Page 1

noblian design your best lifeยบ 2011/ 01

An enormous project of installation art and space. Bahk Seonghi presents an art piece reminding viewers of milky way and a huge landscape painting.

No126


pre 새로움. 얼마나 가슴 뛰는 희망의 단어인가요. 닿소리 ‘ㅅ’을 발음하기 위해 내쉬는 숨소리만으로도 왠지 모를 신선함이 마구 샘솟는 느낌입니다. 헌책방에서 저렴하게 구입한 지식서에서 이제 막 내 삶의 새로운 코드를 발견했을 때처럼 말이지요. 저마다의 사연을 간직한 채 헌책방에 들어와, 유난히 돋보이던 새 책 <가슴 뛰는 삶>(강헌구 지음, 쌤앤파커스)이 제겐 또 다른 새로움이었습니다. ‘삶’보다는 ‘가슴 뛰는’의 문구가 마음에 들어 집어 든 이 책은 한 해를 마감하고 새로운 한 해를 준비하는 지난 12월 한 달을 행복하게 해 주었답니다. 저자는 매 순간 목표와 비전으로 가슴 뛰는 인생을 살아가는 법을 전합니다. ‘마음의 노트북에 미래를 스캐닝하라. 나에게 어울리는 미래를 우주에 홍보하라. 하루에 열다섯 번씩 ‘꿈의 호텔’에 체크인하라. 영혼을 깨우는 신비한 북소리, 비전의 축복을 누려라.’ 단어만으로도 눈치챘겠지만, 그는 이미 최고의 비전 멘토로 불리는 강연가입니다. 평상시 같았으면 아침 시간대 TV 토크쇼 프로그램의 초대 강사가 열변을 토하는 내용쯤으로 들렸을 이 말들이, 머리와 가슴에 차곡차곡 쌓이며 마음은 이미 녹화장에 앉아 있는 주부 패널이 되어 추임새도 넣고 손뼉도 치며 그의 이야기에 집중하게 되었습니다. 저도 이제 대한민국 평균 수명의 절반을 살았으니, 바로 지금이 되돌아보고 들여다보고, 내다봐야 할 시기라는 생각 때문인가 봅니다. 세상은 늘 새로움의 연속으로 우리의 생각과 삶을 결코 느슨해지지 않도록 도와 줍니다. 70s Style, Punk Odyssey, World Wide Pants, Far East Movement, Color Shock… 2011년 패션 피플이라면 기억해야 할 새로운 단어들입니다. 그린 다이아몬드로 불리는 바닐라 플래니폴리아 성분으로 탄생한 샤넬의 수블리마지 에센셜 리제너레이팅 크림이나, 줄기세포 테크놀로지의 활약으로 탄생한 디올의 캡춰 토탈 원 에센셜, 시간을 되돌리는 마법을 지닌 에스티 로더의 ‘타임 존’ 라인도 잊지 말아야 할 뷰티 아이템입니다. 알래스카로 떠나는 오세아니아 레가타호의 새로운 출발과 150년의 시간과 더불어 또 다른 시작의 1년을 힘차게 준비하는 주얼리 브랜드 쇼파드의 행보도 눈여겨 봐야 합니다. 서울신라호텔 로비에 설치된 박선기 작가의 새로운 오너먼트도 감상 리스트에 넣어 두십시오. 그리고 지금도 어딘가에서 ‘Something New’를 만들기 위해 노력하고 있는 모든 이에게 감사해야겠습니다. 지난달부터 NOBLIAN 편집부는 이 새로움의 에너지를 가득 담은 채 1월을 준비했습니다. 새로운 식구들, 새로운 디자인, 새로운 시스템까지 넘쳐나는

The New

새로움에 낯설었지만, 2011년 1월호 NOBLIAN을 받아 든 순간, 그 어느 때보다 보람되고 감동적인 순간을 경험할 것입니다. 그리고 그 감동이 노블리안 모두에게도 고스란히 전달되었으면 하는 바람입니다.

EDITOR IN CHIEF CHOI SUNAH


cover 서울신라호텔 로비를 새롭게 장식한 박선기 작가의 오너먼트는 웅장한 산수화를 반짝이는 입체 조형물로 형상화한 듯한 거대한 규모만으로도 보는 이들을 압도한다. 컨템퍼러리 아트를 개척하는 대표적인 현대 설치미술가 박선기 작가의 작품인 ‘조합체An Aggregate 10-0810’. 전통적인 회화를 염두에 두진 않았지만, 한눈에 웅장한 한 폭의 산수화 같은 형태로 입체감과 광채를 지닌 모던한 설치 작품이다. 로비 천장을 뒤덮는 스케일과 보는 각도에 따라 달라지는 독특한 형상은 조형과 절묘하게 어우러지는 공간의 미학을 느끼게 한다. 이 작품은 미적 가치가 높은 라이프스타일 공간을 추구하는 서울신라호텔이 2006년부터 매해 연말 박선기 작가와 함께 고객에게 선사하는 특별한 ‘선물’의 일환이다. 박선기 작가는 투명 나일론 줄에 수만 개의 투명 아크릴을 매달아 원뿔 반구 사각 등 형태의 변이를 창조하는 거대한 설치 작품으로 서울신라호텔의 시그너처 아트를 책임져왔다. 일상적인 호텔 공간에서 고객이 작가의 작품을 바로 앞에서 감상할 수 있는 친숙함을 부여하고, 일반적인 연말 데커레이션의 정형성을 벗어난 새로운 시도로 전 세계 어느 호텔에서도 찾아볼 수 없는 서울신라호텔만의 시그너처 아트로 자리매김하고 있는 것이다. “쏟아질 듯 아찔하고, 시리도록 빛나고, 카오스를 닮아 비정형적이고, 그러면서도 특유의 리드미컬한 운율이 느껴지도록 했다. 평범하고 형태 없는 나일론 줄과 아크릴 비즈 수만 올이 모이고 모여서 조합체를 이뤄 감동을 주고자 했다” 박선기 작가의 말처럼 그가 표현하고자 한 감동은 모두에게 고스란히 전달되어 서울신라호텔을 더욱 돋보이게 할 것이다.


culture 매년 서울신라호텔의 시그니처 아트를 선 보이고 있는 박선기 작가가 새로운 작품을 선보였다 사진이라는 결과물이 대중에게 더 큰 감동 으로 다가올 수 있도록 돕는 이미지 전달 자, 로베르 델피르 현대 미술을 친근한 작품과 색다른 관람방 식으로 감상할 수 있는 <World Star in Contemporary Art>展을 미리 만나보자 두터운 국내 팬 층을 확보하고 있는 스팅 과 류이치 사카모토의 선율에 귀 기울여라

<빈 슈트라우스 페스티벌 오케스트라 신 년음악회> <서울시향의 말러 2011 시리즈> 가 그 성대한 막을 올린다 150년의 역사를 기점으로 보다 공격적으 로 한국 시장을 공략하고 있는 쇼파드가 더 큰 도약을 위해 기지개를 켜고 있다 삼성 디자인 패션 펀드(SFDF)가 2011년 제 6회 수상자들을 발표했다

SIEGER지거를 선택하는 남성은 최고의 퀄리티를 기대한다. 섬세한 디테일과 컬러 에 대한 창의성은 SIEGER지거만의 특징 음악의 경계선을 아우르는 크로스오버의 대표주자 양방언. 의사에서 음악가가 되기 까지 그의 음악여정을 소개 한다

028 Art 032 View 034 Exhibition 036 Stage 040 Classic 048 Focus on 052 Zoom in 056 People 058 People

issue LOUIS VUITTON, TOD’S, MOSCHINO에 서 2011 S/S 프레젠테이션을 선보였다

희망찬 새해를 맞이하며 들려오는 주얼리 브랜드들의 반짝이는 소식에 주목할 것

기존 라인에서 한 차원 진보한 뷰티 아이 템. 여성의 피부를 아름답게 가꿔주기 위 한 새 단장을 마쳤다

060 Fashion 062 Jewelry 064 Beauty


추운 겨울 실크처럼 부드러운 피부를 만들 어주는 신상 바디 아이템을 제안한다

추위에도 스타일은 포기할 수 없는 법. 스 타일과 기능성을 모두 갖춘 겨울철 머스트 해브 아이템을 소개한다 기능과 스타일이 만나 이뤄내는 라이프스 타일의 변화를 만끽하라

2011년, 세계적인 브랜드에서 럭셔리 카를 출시한다. 카 마니아를 열광하게 만들 매 력적인 신차를 살펴보자 어쩜 이리도 고운 색을 입었나? 생동감 넘 치는 컬러를 입은 최신 테크가 속속들이 그 모습을 드러내고 있다 누구보다 먼저 새로운 스타일을 체득하고 싶다면 2011 S/S 시즌 7가지 트렌드에 주 목하라 여심의 마음을 간질간질하게 해줄 2011 S/ S Spring Look을 미리 만났다

과하지 않은 여성성과 절제미가 공존하는 우아한 핑크의 세계로 초대한다

066 Health 068 Guy 070 Living 072 Car 073 Tech 074 Trend Fashion 078 Trend Beauty 082 Style

lifestyle 아르네 야콥센은 인간과 자연을 조화롭게 아우르는 솔직하고 기초적인 감각을 특징 으로 곡선적인 형태의 디자인을 전개한다 남성을 위한 명품 구두 편집 매장, 헤리티 지가 신세계 강남점 럭셔리 남성관에 오픈 했다 Seoul Auction과 K Auction을 통해 올 한 해의 미술 시장을 조심스럽게 예측해 본다

실용적인 기능과 스타일리시한 외관이 돋 보이는 숄더 캐리어는 애견인과 펫이 함께 하는 외출의 훌륭한 파트너다 싱글몰트 위스키 한 병에 담긴 무궁무진한 가치와 이야기를 지금부터 들어보자

090 Design 092 Heritage 094 Auction 096 Pet 098 Drink


신년을 맞은 레스토랑에는 지금 건강하고 즐거운 사람들의 웃음이 넘쳐나고 있다

주식 명의신탁에 대해 신중하게 생각하지 않을 경우 생각지도 못한 막대한 세금을 부과 받을 수 있음을 명심하라 최고의 성능과 친환경성을 만족시키는 포 르쉐의 하이브리드 기술력을 소개한다

겨울 스포츠의 백미, 바야흐로 스키의 계 절이 돌아왔다. 은빛 설원을 질주하는 짜 릿한 속도감을 즐겨보자 하이클래스 프리미엄 크루즈 선, 알래스카 로 떠나는 오세아니아 호의 출정이 시작 된다

100 Gourmet 104 Law 106 Gear 108 Leports 110 World Travel

well 텍스처와 라이닝, 강렬한 컬러의 선명한 크로스오버. 패션 하우스의 명가 디올의 크루즈 라인 손톱만한 사이즈의 커프 링크스가 발휘하 는 폭발적인 힘. 이 작은 소품은 완벽한 슈 트 스타일링을 위한 키 아이템이다 꽃과 동물, 나뭇잎 등 자연에서 영감을 받 은 유색 찬란한 주얼리 컬렉션의 향연

화이트닝이 돌아왔다. 피부 속부터 차오르 는 밝고 환한 빛으로 가꿔줄 비장의 무기 가 바로 여기 있다 사랑의 의미를 정열적이고도 집요하게 화 폭에 담아내고자 했던 샤갈의 두 번째 회 고전 소식 BMW 최고의 플래그쉽 세단 760Li는 최고 란 수식어가 너무나도 당연한 베스트 드림 카이다

124 Fashion 134 Pelle 140 Jewelry 146 Beauty 152 Scope 160 Auto


noblian meets digital 스마트하게 노블리안 즐기기! 대한민국 최고의 VVIP 매거진 노블리안이 아이패드 어플리케이션으로 여러분께 새롭게 선보입니다. 한국을 대표하는 호텔신라의 멤버십 매거진 노블리안은 기존 멤버십 매거진과는 차별화된 컨셉트와 감각적인 비주얼로 독자들의 문화적 충족감을 더하는 고품격 매거진입니다. 새로워진 노블리안은 이제 아이패드로 더 많은 대한민국 독자와 만나게 됩니다.

잡지 그대로 노블리안이 가진 감각적인 레이아웃 그대로, 실제로 잡지를 읽는 것처럼 책장을 넘기는 효과를 아이패드에서 만날 수 있습니다. 매달 새로운 노블리안이 업데이트 되며 지난 호 보기도 함께 제공됩니다.

이미지만 모아서 노블리안에서 제공하는 하이 퀄리티의 이미지를 슬라이드 쇼로 감상할 수 있습니다. 디지털 액자로, 인테리어로. 다양한 방법으로 간편하게 감상할 수 있는 노블리안 어플리케이션.

노블리안의 모든 컨텐츠를 스마트폰 블로그에서도 그대로! 네이버 블로그 어플리케이션을 다운로드 한 뒤, 노블리안 블로그와 이웃맺기를 해주세요. 노블리안 블로그에서 매 월 새로운 노블리안을 매거진 그대로 만날 수 있습니다. http://blog.naver.com/nobliancom

노블리안을 페이스북에서 만나보세요! 노블리안이 페이스북 페이지를 오픈했습니다. 노블리안의 팬이 되어주세요! 노블리안의 최신 소식을 받아 보실 수 있으며 다양한 이벤트에도 참여하실 수 있습니다. http://www.facebook.com/nobliancom 앱 스토어에서 Microsoft Tag를 다운받아 스캔해보세요!

2F Buwon B/D, 96-14 Chungdam,gangnam-gu, Seoul, Korea (135-517) Tel_82 2 541 6665 Fax_82 2 541 6011 Home_www.naaf.co.kr


culture Exhibition

Inspirations from everyday moments

EDITOR KIM HYEYOON

COOPERATION SEOUL ARTS CENTER(580-1300)

현재를 살고 있는 우리에게 ‘현대’란

구축 등까지 출판 발행인의 의지가 아닌,

친숙한 개념이지만 여기에 ‘미술’을

철저히 작가에게 초점을 맞춰 움직인다.

덧대면 그 정의가 흐릿해진다. 현대라는

이는 대중뿐 아니라 아티스트들에게까지

시간적 모호성과 미술이라는 짐짓

폭넓은 지지를 받은 이유다. 이 협업

방대한 틀이 합쳐지니 말이다. 어렵게

체제를 통해 발행을 거듭한 매거진은

생각하지 말고 그냥 노란 바나나가

다양한 작품을 탄생시켰고, 창간

프린팅된 티셔츠를 감상해보자.

25주년이 되던 2009년에는 총 185명의

이 프린팅은 앤디 워홀의 작품이고 그는

아티스트가 작업한 200여 점의 현대

팝 아트의 창시자이며 그가 바로 현대

미술 작품 목록을 완성하게 된다. 이렇게

미술 작가다.

완성된 〈파케트 에디션PARKETT Edition〉 역시 기대를 저버리지 않는다.

What would be the sources of creativity that pops up suddenly in your brain? If you think creativity is a child of difference, you could be wrong. And you can learn why, from this exhibition at the <World Stars in Contemporary Art>.

〈PARKETT〉를 알다

그중 가장 큰 장점은 현대를 함께하는

현대 미술을 보다 쉽고 가깝게 이해할 수

유명 작가들의 특징을 한눈에 파악할 수

있는 또 다른 기회는 〈월드스타 인

있다는 것. 방대하고 다양한 작품을

컨템퍼러리 아트 展>에서 유수의 현대

깔끔하게 정리한 한 권의 잡지라고 할 수

미술 작품을 만나는 것이다. 전시의

있기 때문이다. 아니, 한 권의

시발점은 세계적인 현대 미술 전문지인

‘잡지’라기보다는 현대 미술관에 대한

〈파케트PARKETT〉이다.

모든 것을 담은 ‘도서관’이라고 하는 게

매 호마다 주목할 만한 새내기 현대 미술

낫겠다. 현대 미술의 단계적 변화와

작가를 엄선하는 〈파케트〉는 잡지

트렌드를 꼬집어주는 〈파케트 에디션〉은

기획에서부터 편집, 평론가 뽑기, 그리고

1987년, 파리의 퐁피두 센터에서 첫선을

작품 제작을 동시에 진행하는 협업 체제

보였다. 그 후 매년 새로운 에디션이

〈월드스타 인 컨템퍼러리 아트 展>의 근간이 되는 현대 미술 전문지 <파케트PARKETT>. 대중의 시선이 머무는 가장 핫한 작가들을 국내에서 만나보자 THOMAS STRUTH, Jiangxi Zhong Lu, Shanghai 1996


culture Exhibition

Inspirations from everyday moments

추가되면서 세계 곳곳의 훌륭한 문화

‘예술가는 일상에서 영감을 만나다’라는

도시의 대표 미술관에서 개최된

큰 주제 아래 6가지로 구성된 테마. 그

특별전으로 대중과의 만남을 이어왔다.

테마의 내용은 ‘놀이터에서’, ‘야외에서’,

그리고 이 두근거리는 현대 미술의

‘옷장에서’, ‘도시에서’ 등이다. 더욱

집약체인 〈파케트 에디션〉이 드디어 국내

흥미를 끄는 것은 감상을 하다가 작품의

팬을 찾아온 것이다.

일부가 되는 관람 체험. 작품을 단순히 보는 것만이 아니라 적극적으로

대중에게 손을 내민 전시

참여하게 만드는 관람 방식은 작가가

〈월드스타 인 컨템퍼러리 아트 展>은

영감을 얻는 과정을 체감할 수 있게

‘감상’과 ‘이해’가 동시에 이뤄진다. 더

해준다. 또 상상만 해보던 거장 작가들의

많은 대중에게 작가의 작품을 쉽게 접할

일상 속에서 어떤 이미지를 포착해

수 있도록 해야 한다는 기획 의도

형상화하는지도 알 수 있고 더불어

때문이다. 그래서 전시는 세계적인 현대

그들의 은밀한 내면의 모습까지

작가의 작품을 통해 예술과 생활 사이에

예견해볼 수 있다. 회화를 비롯해 사진,

벽을 허무는 계기를 제공한다.

도면 인쇄물, 조각, 심지어 비디오,

또 난해한 작품들이 아닌, 우리에게 제법

DVD까지. 현대 미술이 다루는 많은

익숙한 작가들의 작품으로 이루어졌기

작품을 온몸으로 느끼고 내 것으로 만들

때문에 더욱 친근하게 다가온다. 이

수 있는 〈월드스타 인 컨템퍼러리 아트

전시를 통해 현대 미술에 대한 편견에서

展>에서 대중에게 손을 내민 작가들의

벗어나게 된다. 바로 무엇인지 꼭

숨결을 직접 느껴보자. 전시는

특별해야 할 것 같은 영감의 원천은 다름 아닌 일상이라는 것 말이다.

예술의전당 한가람미술관에서 오는 2월 25일까지 감상할 수 있다. n

유명 작가들의 특징을 한눈에 알 수 있는



〈월드스타 인 컨템퍼러리 아트 展>.

JEFF WALL, Boy on TV, 1989

앤디 워홀에서 데미안 허스트까지 모두

(from “Eviction Struggle")



한자리에 모였다  GERHARD RICHTER, Green-Blue-Red,1993 

034 Noblian


culture Art

An enormous project of installation art and space

EDITOR JUNG JALIM

COOPERATION THE SHILLA(02-2230-3305)

웅장하게 펼쳐지는 조형과 공간의 미학

뒤덮는 스케일과 보는 각도에 따라

갤러리에서만 예술을 감상할 수 있던

달라지는 독특한 형상은 조형과

시절이 과연 언제였는가. 거리를

절묘하게 어우러지는 공간의 미학을

걸으면서도 도시와 어우러진 현대

느끼게 한다.

미술의 향연을 마음껏 감상할 수 있는 요즘이다. 쉽게 빈번히 접하는 만큼 작품에 대한

라이프스타일 공간을 추구하는 서울신라호텔이 2006년부터 매해 연말

감동도 메마르게 마련. 하지만 간혹

박선기 작가와 함께 고객에게 선사하는

작품과 공간의 절묘한 만남을 마주할

특별한 ‘선물’의 일환이다.

때면 현대를 살아가는 감동이 온몸에 사무칠 때가 있다. 요즘 서울신라호텔 로비에 들어설 때가

박선기 작가는 투명 나일론 줄에 수만 개의 투명 아크릴을 매달아 원뿔・반구・사각 등 형태의 변이를

그렇다. 웅장한 산수화를 반짝이는 입체

창조하는 거대한 설치 작품으로

조형물로 형상화한 듯한 거대한 작품이

서울신라호텔의 시그너처 아트를

눈을 사로잡는 것. 아시안 컨템퍼러리

책임져왔다.

아트를 개척하는 대표적인 현대

Every year, Seoul Shilla Hotel suggests its signature art by Bahk Seon Ghi. This year, the artist presents an art piece reminding viewers of milky way and a huge landscape painting. This will no doubt be the very special gift for The Shilla guests.

이 작품은 미적 가치가 높은

일상적인 호텔 공간에서 고객이 작가의

설치미술가 박선기 작가의 작품인

작품을 바로 앞에서 감상할 수 있는

‘조합체An Aggregate 10-0810’이다.

친숙함을 부여하고, 일반적인 연말

전통적인 회화를 염두에 두진 않았지만,

데커레이션의 정형성을 벗어난 새로운

한눈에 보기에도 웅장한 한 폭의 산수화

시도로 전 세계 어느 호텔에서도 찾아볼

같은 형태로 입체감과 광채를 지닌

수 없는 서울신라호텔만의 시그너처

모던한 설치 작품이다. 로비 천장을

아트로 자리매김하고 있는 것이다.

서울신라호텔 로비에 설치된 설치미술가 박선기의 작품. 마치 은하수가 쏟아지는 듯 아름다운 광채를 발한다

028 Noblian


culture Art

An enormous project of installation art and space

신라호텔과 박선기 작가의 특별한 선물

사용해 로비의 조명과 어우러져

2006년 12월부터 서울신라호텔과 함께

환상적인 풍경을 이루는 크리스마스

크리스마스 데커레이션 프로젝트를 진행,

데커레이션을 연속적으로 선보이면서

올해로 다섯 번째 작업을 선보이고 있는

고객들로 하여금 다음 해 작품에 대한

설치미술가 박선기는 국내뿐 아니라

기대감을 불러일으키게 했다.

미국, 이탈리아, 독일, 스페인, 포르투갈

이번 작품은 지난해보다 3배나 큰

등에서 활발하게 전시를 열고 있으며,

규모로, 제작 기간도 2배 넘게 걸리고

숯이나 돌을 이용한 거대한 설치 작품과

설치 기간만 무려 20여 일이 소요되어

시점을 교란시키는 부조 작품 등으로

크기로도 전년 작품들을 압도한다.

우리 현대 미술을 대표하는 입체 작가로

건축적인 구조를 형상화하는 데 탁월한

자리매김하고 있다.

작가의 매력이 극대화된 작품으로, 그

2006년 크리스마스 데커레이션을 통해

동안의 작업 중 클라이맥스라 할 수

서울신라호텔과 첫 인연을 맺은 그는

있다. “쏟아질 듯 아찔하고, 시리도록

‘거꾸로 매달린 크리스마스’라는 애칭의

빛나고, 카오스를 닮아 비정형적이고,

설치 작품으로 주목을 받았다. 당시

그러면서도 특유의 리드미컬한 운율이

작품은 연말연시의 기대감을 활기차고

느껴지도록 했다. 평범하고 형태 없는

생동감 있게 표현하는 동시에 호텔이나

나일론 줄과 아크릴 비즈의 수만 올이

공공 기관에 설치되는 독창적인

모이고 모여서 조합체를 이뤄 감동을

크리스마스 데커레이션의 대표

주고자 했다”라고 말하는 박선기 작가의

아이콘으로 자리매김했다.

의도는 이번 시즌 서울신라호텔을

이후 형태감과 컬러를 단순화한 그는

드나드는 모든 이들에게 감동으로 전달되고 있다. n

2007년 이후 투명한 아크릴 비즈를

2006년부터 서울신라호텔의 시그너처 아트를 책임지는 박선기는 매년 연속성 있는 작품으로 로비 공간을 환상적으로 연출하고 있다

030 Noblian


culture View

The world from the lens of Delpire

EDITOR KIM HYEYOON

COOPERATION MINISTRY OF CULTURE, SPORTS&TOURISM(710-0762)

시대의 명화로써 세계인의 뇌리에

그 시작은 의대생이던 델피르가 파리

각인되어 있는 레오나르도 다빈치의

생토노레가에 위치한 매그넘Magnum을

‘모나지라’. 이 역작이 ‘전시’가 아닌

찾으면서부터였다. 매그넘은 보도 사진

‘방치’되었다면 지금의 ‘모나지라’가

작가의 단체로 사진계에서는 영향력

있었을까? 사진도 마찬가지다. 순간을

있는 작가들의 모임으로 정평이 난

낚아채는 사진 작가들의 열정이

곳이다. 그는 이곳을 찾아가 대뜸

대중에게 최고의 감동으로 다가가게

‘고루하지 않은 멋진 의학 잡지’를 만들고

연결해주는 사람, 바로 로베르

싶다고 했다. 그때 그의 나이 23세.

델피르Robert Delpire가 있기에 우리는

짐짓 당돌하기까지 한 델피르의 말이

사진을 기억한다.

사장되지 않은 이유는 ‘친구들’을 만났기 때문이다.

Photography holds the past into present. This gorgeous tool of art becomes even more beautiful by the hands of Robert Delpire, and his photographs arrive in a Korean gallery.

델피르, 결정적 순간의 친구들과 만나다

‘결정적 순간’이라는 경구로 유명한 앙리

사진을 감상할 때 누가 찍었느냐에

카르티에 브레송Henry Cartier Bresson,

초점을 맞추면 델피르의 이름은 나오지

그리고 전쟁 사진에서 확고한 입지를

않는다. 그래서 그가 낯설지도 모른다.

가진 로버트 카파Robert Capa가 그들.

하지만 그는 ‘사진’이라는 기본적인 틀에

그 후로 델피르가 편집을 담당하던

국한하지 않고 사진과 대중 사이에

프랑스 의사협회의 기관지인

잔향을 전달하는 완벽한 매개체다. 사진

〈네프Neuf〉는 매그넘과 소장 사진

기획자뿐 아니라 영화 제작자로 예술

작가들의 작품이 실리는 예술 잡지로

디렉터 등으로, 이미지를 다루는 모든

거듭났다. 단순히 의학 잡지를

활동에 열정적인 델피르. 이런 그에게

혁신적으로 바꾸겠다는 델피르의 소망은

영감을 주는 것은 다름 아닌 ‘우정’이다.

꿈이 아닌 현실이 된 것. 이렇게 시작된

ⓒ Robert Doisneau/ gamma rapho, 시청앞에서의 키스, 1950

032 Noblian


culture View

The world from the lens of Delpire

델피르의 사진 기획자로서의 삶은 또

국립사진센터(CNP)에서의 작품들을

다른 인연을 만들어냈다. 실존주의의

빼놓지 말 것. 대중과 획기적인 소통의

대표적 사상가인 사르트르Sartre,

결과물로 회자되는 〈포토 포슈〉는 가지고

초현실주의의 주창자인 브르통Breton

다니며 어디서든 사진을 감상할 수 있게

등등. 문학・예술・철학에 정통한

한 책이다. 이 재치 있는 사진집은

사람들과의 만남은 그의 상상력에 훈풍

‘세계에서 가장 많이 판매된

같은 존재가 돼주었다. 그래서 그는

사진집’이라는 타이틀도 가지고 있다.

2009년 ‘아를 사진 페스티벌’에서

이 뿐만이 아니다. 한국에서는 조금 낯선

특별전을 열었다. 3300m²가 넘는 공간에

CNP의 작품들과 함께 우리에게 제법

전시된 작품들은 시대를 울린 사진

친숙한 작품들까지 만나볼 수 있다. 그

작가들의 작품과 델피르의 손을 거친 책,

어떤 드라마보다 드라마틱한 키스

그가 제작에 참여한 영화 등을 엮은

장면을 담아낸 로베르 두아노Robert

최고의 전시였다.

Doisneau의 ‘시청에서의 키스’, 요세프 코우델카Josef Koudelka의 ‘멈춰버린



찰나를 사랑하다

시계’ 등이 그것. 이번 기회에 직접

이렇게 최고의 전시로 불리는 아를

그들의 작품을 감상할 수 있다.

페스티벌의 감동을 다음 달 27일까지

더욱이 사진 기획 전시에 그치지 않고

예술의전당 한가람미술관에서 느낄 수

영화를 통해서도 델피르를 만날 수

있다. 무엇보다 델피르가 15년간

있다는 반가운 소식까지. 그의 손길을

몸담으면서 150여 회의 전시를 기획하고,

거친 주옥같은 작품들과 교감 해보자.

사진 출판의 새로운 지평을 연 〈포토

차가운 겨울, 메마른 감성을 촉촉하게 적셔줄 것이다. n

포슈Photo Poche〉를 발간한

 포토 포슈, 나다르 편(좌)

 카오스(혼돈), 요세프 코우델카사진, 델피르편집, 파리, 1999년 첫판(우) 


culture Stage

Musicians be loved by Koreans - Sting and Ryuichi Sakamoto Sting and Ryuichi Sakamoto, who know how to thrill their audiences with great melodies and messages. They are beyond musicians. They are icons.

EDITOR KIM HYEYOON

COOPERATION ACCESS ENTERTAINMENT(3141-3488) VINCERO(599-5743)

최근 우리나라를 찾은 해외

Padovani를 영입해 총 6회의 그래미상을

아티스트들이 모두 입을 모아 한국 공연

수상한 그룹, 폴리스The Police를

수준에 대한 감격의 말들을 쏟아냈다.

탄생시켰다. 영국은 물론, 미국에서도

공연이 진행되는 동안 내내 모든 곡을

사랑받았던 그룹 폴리스는 7년이라는

따라 부르는 관객들과의 음악적 소통에

시간을 끝으로 해체된다.

큰 감명을 받은 것. 지금 우리는 10년

온전히 자신만의 음악을 만들고 싶다는

만에 한국을 찾은 류이치 사카모토와

스팅의 생각 때문이었다. 그리고 마침내

주옥같은 곡들로 마음을 움직이는

대중의 예상을 깨고 그전에 했던 음악

스팅에게 열광할 준비가 되었다.

스타일과 상반된 첫 음반 〈The Dream of Blue Turtles〉를 통해 폴리스라는 틀에서

Englishman in Seoul

분리되었다. 이 성공적인 시작을

스팅은 항상 ‘스팅’의 느낌이다. 어느

밑거름으로 음반 <Nothing Like The

자동차 광고에서처럼 너무 파릇한

Sun>에서 ‘Englishman in New York’,

‘boy’도 아니고 중후한 ‘man’도 아닌

‘Little Wing’, ‘Fragile’ 등의 히트 곡들을

‘guy’의 감성 말이다. 이런 뜨거운 열정과

내놓았고, 폭발적인 사랑을 받은 ‘Shape

세심한 연륜을 가진 그는 그룹 커브드

of My Heart’가 수록된 <Ten

에어Curved Air의 드러머인 스튜어트

Summoner’s Tales>, 전 세계에서 800만

코플랜드Stewart Copeland를 만나면서

장이 넘겨 팔린 ‘Brand New Day’ 등

본격적으로 음악인으로서의 삶을

음악적 완성도와 더불어 꾸준한 인기를

시작했다.

받고 있다. 이런 스팅의 음악 세계를

런던으로 떠난 둘은 그곳에서

체험하고 싶다면 1월 11일, 올림픽공원

기타리스트 베리 파도바니Beri

체조경기장으로 가보자. ‘Englishman in

유럽과 미주 그리고 일본에 국한되었던 류이치 사카모토의 공연 ‘playing the piano’. 2010년 하반기 북미 투어와 일본 투어에 이어 마지막으로 아시아에서 유일하게 우리나라를 찾았다

036 Noblian


culture Stage

Musicians be loved by Koreans - Sting and Ryuichi Sakamoto

Seoul’의 감동을 경험할 수 있는 기회는

언제나 류이치 사카모토 음악의

단 하루뿐이다.

중심에는 피아노와 신시사이저가 있었고, 이를 기반으로 여러 갈래의 실험적인

익숙하지만 낯선 조우

음악이 존재했다. 순수 피아노 연주는

우리의 귀에는 친숙한 류이치

물론 월드 뮤직, 하우스 뮤직, 엠비언트

사카모토가 국내 팬들의 앞에 서는 것은

뮤직 등이 그것.

10년 만이다. 강산이 변한다는

그래서 류이치 사카모토는 ‘하나’만을

10년이라는 공백은 꾸준한 그의 음악에

고집하지 않는다. 시대의 흐름을

대한 지지를 본다면 큰 문제가 되지

민감하게 포착해 변화무쌍한 음악을

않는다.

만들어내는 그. 다채로운 변주와 즐거운

〈마지막 황제〉, 〈메리 크리스마스 미스터

상상력을 겸비한 이번 공연은 2009년

로렌스Merry Christmas Mr. Lawrence〉

유럽 투어를 시작으로 2010년 북미

O.S.T 같은 영화 음악 역사에 한 획을

투어까지 이어지다가 드디어 국내에

그은 작품뿐 아니라 아카데미상,

오게 되었다. 다양한 요소가 적절히

그래미상, 골든글로브상을 수상한

어우러진 음악과 세심한 무대 미술의

대외적인 결실까지. 그의 음악적 재능에

완벽한 조화를 느낄 수 있는 류이치

대한 보상과 신뢰는 두텁다.

사카모토의 공연 ‘playing the piano’.

일렉트로닉과 뉴웨이브 록, 드뷔시의

1월 9일 예술의전당에서 펼쳐진다. 자,

낭만주의, 그리고 여유로운 음색의

실로 오랜만에 방한한 그의 음악을 이

보사노바까지. 광대한 음악 스타일을

공연을 통해 눈에도 담아보자. 귀에만

아우르며 도전을 거듭한 실험 정신이 그

익숙했던 음악 선율에 더할 수 없는 감동을 줄 것이다. n

원동력일 것이다.

약 1억 장의 음반 판매고를 기록하고 있으며, 이를 토대로 그래미상을 16회 수상한 스팅은 아직까지도 음악에 대한 열망이 수그러들지 않은 음악계의 전설이다

038 Noblian


culture Concert

New Year’s greetings, all the way from Vienna Vienna music is to wake up Seoul’s New Year’s mornings. With sophisticated European manners, Vienna Strauss Festival Orchestra is to greet the Korean audience with its New Year’s concert, together with the Seoul City Orchestra’s Mahler 2011 Series for the New Year celebration.

EDITOR JUNG JALIM

COOPERATION VINCERO(599-5743) SEOUL PHILHARMONIC ORCHESTRA(3700-6334)

빈 슈트라우스 페스티벌 오케스트라의

겸하는 빌리 뷔흘러는 빈 태생

신년 음악회

바이올리니스트로 현재 오스트리아에서

요한 슈트라우스 스페셜리스트인 페터

활동 중인 젊은 음악인들의 대표 주자다.

구트가 창단한 빈 슈트라우스 페스티벌

현재 솔리스트로 잘 알려진 동시에

오케스트라는 전통적인 고전

유명한 앙상블의 실내악 연주자로서도

음악에서부터 빈의 상징인 요한

명성을 얻고 있는데, 빈 슈트라우스

슈트라우스의 ‘왈츠’까지 ‘빈 음악’의

페스티벌 오케스트라의 객원 지휘자로서

정수, 즉 빈 출신 음악인들만이 만들어낼

어느 공연에서든지 매 회마다 성공적인

수 있는 특색 있는 연주를 선보여 가는

연주를 이끌어내고 있다.

곳마다 찬사를 받으며 돌풍을 일으키고

협연자로는 조수미 이후 유일하게 유럽

있다. 특히 일본에서는 10여 년간 꾸준히

메이저 오페라 극장에서 주역을 도맡고

세계적인 연주자들과 신년 음악회를

있는 소프라노 임선혜가 나서 빈

개최한 것으로 알려졌다. 미국발 금융

스타일의 오페레타에 도전한다. 독일에서

위기가 한창이던 2009년 1월에도 이들의

활동 중 고음악계의 거장 필립

신년 음악회는 흥행에 성공할 만큼 국내

헤레베헤에게 우연한 기회에 발탁되어

팬들에게도 익숙한 단체다.

약관 23세에 모차르트로 고음악계에

보통 이 악단의 수석 주자는 지휘를 겸해

발을 들여놓은 그녀는 지휘자 르네

한 손에는 바이올린을 들고 직접

야콥스, 윌리엄 크리스티, 지기스발트

연주하면서 지휘하는 화려한 무대를

쿠이겐, 파비오 비온디 등과 작업하면서

보여준다.

바로크 음악계 최고 권위자들의

오는 1월 20일 예술의전당 콘서트홀에서 열리는 이번 공연에서 지휘와 악장을

끊임없는 러브콜을 받으면서 명실상부 고음악계 최고 소프라노로 자리매김했다.

1978년에 창단되어 30년의 전통을 자랑하는 빈 슈트라우스 페스티벌 오케스트라는 빈 음악의 정수를 선보인다

042 Noblian


culture Concert

New Year’s greetings, all the way from Vienna

서울시향의 2011년 말러 시리즈

삶’은 천국에서의 축제를 노래하는데

서울시립교향악단이 마련한 1월 무대는

사이먼 래틀, 발레리 게르기예프, 다나엘

모두 정명훈 예술감독의 지휘로

하딩, 찰스 매커라스 등 거장과 함께해온

이뤄진다. 주목할 만한 것은 2010년에도

스코틀랜드 소프라노 리사 밀네가

이미 성황을 이룬 말러 시리즈가

우리에게 ‘천상의 삶’을 들려준다. 또

2011년에 또다시 새롭게 시작된다는 것.

모차르트 최고의 콘서트 아리아

오는 1월 14일 예술의전당 콘서트홀에

‘엑술타테 유빌라테’(환호하라,

오르는 2011년 정명훈과 서울시향의 첫

기뻐하라)도 청아한 목소리로 부른다.

번째 말러 공연은 그가 빈의 고전주의

1월 21일 공연되는 두 번째 말러 공연은

언어로 돌아가서 작곡한 교향곡 4번이다.

말러 교향곡 5번을 감상할 차례다.

과거의 형식을 빌렸지만, 말러는 이를

유명한 ‘아다지에토’ 악장을 품고 있는

더욱 풍부하게 하고 변형시켜 미래를

교향곡 5번은 말러가 더욱 발전한

지향한다.

관현악법을 과시하고 있는 명곡이다.

연주 시간은 보통 50여 분으로 말러의

정명훈 예술감독의 아다지에토는

교향곡 가운데 가장 짧은 편에 속하는데,

‘사랑’일까, ‘이별’일까? 베토벤적인

말러의 교향곡으로는 좀 억제되어 있고

구성을 갖추었으나 5악장의 승리에는

고전파풍인 첫 번째 악장에 이어 두 번째

아이러니와 불확실성이 자리 잡고 있다.

악장에서는 변칙 조율된 독주

이날 공연에서는 하마마츠 콩쿠르

바이올린이 연주한다.

