Page 1

+ ( $ / 7 + <  / , 9 , 1 *   + ( $ / 7 + <  3 / $ 1 ( 7

IHHOJRRGÂ&#x2021;OLYHVLPSO\Â&#x2021;ODXJKPRUH

FREE

6SHFLDO(GLWLRQ

/LYLQJ

:RPHQ¶V :HOOQHVV

,QWXLWLYHO\

7KH+HDOLQJ 3RZHURI 0DVVDJH

)HQJ6KXL )DVKLRQLVWD

,W%RRVWV,PPXQLW\ 8SV(QGRUSKLQV 5HSDLUV0XVFOHV

7UXVW<RXU*XWWR 1DYLJDWH<RXU/LIH

&KRRVLQJ&RORUV DQG)DEULFV WKDW5HYHDO2XU (VVHQFVH

%2'< ($6(



3DWKVWR D0RUH )OH[LEOH%RG\ May 2014 | Greater Cincinnati/Northern Kentucky | NaturalCinci.com


6LJQL¿FDQW+HDOLQJ:HOO&DUH3UDFWLFH 9LFWRULD6PLWK&HUWL¿HG+ROLVWLF3UDFWLWLRQHUDQG,ULGRORJLVW

:HOO&DUH7KDW:RUNVIRU<RXDQG<RXU)DPLO\ 

Â&#x2021;  &RPEDWIDWLJXH     Â&#x2021; $OOHYLDWHSDLQVRUHQHVV     VWLIIQHVV VOXJJLVKQHVVEUDLQIRJ Â&#x2021; 0DVWHUZHLJKWORVV

IHDWXULQJ

Â&#x2021; (DVHDQ[LHW\GHSUHVVLRQ

Â&#x2021; %DODQFHGLJHVWLYH Â&#x2021; 0DQDJHPHQRSDXVH GLVWXUEDQFHV Â&#x2021; 8QGHUVWDQGXQH[SODLQHG V\PSWRPV Â&#x2021; 5HOLHYHKHDGDFKHV +ROLVWLF:HOO&DUH

0HGLFDO0DVVDJH

1XWULWLRQDO(GXFDWLRQ 6XSSOHPHQWV )LWQHVVDQG3HUVRQDO7UDLQLQJ /OR\G$YHQXH 2II7XUIZD\5RDG )ORUHQFH.<



9LFWRULD#VLJQL¿FDQWKHDOLQJFRP

ZZZ6LJQL¿FDQW+HDOLQJFRP ZZZ3,:HLJKW/RVVFRP


7+(/,9,1*3522),167,787(35(6(176

8QFRYHULQJWKH5227 &$86(RI+\SRWK\URLGLVP +DVKLPRWR¡V'LVHDVH

6DWXUGD\0D\WK 6DWXUGD\0D\VW :RUNVKRSVZLOOEHKHOGIURPDPWRSP

7RSLFV&RYHUHG â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

How lifestyle affects thyroid function and hormone metabolism. What nutrients the thyroid needs to work properly. How digestion impacts the thyroid and how to correct it. How stress impacts the thyroid and what you can do about it. The best type of exercise for thyroid patients. Thyroid friendly shopping list, meal plan, and recipes. What blood markers your doctor should be ordering. Much, much, more.

â&#x20AC;&#x153; Thank you for sharing this amazing information. I feel myself again after 10 years of suffering and struggling to ďŹ nd answersâ&#x20AC;? -Trisha D

5HJLVWHURQOLQHDW

WK\URLGERRWFDPSRKLRFRP

&$// 725(*,67(5 Dr. Jared Seigler DC, CFMP Co-Founder of Thyroid Boot Camp Functional Medicine Provider Author and Speaker

9277 Centre Pointe Drive West Chester, OH 45069

2QO\ /,0,7('6($7,1*


letterfrompublisher

H contact us Publisher Carol Stegman Editing/Writing Theresa Archer • Alison Chabonais Martin Miron • Lucy Moorman Jim Occhiogrosso Linda Sechrist • Gayle Wilson Rose Design & Production Steffi Karwoth • Stephen Blancett Sales/Marketing Carrie Palmer • Carol Stegman Betsy Tartar Technical Support Chris Stegman Advertising Carol@NaturalCinci.com 513-943-7323 Natural Awakenings Greater Cincinnati/Northern Kentucky 1134 Wellesley Ave, Batavia, Ohio 45103 Phone: 513-943-7323 Fax: 513-672-9530 Email: Carol@NaturalCinci.com National Advertising 239-449-8309 © 2014 by Natural Awakenings. All rights reserved. Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing. Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is available in selected stores, health and education centers, healing centers, public libraries and wherever free publications are generally seen. Please call to find a location near you or if you would like copies placed at your business. We do not necessarily endorse the views expressed in the articles and advertisements, nor are we responsible for the products and services advertised. We welcome your ideas, articles and feedback.

