat/Sun Pacific Union International 208-5196

$2,495,000 324-4456

LOS ALTOS HILLS

The DeLeon Difference®

1870 University Ave

481 San Luis Av Sat/Sun Coldwell Banker

6 Bedrooms

$2,998,000

6 Bedrooms

Sat/Sun

4 Bedrooms

4 Bedrooms

Coldwell Banker

PORTOLA VALLEY $2,998,000 543-8500

FOSTER CITY

Experience, knowledge and integrity at your doorstep.

Sun

$1,788,000 543-8500

17507 Skyline Blvd Sat/Sun 1-5

Coldwell Banker

$2,395,000 324-4456

6 Bedrooms 340 Jane Dr Sun

Alain Pinel Realtors

$5,750,000 529-1111


Marketplace PLACE AN AD ONLINE fogster.com

E-MAIL ads@fogster.com

P  HONE

650.326.8216 Now you can log on to fogster.com, day or night and get your ad started immediately online. Most listings are free and include a one-line free print ad in our Peninsula newspapers with the option of photos and additional lines. Exempt are employment ads, which include a web listing charge. Home Services and Mind & Body Services require contact with a Customer Sales Representative. So, the next time you have an item to sell, barter, give away or buy, get the perfect combination: print ads in your local newspapers, reaching more than 150,000 readers, and unlimited free web postings reaching hundreds of thousands additional people!!

INDEX QBULLETIN

BOARD

100-155 SALE 200-270 QKIDS STUFF 330-390 QMIND & BODY 400-499 QJ  OBS 500-560 QB  USINESS SERVICES 600-699 QH  OME SERVICES 700-799 QFOR RENT/ FOR SALE REAL ESTATE 801-899 QP  UBLIC/LEGAL NOTICES 995-997 QFOR

The publisher waives any and all claims or consequential damages due to errors Embarcadero Media cannot assume responsibility for the claims or performance of its advertisers. Embarcadero Media right to refuse, edit or reclassify any ad solely at its discretion without prior notice.

fogster.com

TM

THE PENINSULA’S FREE CLASSIFIEDS WEB SITE Combining the reach of the Web with print ads reaching over 150,000 readers!

fogster.com is a unique web site offering FREE postings from communities throughout the Bay Area and an opportunity for your ad to appear in the Palo Alto Weekly, The Almanac and the Mountain View Voice.

Bulletin Board

For Sale

Mind & Body

115 Announcements

202 Vehicles Wanted

405 Beauty Services

DID YOU KNOW 7 IN 10 Americans or 158 million U.S. Adults read content from newspaper media each week? Discover the Power of Newspaper Advertising. For a free brochure call 916-288-6011 or email cecelia@cnpa.com (Cal-SCAN)

DONATE YOUR CAR, TRUCK OR BOAT TO HERITAGE FOR THE BLIND. FREE 3 Day Vacation, Tax Deductible, Free Towing, All Paperwork Taken Care of. Call 1-800-731-5042 (Cal-SCAN)

ELIMINATE CELLULITE and Inches in weeks! All natural. Odor free. Works for men or women. Free month supply on select packages. Order now! 1-844-703-9774. (Cal-SCAN)

GET CASH FOR CARS/TRUCKS!!! All Makes/Models 2000-2016! Top $$$ Paid! Any Condition! Used or wrecked. Running or Not. Free Towing! Call For Offer: 1- 888-417-9150. (Cal-SCAN)

425 Health Services

PREGNANT? CONSIDERING ADOPTION Call us first. Living expenses, housing, medical, and continued support afterwards. Choose adoptive family of your choice. Call 24/7. 877-362-2401(AAN CAN) FREE BOOK GIVEAWAY HUGE USED BOOK/CD/DVD SALE

Got an older car, boat or RV? Do the humane thing. Donate it to the Humane Society. Call 1- 800-743-1482 (Cal-SCAN)

WISH LIST FRIENDS PA LIBRARY

WANTED! Old Porsche 356/911/91 For restoration by hobbyist 1948-1973 Only. Any condition, top $ paid! PLEASE LEAVE MESSAGE 1-707- 965-9546 (Cal-SCAN)

130 Classes & Instruction

210 Garage/Estate Sales

Hungarian Heritage Festival! - $0-$10 music alternative.

Los Altos, 655 Magdalena Ave., May 19 8-5, May 20 9-2 HUGE TWO DAY RUMMAGE SALE. Los Altos United Methodist Church, 655 Magdalena Ave. @ Foothihll expressway

Bystander Intervention Class IMPACT Bay Area’s Bystander Intervention training teaches effective strategies to safely intervene on behalf of others Learn and practice strategies that keep yourself and others safe. April 29, 2017 12 - 1:30pm Sports Basement Sunnyvale To sign up or for more information: http://impactbayarea.org/bystander_ intervention

MV: Community Yard Sale, 5/20 at Rengstorff Park, 201 S. Rengstorff. Join over 150 vendors in the park for hot food and bargains! PA: City Wide Garage Sale Saturday, June 3, 8-2 Helping the environment and making money has never been so easy. Reusing - whether you donate, buy, or sell - is one of the best ways to reduce waste and keep usable stuff out of the landfill. Join us for the Palo Alto Citywide Yard Sale on Saturday, June 3. Last day to sign up to host a yard sale is May 5.

133 Music Lessons Christina Conti Piano Private piano lessons for all levels, all ages. In your home or mine. Bachelor of Music, 20+ years exp. (650) 493-6950

Details will be posted on www.PaloAltoOnline.com/yardsale/ The map and listings will be uploaded to this page and be printed in the June 2 Palo Alto Weekly.

Hope Street Music Studios Now on Old Middefield Way, MV. Most instruments, voice. All ages and levels 650-961-2192 www.HopeStreetMusicStudios.com

Palo Alto, 2063 Princeton Street, May 13 & 14 9-3:00pm

Paul Price Music Lessons In your home. Piano, violin, viola, theory, history. Customized. BA music, choral accompanist, arranger, early pop and jazz. 800/647-0305

140 Lost & Found Found Prescription Eyeglasses In Palo Alto, on Park Blvd. at Jacaranda Lane.Claim at Palo Alto Eyeworks. 461 S. California Ave. (650) 327-5665

145 Non-Profits Needs DONATE BOOKS/HELP PA LIBRARY

Palo Alto, 50 Embarcadero Road, May 13, 2017 9 AM To 3 PM

230 Freebies FREE LEFTOVERS FROM Estate - FREE

245 Miscellaneous HOME BREAK-INS Take less than 60 SECONDS. Don’t wait! Protect your family, your home, your assets NOW for as little as 70¢ a day! Call 855-404-7601 (Cal-SCAN) SAWMILLS from only $4397.00 MAKE and SAVE MONEY with your own bandmill- Cut lumber any dimension. In stock ready to ship! FREE Info/DVD: www.NorwoodSawmills.com 1-800-578-1363 Ext.300N (Cal-SCAN) Mp3. download music - $3.79