최연소 우승자인 피아니스트 조성진이

세 번째 악장은 느린 악장으로 변주

모차르트 피아노 협주곡 d단조로

형식으로 되어 있다. 네 번째 악장에서

모차르트의 불안과 떨림을 표현할 예정이다. n

소프라노 독창으로 표현되는 시 ‘천상의

정명훈 예술감독이 이끄는 서울시립교향악단이 2011년 말러 시리즈로 새해를 연다

044 Noblian


culture Classic

New Year’s greetings, all the way from Vienna Vienna music is to wake up Seoul’s New Year’s mornings. With sophisticated European manners, Vienna Strauss Festival Orchestra is to greet the Korean audience with its New Year’s concert, together with the Seoul City Orchestra’s Mahler 2011 Series for the New Year celebration.

EDITOR JUNG JALIM

COOPERATION VINCERO(599-5743) SEOUL PHILHARMONIC ORCHESTRA(3700-6334)

빈 슈트라우스 페스티벌 오케스트라의

겸하는 빌리 뷔흘러는 빈 태생

신년 음악회

바이올리니스트로 현재 오스트리아에서

요한 슈트라우스 스페셜리스트인 페터

활동 중인 젊은 음악인들의 대표 주자다.

구트가 창단한 빈 슈트라우스 페스티벌

현재 솔리스트로 잘 알려진 동시에

오케스트라는 전통적인 고전

유명한 앙상블의 실내악 연주자로서도

음악에서부터 빈의 상징인 요한

명성을 얻고 있는데, 빈 슈트라우스

슈트라우스의 ‘왈츠’까지 ‘빈 음악’의

페스티벌 오케스트라의 객원 지휘자로서

정수, 즉 빈 출신 음악인들만이 만들어낼

어느 공연에서든지 매 회마다 성공적인

수 있는 특색 있는 연주를 선보여 가는

연주를 이끌어내고 있다.

곳마다 찬사를 받으며 돌풍을 일으키고

협연자로는 조수미 이후 유일하게 유럽

있다. 특히 일본에서는 10여 년간 꾸준히

메이저 오페라 극장에서 주역을 도맡고

세계적인 연주자들과 신년 음악회를

있는 소프라노 임선혜가 나서 빈

개최한 것으로 알려졌다. 미국발 금융

스타일의 오페레타에 도전한다. 독일에서

위기가 한창이던 2009년 1월에도 이들의

활동 중 고음악계의 거장 필립

신년 음악회는 흥행에 성공할 만큼 국내

헤레베헤에게 우연한 기회에 발탁되어

팬들에게도 익숙한 단체다.

약관 23세에 모차르트로 고음악계에

보통 이 악단의 수석 주자는 지휘를 겸해

발을 들여놓은 그녀는 지휘자 르네

한 손에는 바이올린을 들고 직접

야콥스, 윌리엄 크리스티, 지기스발트

연주하면서 지휘하는 화려한 무대를

쿠이겐, 파비오 비온디 등과 작업하면서

보여준다.

바로크 음악계 최고 권위자들의

오는 1월 20일 예술의전당 콘서트홀에서 열리는 이번 공연에서 지휘와 악장을

끊임없는 러브콜을 받으면서 명실상부 고음악계 최고 소프라노로 자리매김했다.

1978년에 창단되어 30년의 전통을 자랑하는 빈 슈트라우스 페스티벌 오케스트라는 빈 음악의 정수를 선보인다

040 Noblian


culture Classic

New Year’s greetings, all the way from Vienna

서울시향의 2011년 말러 시리즈

삶’은 천국에서의 축제를 노래하는데

서울시립교향악단이 마련한 1월 무대는

사이먼 래틀, 발레리 게르기예프, 다나엘

모두 정명훈 예술감독의 지휘로

하딩, 찰스 매커라스 등 거장과 함께해온

이뤄진다. 주목할 만한 것은 2010년에도

스코틀랜드 소프라노 리사 밀네가

이미 성황을 이룬 말러 시리즈가

우리에게 ‘천상의 삶’을 들려준다. 또

2011년에 또다시 새롭게 시작된다는 것.

모차르트 최고의 콘서트 아리아

오는 1월 14일 예술의전당 콘서트홀에

‘엑술타테 유빌라테’(환호하라,

오르는 2011년 정명훈과 서울시향의 첫

기뻐하라)도 청아한 목소리로 부른다.

번째 말러 공연은 그가 빈의 고전주의

1월 21일 공연되는 두 번째 말러 공연은

언어로 돌아가서 작곡한 교향곡 4번이다.

말러 교향곡 5번을 감상할 차례다.

과거의 형식을 빌렸지만, 말러는 이를

유명한 ‘아다지에토’ 악장을 품고 있는

더욱 풍부하게 하고 변형시켜 미래를

교향곡 5번은 말러가 더욱 발전한

지향한다.

관현악법을 과시하고 있는 명곡이다.

연주 시간은 보통 50여 분으로 말러의

정명훈 예술감독의 아다지에토는

교향곡 가운데 가장 짧은 편에 속하는데,

‘사랑’일까, ‘이별’일까? 베토벤적인

말러의 교향곡으로는 좀 억제되어 있고

구성을 갖추었으나 5악장의 승리에는

고전파풍인 첫 번째 악장에 이어 두 번째

아이러니와 불확실성이 자리 잡고 있다.

악장에서는 변칙 조율된 독주

이날 공연에서는 하마마츠 콩쿠르

바이올린이 연주한다.

최연소 우승자인 피아니스트 조성진이

세 번째 악장은 느린 악장으로 변주

모차르트 피아노 협주곡 d단조로

형식으로 되어 있다. 네 번째 악장에서

모차르트의 불안과 떨림을 표현할 예정이다. n

소프라노 독창으로 표현되는 시 ‘천상의

정명훈 예술감독이 이끄는 서울시립교향악단이 2011년 말러 시리즈로 새해를 연다

042 Noblian


culture Focus on

EDITOR JUNG JALIM

PHOTOGRAPHER PARK SUNGIL COOPERATION WOORIM FMG(3284-1300) HUGO BOSS(512-6551)

Chopard, ready for a whole new chapter Chopard is already beloved worldwide for its high-end jewelry, but it is now ready to hop on to a higher level now in Korea, based on its 150 years of history. NOBLIAN met Kim Yoon-Ho.

048 Noblian


지난 한 해 주얼리 브랜드 중 가장 눈에 띄고 오래도록 잔상에 남는 브랜드가 있다면 에디터는 단연 쇼파드를 먼저 꼽겠습니다. 150주년 축하 행사는 사진 자료만 봐도 감동적이었는데요. 김윤호 352),/(

대표님이 생각하시는 150주년과 관련한 소감에 대해 말씀해주세요.

창의력과 혁신적인 디자인의 조화,

그렇게 생각해주셔서 감사드립니다.

현대 기술과 전통 공예로 표현되는

미리 계획된 건 아니었지만, 쇼파드가

쇼파드는 2010년 브랜드

150주년을 맞는 2010년에 한국 내

부분으로 이들과 함께 창조된

더욱 적극적인 마케팅을 전개해

론칭을 하게 된 것은 좋은 기회였습니다.

주얼리&워치 컬렉션도 쇼파드 역사의

새롭게 주목받고 있다. 2010년부터

5월에 열린 쇼파드 국내 론칭 행사에는

주요한 부분으로 남아 있습니다.

쇼파드의 한국 딜러로 활약하고

본사 CEO인 칼 프리드리히 슈펠레Karl

150주년을 맞으며, 한국 시장에서

있는 우림FMG는 20여 년간 시계

Friedrich Scheufele가 내한해, 쇼파드의

쇼파드의 브랜드 철학이 사회적으로도

리드하고 있으며, 4월 에비뉴엘에

유구한 역사를 보여주는 데 힘을

긍정적 영향을 미치리라 예상됩니다.

단독 부티크를 오픈하고 쇼파드

보태기도 했죠. 많은 분이 쇼파드의 한국

혹시 대표님 개인적으로나 우림FMG가

150주년 기념 행사를 여는 등

입성을 기다렸다고 말씀해주셔서 저

쇼파드의 브랜드 철학으로 인해 변화를

역시 매우 기뻤습니다.

겪는 점은 없는지요.

사업에 매진해온 김윤호 대표가

적극적인 마케팅으로 쇼파드의 브랜드 가치를 알리고 있다

변화를 겪기보다는 묘하게도 닮은 점들을 많이 발견하고 있습니다. 사실

개인적으로 쇼파드를 생각하면 아름다운 주얼리 워치와 150년의 헤리티지가 먼저

건 이미 7~8년 전입니다. 프랑스에서

지난번 만남을 통해 브랜드 철학뿐

떠오릅니다. 지극히 개인적인

쇼파드 매장을 둘러본 후 디자인의

아니라 개인적 관심사나 취미에

생각이지만 브랜드 네임의 어감도

섬세함과 명품을 대중화할 수 있는

대해서도 칼 프리드리히 슈펠레와 제가

매력적이라고 생각되는데요. 김윤호

잠재력을 지닌 브랜드의 가치를

많은 부분에서 닮았다는 것을 알게

대표님에게 쇼파드 브랜드가 갖는

확신했죠. 20여 년간 시계 브랜드를

되었습니다. 예컨대 쇼파드가 칸

의미는 어떤 것인가요?

취급해온 사람으로서 쇼파드에 대한

영화제와의 오랜 파트너로서 영화

브랜드 네임에 대해서는 저도 같은

욕심은 당연한 것이었습니다. 그 후

사업에 대한 관심과 투자를 아끼지 않고

생각입니다. 더욱이 트래디셔널

지속적으로 쇼파드에 관심을 갖고 있던

있는데, 우림FMG 역시 영화와 인연이

클래식의 모티브를 가져오면서도

중 5년 전 처음으로 자연스럽게 쇼파드

깊습니다. 계열사인 영화제작사 (주)필름

독창성이 엿보인다는 점에서 디자인의

본사와의 만남이 이뤄지면서 정식으로

트레인을 통해 최근 개봉한

밸런스가 매우 좋은 브랜드라고

파트너십을 맺기 이전부터 ‘신뢰도’를

〈부당거래〉와 독특하면서도 유쾌한

생각합니다. 쇼파드에 관심을 갖게 된

쌓아왔다고 할 수 있습니다.

감성을 보여준 〈좋지 아니한가〉 등의

제 입장에서는 무엇보다 전통을

영화를 제작했죠. 투자한 영화만도

고수하며 패밀리 경영을 유지하는

5편입니다. 또 쇼파드는 에이즈 재단

쇼파드의 철학을 높이 평가했고, 그런

후원, 백혈병 기금 단체 지원 활동 등을

부분에서 한국 내에 소개하고자 하는

펴고 있는데, 우림FMG 역시 오래전부터

욕심이 많았던 브랜드입니다.

월드비전과의 연계를 통해 지속적으로 기부 활동을 하고 있습니다.

쇼파드만의 브랜드 철학과 현재 진행되고 있는 다양한 사회 공헌 활동에 대해 NOBLIAN 독자에게도 소개해주세요. 쇼파드는 지속적인 사회 공헌 및 스폰서링 활동을 하는 브랜드로서, 칸 영화제와의 오랜 파트너, 그리고 빈티지 클래식 자동차 ‘밀레 밀리아Mille Miglia의 공식 스폰서 등을 통한 문화 후원 사업을 진행하고 있습니다. 더불어 사회 공헌을 위한 엘튼 존과 함께하는 에이즈 재단 후원과 호세 카레라스와의 백혈병 기금 단체 지원 활동은 쇼파드 활동의 중요한

049 January 2011


culture Focus on 쇼파드의 한국 내 딜러를 맡으면서 이런 공통점을 자연스럽게 발견하게 되었는데 본사의 CEO, 칼 프리드리히 슈펠레와의 대화 중에도 이러한 공통점이 화제가 된 적이 있습니다. ‘서로 뭔가 잘 맞는구나’라는 생각에 슈펠레도 저도 매우 흥미로워했던 기억이 납니다.

개념이 아니었기에, 마케팅 활동을

아무래도 그런 부분을 발견하면서 사회

논하기는 어려울 것 같습니다. 브랜드

공헌 활동과 문화 활동에 더 많은 관심을

가치를 보여줄 수 있는 마케팅 활동은

갖게 되었고, 이제 쇼파드의 한국 내

론칭한 해인 2010년에야 정식으로

딜러로서 더 잘해야겠다는 책임감이

시작되었다고 할 수 있고, 150주년과

들었죠.

맞물려 규모 있는 브랜드 행사들로 더욱더 공격적으로 느껴졌을 것입니다.

본사의 CEO, 칼 프리드리히 슈펠레와

지속적으로 쇼파드의 주얼리 부분과

개인적인 취미나 관심사가 같다고

함께 자체 매뉴팩처를 통한 무브먼트

했는데, 구체적으로 어떤 것들인지요?

개발로 이미 세계적인 명성을 확고히 한

슈펠레는 개인적으로도 기계식 시계와

한국 파트너가 된 비하인드 스토리가

쇼파드의 남성 워치 분야를 국내에

클래식 카를 수집하는 취미가 있다고

궁금합니다. 기존 경력과 어떤 연관성이

소개하고, 강화할 예정입니다. 또 점차

들었는데, 혹시 대표님도 그런 취미가

있을까요? 최근 쇼파드의 변신은 한국

고객들의 니즈가 확대되어가는 초고가

있으신지요?

내 딜러의 변화에서도 크게 느껴지는데,

라인(하이 주얼리)도 시기별로 초대해

저도 클래식 카에 대한 관심이 있습니다.

쇼파드가 우림FMG를 통해 한국 시장을

국내에 선보일 계획입니다.

차이가 있다면 저는 클래식 트럭이나

공략하려는 이유는 무엇일까요?

지프에 큰 관심을 갖고 있습니다. 한때

우림FMG는 20년 이상 워치 및 주얼리

고객 입장에서 쇼파드 시계와 주얼리를

〈내셔널 지오그래픽〉 기자가 되고 싶어

파트에서 오랜 시간 노하우를 쌓았고,

평가하신다면 어떤 점에 가장 큰 점수를

자연스럽게 그쪽으로 관심을 가지게

그만큼의 역량도 갖춘 회사입니다.

주실 수 있을까요?

되었죠. 제가 컬렉션하고 있는 지프가

여기에 쇼파드 브랜드를 국내에

쇼파드는 슈펠레 패밀리의 독립적인

6대 있는데, 슈펠레도 관심을 보이며

소개하고자 저희가 오랜 시간 준비한

가족 시스템으로 그들만의 전통과

놀라워하더군요.

플랜이 쇼파드에 믿음을 주었다고

기술을 지켜오고 있는 브랜드입니다.

생각됩니다. 당시 6개월간에 걸쳐 향후

슈펠레의 두 자녀인 카롤린 그로시

여러 가지로 쇼파드와 우림FMG,

5년간의 사업 계획을 제안했는데,

슈펠레Caroline Gruosi Scheufele와 칼

대표님과 칼 프리드리히 슈펠레와의

경쟁사 환경과 한국 내 쇼파드의 포지션,

프리드리히 슈펠레의 공동 CEO 역할이

남다른 인연이 느껴지는데요. 쇼파드의

현황 등 무려 40페이지 분량에 걸쳐

큰 조화를 이루어 두 분야에서 균형적인

저희가 준비한 전략을 성심성의껏

발전과 그만큼의 명성을 획득한 점이

전달했습니다. 1시간 30분 분량의

가장 큰 브랜드 역량이 아닐까 합니다.

프레젠테이션을 이토록 집중력 있게 들어본 적이 없다는 것이 당시 본사의 반응이었죠. 이러한 부분이 두 회사가 파트너십을 갖게 된 배경입니다. 2010년을 기점으로 쇼파드가 한국 시장에 공격적으로 접근하고 있다는 느낌이 강합니다. 기존의 마케팅 전략과 현재의 마케팅 전략의 차이점에 대해 말씀해주세요. 기존의 한국 내 쇼파드는 단독 부티크

050 Noblian


쇼파드 아이템 중 특별히 좋아하는 모델이 있다면 무엇인지 소개해주세요. 쇼파드의 L.U.C 중 클래식한 멋을 내는 ‘루나 빅 데이트Lunar Big Date’를 좋아합니다. 우림FMG가 쇼파드를 맡은 후, 가장 눈에 띄는 변화와 성과에는 어떤 것들이 있습니까? 우림FMG는 다양한 브랜드를 전개하고 있고, 여기에 쇼파드는 ‘프레스티지Prestige’의 새로운 분야를 구축하는 중이라 할 수 있습니다. 럭셔리 사업 존이어서 기존 방식과는 180도 다른 방식의 마케팅으로 진행하고 있습니다. 우린 이 전혀 다른 분야에서의 새로운 성공을 위해 매진하고 있습니다. 우선 쇼파드의 매력을 효과적으로 보여주기 위해 부티크를 오픈한 것이 대표적입니다. 이와 연결해 마케팅과 홍보 활동도 적극적으로 전개하고 있습니다. 2011년 쇼파드가 준비하고 있는 특별함은 무엇인가요? 쇼파드는 2011년 두 번째 부티크를 준비 중입니다. 규모 면에서의 확장과 함께 무엇보다 중요한 것은 ‘브랜드의 가치’를 널리 알리는 한 해가 되고자 합니다. 앞으로 5년간 매년 하나의 부티크를 오픈해 쇼파드의 브랜드 파워를 점진적으로 확장해갈 계획입니다. n

051 January 2011


EDITOR AIDEN

culture Zoom in

COOPERATION SAMSUNG FASHION&DESIGN FUND

One Big Important Step Forward Samsung Design Fashion Fund, also known as SFDF, has a mission statement of finding and supporting Korean designers who have all it takes to advance to a bigger world, and the sixth group winners of the year 2011 were revealed Jung Wookjun of Junn. J, Lim Sanggyun of Siki Im and Lee Jeongsun of J.JS Lee, are the lucky ones.

세계적인 무대에 도전하는 한국계 디자이너들을 발굴, 후원하는 삼성패션디자인펀드 (SFDF)가 2011년 제6회 수상자들을 발표했다. Juun.J의 정욱준, Siki Im의 임상균, J.JS Lee의 이정선이 그 행운의 주인공. Juun.J 정욱준 올해로 세 번째 삼성패션디자인펀드(SFDF)를 수상한 준지의 정욱준은 이제 명실상부 한국의 대표 디자이너다. 지난 2007년 6월 첫 번째 파리 남성복 컬 렉션을 선보인 이후 준지라는 이름은 빠른 속도로 파리를 비롯한 전 세계의 패션계에 알려지기 시작했다. 준지의 이름과 함께한 수많은 콜라보레이 션 프로젝트가 그 증거. 그동안 영국의 대표적인 스파 브랜드 톱맨, 스포츠 브랜드 아레나, 아이웨어 브랜드 린다패로우 등 세계적 인 브랜드들은 물론, 지난해에는 서울의 멀티숍인 10 꼬르 소 꼬모 서울, 리복과 함께 캡슐 컬렉션을 디자인했다. 2010년 말에는 빈폴 액세서리의 준지 라인과 전 세 계의 주목할 만한 젊은 디자이너들과 함께 만 드는 ‘식스 센츠’ 향수 프로젝트의 일원으 로 참여하기도 했다. 신한카드의 카드 를 디자인하고, 지난해 SFDF 수상자 프로젝트인 빈폴 레이디스의 트렌치코트 라인까지. 나열하기에도 숨이 차는 프로젝트들 은 정욱준이라는 디자이너의 인기를 모두 한번에 증명해준다. “이러한 다양한 프로젝트가 제 커리어에 적지 않은 도움을 준 것이 사실입니다. 좀 더 많은 사람이 저와 제 디자인에 대해 알게 되는 기회가 되었습니다.” 덕분에 그는 지난 11월 전 세계의 신 인 디자이너들 중 눈에 띄는 행보를 보인 이들에게 주는 상인 ‘스위스 텍 스타일 어워즈’ 후보로 올라 스위스의 취리히에도 다녀왔다. 이러한 눈에 띄는 결과물들을 가능하게 했던 건 지난 2년간 수상했던 SFDF의 영향도 무시할 수 없 다. “금전적인 지원은 좀 더 여유롭게 파리 쇼를 준비할 수 있도록 도와줍니다. 프로 덕션부터 쇼 장소, 모델 등 생각보다 많은 예산이 필요한 것이 파리 쇼이기 때문입니 다.” 좋은 소재가 곧 좋은 완성도로 이어지는 남성복에서 마음껏 질 좋은 소재를 고 를 수 있었다는 점도 빼놓을 수 없는 장점. “세계적인 무대에서 컬렉션을 선보일 때

052 Noblian


053 January 2011


무엇보다 중요한 기본은 바로 좋은 소재입니다.” 수많은 ‘과외 활동(“내년 봄에는 빈폴 액세서리와의 두 번째 프로젝트와 또 다른 비밀 프로젝트가 기다리고 있습니다)’에도 불구하고, 정욱준은 자신의 본분인 파리 컬렉션 라인에 대한 고민을 잊지 않는다. “1월 중순에 가을 컬렉션을 선보여야 합니다. 당분 간 외도를 해왔으니, 이제는 본격적으로 컬렉션에 집중하려고 합니다.” 여러 아이디 어를 정비하는 시간을 가져야 하는 정욱준에게 앞으로의 5년, 그리고 10년 뒤의 모습 을 그려달라고 부탁했다. “글쎄요. 꿈은 함부로 이야기하는 것이 아니라더군요. 하 지만 굳이 생각해보자면, 파리에 디자인 스튜디오를 마련하는 것이 될 듯합니 다. 현지에서 디자인 작업을 할 수 있고, 활동의 근거지로 삼을 수 있을 만 한 곳을 꿈꾸고 있습니다.” 지금 준지의 이름이 뻗어나가는 속도를 고려해본다면, 이 꿈이 이루어질 날도 머지않았음이 분명하다.

Siki Im 임상균 2009년 첫 번째 컬렉 션을 선보인 Siki Im의 디 자이너, 임상균의 이력을 읽는 건 꽤 흥미로운 경험이다. 독일 쾰 른에서 태어난 그는 영국 옥스퍼드 대 학에서 건축학을 공부했고, 뉴욕에서 건축 가로 일하던 중 패션으로 방향을 전환했다. “어 린 시절에는 순수 예술가를 꿈꿨습니다.” 회화를 공 부하던 소년은 좀 더 응용적인 디자인을 위해 건축을 선 택했다. “뉴욕에서 건축가로 활동하고 있던 어느 날, 갑자기 패션을 하고 싶다는 생각에 건축을 그만두고 패션으로 뛰어들었 습니다.” 물론 어릴 때부터도 패션에 관심이 있었다. “독일에서는 중학 생 때 장래 희망과 연관된 곳에서 인턴을 해야 합니다. 그때 패션 회사에 지원을 했지만, 뽑히지는 않았어요. 그래서 결국 사진가 밑에서 인턴을 했습니 다. 덕분에 17세에 사진가로서 첫 번째 독립 전시를 열기도 했지요.” 마틴 마르지엘라와 라프 시몬스, 드리스 반 노튼을 동경해온 임상균은 2003년 처음 패션에 뛰어든 후, 많은 노력을 해왔다. 헬무트 랭을 지나 칼 라거펠트, 클럽모나코에 서 디자인을 익힌 그는 2009년 첫 번째 컬렉션을 선보였다. “뉴욕은 실용적이고 심 플한 디자인이 대세를 이루는 곳입니다. 그곳에서 옷에 하나의 철학이나 아이디어를 담아내는 제 옷은 차별화될 것이라 생각했습니다.” 자신의 미학을 조용하고 강하지만 철저하게 디자인된 것이라고 말하는 임상균은 특히 퀄리티를 강조했다. “아무리 좋은 아이디어가 있어도 완벽하게 완성하지 못한다면, 의미가 없습니다. 잘 만드는 것이 무엇보다 중요합니다.” 서양 속 이민자들이라는 테마를 차용한 이번 봄 컬렉션은, 마티유 카소비츠의 영화 〈증오〉 속 주인공들의 스타일을 바탕으로 했다. “영화 속 이민자 청년 3명의 패션은 파리의 외곽 지역에서 쉽게 볼 수 있는 캐주얼한 스포츠 스타일입니다. 트레이닝팬 츠, 야구 점퍼, 러닝 톱 등이 그 기본 아이템이 되겠지요.” 임상균은 그토록 일상적인 아이템에 실크부터 고급 저지, 오간자 등을 사용해 완성도를 더했다. “평범한 아이템 에 조금의 디자인을 더하고, 고급스러운 소재를 더해 어떤 종류의 낯선 감정을 표현 하고자 했습니다.” 하얀 티셔츠 하나를 디자인해도 그 속에 디자인을 담고 싶다는 임 상균은 이런 뛰어난 아이디어 발전 재능 덕분에 요즘은 뉴욕의 파슨스 패션 스쿨에서 후배들에게 패션 콘셉트 이론을 가르치고 있다. “젊은 학생들과 함께하는 건 좋은 자 극이 됩니다. 제 디자인 작업에도 많은 도움을 받고 있습니다.” 아직 한국말이 서툰 그는 SFDF의 도움을 받으면 어떤 식의 성장을 하고 싶으냐는 질문에 “한국에 돌아와서 커다란 매장을 세우는 것이다”라는 농담을 했다. 하지만 진 정으로 원하는 것은 좀 더 폭넓은 디자인 세계를 완성하는 것이다. “전 여성들이 제 옷을 입었을 때보다 더 섹시해 보일 때는 없는 듯합니다. 제 옷 중에서 가장 먼저 팔

054 Noblian


리는 옷들 역시 작은 사이즈의 옷들이죠.” 지금으로서는 남성복에 집중하고 있지만, 때가 된다면 서서히 자신의 세상을 넓혀가고 싶은 것이 그의 욕심. “단순히 양적인 성장을 꿈꾸는 것은 아닙니다. 될 수 있으면 더욱 깊은 저만의 미학을 많은 사람과 공 유하고 싶은 것입니다.” 그리고 지금도 그 꿈을 이루기 위해 임상균은 뉴욕 소호의 작은 스튜디오에서 열심히 디자인에 몰두하고 있을 것이다. J.JS Lee 이정선 지난해 6월 런던에서는 미래의 패션 천재들을 미리 점찍어볼 수 있 는 패션 스쿨 졸업 컬렉션 쇼들이 계속되었다. 전 세계에서 건너온 재능 넘치는 학생 들 속에서 당당히 스포트라이트를 받은 이들은 다름 아닌 한국인이었다. 알렉산더 맥 퀸에서부터 피비 파일로, 스텔라 매카트니 등 당대 디자이너들의 모교인 세인트 센트 럴 마틴스 스쿨의 대학원 졸업 쇼가 그 현장. 2명의 한국인이 1등상을 공동 수상한 것. 그중 한 명이 바로 J.JS Lee라는 이름의 라벨로 런던 컬렉션에 데뷔한 디자이너 이정선. “졸업 컬렉션에 대한 기대는 그다지 없었습니다. 하지만 모두들 시선 고정할 곳 없이 복잡하고 화려한 옷을 선보이는 가운데 담담하고 심플한 제 옷이 눈에 띈 것 같습니다.” 졸업 컬렉션 하나만으로 이정선은 든든한 후원군 2명을 얻었다. 한 명은 세인트 센트 럴 마틴스 스쿨의 패션 학장인 루이스 윌슨. 윌슨이 뒤를 밀어준다면, 스타 디자이너 가 되는 것은 시간문제. “선생님께서는 졸업 컬렉션부터 제가 독립할 수 있도록 많은 도움을 주셨습니다. 워낙 엄격한 분이기에 칭찬은 기대하지도 않았습니다. 하지만 제 옷을 보더니, ‘나쁘지 않군’이라고 하시더군요. 그 말에 감동받을 수밖에 없었습니다.” 훌륭한 스승의 지도 아래 선보인 졸업 컬렉션은 그 즉시 영국 런던의 해러즈 백화점 이 바잉해갔고, 이정선은 덕분에 두 번째 멘토를 만났다. 세계적인 패션 칼럼니스트이 자 영국 신인 패션 디자이너들의 대모인 사라 무어가 이정선의 두 번째 스승. “그분은 제게 저만의 디자인을 할 수 있도록 힘을 불어넣어주셨어요. 특히 학교를 졸업하고 처 음 선보인 컬렉션을 준비할 때는 정말 꼼꼼히 살펴보셨습니다.” 이러한 훌륭한 스승들 덕분일까. 지난 9월 런던 패션 위크 기간에 선보인 이정 선의 데뷔 컬렉션은 심플하고 미니멀한 디자인으로 큰 호평을 받았다. 그리 고 사라 무어가 준비한 런던 신인 디자이너들의 파리 쇼룸(가장 많은 패 션 관계자가 찾는 파리 컬렉션 기간에 런던의 신인 디자이너들을 소개하는 행사)에서도 좋은 반응을 얻었다. “특히 미국 〈보그〉 의 편집장, 안나 윈투어와 프랑스 〈보그〉의 편집장, 카린 로이펠드가 제 옷을 꼼꼼히 살펴보는 순간 숨이 멎는 것만 같았습니다. 첫 번째 컬렉션임에도 좋은 반 응을 얻은 것 같아 매우 만족합니다.” 이정선의 디자인이 그토록 좋은 반응을 얻어낸 것은 그녀만의 개성이 담긴 디자인 덕분이었다. “졸업 컬렉션과 마찬가지로 지나치게 과장된 상상력이 주 류로 인정받는 런던 패션계에서 미니멀하고 심 플한 디자인을 선보인 것이 다른 디자이너들과 차 별화될 수 있었던 것 같습니다.” 하지만 신인 디자이너 로서 미니멀한 디자인을 고집하는 것은 쉽지 않은 일이다. 심플한 옷이야말로 뛰어난 테일러링과 완성도를 필요로 하기 때 문. “한국의 내셔널 브랜드에서 패터너로 일한 것이 큰 도움이 되었 습니다. 영국에 유학을 온 것도 좀 더 높은 수준의 테일러링을 배우고 싶 었기 때문입니다.” 6개월 계획으로 떠난 런던행이 벌써 6년째가 되어가는 지 금, 이정선은 런던의 신인 디자이너로서 또 다른 삶에 익숙해지고 있다. “런던은 신인 디자이너가 되기에 더없이 좋은 곳입니다. 모두 처음 시작하는 디자이너들을 도 와주고 싶어 합니다.” 런던은 물론 한국에서도 SFDF라는 든든한 후원자를 만났으니, 이정선의 앞길은 꽤나 밝지 않을까 싶다. n

055 January 2011


culture People

EDITOR WON JONGMYUNG

COOPERATION LANSMERE(542-4155)

352),/(

크리스찬 지거Christian Sieger는 그의 동생 미하엘 지거Michael Sieger와 함께 독일 남성복 브랜드 지거SIEGER의 공동 오너로 마케팅을 담당하고 있다. 지거 형제 중 장남인 크리스찬 지거는 1990년부터 지거 디자인 컨설팅 GmbH의 디렉터로 시작해 1999년부터는 동생 미하엘과 함께 공동 파트너로서 지거 디자인 GbR을 이끌고 있다. 그 후 2005년 지거를 론칭, 남성복Couture 외에도 도자기Porcelain, 유리 공예Fine Glass와 같은 테이블웨어와 가구Furniture를 함께 전개하고 있다. 오너 형제가 이끄는 독일의 토털 디자인 하우스 지거는 분야를 넘나들며 그들의 철학을 전하고 있다

056 Noblian


지거 라이프스타일, 신사의 문화를 만들다

지인 하르코텐 성Harkotten Palace은 그들의 성공에서 빼놓을

모든 스타일 가이의 영원한 로망은 바로 완벽한 젠틀 룩을 연

수 없는 요소다. 지난 20년간 그들의 활동은 독일 뮌스터랜드

출하는 것. 시간을 간직한 클래식함이나 거부할 수 없는 매력을

지역에 위치한 위엄이 느껴지는 하르코텐 성 안의 바로크 양식

더해 완성되는 진정한 남성다움은, 바로 ‘젠틀맨’이라는 단어로

에서 비롯한 것이기 때문이다. 이곳은 지거 디자인의 본사이자

함축되기 때문이다. 그리고 그들은 외형적인 멋과 더불어 그들

지거 형제가 그들의 가족과 함께 자라온 역사적 건물이다. 그들

만의 라이프스타일을 통한 문화를 만들어가고픈 욕구를 지니게

은 지금도 하르코텐 성 주변의 우아한 환경에서 영감을 얻고,

된다.

이를 다시 제품에 투영하고 있다. 더불어 지거의 고객에게 이

그런 의미에서 지거는 이 시대 남성에게 가장 주목받는 브랜 드다. 럭셔리, 퀄리티, 문화와 스타일을 모두 담아내는 이 브랜

If you choose SIEGER, it means that you are a man who expects the finest quality. Gentlemen of the times are lucky to find the modern tailoring, perfect style and luxury to present their lifestyles in SIEGER.

성을 개방하며 지거만의 색다른 라이프스타일을 함께 이해하고 공유할 수 있도록 배려한다.

드는 알면 알수록 묘한 매력에 이끌려 그 존재감을 더욱 명확

이번 시즌 선보이는 지거 컬렉션은 그들의 이상과 철학을 그

하게 한다. 독일 하르코텐Harkotten 출신의 두 형제 크리스찬

대로 반영하고 있다. 진정한 젠틀맨을 표현하는 Lionheart가 테

지거Christian Sieger와 미하엘 지거Michael Sieger가 그들만의

마이다.

크리에이티브한 감각과 패션의 열정을 담아 탄생시킨 지거

지거의 모든 아이템은 패션 트렌드와 짧은 수명에 구애받지

SIEGER. 거친 남성미만을 떠올리는 자동차와 맥주의 나라 독

않으며, 영원한 가치를 지닌다. 지거는 모던하고 섹시한 브랜드

일에서 컬러와 유머가 담긴 패션 브랜드의 탄생은 모두에게 놀

다. 제품에 대한 열정과 독창성은 놀라운 디자인과 색감, 그리

라움과 감동을 선사하고 있다.

고 설득력을 갖춘 기능성으로 눈을 돌린 미하엘 지거의 대범함

지난달 우리나라를 방문한 CEO 크리스티안 지거는 패션에 대

에서 비롯되었다. 그는 독일의 완벽주의와 실용주의, 그리고 지

한 유니크한 감각과 뛰어난 크리에이티브를 모두 갖춘 인물이

중해의 삶에 대한 열정과 다양성을 결합했다. 크리스찬 지거는

었다.

이에 대해 “땅에 단단하게 기반을 둔 범세계적인 디자인이다”

“우아하고 영원하면서 동시에 남자의 특성을 강조하는 것. 이

라고 말한다.

것이 지거를 표현할 수 있는 패션적 표현입니다. 지거를 선택하

디스플레이와 패키지, 로고에 이르기까지 컨템퍼러리적 디자

는 남성은 최고의 퀄리티를 기대하죠. 섬세한 디테일과 컬러에

인을 경험하게 하는 지거의 크리에이티브는 컬러감으로 다시

대한 창의성은 지거만의 특징이라고 할 수 있습니다. 이 시대

한 번 상기하게 만든다. 지거 브랜드 전체를 대변하는 미묘하고

신사들은 그들의 라이프스타일을 완벽하게 표현할 수 있는 현

신비한 퍼플 컬러의 매력은 이것이 지닌 마법과도 같은 특별함

대적인 재단과 스타일, 완벽함, 그리고 럭셔리를 그 안에서 찾

과 모순된 카리스마로 우리를 더욱 황홀하게 할 것이다. 지거의

게 될 것입니다.”

매력적인 포트폴리오는 란스미어를 통해 확인할 수 있다.

지거 디자인은 감정, 이야기, 시로 뒤섞인 문화적 원형을 나타 내며, 이는 다시 지거만의 독창적인 미학과 라이프스타일로 조 화를 이룬다. 이것은 크리스찬 지거와 미하엘 지거, 두 형제의 삶 그 자체가 반영된 것이다. 그들의 디자인 스튜디오이자 거주

Follow the lionhearted chivalry, with SIEGER 057 January 2011


culture People

EDITOR KIM HYE YOON

COOPERATION endorf music(2195-4699)

352),/(

동경에서 출생한 의사출신 재일한국인 2세 음악가 양방언. 일본, 홍콩을 포함한 아시아는 물론 영국, 독일 등 유럽에서 작곡가, 연주가, 편곡가, 프로듀서로 활동하면서 클래식, 락, 월드뮤직, 재즈 등 음악적 장르를 넘어 시대와 세대를 아우르는 음악가이다.

058 Noblian


An artist who knows aesthetics of mixing YANG BANG EAN

Fusion is now a legitimate part of art, as many artists mingle and mix many different things into one harmony. In music, there is YANG BANG EAN, the leading figure of crossover music scene.

음악에는 다양한 장르가 존재한다. 그중에서, 장르를 구분할 수

작품으로 <into the light>를 발표하기에 이른다. 이는 여행 도중

있는 쉬운 곡이 있는가 하면, 분류하기 애매한 곡도 있다. 양방

현지에서 직접 녹음한 민요를 소재로 삼거나 런던 필하모닉 오

언의 음악이 그렇다. 여러 장르의 교차와 그 순서의 뒤섞임까

케스트라와 함께 연주한 곡이 담긴 음반이다. 이렇게 여러 나라

지. 이 모든 것을 깔끔하게 버무릴 줄 아는 양방언이라는 인물

음악을 자신만의 스타일로 창조해낸 곡들로 대중과 더 가까워

자체가 크로스오버다.

졌다.

재일 한국인 2세인 그. 뮤지션이 되기까지 양방언의 삶의 여정

1999년, 양방언의 음악 여정은 전환점을 맞는다. 자신의 정체

은 특별하다. 그는 여느 유명 음악가의 어린 시절처럼 말을 떼

성에 대한 본격적인 탐구를 한 시기이기 때문이다. 바탕에는 우

기 전부터 능수능란하게 악기를 연주하거나 세상을 놀라게 한

리나라 젊은 국악 계승자들이 연주하는 타악기 앙상블 리듬에

음악을 작곡한 것은 아니다. 그는 본래 의사였다. 그가 의사 가

대한 감동이 있었고, 그 감동을 우려낸 <Only Heaven Knows>

운을 벗은 계기는 무엇일까? 양방언의 음악적 여정을 거슬러

가 탄생했다. 이 음반에는 그가 직접 한국, 영국, 내몽골을 오가

올라가면 중학생 시절 프로그레시브 록 음악을 접하고 받은 음

며 담은 현장의 생생함과, 고전 민속 악기로 연주한 클래식 음

악적 충격이 음악인으로서의 시발점이 됐다고 할 수 있다.

악 등을 통해 완성도 있는 작품으로 기억된다. 그 후 양방언은

이후부터 꾸준히 음악적 소양을 쌓은 그는 1986년부터 하다마

한국의 젊은 연주자들과 새롭고 강력한 웨이브 리듬을 순하게

쇼고와의 활동으로 본격적인 음악인으로서의 삶을 시작한다.

만드는 작업을 통해 국내에서의 인지도를 더 높였다. 동시에 국

나이답지 않은 성숙함과 디테일한 감성 표현으로 그룹에서 가

내에서 대규모 공연과 라이브 공연을 여는 등 우리 매스컴으로

장 나이가 어린데도 프로듀서로 발탁되며 재능을 주목받았다.