SUBSCRIPTIONS Subscriptions are available by sending $15 (for 12 issues) to the above address.

ave you ever noticed that the busier life gets, the more mind chatter we have to deal with? As I try to write my monthly letter, thoughts about everything else I have to get done keep running through my mind, distracting me from getting a handle on what’s incubating deep within. Mind chatter, a nearly universal trait of humanity, is counterproductive. We all need to learn how to manage and banish it. OK, I think I’m focused now… Welcome to our May Women’s Wellness issue, brimming with ways to nurture healing and well-being. Linda Sechrist’s feature article, “Trust Your Intuition: Listen to that Still, Small Voice and Let it Lead You,” shares counsel by leading experts on how to distinguish and respond to inner truths instead of all those other voices bouncing around inside of our heads. They maintain that learning how to calm the mindless chatter goes a long way in bringing greater health and happiness to everyday life. We can start by focusing less on outward stimulation from the five senses, which tend to disconnect us from our body’s profound innate intelligence. Practices like quiet time, meditation and prayer are excellent places to begin refocusing our attention. These help us to tap into our own intuition, which we can then learn to do “in the moment” anytime wise guidance is needed. Recently, for example, when I needed to make a pivotal decision for my business and unsure of what to do, I quietly prayed for guidance. The next week I received an out-of-the-blue call from a total stranger connecting me with exactly what I needed and was looking for. I love how such answers come. Massage and energy work such as acupuncture can set the stage by taking us to a deeper state of relaxation, so we are prepared to listen in to that inner voice. If you think that having needles poked into body parts would be anything but relaxing, think again; I find that after an acupuncture session I feel both calm and energized and enjoy a greater sense of clarity. In “Body Ease: Fluid, Flexible Movement,” writer Sarah Todd introduces us to several intriguing bodywork practices. The Alexander Technique, Feldenkrais Method and the Trager Approach all help re-educate the body to correct imbalances contributing to pain and discomfort. Locally, Rossiter Method coaches Marla Cohen and Rob Jones, co-owners of Mantra Massage and BodywoRx, also are trained to help many achieve pain relief through guided movement. Years ago, fresh out of massage school, I was privileged to try Thai yoga massage for the first time and immediately became a fan. The combination of massage and assistance with yoga poses loosens and stretches me beyond anything else I know. Now Mike Burgasser, of It’s Yoga, is offering a special chance to try it via a Mother’s Day special. Oftentimes in today’s society, we feel we are pulled in too many directions. It is vital that we take special time to care for ourselves as well, so that we can fully be there for those that depend on us. Natural Awakenings comes to the rescue with go-to resources in these pages. May you find the nurturing you seek this and every month. In health and happiness,

Like us on Facebook @ www.facebook.com/naturalcinci

Natural Awakenings is printed on recycled newsprint with soybased ink.

4

Carol Stegman, Publisher

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com


contents

14

26

28

7 10 11 13 14 16 21 26 28 30 34 36 39 40 43 46

newsbriefs eventspotlight globalbriefs ecotip healthbriefs

10 HEALTHY PARKS, HEALTHY PEOPLE

18

by Rachel Dearing

community spotlight healingways

16 TEN THOUSAND VILLAGES

greenliving

Making a Difference with Fair Trade Shopping

livingwellrecipes

by Gayle Wilson Rose

fitbody healthykids businessspotlight wisewords calendar classifieds naturaldirectory

advertising & submissions HOW TO ADVERTISE To advertise with Natural Awakenings or request a media kit, please contact us at 513-943-7323. Deadline for ads: the 10th of the month. Submit to Carol@NaturalCinci.com. EDITORIAL SUBMISSIONS Word documents accepted. Email articles, news items and ideas to: Carol@NaturalCinci.com. Deadline for editorial: the 5th of the month. CALENDAR SUBMISSIONS Email Calendar Events to: Carol@NaturalCinci.com. Deadline for calendar: the 10th of the month. REGIONAL MARKETS Advertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets call 239-449-8309. For franchising opportunities call 239-530-1377 or visit NaturalAwakeningsMag.com.

naturalcinci.com

Natural Awakenings is your guide to a healthier, more balanced life. In each issue readers find cutting-edge information on natural health, nutrition, fitness, personal growth, green living, creative expression and the products and services that support a healthy lifestyle.

18 TRUST YOUR INTUITION 24 Listen to that Still, Small Voice and Let it Lead You by Linda Sechrist

24 PRENATAL MASSAGE Benefits and Tips by Marla Cohen

32 SAVING LIVES WITH INFRARED THERMAL IMAGING by Anthony Piana and Alexander Sepper

34 WHOA! TO LIMITATIONS Therapeutic Horseback Riding Strengthens Kids by Cyndee Woolley

36 LIVE WELL CHIROPRACTIC Prenatal Care through Child Development

34 39

by Lucy Moorman

37 IRIDOLOGY AS A DIAGNOSTIC TOOL by Victoria Smith

39 VOLLEYING LIFE Gabrielle Reece on Her Balancing Act by Christine MacDonald

natural awakenings

May 2014

5


AWAKENING AMERICA Natural Awakenings

Celebrates 20 Years of Conscious Living

Read What People Are Saying About Natural Awakenings Natural Awakenings provides helpful information on natural health and environmental issues with a consistently positive perspective and tone, which is not always easy considering how serious and intimidating some of these topics are. It’s a rarity.

~ Sayer Ji, founder, GreenMedInfo.com

I have changed so much over the last year finally realizing that life is so much bigger than me. I love this Earth and all the wonders that are a part of it, and your magazine contributes to my appreciation.

~ Theresa Sutton, Connecticut

It is unusual to see your level of writing and consciousness in a free publication. Thanks for a great work. ~ Kaih Khriste’ King, Arizona

I wanted to let you know how much I enjoyed your antiaging article in Natural Awakenings magazine. Since this is a topic of great interest to me and something I’ve been following for a long time, it’s not often I run across fresh, new ideas and leading edge information. Great stuff. ~ Jim Donovan, author

Natural Awakenings magazine is the only advertising I use for my practice other than word of mouth referrals and it has brought us new patients consistently especially now that we advertise monthly. The quality of the leads is great and we really enjoy helping the holistic minded patient. The publisher is great to work with and truly wants to see the business succeed. We plan on always advertising with Natural Awakenings and expanding our presence in the magazine. ~ Cate Vieregger, DDS, Colorado