150 Volunteers ASSIST IN FRIENDS BOOKSTORE

Kid’s Stuff

ASST SECTION MGRS FOR FOPAL FRIENDS OF THE PALO ALTO LIBRARY Hospice Volunteer Training Soon JET LAG STUDY ($300) JOIN OUR ONLINE STOREFRONT TEAM

330 Child Care Offered

Paid prediabetes study Stanford Museum Volunteer

fogster.com

TM

loving nanny

Got Knee Pain? Back Pain? Shoulder Pain? Get a pain-relieving brace -little or NO cost to you. Medicare Patients Call Health Hotline Now! 1- 800-796-5091 (Cal-SCAN) OXYGEN - Anytime. Anywhere. No tanks to refill. No deliveries. The AllNew Inogen One G4 is only 2.8 pounds! FAA approved! FREE info kit: 1-844-359-3976. (Cal-SCAN) Safe Step Walk-In Tub! Alert for Seniors. Bathroom falls can be fatal. Approved by Arthritis Foundation. Therapeutic Jets. Less Than 4 Inch StepIn. Wide Door. Anti-Slip Floors. American Made. Installation Included. Call 1- 800-799-4811 for $750 Off. (Cal-SCAN)

Jobs 500 Help Wanted Make $1000 A Week Mailing Brochures From Home! No Experience Required. Helping home workers since 2001! Genuine Opportunity. Start Immediately! www.IncomeStation.net (AAN CAN) IT/Software HyperGrid Inc. has openings in Mountain View, CA: Sr. Software QA Engineer(s): Responsible for the design, development and testing of system-level software. Requires experience with Software Quality Testing. Job Code G4901-00005. Mail resume to Att: S. Narayan, Hypergrid, Inc. 1975 W. El Camino Real Suite 306, Mountain View, CA, 94040. (Must ref. jobcode on resume/cvltr) EOE. TECHNOLOGY Informatica LLC has the following position available in Redwood City, CA: Product Specialist (MO-CA): Serve as a technical product specialist by performing technical qualification of opportunities, architecting solutions, performing solution demonstrations, and proving company’s technical capabilities. Position may require travel to various, unanticipated locations. Submit resume by mail to: Informatica LLC Attn: Global Mobility, 2100 Seaport Blvd. Redwood City, CA 94063. Must reference job title and job code: MO-CA. Agile Project Manager for Carnegie Foundation for the Advancement of Teaching, Stanford. Requires BS Comp Sci or rel tech or business field + 1 yr exp w/ full life cycle s/w devel using Agile, Lean, Continuous Delivery, scrum mastering, product roadmapping, Jira, Greenhopper, Javascript, CSS, HTML5 & rel tools. Also requires understanding of educ research & use of educ technol by educators. Resume to resumes@carnegiefoundation.org. Pls reference Agile Project Manager.

No phone number in the ad?

GO TO

fogster.com for contact information

Engineer Systems Software Write ARM & X86 device drivers & peripherals used for obstacle avoidance, data collection & 3D model reconstruction. MS or equiv. degree in Comp Sci, Comp. Eng., EE, Eng. or equiv. field. 4 yrs exp. as Systems Software Eng, Soft Eng, Soft Dev, Eng or equiv. 4 yrs concurrent exp. with: development of software architecture & components for real-time applications in autonomous vehicles using Linux; developing software in C & C++ languages, including use of the Standard Template Library and/or Boost additions & unit testing; detection & tracking of objects using vehicle data & machine vision sensors such as Radar, Laser Scanners/ Lidar & cameras-including calibration algorithms using reference systems; Development using OpenCL or CUDA technology; integration of sensors & software into the vehicle environment; integrating & testing full stack of vehicle components, including the hardware platform, sensors, & navigation software, including design & creation of test scenarios and fixtures. Jobsite: Menlo Park, CA. Mail resume to: Position: CPM052017 Kespry, Inc. 4005 Bohannon Drive, Menlo Park, CA 94025

Switch to DIRECTV. Lock in 2-Year Price Guarantee ($50/ month) w/AT&T Wireless. Over 145 Channels PLUS Popular Movie Networks for Three Months, No Cost! Call 1- 800-385-9017 (Cal-SCAN)

Staff Sftw Engr (Code: SSE-RKD) in Mt View, CA: Apply domain knwldg EMM techs like MDM, MAM, MCM to cust escal, dfcts, & feat. BS+4 yrs rltd exp/BS equiv based on educ&exp +4yrs exp. Mail resume to MobileIron, Attn: Piper Galt, 415 E. Middlefield Rd, Mt. View, CA 94043. Must ref title & code.

748 Gardening/ Landscaping

Business Services 604 Adult Care Offered A PLACE FOR MOM. The nation’s largest senior living referral service. Contact our trusted,local experts today! Our service is FREE/no obligation. CALL 1-800-550-4822. (Cal-SCAN)

619 Consultants EVERY BUSINESS Has a story to tell! Get your message out with California’s PRMedia Release - the only Press Release Service operated by the press to get press! For more info contact Cecelia @ 916-288-6011 or http:// prmediarelease.com/california (Cal-SCAN)

715 Cleaning Services Water Damage to Your Home? Call for a quote for professional cleanup and maintain the value of your home! Set an appt. today! Call 1-855-401-7069 (Cal-SCAN) Isabel and Elbi’s Housecleaning Apartments and homes. Excellent references. Great rates. (650) 670-7287 or (650) 771-8281 Orkopina Housecleaning Cleaning homes in your area since 1985. Last minute calls! (650) 962-1536 Silvia’s Cleaning We don’t cut corners, we clean them! Bonded, insured, 22 yrs. exp., service guaranteed, excel. refs., free est. (415) 860-6988

Authentic Garden Maintenance *Irrigation systems *Tree removal *Clean up and hauling *Planting *Refs. (408) 770-6230 LANDA’S GARDENING & LANDSCAPING *Yard Maint. *New Lawns. *Clean Ups *Irrigation timer programming. 20 yrs exp. Ramon, (650) 576-6242 landaramon@yahoo.com

751 General Contracting A NOTICE TO READERS: It is illegal for an unlicensed person to perform contracting work on any project valued at $500.00 or more in labor and materials. State law also requires that contractors include their license numbers on all advertising. Check your contractor’s status at www.cslb.ca.gov or 800-321-CSLB (2752). Unlicensed persons taking jobs that total less than $500.00 must state in their advertisements that they are not licensed by the Contractors State License Board.