부터 집중적인 조명을 받으며 최고의 뉴에이지 아티스트로서의

또 이것은 중화권에서도 활발하게 활동할 수 있는 계기가 되었

이름을 알리기에 이른다.

다. ‘스타 TV’의 메인 프로그램인 〈정무문〉의 음악 담당과 성룡

이렇게 자신의 뿌리를 기본으로 여러 장르의 음악을 시도하는

이 주연한 영화 〈썬더볼트〉 사운드트랙 음악 감독, 중화권에서

양방언은 에세이에서 “음악에는 축이 많다. 수학에서 x축, y축,

큰 인기를 얻은 밴드인 비욘드의 사운드 프로듀서까지. 일련의

z축 하는 것처럼 말이다. 때로는 x축이 라벨이고 y축이 쇼스타

활동은 그의 음악적 재능이 일본을 넘어 아시아 전역으로 영향

코비치기도 하다. 때로는 x축이 바흐, y축이 스티브 라이히가

력을 넓혀간 신호탄이었다.

되기도 하고, x축이 인더스트리얼, y축이 시끄러운 소리, z축이

유명 뮤지션이나 TV 프로그램 등 다양한 음악 작업을 통해 히

일렉트로니카가 되기도 한다”라고 한다. 마치 복잡한 수학 공식

트 제조기로서의 위치를 확고히 할 무렵, 양방언은 프로듀서가

처럼 느껴지기도 한다. 하지만 그가 하고자 하는 말은 x축, y축

아닌 자신의 이름을 내건 아티스트로서의 삶을 원했다. 그리고

에 무엇이든 대입할 수 있다는 것이다. 경계를 아우르는 멀티

그의 영원을 담아 <The Gate of Dreams>를 발표했다.

플레이어 음악가 양방언. 분명 버무림의 미학이 무엇인 줄 아는

이 음반을 통해 그는 프로그레시브 록 느낌의 키보드플레이를

아티스트다.

바탕으로 중국 중앙교향악단과 협연, 거대한 스케일의 곡을 선 보였다. 작품은 그의 실험 정신이 빛을 발한 결과물이었다. 이 렇게 솔로 아티스트로서의 성공적인 활동을 하던 그는 두 번째

059 January 2011


issue Fashion/new

Hail a new collection TOD’S, MOSCHINO and LOUIS VUITTON present 2011 SPRING/SUMMER collections. EDITOR WON JONGMYUNG

COOPERATION TOD’S(540-4723) MOSCHINO(3447-7701) LOUIS VUITTON(3441-6464)

품격 있는 편안함을 만나다, 토즈

모스키노 칩앤시크는 아말피 해변의 레몬,

‘Made in Italy’를 대표하는 글로벌 브랜드,

사르테냐 섬의 산호, 리구리안 강가의

토즈TOD’S의 2011 S/S 프레젠테이션이

꽃에서 모티브를 얻어 화사하고 발랄한

열렸다. 이번 시즌 가장 주목해야 할

컬렉션을 선보였다. 러브 모스키노는

아이템은 셔츠 백. 가벼운 느낌의 실루엣을

다양한 디자인의 젤리 슈즈와 도트 프린트

연출할 수 있는 가방은 스트링 장식의

가방, ‘LOVE’를 장식으로 활용한 제품을

잠금장치 디테일이 멋스럽다. 토즈의 변치

선보였다. 끊임없이 새로워지는 그래픽

않는 스테디셀러 발레리나 슈즈는 새로운

스토리를 보여준 모스키노를 통해 발랄하고

느낌으로 재해석됐다. 특히 이번 컬렉션은

상큼한 기운을 느껴볼 것.

남성을 위한 기능성 제품이 출시되어 큰 주목을 받았는데, 바로 항해를 연상시키는

전 세계 패셔니스타의 영원한 로망,

토트백이 그것. 실용적인 내부 포켓과

루이비통

열쇠나 휴대폰을 매달 수 있는 후크 장식이

세계 패션 트렌드를 이끄는 가장 영향력

돋보이는 가방은 방수가 가능한 소재와

있고 권위 있는 브랜드, 루이비통LOUIS

바닥 부분에 고무를 입힌 패브릭으로

VUITTON의 2011 S/S 프레젠테이션을

구성되어 튼튼하다. 컴페티션, 폴라코,

찾아가보자. 수석 디자이너 마크

데저트 부츠로 대표되는 슈즈 라인은

제이콥스는 이번 컬렉션에서 눈부신 색감,

다양한 컬러와 디자인으로 재탄생했다.

은은한 텍스처, 마음을 사로잡는 우아한 움직임을 담고자 했다. 1970년대 파리와

모스키노만의 DNA, Graphic Energy

상하이 등에서 영향을 받은 이번 컬렉션은

여성스러움과 유머러스함을 동시에 겸비한

전반적으로 오리엔탈리즘이 강세였다. 중국

이탈리아 패션 브랜드,

전통 의상인 치파오를 비롯해 슬림한

모스키노MOSCHINO가 2011 S/S

실루엣의 의상을 화려하고 고급스러운

프레젠테이션을 진행했다. ‘모스키노’,

소재와 컬러로 풀어냈다. 마치 한 폭의

‘모스키노 칩앤시크’, ‘러브 모스키노’ 3개의

동양화를 보는 듯한 패턴은 오리엔탈리즘에

라인은 각기 다른 콘셉트로 독특한 개성을

대한 충분한 해석이 이루어졌음을 증명한

보였다. 모스키노는 ‘그래픽 에너지Graphic

것. 의상과 완벽하게 어울리는 클러치백과

Energy’란 주제 아래 다양한 컬러와 패턴을

작은 숄더백은 다가오는 봄을 위한 위시

통해 활기찬 에너지를 선사했다.

리스트의 No.1을 차지할 것이다.

060 Noblian


issue Car/new

That car is coming, finally! The year 2011 is a time for worldwide luxury brands to present new cars to drive car maniacs into frenzy. EDITOR WON JONGMYUNG

COOPERATION BENTLEY(3448-2700) Audi Korea(6009-0000) Mercedes-Benz Korea(6456-2504)

최고급 세단의 대명사, 벤틀리 컨티넨탈

진보 정신을 그대로 보여주었다. 이번

플라잉스퍼 시리즈 51

모델은 탁월한 풀타임 사륜구동 콰트로가

벤틀리 모터스 코리아는 국내 최고 인기

적용되었으며, 주로 고성능 스포츠카에만

모델인 컨티넨탈 플라잉 스퍼 세단

제공되는 비스커스 커플링 방식으로 정지

라인업의 내・외부를 더욱 럭셔리하게

마찰, 안정성, 코너링 속도와 정밀함을 주고

업그레이드한 ‘컨티넨탈 플라잉 스퍼

더욱 안정적으로 다이내믹한 주행을 즐길

시리즈 51’을 새롭게 선보였다. 이번 모델은

수 있게 해준다. 스포츠카의 탁월한 성능을

벤틀리 전담 컬러 및 트림 전문가가

품은 럭셔리 스포츠카 ‘뉴 아우디 R8

추천하는 스페셜 디자인 중 고객이 원하는

스파이더’를 주목하자.

옵션을 선택하는 방식으로 제공된다. 시리즈 51의 디자인 패키지는 외관에 전용

우아한 모습으로 돌아온 럭셔리 쿠페,

19인치 휠과 새로워진 펜더 에어홀을

메르세데스-벤츠 더 뉴 제너레이션

적용하고, 내부의 베니어 목재와 고급 가죽

CL 63 AMG

소재 등 3가지 색상 제공과 새

메르세데스-벤츠 코리아는 신형 직분사

인포테인먼트 시스템이 장착됐다. 독보적인

엔진을 장착하고 외관을 개선한 ‘더 뉴

컬러와 트림을 적용할 수 있는 ‘컨티넨탈

제너레이션 CL 63 AMG’를 출시했다. 벤츠

플라잉 스퍼 시리즈 51’를 눈여겨보기

S클래스의 쿠페형 모델이라 할 수 있는

바란다.

이번 모델은 기존 CL 63 AMG에 최근 새로 개발한 AMG 5.5L V8 바이 터보 엔진과 7단

하이 퍼포먼스 오픈탑 스포츠카, 뉴 아우디

멀티 클러치를 탑재, 최고출력을 높였고

R8 스파이더

연비도 향상시켰다. 특히, 연료 효율을 위한

영화 <아이언맨2>에서 주인공 토니

스타트・스탑 시스템을 결합해

스타크의 새로운 애마로 등장해 전 세계

메르세데스-AMG 브랜드 가치의

자동차 마니아의 이목을 사로잡았던

핵심이라고 할 수 있는 파워풀한 성능과

‘뉴 아우디 R8 스파이더’가 우리나라에

함께 연료 효율성과 배기가스 저감을

선보였다. 뉴 아우디 R8 스파이더는 R8의

동시에 실현했다. 더욱 당당해진 위용, 한층

오픈탑 버전으로 2009 프랑크푸르트

더 강렬해진 스포티함과 스타일리시한

모터쇼에서 ‘가장 아름다운 컨버터블’로

디자인이 돋보이는 ‘더 뉴 제너레이션 CL

선정되며 아우디 브랜드의 앞선 기술과

63 AMG’를 만나보자.

072 Noblian


25 truths of Mona Lisa

EDITOR JUNG JALIM COOPERATION MAST MEDIA(541-3174)

다빈치의 진실 레오나르도 다빈치는 화가일까? 발명가일까? 아니면 과학자나 해부학자일까? 당신 이 알고 있던 다빈치의 진짜 모습을 알고 싶다면 현재 화제의 중심에 있는 〈세상을 바꾼 천재, 다빈치 展〉을 주목할 만하다. 다빈치의 다양한 분야의 업적 덕분에 ‘모나리자’를 그린 화가에서 비행기를 처음 만 든 비행가, 동맥 경화를 처음 발견한 해부학자, 밀레니엄 최고의 발명품인 원근법을 최초로 발명한 예술가, 캐리커처를 처음 그린 화가 등 500년 전 다빈치의 엄청나고 방대한 업적에 관객들의 놀라운 반응이 줄을 잇는다. 모나리자를 그리며 산업 기계와 병기를 제작하고 밀라노 궁정 연희와 축제 연출에 더 많은 노력과 시간을 쏟았다는 잘 알려지지 않은 사실, ‘최후의 만찬’을 그리면서 최초의 자동차를 설계하고 새의 비행을 관찰하면서 비행기를 제작했으며, 자전거, 낫 전차, 휴대용 교량 등 기상천외한 발명품들이 그의 머리에서 탄생한 사실, 미 국무성 펜타곤이 다빈치의 설계 도면을 바탕으로 해서 지어진 것 모두 그의 천재성을 입증 하는 작은 예에 지나지 않는다. 전시는 천재 다빈치의 이 모든 것을 증명하고 있으며, 특히 어린 시절 사생아로 태 어나 제대로 된 정식 교육조차 받지 못한 채 왕성한 호기심으로 자연과 과학을 연결 해 전 분야를 연결한 그의 천재성에 경의를 표하고 있다. 남녀노소, 세대를 넘어선 관람 열기 지난 2009년 9월 28일부터 오는 2011년 2월 27일까지 용산 전쟁기념관 기획전시실 에서 열리고 있는 이 전시는 다빈치의 다양한 직업에 따른 업적이 11개 섹션으로 나 누어져 있다. 화가, 발명가, 해부학자, 건축가, 과학자, 음악가, 기술자 등으로 활동한 다빈치의 발명품 등을 감상하고, BBC 다큐멘터리 〈모든 것을 알고 싶어 했던 사나 이〉까지 관람하면 평균 관람 시간은 3시간 정도 소요된다. 현장을 찾은 관람객들은 방대하고 깊이감 있는 전시에 만족감을 표하고 있다. 어린이와 학생은 전시장 1층에 자리 잡은 다빈치의 발명품에, 어른은 다빈치가 남긴‘르네상스 그림’, 실물 크기의 ‘최후의 만찬’을 흥미롭게 관람한다. 특히 연인들의 관람이 줄을 잇고 있는데, 원작이 있는 루브르에서는 결코 볼 수 없는 ‘모나리자’의 뒷면이나 25가지 비밀에 관한 과학 적인 분석과 자료가 관람객들의 호기심을 자극하고 있다.

information Art Science gave a key to secrets of art. Pascal Cotte, a French scientist, invented a camera with 240 million pixels, and pictured Mona Lisa of the Louvre, and its surprising discoveries are brought to Korea in a form of an exhibition.


Endless quest of PIAGET

EDITOR WON JONGMYUNG COOPERATION PIAGET BOUTIQUE(3467-8924)

피아제는 피아제의 DNA를 완벽히 반영해낸 또 하나의 독보적인 울트라 씬 시계, 엠 퍼라도 쿠썽 뚜르비옹 오토매틱 울트라 씬(Emperador Coussin Tourbillon Automatic Ultra-Thin)을 공개했다. 피아제는 전체 두께가 단 10.4mm에 불과한 오토 매틱 뚜르비옹 시계를 탄생시킴으로써 전세계에서 가장 얇은 셀프 와인딩 뚜르비옹 시계라는 새로운 기록을 세운 것이다. 세상에서 가장 얇은 시계, 엠퍼라도 쿠썽 뚜르비옹 오토매틱 울트라 씬 끊임없이 혁신적이고 창의적인 컴플리케이션 칼리버 개발을 위한 피아제의 행보는 계속되었다. 피아제가 자체 제작한 세계에서 가장 얇은 핸드 와인딩 뚜르비옹 무브 먼트 칼리버 600P와 마이크로 로터를 장착한 세계에서 가장 얇은 셀프 와인딩 무브 먼트 칼리버 1208P의 대를 잇는 칼리버 1270P는 피아제 최초의 울트라 씬 셀프 와 인딩 뚜르비옹 무브먼트로 두께가 단 5.35mm에 불과하다. 칼리버 1270P는 기술적 으로나 미학적으로 모두 혁신적인 시도가 이뤄졌다. 엠퍼라도 컬렉션에서 새롭게 선보인 이 타임피스는 강렬한 디자인과 단연 아방가르 드한 특성을 내보이며 블랙 타이(Black Tie) 컬렉션의 아이코닉한 라인인 엠퍼라도 쿠썽에 정점을 찍었다. 기존에 확립된 최상급 워치메이킹 코드를 명백히 뒤집은 이 시계는 레이저 인그레이빙한 사파이어 크리스탈을 다이얼에 적용해 다이얼 너머로 수공으로 조립한 오토매틱 와인딩 무브먼트의 가장 매혹적인 부품의 모습을 드러낸 다. 이러한 다이얼 표현을 통해 골드 소재 오프셋 마이크로 로터(offset micro-rotor) 의 전 모습을 자유롭게 감상할 수 있으며, 역시 오프 센터 장착된 시선을 사로잡는 피아제 고유의 뚜르비옹 캐리지와 로터의 프레임이 맞물려 최고의 행운의 숫자인 8 의 형태를 그려낸다. 그리고 시침과 분침 또한 중심이 아닌 5시 방향에 세팅되었다. 사파이어 크리스탈을 통해 드러나는 무브먼트의 섬세한 마감 역시 돋보인다. 이 시 계는 블랙 타이 컬렉션이 갖춘 본질적인 디자인 코드를 우아하면서도 컨템포러리한 방식으로 살려냈다. 다이얼 위에 가한 레이저 기요셰 작업, 오프 센터 핸즈를 향해 점차 가늘어지는 형태의 아워 마커, 그리고 림(rim, 테두리) 장식으로 아름답게 강조 한 로터와 뚜르비옹 디스플레이는 시계에 극도로 현대적인 아름다움을 더한다. 전체 적으로 매우 모던한 분위기를 지닌 이 시계에 마이크로 로터에 적용된 기요셰 처리 와 전통적인 오뜨 올로제리 마감 기법이 더해져 전통과 현대의 균형을 이뤄낸다.

information Jewelry PIAGET Korea had the first official press presentation of Pre-SIHH in Korea, in celebration of the new and revolutionary Automatic Tourbillon Movement, a new invention of Manufacture de Haute Horlogerie Piaget.


Inner Beauty for Woman

information Health A woman can be perfectly beautiful only when she seeks for inner beauty. RIZ laser center knows this need and offers an invitation to a true inner beauty.

352),/(

EDITOR KIM HYEYOON

산부인과 전문의 의학박사 이형근 원장은 리즈산부인과 네트워크 대표원장으로 여성들에게 진정한 이너뷰티의 방법을 소개한다

소중한 사람에게 매력적인 모습으로! 레이저 여성성형 딱히 어느 분야라고 할 것도 없이 대부분의 분야에서 맹활약을 하며 앞서가는 여성 들이 많아졌다. 性에 대한 자세 역시 능동적으로 변해 성적인 트러블이 있을 때에는 여성이 먼저 적극적으로 대처한다. 이러한 트렌드를 반영하듯 산부인과의 여성 성형 수술을 선택하는 여성들이 부쩍 늘었다. 리즈산부인과의원에서 레이저 질 성형&레 이저 여성성형수술로 소중한 사람에게 더욱 매력적인 모습으로 다가설 수 있기 때문 이다. 레이저 질 성형 별다른 이유 없이 여성으로서의 자신감을 잃게 된다면, 그동안 임신, 출산, 유산, 잦 은 성관계 그리고 노화 등의 이유로 섬세하면서도 은밀한 신체 부분인 질 구조에 변 화가 있는 것은 아닌지 한번쯤 체크해 보는 것이 좋다. 性에 있어 중요한 부위인 여

수준 높은 의료서비스

성의 질은 위의 요인들로 인해 이완되기 쉽기 때문이다. 이 경우 ‘레이저 질 성형’이

적극적인 노력으로 자신의 불만을 해소하려는 여성들이 많아지면서 산부인과의 여

효과적인 해결책이 될 수 있다. 레이저 질 성형은 질의 이완 등을 교정하는 것으로

성성형에 대한 관심이 부쩍 커졌다. 또 그만큼 지금은 여성성형 수술을 시술하는 병

다시 질의 구조를 타이트하게 만들어주는 수술이기 때문이다.

원도 늘어났다. 리즈산부인과의원은 2001년부터 이미 레이저 질 성형, 레이저 소음 순 성형에 매진해와 지금까지 수많은 수술케이스를 통해 한층 안정적이고 만족스러

레이저 소음순 성형

운 수술기법을 제공하고 있다. 또 리즈산부인과의원은 상담에서 수술, 수술 후 관리

얼굴성형을 통해 여성으로서의 아름다움을 완성했다는 생각은 금물! 속까지 예쁜 여

에 이르기까지 철저하게 환자 위주의 시스템으로 운영되며, 수준 높은 의료서비스를

성들에게는 남다른 비밀이 있다. 최근에 얼굴이나 팔, 다리처럼 드러나는 부위는 아

제공하고 있다. 특히 예약된 환자만을 위한 시스템에서 수술하는 만큼 다른 환자의

니지만 질 입구를 감싸고 있는 소음순의 비대칭, 비대, 변형 등으로 말 못할 고민을

진료시간에 쫓기지 않고 시술에 매진할 수 있는 안정적인 시술환경을 자랑한다. 따

호소하는 여성들이 많다. 이런 경우 스스로 불만스러운 부분을 ‘레이저 소음순 성형’

라서 충분한 시간을 가지고 세심하게 시술을 할 수 있어서 환자들의 만족도가 높다.

을 통해 정교하게 절개하면 미(美)적인 부분까지 모두 만족시킬 수 있다. 리즈의 소

레이저질성형과 레이저소음순성형은 환자에 따라 수술 후 드물게 염증반응, 성교통

음순 성형은 많은 여성들이 비대칭이거나 지나치게 커서 고민하는 소음순 뿐만 아니

등의 현상이 나타날 수도 있으므로 사전 정확한 진단과 경험이 풍부한 산부인과전문

라 대음순, 회음부, 질입구, 처녀막 등을 아름다운 모양으로 디자인하여 바꾸어 주는

의에게 시술 받는 것이 중요하다.

수술이다. 단순히 잘라내고 봉합하는 수준의 시술이 아니라, 레이저를 이용해 비대해 진 부위는 아름답게 깎아내고 변형된 부위는 자연스러우면서도 원래의 모양에 가깝

문의 이형근 원장 (리즈산부인과의원 청담점 02-540-8811, www.womanlaser.com)

게 정밀한 수술을 통해 복원해주는 방법이다.

| 대한의사협회 의료광고 심의필 제100125-중-16557호 |


It’s my MASERATI style

EDITOR WON JONGMYUNG

PHOTOGRAPHER KIM JAESEOL, DANIEL COOPERATION FORZA MOTORS KOREA(3433-0888)

지난달 8일, 신사동 마세라티 공식 전시장에서는 특별한 고객 행사가 열렸다. 바로 고객을 위해 마세라티가 준비한 ‘Beautiful Mind, Beautiful Life! 마세라티와 이유정 ´er가 함께하는 ‘Beautiful Day’. 이유정 크레의 스타일 클래스로 진행된 이번 크레Cre

행사는 천편일률적인 유행과 트렌드 속에서 나만이 갖고 있는 아름다움을 찾아 내 스타일로 완성하는 것을 주제로 진행되었다. 비교할 수 없는 존재감을 가진 스타일로 말하자면, 럭셔리 세단 브랜드 마세라티를 빼놓을 수 없다. 이탈리아 대통령의 공식 의전 차량으로도 선택된 마세라티는, 현재 도 모든 차량을 수작업으로 생산하는 철저한 맞춤 주문 방식을 기본으로 나만의 스 타일을 추구하는 감각 있는 드라이버들의 아이콘으로 인정받고 있다. 차량의 대시보 드 및 핸들 색상뿐 아니라 바느질용 실의 굵기와 색, 시트의 바느질 마감 방식까지 고객의 주문에 맞춰 세상에서 단 하나밖에 없는 마스터피스를 고집하기 때문에 이 세상 누구와도 공유하지 않는 나만의 스타일을 자동차에서 고스란히 완성할 수 있는 브랜드다. 이날 열린 뷰티&스타일링 세션에서는 메이크업 아티스트 이유정이 마세라티 전시 장을 찾은 고객을 대상으로 고객 한 사람 한 사람만의 특징과 아름다움을 찾아내 메 이크업부터 의상까지 총체적인 스타일링을 제시했다. 그뿐만 아니라 마세라티의 대 표적인 두 차량으로 전시된 콰트로포르테Quattroporte와 그란투리스모Gran Turismo 를 배경으로 미니 패션쇼도 진행되어 ‘열정이 빚어낸 탁월함Excellence Through Passion’이라는 마세라티의 지향점과 완벽하게 어울리는 이미지를 연출했다. 탁월함 Excellence을 상징하는 콰트로포르테는 흰색 외장에 와인색 내장을 갖춰 와인 계열 원피스와 함께 퍼 의상을 입은 모델과 조화를 이루며, 우아하고 럭셔리한 데이 드라 이빙을 선호하는 참가자들의 라이프스타일을 표현했다. 또 열정Passion을 상징하는 그란투리스모는 군청색 외장에 베이지 컬러의 내장을 갖춰 다크 블루의 퍼 의상을 입은 모델과 어울리며 여가 시간에 더욱 짜릿하고 다이내믹한 드라이빙을 선호하는 참가자들의 라이프스타일을 드러냈다. 다른 사람과 다른 나를 표현하고 싶지만 가끔은 용기가 없어 머뭇거리거나 주저할 때도 있다. 하지만 이날 마세라티가 준비한 행사는 “당신만이 갖고 있는 아름다움, 그것이 바로 다른 누구도 갖고 있지 않은 당신만의 스타일이다”라며, 문화적 코드 안 에서 쇼핑의 궁극적 아이콘=차=마세라티라는 강한 메시지를 남겼다.

information Lifestyle Maserati’s “Beautiful Mind, Beautiful Life Beautiful Day with Maserati and Lee Youjung Créer” brought the audience to a style class that goes one step further in style, to make your own beauty.






issue Trend Fashion

Spring Preview Tis the season to start this New Year with a whole new style. Pay your attention to these 8 trends from the S/S collection.

EDITOR AIDEN

 V6W\OH<6/0DUF-DFREV

 :RUOG:LGH3DQWV&(/,1( 'ULHV9DQ1RWHQ

 0LQLPDO0DQLD&(/,1( $.5,6

 )DU(DVW0RYHPHQW +DLGHU$FNHUPDQQ &$52/,1$+(55(5$










70s

팬츠를 잊게 하기에 충분했다. 게다가 지난 몇 년간 지겹게도 여성들은 스키니

디자이너들이 한창 올봄 컬렉션을 위한 준비를 시작할 때인 지난해 초, 파리의 프티

팬츠만 고집하고 있었다. 덕분에 중간 중간 등장한 하렘 팬츠, 페그드 팬츠, 배기

팔레에서는 대대적인 이브 생 로랑의 회고전이 열렸다. 그 누구보다 여성미를

팬츠 등은 그 기세를 펴지도 못하고 조용히 트렌드의 뒤안길로 사라져버렸다. 하지만

찬양했던 이브 생 로랑의 대표적인 작품들을 모조리 만날 수 있었던 전시회는

이번 봄 팬츠가 돌아왔다. 어쩌면 눈치 빠른 멋쟁이들은 이미 그 사실을 간파했을지

패션계에서 일하는 이라면 누구나 한 번은 구경해야 할 필수 코스로 등극했다.

모른다. 요즘 여성들의 옷 입기 비법을 전수하는 스승인 셀린의 피비 파일로가

그리고 지난가을 세계 4대 도시 컬렉션의 런웨이에서 유난히 70년대풍 이브 생 로랑

완벽한 팬츠 5종류만 모은 캡슐 컬렉션을 선보인 것. 그 매력적인 팬츠들 중에서도

스타일이 자주 등장한 것은 단순한 우연일까? 대담한 컬러, 여성스럽게 느껴지는

꼭 하나만 골라달라고? 무조건 통이 넓은 와이드 팬츠를 선택하라. 셀린부터 드리스

길고 가느다란 스타일, 이국적인 향취가 풍겨 나오는 리조트 의상들 모두 이브 생

반 노튼, 디올, 데렉 램 등 시원시원한 라인을 자랑하는 와이드 팬츠가 대세로

로랑의 전성기 컬렉션을 그대로 닮았다. 대표적인 디자이너는 당장이라도 기 보댕의

떠올랐기 때문. 또 하나의 공통점이라면 모두 하이웨이스트, 즉 높은 허리선을

사진에서 걸어 나온 듯한 여성상을 완성한 마크 제이콥스, 이브 생 로랑의 이름 아래

자랑한다는 것. 조금이라도 더 다리를 길어 보이게 하고 싶다면? 이번 시즌의 슈즈가

21세기에 어울리는 파리지엔 시크를 선보인 YSL의 스테파노 필라티, 대담한 컬러로

될 높은 플랫폼 힐을 그 바지 밑에 매치하는 것!

70년대를 재해석한 구찌의 프리다 지아니니가 될 것. 적당한 스타일링 비법을 찾고 있다면 이 세 디자이너들의 컬렉션 속 대담한 컬러 매치와 여성스러운 실루엣을

Minimal Mania

자세히 살펴보길.

지난해 셀린의 피비 파일로가 몰고 온 ‘스타일 폭풍’은 그야말로 대단했다. 한동안 여성들의 옷장 속을 가득 채우고 있던 지나친 장식의 스타일과 귀엽고 깜찍한

World Wide Pants

스타일의 옷들은 파일로의 힘찬 ‘미니멀 빗질’에 순식간에 구석으로 쫓겨났다.

한동안 여성들은 ‘팬츠’를 외면하고 있었다. 수많은 미니스커트 드레스들의 유행은

파일로가 제안한 화이트 셔츠와 네이비 팬츠의 단순한 멋은 패션 열차의 목적지를










단번에 ‘맥시멀리즘’에서 ‘클리니즘’으로 바꿔버렸을 정도. 이번 봄에도 그 청결한 맛의

수 있었으니 말이다. 우리 것이 최고라는 신토불이 정신이 파란 눈의

멋은 이어진다. 화이트 컬러의 오버사이즈 스타일 팬츠와 롱 셔츠에 익숙해 보인다면,

디자이너에게까지 전해진 건 아닐까?

적당한 컬러가 가미된 그래픽한 팬츠와 블라우스는 어떤가? 봄에 걸맞은 화사한 기분을 선사하는 데 한몫할 것이다. 빅터 앤 롤프, 아크리스, 막스 마라 등도 이러한 세련된

Print Play

그래픽적인 미니멀리즘의 옷을 찾기엔 좋은 목적지가 될 것.

봄은 언제나 프린트의 계절이었다. 세상의 모든 것이 만개하는 계절에는 화사한 작약이나 붓꽃 프린트가 입고 싶게 마련이니 말이다. 이번 봄 그 프린트는 좀 더

Far East Movement

대담해졌다. 패션계의 지팡이 역할을 스스로 즐기는 미우치아 프라다 여사는

파리의 새로운 메이저 디자이너로 떠오른 하이더 아커만의 쇼를 지켜보던 관객들은

바나나와 접시 속 문양 등을 확대하고 확대해 스커트와 톱, 드레스에 마구 프린트

이렇게 속삭였다. “이건 일본 스타일이야? 중국 스타일이야? 아니면 한국 스타일이야?”

버튼을 눌렀다. 그 효과는 당당하고 신선한 시각적 충격 그 자체. 반면 도나텔라

그 의문은 하이더 아커만 쇼 속에 등장한 묶음 장식(태권도나 유도 도복에서 본

베르사체는 그래픽 놀이에 푹 빠졌다. 베르사체 특유의 격자무늬 로고를 컬러복사기

듯한)이나 시선을 모으는 청명한 블루와 레드 등의 컬러 등 동양의 미를 떠올리게

위에 올려놓고 마구잡이로 복사한 듯한 문양이 드레스와 스커트 위에 등장했다. 물론

했으니 정당했다. 지난 몇 십 년간 패션계가 아시아에 주목할 때 그 목적지는 주로

좀 더 전통적인 봄날의 프린트도 등장했다. 새로운 로맨티스트인 런던의 어덤,

인도나 몽골 등의 이국적인 지방을 고집했다. 물론 중국의 청삼 드레스와 일본의

동양화가의 수채화를 보는 듯한 드리스 반 노튼은 여성적이고 여린 꽃무늬로 시선을

기모노가 그 영향권에 든 적은 있지만 말이다. 그리고 이번엔 한국도 그 영향권 속에

빼앗았다. 자, 당신의 선택은 어디로 향하겠는가? 과감하고 선명한 그래픽적인

당당히 한 자리를 차지했다. 노골적으로 한복과 조선 시대의 갓에서 영감을 가져온

프린트? 아니면 지극히 로맨틱한 플라워 프린트? 사실 둘 중 어느 것도 좋지만

캐롤리나 레라, 과장된 엠파이어 라인이 꼭 한복의 가슴선을 떠올리게 한 릭 오웬스,

말이다.

태극 문양을 쇼 곳곳에 사용한 비비안 웨스트우드까지. 어디나 한복의 모티브를 발견할

 3ULQW3OD\35$'$9(56$&(

 6WHHOWKH6QDNH -26(3+$/78=$55$ -RKQ*DOOLDQR

 'DQFHU'D\V&KORp 2VFDUGHOD5HQWD

 1HR1HRQ/$19,1 &KULVWRSKHU.$1(










Steal the Snake

옷차림에 영향을 줄 것이다. 잠시 70년대풍의 케이프를 벗어 던진 클로에의 한나

어느 정도 봄날의 멋을 마음껏 즐길 준비가 끝난다면 슬슬 뜨거운 태양이 내려쬐는

맥기본도 동의한다. 그녀의 컬렉션에는 방금이라도 리허설 무대를 마치고 백

여름날을 준비할 때가 온다. 그때가 되면 여성들의 눈길은 아주 이국적이고, 아주

스테이지로 걸어 들어온 우아한 발레리나로 가득했으니깐. 하늘거리는 플리츠스커트,

섹시한 무늬로 향할 것이다. 요즘 최고의 전성기를 누리고 있는 레오퍼드냐고?

발을 우아하게 감싸는 발레 슈즈, 상체의 라인을 그대로 드러내는 저지 톱까지 온통

천만에, 레오퍼드는 여름에 입기엔 너무 뜨겁다. 뱀피 프린트로 완벽하고 현대적인

발레에서 영향을 받은 스타일뿐이다. 만약 당장 〈지젤〉의 주인공처럼 길거리를

스타일을 완성한 뉴욕의 신성, 조셉 알투자라의 컬렉션을 살펴보라. 몸에 ‘착~’ 하고

거닐기 부담스럽다면, 천천히 레페토의 발레 플랫을 꺼내 신는 것부터 트렌드에

달라붙은 하얀색 시스 드레스 곳곳에 양념처럼 들어간 뱀피 프린트는 얼마나 모던해

도전해도 좋다.

보이는가. 환상적인 패션 세계 속에 사는 디자이너, 존 갈리아노의 뱀피 오버 코트는 오히려 화려한 시폰 드레스 물결 사이에서 현실적으로 보일 정도였다. 용감한

Neo Neon

멋쟁이들이라면 올여름 뱀피에 다시 한 번 시선을 빼앗기게 될 것.

‘짜릿한 컬러의 충격’은 이번 봄을 정의하는 캐치프레이즈가 될 것이다. 세상의 모든 색상이 지난 9월과 10월, 올봄을 위한 패션쇼 런웨이 위에서 살아 움직였으니

Dancer Days

말이다. 그중에서도 새롭게 우리의 시선을 자극한 컬러는 다름 아닌 네온 컬러.

올 2월 오스카 시상식에서는 어떤 영화가 가장 화제가 될까. 지금까지의 상황이라면,

하지만 네온 컬러라고 해서 80년대 롤라장에서 만날 수 있었던 화려하기만 한

나탈리 포트만이 주연을 맡은 <블랙 스완(Black Swan)>이 그 주인공이 될 듯하다.

‘형광색’을 연상하진 말 것. 이번 네온 컬러는 훨씬 여성스러워졌다. 플리츠 소재를

천재적인 무용수들의 암투를 담은 이 서스펜스는 완벽한 드라마와 안무만큼이나

만나 더욱 빛난 알버 엘바즈의 랑방, 새로운 고상한 숙녀복을 정의한 뉴욕의 스타,

스타일이 화제다. 나탈리 포트만의 ‘절친’인 로다테의 멀리비 자매가 손수 극중

프로엔자슐러부터 레이스와 네온 컬러를 접목하는 신선한 패션 실험에 성공한

발레복을 디자인한 것. 이 아름다운 투투는 또 다른 방식으로 봄날 여성들의

런던의 천재, 크리스토퍼 케인까지 그 증거는 다양하다. n






issue Trend Beauty/new

Spring Breeze So it’s January on your calendar, but not in beauty world, as we hear songs of spring already. Be the first one to learn what’s hot in the 2011 Spring look.

EDITOR PARK SUMIN










불어라 봄바람! 추워도 너무 추운 이 엄동설한에 무슨 소리냐고 묻는다면, 에디터는

Butterfly’. 자유롭고 순수한 여성의 상징인 나비와 개성 있는 스타일을 완성하는

2011 스프링 메이크업 컬렉션 아이템을 한바탕 풀어놓을 참이다. 그 어느 때보다

나비넥타이가 라벤더 톤 치크 위에 사뿐히 내려앉았다.

화사하고 아름다운 봄 컬렉션을 기다리는 마음. ‘버선발로 마중’이라도 나갈 뷰티 얼리어댑터들의 기대감 때문인지 각 뷰티 브랜드에서는 속속들이 봄 컬렉션을

그대 안의 블루

내놓았다. 라벤더에서 블루, 핑크로 이어지는 2011 스프링 컬렉션의 컬러 판타지를

사하라 사막 위의 유목민, 투아레그족 여성의 오묘한 매력에 빠져든다. 조르지오

만나보자. 뷰티 월드의 달달한 봄노래가 마음속에 울려 퍼지고 있으니.

아르마니는 투아레그족의 에스닉한 컬러인 블루에서 영감을 받았다. 2011 스프링 컬렉션, ‘라팜므 블루La Femme Bleue’가 그것. 물론, 조르지오 아르마니 특유의

그대 모습은 보랏빛처럼

도시적인 색채를 빼놓을 순 없는 법. 메건 폭스를 앞세운 아르마니식의 ‘어반 시크

얄밉도록 섹시하고 신비하다. 카린 로이펠드의 딸이자 세계적인 패셔니스타의

룩’으로 탄생한 컬렉션은 빼어나다. 특유의 비밀스럽고도 매력적인 분위기 때문인지

자리를 꿰찬 줄리아 레스토앵 로이펠드가 랑콤의 컬러로 곱게 차려입은 모습이다.

표현도 시적으로 해야 할 듯하다. ‘태양 아래 모래알처럼 반짝이는 피부 위, 그리고

랑콤의 크리에이티브 디렉터 아론 드 메이는 봄의 컬러로 라벤더를 점찍었다. 그리고

고요한 달빛이 깃든 사막의 밤 같은 깊고 푸른 눈매’면 적당하지 않을까 싶다.

새로운 뮤즈의 얼굴을 온통 보랏빛으로 물들여놨다. 랑콤이 전개하는 2011 스프링

조르지오 아르마니의 로고를 새긴 블랙 케이스 안에 자리한 리미티드 아이섀도는

컬렉션의 이름은 ‘울트라 라벤더Ultra Lanevde’. 1970년대를 가장 잘 대변하는

이번 룩의 시그너처 아이템. 제이드 그린, 파르마 바이올렛, 실버 그레이, 차콜

2가지의 상징을 강렬한 라벤더 컬러로 펼쳐낸 그의 기민함은 역시 기대를 저버리지

그레이로 조합된 컬러는 미묘한 푸른 톤의 눈매를 완성한다. 단, 그윽한 눈매와

않는다. 자연을 존중하는 ‘에코프렌들리Ecofriendly’ 사상은 100% 천연 성분으로,

완벽한 대비를 이루는 펄리 핑크 립 컬러는 절대 빼놓지 말 것.

그리고 열풍을 넘어 광풍이 몰아친 ‘디스코Disco’ 정신은 화려한 컬러감으로 컬렉션에 녹아 있다. 특히 손꼽을 만한 아이템은 ‘라 로즈 버터플라이La Rose



이번엔 한창 주가를 올리고 있는 ‘차가운 도시 여자’다. 아니, 푸른빛 도시의 여자다. 중성적인 매력의 모델 아이리스 스트루베거의 무심한 듯 시크한 모습은 봄을 위한








프랑수아 나스의 선택이다. 나스는 올봄을 위해 진보적이고 모던한 블루 아이

청순함을 앞세워 2011 스프링 컬렉션을 전개한다. 풍부한 발색과 부드러운 텍스처,

메이크업에 한 표를 던졌다. 랭보의 저명한 시의 제목을 딴 ‘바토 이브르Bateau Ivre’

여기에 더해진 최상의 스킨케어 성분이 돋보이는 ‘루쥬 아 레브르’. 특히 아만다

아이섀도는 그 문학적인 이름만큼이나 리치한 스카이블루와 짙은 데님 컬러가 꽤

사이프리드가 바른 T7 핑크 컬러는 한층 세련되고 차분한 느낌이다. 완벽하게 정돈된

드라마틱하다. 나스에서 제안하는 봄빛 아이 메이크업을 통해 모던하면서도 시크한

피부 톤, 소프트한 컬러감 위에 잔잔하게 빛나는 분홍 립 컬러를 원하는 여성에게

스프링 룩의 정수를 경험해보자.