This magazine changes lives. Many of our clients have improved health as a direct result of reading about us in Natural Awakenings. Our deepest appreciation goes out to the NA staff for their level of integrity and their commitment to all-encompassing healing. ~ Jodie Mollohan, IntroCell, Pensacola, Florida

6

Greater Cincinnati/Northern Kentucky Edition

addirectory :HDOOKDYHDKDQGLQFUHDWLQJWKH

FRPPXQLW\  F ZKHUHZHZDQWWROLYH WůĞĂƐĞƐƵƉƉŽƌƚƚŚĞďƵƐŝŶĞƐƐĞƐ  ƚŚĂƚƐƵƉƉŽƌƚƵƐ͘͘͘ŶĚďĞƐƵƌĞ ƚŽŵĞŶƟŽŶLJŽƵƐĂǁƚŚĞŵ ŝŶEĂƚƵƌĂůǁĂŬĞŶŝŶŐƐ͊ dŚĂŶŬLJŽƵ͊ Company

Page

Alba Organic Beauty Studio ...............................................43 All About You Health Coaching .........................................24 Allure Salon ....................................................................... 7, 46 Bada Bloom ..............................................................................11 Beverly Welbourne .............................................................. 46 Bite Restaurant......................................................................28 Brain Balance .....................................................................7, 47 Cincinnati Colon Hydrotherapy ...................................19, 47 Crunchy Beginnings ..............................................................16 Dancing Heart Massage ......................................................47 Diamond Quality Clean ................................................ 26, 46 Donna Lynn Strong Brott, Lac ...........................................23 Dr. Westendorf, DDS ............................................................ 20 FIT Montgomery .............................................................25, 47 Full Circle Feng Shui and Life Design ...............................26 Gary Matthews.......................................................................47 Gateways to Healing...................................................... 15, 46 Gracetree Yoga and Growth Studio ..................................24 Great Parks of Hamilton County ..................................10, 17 Gwendoline Josey ...........................................................10, 47 HealthSavor ....................................................................29, 47 It’s Working Out ......................................................................13 It’s Yoga ....................................................................... 8, 23, 33 Julie Chafin Health Insurance............................................47 Jungle Jim’s International Market .................................. 7, 9 Karma Wellness Studio ........................................................25 Live Well Chiropractic .............................................31, 36, 46 Madeira Farmers Market .....................................................23 Mantra Massage and BodywoRx ......................... 22, 23, 24 Medical Massage Cincinnati ........................................25, 46 Mindful Wellness Thermography ................................ 33, 47 Nature’s Rite ....................................................................14, 29 Significant Healing Well Care Practice...........2, 37, 46, 47 Stillpoint Center for the Healing Arts ...............................21 Ten Thousand Villages ...................................................16, 35 The Living Proof Institute ..............................................3, 46 The Spice and Tea Exchange..............................................28 Third Sun Solar ......................................................................27 Tri-State Compounding Pharmacy..............................31, 46 Whole Foods ............................................................................12 Women’s Fitness Association ........................................ 9, 30 Yamuna .............................................................................21, 46 YMCA ...................................................................................... 48 NaturalCinci.com


newsbriefs

*(77+(+$,5

<28/29( 3(50$1(17/<

Infrared Bodywrap Special in Kenwood

VPRRWKLQIXVLRQÂ&#x152; UHWH[WXUL]LQJWUHDWPHQW

F

IT Montgomery is offering special pricing on bodywraps until May 30. While a FIT bodywrap may look and feel like a glorified red sleeping bag, it is actually an advanced weight-loss technology designed to burn 1,400 calories per session. Participants can enjoy relaxing activities such as listening to music, reading a book, meditating or just taking a short nap during a session. The bodywrap emits infrared heat that activates the release of stored fats and toxins. According to the Journal of the American Medical Association, infrared heat stimulates both metabolism and brain functions. It can help enhance the effects of a diet to lose unwanted weight, especially for those that have chronic muscle or joint pain. For the month of May, buy one wrap for $118 and receive the second wrap for free. To purchase the special, use the Natural Awakenings action code: NA2014 on the website.

6DYH

RQ$9('$5(7(;785,=,1* 75($70(17KDLUFXWDQGVW\OH DFRPSOLPHQWDU\VKDPSRRDQG FRQGLWLRQHU$KRXUVHUYLFH WKDWSHUPDQHQWO\VWUDLJKWHQV KDLUXQWLOLWJURZVRXW $YDOXHIRUMXVW 2IIHUYDOLG0D\ -XQH

 )250$/'(+<'()5(( 9LVLWXVRQ $OOXUH0DVRQFRP



)ROORZXVRQ

&RXUVHYLHZ'ULYH0DVRQ

Location: 9030 Montgomery Rd., in Kenwood. For more information, call 513-409-3174 or visit FITBodyCinci.com. See ad, page 25.

Vegetarian Indian-Style Cooking Class

T

he cooking school at Jungle Jimâ&#x20AC;&#x2122;s is offering a hands-on cooking course from 11:30 a.m. to 1 p.m., May 31, that will provide an in-depth look at how to prepare dishes that highlight the savory foods of Indian cuisine. Born and raised in India, instructor Madhu Sinha is passionate about cooking and encourages students to experiment with the warm, nutty spices found in Indian dishes. The course menu includes preparation of dishes such as colorful peppers stuffed with potatoes and spices, as well as lentils flavored with curry leaves. Using ingredients like eggplant, cauliflower, garlic, tamarind, and of course, curry, participants will learn the basics of combining complex, delicious and fragrant spices into everyday dishes with healthy, vegetarian and authentic Indian flavors. Registration is recommended and the class cost is $65 per person. Location: Jungle Jimâ&#x20AC;&#x2122;s International Market, 5440 Dixie Hwy., Fairfield. For more information, call 513-647-6000 or visit JungleJims.com. See ad, page 9.