624 Financial Do you owe over $10,000 To the IRS or State in back taxes? Our firm works to reduce the tax bill or zero it out completely FAST. Call now 855-993-5796. (Cal-SCAN) SOCIAL SECURITY DISABILITY Unable to work? Denied benefits? We Can Help! WIN or Pay Nothing! Contact Bill Gordon and Associates at 1-800-966-1904 to start your application today! (Cal-SCAN)

636 Insurance Lowest Prices on Health And Dental Insurance. We have the best rates from top companies! Call Now! 888-989-4807. (Cal-SCAN)

Home Services 707 Cable/Satellite

761 Masonry/Brick MNF Construction Concrete and Masonry Retaining walls, interlock pavers, natural stone, brick. Stamps, concrete design, driveways. Free est. (650) 218-4676. Lic. 1014484. www. mnfconstruction.com

771 Painting/ Wallpaper EJ Painting and Decorating Int/exterior painting. Texture and drywall repairs. Stain and varnish. 10 years exp. Excel. refs. Lic. #1011227. (650) 679-4953 Glen Hodges Painting Call me first! Senior discount. 45 yrs. #351738. 650/322-8325, phone calls ONLY. STYLE PAINTING Full service interior/ext. Insured. Lic. 903303. 650/388-8577

DISH TV - BEST DEAL EVER! Only $39.99/mo. Plus $14.99/mo. Internet (where avail.) FREE Streaming. FREE Install (up to 6 rooms.) FREE HD-DVR. Call 1-800-357-0810 (Cal-SCAN)

fogster.com

TM

Classified Deadlines:

NOON, WEDNESDAY

go to fogster.com to respond to ads without phone numbers www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 61


MARKETPLACE the printed version of

fogster.com

TM

775 Asphalt/ Concrete Roe General Engineering Asphalt, concrete, pavers, tiles, sealing, artificial turf. 36 yrs exp. No job too small. Lic #663703. 650/814-5572

781 Pest Control KILL BED BUGS & THEIR EGGS! Buy Harris Bed Bug Killers/KIT Complete Treatment System. Available: Hardware Stores, The Home Depot, homedepot. com (AAN CAN) KILL ROACHES - GUARANTEED! Buy Harris Roach Tablets. Odorless, Effective, Long Lasting. Available: Hardware Stores, The Home Depot, homedepot.com (AAN CAN)

KILL SCORPIONS! Buy Harris Odorless Scorpion Spray. Effective Results Begin After Spray Dries. Available: Hardware Stores, The Home Depot, homedepot.com (AAN CAN)

Real Estate 801 Apartments/ Condos/Studios Los Altos Hills, 1 BR/1 BA - $2850/mont Palo Alto, 2 BR/2 BA - $4,500/mon Palo Alto, 2 BR/2 BA - $5,200/Mon

805 Homes for Rent Mountain View, 3 BR/2.5 BA - $4350/mo. Palo Alto, 4 BR/2 BA - $7495

809 Shared Housing/ Rooms Find the perfect roommate Tt complement your personality and lifestyle at RentMates.com! (AAN CAN) Palo Alto, 1 BR/1 BA - $ 1,375. Redwood City, 1 BR/2 BA - 1200.00/mo

811 Office Space Therapist office sublet

fogster.com

TM

THE PENINSULA’S FREE CLASSIFIEDS WEBSITE TO RESPOND TO ADS WITHOUT PHONE NUMBERS GO TO WWW.FOGSTER.COM 825 Homes/Condos for Sale

855 Real Estate Services

Palo Alto, 2 BR/2 BA - $1,500,000

DID YOU KNOW Information is power and content is King? Do you need timely access to public notices and remain relevant in today’s highly competitive market? Gain an edge with California Newspaper Publishers Association new innovative website capublicnotice.com and check out the Smart Search Feature. For more information call Cecelia @ (916) 2886011 or www.capublicnotice.com (Cal-SCAN)

830 Commercial/ Income Property Professional Office Space

850 Acreage/Lots/ Storage Yolo County, California LAND AUCTION, Fri., June 2nd @ 11 AM. 275 ACRES 1 TRACT, Highly Productive Tillable Farmland! 8 miles SE of Davis, CA (844) 847-2161 www. SullivanAuctioneers.com (Cal-SCAN)

San Carlos, 1 BR/1 BA - $2,200.00

“Rhymes at the Zoo”—a group effort for Take Your Kids to Work Day. Matt Jones

Answers on page 63.

Across 1 [Note: Matt J. took his two kids to the zoo, where they came up with this theme (no, he doesn’t work at the zoo, just thought it’d be fun). Clues with an [E] were written by 67-Across, and clues with an [S] were written by 49-Across.] Sound of a punch [E] 5 Green paper that you pay with [E] 9 They make up stairs [E] 14 Make goo-goo eyes at 15 Tennis’s Arthur ___ Stadium 16 Like some dirt bike tracks [S] 17 Fearsome cat that spends moolah on Lamborghinis and mansions? [S] 19 Former “Come on down!” announcer Johnny 20 “I ___ open this jar. Can you help, Daddy?” [E] 21 Monkey that eats curtains? [E] 23 “Gimme ___! ... What’s that spell? Ella!” [E] 24 There are 100 in a century (abbr.) [S] 26 Something a toy poodle says [E] 27 Rat-a-___ [E] 28 Something that people say in awe [E] 30 Pookums [E]

Fogster.com is a unique website offering FREE postings from communities throughout the Bay Area and an opportunity for your ad to appear in the Palo Alto Weekly.

This week’s SUDOKU

Answers on page 63.

35 Scaly creature that likes to eat frosted sweets? [S] 37 Ninja Turtle that wears red, to his friends [S] 40 Getting from ___ B 41 Kid that can have a cellphone [S] 42 Bird that smokes and does vandalism? [E] 47 Sneaky little animal [E] 48 ___ gin fizz 49 Kid who is “epic!” [S] 52 The ___ on the Shelf [S] 54 Sid: “I’m not ___ years old anymore.” Me: “No, I mean ___ as in ‘I ___ some food.’” 55 Palindromic Turkish title 56 Water animal with flippers that barters 24/7? [S] 61 Wants really badly [S] 63 Go off-script (sorry, Ella, it doesn’t mean “get more pounds”) 64 Slow animal that grows wings and gets in your clothes? [E] 66 She was a princess “long ago” [E] 67 “The coolest kid in the universe” [E] 68 Lake that sounds scary [E]

DID YOU KNOW 144 million U.S. Read a Newspaper print copy each week? Discover the Power of Newspaper Advertising. For a free brochure call 916-288-6011 or email cecelia@cnpa. com (Cal-SCAN)

RETIRED COUPLE $$$$ For business purpose Real Estate loans. Credit unimportant. V.I.P. Trust Deed Company www.viploan.com Call 818 248-0000 Broker-principal BRE 01041073. (Cal-SCAN)