워너비 룩이 되어줄 수 있겠다.

분홍의 립스틱을 바르겠어요

샤넬이 사랑해 마지않던 진주를 그대로 메이크업에 흩뿌려놨다. 샤넬의 글로벌

꽃피는 봄이 오면 단연 핑크다. 특히 이번 2011년 스프링 컬렉션의 주인공은 ‘푸시아

크리에이티브 디렉터 피터 필립스는 진주 그 자체로 여성의 얼굴에 빛을 밝히고자

핑크’. 참 곱디고운 분홍빛이 여성의 얼굴을 꽃피울 예정이다. 요정 같은 뮤즈

한다. 심플하면서도 고급스러운, 단아하면서도 섹시한 매력의 진주가 메이크업에

나탈리아 보디아노바는 겔랑의 푸시아 핑크 컬러에 물들어 황홀한 매력을 어필한다.

들어오니 이렇게 화사할 수 없다. 아이섀도 ‘옹브르 뻬를르 드 샤넬’의 날카로운

겔랑의 클래식하면서도 도발적인 푸시아 핑크는 크리에이티브 디렉터인 올리비에

직사각형 블랙 케이스는 열자마자 부드럽고 은은한 진주의 속살을 살포시 내민다.

에쇼드메종의 작품. 생동감이 살아 있는 겔랑의 푸시아 핑크는 이번 스프링 시즌을

리치한 크림 텍스처의 5가지 펄 아이섀도 컬러는 화이트・로즈・바이올렛・그린・

위한 리미티드 에디션이라니 더욱 솔깃하다. 강렬한 핑크 아이 메이크업이

블랙 톤. 본연의 컬러는 진주를 입어 한층 우아하게 변신했다. 장밋빛 레드와 에너지

망설여진다면 에끄레 6 꿀뢰르의 팔레트를 훔쳐보자. 부드러운 누드, 섬세한 골드, 펄

넘치는 핑크 컬러의 ‘루쥬 알뤼르’, 또는 소프트한 핑크와 코랄빛 ‘루쥬 코코’는

아이보리와 어우러진 푸시아 핑크 컬러 섀도의 조화는 이번 봄 메이크업을 위한

분홍색 입술의 아름다움으로 충만하다.

지극히 여성스러운 룩은 스프링 시즌의 특권이다. 여성의 로망 샤넬은 마드무아젤

훌륭한 지침서가 되어줄 듯.

여기 또 하나의 봄 처녀가 오셨다. 봄 컬렉션의 정석을 보여주는 듯, 소프트한

꽃봉오리가 톡 터질 듯 청초한 입술. 끌레드뽀 보떼는 아만다 사이프리드의



핑크빛 매력을 발산하는 코스메 데코르테의 2011 스프링 메이크업 컬렉션. 이












엘레강스한 핑크빛 메이크업 룩의 비밀은 코스메 데코르테의 장기인 ‘금 콜로이드

/$1&Ñ0(

FOHGHSHDXEHDXWH

파우더’ 덕분. 모든 메이크업 컬렉션에 금빛 파우더를 넣어 반짝임을 배가했다.





*,25*,2$50$1,

&+$1(/





1$56

&260('(&257(





*8(5/$,1

',25

코스메 데코르테식 메이크업 룩이 탐난다면 2가지만 명심하자. 우선, AQ 메이크업 룩의 ‘AQ섀도우슈프림’의 샴페인 골드 컬러로 고급스러우면서도 화사한 눈매를 만들 것. 그리고 핑크 베이스에 따스함이 느껴지는 복숭아 컬러를 더한 ‘AQ루즈슈프림’ 립 컬러로 봄 메이크업의 정점을 찍는다. 에센스를 함유한 립스틱은 물을 머금은 듯 탐스러운 입술을 만들기에 충분히 촉촉하다. 핑크와 세련되게 매치할 수 있는 최상의 컬러는? 디올 하우스가 명료한 답을 내려줄 수 있겠다. 디올의 2011 스프링 컬렉션은 ‘그레이 몽테뉴Gris Montaigne’. 하우스가 갖고 있는 고유의 이미지를 매번 새롭게 재해석하는 영민함에 박수를 보낸다. 특유의 카나주 패턴은 블랙 페이턴트 케이스에 자리했고, 메탈릭한 그레이 아이섀도 위에 역시 새겨져 있다. 섀도는 밝은 그레이부터 다크 그레이까지 다양한 베리에이션을 펼쳐낸다. 파리지엔 스타일의 아이 메이크업을 위한 그레이 컬러는 시크함 그 자체다. 그 때문에 입술 위에 자리할 디올의 핑크 립 컬러는 더욱 눈부시다. 푸시아 핑크와 코럴 핑크로 이어지는 컬러 톤은 섬세한 그레이 톤 아이섀도와 완벽한 조화를 이룬다. 네일은 또다시 그레이다. 이 세련된 컬러의 조합은 봄을 위한 훌륭한 선택이라 할 만하다. n










issue Style/new EDITOR PARK SHINHYUN COOPERATION YSL(3444-3189)

Red Hottie Be accessorized with ravishing red.

082 Noblian


PAGE LEFT YSL

PAGE RIGHT YSL

극단의 섹시함은 식상할 뿐이고

부드러운 스웨이드 소재의

틀에 박힌 품위도 지루하다.

파우치는 화려한 컬러와 대비되는

강렬한 레드 컬러에 보디라인을

절제된 디자인 덕분에 과하지 않은

아름답게 살려주는 아찔한 높이의

섹시미를 표현하기에 제격이다.

킬힐로 당당하면서도 품위를 잃지

블랙이나 골드 컬러의 이브닝

않는 스타일을 완성하자.

드레스와 함께 매치해보자.

083 January 2011


lifestyle Design

EDITOR WON JONGMYUNG

Deep into the Scandinavian simplicity with Arne Jacobsen 

COOPERATION INNEN DESIGNWORKS(3446-5103)

Based on the honesty and simplicity with harmony between human beings and the nature, this design mixes modern sentiments together with curvy shape of design.

간결한 기능주의의 선구자 전통 공예에 뿌리를 둔 덴마크 디자인을 세계 중심에 올려놓은 아르네 야콥센Arne Jacobsen. 그 는 20세기 가장 영향력 있는 덴마크의 건축가이자 디자이너로서 모더니즘과 자연주 의를 적절히 융화시킨 작품을 선보였다. 그는 바우하우스Bauhaus와 아츠 앤 크라프 트Arts and Craft 사조의 철학에서 영감을 받아 작은 디테일도 놓치지 않는 토털 디자 인을 완성했다. 1902년, 코펜하겐에서 태어난 아르네 야콥센은 왕립 미술원Royal Academy of the Arts에서 건축을 배우기 전까지 벽돌공으로 일했다. 그가 이 직업을 선택한 이유는 벽 돌공과 채석공으로 일을 시작한 존 손John Soane, 루트비히 미스 판 데어 로에 Ludwig Mies Van Der Rohe와 같은 위대한 건축가에게서 영향을 받았기 때문이다. 이것은 후에 ‘건축물은 외관에 못지않게 인테리어 디자인 역시 예술적 완성도를 갖춰 야 한다’는 그만의 철학을 세운 계기가 되었다. 1933년, 그는 코펜하겐 교외 벨비스타 에 지은 주택 단지로 주목을 받았고, 이어 오프스 시청사와 슬레로드 시청사를 설계 했으며, 제2차 세계대전 후엔 스톡홀름의 주택군, 에스페르슨 회사 빌딩, 덴마크 최초 090 Noblian


의 마천루 SAS빌딩 등을 구상했다. 그는 병원과 학교, 호텔, 사무실, 시청 등으로 작 업 영역을 확대했으며, 나아가 건축물에만 국한되지 않고 스탠드・시계・가구와 같 은 제품도 디자인했다. 1934년부터 덴마크 가구 회사 프리츠 한센Fritz Hansen과 작 업하며, 세계 가구 디자인 역사에 길이 남을 ‘The Ant’와 ‘Series 7 Chair’를 선보였다. 그의 조각적이고 유기적인 디자인은 현재까지 많은 디자이너에게 영감을 주고 있으 며, 가구와 제품 디자인은 세계적으로 인정받는 문화유산으로 인식되고 있다. ‘20세기의 가장 유명한 의자’로 꼽히는 ‘Series 7 Chair’는 그의 수많은 작품 중 최고 의 걸작으로 꼽힌다. 숫자 7을 등받이에 형상화해 탄생한 제품은 캐스터, 기둥형 베이 스를 포함해 여러 액세서리를 선택할 수 있다. 쉘은 9겹의 우드 비니어와 2겹의 면으 로 된 직물 레이어로 이루어졌고, 베이스는 ‘mirror chromed’, ‘satin chromed steel’ 의 2가지 중에서 선택할 수 있다. 제품은 사이드 체어, 오피스 체어, 페디스탈 체어, 바 스툴, 카운터 스툴, 어린이용 의자처럼 다양한 용도로 사용된다. 편안함을 더하기 위해 앞면, 또는 전체를 가죽이나 패브릭으로 교체할 수 있다. 이 제품은 시간을 초월 한 영원불변성과 유니크한 디자인으로 대변된다.

  Arne Jacobsen 덴마크의 유명한 건축가이자 가구 디자이너. ‘덴마크 모던 스타일’을 발전시킨 장본인으로 건축 기능주의에 기여했다. 그는 군더더기 없는 심플한 아름다움을 추구하며 작은 디테일도 놓치지 않는 토털 디자인을 완성했다

 7 Chairs, 7 Colours, 7 Designers 가구 디자인의 클래식이며 아이콘이라 할 수 있는 아르네 야콥센의 ‘Series 7 Chair’가 마르텐 바스, 아릭 레비, 파비오 노벰브레, 하이메 아욘, 세바스찬 번, 넨도, 아우토반과 같은 젊고 영민한 7명의 디자이너에 의해 새로운 색상으로 재탄생했다

7 NEW COLOURS SELECTED BY 7 YOUNG DESIGNERS 아르네 야콥센의 ‘Series 7 Chair’가 새로운 색상을 통해 컨템퍼 러리한 모습으로 재탄생했다. 마르텐 바스Maarten Baas, 아릭 레비Arik Levy, 파비 오 노벰브레Fabio Novembre, 하이메 아욘Jaime Hayon, 세바스찬 번Sebastian Bergne, 넨도Nendo, 아우토반Autoban과 같이 젊고 영민한 디자이너들이 선택한 색 상으로 새로운 옷을 입은 것. ‘Series 7 Chair’에 대한 7인의 디자이너의 색다른 감성 에 주목해보자. “색이란 다양성, 즐거움, 음악, 삶의 구현이다. 나의 작품은 이름을 하나로 붙이기 어 렵다. 난 예술・제품・인테리어 등 나를 표현할 수 있는 모든 것을 디자인하고 만들 어낸다. 반사색은 모든 색을 상징한다. 반사되는 순간, 난 이러한 아이디어가 흥미롭 다는 것을 발견했다.” 하이메 아욘의 말처럼, 실용적인 아름다움, 절제된 디자인을 추구하며 독창적인 작품 세계를 창조한 아르네 야콥센이 전개하는 감각적인 제품은 인엔디자인웍스를 통해 만날 수 있다.

091 January 2011


lifestyle Heritage

EDITOR PARK SHINHYUN

The luxury male shoes select shop, ‘Heritage’ 

COOPERATION HERITAGE(3489-5927)

For the first time in Korean history, Kumgang opened ‘Heritage,’ a select shop targeting only male customers to offer a luxury shoe styling. First the store opened in Shinsegae main branch in 2007 and now, it has another branch on the 6th floor in Shinsegae branch in southern Seoul on December 10.

헤리티지의 뜻 깊은 행보 국내 최초 명품 남성 슈즈 멀티샵, 헤리티지HERITAGE가 지난 12월 10일 신세계 강남점 럭셔리 남성 관 6층에 오픈했다. 이번에 새롭게 리뉴얼을 마친 신세계 강남점 럭셔리 남성관은 ‘Men’s Furnishing- 최고급 남성 슈즈 전문 편집 매장’을 컨셉으로 헤리티지를 비롯 해 존롭John Lobb, 크로켓 앤 존스Crockett & Jones, 조지 클레버리George Cleverley, 처치스Church’s 등 영국 정통 수제화와 이태리・프랑스 고급 신사화 브랜 드가 함께 구성된다. 전체적으로 모던과 클래식이 고급스럽게 조화를 이룬 신세계 강남점 럭셔리 남성관 의 인테리어 컨셉은 바니스 뉴욕, 이세탄 신주쿠에서 영감을 받았다. 다양한 브랜드군과 고객을 배려한 편안하고 차분한 매장 분위기는 쇼핑을 즐기기에 최적의 조건을 갖췄다. 특히 25년 이상 경력의 헤리티지 장인이 선사하는 비스포크 서비스는 고객에게 잊지 못할 경험을 선사해 줄 것이다. 이번 오픈을 기념하여 헤리 티지 신세계 강남점에서는 12월 10일부터 12일까지 숙련된 구두 장인의 크래프트맨 십을 눈 앞에서 경험해 볼 수 있는 시연 이벤트가 마련되어 고객들의 눈길을 끌었다.

092 Noblian


헤리티지, 비스포크를 경험하다 ‘비스포 크Bespoke’란 시작에서 완성 단계까지 오로지 한 사람을 위한 맞춤 구두를 만드는 장인정신을 의미한다. 25년 이상 숙련된 헤리티지 장인의 비스포크 서비스는 고객에 게 잊지 못할 경험을 선사해 줄 것이다. 최고의 순간으로 기억될 이 특별한 서비스는 헤리티지 장인의 방문으로 시작된다. 정확한 사이즈 측정에서부터 디자인 선택, 가죽 선별, 박음질과 폴리싱 마무리 작업까지 고객의 취향에 맞추어 선택되고, 장인의 손 에서 이루어진다. 처음 신었을 때 약간 타이트한 느낌이 들 수 있으나 신을수록 편안 한 착용감과 특유의 견고함은 비스포크 구두의 최대 장점이다. 바로 이 점이 상류층 고객의 마음을 사로잡은 매력이라 할 수 있다. 비스포크 서비스는 구두 제작에서 끝나지 않는다. 고객의 이름이 새겨진 단풍나무 라스트를 만들어 헤리티지 라스트룸에 영구 보관하는 서비스를 제공하는 것. 이렇게 함으로 비스포크 고객은 사이즈 재측정 없이도 보관된 기록으로 언제 어디서나 자신 만의 구두를 재주문할 수 있다. 함께 제공되는 슈트리와 라이프스타일 슈케어 또한 비스포크만의 특별한 고객 감동 서비스다.

  숙련된 헤리티지 장인의 크래프트맨십을 눈 앞에서 경험해 볼 수 있었던 신세계 강남점의 시연 이벤트

 장인의 정교한 핸드메이드 공정을 거쳐 완성된 헤리티지 블랙은 남성을 더욱 우아하게 진보시킨다

헤리티지 블랙, 최고의 품격 장인의 정교 한 수작업 공정을 거쳐 완성된 헤리티지 블랙은 빛나는 장인 정신과 최고의 품격으로 남성을 더욱 우아하게 진보시킨다. 오랜 시간 장인의 손길로 다듬어져 섬세하면서도 예술적 선율처럼 깊은 감동을 주는 것. 최고급 가죽과 하루에 한 켤레도 만들기 힘든 수작업 박음질, 수십 번의 핸드 피니싱으로 빚어낸 섬세한 컬러는 깊은 감동을 준다. 조지 클레버리George Cleverley, 헤리티 지 매장을 통해 국내 첫 선 1958년 설립된 조지 클레버리George Cleverley는 영국의 전통 비스포크 전문 수제화 브랜드로 최상의 품질과 고급스러운 디자인으로 오랫동 안 사랑받아왔다. 존롭, 크로켓 앤 존스 등과 함께 영국을 대표하는 수제화 브랜드인 조지 클레버리는 국내에서는 처음으로 헤리티지 매장을 통해 고객을 만난다. 새롭게 오픈한 헤리티지 매장에서는 이 밖에도 영국에서 가장 오래된 수제화 브랜드 이자 컨트리 부츠의 대명사, 트리커스Tricker’s와 130년 이상의 역사를 자랑하는 처치 스Church’s 등의 컬렉션을 만나볼 수 있다.

093 January 2011


lifestyle Auction

EDITOR PARK SUMIN

Art market, seen through two auctions 

COOPERATION K AUCTION (3497-8888, www.k-auction.com) SEOUL AUCTION (395-0330~4, www.seoulauction.com)

Seoul Auction’s third art auction show and K Auction, closed their major auctions for December. Here’s what we learned from those two major auctions about the year’s art market.

작년 12월의 국내 미술품 경매 시장은 다소 부담감을 안고 시작된 것이 사실이다. 연 평도 사건 후의 시장 상황과 올해부터 시행될 예정이던 미술품 양도소득세 부과가 미 칠 영향 때문이었다. 그러나 12월 중순, 미술품 양도소득세 부과가 2년간 유예된다는 결정이 내려졌다. 그 때문인지 K옥션과 서울옥션에서 개최된 2010년 마지막 주요 경 매에서는 미술 시장의 활성화에 대한 가능성을 엿볼 수 있었다. 국내 미술 시장의 흐 름에 대한 긍정적인 미래를 가늠해본 두 경매의 결과를 살펴보자. 국내 미술 시장의 회복 가능성에 대한 기 대, K옥션 지난해 개최된 K옥션의 ‘12월 메이저 경매’는 무난하게 마무리되었다는 평 이다. 천경자, 로버트 인디애나, 이인성, 이우환 등 대형 작가들의 작품 총 186점이 출 품된 경매는 낙찰률 75%, 낙찰 총액 28억6천만여원의 결과를 보였다. 전체적으로 2009년보다 변화나 특징이 두드러진 것은 아니지만, 한국 근현대 부문의 지속적인 선전에 대한 기대감을 낳기에는 충분했다. 미술품 양도소득세 부과 유예 결정 자체가 적극적인 호재로 작용하진 않았다 해도 12월 메이저 경매를 통해 분명 2011년 미술

094 Noblian


시장의 회복에 대한 가능성을 엿볼 수 있었다는 점 역시 반가운 소식이다. 이번 경매에 다수 출품된 작품들의 특징은 소장이 용이하고 장식성이 뛰어나다는 것 이다. 많은 작품이 현장, 서면, 전화 경합 등을 통해 골고루 낙찰됐다. 프리뷰 기간에 고객들의 꾸준한 관심 속 치열한 경합이 예상된 이인성의 대표작 ‘주전자가 있는 정 물’은, 10번이 넘는 경합 끝에 2억500만원에 낙찰되는 기록을 보였다. 이번 경매에서 최고가로 낙찰된 작품은 이우환의 ‘점으로부터 No.78087’로, 3억9천만원이라는 낙찰 가를 기록했다. 또 한 가지 주목할 만한 작품은 이중섭의 소품 ‘은지화’. 이 작품은 4500만원에 시작, 10번이 넘는 경합을 거쳐 7200만원에 낙찰되었다. 2011년 활발한 미술 시장에 대한 기대감, 서울옥션 서울옥션에서 지난해 12월 14일에 열린 경매 프로그램, ‘제3회 아트옥션쇼’ 는 낙찰률 72%, 낙찰 총액 42억1830만원이라는 결과를 낳았다. 2010년 평균 낙찰률 인 69%에 비해 상향된 것으로 분석할 수 있는 이번 경매의 결과를 통해 올해 미술 시장 활성화에 대해 긍정적으로 예측할 수 있을 것. 그뿐만 아니라 작년의 미술품 경

  Lee UFan, From Point No.78087, Pigment on Canvas, 90.9×72.7cm, 1978

 Damien Hirst, Chlorogenic Acid, Gloss Household Paint on Canvas, 114.5×84cm, 1997

매를 종합적으로 살펴보면, 홍콩경매를 포함 낙찰가는 약 502억원으로 2009년보다 30% 정도 증가한 추세다. 이는 미술 경매의 저변 확대와 디자인 경매 등을 통한 경매 아이템 다각화, 해외 시장 진출 등에 대한 서울옥션의 꾸준한 노력의 결과로 해석할 수 있다. 이번 아트옥션쇼의 눈에 띄는 작가는 근현대 미술 분야의 권진규. 작가의 테라코타 조각 2점이 활발한 경합 끝에 낙찰되는 좋은 결과를 거뒀는데, 그중 경매의 하이라이 트 작품인 ‘춘엽니’는 1억9500만원, 또 다른 작품인 ‘경자’는 2억500만원이라는 낙찰 기록을 세웠다. 경매 최고 낙찰가는 6억원으로, ‘추정가 별도 문의’로 출품된 데미안 허스트의 작품 ‘Chlorogenic Acid’가 그 주인공이다. 고미술 분야 역시 눈여겨볼 만하 다. 소정 변관식의 ‘내금강보덕굴추색’은 치열한 경합 끝에 추정가의 배인 2억원의 낙 찰가를 기록했고, 출품작 7점이 모두 낙찰되는 등 소정의 지속적인 인기를 반영했다. 또 아트옥션쇼와 함께 치러진 ‘제5회 화이트 세일White Sale’ 자선 경매는 5년 연속 100% 낙찰률을 기록하는 가슴 따뜻한 결과를 선사해주었다. 낙찰 총액은 8220만원 으로 수익금은 저소득층 아동의 미술 교육 지원 사업에 쓰일 예정이다.

095 January 2011


lifestyle Pet

EDITOR PARK SUMIN WRITING BARBIE RANG

Fashionable & Functional, Shoulder Carrier 

Carrying your dog around is almost like a fashion accessory these days. Besides being a fashion accessory, shoulder carrier would be a great fashion accent for you and your dog as well. It also supports to act as a convenient way to transport your dog from one destination to another.

애견과 함께 외출할 때 캐리어를 선택하는 것은 큰 고민거리가 아닐 수 없다. 대중교 통을 이용하거나 사람이 많은 장소에서, 혹은 애견을 안고서 이동해야 할 때는 더 신 경 쓰인다. 사각형의 커다란 이동용 케이지나 하드 케이스는 넓고 안정적이기 때문에 강아지에게는 좋지만, 견주에게는 무겁고 커다란 짐이 되게 마련. 이때 요긴한 것이 바로 어깨끈이 달린 숄더백 형태의 캐리어다. 숄더 캐리어, 한 단계 업그레이드되다 디 자이너 마크 제이콥스는 자신의 애견 사랑을 담아 루이비통의 숄더 캐리어를 디자인 했고, 언제나 루이비통 캐리어 속 애견과 함께 출장길에 오른다. 구찌, 말로, 멀버리 같은 럭셔리 브랜드 역시 잇백 못지않게 펫 캐리어 디자인에 정성을 들이는 등 패셔 너블한 견주들의 열망을 반영한 아이템을 속속들이 선보이고 있다. 명품 브랜드의 애 완견 숄더백에 눈길이 가는 것은 사실이지만, 가격이 부담스럽다면 명품 못지않은 퀄 리티와 디자인으로 무장한 숄더 캐리어 백을 눈여겨볼 필요가 있다. 기존 숄더 캐리어에서 아쉬웠던 부분은 사각형 케이스보다 안정감이 부족했다는 것.

096 Noblian


그러나 최근 출시되고 있는 숄더 캐리어는 애견의 불편함을 줄이기 위해 견고한 패브 릭과 내부 디자인으로 안락함을 높여 걱정 없다. 다양한 수납공간과 가방의 기능을 더한 실용성은 특히 남성 견주에게 많은 인기를 누린다. 어깨 한쪽으로 메는 빅 백, 또는 크로스백 스타일의 캐리어는 세련된 디자인도 돋보이는데, 마치 하나의 패션 소 품과 같은 매력을 뽐낸다. 그중 전 세계 ‘강아지 포대기’ 열풍을 일으킨 주역, 국내 애견 용품 업체 ‘펀들’에서 출시한 애견 캐리어 ‘펀들’은 특히 시선을 끄는 아이템이다. 크로스백 형태의 캐리어 인 펀들은 노트북 가방에 버금가는 튼튼하고 푹신한 패딩 끈이 달려 있어 어깨에 무 리를 주지 않는다. 유선형으로 제작된 내부는 마치 강아지가 이불로 감싸 안기는 것 같은 포근함과 편안함을 선사한다. 가방 윗부분에는 강아지가 턱을 댈 수 있는 쿠션 이 있고, 가방 덮개는 지퍼가 달려 있는 망사로 되어 있어 애견이 전혀 답답해하지 않 는다. 펀들의 하이라이트는 가방 앞쪽에 달려 있는 지퍼 주머니. 주머니에 손을 넣으 면 강아지의 배 부분을 만져줄 수 있는 반짝이는 아이디어가 돋보이는 대목이다. ‘교 감 주머니’라는 애칭을 갖고 있는 펀들 캐리어는 깔끔한 디자인까지 더해져 세계적으

  적당한 사이즈와 기능성, 그리고 패셔너블한 디자인이 돋보이는 숄더 캐리어는 애견인들의 외출 필수품이다

 남성 애견인을 위한 숄더 캐리어는 멋스러운 스타일과 가방 대용으로도 사용할 수 있는 실용성을 겸비했다

로 환영받고 있다. 남성 애견인을 위한 스타일리시 숄더 캐 리어 트렌디한 남성이라면 주목할 것. 도글스Doggles의 ‘헴프Hemp 캐리어 백’은 이 름처럼 헴프, 즉 삼베 껍질을 주 소재로 만든 숄더 캐리어다. 캔버스 빅 백과 같은 멋 스러운 생김새는 나일론이 아닌 친환경 자연 소재로 만들어졌기 때문. 양털을 넣은 쿠션을 바닥에 깔아 안정감도 높였다. 튼튼하고 견고한 스트랩은 강아지를 캐리어에 넣고 뛰어도 무겁거나 불안한 느낌을 주지 않는다. 가방 윗부분의 메시 소재는 자외 선 차단 기능이 있으며, 헴프 백 양쪽의 포켓에는 휴대폰・열쇠・물병 같은 소품을 수납할 수 있어 가방 대신 사용해도 편리할 듯. 무엇보다 남성을 타깃으로 디자인한 만큼 컬러 역시 다크 브라운, 내추럴 브라운, 블루 톤 등으로 모던하면서도 고급스럽 다. 캐주얼에서부터 슈트까지 모든 스타일링에 훌륭한 액세서리로도 손색없는 헴프 백은 4~5kg의 소형 견까지 사용할 수 있는 작은 사이즈와 12kg의 대형 견까지 들어 갈 수 있는 큰 사이즈의 두 종류로 전개된다.

097 January 2011


lifestyle Drink

EDITOR PARK SUMIN

One and only

COOPERATION Pernod Ricard Korea(3446-5843) DIAGIO KOREA(2112-1400)

Single malt Scotch whiskey has its charms as it is produced with one and only grain. Hear the stories of infinite values in this one bottle of single malt Scotch whiskey.



발효한 곡물로 만든 양조주를 증류한 맑고 깨끗한 술. 여러 단계의 까다로운 과정을 거치고, 700L 이하의 오크 통에서 최소 3년 이상 잠든 후에야 빛을 볼 수 있는 주류. 이 귀한 존재는 바로 스카치위스키다. 스코틀랜드의 곡류, 물, 효모로 만든 스카치위스키는 그 이름만으로도 무게감을 준다. 위스키를 좋아하는 사람은 많지만 그 종류나 만들어지는 과정에 대해 알고 있는 이는 많지 않은 법. 그러나 그저 한 잔으로 즐기기엔 그 안에 담긴 역사와 정성, 뛰어난 풍 미는 꽤 의미 있게 다가온다. 스카치위스키 중 단연 특별한 것은 ‘싱글 몰트 스카치위스키Single Malt Scotch Whisky’. 술에는 ‘한 곳의 증류소에서 단식 증류기를 사용해야만 한다’, ‘물과 맥아를 제외한 어떤 것도 첨가해서는 안 된다’는 등의 엄격함이 존재한다. ‘피트’라는 석탄을 태워 그 연기와 열풍으로 건조한 맥아를 원료로 하는 술은 그 중후한 향과 맛이 독보 적이다. 대중적인 블렌디드 위스키의 원료가 되는 술은 그 존재 자체로 위스키 마니 아에게 최고로 손꼽히는 것. 싱글 몰트 스카치위스키의 진수를 확인할 수 있는 2가지 드링크, 더 글렌리벳 25년과 싱글톤 18년을 통해 그 진정한 가치를 경험해보자.

098 Noblian


오리지널리티의 완성, 더 글렌리벳 25 싱 글 몰트 스카치위스키의 효시라 할 수 있는 더 글렌리벳THE GLENLIVET은 증류 합 법화 후 최초로 공인 증류 면허를 취득한 위스키다. ‘위스키의 젖줄’로 잘 알려진 스 페이 강 유역인 스페이사이드Speyside에서 생산되는 술은 이 지역을 싱글 몰트 스카 치위스키의 세계적인 고장으로 만들었다. 미네랄 성분이 풍부한 광천수, 최적의 조건 을 갖춘 자연환경에서 거치는 숙성 과정은 200여 년이 지난 지금까지 내려오는 브랜 드만의 차별화된 조건이다. 더 글렌리벳 25년산은 싱글몰트의 마스터피스라 할 만하다. 무르익은 호박의 황금색 을 지닌 위스키는 셰리 와인을 담았던 첫 번째 오크 통에서 숙성 과정을 거친다. 감미 로운 과일, 톡 쏘는 스파이시 등 화려하고 다채로운 향은 완벽한 균형미를 이룬다. 캐 러멜과 같은 달콤함 뒤에 느껴지는 오렌지 껍질의 새콤함, 그리고 다크 초콜릿의 건 조함은 이 싱글 몰트 위스키의 백미다. 더 글렌리벳 25년산은 메탈 슬라이드 빗장으 로 봉인된 수공 우드 케이스에 담겨 더 스페셜하다. 일련번호와 4명의 마스터가 승인 한 서명이 동봉된 더 글렌리벳 25의 모습은 무척이나 당당하고 위엄 있다.

  ‘위스키의 젖줄’로 정평이 난 스페이 강 유역인 스페이사이드에서 생산되는 더 글렌리벳 25년산

 싱글 몰트 스카치위스키 중 유일하게 스코틀랜드에서 생산한 보리를 사용, 하이랜드 지역의 맑은 물로 만드는 싱글톤 글렌오드 18년산

싱글 몰트 스카치위스키의 정점, 싱글톤 18 싱글 몰트 스카치위스키 중 유일하게 스코틀랜드에서 생산한 보리와 스코틀랜드 하이랜드 지역의 맑은 물로 제작되는 싱글톤. 글렌오드 지역에서 자라는 보리 전량을 제조하는 증류소는 싱글톤의 글렌오드 증류소가 유일하다. 그뿐만 아니라 위스키에 는 하이랜드 산악 지대의 향취가 그대로 녹아들었다. 싱글톤의 풍미를 일컬어 ‘싱글 몰트 스카치위스키의 정수’라고 하는 이유다. 최초로 우리나라를 비롯한 아시아인의 미감에 맞춘 위스키라는 점은 더 더욱 환영할 만하다. 단맛이 강하면서도 목 넘김이 부드러운 위스키를 선호하는 아시아인을 위해 싱글톤은 유럽산 셰리 오크 통에서 반, 미국산 버번 오크 통에서 반을 섞어 제작하는 노력을 아끼지 않는다. 싱글톤의 최정상급이라고 할 수 있는 싱글톤 글렌오드THE SINGLETON OF GLEN ORD 18년산은 그 이름이 아깝지 않다. 말린 과일이나 견과류와 함께 즐기면 입안 가 득 퍼지는 달콤함과 고소한 기름 향, 시간이 지날수록 다가오는 잘 익은 오렌지 향, 그리고 약간의 이끼 향이 가득 풍겨올 것. 짙은 농도에 이어 퍼지는 부드럽고 담백한 식감은 유쾌하게 전달된다.

099 January 2011


lifestyle Gourmet

EDITOR PARK SUMIN

Greet the New Year with some flavor HONGKONG Nanhai No.1

WRITING EVA(HONGKONG) CHO MEEHEE(MILAN) SIM(PARIS) BARBIE RANG(NEW YORK)

What more do you need, when you have your beloved ones and favorite food on your table for the New Year? We hear laughs already from restaurants that are all set to greet the year 2011.

iSQUARE 30F, 63 Nathan Road, Tsim Sha Tsui + 852 2487 3688

화려한 야경, 산해진미가 가득한 먹을거 리, 완벽한 쇼핑의 천국. ‘홍콩’ 하면 떠오르는 3가지다. 특히 홍콩 음식은 수없이 많 은 매력을 간직한 도시를 더욱 빛나게 만드는 일등 공신. 그중에서도 가장 ‘핫’한 홍 콩의 미각 여행지를 꼽으라면? 단연 ‘난하이Nanhai No.1’을 추천한다. 난하이 No.1은 최고급 레스토랑이 갖춰야 할 모든 요소를 겸비한 파인 다이닝으로 새 롭게 부상하고 있는 곳이다. 난하이 No.1에서 제공하는 수많은 종류의 중국식 정찬 메뉴는 보는 것만으로도 놀라움을 안겨준다. 레스토랑의 이름은 13세기 중국의 정 Zheng 해군 장군이 이끈 보물선 이름에서 따온 것으로, ‘난하이Nanhai’는 중국 남해 南海를 뜻한다. 송 왕조 시대 그가 이끌던 보물선이 엄청난 양의 보석과 값비싼 도자 기를 싣고 난하이 바닷가에 가라앉았다고 한다. 찬란한 문화를 꽃피운 송나라 시대의 아름다움을 간직한 역사적 배경은 레스토랑의 메뉴에 영감을 불어넣었다. 중국 남해에서 갓 잡아 올린 신선한 해산물을 재료로 한 볶음 요리와 그릴 요리가 난 하이 No.1의 메인 메뉴다. 대나무순을 곁들인 가루파(옥돔의 일종) 지느러미 요리 Garoupa’s fin with bamboo shoots는 옥돔의 꼬리와 지느러미에 콩, 대나무순, 버섯 을 첨가해 도기에 담아낸 음식으로, 반드시 먹어봐야 할 메뉴 중 하나다. 티-스모크 

드 치킨Tea-smoked chicken은 모든 사람이 즐겨 찾는 요리. 한 번이라도 이 메뉴를

중국식 정찬 요리의 정수를 맛볼 수 있는, 새롭게

먹어본 이들은 지금까지 맛본 훈제 치킨 중 으뜸이라는 찬사를 아끼지 않는다.

떠오르는 홍콩의 파인 다이닝 레스토랑, 난하이 No.1

레스토랑 안에 자리한 아이 바Eye Bar에서는 한눈에 들어오는 하버시티를 내려다보



며 이국적인 칵테일 한잔을 음미해보자. 홍콩의 중심가 침사추이 아이스퀘어

홍콩의 중심가 침사추이 지역 아이스퀘어 30층에

iSQUARE 쇼핑몰의 30층에 위치한 난하이 No.1에서는 매일 저녁 빛의 향연으로 불리

자리하고 있는 난하이 No.1에서는 매일 밤 홍콩의

는 ‘심포니 오브 라이트 쇼’를 감상할 수 있어 더 매력적이다.

야경을 만끽할 수 있다

100 Noblian


상업 도시로서 밀라노의 면모가 여실히

 밀라노의 면모가 여실히 드러나는 산 바빌라 중심 지역에 자리 잡고 있는 레스토랑, 발렌티노 빈티지

드러나는 다운타운 산 바빌라의 중심가 한구석에 레스토랑 ‘발렌티노 빈티지 Valentino Vintage’가 있다. 밀라노가 속한 지역인 롬바르디아의 정통 음식을 표방하



는 발렌티노 빈티지는 지역의 특성에 걸맞은 다양한 육류 요리를 선보인다.

롬바르디아 정통 가정식을 선보이는 발렌티노

밀라노 북부 지역의 대표 음식인 소고기 커틀릿을 비롯해 손질이 어렵다고 정평이 난

빈티지는 고객을 배려한 메뉴 구성과 뛰어난 맛으로

염소고기 소스를 이용한 파스타, 어린 양고기를 그릴과 오븐에 2번 구운 스테이크는

미식가들의 발길을 사로잡는다

레스토랑이 처음 문을 열었을 때부터 지금까지 베스트셀러 자리를 지키고 있다. 발렌 티노 빈티지는 점심시간에 손님을 배려하는 것도 소홀히 하지 않는다. 스테이크를 2/3 크기로 줄이고 하프 가격으로 구성한 런치 메뉴는 부담스럽지 않게 훌륭한 요리 를 맛보기 제격. 생선 요리 역시 돔・연어・민어 등을 1마리 단위의 필렛 요리로 판매 하는데, 가격까지 합리적이어서 높은 인기를 끌고 있다. 발렌티노 빈티지에서는 리소 토도 다채롭게 즐길 수 있다. 밀라노식 리소토의 스탠더드라 할 수 있는 노란 샤프란 의 색상에 절로 입맛이 도는 리소토 밀라네제, 치커리와 바롤로 와인의 쌉쌀한 맛과 치즈의 부드러움이 오묘히 조화를 이룬 리소토 콘 라디키오 등 골라 먹는 재미는 절 대 놓칠 수 없다. 소박한 가정식으로 정평이 난 만큼 레스토랑 분위기 자체도 무겁지 않고 편안하다. 샹들리에를 다는 대신 도서관에서나 볼 법한 스탠드를 테이블마다 비치했는데, 부담 스럽지 않으면서도 오히려 아늑한 멋이 배가된다. 벽에 걸린 수많은 그림과 사진 액 자는 넓은 공간을 아기자기하게 꾸민 감각을 더욱 돋보이게 해준다. 뉴욕 어느 거리 의 재즈 바 분위기도 느낄 수 있는 레스토랑 발렌티노 빈티지. 기분 좋은 북적거림과 대화 속에서 음미하는 식사는 밀라노라는 도시 특유의 공기를 그대로 전달해준다.

MILAN Valentino Vintage Corso Monforte 16, Milan + 39 02 7639 4369

101 January 2011


lifestyle Gourmet

Greet the New Year with some flavor

PARIS Le Mouton Blanc 40, Rue d'Auteuil 75016, Paris + 01 42 88 02 21

‘하얀 양’이라는 뜻의 프랑스 전통 레스토 랑 ‘르 무통 블랑Le Mouton Blanc’. 레스토랑 이름을 듣는 순간 프랑스인은 어린 시 절 시골 할머니 집에서 맛보던 프랑스식 시골 음식을 금방 떠올릴 것이다. 역사의 향 기가 잔뜩 묻어나는 르 무통 블랑은 파리에서 가장 오래된 레스토랑 중 한 곳으로도 유명하다. 〈돈 주앙〉의 작가 몰리에르, 프랑스 고전극을 대표하는 라신, 프랑스 시인 이자 동화 작가 라퐁텐 등의 문학 천재들은 르 무통 블랑의 테이블을 가득 채웠던 이 들. 레스토랑은 지금까지도 수많은 이야기를 간직한 파리의 명소로 그 자리를 굳건히 지키고 있다. 레스토랑은 2008년 레노베이션을 거쳐 한층 신선한 변신을 맞았다. 르 무통 블랑의 본래 이미지와 콘셉트는 중심에 남겨두고 디테일한 터치를 가미한 것. 고급스럽고 권위적인 석재는 다시 손질하고, 금색 톤의 실내 장식과 메탈 장식에는 새롭게 칠을 해 한결 깔끔하고 단정한 분위기로 다시 태어났다. 르 무통 블랑에서 꼭 맛봐야 할 요리는 무엇일까? 먼저 시골식 홈메이드 테린느를 잘 구운 바게트 위에 발라 레드 와인으로 입맛을 돋운다. 프랑스에 왔다면 꼭 먹어봐야 하는 푸아그라와 화이트 와인 역시 스마트한 선택. 메인 디시로는 치즈가 알맞게 녹 은 가재 그라탱, 혀 위에서 살살 녹는 오리 가슴살 요리, 알싸한 후추 향과 뛰어난 육 

질의 스테이크, 마늘을 곁들인 양 넓적다리 고기 등의 프랑스 전통 음식을 추천한다.