This summer, change his future. The Brain Balance ProgramÂŽ helps kids overcome their academic, social and behavioral challenges. ADHD Learning Disabilities Ä&#x2018; Aspergerâ&#x20AC;&#x2122;s

Social Issues Behavioral Issues Ä&#x2018; Processing Disorder

Ä&#x2018;

Ä&#x2018;

Ä&#x2018;

Ä&#x2018;

CALL

513.257.0705

LEARN MORE brainbalancecincinnati.com VISIT 12084 Montgomery Rd., Cincinnati, OH 45249

Š2014 Brain Balance Centers

natural awakenings

May 2014

7


newsbriefs

YMCA of Greater Cincinnati Offers Free Weekend Workouts in the Park

Intensive Summer Yoga Teacher Training

I

t’s Yoga is offering a 200-hour training teacher training course beginning June 22 and continuing through July 27. The class will be conducted for six days per week for a total of five weeks. This program focuses on training yoga students that have experience with any yoga style or a recommendation from their yoga instructor. Upon completion of the program, trainees receive a certificate from It’s Yoga, Cincinnati, enabling them to become registered yoga teachers with the National Yoga Alliance. Having conducted yoga teacher trainings for 14 years, Its Yoga’s 200-hour training program is time-tested and designed to enhance the overall health of yoga practitioners by deepening and refining the layers of their yoga practice. Trainees learn yoga anatomy and kinesiology, asana biomechanics, postural adjustment and alignment techniques. The yoga philosophy, history and Sanskrit—the language of yoga—is also taught, along with meditation and pranayama. Students will learn to conduct classes in several styles such as hatha, yin, vinyasa, and ashtanga/power yoga so that trainees can modify their teaching repertoire according to current demands of yoga studios and fitness centers. The program cost is $2,250. Finance plans and early registration discounts are available. Location: 346 Ludlow Ave., Clifton. For more information, contact Mike Burgasser at 513-324-4654 or email ItsYogaMike@earthlink.net, or visit ItsYogaGarage.com. See ad, page 33.

Earthshares CSA Now Accepting New Members for 2014 Growing Season

E

arthshares CSA, a not-for-profit organization, is offering 115 shares and still has openings available for the 2014 season. During 2013, each CSA member received more than 200 pounds of vegetables during the 22-week growing season. Typical crops include tomatoes (including heirloom and cherry), corn, broccoli, lettuce (several varieties), spinach, garlic, potatoes, greens (kale and chard), cucumbers, onions, peppers, summer and winter squash, eggplant, sweet potatoes and herbs. For more information, visit EarthSharesCSA.org or email Membership@EarthSharesCSA.org.

8

Greater Cincinnati/Northern Kentucky Edition

G

et outside and get in shape with the YMCA of Greater Cincinnati. The Y offers free Saturday morning workouts at beautiful Washington Park. It’s free and open to the public. Classes start at 9 a.m. and all ages are welcome. Location: 1230 Elm Street in downtown Cincinnati. For more information visit MyY.org or call the Central Parkway YMCA at 513-241-5348. See ad, back cover.

Natural Awakenings Publisher Releases The Art of Flow

F

reddie Zeringue, a transformational coach and facilitator for over 25 years, has announced the release of his long-awaited new book, The Art of Flow, available in print and digital form. Known for helping clients achieve breakthroughs in the areas of health, relationships, prosperity and personal well-being, he has distilled vital principles into The Art of Flow, marking a new direction in the transformational field. Zeringue, publisher of the Northeast Florida edition of Natural Awakenings magazine, says, “The point of the book is to bring people into a state of natural flow, where they are able to create their lives in a very dynamic way that overrides resistance and opens up space to let in the limitless bounty of creation. The Art of Flow goes beyond The Secret and other books in the field to transform how we see ourselves and each other, objectively analyzing great teachings from a new perspective and embracing the idea that we are ‘divine creators’.” Universally-applicable and harmonizing with any individual’s personal beliefs or spiritual path, the essentials of the book are practical explanations of concepts we are all familiar with—things we’ve heard so often that we might assume we already know what’s at their core. Zeringue brings them into a new light, illuminating how they work together to dynamically create our lives. The mastery of these principles is profoundly life changing. Charlotte Eulette, international director of the Celebrant Foundation & Institute, says about The Art of Flow, “Stirring and moving to the very core, each story and lesson resonates and is immediately useful. Never remove it from your desk; refer to it always.” The book is available on Amazon.com and ArtofFlow.com, which features a free audio supplement available for download.

NaturalCinci.com


Second Annual Local Fest at Grailville

Second Annual Fitness Throw Down and Symposium

T

T

he Grailville Retreat and Program Center, in Loveland, with Turner Farm and media sponsor WNKU, will hold their second annual festival celebrating local food, art and music from noon to 5 p.m., May 24. This all-day outdoor festival features the artwork and wares of local artisans; light food fare from organic and local food vendors that include Bones Burgers, with grass-fed burgers made from local ingredients; and music from the award-winning Comet Bluegrass All Stars, a local bluegrass band that has opened for Del McCoury, Ricky Skaggs and Sam Bush. Beer will be available exclusively from the local brewery, Mad Tree Brewing. Additional participants this year are Gorman Heritage Farm, Grannyâ&#x20AC;&#x2122;s Garden, Turner Farm, Wormâ&#x20AC;&#x2122;s Way, Whistle Stop Clayworks, Jaybird Farms, Celtic Designs and Music, Pure Goodness Bakery, Earthshares CSA, Treats of Love, Worms Way, doTerra, the Centre for Sustainable Development Intiatives (CENSUDI) and others.