69 Me: “How about the clue ‘Used needles,’ Ella?” Ella: “No, new needles. You have to use them because it affects the fabric more than you expect.” 70 Martens and McStuffins, for instance [S] 71 Air France fliers, once Down 1 Type of wild “kitty-kitty” [E] 2 Type of lizard in “Sing” [E] 3 Horse’s mesh protection against pests, maybe 4 Sinn ___ (Irish political movement) 5 Spike thrown in the road to stop robbers [S] 6 “___ was saying ...” [E] 7 Like show horses’ feet 8 “___ Danger” (Nickelodeon show) [E] 9 Quaint stores (you’d think, based on how they’re spelled) 10 Piece that goes on the floor [S] 11 Queen in Arendelle [E] 12 Water drop sound [E] 13 “Auld Lang ___” 18 Something said in an “argument party” [S] 22 Teacher’s helper [E] 25 Region with Legoland, informally [S] 29 Dislikes [S]

Page 62 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

www.sudoku.name

31 Poker money 32 “Call Me Maybe” singer Carly ___ Jepsen [E] 33 “I Like ___” (‘50s political slogan) 34 “Hallow” ending 35 Someone who might cook meatballs for you [S] 36 Animal that’s cute, fuzzy, lazy, and gray [E] 37 ___ for “Ricky Bubwick” (apparently a name that Sid just made up) 38 Everyone [S] 39 Toilet paper layer 43 Turns evil or moldy [E] 44 Remote control car part [S] 45 Tag situations? [S] 46 Looks rudely 49 Enjoys, as food [S] 50 “Understood” [S] 51 Marks that are lines [S] 53 Popular [E] 56 Parents “who do puzzled goodness” [S] 57 Brickell whose band is the New Bohemians 58 “There ought to be ___” 59 It may be parallel [E] 60 Olympic hurdler/ bobsledder Jones 62 Drinks that are alcoholic [S] 65 “Waterfalls” trio ©2016 Jonesin’ Crosswords (editor@ jonesincrosswords.com)

A BOLD NEW APPROACH TO CLASSIFIEDS FOR THE MIDPENINSULA The Peninsula’s FREE Classifieds Website To respond to ads without phone numbers

fogster.com


MARKETPLACE the printed version of

THE PENINSULA’S FREE CLASSIFIEDS WEBSITE TO RESPOND TO ADS WITHOUT PHONE NUMBERS GO TO WWW.FOGSTER.COM

Legal Notices 995 Fictitious Name Statement SOUND WISDOM WITHIN FICTITIOUS BUSINESS NAME STATEMENT File No.: FBN628825 The following person (persons) is (are) doing business as: Sound Wisdom Within, located at 2685 Marine Way Suite 1322, Mountain View, CA 94043, Santa Clara County. This business is owned by: An Individual. The name and residence address of the registrant(s) is(are): MICHELE E KASPER

3242 South Court Palo Alto, CA 94306 Registrant began transacting business under the fictitious business name(s) listed above on 04/05/2017. This statement was filed with the County Clerk-Recorder of Santa Clara County on April 14, 2017. (PAW Apr. 21, 28; May 5, 12, 2017) FL3 FICTITIOUS BUSINESS NAME STATEMENT File No.: FBN629007 The following person (persons) is (are) doing business as: FL3, located at 88 Bush Street, Unit 4111, San Jose, CA 95126, Santa Clara County. This business is owned by: An Individual. The name and residence address of the registrant(s) is(are): LEIRE CARBONELL AGUERO 88 Bush Street, Unit 4111 San Jose, CA 95126 Registrant began transacting business under the fictitious business name(s)

listed above on 04/01/2011. This statement was filed with the County Clerk-Recorder of Santa Clara County on April 20, 2017. (PAW Apr. 28; May 5, 12, 19, 2017) CALAVERAS CORNERS APARTMENTS FICTITIOUS BUSINESS NAME STATEMENT File No.: FBN628982 The following person (persons) is (are) doing business as: Calaveras Corners Apartments, located at 50 Elena Ave., Atherton, CA 94027, Santa Clara County. This business is owned by: A Trust. The name and residence address of the registrant(s) is(are): LAWRENCE CHEW Trustee of The Trust of Lawrence and Helen Chew dated September 12, 1995 Registrant began transacting business under the fictitious business name(s) listed above on 11/06/2013. This statement was filed with the County Clerk-Recorder of Santa Clara County on April 19, 2017. (PAW Apr. 28; May 5, 12, 19, 2017)

fogster.com

TM

ALL ABOUT CASH ATM’S FICTITIOUS BUSINESS NAME STATEMENT File No.: FBN629462 The following person (persons) is (are) doing business as: All About Cash ATM’S, located at 5646 Keymar Dr., San Jose, CA 95123, Santa Clara County. This business is owned by: An Individual. The name and residence address of the registrant(s) is(are): JUAN J. SAUCEDO 5646 Keymar Dr. San Jose, CA 95123 Registrant began transacting business under the fictitious business name(s) listed above on 04/27/2015. This statement was filed with the County Clerk-Recorder of Santa Clara County on May 3, 2017. (PAW May 5, 12, 19, 26, 2017)

News, sports and local hot picks

fogster.com

TM

We handle all your Legal publishing needs

The local news you care aboutis one click away. Receive information on what’s happening in your community by email every day. Sign up today at PaloAltoWeekly.com Answers to this week’s puzzles, which can be found on page 62.

• The Palo Alto Weekly is adjudicated to publish in the County of Santa Clara. • Our adjudication includes the Mid-Peninsula communities of Palo Alto, Stanford, Los Altos, and Mountain View • The Palo Alto Weekly publishes every Friday.

Call Alicia Santillan 650-223-6578 asantillan@paweekly.com

Free. Fun. Only about Palo Alto. 24/7 Online

C R O S S W O R D S www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 63


Sports Shorts SAVING COLTON . . . Stanford junior Colton Hock set the school’s single season saves record as he closed No. 10 Stanford baseball’s 4-0 nonconference win over San Francisco at Sunken Diamond on Tuesday night. “I have been very fortunate,” Hock said of the record. “If the team doesn’t put up runs and pitch well, then I don’t have that opportunity. I’ve been very fortunate to be the guy at the end of it.” Hock recorded the last four outs for his 14th save of the year. That broke a standard originally set 30 seasons ago by Steve Chitren (1987), and then matched by Jeff Bruksch in 2000. Hock also moved into a tie for 10th in Pac-12 history with his 23rd career save, which is second-most at Stanford behind Chitren’s 26.

SOCCER TRYOUTS . . . The Elite AYSO will host tryouts for its boys and girls teams starting next week. The Elite AYSO is a Club style environment compared to regular AYSO, and it is designed for competitive kids with higher skill, intensity and commitment. For additional information and tryout schedule, please visit us at http:// www.ayso26.org/. SUMMER LACROSSE . . . The Menlo-Atherton Grizzlies Summer Ball, for grades 1st through rising 8th, will be held at the Hillview Middle School Turf Field on six Tuesdays between 5-6 p.m. for grades 1-5 and 6-7 p.m. for grades 6-8 through the summer, beginning June 20. For more information and/ or to sign up, visit the Grizzles website at menloathertonlacrosse. com.