프랑스인에게 시골 할머니 집에 대한 향수를

스코틀랜드산 연어와 도미 요리도 많은 파리지엔이 르 무통 블랑을 다시 찾는 이유

불러일으키는, 프렌치 전통 요리를 제공하는 레스토랑, 르 무통 블랑

다. 레스토랑의 디저트 역시 모자람이 없다. 프랑스 할머니들만이 간직한 비밀 레시 피로 마술을 부린 것 같은 향긋한 디저트와 그윽한 에스프레소 한 잔을 맛보면 더할



나위 없는 만족감을 느끼게 될 것. 가장 파리다운 장소에서 프렌치 전통 음식을 경험

르 무통 블랑에서는 역사의 깊이가 배어 있는

하고 싶다면 단연 르 무통 블랑이다.

프랑스 요리는 물론, 디저트를 꼭 맛보아야 한다

102 Noblian


한국의 국민 간식이 ‘라면’이라면 미국에

 더위나 추위에도 아랑곳하지 않고 뉴요커와 관광객이 2~3시간 줄서서 기다리는 뉴욕의 명물 피자 레스토랑, 그리말디 피자리아

는 ‘피자’가 있다. 시카고, 뉴욕, LA 등 대도시의 이름을 단 피자는 미국인의 사랑을 한 몸에 받는다. 그중 뉴욕은 미국식 피자의 본고장으로 손꼽히는 도시. 뉴욕의 피자 가 유명한 이유는 바로 얇은 도우의 피자를 화덕에서 구워내는 이탈리아 방식을 고수



하는 것. 그리고 나이아가라 폭포에서부터 흘러온 물을 끌어다가 도우를 반죽하기 때

그리말디 피자리아의 피자는 뉴욕 피자 특유의

문이다. 뉴욕 피자의 진수를 맛보려는 관광객과 뉴요커 덕분에 최고라 인정받는 피자

느끼하지 않고 담백한 맛이 일품이다

집들은 뉴욕 곳곳에서 문전성시를 이룬다. ‘그리말디 피자리아Grimaldi’s Pizzeria’는 알 만한 이는 다 안다는 뉴욕의 베스트 오 브 베스트 레스토랑이다. 많은 사람이 더위와 추위에 아랑곳하지 않고 2~3시간 줄을 서서라도 이 남루하고 오래된 피자 레스토랑에 들어가고 싶어 하는 이유는 그 질리지 않는 담백한 맛 덕분. 피자 하면 빠질 수 없는 시카고 출신의 미셸 오바마마저 극찬을 보낸 곳이다. 얇은 도우 위 신선한 토마토소스를 깔고, 모차렐라 치즈를 아낌없이 얹 은 후 화덕에서 구워내면 겉에서부터 바삭하게 부풀어 오른 피자. 기름기는 한 방울 도 찾아볼 수 없다. 여기에 매콤한 이탤리언 소시지와 개운하게 뒷맛을 책임져줄 양 파 두어 조각을 토핑으로 올려주면 환상적이라는 표현이 아깝지 않을 정도다. 브루클 린에서만 제조되는 브루클린 브루어리 맥주를 곁들이는 것은 필수다. 애피타이저로 는 이탈리아산 포토벨로 버섯을 잔뜩 얹은 샐러드를 놓치지 말아야 할 터다. 또 새로 움을 경험하고 싶다면 마늘과 치즈만 토핑된 화이트 피자에 도전해보자. 중독성 있는 그 맛은 절대 잊을 수 없을 것. 브루클린 브리지를 건너자마자 위치한 레스토랑은 맨 해튼의 야경을 가장 아름답게 볼 수 있다는 덤보 지역에 자리하고 있다. 식사를 마치 고 유유히 뉴욕의 밤을 만끽하는 행복은 보너스다.

NEW YORK Grimaldi’s Pizzeria 19 Old Fulton St.(near A/C High Station), New York + 1 718 387 7400

103 January 2011


EDITOR PARK SUMIN

lifestyle Law

COOPERATION YULCHON LAW FIRM(www.yulchom.com)

WRITING KANG SEOKHOON

Trust stocks under somebody else’s name 

It’s not so uncommon to trust your stocks under someone else’s name. But you might want to be more cautious, as you may fall victim to an immense amount of tax money, if you are not careful here.

국세청이 2006년부터 지난해 상반기까지 주식 명의신탁에 대해 증여세를 부과한 건 수는 1만2681건, 금액은 1조447억원에 달한다. 한 해 증여세 세수가 1조~2조원임을 감안하면, 주식 명의신탁으로 인해 거둬들이는 증여세 비중이 매우 높음을 알 수 있 다. 국세청은 앞으로도 자금 출처 조사와 주식 변동 조사 등을 통해 주식 명의신탁을 철저히 검증, 관련 세금을 추징하겠다는 강한 의지를 보이고 있는 상황이다. 명의수탁자에게 증여세가 부과되는 명의 신탁 증여의제 ‘명의신탁’은 실질적인 소유자와 주주명부 등 공부상의 소유 명의자가 다른 경우를 의미한다. 예를 들어 A회사의 실질적 주주인 갑(甲, 명의신탁자)이 을(乙, 명의수탁자)의 명의를 빌려 주주명부상의 명의만 을로 해놓는 것이다. 물론 ‘명의신 탁’이라는 법률 행위가 성립하기 위해서는 갑과 을 사이의 명의신탁 합의가 필요하다. 상속세 및 증여세법 제45조의2 제1항은 “권리의 이전이나 그 행사에 등기 등이 필요 한 재산(토지와 건물은 제외한다)의 실제 소유자와 명의자가 다른 경우에는 국세기본 법 제14조에도 불구하고 그 명의자로 등기 등록을 한 날, 그 재산의 가액을 명의자가

104 Noblian


352),/(

글을 쓴 강석훈 변호사는 법무법인 율촌의 파트너 변호사로 조세쟁송

실제소유자에게서 증여받은 것으로 본다”고 규정한다. 실질적인 소유권은 여전히 명 의신탁자가 갖고, 명의수탁자는 명의만 빌려준 채 실제 아무런 과세소득이 없을지라 도 위 규정에 의해 증여세를 부담해야 한다. 물론 이는 결국 세법의 대원칙인 ‘실질과

팀장을 맡고 있다. 1990년

세원칙’에 비춰보면 납득하기 어려울 수 있다. 그러나 상증세법은 실질과세원칙을 규

서울남부지법의 판사를 시작으로

정한 “국세기본법 제14조에도 불구하고”라는 표현을 사용함으로써 명의신탁 증여의

2007년까지 서울고등법원, 대법원

제는 원칙의 예외임을 명시했다. 또 현행 상증세법 제45조의2 제1항 제1호에서는 “조

등 각급 법원에서 판사로 재직, 대법원 재판연구관 부장판사를 끝으로 율촌에 합류했다

세회피의 목적 없이 명의신탁을 한 경우”는 증여의제를 적용하지 않도록 규정하고 있 다. 여기서 문제는, “조세회피의 목적이 없다”에 대해 과세관청이 아닌 납세의무자가 입증을 해야 하고, 실제로 이에 대한 입증이 쉽지 않다는 데 있다. 대법원은 조세회피 의 목적이 없었음을 입증하기 위해 2가지를 밝혀야 한다고 본다. 첫 번째는 ‘명의신탁 이 조세회피의 목적이 아닌 다른 특별한 목적으로 이루어졌다’는 점, 두 번째는 ‘명의 신탁으로 인해 감소되는 세금이 없거나 극히 사소하다’는 점이 바로 그것이다. 주식 명의신탁으로 인해 회피할 수 있는 세금은 주로 배당소득에 대한 종합소득세, 과점주 주로서의 제2차 납세의무나 간주취득세 등 명의신탁으로 감소된 세액이 결과적으로

  주식 명의신탁에 대한 문제의식을 갖지 않는다면 예상하지 못한 막대한 세금을 부과받을 수 있음을 유념해야 한다

 명의신탁 증여의제로 인한 과세와 상속세를 이중으로 받아 주식 가액에 해당하는 모든 금액을 세금으로 납부해야 하는 경우도 발생할 수 있다

상당한 액수에 달한 경우, 조세회피 목적을 인정한 사례도 있다. 막대한 증여세를 부과받을 수 있는 주식 명의신탁 현재 많은 비상장 회사에서 주식 명의신탁이 관행적으로 행해지고 있는 것 이 사실이다. 그러나 이 부분에 대해 문제의식을 갖지 않는다면, 생각지도 못한 막대 한 세금을 부과받을 수 있다. 증여세는 최대 50%의 누진세율로 부과되고, 명의신탁 증여의제로 인한 증여세에서는 각종 세금공제가 배제된다. 더욱이 비상장 법인의 주 식 가치는 상증세법상 평가를 거칠 경우, 조그마한 중소기업의 주식 가치도 상당히 높은 가액으로 평가되는 일이 비일비재하다. 또 명의신탁자가 사망할 경우 명의신탁 주식의 소유권은 여전히 명의신탁자인 망인이 가지고 있다고 보는데, 이를 상속재산 에 포함시켜 상속세를 부과하는 것이다. 이는 자칫 명의신탁 증여의제로 인한 과세와 상속세 과세를 이중으로 받아 사실상 주식 가액에 해당하는 금액을 모두 세금으로 납 부해야 하는 일이 발생한다. 따라서 현재 주식 명의신탁이 이뤄졌다면, 이를 해결하 기 위해 조세 전문가의 조력을 받는 등 해결 방안을 모색할 필요가 있다.

105 January 2011


lifestyle Gear

EDITOR PARK SHINHYUN

Porsche Intelligent Performance 

COOPERATION PORCHE(1544-0911)

Porsche was the first automobile company to offer the first-ever hybrid car some 110 years ago. Now, it is ready to surprise the world once again as it developed a hybrid system.

포르쉐의 시대를 앞선 하이브리드 시스템 포르쉐를 따라다니는 수식어에는 주로 스피드, 강력한 파워, 슈퍼카, 럭셔리 등이 있 다. 하지만 최근 몇 년 사이 자동차 업계에 거세게 불고 있는 하이브리드 바람이 포르 쉐에서 시작됐다는 사실을 알고 있는 이가 몇이나 될까. 포르쉐는 이미 110년 전 페르 디난드 포르쉐 박사의 고안으로 세계 최초 하이브리드 차량을 개발했다. 그리고 2010 년, 다시 한 번 시대를 앞선 하이브리드 시스템을 가지고 나타난 포르쉐에 모든 이목 이 집중하고 있다. 인텔리전트 퍼포먼스를 바탕으로 한 포르쉐 하이브리드는 월등한 퍼포먼스와 자동차의 효율적인 구동에 대한 콘셉트가 결합해 적은 연료로 탁월한 성 능을 내면서도 이산화탄소의 배출량을 획기적으로 줄이는 데 성공했다. 지난 3월, 포르쉐는 2010 제네바 모터쇼에서 3가지 하이브리드 차량 모델을 공개했 다. 앞 차축 전기 모터와 플라이휠 배터리를 장착한 911 GT3 R 하이브리드 경주차와 병렬 풀 하이브리드 방식의 포르쉐 카이엔 S 하이브리드, 플러그인 하이브리드의 미 드십 엔진 스포츠카 918 스파이더가 바로 그들. 최고의 성능과 친환경성을 동시에 만 족시키는 포르쉐의 하이브리드 기술력이 자동차의 미래를 보여줬다.

106 Noblian


 911 GT3 R 하이브리드는 플라이휠을 새롭게 적용, 제동 시 생성되는 에너지를 회전 에너지로

911 GT3 R 하이브리드는 운전석 옆에 위치한 플라이휠을 새롭게 적용했다. 제동 시 생성되는 에너지를 회전 에너지로 변환해 플라이휠에 저장된다. 이로써 운전자는 필 요할 때 4L의 6기통 복서엔진 성능뿐 아니라 양쪽 앞바퀴에 각각 60kW(81마력)의 동

변환해 플라이휠에 저장한다.

력을 전달해 연료와 함께 전기 엔진을 병행, 사용할 수 있다. 뉴 카이엔 S 하이브리드

이로써 운전자는 연료와 함께 전기

는 포르쉐 최초의 하이브리드 양산차로, 높은 성능과 절감된 연료 소모량을 특징으로

엔진을 병행 사용할 수 있는

한다. 918 스파이더에 적용된 하이브리드 기술은 경량 차체 구조와 고회전 V8 엔진

것이다

에 총 160kW(218마력)의 파워를 자랑하는 프런트 리얼액슬에 장착된 2개의 전기 엔



진 조합으로 구현된다. 또 제동 시 회수되는 전기 에너지는 충전지에 저장한다. 이로

최고의 성능을 자랑하는

써 918 스파이더는 주행 시 이산화탄소를 전혀 배출하지 않으면서 순수한 전기의 힘

콘셉트카인 918 스파이더는 주행

으로 구동할 수 있다.

시 이산화탄소를 전혀 배출하지 않으면서 순수한 전기의 힘으로

포르쉐 인텔리전트 퍼포먼스Porsche

구동할 수 있다

Intelligent Performance 끊임없는 기술 개발을 통해 60여 년간 르망과 모터스포츠에 서 2만8천여 번의 우승을 차지한 포르쉐는 모터스포츠를 무대로 성장해왔다. 극한의



성능이 요구되는 레이스를 통해 고성능 스포츠카 개발에 필요한 노하우를 쌓으며 자 동차의 발전을 이끌어온 것이다. 포르쉐의 엔지니어들은 모터스포츠의 경험과 기술 력을 바탕으로 세계 최고의 퍼포먼스를 자랑하는 차량으로 만들어냈는데, 그 바탕에 는 ‘포르쉐 인텔리전트 퍼포먼스Porsche Intelligent Performance’라는 포르쉐만의 철 학이 있다. 최근 몇 년간 자동차 업계의 변함없는 화두는 바로 친환경이다. 포르쉐는 이 같은 친 환경 이슈에도 포르쉐 인텔리전트 퍼포먼스의 기본 원칙을 바탕으로 접근하고 있다. 모터스포츠에서도 그랬듯 미래의 자동차 기술에서도 포르쉐는 효율성의 향상을 최우 선으로 한다. 미래의 자동차는 대체 엔진을 사용해 강력한 성능을 내는 것과 동시에 에너지 효율이 높은 차량을 개발하는 것을 포괄한다. 이제 포르쉐는 그 빛나는 전통을 만들어낸 원동력인 포르쉐 인텔리전트 퍼포먼스 철 학에 다시 자동차의 미래를 묻는다. 친환경이라는 타이틀에 맞춰 가공된 기술을 넘어 더 높은 연료 효율과 성능을 발휘하는 자동차 기술의 새로운 패러다임을 제시하는 것 이다.

107 January 2011


lifestyle Leports

EDITOR WON JONGMYUNG

A season of ski and snow

COOPERATION adidas Korea(2186-0445)

How can you possibly let go of winter without skiing? Get your outfit and ski, and head out to the ski resort right now.



깊어가는 겨울, 새하얀 눈으로 덮인 그 화려한 풍경에 취해 있자니 문득 영화 <다운힐 레이서Downhill Racer>가 생각났다. <프리미어>가 선정한 역대 최고 할리우드 영화 포스터 중 하나로 뽑혀 더 유명한 영화에서는 젊은 시절의 로버트 레드포드와 진 해 크먼을 만나볼 수 있다. 그들이 스키를 타고 은빛 설원을 질주하는 모습을 보고 있자 니 겨우내 감추었던 무한 질주 본능이 되살아나는 듯했다. 겨울 스포츠에 스키만한 것이 또 있을까…. 겨울의 낭만, 스키의 매력에 빠지다 스키 는 2개의 발판으로 눈밭 위를 미끄러지는 스릴과 속도감이 매력인 스포츠다. 현대 스 키는 스피드와 기록을 겨루는 ‘경기 스키’와 그렇지 않은 ‘일반 스키’로 나뉜다. 경기 스키는 활강・회전・대회전・알파인 복합과 같이 스피드와 기술을 겨루는 알파인 Alpaine 경기, 바이애슬론・점프・크로스컨트리・콤바인과 같이 지구력과 스피드를 측정하는 노르딕Nordic 경기가 있다. 일반 스키는 리프트나 공중 케이블이 완비된 겔 렌데Gela‥nde에서 즐기는 단순 레포츠다. 최근엔 정해진 코스를 각자의 체력과 훈련

108 Noblian


량에 맞춰 걷거나 달리는 크로스컨트리 스키Cross-country ski가 건강 스포츠로 각 광받고 있다. 스키는 새로운 눈이 쌓인 산야나 다진 경사면을 자유자재로 이동해야 한다. 따라서 ‘달리고, 미끄러지고, 멈추고, 돌고, 나르는’ 기술이 필요하다. 즉, ‘돌고 싶은 곳에서 돌고, 멈추고 싶은 곳에서 멈출 수 있도록’ 하는 것이 모든 스키어의 공통적 목표다. 하지만 높은 곳에서 낮은 곳으로 내려오려는 관성의 힘 때문에 스키어 스스로의 힘만 으로는 모든 동작을 할 수 없다. 즉, 자연의 물리적 조건과 인간의 힘이 적절하게 조 화를 이뤄야 한다. 남녀노소의 구분 없이 즐기는 스포츠인 스키는 많은 스포츠 중에서도 ‘평생 스포츠’ 로서의 가치가 있다. 특히 스키는 운동량이 풍부한 전신 운동으로 하체와 허리 기능 강화에 좋고 심폐 기능과 균형 감각, 순발력을 기르는 데 효과가 있다. 겨울 스포츠의 백미, 스키를 타며 대자연 속에서 함께 숨 쉬며 하나가 됨으로써 서로 간의 존재와 소 속감을 일깨워 생활의 활력소를 되찾아보자.

  탁 트인 산봉우리를 따라 은빛 설원을 내달리는 질주 본능, 스키는 눈 덮인 자연 속에서 맑은 공기를 마시며 여러 형태의 경사나 눈의 상태를 극복하며 즐거움을 만 끽하는 스포츠다

 아디다스의 최첨단 기술과 디자이너 스텔라 맥카트니만의 독창적인 디자인을 결합한 ‘아디다스 by 스텔라 맥카트니’는 시크한 블랙 컬러와 섹시한 실루엣으로 감각적인 스키웨어를 선보였다

패셔너블 스키웨어로 감각적인 스타일링 을 <다운힐 레이서>를 보면 로버트 레드포드가 입고 나온 스키웨어가 유독 눈에 띈 다. 다운힐 레이서 스트라이프 패턴을 새긴 스키웨어는 그의 멋진 활강 실력을 더 돋 보이게 한다. 이처럼 다양한 스포츠 중 스키만큼 패션을 뽐낼 수 있는 분야도 드물다. 스키웨어는 단순히 스타일에만 치중해선 안 된다. 눈보라와 추위에 맞설 수 있는 기 능성과 움직임에 적합한 활동성, 여기에 하얀 설원 위 스키어들을 돋보이게 해줄 스 타일까지, 3박자를 고루 갖춰야 한다. 평범한 스키웨어를 거부한다면 디자이너 감각 이 돋보이는 세련되고 시크한 스타일의 스키웨어를 추천한다. 아디다스의 최첨단 기 술과 디자이너 스텔라 맥카트니만의 독창적인 디자인을 결합한 ‘아디다스 by 스텔라 맥카트니adidas by Stella McCartney’의 스키웨어가 그것. 이번 시즌 선보이는 스키 웨어는 강렬한 퍼플과 다크 브라운, 클래식 블랙 컬러를 중심으로 더욱 슬림해지고 섹시한 실루엣이 특징. 모터스포츠 재킷에서 영감을 받은 스키 재킷은 스포티하고 시 크한 느낌을 준다. 이번 겨울 아디다스 by 스텔라 맥카트니의 감각적인 스키웨어를 입고 세련된 라이프스타일을 즐겨보자.

109 January 2011


world travel High class premium cruise EDITOR WON JONGMYUNG COOPERATION CLUB THOMAS(722-7590))

will take you to the highest-end possible journey on the sea. Now, hop on this Oceania cruise ship bound for Alaska.


Dreaming on the sea, Crusing to Alaska

111 January 2011


알래스카, 바람 같은 이야기 ‘북극의 들판을 여행하는 카리부, 그리고 이 땅에 사는 사람들의 삶을 생각할 때면 나는 늘 한 늙은 인디언을 생각한다. 위대한 알래스카. 이제 그곳에서 한 시대가 확실하게 막을 내리려고 한다. 카리부의 여 행을 뒤쫓으면서 나는 아름다운 알래스카의 자연 속으로 이끌렸고,

Dreaming on the sea,

이 땅에서 소용돌이치는 다양한 일과 만나게 되었다. 자연이란 인간 의 삶 바깥에 있는 것이 아니라, 사람의 삶마저 포괄하는 것이다. 아 름답고, 잔혹하고, 그리고 작은 것에서 큰 상처를 받는 것이 자연이 다. 자연은 강하고 연약하다. 여행하면서 늘 생각하는 것은, 그 지방의 풍경을 내 것으로 만들려

면 거기서 누군가를 만나야 한다는 것이다. 그렇지 않으면 스크린을 바라보는 것과 같아서, 풍경은 결코 나와 참된 언어를 나누려 하지 않는다. 그런 여행을 할수록 세계는 그저 좁아지기만 할 뿐이다. 하지 만 누군가를 만나고 그를 좋아하게 되면 풍경은 비로소 폭과 깊이를 띠게 된다. 사람들은 저마다 2개의 소중한 자연을 가지고 있다. 일상생활에서

Crusing to Alaska

접하는 가까운 자연, 그리고 좀처럼 갈 수 없는 먼 자연이다. 먼 자연 은 비록 가볼 수는 없지만 상상하는 것만으로도 좋은 것이다. 거기에 그런 자연이 있다는 것만으로도 무엇인가를 상상할 수 있고 마음이 풍요로워진다.’ 세계적인 야생 동물 사진작가 호시노 미치오가 자신의 조국보다 사 랑한 알래스카는 그의 사진집 <알래스카, 바람 같은 이야기>(청어람 미디어)를 통해 우리에게 수많은 이야기를 전한다. 하늘과 땅이, 물과 바람이 맞닿은 알래스카의 드넓은 자연을 줄지어 걷는 사슴 떼와 눈 속을 거니는 북극곰, 향기가 궁금한 이름 모를 야생화와 다람쥐는 책 을 통해 우리를 알래스카로 떠나게 한다. 사람과 자연이 한데 어우러 진 몇 장의 사진만 보고도 당장 그곳으로 떠나고 싶은 충동을 일으키 게 하는 것이다. 호시노의 알래스카가 마음속 동경의 여행지 일순위로 자리 잡은 지 오래지 않아, 또 다른 알래스카 여행의 새로움을 알게 되었다. 그것도 아주 럭셔리한 방법으로.

112 Noblian


바다 위의 호텔, 럭셔리 크루즈 트래블 부드러운 아침 햇살과 신선한 공기를 가르며 피트니스 트랙을 따라 조깅을 하고, 세계 각국의 진미가 차려진 뷔페로 아침을 즐기며, 드넓 은 수영장에서 선탠을 한 후 트로피컬 주스 한 잔의 여유를 갖는다. 점심은 캐주얼 레스토랑에서 가볍게 즐긴 후 부티크에서 쇼핑하거나 선택 관광 코스를 통해 여행의 묘미를 더한다. 저녁에는 격식을 갖춘 정찬 갈라 디너 타임을 가지며 다양한 쇼를 관람한다. 칵테일 바에서 마티니를 한 잔 마신 후 카지노에서 흥겨운 나이트 라이프를 즐기며 하루를 마감한다. 유명 관광지의 일등급 호텔 이야기가 아니다. 바다 위에 떠다니는 호텔로 불리는 럭셔리 크루즈에서는 이 모든 것이 가능하다. 영화를 통해서나 감상하던 모두가 현실에서 이루어지는, 꿈의 궁전과도 같은 크루징의 세계는 놀라움 그 자체다. 열흘 이상의 긴 여행에서 커다란 여행 가방은 말 그대로 ‘짐’일 수밖에 없지만, 크루즈 여행이라면 세 계 각국을 돌아다니면서도 결코 짐을 꾸리고 풀 필요가 없다. 초호화 객실에서 편안히 수면을 취하는 동안 크루즈 선박이 다음 여행지로 안내하기 때문이다. 항해 중에는 지상 호텔에서 누릴 수 있는 모든 것을 경험하고 기항지에서는 관광을 즐긴다. 매일 이어지는 최고급 만찬이며 품격 있는 서비스와 부대시설 등을 감안한다면, 크루즈 여 행 경비가 결코 비싸지 않다는 생각을 하게 될 것이다. 오세아니아 크루즈Oceania Cruises는 바다 위에서 즐길 수 있는 최 상의 요리와 여정을 선보이는 대표적인 럭셔리 크루즈 회사. 5성급 호텔만큼 세련되고, 우아한 여행 경험을 찾는 이들을 위한 크루즈 노 선으로 이름난 곳이다. 오세아니아 크루즈에서 보유하고 있는 호화스 러운 중형급 배는 684명의 손님이 승선할 수 있으며 여느 선사의 배 와 비교할 수 없는 안락함과 편안함으로 여행을 즐길 수 있다. 승객 옆에는 항상 대기 중인 400명의 직원이 버틀러 서비스에 가까운 편

 0D\


리함을 선사하며, 4개의 고급 레스토랑에서 매일 정찬을 즐길 수 있 다. 세계적인 명성을 얻고 있는 셰프 자크 페팽Jacques Pe′ pin이 세 심하고 품격 높게 만든 요리를 경험하게 되는 것. 레가타Regatta, 인 시그니아Insignia and 노티카Nautica, 3척의 배는 전 세계의 낭만적 인 항구로 여행객을 안내한다. 그중에서도 알래스카로 떠나는 레티카호에 몸을 실어보자. 밴쿠버를 출발한 배는 서서히 움직이며 아름다운 알래스카를 꿈꾸게 한다. 12 일 동안 펼쳐질 여정에 대한 기대로 마음은 이미 아름다운 북극해 위 를 달리고 있다. 밴쿠버(캐나다) 캐나다 브리티시컬럼비아 주 남서부에 있는 도시. 밴쿠버라는 이름은 1792년 태평양 연안을 탐험한 조지 밴쿠버 선장의 이름에서 딴 것이 다. 캐나다 제3의 대도시로 조지아 해협의 버라드 만과 프레이저 강 의 삼각주 사이에 위치하며, 밴쿠버 섬과 마주 본다. 서부 캐나다 최 대의 상공업 도시이자 태평양으로 통하는 주요 무역항이기도 하다. 시가지는 남쪽에 프레이저 강의 삼각주 지대, 북쪽에 만년설이 있는 해안 산지(코스트 마운틴스)를 바라보며, 완만한 구릉이 펼쳐져 있다. 1월 평균 기온은 3℃, 7월 평균 기온은 18℃의 온난한 기후 아래 다양 한 자연환경에 둘러싸인 밴쿠버는 캐나다 제3의 대도시임에도 아름 다운 주택이 많아 조용한 휴양 도시 같은 인상을 준다. 석양으로 물 든 아름다운 저녁 바다를 향해 레가타호는 알래스카로 항해를 시작 한다. 싯카(알래스카) 이틀간 선상에서의 호화로움을 즐기고 도착한 첫 기항지는 알래스카 의 싯카 지역. 1867년 미국이 러시아에서 인수한 지역으로, 당시 이곳 에서 살던 틀링깃족과 러시아인의 삶과 경험을 기리기 위해 1972년 10월 18일에 세운 국립 역사공원 싯카 국립공원이 있다. 이곳은 ‘인디 언 강 공원’과 ‘토템 공원’으로도 알려져 있다. 아름다운 자연 경관을 즐기며 사이클링과 숲 속을 산책하거나 야생적인 바다에서는 카약 어드벤처를 경험할 수 있다. 수상 보트를 타고 야생 지역을 탐방하거 나 뗏목 투어를 하는 것도 이색 경험이 될 것이다.

 1REOLDQ


Dreaming on the sea,

Crusing o Alaska

아이시 스트레이트 포인트(후나-알래스카) 다음 날 기항지는 아이시 스트레이트 포인트. 미국 알래스카 주의 인 구 조사 구역으로 원래 스캐그웨이-후나 인구 조사 구역이었으나, 2007년 6월 5일 스캐그웨이 버러가 설립되면서 스캐그웨이는 제외 되었다. 아이시 스트레이트 포인트는 크로스 사운드와 글래시어 항구 의 교차점에서 서쪽으로 64km 떨어진 곳이다. 이곳에서는 북극해를 유영하는 돌고래 떼를 자주 만날 수 있고, 고래와 야행 곰도 가까이 서 볼 수 있다. 또 숲 속 트램 투어와 넙치 낚시도 매력적이다. 코디악(알래스카) 하루 동안의 허버드 빙하 항해를 마치고 6일째 도착하게 되는 곳은 코디악이다. 미국 알래스카 만 서부, 알래스카 반도 동쪽에 있는 섬이 다. 면적 1만3890km², 해발 고도 1500m 이상으로 전체적으로 산이 많다. 또 빙하 지형과 해안에는 협만이 많다. 1764년 러시아인 글로토 프가 발견한 뒤 모피와 어업 중심지로 발전해 1805년까지는 러시아 교역 회사의 근거지였다. 지금은 미국 군사 기지가 들어섰으며 세계 최대 코디악 곰의 서식지기도 하다. 이외에도 애버크롬비 지역의 자 연 공원 투어와 코디악 도시 탐방, 러시아 티 투어가 여행객을 기다 리고 있다. 랭글러(알래스카) 8일째 기항지인 랭글러. 미국 알래스카 주의 인구 조사 구역으로 알 래스카 주 남동쪽에 있으며, 동쪽으로는 캐나다와 접하고 있다. 명칭

115 January 2011


Dreaming on the sea, Crusing to Alaska

에는 랭겔이 포함되어 있으나, 2008년 6월 랭겔이 ‘랭겔과 버러’로 독립하면서 인구 조사 구역에서 제외되었다. 주요 도시는 피터스버그 이며, 그 밖에 카케・쿠프레아노프・토머스플레이스 등의 도시가 있 다. 인구는 백인 72.5%, 원주민 22.6%로 구성되어 있다. 오래된 목초 지 기차 투어와 목초지에서의 골프 체험은 이색적인 시간이 될 것이 다. 또 섬 탐사와 지역 문화 체험, 흔들리는 카누에서 보내는 즐거운 시간 역시 잊을 수 없는 소중한 경험이다. 케치칸(알래스카) 9일째의 기항지는 케치칸. 미국 알래스카 주 남동부에 있는 도시로, 알렉산더 군도의 리빌러기기도 섬에 위치한다. 인사이드 수로를 따라 펼쳐진 항구로, 항공 교통과 기선이 알래스카 해양 고속도로를 통해 연결된다. 천연 양항으로 어업・목재업・광산업・펄프업의 중심지이 다. 특히 연어・넙치 등의 어획량이 많으며, 1887년 연어 통조림 공장 이 도심 지역에 세워졌다. 이 밖에 관광업도 도시 경제에 크게 기여 하고 있다. 니츠 항에서는 수상 비행기를 타고 북극곰을 구경할 수도 있다. 안개 낀 피오르에서 해상 비행기를 타는 스릴을 만끽하고, 말을 타고 케치칸 지역을 투어하기도 한다. 또 위대한 알래스카 벌목꾼의 묘기를 감상하며 알래스카 요리사가 준비한 만찬을 즐긴다. 베링 해 에서는 꽃게잡이 투어를 즐기고 누손 동굴에서는 살몬 스포츠 낚시 를, 독수리 섬에서는 바다 카약을 체험한다. 케치칸 기항을 끝으로 레가타호는 아름다운 알래스카를 뒤로한 채 밴쿠버로 향한다. 10일간의 알래스카 여행의 환상적인 추억을 가득 실은 배는 길고도 매력적인 여정의 마지막 날을 아쉬워할 것이다.

116 Noblian


More Information 클럽토마스가 선보이는 알래스카 크루즈 여행 크루즈 전문 기업, ㈜클럽토마스는 오세아니아 크루즈의 알래스카 첫 취항을 기념하기 위해 12일 일정의 알래스카 크루즈를 특가로 판매한 다. 오세아니아 크루즈의 알래스카 첫 운항을 기념하기 위해 마련된 ‘알래스카 12일’ 상품은 619만~779만원의 특가로 6월 7일과 8월 4일 에 각각 출발한다. 12일의 항해 일정은 캐나다의 밴쿠버 항을 출발해 알래스카의 싯카, 코디악, 랭글러, 케치칸을 거쳐 밴쿠버로 귀항하게 된다. 크루즈 상품에는 크루즈 객실료, 항구세, 각종 세금, 항공권(이 코노미 클래스 기준), 크루즈 내 전일 식사, 사우나, 수영장, 피트니스 센터 등 부대시설과 선장이 주최하는 환영 정찬 파티를 포함한 선상 프로그램 이용, 선내 레스토랑에서 와인, 음료, 샴페인, 생수 무료 이 용, 밤마다 펼쳐지는 다양한 쇼가 포함된다. 오세아니아 크루즈는 2002년 설립된 하이클래스 프리미엄 선사로 바다 위에서 즐길 수 있는 최상의 요리와 여정이 장점이다. 5성급 호 텔만큼 세련되고, 우아한 여행을 위한 오세아니아는 684명이 승선할 수 있는 럭셔리한 3만 톤급 중형 크루즈로 승객 대 승무원의 비율이 2:1을 넘지 않고 400명의 승무원이 옆에서 항상 대기하며 승객의 요 구를 파악하고 세심하게 맞춤 서비스를 제공하는 고품격 서비스를 제공한다. 턱시도나 이브닝드레스 등 격식을 갖춘 차림이 필요 없고, 컨트리클럽과 같은 친절하고 편안한 분위기로 대형 크루즈 선은 갈 수 없는 작고 매력적인 항구를 항해하는 세련되지만 자유로움을 원 하는 당신을 위한 차별화된 크루징 스타일을 자랑한다. 오세아니아 레가타호는 90% 이상의 오션뷰 선실과 다수의 발코니 선실을 보유한 3만200톤급 럭셔리 선박. 월풀과 24시간 버틀러 서비 스가 포함된 프리미엄 스위트는 환상적인 여행의 즐거움을 선사한다. 세계적인 요리사 자크 페팽이 소개하는 특별한 메뉴와 타파스 요리, 플라멩코 기타 연주는 선박의 하이라이트. 그 외에도 세계 수준의 스 파, 1930년대 스타일의 스테이크 하우스 등 고품격 서비스가 가득한 크루즈 여행의 세계로 안내할 것이다. 문의 02-722-7590 n

 0D\


The Ultimate Shopping at THE SHILLA DUTY

FREE


duty free Flash

EDITOR PARK SUMIN COOPERATION THE SHILLA DUTY FREE (1688-1110, www.dfsshilla.com)

THE SHILLA DUTY FREE stores are the heart of the duty free shopping at Incheon International Airport. There would be possibly no place better than THE SHILLA for an ideal duty free shopping.

Exclusively special, offered by THE SHILLA DUTY FREE stores 120 Noblian


희망과 기쁨이 가득한 새해. 설렘으로 차오르는 마음을

출국 예정 고객 정보 입력 이벤트

주중 쇼핑 고객 Special Bread 증정 이벤트

더 따뜻하게 북돋워줄 반가운 소식이다. 바로 신라면세

‘출국 예정 고객을 위한 스페셜 이벤트’가 눈길을 끈다.

신라면세점 서울점은 주중 오전 시간대 신라면세점을

점에서 새해맞이 이벤트가 화려하게 펼쳐지는 것. 신라

오는 2월 6일까지 신라인터넷면세점(www.dfsshilla.

찾은 고객을 위한 감사 이벤트를 준비했다. 월요일부터

면세점 전점에서는 OK캐쉬백 포인트 사용과 적립도

com)에 접속해 본인의 해외 출국 일정을 입력하면, 신

금요일까지 오후 1시 이전에 $200 이상 구매한 고객에

모두 가능하다. 신라면세점에서 준비한 선물이 한 가득

라면세점 서울점과 인천공항점에서 사용 가능한 사은

게 신라호텔 베이커리 명장이 준비한 신라면세점 ‘스페

이다. 여행을 떠나는 이라면 신라면세점으로 부지런히

권 2만원권을 선물로 받을 수 있다. 이번 이벤트에 매

셜 브레드’를 증정한다(1일 선착순 50명 한정).

발걸음을 옮겨야겠다.

일 500명 이상 참여하면 인터넷면세점 할인쿠폰, 적립

새해맞이 구매 금액별 선불카드 증정 행사

금 등이 추가로 증정된다니 지인들과 함께 참여해보도

아시아나 항공 쇼핑 마일리지 적립

록 하자.

신라면세점 회원 카드를 소지하고 한국 출발 아시아나

신라면세점 서울점과 인천공항점에서 1월 7일부터 2월

항공편을 이용하는 아시아나 클럽 회원이라면 신라면

10일까지 신년 첫 ‘구매 금액별 선불카드 증정 이벤트’

제휴 상품권 사용 고객 Special Gift 증정

세점 서울점에서 쇼핑 금액 US $1당 1마일을 적립할 수

가 펼쳐진다. 행사 기간에 $500/ $1,000/ $1,500/

신라면세점 서울점은 설날을 맞아 1월 7일부터 2월 10

있는 좋은 기회를 놓치지 말자. 쇼핑 전 신라면세점 지

$2,000/ $2,500 이상 구매하면 신라면세점에서 현금

일까지 ‘제휴 상품권 사용 고객을 위한 스페셜 기프트

하 1층 안내데스크에 본인의 여권과 신라면세점 멤버스

처럼 사용할 수 있는 선불카드 1만/2만/3만/4만/5만원

증정 행사’를 준비했다. 이 기간에 삼성상품권, 신세계

카드, 아시아나 클럽 회원카드를 제시하면 마일 적립

권을 받을 수 있다. 또 화장품 구매 금액별 선불카드 증

상품권, 호텔신라상품권, 삼성플라자, 롯데백화점, 애경

신청을 할 수 있다.