he Womenâ&#x20AC;&#x2122;s Fitness Association is hosting their second annual Fitness Throw Down and Symposium from 7:30 a.m. to 2 p.m., June 28, at the Five Seasons Sports Club Cincinnati location. The Throw Down is a competition of the top fitness instructors in the area. Participants vote for the best instructor and the one with the most votes takes home the Throw Down crystal trophy. Participants that preregister get to take up to five 30-minute exercise classes and/or lectures. This event is an eclectic fun mix of exercise classes, lectures, networking with vendors or the keynote speaker and lunch. All fitness levels are welcome and the event is open to both sexes. Location: 11790 Snider Rd. For more information, email Lisa@WomensFitnessAssociation.org or visit WomensFitnessAssociation.org. See ad, page 30.

The event is free and open to the public. Parking is available for a nominal fee. Location: 932 Oâ&#x20AC;&#x2122;Bannonville Rd. For more information or to register, call 513-683-2340 or visit Grailville.org. Event sponsors or business vendors, email Morgan Lyn at MLyn@Grailville.org. Artist vendors, email Joy France at JFrance@Grailville.org.

Love yourself first and everything else falls into line. You really have to love yourself to get anything done in this world. ~Lucille Ball

OPEN DAILY

4EV EVEHMWI 8LI1DWXUDO*SSH0SZIVW¸4EVEHMWI *5($735,&(6 %(676(/(&7,21 1DWXUDO+HDOWK %HDXW\2SWLRQV

/DUJHVW

8AM- 10PM

´-XQJOH¾ ´--XXQJ QJJJOH OH¾ H -LP --LLP

*OXWHQ)UHH

6HOHFWLRQLQWKH0LGZHVW

/DUJH6HOHFWLRQ RI(VVHQWLDO2LOV %RLURQ +RPHRSDWKLFLV

/RFDOO\%UHZHG .RPEXFKD 5440 Dixie Highway Fairfield, OH 45014 4450 Eastgate South Drive Cincinnati, OH 45245

WWWJUNGLEJIMSCOM

/RFDO*OXWHQ)UHHEDNHGJRRGV GVV GHOLYHUHGRYHU[DZHHN

SOXV

 Ä&#x160;  $ F UH V  2 I  ) R R G  natural awakenings

May 2014

9


Ć ĆŻĆšĆłĆŻƹƜƯƟƾƳÇ&#x201A;ƽƲƯÇ&#x2021; Ć´Ć˝Ç&#x20AC;ĆŻƜƯƞƞơƳÇ&#x20AC; Ç&#x201A;ƽƝƽÇ&#x20AC;Ç&#x20AC;Ć˝Ç&#x2026;

eventspotlight

Healthy Parks, Healthy People by Rachel Dearing

Ć&#x2DC;Ç&#x2020;ƞƳÇ&#x20AC;ơƳƟƹƳÇ&#x201A;ƜƳĆ&#x2022;ƳƟƳƴơÇ&#x201A;Ç ƽƴĆ&#x203A;Ç&#x2021;ƞƟƽÇ&#x201A;ƜƳÇ&#x20AC;ĆŻĆžÇ&#x2021;

ƪƳơƾƜÇ&#x201A;Ć&#x;Ć˝Ç Ç +ƊơÇ&#x20AC;Ç&#x201A;Ç&#x192;ĆŻĆşĆ&#x161;ĆŻÇ Ç&#x201A;Ç&#x20AC;ơƹĆ&#x2022;ƯƟƲ Ć&#x2DC;ƺơƝơƟƯÇ&#x201A;ĆłĆŁĆśĆ˝Ć°ĆˇĆŻÇ Ć&#x2122;ƳƯÇ&#x20AC;Ç Ć&#x2022;ƯƲĆ&#x203A;ƯươÇ&#x201A;Ç ĆŚÇ&#x201A;Ç&#x20AC;ĆłÇ Ç ƼƳƲÇ&#x192;ĆąÇ&#x201A;ơƽƟ Ć&#x2022;Ç&#x192;ơƺƲĆ&#x2013;ƽƟƴơƲƳƟƹƳƌƳƺƴĆ&#x2DC;Ç Ç&#x201A;ƳƳƝ Ć&#x153;ƝƞÇ&#x20AC;Ć˝Ç&#x201E;ĆłĆ&#x;ƳƯÇ&#x20AC;ƟơƟƾĆ&#x201D;ươƺơÇ&#x201A;Ç&#x2021; ƌƞƽÇ&#x20AC;Ç&#x201A;Ç ĆŁĆłÇ&#x20AC;Ć´Ć˝Ç&#x20AC;ƝƯƟƹƳƌƞƳƹơƯƺơÇ&#x2C6;ơƟƾơƟĆ&#x161;ƽƺƴƧƳƟƟơÇ

Ć&#x2013;ƯƺƺÇ&#x201A;ƽƲƯÇ&#x2021;Ć´Ć˝Ç&#x20AC;ĆŻĆ&#x2122;ĆĽĆ&#x2DC;Ć&#x2DC; ƞƜƽƟƳĆąĆ˝ĆźÇ Ç&#x192;ĆşÇ&#x201A;ĆŻÇ&#x201A;ơƽƟ Ć&#x161;Ç&#x2026;ƳƟƲƽƺơƟƳĆ?Ć˝Ç ĆłÇ&#x2021;