Albert Gwo

NATIONAL ATTRACTION . . . Stanford freshman and Sacred Heart Prep grad Tierna Davidson was named to the United States womenís soccer team U-20 team that will train at the U.S. Soccer national team training center in Carson beginning Saturday. Cardinal freshman Cecilia Gee was named to the U-19 team that will begin training on May 18.

Palo Alto senior Alex Liang looks to defend his CCS titles when the championship meet gets underway Friday at the Santa Clara International Swim Center.

Gunn boys, Paly girls looking for a repeat CCS meet should produce top times, big performances

by Glenn Reeves he Gunn boys and Palo Alto girls are both defending Central Coast Section swim champions. And they’d both love to win it again. Gunn’s win last year ended Bellarmine’s 31-year reign, the longest championship streak in CCS history. The Titans will have to subdue a dangerous, angered and wounded beast in order to repeat. “I know Bellarmine will be extremely motivated after last year,’’ Gunn coach Mark Hernandez said. Last year’s meet went down to

T

the final event, the 400 freestyle relay. Gunn led the Bells 402-399 going into the event. With first place getting 40 points and second place 34, Bellarmine, which had the fastest qualifying time, would have won the meet and made it 32 consecutive CCS titles by winning the race. But Gunn summoned a great effort and took first place in 3:04.44, thereby winning the meet with 442 points to 431 for Bellarmine. Michael Lincoln swam the third leg and gave the Titans the lead. Lincoln, who is entered in the

200 free and the 500 free, will lead Gunn into this year’s meet, which will take place Friday (preliminaries) and Saturday (finals) at the Santa Clara International Swim Center. “We’re all really excited, that was such a lot of fun last year,’’ said Lincoln, who along with teammate Max Pokutta is headed to Brown University for college. “We’ve been looking forward to this since last year. It’s always a super fast meet.’’ Lincoln was the one junior on that 400 free relay team. On the

(continued on page 67)

HIGH SCHOOL GOLF

ON THE AIR

Paly’s Ali tees off at CCS regional

Friday

College softball: Oregon at Stanford, 5 p.m., Pac-12 Networks

Saturday

College softball: Oregon at Stanford, noon, Pac-12 Networks WNBA basketball: Seattle Storm at Los Angeles Sparks, 2 p.m., ESPN College baseball: Stanford at California, 4 p.m., Pac-12 Bay Area IAAF track and field: Shanghai Golden Grand Prix, 4:30 p.m., NBCSN

Paly, M-A advance along with several individuals by Rick Eymer alo Alto junior Ahmed Ali has made a point of doing his best work at the highest level. This year is no different. Ali shot a 7-under 64 to earn medalist honors at the Central Coast Section Region I tournament at Laguna Seca Golf Ranch in Monterey on Tuesday. Ali matched the lowest round of golf at the CCS level. Menlo Schoolís Andrew Buchanan (2012) and Patrick Grimes (2010) each shot a 64 in the CCS tournament. Ali, who finished second at last weekís Santa Clara Valley Athletic League tournament and fifth at last year’s CCS competition,

P

Sunday

College rowing: Stanford at Pac-12 championships, 9 a.m., Pac-12 Networks College baseball: Stanford at California, noon, Pac-12 Bay Area College track and field: Stanford at Pac-12 championships, 1p.m., Pac-12 Bay Area

Monday

College baseball: Stanford at California, 6 p.m., Pac-12 Networks Keith Peters

READ MORE ONLINE

www.PASportsOnline.com For expanded daily coverage of college and prep sports, visit www.PASportsOnline.com

whole the Titans were a seniorheavy team, but they haven’t fallen off much this season, capturing their third consecutive Santa Clara Valley Athletic League De Anza Division championship. ‘’A lot of seniors graduated, so it’s a lot more up for grabs this year,’’ Lincoln said. ‘’But we have a real good freshman class. We definitely have a shot, but the main thing is to swim our best and be proud of our swims.’’

Palo Alto junior Ahmed Ali shot a 7-under 64 to help Palo Alto secure a bid into the CCS championship tournament.

Page 64 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

also helped the Vikings advance to next Tuesdayís CCS championship as a team. Palo Alto and Stevenson matched rounds of 381 to finish behind Bellarmineís 357. MenloAtherton came in with a 383 to claim the final spot into the CCS. The top three teams and the top four individual golfers not on a qualifying team will advance to the Northern California tournament at Sierra View Country Club on Monday, May 22. The state golf tournament is scheduled for May 31 at Poppy Hills Golf Course in Pebble Beach. (continued on page 66)


STANFORD ROUNDUP

Larkin named top Rowing Scholar Water polo’s Steffens is a finalist for Cutino award