정 행사도 펼쳐지는데, 신라면세점 서울점과 인천공항

상품권, 홈플러스상품권, 이랜드상품권, 오크밸리상품

점에서 $200/ $300 이상 구매할 경우 선불카드 1만/2

권, 갤러리아상품권, 제일모직상품권으로 구매하는 고

만원권을 증정한다.

객은 신라면세점이 준비한 특별한 선물을 받을 수 있다 니 기대해도 좋을 듯. The Shilla Wedding Fair 신라면세점 서울점・인천공항점・인터넷면세점・제주 점은 1월 31일까지 ‘더 신라 웨딩 페어’를 진행한다. 청 첩장 또는 예식장 계약서 소지 고객에게는 15~5%의 할인 혜택이 주어지는 신라면세점 멤버스 골드 등급 카 드를 발급해주며, $800/ $1,300/ $1,800/ $2,300/ $2,800 이상 구매할 경우 상품권 2만/4만/6만/8만/10 만원권을 선물한다.

121 January 2011


duty free Selection

EDITOR PARK SUMIN COOPERATION THE SHILLA DUTY FREE (1688-1110, www.dfsshilla.com)

Italian fashion house CANALI arrives nowhere but the SHILLA DUTY FREE SEOUL. Greet the essence of suit style, through CANALI’s perfect tailoring based on elaborate craftsmanship.

“It” items of THE SHILLA DUTY FREE 122 Noblian


미국의 버락 오바마 대통령이 즐겨 입는 브랜드로 그

까날리, 할리우드의 상징이 되다

정통 테일러링과 모던한 감각의 조우,

명성을 다시 한 번 세계에 알린 이탈리안 슈트 하우스

1992년 에디 머피가 주연한 영화 〈The Distinguished

2011 S/S Collection

‘까날리CANALI’가 오는 2월 신라면세점 서울점을 찾는

Gentleman〉을 시작으로 말쑥한 더블 슈트의 진 해크

까날리에서 전개하고 있는 2011 S/S 컬렉션은 현대적

다. 올해로 75주년을 맞는 이탈리안 슈트 하우스의 신념

먼이 출연한 〈The firm〉과 〈The Runaway Jury〉, 조지

이면서도 독창적으로 발전한 포멀 웨어와 다이내믹한

과 그 변치 않는 가치를 신라면세점을 통해 만나보자.

클루니의 〈Michael Crayton〉, 니콜라스 케이지의

에너지가 넘치는 레저 웨어로 구성돼 있다. 2가지 룩의

〈Beyond a Reasonable Doubt〉 등에서 까날리는 그

공통점은 클래식함을 잃지 않으면서도 모던한 터치를

진가를 발휘한다.

적절히 조화시킨 것.

슈트, 정점에 서다 최고급이 아니면 가치를 두지 않는 원단에 대한 고집,

안토니오 반데라스, 리처드 기어, 벤 애플렉, 윌리엄

우선 포멀 라인에서는 더욱 슬림한 라인의 재킷과 넥

디테일한 부분까지 정성을 다하는 세심함, 입었을 때

허트, 로버트 드니로 등 수많은 배우들이 사랑하는 슈

타이, 스포티함이 묻어나는 팬츠 등이 등장했는데 펄

비로소 빛을 발하는 스타일. 이는 모두 까날리의 변치

트 역시 까날리다. 최근 마이클 더글러스가

그레이, 코럴 핑크, 브라운 등의 뉘앙스와 네이비 블루

않는 신념이다. 1934년, 조반니Giovanni & 지아코모 까

〈Wallstreet〉에서 입고 나온 까날리 슈트는 진정한 신사

등의 컬러를 믹스해 한층 세련된 모습이다. 면과 실크

날리Giacomo Canali 형제가 설립한 브랜드는 현재

의 멋을 보여줬다. 할리우드 의상 디자이너들은 이탈리

혼방, 캐시미어와 실크 혼방, 140수의 울로 된 클래식

800여 나라의 1000여 판매 지점과 160여 부티크에서

아 클래식 슈트인 까날리야말로 젠틀한 남성상을 표현

한 소재부터 스톤 워싱 처리된 다양한 니트는 선택의

만나볼 수 있는 글로벌 패션 하우스로 성장했다. 까날

하는 데 더할 나위 없는 브랜드라 평가하고 있다. 수많

폭을 넓혔다. 마지막으로 다채로운 레더로 핸드메이드

리의 전 제품은 밀라노 소비코Sovico 본사와 7개의 이

은 명사와 스타들 역시 같은 이유로 까날리를 찾는다.

제작된 구두와 여행용 가방 등 액세서리는 까날리 스타

탈리아 현지 생산 기지를 연결해 제작된다. ‘Made In

일에 중요한 마침표를 찍는다.

Italy’라는 자부심은 숙련된 장인들의 한 치 오차도 없는

레저 라인은 산뜻하고 재기 발랄한 에너지가 느껴지는

완벽한 커팅, 그리고 전통 핸드메이드 방식의 테일러링

스타일이 주를 이룬다. 캐주얼하지만 까날리 특유의 럭

에 의한 것.

셔리함을 고스란히 간직하고 있는 다양한 디자인의 아

까날리의 모든 재킷과 오버코트에서는 다른 브랜드에

웃 웨어는 깃털처럼 가벼운 슈퍼 사파리 재킷, 블루종,

서 흔히 볼 수 있는 캔버스 심지를 찾을 수 없다. 캐멀,

트렌치코트, 스프링 재킷, 저지 재킷 등으로 소개됐다.

말총 원단 같은 고급 소재를 사용, 신체의 굴곡에 따라

고급 면부터 실크, 마이크로파이버, 다른 원단과 블렌

자연스럽게 흐르도록 비접착식 수제 테일러링을 하기

딩한 캐시미어, 레더 등의 소재는 파피루스, 그레이 멜

때문이다. 봉제하기 전, 맞춤복 가봉 형태의 시침 과정을

란지, 민트 등의 부드러운 컬러 톤과 블루&블랙의 시원

거친 후에야 비로소 제품이 탄생하기 때문에 착용했을

한 컬러감과 어우러져 까날리만의 매력을 내뿜고 있다.

때 어깨와 암홀 부분에서 더 없는 편안함이 느껴진다. 그뿐만이 아니다. 까날리는 최고급 프레스티지 원단과 오리지널 블렌딩 패브릭을 만들기 위해 최상위급 원사 생산지를 발굴하는 데 드는 노력과 시간을 아끼지 않는 다. 클래식하고 정교함으로 대표되는 까날리만의 스타 일은 울・앙고라・캐시고라 등의 고급 소재와 블렌딩 된 슈퍼 160수 또는 슈퍼 200수의 럭셔리 원단으로 만 들어져 극대화된 가벼움과 부드러움을 느낄 수 있다.

123 January 2011


Moonlight PHOTOGRAPHER KIM JEWON STYLIST HAN YOUNGU HAIR LEE ENOC MAKEUP LEE JIYOUNG MODEL KAROLINA ASSISTANT LEE AHRAN COOPERATION Dior(513-3232)

Blossom


Grey jacket& black chiffon skirt, pearl detail mini bag, black bootie all Dior


Flower print tiered dress, pink sandal all Dior


Black dress, red watch, patent bag, black shoes all Dior


Ruffle detail knit dress, red watch all Dior


Silver tiered dress, black shoes all Dior


Romantic white cloche dress is Dior


Navy dress Dior, pink patent bag, black mini watch, black sandal all Dior


Stripe jacket, leather pants, black shoes, bag all Dior hat stylistâ&#x20AC;&#x2122;s own


Dress up his wrinkle with cufflinks EDITOR WON JONGMYUNG COOPERATION MONTBLANC(3485-6627) S.T. Dupont(2106-3446) SWAROVSKI(543-7685) Alfred Dunhill(3440-5615) Ermenegildo Zegna(2016-5325)

Just a small size of cufflinks has this huge power to style up your beloved gentlemen. This is a key item that you need to make your suit style perfect.


MONTBLANC

NAME KYUNGHWAN KIM AGE 34 PROFESSION COMPUTER PROGRAMMER STYLE KEYWORD GOLD IS FOREVER

NAME HYUNSUK LEE AGE 42 PROFESSION ARCHITECT STYLE KEYWORD 3 SILVER RINGS

NAME JAEMIN YANG AGE 36 PROFESSION VISUAL MERCHANDISER STYLE KEYWORD BLUE MOTHER OF PEARL

NAME SANGHYUN LEE AGE 38 PROFESSION TEACHER STYLE KEYWORD BLACK IS MINE

NAME JUNSUP YOON AGE 41 PROFESSION TRAVEL AGENT STYLE KEYWORD MECHANISM OF STAR

NAME JUNGHWAN AHN AGE 35 PROFESSION ACCOUNTANT STYLE KEYWORD 3 GOLD RINGS

NAME YOUNGJUN SON AGE 44 PROFESSION LAWYER STYLE KEYWORD FLOATING DIAMOND

NAME SANGIN PARK AGE 37 PROFESSION CHEF STYLE KEYWORD MY PRECIOUS

NAME HYUNGJUN KIM AGE 39 PROFESSION EDITOR STYLE KEYWORD STERLING SILVER STAR


S.T. Dupont

NAME JUNGSIK LEE AGE 33 PROFESSION NOVELIST STYLE KEYWORD SILVER PUZZLE

NAME JUNGMIN HWANG AGE 41 PROFESSION PROFESSOR STYLE KEYWORD BLACK STRUCTURE

NAME SUKWON JUNG AGE 30 PROFESSION FASHION DESIGNER STYLE KEYWORD DENSITY OF SILVER

NAME YOUNGMIN WON AGE 37 PROFESSION HOTELIER STYLE KEYWORD BLACK AND WHITE VARIATION

NAME SUNGTAE KIM AGE 40 PROFESSION FLORIST STYLE KEYWORD RED GOLD CUBE

NAME DONGHYUK SON AGE 32 PROFESSION LANDSCAPE ARCHITECT STYLE KEYWORD SENSUAL ENCOUNTER

NAME HOYOUNG KANG AGE 36 PROFESSION ACTOR STYLE KEYWORD WHOLE BODY IS WEAPON

NAME YOUNGMIN KOO AGE 31 PROFESSION PAINTER STYLE KEYWORD BRILLIANT JADE

NAME JAEHOON KIM AGE 42 PROFESSION PHYSICIST STYLE KEYWORD HIDE AND SEEK


SWAROVSKI

NAME DAEHO JO AGE 36 PROFESSION STYLIST STYLE KEYWORD WHITE DIAMOND

NAME DOWON LEE AGE 32 PROFESSION SCULPTOR STYLE KEYWORD BLUE SAPPHIRE

NAME BYUNGHO YANG AGE 40 PROFESSION CONDUCTOR STYLE KEYWORD RED SHIELD

NAME KYUWAN LIM AGE 31 PROFESSION COLORIST STYLE KEYWORD PINK RUBY

NAME JANGHUN SEO AGE 35 PROFESSION MODELIST STYLE KEYWORD MOONCARBON

NAME HYUNSUNG HWANG AGE 32 PROFESSION REVIEWER STYLE KEYWORD SILVER CRYSTAL

NAME KYUNGIN KIM AGE 37 PROFESSION ORIENTAL DOCTOR STYLE KEYWORD GREEN SHIELD

NAME JONGIL WON AGE 45 PROFESSION RESEARCHER STYLE KEYWORD RED SAPPHIRE

NAME MINKYU KIM AGE 34 PROFESSION SOMMELIER STYLE KEYWORD BLACK DIAMOND


Alfred Dunhill

NAME SEJONG MOON AGE 36 PROFESSION MARKETER STYLE KEYWORD SILVER WHEEL

NAME DOHYUNG PARK AGE 38 PROFESSION INVENTOR STYLE KEYWORD TOWARD THE CENTER

NAME JONGHYUN SEO AGE 37 PROFESSION INTERIOR DESIGNER STYLE KEYWORD PINK CIRCLE TWIRL

NAME HYUNHO KIM AGE 32 PROFESSION PSYCHIATRIST STYLE KEYWORD PERFECT STABILITY

NAME HYUNJAE SHIN AGE 35 PROFESSION COPY WRITER STYLE KEYWORD CHANDELIER GOLD WINE

NAME YOUNGBIN OH AGE 31 PROFESSION GRAPHIC DESIGNER STYLE KEYWORD MY LOVELY SWEETHEART

NAME SEYOUNG JO AGE 39 PROFESSION CURATOR STYLE KEYWORD GOLD BULLION

NAME JUNMO LEE AGE 34 PROFESSION POLICEMAN STYLE KEYWORD AIRSHIP IS FLYING

NAME JINWOO YANG AGE 45 PROFESSION ART DIRECTOR STYLE KEYWORD ALL 4 ONE


Ermenegildo Zegna

NAME LIM LEE AGE 32 PROFESSION FASHION MODEL STYLE KEYWORD HORIZONTAL SYMMETRY

NAME CHUNGHWAN SEO AGE 43 PROFESSION PATENT AGENT STYLE KEYWORD BLACK ORIENTALISM

NAME SEOJUN MUN AGE 36 PROFESSION BALLERINO STYLE KEYWORD BLUE DICE

NAME SEOKJUN OH AGE 38 PROFESSION ILLUSTRATOR STYLE KEYWORD COLOR ILLUSION

NAME EUNSOO JUNG AGE 40 PROFESSION PILOT STYLE KEYWORD BASALT OF BLACK DOT

NAME CHIHO LEE AGE 31 PROFESSION PHOTOGRAPHER STYLE KEYWORD TIME CAPSULE

NAME HYUNGJAE JANG AGE 43 PROFESSION SINGER STYLE KEYWORD NEON BLUE

NAME JINWOO KIM AGE 38 PROFESSION MOVIE DIRECTOR STYLE KEYWORD VERTICAL SYNC

NAME HONGJUN LEE AGE 45 PROFESSION WEB DESIGNER STYLE KEYWORD GRAY CRESCENT


Show your love for the world around you with nature inspired jewelry collection. These magnificent plant and animal themed gems will keep you feeling connected with mother nature.

EDITOR PARK SHINHYUN COOPERATION BVLGARI(2056-0172) VAN CLEEF&ARPELS(3479-6032) CHAUMET(3442-3159) BOUCHERON(543-6523) CHOPARD(2118-6085) YSL(3444-3189)

Nature of the shiny


From top High jewerly necklace completed with emeralds, garnets, diamonds. BVLGARI Cameleon pop caption of 2009's animal collection. BOUCHERON Tuileries clip inspired by natural power of life. Van Cleef&Arpels Animal collection earring Chopard


From top High jewerly necklace completed with rubellites, emerald beads, sapphire beads, garnets and round brilliant cut diamonds. BVLGARI Animal collection earring Chopard


From top Cameleon brooch of 2009's animal collection. BOUCHERON Desert flower clip from High jewerly collection Van Cleef&Arpels Attrape-moi extension line citrine ring completed with round cut pink tourmaline and brilliant cut diamonds CHAUMET


From top High jewerly necklace completed with central star sapphire, round & pear cut diamonds, fancy colour sapphire BVLGARI Animal collection earring Chopard Caligo earclips of high jewerly collection Van Cleef&Arpels


From top Pink quartz turtle ring BOUCHERON High jewerly necklace completed with peridots, coral beads, round-shape amethysts and diamond pave setting BVLGARI Earrings of sapphire flower collection BVLGARI Gold necklace of 2011 cruise collection YSL


EDITOR PARK SUMIN COOPERATION CHANEL(3708-2718) sisley(080-549-0216) ÂŻ E LAUDER(3440-2772) ESTE la prairie(080-511-6626) SHISEIDO(3456-0174)

Whitening is back Focus on whitening skin care based on ABC steps. Here we have a compass for you, to make your skin to get whiter with gloss.


‘Le Blanc Collection’ magically removes skin problems thanks to its functions of multifunction element called TXC™, pearl protein, mineral ceramic pigment, and makes your skin naturally shine. CHANEL


â&#x20AC;&#x2DC;Phyto Blanc Collectionâ&#x20AC;&#x2122; controls melanin thanks to its vitamin C and other natural activating elements. sisley


‘CyberWhite Brilliant Cells Collection,’ which is to be released in March, offers Full Spectrum Brightening System, as a solution to four major melanin problems of the skin. ¯ E LAUDER ESTE


â&#x20AC;&#x2DC;White Caviar Illuminating Systemâ&#x20AC;&#x2122; boasts Golden Imperial Caviar element with rich Omega 3 and firms, lifts, whitens and brightens your skin. la prairie


â&#x20AC;&#x2DC;White Lucent' intensively takes care all kind of die-hard dark spots thanks to its 3 of powerful whitening elements. SHISEIDO


COOPERATION SEOUL MUSEUM OF ART(1577-8968)

EDITOR PARK SHINHYUN

Seoul Museum of Art is opening <Chagall: Magician of Color> exhibition through March 27 of 2011. This exhibition pays tribute to the painter who wanted to bring meanings of love through glamor of color.

Chagall, colored in love


â&#x201C;&#x2019;Marc Chagall/ADAGP, Paris-SACK, Seoul, 2010 Chagall (R)

Musees Royaux des Beaux Arts de Belgique, Bruxelles Inv. 11108

61.8 x 48.9 cm

Pencil, watercolour, gouache on paper

1912

I and the Village

gallery 01


â&#x201C;&#x2019;Marc Chagall/ADAGP, Paris-SACK, Seoul, 2010 Chagall (R)

The State Tretyakov Gallery, Moscow, Russia

212.5 x 103.2 cm

Tempera, gouache on canvas

1920

Music

gallery 02


â&#x201C;&#x2019;Marc Chagall/ADAGP, Paris-SACK, Seoul, 2010 Chagall (R)

Tate: Presented by the artist 1953, London

34.9 x 26.7 cm

Oil on canvas

1950

The Blue Circus

gallery 03


â&#x201C;&#x2019;Marc Chagall/ADAGP, Paris-SACK, Seoul, 2010 Chagall (R)

The State Russian Museum, St. Petersburg, Russia

175.2 x 168.4 cm

Oil on canvas

1917-1918

Promenade

gallery 04


â&#x201C;&#x2019;Marc Chagall/ADAGP, Paris-SACK, Seoul, 2010 Chagall (R)

The State Tretyakov Gallery, Moscow, Russia

139 x 197 cm

Oil on canvas

1914-1918

Over the Town

gallery 05


â&#x201C;&#x2019;Marc Chagall/ADAGP, Paris-SACK, Seoul, 2010 Chagall (R)

Private collection, Paris

99 x 72 cm

Oil on canvas

1927

Bride with a Double Face

gallery 06


â&#x201C;&#x2019;Marc Chagall/ADAGP, Paris-SACK, Seoul, 2010 Chagall (R)

Albright-Knox Art Gallery, Buffalo, New York

100.01 x 80.01 cm

Oil on canvas

1925

Peasant Life

gallery 07


The center of the world EDITOR YOON YONGGIL COOPERATION BMW KOREA(3441-7800)

the BMW 760Li

160 Noblian


BMWâ&#x20AC;&#x2122;s finest and best flagship sedan 760Li remains true to its title as the best automobile on Earth, as it shines with the finest technology that BMW has to offer.

161 January 2011


162 Noblian


BMW 뉴 760Li의 시동을 켜고 부드럽게 액셀을 밟아 도로 위를 미끄러지듯 달려

에 앉게 될 그분에겐 최고의 기능 중 하나가 아닐까 싶다. 적어도 ‘쾅’ 하는 소음

나가는 순간 가졌던 처음의 느낌을 에디터는 이렇게 기억한다. ‘여유로운 V12 사

을 내며 도어가 닫히는 일은 없을 테니까. 운전석에 앉아 실내로 눈을 돌려보니

운드에 심취해 세상의 중심이 된 듯한 기분’.

메리노 가죽 시트와 알칸타라 가죽으로 씌운 천장이 가장 먼저 눈에 들어온다.

미드십 엔진의 수퍼카에서나 느낄 수 있는 순발력을 확인하기 위해 몇 번의 주

메리노 가죽은 최고급 핸드백을 만드는 것과 동일한 공정을 거치는 가죽 시트의

행 테스트를 한 에디터는 실제로 비행기가 이륙하는 듯한 가속력을 경험했다. 신

최고품인 데다, 알칸타라 가죽은 이 차가 단순히 뒷자리만을 우선으로 하는 재미

체 건강한 에디터가 실제로 현기증을 느낄 정도로 이 모델이 지닌 출력과 마력은

없는 차가 아님을 증명한다. 아무리 뒷좌석만을 위한 플래그십 세단이라도 드라

엄청난 것이리라. BMW 5세대 7시리즈 라인업의 최상위급 모델인 BMW 뉴

이빙의 재미를 결코 양보할 수 없음을 BMW는 잘 알고 있기 때문이다. 여기에 최

760Li는 V12가 장착되어, 5250rpm에서 최고출력 544마력, 1580rpm에서 최대토

고급 우드트림과 소재 등이 세밀한 조화를 이루며 뒷좌석 전용 모니터와 iDrive,

크 76,5kg/m로 이전 모델보다 출력은 22% 토크는 25% 이상 향상되었다. 구형

뒷좌석 개별 도서와 냉장고 등 동승자만을 위한 첨단 시스템을 갖춰서 최고급 프

모델보다 비약적으로 발전한 덕분에 0~100km/h를 단 4.6초 만에 돌파하는 스

리미엄 세단만의 분위기를 완성한다. 더불어 신규로 추가된 ‘이피션트 다이내믹

피드도 놀랍다. 새롭게 적용된 고정밀 직분사 및 트윈터보 시스템의 위력을 실감

스’ 디스플레이가 더해져 럭셔리 인테리어의 정점을 이루게 된다.

하기에 충분한 펀치력을 예상하게 한다. V12로 얻은 출력은 현재 BMW의 V8 엔 진으로도 충분히 500마력 이상의 엔진을 만들어낸다. 최고의 플래그십 세단이라

정숙함과 최첨단이 만났을 때 실내를

는 상징성과 V12에서 만들어내는 여유로운 회전 감성은 프리미엄 세단을 만드는

둘러본 후 엔진 스타트 버튼을 누르니 V12 엔진 특유의 낮게 깔린 시동음과 함께

BMW의 철학이 녹아든 결과물로 또 하나의 BMW의 혁신적 창조물이라는 평가

차 내부는 시동 여부를 확인할 수 없을 정도로 정숙하다. 일반 시내 주행으로 부

를 얻기에 충분하다.

드럽게 달리고 있자면 엔진 소리는 실내로 거의 유입되지 않을 뿐만 아니라 도로 위 버스에서 들리는 디젤 소음마저 차단하며 세상과 격리된 듯한 느낌을 들게 한 새로운 변신을 위한 또 다른 무장 새

다. 여유로운 엔진 회전수로 인한 V12의 정숙성은 물론 방음 기술 또한 더해진

로운 외관 디자인은 사진으로만 접했을 때 보이지 않던 세련미와 섬세함을 물씬

것. 여기에 BMW 최초로 적용된 8단 자동 변속기가 결합되어, 강력한 성능을 발

풍기며 구형의 흔적을 깔끔히 벗은 듯하다. 수직으로 선 키드니 그릴과 길고 낮

휘하면서도 효율적인 기어 변환을 통해 이 같은 성능과 정숙함을 동시에 느끼게

아진 보닛은 완만한 곡선을 그리며 새로운 스타일로의 변화된 메시지를 전달하

하는 것이다.

고 있다.

이처럼 최고급 프리미엄 세단임을 알리는 타이틀을 얻으려면 새로운 안전 기능

시승을 위해 운전석 도어를 열고 다시 살짝 닫는 순간 자동 잠금장치가 스스로

을 비롯한 최첨단 기능이 탑재되어야 함은 기본이다. 주행 시 가장 좋은 최첨단

작동한다. 최고급 세단에서만 느낄 수 있는 호사같아 처음에는 좀 어색했지만 익

기능을 꼽자면, 앞뒤 엑셀을 제어하는 인테그럴 액티브 스트어링 시스템을 우선

숙해지니 최고급 프리미엄 세단에 꼭 필요한 기능이라는 생각이 든다. 또 뒷자리

으로 들 수 있겠다. 기존 구형 모델보다 주행 중 회전 반경을 70cm나 줄였으며,

163 January 2011


164 Noblian


저속에서 더 쉽게 방향을 전환할 수 있게 보완했다. 쉽게 말해 전장이 5212mm나

로 야간 운전 시에도 최고의 안전 기준을 제공한다. BMW는 지난 수년 동안 운전

되는 대형차가 국산 중형차보다 회전 반경이 짧다는 것. 이는 국내 좁은 도로 사

자가 야간에도 더 편리하게 운전할 수 있도록 혁신적인 헤드라이트 기술 개발에

정을 고려할 때 가장 중요한 기능이 아닐까 싶다.

몰두해왔다. 하이 빔 어시스트High Beam Assist도 야간 주행을 위한 첨단 기능

이와 함께 뉴 760Li에는 국내에 소개된 BMW 모델 중 최초로 브레이크 에너지

이다. 인공 지능으로 통제되는 라이트 빔으로, 빛의 발자국을 확장함으로써 운전

재생 기술이 적용되었다. 이피션트 다이내믹스 기술 중 하나인 브레이크 에너지

자의 시야를 자동적으로 넓혀주며, 야간 운전 시 50km/h 미만의 속도로 주행하

재생 기술은 브레이크 페달을 밟거나 가속 페달에서 발을 떼면 운동 에너지가 배

는 전형적인 도시 불빛 상태에서 다가오는 양쪽, 반대편 차량을 쉽게 인식할 수

터리로 전달되어 충전되는 시스템으로, 엔진에서 배터리로 전달되는 동력을 줄

있도록 빛을 분포하게 되는 것. 고속도로에서는 라이트 빔을 더 멀리 비추어 왼

여 연료 소비를 줄이고 반대로 운전자가 가속 페달을 밟으면 발전기가 구동계통

쪽의 다가오는 차량들의 조도를 더 크게 확장해 비춰준다.

으로부터 분리되어 가속 시 엔진 출력을 더 높이는 기술을 말한다. 이 밖에도 운

지금까지 소개한 뉴 760Li의 첨단 기능 중 드라이버를 위한 또 하나의 편리한

전자 보조 시스템인 차선 이탈 방지 장치Lane Departure Warning, 사람 인식 기

기능을 찾는다면 그건 헤드업 디스플레이 기능이다. BMW에서 선보인 헤드업 디

능이 포함된 나이트 비전Night Vision, 헤드업 디스플레이, 백업 카메라 및 사이

스플레이Head-up Display는 내비게이션 방향 안내와 차량 속도, 차량 상태 등

드 뷰 시스템과 함께, 운전 시 편의성을 제공하는 한글 내비게이션 시스템도 기

의 중요한 정보를 앞 유리창에 반사해 운전자의 시선상에 나타내어 드라이버 전

본 적용되어 있다. 특히 안전에 직접적 역할을 하는 차선 이탈 경고 장치는 주행

방의 교통 상황을 주시하면서 동시에 중요한 정보들 대부분을 확인할 수 있게 한

차선을 이탈할 경우 운전자에게 자동으로 경고하는 시스템으로 시속 70km 이상

다. 헤드업 디스플레이 모니터에 나타난 정보를 읽는 데 소요되는 시간은 계기판

상태에서 방향 지시등을 켜지 않았거나, 브레이크의 조작 없이 차체가 중앙선을

에서 정보를 읽는 데 필요한 시간의 절반 정도에 불과하며, 전방 차량의 브레이

침범해 옆 차선을 넘으면 강력한 진동이 스티어링 휠에 전달된다. 음주 운전보다

크 등을 보지 못하는 등의 위험한 상황을 최소화할 수 있다. 실제로 헤드업 디스

무섭다는 졸음 운전이나 급차선 변경의 위험에 대한 안전장치를 BMW 7시리즈

플레이를 사용하면 도로에서부터 계기판으로의 주의력 이동 빈도수가 최대 90%

에서 경험할 수 있는 것이다.

까지 감소하는 것이 실험을 통해 밝혀졌다. 차선 이탈 방지 장치, 사람 인식 기능이 포함된 나이트 비전, 헤드업 디스플레이, 야간 드라이빙의 안전성과 여유로움

백업 카메라 및 사이드 뷰 시스템, 인테그럴 액티브 스티어링, 어댑티드 헤드라이

어두운 곳에서 자동차를 운전할 때는 낮보다 더 많은 집중력이 필요하며 더 많은

트 등 첨단 장치들의 집합체. 일일이 열거하기에도 벅찰 만큼의 다양한 최첨단

위험 요소와 맞닥뜨리게 된다. 유럽 자동차 제조업체 가운데 BMW가 최초로 실

기능을 갖고 있는 BMW 뉴 760Li야말로 이 시대 진정한 럭셔리 세단이라는 수식

현하는 적외선 나이트 비전 시스템은 이러한 위험을 경감할 수 있는 혁신적인 기

어를 주저 없이 붙일 수 있을 것이다. 드라이빙은 물론, 정차 시 시트에 앉아만

술을 갖고 있다. 이 시스템은 하이 빔보다 더 먼 거리까지 커버해주고 있으며, 어

있는 순간에도 만족스러움을 얻을 수 있는 자동차가 바로 BMW 뉴 760Li인 것이 다. 아직도 여유로운 V12 사운드의 부드러움이 온몸으로 전해지는 것 같다. n

두운 곳에서 전조등 불빛이 미치지 못하는 곳까지 볼 수 있도록 도와주는 기능으

165 January 2011


Contemporary l i f e s t y l e destination, THE SHILLA


The Shilla Flash

EDITOR JUNG JALIM

COOPERATION THE SHILLA JEJU (1588-1142, www.shilla.net/jeju)

Childrenâ&#x20AC;&#x2122;s winter paradise Jeju Shilla

For children in winter vacations, Jeju Shilla Hotel is truly a paradise, as it is armed with variety of childrenoriented programs, camping zone for families and a Kidsâ&#x20AC;&#x2122; Island where children can have dreams-come-true experiences. 168 Noblian


겨울방학 어린이 프로그램

제주신라호텔이 선보이는 국내 호텔 최초 야외 캠핑장

국내 최고 수준의 어린이 체험 문화 공간 제주신라호텔

겨울방학이다. 다양한 체험 프로그램을 찾는 학부모들

아이들과 함께 즐거운 추억을 남길 수 있는 캠핑장을

키즈 아일랜드

을 위한 희소식은 바로 제주신라호텔 키즈 프로그램.

이용해보는 것은 어떨까? 요즘은 신문이나 TV 같은 매

제주신라호텔 ‘키즈 아일랜드’는 기존 키즈 클럽과 3가

신나는 모험의 세계가 펼쳐지는 제주신라호텔 ‘키즈 아

체에서 캠핑 관련 기사를 쉽게 찾아볼 수 있을 만큼 캠

지 면이 다르다.

일랜드’는 다양한 놀이와 체험 프로그램 시설이 총 5개

핑이 대세다. 하지만 캠핑을 위해 떠난다는 것이 말처

첫째, 연령별로 그 나이의 특성에 맞는 다양한 놀이 시

의 섹션으로 구성되어 있으며, 실내 수영장 옆에 위치

럼 쉬운 일만은 아니다. 바쁜 일상 속에서 캠핑을 하기

설과 프로그램을 갖추고 있다는 것. 영・유아를 대상으

하고 있어 섬처럼 물과 맞닿은 모습이 ‘키즈 아일랜드’

위해 준비해야 할 도구와 음식이 부담스러울뿐더러 캠

로 하는 ‘짐보리’와 5세 이상의 어린이를 대상으로 하

라는 이름과 잘 어울린다. 키즈 아일랜드는 제주도에

핑이 낯선 사람들에게는 막막하기까지 하다. 또 안전과

는 ‘키즈 아일랜드’는 성별과 연령을 고려한 다양한 프

있는 어린이들만을 위한 또 다른 섬이라는 뜻도 가지고

위생을 걱정하는 사람들도 있다.

로그램과 시설을 갖추고 세분화된 어린이들의 호기심

있다. 키즈 아일랜드에서 운영하는 다양한 키즈 프로그 램은 자녀에게 멋진 경험과 추억을 선사할 것이다.

제주신라호텔이 여러 이유로 캠핑을 떠나지 못하고 있 는 가족들의 고민을 해결했다. 안전과 위생은 물론 텐

을 충족시켜줄 뿐 아니라 온 가족이 함께 즐길 수 있도 록 맞춤 프로그램을 제공한다.

쿠킹 클래스는 쿠키 만들기와 케이크 만들기로 이루어

트(텐트는 모두 스노 피크 제품 사용), 야외 테이블, 그

둘째, 키즈 아일랜드는 어린이를 위한 시설인 만큼 모

지며 매일 밤 8~9시, 9~10시에 하루 2번 진행된다.

릴, 파라솔, 이동식 난로 등 모든 캠핑 도구에서 바비큐

든 면에서 안전을 최우선으로 했다. 실내 인테리어는

일반 호텔이 연회장을 쿠킹 클래스룸으로 쓰는 것과 달

재료까지 캠핑에 필요한 모든 준비 끝! 무엇보다 환상

모두 친환경 제품을 이용했으며 실내는 모서리가 없도

리 제주신라호텔은 키즈 아일랜드 안에 어린이 체격에

적인 것은 이국적인 분위기의 숨비 정원의 아름다운 경

록 원형으로 디자인했다. 바닥재는 아토피가 있는 아이

맞는 테이블과 의자를 갖춘 어린이 전용 쿠킹 클래스룸

관과 시원한 파도 소리, 맑은 공기를 만끽하며 야외 캠

들의 건강을 고려해 코팅이 안 된 천연 코르크 재료를

을 갖추고 있다. 비용은 2만~3만원.

핑을 즐길 수 있다는 점이다. 럭셔리한 호텔 투숙과 캠

사용했다. 암벽 등반은 특수 안전 처리를 한 바닥을 깔

어린이 캠프는 오전과 오후의 캠프로 나눠지고, 오전

핑이 만났으니 여행의 재미가 더한다. 날씨가 추워져서

았고 어린이들의 무릎 보호대와 헬멧 착용은 필수다.

9시 50분부터 오후 1시까지 진행되는 오전 캠핑은 동

캠핑존 안에 파이어 플레이스, 토템 파이어, 온열 기구

또 키즈 아일랜드 내에는 레저 전문 직원 GAO가 어린

물 먹이 주기와 만들기 위주로 진행된다. 오후 1시 40

등을 설치해 더욱 낭만적이고 따뜻한 겨울 캠핑을 선사

이들의 안전을 체크하고 있어 부모는 안심하고 아이들

분부터 5시까지는 연날리기, 팽이 돌리기, 버나 돌리기

한다.

을 맡길 수 있다.

등 야외 전통 놀이 캠프가 진행된다. 매주 토요일과 일

바비큐 메뉴로 흑오겹살, LA갈비, 새우, 조개, 전복, 키

셋째, 무엇보다 이번 ‘키즈 아일랜드’에서 가장 눈에

요일은 야외 전통 놀이 캠프를 원어민 교사와 함께 영

조개 등으로 구성된 모둠세트를 1인 기준 6만5천원(세

띄는 것은 어린이 안전을 확인하고 싶어 하는 부모를

어로 진행한다. 비용은 4만~5만원.

금 별도)에 판매한다.

위해 스마트폰으로 자녀들의 모습을 볼 수 있도록 애플

GAO의 재미있고 친절한 설명을 들으며 한라산의 환

아이들은 텐트 안에서 뛰어놀고, 아빠는 가족을 위해

리케이션을 제공한다는 것이다. 키즈 아일랜드 안에는

상적인 풍광을 감상할 수 있는 ‘한라산 눈꽃 트레킹’은

셀프 바비큐를 굽고 엄마는 우아하게 제주의 겨울을 느

총 6개의 CCTV가 설치되어 있고 애플리케이션을 다운

매주 수요일과 토요일에 진행되며, 10세 이상이면 참여

낄 수 있다. 특히 재즈 공연이 열리는 주말은 둘만의 오

받은 부모는 어디서든 6개의 CCTV를 통해 자녀의 실

할 수 있다. 호텔을 출발해 어리목~윗세오름~영실로

붓하고 낭만적인 겨울 여행을 계획하는 커플이나 부부

시간 상황을 파악할 수 있다. 고객들은 제주신라호텔의

돌아오는 코스로 수제 어묵, 김밥, 커피, 귤, 초콜릿, 생

에게 강력하게 추천하고 싶다. 매주 일요일 저녁에는

세심한 서비스를 엿볼 수 있는 이런 시스템에 매우 만

수가 제공된다. 온 가족이 함께 참여하는 비용은 5만

풀 사이드바에서 재즈 콘서트가 열린다. 라이브 재즈

족해하고 있다.

원.

선율을 감상하며 캠핑을 즐기는 모습은 상상만 해도 낭

매일 진행되는 올레길 걷기 프로그램은 방학을 맞아

문의 및 예약 1588-1142, www.shilla.net/jeju

만적이다.

온 가족이 즐길 수 있는 GAO 프로그램이다.

169 January 2011


The Shilla Arcade

EDITOR JUNG JALIM

COOPERATION THE SHILLA Arcade(2233-3131)

Timeless value

Crafted with fingers of elaborate techniques of craftsmanship, a true winter style shines here with a unique taste and warm comfort to give it a timeless value.

170 Noblian


발렉스트라Valextra

오리엔탈 감성이 느껴지는 브리오니 우먼의 실크 코트

KITON 안의 또 다른 KITON ‘CIPA’ COLLECTION

최고의 럭셔리 가죽 액세서리 브랜드 발렉스트라에서

최고급 소재와 페미닌한 아름다움을 강조한 세련된 디

키톤의 창립자인 치로 파오네Ciro Paone의 이니셜을

는 엄선된 가죽과 심플한 디자인의 타임리스한 스타일

자인, 핸드메이드 기법의 조화로 사랑받고 있는 브리오

조합해 1960년 만든 키톤KITON의 캡슐 컬렉션

을 반영한 S Series 백을 선보인다. 1960년대 모델에서

니 여성 컬렉션은 몽골과 티베트 등 아시아의 자연 풍

Capsule Collecion ‘치파CIPA’. 치파는 클래식과 포멀

영감을 받은 S Series는 발렉스트라 여성 컬렉션의 대

경에서 영감을 받은 실크 코트를 선보인다. 세련된 퍼

한 슈트로만 알려진 키톤의 컬렉션 중 좀 더 피트되고

표 아이템으로, 부드럽고 심플한 실루엣과 더블 지퍼가

플 컬러와 기하학적인 패턴 프린트는 화려하면서도 오

모던한 품격이 느껴지는 스타일리시한 아이템을 선보

포인트로 에지를 더한다. 아웃 포켓의 지퍼 장식과 내

리엔탈적인 분위기를 자아내며, 절제된 디자인과 보디

인다. 과감한 커팅과, 슬림한 실루엣, 치파만을 위해 독

부 플랫 포켓의 활용도로 백의 공간 활용이 높으며, 탈

라인을 따라 흐르는 실루엣으로 우아하면서도 아름다

점적으로 개발된 소재, 다양한 색채와 패턴의 체크 모

착이 가능한 어깨 스트랩으로 토트 또는 숄더 스타일을

운 여성미를 돋보이게 하는 것이 특징이다. 또 은은한

티브가 모던한 느낌을 준다. 기존 키톤의 블랙라벨과는

자유자재로 연출할 수 있다. 발렉스트라의 기본 정신인

광택이 느껴지는 100% 실크 소재의 겉감에 버진 울과

달리 붉은 바탕의 라벨 역시 100% 장인의 손에 의해

군더더기 없는 심플한 디자인과 엄선된 가죽의 사용으

앙고라를 안감으로 사용해, 패셔너블한 감각과 보온성

봉제되며, 재킷의 안감과 라이닝, 그리고 슬릿Slit 안감

로 제품의 내구성도 자랑할 만하며, 라이트 골드와 로

을 동시에 살린 유니크한 스타일이 돋보인다.