ĆŁÇ&#x20AC;Ć˝Ć´ĆłÇ Ç ĆˇĆ˝ĆźĆŻĆşĆ&#x2013;ƺơƟơƹƯƺĆ&#x203A;Ç&#x2021;ƞƟƽÇ&#x201A;ƜƳÇ&#x20AC;ĆŻĆžĆˇÇ Ç&#x201A; Ć ĆłĆťĆ°ĆłÇ&#x20AC;ƽƴÇ&#x201A;ƜƳĆ&#x153;ĆźÇ&#x201A;ĆłÇ&#x20AC;ƟƯÇ&#x201A;ơƽƟƯƺĆ&#x203A;Ç&#x2021;ĆžĆźĆ˝Ç ĆˇÇ Ć&#x2122;ƳƲƳÇ&#x20AC;ĆŻÇ&#x201A;ơƽƟ



Ç&#x2026;Ç&#x2026;Ç&#x2026;ĆśÇ&#x2021;ĆžĆźĆ˝Ç ĆˇÇ Ć˝ĆźĆşĆˇĆźĆłƹƽƝĆľÇ&#x2026;ƳƟƲƽƺơƟƳ

0$!

,G<IO/<G@ ,M@QD@R,<MOT Friday, May 2 6:00 to 9:30

5D>F@54

@BD45@3

#$=@A03@<13D-!$ $$<55C@?003 %C045 C045@4 >D7D>B<3?@/>@/5@3)03B 3$ " !! (' @95 '

,P=GD>/<G@

G? . D 4 4 D 0/

DQD>#<M?@I@IO@M .@<?DIB.J<? 10

H

ealth and wellness begins with a conscious decision to shape a positive lifestyle, which leads to high levels of well-being and life satisfaction. Regular activity and a healthy diet promotes cardiovascular fitness, reduces the risk of chronic disease, helps maintain a healthy weight, reduces anxiety and depression, improves self-esteem and provides an overall sense of well-being. Recreation in natural settings of parks is especially important as our lives are dominated by the constriction of urban environments and indoor activities. Recreation in a park establishes a special connection to nature and is a way to clear the mind and cleanse the body. Great Parks of Hamilton County is offering programming and events that promote health and wellness with a 2014 Health and Wellness initiative. As part of the initiative, Great Parks of Hamilton County is hosting the first Healthy Parks, Healthy People Wellness and Sustainability Fair at Winton Woods Harbor on May 18, from noon to 5 p.m. The event will encourage and educate the public about healthy recreational activities and programs that are available outdoors and in our community. Be sure to visit the Wellness and Green Awareness area, to learn from and interact with Mercy Health-Plex, Green BEAN Delivery, Abel Fitness and Training, Interact for Health, YMCA, American Heart Association and many more. There will be a live performance and interactive activity area with hip hop aerobics, site-responsive dance with Pones Inc., recycling with Clear Science Râ&#x20AC;&#x2122;s for Life and more. The Step and Learn Park Events area will feature a walk around the harbor trail, tree planting demonstration, rain garden discussion and naturalist program, and the Outdoor Recreation Event Hot Spots will feature a climbing wall, bike safety, paddling demonstrations and more. All of the participating organizations, businesses and groups at the Healthy Parks, Healthy People Wellness and Sustainability Fair will help educate and answer questions regarding wellness initiatives, healthy and safe living, health screenings and products for a better lifestyle. The event is free and open to the public. Rachel Dearing is a guest event spotlight contributor and is recreation services manager for the Great Parks of Hamilton County. For more information, visit GreatParks.org. See ad, page 17.

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com


globalbriefs News and resources to inspire concerned citizens to work together in building a healthier, stronger society that benefits all.

Harmful Harmonics Whales Under Siege by Seismic Surveys

Bikes-to-Go Cycling Gains Ground at Colleges and in Cities May is National Bike Month, and more universities continue to commit to bicycling as a sustainable, healthy and environmentally conscious transportation choice. Recently, Harvard University joined Princeton and Yale as an official Bicycle-Friendly University (BFU), and the League of American Bicyclists designated 14 new BFU members, expanding the program to 58 colleges in 30 states across the U.S. with more to come. When New York City opened registration for a public bike-sharing program, Citi Bike, more than 5,000 people signed up within 30 hours. Similar demand for more cycling options is happening across the nation where shared bicycle programs are taking root (see Tinyurl.com/Top50BikeFriendliestCities). The popular Washington, D.C., Capital Bikeshare program began operating in September 2010, and is now the nationâ&#x20AC;&#x2122;s largest, with 200 locking docks able to accommodate more than 1,800 bright-red bicycles. As in many programs, people can sign up for a short-term stint or an annual membership using either a credit card online or at a station kiosk. Then they can unlock a bicycle and return it to any station within the system. All rides under 30 minutes are free, after which escalating fees kick in, encouraging people to make short trips and to keep more bikes available for other riders.

For more information, visit BikeLeague.org.

The International Union for the Conservation of Nature (IUCN) is intensifying global efforts to safeguard whales and other marine species from the harm caused by powerful noises generated by seismic seafloor surveys by the oil and gas industry and others. In seismic surveys, air guns towed behind ships repeat powerful bursts of sound; sensors measure the return echo to reveal details of the sea floor and the underlying geologic structure to a depth of several kilometers. Whales rely on sound for communication, navigation and foraging. Exposure to loud noise from seismic surveys can result in stress and behavior changes, affect foraging and nursing or cause direct physical damage. In a study published in the journal Aquatic Mammals, the authors present the most thorough, robust and practical approach to minimizing and monitoring the risk of harm to vulnerable marine species when intense sounds are used. A step-by-step guide to reducing effects on whales and other marine species during seismic sea floor surveys is available from the IUCN Western Gray Whale Advisory Panel and Sakhalin Energy Investment Company (Tinyurl.com/WhaleSavingGuide).