of the scheduled contests in the enior Brendan Larkin was sport and have a minimum of one named the Pac-12 Men’s year in residence at the instituRowing Scholtion. Winners are sear-Athlete of the Year, lected by a committee the conference anof Pac-12 staff memnounced on Thursday, bers at the conclusion giving the Cardinal of each sport’s regular its fourth consecutive season. The athletic acmen’s rowing honor. complishments of the The award, which nominees are a conis presented in each sideration in the voting of the 23 sports the for the award. Pac-12 sponsors, was Stanford will comestablished to honor pete in the Pac-12 collegiate student- Brendan Larkin Championships this athletes that are standouts both Sunday on the Lake Natoma academically and in their sports course near Sacramento. discipline. Larkin has rowed in the second Women’s water polo varsity eight for the Cardinal all Maggie Steffens was named season, primarily in the bow seat. one of three finalists for the presHe helped guide the Cardinal to tigious Peter J. Cutino Award, a third-place finish in the Pac-12 The Olympic Club of San FranChampionships last season. cisco announced Thursday. This An electrical engineering ma- award is given to the outstandjor with a concentration in soft- ing female and male collegiate ware and signal processing, the water polo players in the United senior’s cumulative States as voted by the grade-point average of coaches of the Division 3.97 is one of the highI schools. est among Stanford Five Stanford womstudent-athletes. He en have earned the was a First Team Pachonor seven times, 12 All-Academic and including five of the a First Team Intercollast six years. Kiley legiate Rowing AssoNeushul (2015, 2012), ciation All-Academic Annika Dries (2014, selection last season. 2011), Melissa SeideLarkin, who served as mann (2013), Jackie a resident assistant in Maggie Steffens Frank (2003) and one of the dorms on the Stanford Brenda Villa (2002) are Stancampus, was a recipient of the ford student-athletes to collect Stanford President’s Award for the award, which was instituted Academic Excellence for finish- in 1999. ing in the top three percent of his The winners will be announced class as a freshman. at the 18th Annual Cutino Awards He has conducted several stud- Dinner to be held Saturday, June 3 ies on campus, including a project at The Olympic Club’s City Clublearning how to take measure- house. Steffens, who has been a ments of spaces on campus from finalist in each of her collegiate an acoustic standpoint to capture seasons, is up for the award along the reverberation characteristics with Rachel Fattal of UCLA and of how the room sounds. Ashleigh Johnson of Princeton. Larkin was the fourth consecuConsidered the Heisman Trotive Stanford men’s rower to be phy of water polo, the Cutino named the Pac-12 Scholar-Ath- Award is given annually in honor lete of the Year. Landon Alecxih of the late Peter J. Cutino, the forwas honored last season, Kaess mer California and The Olympic Smit was the 2015 recipient and Club coach, who passed away in Austin Hack was honored in September 2004. He is in the U.S. 2014. Larkin is the sixth Cardi- Water Polo Hall of Fame, won nal to be named the conference’s “Water Polo Coach of the Year” Men’s Rowing Scholar-Athlete 17 times and led the Golden of the Year since the honor since Bears to eight NCAA Championits establishment in 2007-08. ships. In his career, Cutino also Along with Alecxih, Smit and coached in the Olympic Games, Hack, Alex Syverson (2011) and the Pan American Games, the Mark Murphy (2009) were also Water Polo World Championhonored. ships and the World University Larkin is the third Stanford Games. student-athlete to be named the A two-time Olympic gold medPac-12 Scholar-Athlete in their alist, two-time Olympic MVP sport this academic year, joining and two-time FINA Women’s Maddie Bauer (women’s soccer) Water Polo Athlete of the Year, and Peter Galli (wrestling). Steffens has never won the CuIn order to be eligible for the tino Award. She was named the Pac-12 Scholar-Athlete of the ACWPC National Player of the Year award, student-athletes must Year in 2015, is a three-time firstbe a senior on track to receive a team All-American and two-time degree, have a cumulative grade MPSF Player of the Year. point average of 3.0 or higher, Steffens leads the Cardinal with participate in at least 50 percent 55 goals this season, has scored in by Stanford Athletics

Casey Valentine/isiphotos.com

Stanford freshman Albane Valenzuela won medalist honors at the NCAA regional tournament in Albuquerque, shooting a 6-under 210 for the three-day tournament.

STANFORD WOMEN’S GOLF

Cardinal hopes to regain national title Valenzuela leads Stanford to the NCAA Albuquerque Regional title

by Mark Soltau parked by individual winner Albane Valenzuela, the top-ranked Stanford women’s golf team captured the school’s first outright NCAA Regional title Wednesday by posting a seven-stroke victory over Duke at the University of New Mexico South Championship Course. The Cardinal shared the crown in 2016 and 2007. Playing in breezy conditions, Stanford closed with a finalround 5-over 293 and finished the 54-hole, 18-team tournament at 2-over 866. Duke was second at 873, followed by Pepperdine (879), USC (884), Cal and Miami (888). All six advance to the NCAA Championship, May 19-24 at Rich Harvest Farms in Sugar Grove, Illinois. The victory was the Cardinal’s fifth of the season, establishing a new program record. Valenzuela, a freshman from Geneva, Switzerland, posted a brilliant 2-under 70 in the final round to wind up at 6-under 210, three strokes ahead of Tatiana Wijaya of Pepperdine. It was the first career triumph for Valenzuela, sidelined earlier this spring due to injury. Valenzuela, who played at the 2016 Rio Olympcs, started the last

S

round with a one-shot advantage and never surrendered it. She birdied the first two holes, reeled off 10 consecutive pars, then birdied the par-4 14th hole. Her only blemish was a bogey at the par-3 16th. The Cardinal depth showed, as four players placed in the top 11. Freshman Andrea Lee, a three-time winner this season and ranked No. 2 in the country, gamely finished her final round with 12-straight pars. She shot 73 and tied for eighth at 1-over 218, her eighth top 10 showing of the campaign. Senior Casey Danielson (74) and junior Shannon Aubert (76) finished at 3-over 219 and tied for 11th. Sophomore Sierra Kersten (77) tied for 66th at 15-over 231. Stanford began the final round with a four-stroke cushion and was never challenged. All five Cardinal players birdied the par-5 first hole. Stanford led the field in par-3 (3.03) and par-5 (4.77) scoring, finished first in pars (181) and third in birdies (37). Valenzuela tied for first in par-4 scoring (-2), and tied for fourth in pars (40) and birdies (10). Lee tied for first in par-5 scoring (-6). Stanford secured its first NCAA title in 2015 and finished second last year. Q

Bob Drebin/Stanford Athletics

Cardinal coach Anne Walker talks strategy with her team. Stanford has played in the NCAA championship round in each of the past two years.

S

20 games and has 14 multi-goal efforts. She is third in the MPSF in goals per game (2.39) and her 219 career goals are fourth in Stanford history. The senior will be going for her third NCAA championship with the Cardinal in Indianapolis this weekend. No. 2 Stanford, which has won five titles and four of the last six, begins with No. 8 Pacific (21-8) at 12:30 p.m. on Friday ,with the winner advancing to play either No. 3 USC or No. 7 Michigan in the semifinals on Saturday 2 p.m. The championship is on Sunday at noon. Women’s swimming Stanford senior swimmer Nicole Stafford was named one of three finalists for the Honda Inspiration Award as announced by The Collegiate Women Sports Awards (CWSA) on Monday afternoon. “I am extremely honored to be a finalist for the 2017 Honda Inspiration Award with two other incredible athletes,” said Stafford. “Everyone who is nominated for this award is a winner. Thanks to the support of the CWSA, my parents, my Stanford swimming coaches -- Greg, Tracy and Joey -- my trainer Scott Anderson for always believing in me even when I didn’t myself, as well as my Stanford teammates who inspired me to keep pushing and fighting everyday. “In addition, I’d like to thank my club coach Jason Turcotte, who gave me the confidence that I could come to Stanford as a freshman and still contribute to the team while battling my functional movement disorder.” Stafford is joined by two other inspiring athletes, senior skier Jesse Knori from Colorado University and junior swimmer Bailey Scott of the University of Alabama. The Honda Inspiration Award winner will be selected by the CWSA Board of Directors and announced this week. The winner will be presented on a live telecast on CBS Sports Network on June 26 in the Founders’ Room at the Galen Center on the campus of the University of Southern California in downtown Los Angeles, as part of the two-day Honda Awards event. Stafford suffers from a functional movement disorder with no known cure. The neurological condition gives Nicole painful full-body spasms or tremors every time she swims. Despite the seizure-like movements, she was a four-year letterwinner for the Cardinal and earned her first individual AllAmerica honor in March. She served as team captain for the 2017 national championship team and was also a member of the NCAA winning 200-medley relay team in 2014. Q