역시 키톤만의 독점적인 원단을 사용해 재킷을 입고 벗

듐 색상의 금속 디테일이 한층 더 멋스러움을 더한다.

문의 2230-1321

을 때마다 살짝 엿보이는 은근한 멋이 돋보인다. 트렌

심플하면서 어떤 스타일링에서도 빛을 발하는 발렉스

드를 뛰어넘는 키톤의 치파 컬렉션을 만나보자.

트라의 S Series 는 오이스터 그레이, 파르가메나 화이

봉쁘앙 울 패딩 베스트

트, 핑크, 코발트 블루, 마라스카 와인, 캐멀까지 다양한

프렌치 프리미엄 아동 브랜드 봉쁘앙에서 올겨울 따뜻

컬러로 선보인다. 문의 2232-1937

하고 스타일리시하게 연출할 수 있는 울 패딩 베스트를

COLOMBO via della spiga

선보인다. 매해 겨울 시즌마다 출시되는 ‘봉쁘앙 SKI 컬

‘CART PIEG’, WALUCH’

세련된 남성을 위한 브리오니 윈터 캐주얼 컬렉션

렉션’ 라인의 아이템으로 가벼우면서도 탁월한 보온성

오랜 역사와 전통을 이어온 콜롬보 비아 델라 스피가

성공한 리더의 완성, 브리오니Brioni가 활동적인 라이

과 볼륨감을 동시에 제공하는 울 베스트는 실용적이면

COLOMBO via della spiga에서 콜롬보 고유의 오리지

프스타일을 즐기는 남성을 위해 윈터 캐주얼 컬렉션을

서도 패셔너블한 장점을 두루 갖추고 있다. 다크 그레

널리티가 반영된 다양한 제품을 선보인다. 콜롬보는 부

소개한다. 브리오니 윈터 캐주얼은 꼬임 장식이 들어간

이 컬러 모직으로 감싼 패딩 베스트는 튀지 않으면서

티크 최초로 악어가죽 제품을 선보이며 디자인 개발과

초콜릿 컬러의 캐시미어 니트, 두께감이 있는 코튼 소

광택감이 있는 나일론 소재 패딩 점퍼보다 단정한 느낌

패턴 제작에 주력함으로써 전문 영역화된 브랜드로서

재의 베이지 컬러 트라우저를 캐시미어 점퍼와 함께 매

이 강해 캐주얼하면서도 세련된 스타일을 완성할 수 있

의 명성을 쌓아가고 있다. 또 전통성을 유지하되 꾸준

치해, 편안하면서도 고급스러운 스타일을 연출했다. 퀼

다. 또 단추로 탈착이 가능한 후드로 편하게 2가지 연

히 새로운 소재와 가공법을 개발해 새로운 백들을 탄생

팅 디테일의 점퍼는 최상급 캐시미어와 사슴 가죽을 결

출이 가능하고, 모자를 분리해 착용할 때도 칼라 부분

시키고 있다.

합해 차별화된 소재의 믹스 매치로 소장 가치가 높다.

을 높게 세울 수 있어 찬 바람을 막아주며, 깔끔하고 댄

이번 시즌, 새롭게 선보이는 콜롬보의 ‘카르트 피에그

안감 역시 100% 캐시미어 소재를 사용해, 따뜻하면서

디한 스타일을 연출할 수 있다. 가슴 부분의 로고 패치

Cart Pieg’는 콜롬보만의 클래식 무드를 강조한 브리프

도 뛰어난 착용감이 돋보인다. 컬러는 브라운과 블랙으

로 포인트를 준 스타일리시한 울 패딩 베스트는 3세부

케이스로, 심플한 디자인과 모노톤의 컬러가 잘 어우러

로 선보였으며, 아웃 포켓 디자인으로 실용성을 더했

터 성인 사이즈까지 다양하게 출시되었으며 전국 봉쁘

진 아이템이다. 문의 2230-6567

다. 여기에 심플하고 클래식한 디자인의 부드러운 양가

앙 매장에서 만나볼 수 있다. 문의 2233-8088

문의 2230-1320

죽 소재 글러브를 착용하면 멋스러우면서도 활동적인 윈터 캐주얼 룩을 완성할 수 있다. 문의 2230-1321

171 January 2011


The Shilla Hot

EDITOR JUNG JALIM

COOPERATION THE SHILLA(2233-3131)

Sweet or warm

THE SHILLA is proud to presents a romantic winter package. If you want to make your winter hot, comfortable, sweet and romantic, THE SHILLA is your answer.

172 Noblian


서울신라호텔 ‘Sweet Home’ 윈터 패키지

스를 설치해 야외 스파와 함께 겨울 건강을 챙길 수 있

Night’ 패키지를 선보인다. 스튜디오 스위트룸 1박을 추

서울신라호텔은 내 집보다 더 푸근한 휴식을 누릴 수

도록 구성했다.

가 비용 없이 3명이 이용할 수 있도록 엑스트라 베드 1

있는 ‘Sweet Home’ 윈터 패키지를 선보인다. 기본 수

가족과 함께한 여행이라면 캠핑존의 셀프 바비큐는 필

개를 무료로 제공한다. EFL(Executive Floor) 혜택인

페리어룸 1박에 쿠션이나 방석을 겸할 수 있는 초콜릿

수 코스다. 제주신라호텔은 국내 호텔 중 최초로 호텔

‘Happy Hour’ 서비스(17:30~20:00)를 제공해 와인, 맥

색 고급 무릎 담요, 패스트리 부티크의 고급 수제 쿠키

내에 야외 캠핑장을 오픈, 럭셔리한 호텔 휴식과 함께

주, 칵테일, 탄산음료, 커피 및 페이스트리 등 각종 스

를 증정한다. 1층 바&라운지 더 라이브러리에서 윈터

여행의 트렌드로 떠오른 캠핑의 분위기까지 누릴 수 있

낵을 무제한 즐길 수 있다. 디저트와인(Moscato D'Asti

음료 2잔을 제공하며, 모든 고객은 사우나를 50% 할인

도록 야외 정원 내에 ‘캠핑존’을 마련했다. 겨울 캠핑을

2병 세트), 과일, 패스트리 부티크의 초콜릿 등이 객실

된 요금에 이용할 수 있다. 100% 라이브 키친에서 조

위해 캠핑존 안에는 파이어 플레이스, 토템 파이어, 온

에 세팅되어, 저녁에 친구들과 함께 미니 파티를 즐길

리해 더욱 신선한 더 파크뷰의 조식 뷔페 이용 시 3만

열 기구 등을 설치해 따뜻한 분위기를 연출한다. 그뿐만

수 있다. 다음 날 아침에는 EFL 라운지의 아메리칸 스

원을 추가하면 된다. 한편 평일 투숙 고객은 더 파크뷰

아니라 제주의 아름다운 자연, 시원한 겨울 파도 소리,

타일 건강식 조식을 이용할 수 있으며, 실내 수영장 및

뷔페 이용 시 10% 할인 혜택 및 와인 2잔 제공 쿠폰을

캠핑존을 장식한 크리스마스 조명, 그리고 사랑하는 가

피트니스 무료 이용 혜택이 포함된다. 2011년 1월 1일부

추가로 제공한다. 1월 투숙 고객에게는 〈피카소와 모던

족과 함께하는 캠핑존의 낭만은 올겨울 여행을 멋지게

터 2월 28일까지이며, 요금은 35만원(세금 및 봉사료

아트〉 전시 초대권 2매를 추가로 증정한다. 1월 1일~2

완성해줄 것이다. 바비큐 메뉴로 흑오겹살, LA 갈비, 새

별도).

월 28일(24, 25일은 제외)이며, 요금은 21만원(세금 및

우, 조개, 전복, 키조개 등으로 구성된 모둠세트를 1인

문의 02-2230-3310, www.shilla.net

봉사료 별도). 문의 2230-3310, www.shilla.net

기준 6만5천원(세금 별도)에 판매한다. 밥, 야채, 김치, 쌈장, 컵라면 등이 포함된 가격이다.

제주신라호텔의 ‘4色 윈터 스파 패키지’

서울신라호텔 아리아께의 사케 갈라 디너

또 제주신라호텔은 겨울 바다의 낭만을 즐길 수 있고,

서울신라호텔 일식당 아리아께에서 1월 25~26일에

올겨울 제주신라호텔의 겨울 여행은 컬러로 표현된다.

영화의 한 장면 같은 멋진 추억을 만들 수 있는 ‘프라이

일본 정통 가이세키 요리와 함께하는 사케 갈라 디너

2011년 겨울, 사랑하고 싶다면 레드를, 건강을 생각한

빗 비치 하우스 북 카페’를 호텔 절벽 아래 중문 해수욕

를 연다. 이번에 선보이는 사케는 물이 좋아 일본에서

다면 퍼플을, 가족과 함께한다면 그린을, 아름다운 추

장에 오픈했다. 프라이빗 비치 하우스는 통유리로 이루

가장 맛있는 사케가 난다는 이자카와 현 가나자와에서

억을 만들고 싶다면 브라운을 선택하자. 물론 모든 컬

어져 있고, 히팅 램프와 대형 벽난로가 설치되어 있어

가장 큰 사케 제조사로 널리 알려진 후쿠미츠야(福光

러를 다 선택할 수도 있다. 제주신라호텔이 선사하는

따뜻한 실내를 연출한다. 비치 하우스 안에는 독서를

屋)의 최고급 사케 4종이다. 후쿠미츠야는 1625년 설

‘4色 윈터 스파 패키지’로 초대한다.

즐기며 눈앞에 펼쳐진 겨울 바다를 감상할 수 있도록

립한 이래로 화학 성분이 전혀 들어가지 않은 천연 준

가장 먼저 눈에 띄는 점은 아름다운 숨비 정원이 올겨

2010년 CEO 추천 도서, 여행 도서, 여성&어린이 도서,

마이 긴조만을 취급해오고 있으며, 이번에 선보이는 4

울 화려한 ‘조명’과 ‘불’로 꾸민 ‘파이어 가든’으로 새롭

잡지 등 다양한 책이 마련되어 있다. 힐링 스톤 풋 스

종의 사케는 아리아께를 통해 국내에 최초로 소개되는

게 태어난다는 것. 토템 파이어, 대형 파이어 플레이스,

파, 미니 자쿠지와 샤워 시설도 있어 최고의 조건에서

제품이다.

웅장한 벽난로 등으로 꾸민 따뜻하고 낭만적인 정원에

겨울 바다를 감상할 수 있으며, 군고구마・감귤・결명

제니야의 가이세키는 세계적인 스타 셰프 장 조지, <자

숨비 스파, 패밀리 자쿠지, 핀란드식 사우나, 카바나로

자차 등 겨울철 먹을거리가 무한 제공된다. 요금은 24

갓 서베이Zagat Survey>의 설립자 팀 자갓Tim Zagat

구성된 윈터 스파 존을 오픈해 제주 어디서도 경험할

만~34만5천원(조식 2인 포함, 세금 및 봉사료 별도).

을 비롯해 일본 황실 관계자와 뉴욕의 스타 셰프들이

수 없는 따뜻하고 로맨틱한 야외 스파를 제공한다. ‘윈

문의 1588-1142 www.shilla.net/jeju

극찬한 적이 있다. 이번에는 제철을 맞은 대게를 메인

터 스파 존’에 마련된 힐링스톤 테라피 카바나는 보다

으로 하며, 제니야에서 직접 공수해온 가나자와의 전

럭셔리하고 이색적인 겨울 테라피를 경험할 수 있게 한

럭셔리한 스위트룸에서 친구들과 달콤한 하룻밤

통 특산물인 금박 세공, 칠기 등 다양한 그릇에 담겨

다. 풀 사이드바에 위치한 카바나 안에는 온열 기구를

서울신라호텔은 럭셔리한 스위트룸에서 친구들과 함께

선보일 예정이다. 가격은 40만원(세금 및 봉사료 별

비치해 따뜻한 공간으로 연출하고, 힐링스톤 테라피 바

새해 맞이 미니 파티를 할 수 있는 ‘Sweet Ladies’

도). 문의 02-2230-3356, www.shilla.net/seoul

173 January 2011


what’s up Brioni_Silk Coat 페미닌한 아름다움을 강조한 세련된 디자인과 핸드메이드 기법의 조화로 사랑받고 있는 브리오니Brioni 여성 컬렉션에서 실크 코트를 선보인다. 세련된 퍼플 컬러와 기하학적 패턴 프린트는 오리엔탈적인 분위기를 자아내며, 보디라인을 따라 흐르는 실루엣은 우아한 여성미를 잘 표현했다. 또 은은한 광택이 느껴지는 실크 소재의 겉감에 버진 울과 앙고라를 안감으로 사용해 패셔너블한 감각과 보온성을 겸비했다. 여기에 브랜드 특유의 정교한 핸드 테일러링 기법을 통해 고급스러운 분위기를 자아내며, 미니멀한 디자인에 포인트를 더하는 네크라인 부분의 디테일이 시선을 사로잡는다. 스타일과 추위를 모두 잡아주는 코트를 원한다면, 절제된 실루엣과 화려한 패턴이 돋보이는 브리오니 실크 코트에 주목하자. 문의 3274-6483

NINA RICCI_Vincent Label Suit 프렌치 컨템퍼러리 클래식을 추구하는 니나리치 맨Nina Ricci Men에서 최고급 라인 빈센트 라벨Vincent Label 슈트를 선보인다. 절제된 디테일이 돋보이는 빈센트 라벨 슈트는 깊이 있는 그레이 컬러 원단에 버건디와 라이트 그레이 컬러의 체크 패턴으로 고감도 프렌치 시크 스타일을 연출한다. 최고급 모 소재와 비접착공법으로 제작된 빈센트 라벨 슈트는 완벽한 테일러링으로 몸에 따라 흐르는 실루엣과 함께 가벼운 착용감을 선사한다. 자연스러움과 세련된 무드가 조화를 이룬 빈센트 라벨 슈트로 한층 업그레이드된 니나리치만의 프렌치 감성을 느껴보자. 문의 070-7130-7895

FURLA_Piper Line 우아함과 모던함이 돋보이는 이탈리아 명품 브랜드 훌라FURLA는 매끈한 라인이 돋보이는 빅 사이즈 핸드백 파이퍼Piper 라인을 2011 S/S 신상품으로 출시한다. 깔끔한 스터드와 자물쇠 장식의 디테일을 가미했으며, 가방 윗부분 지퍼의 오픈 디자인은 심플한 느낌을 준다. 토트와 숄더 또는 크로스 겸용이 가능해 실용적이며, 악어 무늬 프린트 소가죽이 견고함을 더했다. 포멀 또는 캐주얼한 스타일에 모두 어울리는 파이퍼 라인은 열대 지방의 과일을 연상시키는 망고 옐로, 아보카도 그린, 패션 프루트 레드 등의 강렬한 컬러를 선보인다. 문의 515-2747

LEBEIGE_Pink Double Breasted Tweed Coat 품위 있고 우아한 베이지 제너레이션을 위한 캐릭터 브랜드 르베이지LEBEIGE에서 핑크 더블브레스트 트위드 코트Double Breasted Tweed Coat를 선보인다. 경쾌한 핑크 컬러의 트위드 코트는 소재 특유의 고급스러운 멋이 느껴지는 아이템이다. 칼라와 라펠, 더블브레스트로 코트의 정석을 갖추고 있으며, 모든 여성이 사랑하는 핑크 컬러를 한층 더 사랑스럽게 표현했다. 정교하게 처리된 스티치와 소매의 절개선 디테일은 화려함 속에서도 우아함을 잃지 않으려는 브랜드만의 철학을 보여준다. 다양한 룩으로 포인트 스타일링이 가능하며 추운 겨울 어두운 컬러의 아우터 속에서 돋보일 수 있는 아이템으로 추천한다. 문의 3438-6212

Salvatore Ferragamo_Ferragamo World 80년 전통의 이탈리아 명품 브랜드 살바토레 페라가모Salvatore Ferragamo는 환경과 인간을 생각하는 바이오 프렌들리 남성화 라인, 페라가모 월드Ferragamo World를 출시한다. 페라가모 월드는 세련됨, 장인 정신, 편안함을 추구하는 페라가모의 전통을 바탕으로 캐주얼하고 세련되며 기능적인 디자인으로 선보인다. 도시에서의 편안한 야외 생활, 도보, 자전거를 떠오르게 하는 이번 라인은 데저트 부츠, 모카신, 테니스화처럼 스포티한 모델로 구성됐다. 제품의 판매 수익금 일부는 남아시아와 동아프리카에서 빈곤과 맞서 싸우는 국제 비영리 사회복지단체 ‘어큐먼 펀드’에 기탁된다. 글로벌 기업으로서 사회적 책임을 다하며 환경을 존중하는 라이프스타일을 지향하는 페라가모 월드를 눈여겨보자. 문의 512-8484


what’s up TUMI_Townhouse Collection Boston bag 여행과 비즈니스를 대표하는 스마트 럭셔리 브랜드 투미TUMI에서 35주년을 기념해 타운하우스 컬렉션 보스턴백Townhouse Collection Boston bag을 선보인다. 이번 모델은 최고급 소재와 우아한 디자인, 이에 투미만의 기능성이 만나 탄생했다. 특히, 여행과 멋을 즐기는 남녀 모두가 사랑할 수 있는 클래식한 멋과 세련미가 어우러진 점이 돋보인다. 브랜드 고유 소재인 FXT 방탄 나일론과 베체타 가죽, 송치 3가지 소재로 만나볼 수 있으며, 컬러는 심플한 블랙, 은은한 브라운 레오퍼드 프린트까지 다양하다. 어깨끈은 탈착이 가능해 라이프스타일에 맞춰 연출이 가능하며, 초강력 마모 저항력을 지닌 엑셀라 지퍼를 사용해 내구성을 높였다. 여기에 넓은 내부 수납공간으로 단기 여행은 물론 일상에서도 멋스럽게 들 수 있다. 문의 546-8864

TIFFANY&Co._Paloma Picasso’s Zodiac Collection 2011년 새해, 티파니TIFFANY&Co.는 당신의 한 해를 지켜줄 수호 동물, 디자이너 팔로마 피카소의 12지신 컬렉션Paloma Picasso’s Zodiac Collection을 제안한다. 컬렉션은 ‘인간이 탄생한 해에 따라 그 해를 대표하는 12개의 동물 중 하나가 운명적으로 결정된다’는 전설에서 영감을 받아 탄생됐다. 자신의 띠를 나타내는 동물을 지니고 있으면 행운을 가져다준다는 의미가 있어 소중한 사람을 위한 새해 선물로 더욱 특별하다. 18K 옐로 골드 참으로 펜던트 또는 브레이슬릿에 달 수 있으며, 동물의 눈이 다이아몬드로 세팅된 것이 특징이다. 컬렉션에는 팔로마 피카소의 상징이자 키스를 뜻하는 ‘X’가 숨어 있다는 것이 또 하나의 즐거움이다. 팔로마 피카소의 12지신 컬렉션으로 12동물의 신비함을 선물해보는 건 어떨까? 문의 2230-1007

TASAKI_Balance Ring Collection 57년 전통의 럭셔리 주얼리 타사키TASAKI가 밸런스 링 컬렉션Balance Ring Collection을 선보인다. 크리에이티브 디렉터 타쿤 파니치걸이 디자인한 컬렉션은 마치 밸런스 볼이 공기 위에 떠 있는 듯, 둥근 진주가 각진 골드 바 위에 줄지어 부유하고 있는 형태로 모던하고 깔끔한 디자인이 진주의 아름다움을 돋보이게 한다. ‘5 진주 링’을 손가락에 착용한 후, 위에서 내려다보면 골드 바가 진주에 숨어 마치 손가락 위에 진주가 떠 있는 듯한 느낌을 준다. ‘3 진주 링’은 평범해 보이지만 기존 모델에서는 볼 수 없던 심플한 디자인을 선보이며 밸런스 컬렉션의 대표적 링으로 자리매김했다. 세계 각국의 관심을 받는 기업으로 주얼리의 아름다움을 위해 항상 노력하는 타사키의 제품을 만나보자. 문의 511-1522

Chopard_Animal World Collection 展 탄생 150주년을 맞는 쇼파드Chopard는 브랜드의 전설적 창의력과 오랜 경험을 바탕으로 150개의 아름답고 신비한 애니멀 월드 컬렉션Animal World Collection을 완성했다. 워치와 주얼리로 구성된 컬렉션에는 원숭이, 황소, 양, 토끼, 고양이, 코끼리, 오리, 펠리칸, 거북이, 개구리, 돌고래, 소라에 이르는 다양한 동물이 형상화됐다. 이번 컬렉션의 전시는 각각의 동물이 살고 있는 세계에 놓인 형태로 구성되어 보는 이로 하여금 자연을 그대로 들여다보는 듯한 즐거움을 주었다. 특히, 애니멀 컬렉션과 함께 브랜드의 아이콘으로 군림한 해피 다이아몬드Happy diamonds 워치가 선보여 빛을 발했다. 이번 전시는 브랜드 설립 초기의 뮤지엄 피스가 함께 전시되어 쇼파드 탄생과 함께 150년 역사의 발자취를 엿볼 수 있는 자리였다. 문의 2118-6085

eSpoir_Open Your Stylish Closet 향수 전문 브랜드로 입지를 다져온 에스쁘아eSpoir가 메이크업 전문 브랜드로 재탄생한다. ‘오픈 유어 스타일리쉬 클로젯Open Your Stylish Closet’이란 콘셉트로 진행된 이번 행사는 에스쁘아가 뷰티와 스타일을 접목한 패셔너블한 메이크업 브랜드로, 감각적인 컬러와 반짝임으로 자신만의 스타일을 찾아주는 메이크업 스타일리스트라는 점을 내세웠다. 메이크업도 패션의 일부라는 브랜드 철학을 담은 ‘패셔나이즈 유Fashionize You’란 슬로건 아래, 뷰티 브랜드로는 이례적으로 에스쁘아 메이크업 룩을 소개하는 런웨이 쇼를 진행해 눈길을 끌었다. 런웨이 쇼는 디자이너 하상백의 스타일링으로 세련되고 다이내믹한 패션과 에스쁘아만의 감각적이고 다양한 컬러 메이크업이 만나 트렌디하고 패셔너블한 브랜드 이미지를 표현했다. 문의 3446-4058


wellness DUXIANA_The Setai Fifth Avenue 세계에서 가장 편안한 침대, 덕시아나가 뉴욕의 최고급 호텔 세타이 피프스 애비뉴The Setai Fifth Avenue와 만났다. 뉴욕이 자랑하는 세타이 피프스 애비뉴 전 객실에 덕시아나 침대를 사용한 것. 이는 뉴욕의 상류 사회를 대변하는 세타이 피프스 애비뉴의 인테리어가 덕시아나를 통해 더 빛나고 있음을 보여준다. 157개의 고급스러운 객실을 보유한 세타이 피프스 애비뉴는 블랙 오크와 석회석 마루, 빛나는 오닉스, 월넛, 고급 스톤 등 최고급 자재로 장식되어 그 가치가 더욱 빛을 발하는 곳. 덕시아나는 미국 마이애미의 Setai Hotel, The Greenwich USA, Crowne Plaza Wiesbaden Germany, Bellevue Bern Switzerland, Grand Stockholm Sweden 등의 럭셔리 호텔에서 그 위상을 높이고 있다. 문의 512-6512~3

Les Vins de Maeil_Loredona Riesling 와인 수입 업체 레뱅드매일은 2011년을 산뜻하고 가벼운 마음으로 시작한다는 의미를 담아 화이트 와인 ‘로레도나 리슬링’을 선보인다. 풍부한 과일 향에 달콤하면서도 명쾌한 산도를 지닌 화이트 와인 로레도나 리슬링은 깔끔한 첫 맛과 우아하고 균형 잡힌 끝 맛의 조화가 뛰어난 와인은 기분좋은 시작, 새해와 잘 어울린다. 미국 캘리포니아의 몬터레이 지역에 위치한 포도밭에서 10월 말까지 포도가 익기를 기다렸다 수확하는 제로 방식은 품종의 특징을 제대로 살려냈다는 평가를 받는다. 로레도나 리슬링은 이국적인 과일 향과 스파이시한 향이 어우러져 가벼운 핑거푸드나 견과류, 치즈, 또는 매콤한 중식, 인도 음식과도 잘 어울린다. 문의 3497-6888

JISAN FOREST RESORT_Winter night, Ski night! 서울에서 가장 가까워 많은 이들의 호응을 얻고 있는 지산 리조트가 스키와 보드를 즐기는 마니아를 맞이할 채비를 마쳤다. 2010~11 시즌부터 저녁 9시에서 새벽 4시까지 이용할 수 있는 ‘야간 심야권’을 새로 도입해, 퇴근 후 스키장을 찾는 야간 보드, 스키족이 편리하게 이용할 수 있도록 했다. 또 별도의 개인 장비 없이 스키장에 온 이들도 좋은 장비로 스키와 보드를 즐길 수 있도록 신규 렌탈 장비를 다량 입고했고, 렌탈 시 혼잡함을 줄이기 위해 추가 렌탈 하우스 역시 오픈했다. 슬로프 공간을 확장해 유아와 초보자들도 쉽게 즐길 수 있게 한 것이 지산만의 장점. 그뿐만 아니라 고속 리프트 가동으로 대기 시간의 지루함 없이 여유롭고 즐겁게 스키 및 보드를 탈 수 있도록 배려했다. 문의 031-644-1200

Cremesso_Cremesso Compact Touch 캡슐 커피 머신 브랜드인 크레메소가 오는 2011년 2월까지 특별한 리미티드 에디션 크레메소 콤팩트 터치Cremesso Compact T o u c h를 출시했다. 올겨울에만 만나볼 수 있는 리미티드 에디션 크레메소 콤팩트 터치는 심플한 보디의 콤팩트 오토매틱Compact Automatic과 달리 유려한 곡선의 디자인과 무광 처리된 세련된 블랙 컬러가 돋보이며, 디지털 LED 터치로 작동되어 고급스러운 디자인에 편리함을 더했다. 크레메소의 또 하나의 자랑거리. 커피 브랜드 중 유일하게 공정무역(UTZ) 인증을 받은 최상급 원두만을 사용하므로 깨끗하고 깊은 맛과 향을 음미할 수 있을 것이다. 문의 1577-3265

GaHoe_Grand Open 가회동 하면 떠오르는 고정된 이미지가 있다. 한옥 마을과 기와지붕 그리고 신발을 벗고 방으로 들어는 좌식 공간과 전통 차. 이런 보편적인 생각을 뒤집은 갤러리 카페가 가회동에 오픈했다. 이름은 ‘가회GaHoe’. 물론 카페 이름이나 로고, 전통 문양을 연상케 하는 간판의 디자인은 전형적인 가회동 분위기 일 것이라 생각 될 수도 있지만 내부 인테리어는 조금 다른 느낌이다. 모던하고 시원하게 탁 트인 공간 안에 꾸민 인테리어는 상상력을 자극한다. 또 카페와 갤러리가 어우러져 커피와 함께 다양한 디자이너와, 아티스트들의 작품을 감상하거나 구매할 수도 있다. 이전 달 중순까지는 〈2011 다이어리전〉이, 이번 달 말까지는 캘리그래피 전시 행사가 진행될 예정이다. 문의 546-1883


hotstuff LONGINES_Retrograde Rosegold 로즈골드의 부드러움과 44mm 사이즈의 중후함, 그리고 브라운 악어가죽 밴드의 고급스러움까지 더해진 론진의 마스터 컬렉션 ‘레트로그레이드 로즈골드’. 시간이 지날수록 품격에 맞는 특별한 워치로서 명성을 더해가고 있다. 2011년, 거부할 수 없는 매력을 가진 론진의 레트로그레이드 로즈골드가 워치 마니아의 마음을 또 한 번 뒤흔들 예정이다. 최상의 ‘美’와 우아함을 갖춘 최고의 타임피스로 평가받는 마스터 컬렉션 레트로그레이드. 론진만을 위해 오랜 기간 개발되고 만들어진 ETA의 칼리버 무브먼트 장착으로 더욱 그 가치를 발휘한다. 오토매틱 리와인딩과 함께 요일, 날짜, 초, 24아워 세컨드 타임존의 레트로그레이드 등 많은 기능에 비해 기존의 기계식 시계가 가질 수 있는 복잡함을 없앤 심플함이 돋보인다는 것. 문의 3149-9591

Michel Herbelin_Couple Watch 미쉘 에블린Michel Herbelin은 1947년에 탄생한 시계 브랜드로, 섬세한 기술력과 정통성을 지닌 클래식하면서도 엘레강스한 무드가 공존하는 프랑스 워치다. 특히 이번 겨울 시즌 선보이는 미쉘 에블린의 커플 워치는 클래식한 로마자 인덱스에 군더더기 없는 심플한 빈티지 스타일로 시크한 스타일링을 완성해준다. 정직하고 전통적인 방식으로 제작된 정통 프랑스 시계라는 점은 고급스러움과 남다른 멋이 묻어나는 매력으로 다가온다. 이번 시즌 럭셔리하고 우아한 감성 미쉘 에블린의 커플 워치로 따뜻한 마음을 전달해보자. 때로는 반짝이는 것보다 심플하고 담백함이 마음을 흔들어놓는다. 바로 미쉘 에블린의 커플 워치처럼 말이다. 올겨울, 진정한 사랑을 함께 나눌 수 있는 의미 있는 시계를 찾는다면 단연 미쉘 에블린 커플 워치다. 문의 3284-1300

BLANCPAIN_Villeret Complete Calendar Watch 블랑팡의 시그너처 컬렉션, ‘빌레레의 컴플리트 캘린더 워치’는 시계의 가치를 아름답게 담아낸다. 지름 33mm, 두께 10.7mm의 작은 원 안에 자리한 고급스러운 장치와 디자인을 보면 그 매력을 이해할 수 있을 것. 그뿐만 아니라 세심한 디테일도 돋보이는데 다이얼의 인덱스의 가장자리를 따라 1부터 30일까지 날짜가 표시되어 있으며 12시 방향에는 요일과 달을 나타내주는 창이 자리 잡았다. 특히 시계의 반을 아래로 가르는 6시 방향에는 재치 있는 달의 얼굴이 돋보이는 문페이스 창과 초침을 함께 넣어 위트를 더했다. 로즈골드 소재의 케이스에 다이아몬드를 세팅해 화려함을 강조하고 그 품격을 한껏 더한 것도 빌레레의 컴플리트 캘린더 워치의 또 다른 자랑. 문의 2118-6151

FENDI_NEW QUADRO 패션을 리드하는 럭셔리하고 글래머러스한 느낌의 이탈리아 디자인. 그리고 스위스의 장인정신이 함께 만들어내는 하이 퀄리티의 펜디 워치에서 뉴 콰드로NEW QUADRO 워치 컬렉션을 선보인다. 특히 이번 시즌 새롭게 선보이는 뉴 콰드로 워치 컬렉션은 더블 'F' 로고가 투각된 스틸 밴드로 펜디 콰드로만의 고풍스러움을 느낄 수 있으며, 자개 문자판과 로마자 인덱스로 우아함과 세련미를 강조했다. 또 이번 시즌 프티 사이즈가 추가로 출시되어 실용적이며 감각적인 스타일링을 제안한다. 손목 사이즈에 딱 맞는 펜디의 뉴 콰드로 워치로 이번 겨울 소중한 사람에게 따뜻한 마음을 전달해보자. 문의 3284-1300

HAMILTON_Jazz Master Seaview Medium 37mm 1892년 미국 펜실베니아 주의 랭커스터에서 탄생한 해밀턴은 미국적 헤리티지와 고도의 정밀함, 그리고 스위스의 무브먼트와 기술력이 결합된 브랜드다. 재즈마스터 시뷰 미디엄Jazzmaster Seaview Medium 37mm는 스포티함을 원하는 현대인에게 이상적인 손목 파트너다. 아이보리와 블랙의 다이얼, 입체적으로 조각된 인덱스, 3시 방향의 날짜 디스플레이 창은 러버 스트랩 또는 스틸 브레이슬릿과 완벽하게 조화된다. 특히 이 컬렉션의 스페셜 모델은 2개의 여분 스트랩 러버와 레더 스트랩이 함께 제공되어 일석이조. 아웃도어 활동에 알맞은 실용성과 스트랩 교체가 용이한 디자인으로 재즈마스터 시뷰 미디엄 37mm는 바쁜 일상에 마음의 여유와 쉼을 선사한다. 문의 3149-9593


One Big Important Step Forward

EDITOR AIDEN COOPERATION ENDORF MUSIC(2195-4699)

Samsung Design Fashion Fund, also known as DFDF, has a mission statement of finding and supporting Korean designers who have all it takes to advance to a bigger world, and the sixth group winners of the year 2011 were revealed Jung wookjun of Junn. J, Lim sangkyun of Siki Im and Lee jungsun of J. JS Lee, are the lucky ones.