%$'$ *DUGHQ&HQWHU Ă RZHUVÂ&#x2021;SHUHQQLDOV DQQXDOVÂ&#x2021;EDVNHWV Ă DWVÂ&#x2021;WURSLFDOV

2)) \RXUQH[WHQWLUHSXUFKDVH ZKHQ\RXPHQWLRQWKLVDG

3D[WRQ$YH

DW+<'(3$5.3/$=$a1HDU3DQHUD 2SHQHYHU\GD\IURPDPWRSP Â&#x2021;  natural awakenings

May 2014

11


globalbriefs Greening Garbage Activist Turns City Food Waste into Rural Soil Jeremy Brosowsky had an epiphany at a Milwaukee, Wisconsin, greenhouse a few years ago that set him on a more sustainable path: â&#x20AC;&#x153;What if we could take our garbage and grow food in it?â&#x20AC;? He was in the Midwest to learn about urban agriculture at Growing Power, the pioneering urban farm of McArthur Genius Fellow Will Allen, and was considering starting a rooftop agriculture business. Allenâ&#x20AC;&#x2122;s emphasis on the importance and elusiveness of fertile soil intrigued him. â&#x20AC;&#x153;If you donâ&#x20AC;&#x2122;t dramatically improve the soil, you cannot grow food in cities,â&#x20AC;? Brosowsky realized. His solution was to create Compost Cab (CompostCab.com), a Washington, D.C.-based service that picks up and delivers urban food waste to local farms for composting. Nearly 100 cities already divert food waste from landfills, but Brosowsky emphasizes, â&#x20AC;&#x153;Composting is not just about waste reduction. Itâ&#x20AC;&#x2122;s about food production, education, jobs and creating social benefits.â&#x20AC;? He hopes to roll out Compost Cabs in other cities.

Information Overload Organic Food Labeling Causes Confusion A recent Harris Poll of 2,276 U.S. adults showed that concern for the environment is growing, but Americans may not be ready to spend more for organic food. More than half think that labeling food or other products as organic is just an excuse to charge more. Yet more than half of respondents also believe that organic foods are healthier than non-organic. At the same time, only 23 percent know what the term â&#x20AC;&#x153;dirty dozenâ&#x20AC;? means in regard to organic food; itâ&#x20AC;&#x2122;s the Environmental Working Groupâ&#x20AC;&#x2122;s annual list of foods consumers should always buy in organic form due to high pesticide levels in conventional farming.

Celebrate Mom!

Saturday, May 10th 10am

7UHDW0RPWRDGHOLFLRXVEUHDNIDVWIRU 0RWKHUĂ´V'D\3OHDVH5693E\HPDLOLQJ FLQUHJLVWUDWLRQ#ZKRIRRGVFRP :KROH)RRGV0DUNHW&LQFLQQDWLĂť(GPRQGVRQ5RDG &LQFLQQDWL2KLRĂť 12

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

Sinking Reptiles World Turtle Day Sounds Alarm Since 2000, people around the globe have celebrated World Turtle Day, held this year on May 23, to increase respect for and knowledge of the worldâ&#x20AC;&#x2122;s oldest creatures. Susan Tellem, co-founder with Marshall Thompson of American Turtle Rescue (ATR), states, â&#x20AC;&#x153;These gentle animals have been around for about 200 million years, yet they are rapidly disappearing as a result of the exotic food industry, habitat destruction and the cruel pet trade.â&#x20AC;? They believe that turtles may be extinct within 50 years and suggest ways to increase their chances for survival for future generations: â&#x2013; Never buy a turtle or tortoise from a

pet shop; it increases demand from the wild. â&#x2013; Never remove turtles or tortoises

from the wild unless they are sick or injured. â&#x2013; If a tortoise is crossing a street, pick

it up and gently place it on the other side in the same direction it was headed. â&#x2013; Write legislators about keeping

sensitive habitats preserved. â&#x2013; Report cruelty or illegal sales to a

local animal control shelter. â&#x2013; Report the sale of any turtle or

tortoise less than four inches long, which is illegal throughout the U.S. For more information, visit Tortoise.com or Facebook.com/AmericanTortoiseRescue.


Forests Preserve Trees Rescue Urbanites from Dirty Air According to the U.S. Environmental Protection Agency, poor air quality can irritate the respiratory system, reduce lung function, inflame and damage the cells that line the lungs, make lungs more susceptible to infection, aggravate asthma, aggravate other chronic lung diseases and cause permanent lung damage. U.S. Forest Service researchers have discovered that the urban forests in 10 cities across the country save on average one person a year from pollution-related death. In New York City alone, that number increases to eight people per year. The scientists recommend that people everywhere plant more trees. Source: AmericanForests.org

Radical Fuel Three Automakers Roll Out Hydrogen Models Toyota has announced that it will market a hydrogen-powered car beginning with the 2015 model year, and Hyundai has also committed to rolling out its fuel-cell Tucson model next year. Honda has already begun leasing its hydrogen-powered FCX Clarity to customers in California. Each of these vehicles can travel about 300 miles without a refill (three times the range of the hybrid Chevy Volt in battery mode), and reach a top speed of about 100 miles per hour. A refill takes just a few minutes, and because the hydrogen is used to produce electricity, the cars drive without the roar of an internal combustion engine. The cost of hydrogen-fuel-cell vehicles is expected to continue to fall and eventually match that of conventional cars by 2023.