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 65


Sports PREP ROUNDUP

Gunn girls in SCVAL lacrosse final Sacred Heart Prep boys clinch PAL title

E

Both defenses played well the whole way and both really dug in through the first overtime to keep the game knotted. Gunn goalie Mikaela Wayne recorded 11 saves on the night and Paly goalie Mattie Orloff had eight. Julia Stoneburner, Lucy Augustine, Anna Tsai, and Sabrina Dahlen were also instrumental in keeping the Vikings out of the net. Kathryn Cox and Madeline Hare led Palo Alto’s defense. In the second overtime, Garcia-Milla worked the ball from behind the net and found Axtell cutting across the front of the goal for the winning score. On the boys side, Jack Crockett added a pair of goals as the Gators (16-5) recovered from a 4-2 halftime deficit. Cody Weibe recorded 12 saves. Wilson Weisel, Tommy Barnds, Joe Sonsini and Vought also scored for Sacred Heart Prep, which won its last seven in a row and 12 of 13 overall. Chris Rotelli has a 72-22 (.766) record in is four years with the Sacred Heart Prep program. Baseball Shiva Buchlin and Marvin Li each drove in a pair of runs and

Karen Ambrose Hickey

by Rick Eymer mily Axtell, with an assist from Andrea Garcia-Milla, scored in the second overtime to lift host Gunn to a 4-3 victory over Palo Alto in the Santa Clara Valley Athletic League De Anza Division semifinals Wednesday night. Kevin Tinsley scored three goals, Teddy Vought had three assists and the Sacred Heart Prep boys lacrosse team beat host Menlo School 9-7 to clinch the Peninsula Athletic League Bay Division title Wednesday. The Titans (16-4) face either Los Gatos or Mountain View in Saturday’s league championship contest. Depending on the outcome of the other semifinal, Gunn would travel to Los Gatos or host Mountain View. Gunn opened a 3-1 lead in the first half, on goals from Janis Iourovitski, Jenilee Chen and Grace Williams. Anna Seligson scored the first goal for the Vikings (13-8) and Charlotte Cheng converted a pass from Quinn Knoblock as time expired in the half to close the gap to 3-2. Abigail Ramsey tied the game for Palo Alto with a goal four minutes into the second half.

Gunn senior gtoalie Mikaela Wayne gets mobbed by her teammates following the Titans’ 4-3 overtime victory over Palo Alto. host Gunn downed Santa Clara 10-4 in a SCVAL El Camino Division contest Wednesday. Bucklin, Cole Mantovani, David Clarke, Bucklin, Charlie Racz and Nathan Nakamitsu each added two hits for the Titans (12-12-1, 7-7), who complete the regular season at Lynbrook at 4 p.m. Friday in the regular season finale. Hillsdale scored three runs in the top of the seventh to snatch a 4-3 victory over host Sacred Heart Prep in a PAL Bay Division contest Wednesday. The Knights scored an unearned run in the top of the first but the Gators tied the game in the third when Kyle Cody singled

and scored on Jack Molumphy’s double. With two outs in the sixth, Brendan Semien walked after working a full count. He stole second and scored when Mathew Jackson’s grounder was misplayed in the infield, giving Sacred Heart Prep a 2-1 edge. That’s when Hillsdale struck for three runs and the lead. Jack Donnelly and Schafer Kraemer, who had three hits on the day, singled with one out in the seventh. John McGrory singled in Donnelly and the game ended with Gators on first and third. Sacred Heart Prep (5-8, 9-161) finishes the regular season with a game at Hillsdale on

Friday at 4 p.m.

Softball Mackenzie Glassford pitched a three-hitter and drove in two runs as Palo Alto ended the regular season with a 9-0 victory over visiting Lynbrook. Sophie Frick drove in three runs for the Vikings (12-5, 8-4), who recorded their first winning season since finishing 2010 with a 19-9 overall mark. Sydney Liu, Maggie Rentreria and Taylor Duncan each added two hits for Palo Alto. Glassford struck out eight and did not walk a batter in im,proving to 7-3 on the season. She has won her last five decisions. Q

CCS golf (continued from page 64)

Sergie Mata fired a 75 in support of the Vikings effort to advance as a team into the CCS championship tournament.

Page 66 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Keith Peters

Keith Peters

Max Ting, who finished seventh with a round of 73, and Charlie Hsieh, who was 12th with a 74, advance as individuals but Menlo finished sixth with a score of 390. Sacred Heart Prep placed ninth with a score of 406. Ali and Ting tied for seventh at last year’s regional tournament. Pinewoodís John Foley, who shot a 75 and finished 16th, also qualified for the CCS tournament, which will be held at Laguna Seca with an 8 a.m. start. Foley placed second at last year’s CCS tournament. Sergi Mata and Akira Isayama each added a 75 to help the Vikings advance. Bob Zhu shot an 82, Joonsung Ha came in with an 83 and Timothy Liu shot a 91. Jackson Lee led M-A golfers with a 74 and a tie for 12th. Bryce Sevy was one stroke behind at 75 and a 16th-place tie. Jonathan Dicks (76), Bill Kirkpatrick (77), Leo Tuchman (81) and Maxwell Heller (87) all advance for the Bears. Ankikait Bhardwaj (76) and Finn OíKelly (77) were Sacred Heart Prep’s top golfers. Gunn’s Andy Zhou, the SCVAL medalist, shot an 80 and tied teammate James Berger for 37th. Q

Akira Isayama shot a 75 to help Palo Alto advance to the CCS championship tournament at Laguna Seca Golf Ranch in Monterey.


Sports CCS SWIMMING

A unique experience awaits CCS swimmers Energy levels, excitement at fever pitch inspire top athletes

Castilleja’s Natalie Tuck finished third in the 200 IM and 500 free in last year’s meet. in the WBAL finals in 22.08. He swam faster in last year’s CCS meet. “The CCS meet is ultimately about bonding with your teammates,” Rohlen said. “It’s a huge deal. We get videos from alumni wishing us good luck.” Rohlen, also a top water polo player, came to swimming late. He still caught the fever. “I didn’t swim until I got to high school,” he said. “I fell in love with the sport.” Sacred Heart Prep sophomore

M-A’s Izzi Henig is the defending CCS champion in the 50 free and 100 free.

Gabby Ma remembers being in awe at her first CCS meet. “It was really exciting and I was nervous at the same time,” Ma said. “I was racing against the big kids. My teammate were helpful and made it fun. It’s a great atmosphere.” Like most of the CCS swimmers, Ma finds herself competing against club teammates. “You’re in a different mode when you race against each other,” she said. “It’s fun seeing club members.”