-XXQ--XQJZRRNMXQ -XXQ-LVQRWIRUHLJQWRWKH6)')DVLWLV-XQJ VWKLUGWLPHYLFWRU\ WKLV\HDU-XQJLVQRZDOHDGLQJGHVLJQHURI.RUHD6LQFHWKH GHEXWLQWKH3DULV0HQ V)DVKLRQFROOHFWLRQLQ-XQHRIWKH QDPH-XXQ-ZDVZLGHVSUHDGLQWKHZRUOGZLGHIDVKLRQVFHQH$ QXPEHURIFROODERUDWLRQSURMHFWVDUHMXVWJRRGH[DPSOHVWRJHWKHU ZLWK7RS0DQRI(QJODQGVSRUWVEUDQG$UHQDD.RUHDQPXOWL VKRS&RUVR&RPR6HRXODQG5HHERN 6D\V-XQJ6XFKYDULRXVSURMHFWVKDYHLQGHHGKHOSHGPHDORW, FRXOGXVHWKLVRSSRUWXQLW\WROHWP\GHVLJQDQGP\VHOINQRZQWRD ZLGHUDXGLHQFHLQWKHZRUOG7KDQNVWRVXFKUHSXWDWLRQ-XQJ ZDVLQ=XULFK6ZLW]HUODQGDVKHZDVQRPLQDWHGIRUWKHZLQQHURI 6ZLVV7H[WLOH$ZDUGVIRUZRUOG VXSDQGFRPLQJ\RXQJGHVLJQHUV $QG-XQJVD\VWKDW6)')H[SHULHQFHVIRUWKHSDVWWZR\HDUV KDYHFRQWULEXWHGDORWWRKLVJURZLQJFDUHHU,KDYHWREHKRQHVW ILQDQFLDOVXSSRUWKHOSVPHWRSUHSDUHIRUP\3DULVVKRZZLWK PRUHHDVH)URPSURGXFWLRQWRVKRZORFDWLRQVWRPRGHOV3DULV IDVKLRQVKRZVGHPDQGEXGJHWUDQJHVWKDWDUHELJJHUWKDQ\RX HYHUH[SHFW,QDPHQ VIDVKLRQZRUOGDJRRGWH[WLOHLVDNH\WR SHUIHFWLRQDQGKHFRXOGDOVRFKRRVHIRUWKHILQHTXDOLW\WH[WLOHV 178 Noblian


IRUKLVZRUN´7KHNH\WRDFROOHFWLRQDWDZRUOGVWDJHLVDJUHDW PDWHULDO,WҊVWKHEDVLFRIWKHEDVLFµ-XQJVD\V 7KLV1HZ<HDUKHKDVDQXPEHURIRWKHUSURMHFWVVXFKDVD FROODERUDWLRQSURMHFWZLWK%HDQ3ROH$FFHVVRULHVDQG\HWDQRWKHU VHFUHWSURMHFWEXW-XQJVWLOOGRHVQRWIRUJHWDERXWKLV3DULV FROOHFWLRQOLQHXS,QPLG-DQXDU\,KDYHWRSUHVHQWP\IDOO FROOHFWLRQ,ZDVGHYLDWHGIRUDZKLOHIURPP\3DULVFROOHFWLRQDQG QRZLVWKHWLPHIRUPHWRJHWIRFXVHGDJDLQKHVD\V 6R-XQJQHHGVWLPHWRSUHSDUHIRUVHYHUDOLGHDVDQGWKHFRPLQJ ILYH\HDUVDQGHYHQDGHFDGHPD\EHWRRPXFKWRLPDJLQHIRU QRZ<HW-XQJDQVZHUV:HOOWKH\VD\,VKRXOGQRWWDONDERXW P\GUHDPVWRRHDVLO\:KHQ\RXWKLQNDERXWLWKRZHYHU,JXHVV, ZRXOGEHJHWWLQJUHDG\WRKDYHP\RZQ3DULVVWXGLR,DP GUHDPLQJRIDVSDFHWKDWFDQEHKRPHWRP\GHVLJQDQGP\ DFWLYLWLHV&RQVLGHULQJKRZIDVW-XQJ VUHSXWDWLRQLVVSUHDGLQJ ZHFRXOGVRRQSLFWXUHWKHGD\ZKHQKLVGUHDPVFRPHWUXH 6LNL,P/LPVDQJN\XQ 6WDUWLQJZLWKWKHILUVWHYHUFROOHFWLRQGHEXWLQ'HVLJQHU,PRI 6LNL,PSUHVHQWVDTXLWHLQWHUHVWLQJFDUHHUSDWK%RUQLQ*HUPDQ\ ,PVWXGLHGDUFKLWHFWXUHDW2[IRUG8QLYHUVLW\LQ(QJODQGDQGWKHQ ZRUNHGLQ1HZ<RUNDVDQDUFKLWHFW7KHQKHPDGHDQLQWHUHVWLQJ WXUQLQKLVFDUHHUWREHDIDVKLRQGHVLJQHU,PVD\V%XW\RX NQRZZKDW,GUHDPHGRIEHLQJDILQHDUWLVWLQP\FKLOGKRRG6R KHVWXGLHGSDLQWLQJEXWGHFLGHGWRPDMRULQDUFKLWHFWXUHLQDQ HIIRUWWRVWXG\DPRUHDSSOLHGIRUPRIDUW2QHGD\ZKHQ,ZDV ZRUNLQJLQ1HZ<RUNDVDQDUFKLWHFW,KDGMXVWVXGGHQXUJHWREHLQ IDVKLRQVR,MXVWTXLWFROGWXUNH\DQGGLYHGLQWRIDVKLRQ2IFRXUVH ,PKDVDOZD\VIDVKLRQRQKLVPLQGIURPKLV\RXWK,Q*HUPDQ\ ZKHUH,JUHZXS,KDYHWRGRLQWHUQVKLSLQDZRUNSODFHWKDWLV UHODWHGWRVRPHWKLQJWKDW,ZDQWWRGRLQWKHIXWXUH7KHQ,DSSOLHG IRUVHYHUDOIDVKLRQFRPSDQLHVEXW,ZDVQRWSLFNHG6R,HYHQWXDOO\ ZRUNHGXQGHUDSKRWRJUDSKHUDVDQLQWHUQ7KDQNVWRWKDW,FRXOG RSHQDVRORH[KLELWLRQDVDSKRWRJUDSKHUDWWKHDJHRI 6LQFHWKHGHEXW,PKDVPDGHDQXPEHURIHIIRUWVDIWHU WDNLQJURRWLQIDVKLRQE\ZRUNLQJDQGOHDUQLQJLQDQXPEHURI IDVKLRQKRXVHVOHGE\.DUO/DJHUIHOWDQGPDQ\RWKHUV,QKH SUHVHQWHGKLVILUVWFROOHFWLRQ,PHPSKDVL]HGLQSDUWLFXODUWKH TXDOLW\DVKHVDLGWKDWKLVDHVWKHWLFVRIIDVKLRQLVVLOHQWVWURQJ EXWWKRURXJKO\GHVLJQHG1RPDWWHUKRZJUHDW\RXULGHDZRXOG EHWKHUHLVQRPHDQLQJLI\RXFDQQRWFRPSOHWHLWSHUIHFWO\:KDW V WKHPRVWLPSRUWDQWLVWRPDNHLWULJKW )RUWKLVVSULQJFROOHFWLRQWKHPHGLPPLJUDQWVLQWKH:HVW,P JRWLQVSLUDWLRQVIURPWKHILOP/D+HLQH+HVDLG7KHWKUHH LPPLJUDQWVLQWKHILOPDUHFDVXDOVSRUWVVW\OHWKDW\RXFDQHDVLO\ UXQDFURVVLQVXEXUEDQ3DULVOLNHWUDLQLQJSDQWVEDVHEDOOMXPSHUV DQGUXQQLQJWRSV2XWRIWKHVHRUGLQDU\LWHPV,PFUDIWHGKLV VW\OHE\PDWHULDOVOLNHVLONKLJKTXDOLW\MHUVH\DQGRUJDQ]D, DGGHGDOLWWOHELWRIGHVLJQWRRUGLQDU\LWHPVDQGZDQWHGWR H[SUHVVUDWKHUXQIDPLOLDUHPRWLRQVE\DGGLQJOX[XU\PDWHULDOV 5DWKHUQRWYHU\FRPIRUWDEOHLQ.RUHD,PVDLGWRDTXHVWLRQ DERXWZKDWNLQGRIJURZWKKH VJRLQJWRVHHNZLWKWKHVXSSRUWRI

6)'),ZDQWWRFRPHEDFNWR.RUHDWREXLOGDKXJHVWRUH,WZDV DMRNHKHVDLGDQGVRRQDGGHGWKDWKHZDQWVWRFRPSOHWHD ODUJHUGHVLJQZRUOG,WKLQNWKDWDZRPDQORRNVWKHVH[LHVWZKHQ VKHLVGUHVVHGXSLQP\GHVLJQ7KHEHVWVHOOLQJLWHPVRIP\ GHVLJQKDSSHQWREHLQVPDOOVL]HV)RUQRZKHLVIRFXVHGLQ PHQ VIDVKLRQEXWKHGUHDPVRIH[SDQGLQJKLVNLQJGRPOLWWOHE\ OLWWOH,GRQRWIDQF\JURZLQJLQVL]H,ZDQWWRVKDUHP\VHQVHRI EHDXW\ZLWKODUJHUDXGLHQFH$QGKHZRXOGEHZRUNLQJKDUGWR PDNHWKLVGUHDPFRPHWUXHDWKLV6RKRVWXGLRLQ1HZ<RUN --6/((/HHMXQJVXQ /DVW\HDULQ-XQH/RQGRQKDGDQXPEHURIJUDGXDWLRQFROOHFWLRQ VKRZVWKDWSUHVHQWDSUHOXGHRIIXWXUHELJWLPHIDVKLRQJHQLXVHV 2QHVWXGHQWZKRVZHSWWKHDWWHQWLRQDPRQJFUHPHGHODFUHPH VWXGHQWVKDSSHQHGWREH.RUHD-6/HHDJUDGXDWHRI6DLQW &HQWUDO0DUWLQV6FKRRO/HH VDOXPQLLQFOXGHWKHEHVWGHVLJQHUV RIRXUWLPHV/HHZDVRQHRIWKHWZR.RUHDQVZKREHFDPHWKH 1RZLQQHUVWRJHWKHU 7KDWJUDGXDWLRQFROOHFWLRQZDVHQRXJKWRHDUQ/HHWZRVWURQJ VXSSRUWHUV2QHLV/RXLV:LOVRQWKHIDVKLRQGHDQRIKHUVFKRRO DQGLWLVRQO\DPDWWHURIWLPHIRUDGHVLJQHUWREHDVWDUZKHQKH RUVKHKDVDEDFNXSRI:LOVRQ8QGHUWKHJXLGDQFHRIWKLVJUHDW WHDFKHU/HHVDZKHUGHVLJQVERXJKWE\WKH+DUURG VRI/RQGRQ DQGWKLVRSSRUWXQLW\HDUQHGKHUWKHVHFRQGPHQWRU6DUDK 0RRUHWKHJRGPRWKHURIWKHZRUOG VEHVWNQRZQGHVLJQHUV6KH LQVSLUHGPHWRGRP\RZQGHVLJQ6KHZDVVRNLQGWRJLYH GHWDLOHGFRDFKLQJZKHQ,ZDVSUHSDULQJP\ILUVWSRVWJUDGXDWLRQ FROOHFWLRQ 7KDQNVWRWKHJUHDWPHQWRUVSHUKDSV/HHZRQFULWLFDODFFODLPLQ KHUGHEXWFROOHFWLRQGXULQJWKH/RQGRQ)DVKLRQ:HHNODVW 6HSWHPEHU$QGVKHHDUQHGJUHDWUHDFWLRQLQWKH3DULV6KRZURRP IRUXSDQGFRPLQJGHVLJQHUVRI/RQGRQZKLFKLVWKRXJKWWREHD JDWHZD\IRU\RXQJGHVLJQHUVWRVXFFHVV:DWFKLQJFHOHEULW\ HGLWRUVOLNH$QQD:LQWRXURIWKH86 9RJXH PDJD]LQHFDUHIXOO\ H[DPLQLQJP\GHVLJQV,ZDVWKULOOHGZLWKKDSSLQHVV,DPYHU\ VDWLVILHGE\WKHIDFWWKDW,FRXOGKDYHZRQDJRRGVWDUWIURPP\ ILUVWFROOHFWLRQ /HH VNH\WRVXFFHVVLVKHURULJLQDOGHVLJQ,Q/RQGRQIDVKLRQ VFHQHUDWKHUH[DJJHUDWHGLPDJLQDWLRQVHHPVWRHDUQDWLFNHWWR PDLQVWUHDP%XW,ZHQWRQZLWKP\RZQVW\OHRIEHLQJPLQLPDO DQGVLPSOHDQG,WKLQNLWFRXOGGLIIHUHQWLDWHPHIURPRWKHU GHVLJQHUV,WLVKRZHYHUQRWHDV\IRUD\RXQJGHVLJQHUWRVWLFN WRVLPSOLFLW\EHFDXVHVLPSOHGHVLJQVDUHQHFHVVDU\WRKDYH H[FHOOHQFHLQWDLORULQJWRWKHOHYHORISHUIHFWLRQ,JRWDORWRIKHOS IURPWKHH[SHGLHQFHVLQ.RUHDZKHUH,ZRUNHGDVDSDWWHUQ PDNHUIRUDGRPHVWLFEUDQGWKHUH7KHQ,PRYHGWR/RQGRQWR OHDUQDKLJKHUOHYHORIWDLORULQJ/HHILUVWSODQQHGWRVSHQGVL[ PRQWKVLQ/RQGRQEXWLWLVDOUHDG\KHUVL[WK\HDU/HHLVILQGLQJ FRPIRUWWKHUHDVVKHVD\V/RQGRQLVWKHEHVWSODFHWREHD \RXQJGHVLJQHU(YHU\RQHZDQWVWRKHOSRXWDEHJLQQLQJ GHVLJQHU7KHQLQ.RUHDVKHPHWWKLVJUHDWVSRQVRU6)')DQG LWVHHPVWKDWVKHKDVRQO\VXFFHVVHVLQKHUSRUWIROLRIURPQRZRQ 179 January 2011


Chopard, ready for a whole new chapter

EDITOR JUNG JALIM PHOTOGRAPHER PARK SUNGIL COOPERATION WOORIM FMG(3284-1300) HUGO BOSS(512-6551)

Chopard is already beloved worldwide for its high-end jewelry, but it is now ready to hop on to a higher level now in Korea, based on its 150 years of history. NOBLIAN met Kim Yoon-Ho.

,QUHWURVSHFW,ZRXOGVD\WKDWDPRQJMHZHOU\EUDQGV&KRSDUG RXWRIPDQ\RWKHUVVWRRGRXWIRULWVH[FHOOHQFHWKDWUHPDLQV ORQJHULQP\PHPRU\,QSDUWLFXODUWKHFHOHEUDWLRQHYHQWIRUWKH WKDQQLYHUVDU\ZDVMXVWVWXQQLQJHYHQIURPDORRNDW SKRWRJUDSKV3OHDVHVKDUH\RXUWKRXJKWVDERXWWKHWK DQQLYHUVDU\FHOHEUDWLRQ )LUVWRIDOOWKDQN\RXIRUNLQGZRUGV,WZDVQRWSODQQHGLQ DGYDQFHEXWLWWXUQHGRXWWREHDJUHDWRSSRUWXQLW\IRUXVWRKDYH GRQHWKH.RUHDQODXQFKLQJLQWKH\HDUZKLFKKDSSHQHGWR EHWKHWKDQQLYHUVDU\RI&KRSDUG,Q0D\DWWKH.RUHD ODXQFKLQJHYHQWDQXPEHURILPSRUWDQWILJXUHVVXFKDV.DUO )ULHGULFK6FKHXIHOHWKH&(2RIRXUFRPSDQ\IRXQGWLPHWRFRPH WR.RUHD7KHLUSUHVHQFHKHOSHGDORWWRSUHVHQWWKHORQJKLVWRU\ RI&KRSDUG,ZDVVRKDSS\WRKHDUVRPDQ\SHRSOHVD\LQJWKDW WKH\ YHEHHQZDLWLQJIRUVRORQJIRUWKH&KRSDUG.RUHDODXQFK 3HUVRQDOO\&KRSDUGUHPLQGVPHILUVWRILWVEHDXWLIXOMHZHOU\ ZDWFKHVDQG\HDUVRIKHULWDJH7KLVLVXWWHUO\SHUVRQDOEXW, DOVRIDQF\KRZWKHQDPHVRXQGV7R\RXZKDWLVWKHPHDQLQJRI WKHEUDQG&KRSDUG" 180 Noblian


,DPWRWDOO\RQWKHVDPHSDJHZLWK\RXRQWKHEUDQGQDPH %HVLGHV,HVSHFLDOO\ORYHWKHEDODQFHEHWZHHQWUDGLWLRQDOFODVVLF DQGRULJLQDOLW\RIWKHGHVLJQ,WKDVEHHQDOUHDG\VHYHQWRHLJKW \HDUVVLQFH,VWDUWHGWRWDNHLQWHUHVWLQ&KRSDUG$IWHUKDYLQJD ORRNDURXQGWKH&KRSDUGVWRUHLQ)UDQFH,KDGWKLVFRQYLFWLRQ DERXWWKHSRWHQWLDOEUDQGYDOXHVEHKLQGWKLVEUDQGWKDWKDV HODERUDWHGHVLJQDQGSRZHUWRWXUQOX[XU\LQWRSXEOLF,KDYHEHHQ LQZDWFKEXVLQHVVIRUVRPH\HDUVDQGLWZDVRQO\QDWXUDOIRU PHWRKDYHLQWHUHVWVLQ&KRSDUG)URPWKHQRQ,FRQWLQXHGWR WDNHLQWHUHVWVLQ&KRSDUGDQGDERXWILYH\HDUVDJR,KDGWKLV FKDQFHWRKDYHPHWD&KRSDUGKHDGTXDUWHUVWDIIDQG,ZDVOXFN\ WRKDYHDFFXPXODWHGFUHGLELOLW\HYHQEHIRUHVLJQLQJSDUWQHUVKLS )URPP\SRLQWRIYLHZ,WKRXJKWYHU\KLJKRI&KRSDUGSKLORVRSK\ WKDWNHHSVWUDGLWLRQDQGIDPLO\PDQDJHPHQWV\VWHP$QG,ZDV DPELWLRXVWRLQWURGXFHSURSHUO\WKHEUDQGWR.RUHD ,XQGHUVWDQGWKDW&KRSDUGKDVWKLVDZDUHQHVVDERXWFRUSRUDWH VRFLDOUHVSRQVLELOLW\LVVXHDQGSOHDVHVKDUHWKHVWRULHVWRRXU 12%/,$1UHDGHUV &KRSDUGLVDEUDQGWKDWKDVPDLQWDLQHGFRQWLQXRXVDFWLYLWLHVWR VXSSRUWVRFLHW\E\VSRQVRULQJDQGJRRGH[DPSOHVDUHWKLVORQJ SDUWQHUVKLSZLWKWKH&DQQHV,QWHUQDWLRQDO)LOP)HVWLYDODQGWKH RIILFLDOVSRQVRUVKLSZLWKWKH0LOOH0LJOLDWKHYLQWDJHFODVVLF DXWRPRELOHEUDQG%\GRLQJVRZHPDNHVXUHWKDWZHGRVSRQVRU FXOWXUH$WWKHVDPHWLPHZHKDYHMRLQHG(OWRQ-RKQLQKLVHIIRUW WRILJKW$,'6DQG-RVH&DUUHUDVWRILJKWOHXNHPLD:HKDYHDOVR FUHDWHGMHZHOU\DQGZDWFKFROOHFWLRQVWRJHWKHUZLWKWKHPDQGWKLV UHPDLQVDVDQLPSRUWDQWSDUWRI&KRSDUGKLVWRU\ ,DPVXUHWKDWWKLV&KRSDUGEUDQGSKLORVRSK\LVJRLQJWRJLYH SRVLWLYHLQIOXHQFHWRVRFLHW\:KDWDERXW\RXSHUVRQDOO\RU\RXU FRPSDQ\:RRULP)0*"$UHWKHUHDQ\FKDQJHVPDGHEHFDXVH RIWKLVEUDQGSKLORVRSK\RI&KRSDUG" ,ZRXOGQRWVD\LWDFKDQJHEXW,DPGHOLJKWHGWRILQGDQXPEHURI VLPLODULWLHV,QIDFWWKDQNVWRRXUODVWPHHWLQJ,FRXOGOHDUQWKDW, DQG.DUO)ULHGULFK6FKHXIHOHVKDUHDQXPEHURIFRPPRQWKLQJV )RUH[DPSOH6FKHXIHOHKDVQHYHUVSDUHGKLVVXSSRUWIRUWKH &DQQHV,QWHUQDWLRQDO)LOP)HVWLYDODQG:RRULP)0*DOVRKDV WKLVGHHSDQGORQJUHODWLRQVKLSZLWKILOPV2XUVLVWHUFRPSDQ\ )LOP7UDLQMXVWUHOHDVHGDKLWILOP7KH8QMXVWDQGDQXPEHURI RWKHUILOPV:RRULP)0*KDVLQYHVWHGLQDVPDQ\DVILYHILOPVVR IDU$WWKHVDPHWLPH&KRSDUGDOVRVXSSRUWVRUJDQL]DWLRQVWKDW ILJKWGLVHDVHVOLNH$,'6DQG:RRULP)0*KDVDOVRVXSSRUWHG :RUOG9LVLRQWRPDNHFRQWLQXHGGRQDWLRQVIRUWKHOHVVSULYLOHJHG $V,GLVFRYHUHGWKHVHIDFWVDV:RRULP)0*EHFDPHD.RUHDQ GHDOHUIRU&KRSDUGDQG.DUODQG,KDYHDOVRWDONHGDERXWWKLVDQG WKRXJKW:RZZHKLWLWRIISUHWW\ZHOO,WZDVDSUHWW\H[FLWLQJ H[SHULHQFH,QWKLVSURFHVV,FRXOGKDYHPRUHLQWHUHVWVLQ FRUSRUDWHVRFLDOUHVSRQVLELOLW\LVVXHDQGFXOWXUHLVVXHDQG,KDYH WKLVKXJHUHVSRQVLELOLW\WREHEHWWHUDGHDOHUIRU&KRSDUGLQ.RUHD

)ULHGULFK6FKHXIHOH",XQGHUVWDQGWKDW6FKHXIHOHKDVSHUVRQDO KREELHVRIFROOHFWLQJPHFKDQLFDOZDWFKHVDQGFODVVLFFDUV'R \RXKDSSHQWREHKDYHWKHVDPHKREELHV" ,DOVRKDYHKXJHLQWHUHVWVLQFODVVLFFDUV2QHGLIIHUHQFHZRXOG EHWKHIDFWWKDW,OLNHFODVVLFWUXFNVDQGMHHSV2QFH,GUHDPHGRI EHLQJD1DWLRQDO*HRJUDSKLFUHSRUWHUVR,QDWXUDOO\GHYHORSHG LQWHUHVWVLQWKDWSDUW,KDYHDFROOHFWLRQRIVL[MHHSVDQG 6FKHXIHOHDOVRVKRZHGJUHDWLQWHUHVWV 6RDOOWKHVHVWRULHVWHOOPHWKDW\RX0U6FKHXIHOH&KRSDUGDQG :RRULP)0*VKDUHDORWLQFRPPRQ1RZ, GOLNHWROHDUQKRZ \RXFRXOGZLQWKHSDUWQHUVKLSZLWK&KRSDUG:DVWKHUHDQ\ FRQQHFWLRQWR\RXUSDVWFDUHHUV"$OVRWKHUHFHQWUHIRUPRI &KRSDUGVHHPVWRKDYHLQIOXHQFHGDORWLQ.RUHDDQG, GOLNHWR OHDUQWKHUHDVRQZK\&KRSDUGZDQWVWRMRLQWKH.RUHDQPDUNHW WKURXJK:RRULP)0* :RRULP)0*KDVWKLVSLOHRINQRZKRZLQWKHZDWFKDQGMHZHOU\ SDUWIRUPRUHWKDQ\HDUVDQGWKLVKLVWRU\LVDSURRIIRURXU FDSDELOLW\2QWRSRIWKLVZHKDYHSUHSDUHGORQJHQRXJKWREHWKH ULJKWSDUWQHUZLWK&KRSDUGDQGWKLVSODQVHHPHGWRKDYHJLYHQ WUXVWWR&KRSDUG:HKDYHSURSRVHGDILYH\HDUSODQZKLFKZH SUHSDUHGIRUVL[PRQWKVDQGWKHUHSRUWZDVDERXWSDJHVORQJ DQGHODERUDWHGRQWKHHQYLURQPHQWUHJDUGLQJFRPSHWLWRUV &KRSDUGVWDWXVLQ.RUHDDQGPDQ\RWKHUV,WWRRNKRXUDQG PLQXWHVIRUXVWRJLYHWKHSUHVHQWDWLRQDQGWKH&KRSDUG KHDGTXDUWHURIILFHUHDFWHGWKDWWKH\ YHQHYHUIRFXVHGRQDQ\ RWKHUSUHVHQWDWLRQVEHIRUH7KHVHDUHWKHEDFNJURXQGVWRULHV EHKLQGWKHVFHQHVRIWKHSDUWQHUVKLS 6WDUWLQJIURPLWVHHPVWREHREYLRXVWKDW&KRSDUGLVJHWWLQJ DJJUHVVLYHLQWDNLQJURRWLQ&KRSDUG3OHDVHWHOOXVWKHGLIIHUHQFH EHWZHHQWKHSDVWDQGWKHSUHVHQWLQWHUPVRIPDUNHWLQJVWUDWHJ\ &KRSDUGLQWKHSDVWLQ.RUHDZDVQRWVHWXSDVDVRORERXWLTXH VRWKHUHZDVQRWPXFKRIDPDUNHWLQJSHUIRUPDQFH$WUXH PDUNHWLQJSHUIRUPDQFHWKDWSUHVHQWVDEUDQGYDOXHFDQEH GHVFULEHGWRKDYHVWDUWHGLQZKHQWKHEUDQGODXQFKHGLQ .RUHDDQGWRJHWKHUZLWKWKHWKDQQLYHUVDU\ZHFRXOGSXUVXH DQXPEHURIVL]DEOHEUDQGUHODWHGHYHQWVDQG,WKLQNWKLVLVZK\ VRPHFXVWRPHUVZRXOGIHHOWKDW&KRSDUGKDVWXUQHGDJJUHVVLYH :HSODQWRGRPRUHDFWXDOO\DVZHDUHWRLQWURGXFHPDOH ZDWFKHVWR.RUHDZKLFKKDYHDOUHDG\FHPHQWHGWKHVWDWXVLQWKH ZRUOGZLGHPDUNHWWKDQNVWRWKHDXWRPDWLFPRYHPHQW GHYHORSPHQW$OVRZHDUHDERXWWRSUHVHQWKLJKHQGMHZHOU\OLQH WRPHHWXSZLWKWKHH[SDQGLQJQHHGVRIFXVWRPHUV

&RXOG\RXSOHDVHHODERUDWHRQ\RXUFRPPRQLQWHUHVWVZLWK.DUO 181 January 2011


An artist who knows aesthetics of mixing YANG BANG EAN Fusion is now a legitimate part of art, as many artists mingle and mix many different things into one harmony. In music, there is YANG BANG EAN, the leading figure of crossover music scene.

EDITOR KIM HYE YOON COOPERATION endorf music(2195-4699)

0XVLFKDVYDULRXVJHQUHV,WÒ&#x2039;VHDV\WRILJXUHRXWZKLFKJHQUHRI VRPHSLHFHV2WKHUVKRZHYHUHOXGH\RXUFDWHJRUL]DWLRQ<DQJ %DQJHDQÒ&#x2039;VPXVLFZRXOGEHWKHODWWHU6WDUWLQJZLWKDPRGHVW LQWUR<DQJÒ&#x2039;VPXVLFVRPHWLPHVHQGVZLWKURFNPXVLFVSLFHGZLWK SDUWVRIRWKHUJHQUHVDQGFURVVRYHUV7KLVLVPXVLFLDQ<DQJLV DQDUWLVWZKRNQRZVKRZWRPL[JHQUHVWREULQJKDUPRQ\$VD VRQRID.RUHDQZKRPRYHGWR-DSDQLQWKHFRPSOLFDWHGKLVWRU\ RIWKHWKFHQWXU\<DQJWUHDGHGDYHU\VSHFLDOSDWKWREHFRPHD FDUHHUPXVLFLDQ+HKDVQHYHUEHHQDFKLOGSURGLJ\+HKDVQRW EHHQDIDWKHURIDPXVLFSLHFHWKDWWRRNWKHZKROHZRUOGE\VWRUP <DQJEHJDQKLVFDUHHUDVDPHGLFDOGRFWRU7KHQZKDWPDGHKLP WRWDNHRIIKLVZKLWHJRZQ"3HUKDSVZHFDQILQGWKHDQVZHUIURP KLVWHHQDJH\HDUVZKHQKHZDVVKRFNHGWRKHDUSURJUHVVLYHURFN PXVLF)URPWKHQRQKHDFFXPXODWHGKLVPXVLFH[SHULHQFHVDQG VLQFHKHVWDUWHGDFKDSWHUDVDPXVLFLDQWRJHWKHUZLWK 6KRJR+DGDPD+LVPXVLFWKHQVRXQGHGWRRPDWXUHIRUKLVDJH DQGKHVRRQEHFDPHDSURGXFHU7KLVDOVREHFDPHDEULGJHIRU KLVFDUHHULQ&KLQHVHVSHDNLQJFRXQWULHV7RQDPHMXVWDIHZKH ZDVDPXVLFGLUHFWRUIRU-DFNLH&KDQÒ&#x2039;VILOP´7KXQGHUEROWµDQGD VRXQGWUDFNGLUHFWRUIRU%H\RQGDOEXPUHOHDVHGLQ&KLQHVH VSHDNLQJFRXQWULHV+LVFDUHHUVRRQZHQWRYHUWKH-DSDQHVH ERUGHUWRDOORYHU$VLD$VKHZDVFHPHQWLQJKLVVWDWXVDVDKLW PXVLFGLUHFWRUKHWKHQWKRXJKWWKDWKHZDQWVWREHDQDUWLVWZKR UHOHDVHVDOEXPVXQGHUKLVRZQQDPH$QGKHPDGHKLVGUHDP FRPHWUXHLQDIWHU\HDUVLQWKHPXVLFLQGXVWU\ZLWKKLV DOEXP´7KH*DWHRI'UHDPVµ,QWKLVDOEXPKHSUHVHQWHGODUJH VFDOHGPXVLFSLHFHVDVKHSOD\HGWRJHWKHUZLWK&KLQDÒ&#x2039;V RUFKHVWUDEDVHGRQKLVSURJUHVVLYHURFNVW\OHNH\ERDUG SHUIRUPDQFH+LVDOEXPZDVDVXFFHVVIXORXWFRPHRIKLV H[SHULPHQWDORUFKHVWUDWLRQRIVHYHUDOFRXQWULHVÒ&#x2039;WUDGLWLRQDO PXVLFDOLQVWUXPHQWV $IWHUWKLVVRIWODQGLQJVWDUW\DQJWKHQZHQWRQZLWKKLVVHFRQG DOEXP´,QWRWKH/LJKWµEDVHGRQWKHLQVSLUDWLRQVIURPUHFRUGLQJV RIIRONVRQJVRIPDQ\FRXQWULHVWKDWKHWUDYHOHGWRJHWKHUZLWK /RQGRQ3KLOKDUPRQLF2UFKHVWUD$WWKHVDPHWLPHKHDOVRGLGWKH SURGXFLQJRIWKH5XVVLDQERUQDUWLVW2ULJDDQGPDGHDQH[RWLF VRXQGZKLFKZDVFULWLFDOO\DFFODLPHG6RKHVWHSSHGFORVHUWR WKHSXEOLFZLWKKLVRZQVW\OHRIRUFKHVWUDWLRQRIYDULRXVFRXQWULHVÒ&#x2039; PXVLFVW\OHV 6XFKDMRXUQH\RI<DQJÒ&#x2039;VPXVLFJUHHWHGDWXUQLQJSRLQWLQ 7KDWZDVDWLPHZKHQKHPDGHDQLQGHSWKGHOLEHUDWLRQRIKLV LGHQWLW\+LVPXVLFDOZD\RIWKLQNLQJZDVKDYLQJDHYHQPRUH YDJXHERUGHUOLQHDVKHJRWFORVHUWR.RUHD+HZDVLPSUHVVHGE\ WKH.RUHDQWUDGLWLRQDOGUXPVRXQGVZKLFKKHFDUULHGLQKLV DOEXP´2QO\+HDYHQ.QRZVµ7KLVDOEXPEULQJVWRJHWKHUYLYLG VRXQGVIURP.RUHD(QJODQG0RQJROLDDQGPDQ\RWKHUVZKLFK KHPL[HGWRJHWKHUZLWKFODVVLFDOVRXQGVWRSURGXFHWKHILQHVW VRXQGHYHU<DQJWKHQZHQWRQWROHYHOXSKLVUHSXWDWLRQLQ.RUHD DVKHZRUNHGWRJHWKHUZLWK\RXQJ.RUHDQPXVLFLDQVWRSURGXFH JHQWOHZDYHUK\WKPV$WWKHVDPHWLPHKHJDYHODUJHVFDOH FRQFHUWVLQ.RUHDDQGHDUQHGKHDWHGPHGLDDWWHQWLRQWRFHPHQW KLVQDPHDVDQHZDJHDUWLVW 182 Noblian


Follow the lionhearted chivalry, with SIEGER Eugenio Alphandery is a CEO of the Santa Maria Novella, a home to Florenceâ&#x20AC;&#x2122;s history, art and craftsmanship. Based on history and revolution at the same time, Santa Maria Novella takes you to its special fragrance.

EDITOR WON JONGMYUNG COOPERATION LANSMERE (542-4155)

6,(*(5OLIHVW\OHFUHDWLQJFXOWXUHIRUJHQWOHPHQ (YHU\JX\ZLWKVW\OHGUHDPVRISUHVHQWLQJDSHUIHFWJHQWOHPDQÒ&#x2039;V ORRN$WUXHPDQLVFRPSOHWHRQO\ZLWKWKLVRQHZRUGJHQWOHPDQ <RXFDQQHYHUUHVLVWLWVFKDUP$QGWRJHWKHUZLWKDSK\VLFDO DSSHDUDQFHDWUXHJHQWOHPDQNQRZVKRZWRFUHDWHDFXOWXUHRI KLVRZQWKURXJKKLVOLIHVW\OH ,QWKLVFRQWH[W6,(*(5GHVHUYHV\RXUKHDWHGDWWHQWLRQ)URP OX[XU\WRTXDOLW\WRFXOWXUHWRVW\OH6,(*(5KDVHYHU\WKLQJDQG LWVVXEWOHFKDUPVZLOOVRRQRYHUZKHOP\RX+DLOLQJIURP +DUNRWWHQ*HUPDQ\WKHWZREURWKHUV&KULVWLDQ6LHJHUDQG 0LFKDHO6LHJHUFUHDWHG6,(*(5ZLWKWKHLUFUHDWLYHVW\OHDQG SDVVLRQ,WÒ&#x2039;VDELWVXUSULVLQJWKDWWKLVEUDQGRIPL[LQJFRORUVDQG KXPRUFRPHVIURP*HUPDQ\DFRXQWU\RIEHHUDQGFDUV &KULVWLDQ6LHJHUWKH&(2RIWKHEUDQGYLVLWHG.RUHDODVWPRQWK WRVKDUHKLVXQLTXHVW\OHDQGH[FHOOHQWFUHDWLYLW\ +HVDLG´,EHOLHYHWKDWDPDQFDQEHWUXO\HOHJDQWHWHUQDODQG PDQO\DQGWKLVLVWKHIDVKLRQSKLORVRSK\RI6,(*(5,I\RX FKRRVH6,(*(5LWPHDQVWKDW\RXDUHDPDQZKRVHHNVWKH ILQHVWTXDOLW\6,(*(5LVGHILQHGIRULWVHODERUDWHGHWDLOVDQG FUHDWLYHFKRLFHRIFRORUV7KHJHQWOHPHQRIRXUWLPHVFDQILQG WKHLUGUHDPLQ6,(*(5ZKLFKFRPHVZLWKPRGHUQWDLORULQJ SHUIHFWVW\OHDQGOX[XU\6,(*(5VWDUWVZLWKWKHFXOWXUHWKDWKDV PDQ\OD\HUVRIGHVLJQH[SHULHQFHVEDVHGRQSDVVLRQIRUIDVKLRQµ 6,(*(5GHVLJQSUHVHQWVHPRWLRQVVWRULHVDQGFXOWXUDO SURWRW\SHVRIPL[WXUHVDQGWKLVLVDJDLQKDUPRQL]HGE\WKH RULJLQDOLW\RI6,(*(57KLVLVWKHUHIOHFWLRQRIWKHWZR6LHJHU EURWKHUV7KHLUVWXGLRDQGUHVLGHQFHRI+DUNRWWHQ3DODFHLVDFRUH IDFWRURIWKHLUVXFFHVVDVLWVEDURTXHVW\OHLQVSLUHVWKHLUIDVKLRQ SKLORVRSK\7RWKHPWKHSDODFHLVWKHVRXUFHRILQVSLUDWLRQVIRU WKHLUFXVWRPHUV7KH\VWLOOJHWLGHDVIURPHOHJDQFHRIWKHSDODFH DQGWKH\EULQJLWLQWRWKHLUGHVLJQV$WWKHVDPHWLPHWKH\VKDUH WKHLUSDODFHWRWKH6,(*(5FXVWRPHUVDQGKHOSWKHPWREXLOGXS WKHLURZQVW\OH 7KLVVHDVRQÒ&#x2039;V6,(*(5FROOHFWLRQUHIOHFWVWKHLULGHRORJ\DQG SKLORVRSK\DVWKH\DUH'HVLJQHU0LFKDHO6LHJHUKDVWKLV SKLORVRSK\WKDWKDYLQJWROHUDQFHRSHQPLQGHGQHVVDQGPDQQHUV IRURWKHUVDUHZKDWGHILQHDWUXHJHQWOHPDQUHJDUGOHVVRIWKHLU UDFHVRUMREV6XFKDSKLORVRSK\KDVEHFRPHDPRWLYHSRZHUWR GULYHWKHWZREURWKHUVWRODXQFKWKHQHZ$: FROOHFWLRQWKHPHGZLWKWKHSKUDVH/LRQ+HDUWZKLFKLVEDVHGRQ DPRGHUQPDQÒ&#x2039;VVHOIUHFRJQLWLRQDQGPDQQHUVIRURWKHUV 6,(*(5LVPRGHUQDQGVH[\7KHEUDQGÒ&#x2039;VSDVVLRQDQGRULJLQDOLW\ FRPHVIURPWKHGDULQJQDWXUHRI0LFKDHO6LHJHUZKRWXUQHGKLV H\HVWRVXUSULVLQJGHVLJQFRORUVDQGSHUVXDVLYHIXQFWLRQV+LV *HUPDQVW\OHRISHUIHFWLRQDQGSUDFWLFDOLW\FRPELQHGSDVVLRQIRU IDVKLRQ&KULVWLDQ6LHJHUSXWLWWKLVZD\´XQLYHUVDOGHVLJQILUPO\ IRRWHGRQ(DUWKµ6,(*(5Ò&#x2039;VFUHDWLYLW\LVUHPLQGHGZLWKLWVYLYLG FRORUVZKLFKSUHVHQWDVHQVHRIFRQWHPSRUDU\GHVLJQLQLWV GLVSOD\SDFNDJLQJDQGORJR3XUSOHLVWKHGHILQLQJFRORURIWKH EUDQGDQGLWVPDJLFDOFRORUSUHVHQWVVSHFLDOFKDULVPDRIWKH EUDQGDQGLWLVDOOVHWWRPHVPHUL]HFXVWRPHUV6,(*(5Ò&#x2039;V FKDUPLQJSRUWIROLRFDQEHFRQILUPHGLQ/DQVPHUH 183 January 2011


horoscope

Aquarius

Taurus

Leo

Scorpio

1.20-2.18

4.20-5.20

7.23-8.22

10.24-11.22

물병자리

황소자리

사자자리

전갈자리

중요한 결정을 앞두고 있다면 조금만 더

그동안 마음속으로만 꿈꿔오던 상상이

과거에 미련을 두어봤자 나아질 건

여러 가지 일로 당신은 지칠 대로 지쳐

미룰 것. 섣부른 결정으로 자칫 곤란한

드디어 현실로 다가오기 시작했다. 이

아무것도 없다. 지금 하고 있는 일에

있다. 이달과 다음 달은 한결 여유로움을

결과를 맞닥뜨릴 위험이 크다. 매사에

커다란 행운을 받아들이기에 당신은

최선을 다해 과거를 회복하고 더 앞으로

가질 수 있는 시기다. 몸도 마음도

신중한 결정을 하는 당신이지만

오히려 두려움이 앞설 수도 있겠다.

나아가는 길을 모색해야 할 것. 자꾸

재충전할 수 있는 기회인 만큼 새로운

이번만큼은 그 어느 때보다 심사숙고해야

당신을 진정으로 이해해줄 이들과

과거에 얽매이다간 지금 유지하고 있는

취미 생활을 시작하거나, 여행을 떠나는

하는 때임을 잊지 말 것.

함께한다면 당신의 빛나는 미래로 더

상황마저 난처해질 수 있다. 좀 더 먼

것도 좋은 기운을 불어넣을 수 있겠다.

안전하고 빠르게 도착할 수 있음을 명심

미래를 내다보고 힘차게 전진하는 용기가

Pisces

할 것.

필요한 달이다.

Sagittarius

2.19-3.20

Gemini

Virgo

11.23-12.21

물고기자리

5.21-6.22

8.23-9.22

사수자리

이번 달 새롭게 시작한 일에 금방 싫증이

당신의 우유부단한 태도는 주변의

날 수 있다. 하지만 당신에게 새로운 일은

쌍둥이자리

처녀자리

불안감만 증폭시킨다. 좋은 평판을

머지않은 미래에 큰 행운이 되어 돌아오게

지금의 상황은 당신이 생각하고 있는

이전과 비교하면, 지난달 비교적 평온한

유지하고 싶다면 좀 더 확실하고 자신감

된다. 조금의 지루함으로 하던 일을

것보다 좋지 않다. 당신의 사소한

심정으로 한 달을 보냈을 당신. 그동안의

넘치는 태도를 견지할 필요가 있다.

중단하는 실수를 범하지 않도록, 끈기를

부주의가 돌이킬 수 없는 큰 불행을 몰고

힘든 시기는 다 지났다. 지난 경험을

지나친 신중함보다는 실수를 두려워하지

가져야 할 때다.

올지도 모를 일. 언제나 매사에 신중해야

바탕으로 앞으로의 미래에는 찬란한

않는 당당한 태도가 오히려 당신을 빛나게

하며 한시도 긴장의 고삐를 늦추어선 안

무지개를 만날 일만 남았기 때문이다.

해주니 명심하자.

된다.

그런 와중에도 주위를 돌아보며 감사와

Aries 3.21-4.19 양자리

배려의 마음을 잃지 않도록 신경

Cancer

써야겠다.

6.23-7.22

Libra

가까운 사람이나 연인에게 배신을 당할 수

Capricorn 12.22-1.19 염소자리

있으니, 사람을 잃은 슬픔이 클 것. 견디기

게자리

힘든 일이겠지만 그럴수록 더 힘을 내어,

윗사람에게서 책망의 소리를 들을 수 있는

부정적인 절망 속으로 빠져드는 일이

달이다. 순간의 화로 인해 실수를 범하지

천칭자리

부드러운 거절의 말을 준비해두는 것이

없도록 하자. 자신을 다스리는 법을

않도록 자신을 다스려야 한다. 지금의

오랫동안 계속된 일 때문에 지쳐

좋다. 현명하게 헤쳐가지 못하면 여러모로

연구해야 할 때.

충고를 겸허히 받아들인다면 당신에게 또

있었다면, 머지않은 장래에 여유가 생길

당신에게 힘든 시간이 될 수 있다.

한 번의 커다란 기회가 주어지니, 이

것. 모처럼 생긴 여가를 집 안에서

기회를 절대 놓치지 말고 자신의 것으로

소진하지 않도록 하자. 잠깐의 휴식기가

만들어야 한다.

지나면 다시 바쁜 일상으로 돌아가야 하니

9.23-10.23

당신의 일에 관계된, 거절하기 힘든 사적인 부탁이 자주 들어오게 되는 시기.

이 기회를 빌려 재충전하는 것이 중요하다.

noblian 2011/01  

Contemporary Lifestyle Desination THE SHILLA

Read more
Read more
Similar to
Popular now
Just for you