Keith Peters

T

team points. Menlo-Atherton’s Izzi Henig was a double winner last year as a sophomore in the 50 and 100 free. She is seeded second in the 50 free this year behind St. Francis’ Brooke Schaffer. “I love CCS,” Henig said. “It’s probably my favorite meet of the year. You can feel the energy around you. It’s an incredible experience. Menlo’s Scott Little swam in the consolation final of the 50 free last year, tying for 13th place with Sacred Heart Prep’s Luke Rohlen. He won the West Bay Athletic League title this season with a personal best 21.58. “I’d like to take it one more step,” he said. Rohlen finished second to Little

Albert Gwo

by Rick Eymer he Central Coast Section swimming meet usually features athletes who become major collegiate stars and, occasionally, international stars. The meet also features seniors swimming in their final competitive event. Either way, it’s a special event for everyone involved. This year’s meet will be held at the George F. Haines International Swim Center in Santa Clara, with girls diving getting things started Friday at 9 a.m. The swimming preliminaries begin at 2:30 p.m. On Saturday, boys diving is at 9 a.m., with swimming consolation and finals beginning at 2:30 p.m. It’s an event that rewards depth, with the top 16 finishers earning

Castilleja senior Natalie Tuck, who will be competing at California in the fall, said seeing her teammates improve throughout the season is part of her inspiration. “It’s really exciting to see your teammates make the cut,” she said. “There’s definitely more energy. This is the most exciting part of the season.” Tuck finished third in both the 200 IM and 500 free last year and she’ll see some of the same competitors this year. Q

ATHLETES OF THE WEEK

The junior swimmer went outside the box at the Peninsula Athletic League championship meet last weekend, winning the 100 fly (56.48) and the 500 free titles and helping the 200 free relay team (1:38.36) set a meet record as the Bears won the league title.

The senior swimmer won his second consecutive West Bay Athletic League titles in the 50 free (21.58) and 100 free (47.53). He recorded a personal best in the 50 free and his 100 free time was his best in a year. Little is headed to Bucknell to play water polo.

Honorable mention Becca Chapman

Aron Ecoff

Mackenzie Glassford

Brody La Porte

Natalie Hildebrand

Kent Slaney*

Joyce Shea

Angelo Tonas

Natalie Tuck

Cody Weibe

Grace Tully

Andy Zhou

Gunn lacrosse

Palo Alto softball

Menlo swimming

Gunn track and field Castilleja swimming Menlo-Atherton lacrosse

Palo Alto baseball Menlo lacrosse

Palo Alto track and field Sacred Heart Prep baseball Sacred Heart Prep lacrosse Gunn golf

* Previous winners

Watch video interviews of the Athletes of the Week, go to PASportsOnline.com

Michael Lincoln gets ready to swim the 500 free in a recent meet. Lincoln helped Gunn win last year’s CCS meet.

CCS swimming (continued from page 64)

Palo Alto’s Alex Liang is clearly the top individual in the boys meet. A double winner at both CCS and the state meet last year in the 200 and 500 free, Liang, a Stanford commit who will join his older brother Andrew on the powerhouse Stanford swim team, is entered in the 200 IM and 500 free this year. He has the fastest qualifying time by nearly five seconds in the IM and by nearly 12 seconds in the 500. He is also a key member of Paly’s 200 free relay and 400 free relay teams, which both have the fastest qualifying marks on the CCS psych sheet. On the girls side, Palo Alto will face plenty of competition in its bid to repeat. Paly coach Danny

Albert Gwo

Scott Little MENLO SWIMMING

Albert Gwo

Izzi Henig M-A SWIMMING

Max Pokutta won two events at last week’s SCVAL championships to help Gunn win its third straight league title.

Dye rattled off Gunn, St. Francis, Mitty and Cupertino as his team’s primary challengers. “The entire team wants to repeat,’’ said Grace Zhao, who won the 100 breaststroke last year in a CCS-record 1:00.96. . “We’ll have good competition, especially from St. Francis. If everything falls into place, maybe a couple girls sneak into the finals, it’s a pretty viable possibility.’’ Zhao, who like Liang is headed to Stanford, also took second in the 50 free last year, but will compete instead in the 200 IM as her second individual event this time around. “Both races have their perks,’’ Zhao said. “The IM is longer and hurts more, but I have a better shot at winning it this year. I think the IM is the more exciting race.’’ Zhao has the fastest qualifying time in both of her events.

Sprinter Claire Lin and backstroker Zoe Lusk are a couple of other key individuals for Paly along with freshmen Amy Wu and Mary Wilkinson. The team’s 200 medley relay and 200 free relay teams both have No. 1 qualifying marks. “This year it’s definitely a team approach,’’ Dye said. “This team has a quiet confidence about them. They’re not cocky, but they believe in themselves. This is a special group. I’m blessed as a coach.’’Q About the cover: Palo Alto senior Grace Zhao glides through the water during a winning 100 breast. Photo by Albert Gwo, a CCS swimming champion from Los Altos who will be a freshman at Columbia University in the fall.

www.PaloAltoOnline.com • Palo Alto Weekly • May 12, 2017 • Page 67


ColdwellBankerHomes.com WOO WOOD WO OD DS SIID DE E

Erika Demma 650-740-2970 edemma@cbnorcal.com CalBRE #01230766

100 Phillip Rd $6,995,000 Magnificent Craftsman-style estate in Central Woodside. Aprx. 3 flat ac w/vineyard, pool & spa. 2-story home w/4BD/3.5BA + studio apt. 100Phillip.com

THIS IS HOME Happy Mother’s Day from Coldwell Banker.

This is where Mom’s hugs are endless, her chocolate chip cookies come to life and her love is constant.

Coldwell Banker. Where home begins. #ThisIsHome

californiahome.me |

/cbcalifornia |

/cb_california |

/cbcalifornia |

/coldwellbanker

©2017 Coldwell Banker. All Rights Reserved. Coldwell Banker® is a registered trademark licensed to Coldwell Banker Real Estate LLC. An Equal Opportunity Company and Equal Housing Opportunity. Each Coldwell Banker Residential Brokerage Office is Owned by a Subsidiary of NRT LLC. This information was supplied by Seller and/or other sources. Broker has not and will not verify this information and assumes no legal responsibility for its accuracy. Buyers should investigate these issues to their own satisfaction. Real Estate Licensees affiliated with Coldwell Banker Residential Brokerage are Independent Contractor Sales Associates and are not employees of NRT LLC., Coldwell Banker Real Estate LLC or ©2013 Coldwell Banker Real Estate LLC. All Rights Reserved. Coldwell Banker® is a registered trademark licensed to Coldwell Banker Real Estate An Equal Opportunity Company. Housing Opportunity. Each Coldwell Banker Residential Brokerage Office is Owned by a Subsidiary of NRT LLC. BRE License #01908304. Coldwell BankerLLC. Residential Brokerage. CalBRE LicenseEqual #01908304.

Page 68 • May 12, 2017 • Palo Alto Weekly • www.PaloAltoOnline.com

Palo Alto Weekly May 12, 2017  
Read more
Read more
Similar to
Popular now
Just for you