ecotip Best Weddings Small, Simple, Sustainable Every couple wants their wedding to reflect their values. Concern for the environment prompts planning that supports eco-friendly local businesses and avoids generating the considerable waste and carbon footprints of traditional events. Veteran green wedding planner and environmentalist Kate Harrison, author of The Green Bride Guide, who blogs at GreenBrideGuide.com, assists couples through the process. â&#x20AC;&#x153;I advise couples to look at simple substitutions in line with their style and budget,â&#x20AC;? says Harrison. â&#x20AC;&#x153;Every choice adds up.â&#x20AC;? By invitation only. Digital invitations cost just pennies apiece; options like PaperlessPost.com offer the appearance of a paper invitation, arriving in an envelope that â&#x20AC;&#x153;opensâ&#x20AC;? on the screen. Also consider elegant renditions of more conventional invitations made of recycled, upcycled or organic papers. For the invite that keeps on growing, try seed-studded paper creations that guests can plant in their backyards. Where the guests are. Selecting a location central to most of the guests minimizes the celebrationâ&#x20AC;&#x2122;s carbon footprint, reduces travel expenses and maximizes attendance. â&#x20AC;&#x153;Consider picking a venue with natural beauty already present, such as a beautiful garden or ballroom,â&#x20AC;? advises Harrison. â&#x20AC;&#x153;Youâ&#x20AC;&#x2122;ll cut down on the amount and cost of dĂŠcor youâ&#x20AC;&#x2122;re buying just for the wedding.â&#x20AC;? Let them eat cake. Food and flowers are among the most costly components of a wedding, yet sustainable options can be just a worthy fraction more. A cake made with organic flour, a natural sweetener and local cage-free eggs, for example, can cost just $5 more. The key is finding a vendor willing to work with the coupleâ&#x20AC;&#x2122;s values, says Harrison. Simple gifts. Americans spend an estimated $20 billion annually on wedding gifts, a high-impact opportunity to support local green economies. Harrison recommends establishing registries for experiences, charities and products (select sustainable options like recycled glass dishes or organic linens). Consider a local, seasonable wedding favor that guests can eat or reuse, such as maple syrup for a fall wedding in Vermont. Generally, keep all elements small, simple and localâ&#x20AC;&#x201D;and your ownâ&#x20AC;&#x201D;for an occasion that truly cherishes both loved ones and our planet.

/RVH:HLJKW*HW6WURQJ)HHO*UHDW $OOFRUHDOOWKHWLPH7UDLQLQDOOSODQHVRIPRWLRQ 0XOWL/HYHO&KDQJHWKHDQJOHWRLQFUHDVHRUGHFUHDVH WKHDPRXQWRIZHLJKW\RXDUHPRYLQJ *UHDWFURVVWUDLQLQJIRUUXQQHUVDQG\RJLV *UHDWWUDLQLQJIRUURWDWLRQDOVSRUWV JROIWHQQLVEDVHEDOOHWF

,17522))(5IRUGD\VRI75;FODVVHV &ROXPELD3NZ\ DFURVVIURP0RNVKD

LWVZRUNLQJRXWFRP



natural awakenings

May 2014

13


healthbriefs

Merciér Pelvic Massage Boosts Women’s Fertility

Natural Treatment Option for Respiratory Infections

A

A

ccording to the National Institutes of Health, lower respiratory infections are more prevalent worldwide than HIV, malaria, cancer and heart attacks. Those that suffer from chronic obstructive pulmonary disease, cystic fibrosis or asthma are especially prone reports the journal PLOS Medicine. Treatment can be especially difficult when it’s unclear if the cause is a virus, bacterium or fungus. The typical Western practice of ingesting pills spreads drugs throughout the body instead of treating only the airside of the lungs, where the problem is located. It’s better to target the active treatment agent only where it’s needed. A study in the European Journal of Clinical Micriobiology & Infectious Diseases suggests delivering a fine-droplet mist from a nebulizer directly atop the invading pathogens and replenishing often to keep the area moist with antimicrobials. This can achieve far greater local dosing with far lower systemic penetration. Choose an antimicrobial that kills all three potential types of pathogens so the physician won’t need to guess the proper drug or try them sequentially. A more natural option is to avoid drugs. Clinical studies by the Klearsen Corporation and the laboratory work at National Jewish Hospital have shown that locally administering an enhanced aqueous colloid of silver in the recommended manner will clear even the most stubborn pathogens. Plus, it has no adverse side effects. When dosing with a liquid colloid of silver concentration of 50 parts per mission (ppm) or more, the suggested protocol is usually three milliliters, three times per day. For acute infections, the three-milliliter dose can be administered every two waking hours. Using a nebulizer is essential to achieve the effective micro-droplets required to reach all areas of the lungs. Inhaling the nebulized mist deep into the lungs will coat the invading pathogens. Note that a vaporizer isn’t suitable because its steam delivery will leave the active ingredients behind. Steven Frank, has researched respiratory infection therapies for 15 years and holds three related patents. Study sites include the Institute for Tuberculosis Research, National Jewish Hospital and Klearsen Corporation. He presented Respiratory Clinical Trial results to the American Naturopathic Medical Association in 2006. He can be reached at SteveF@ NaturesRiteRemedies.com. See ad, page 29.

14

Greater Cincinnati/Northern Kentucky Edition

new, noninvasive infertility treatment has met with highly favorable results. In a recent study published in the journal Midwifery Today, 40 of 48 women between ages 28 and 42 that underwent two or more sessions of Merciér Therapy achieved pregnancy within the first year; 32 of those used the method alone (no other artificial fertilization/insemination techniques). The four-year study was presented at the 2013 World Congress of Low Back and Pelvic Pain. The Merciér Method was developed by Jennifer Merciér, a midwife and holistic women’s health practitioner. The regimen includes six hours of pelvic organ massage manipulation, along with a supplement program and continuous monitoring. She explains, “Our protocol is a gentle and noninvasive visceral manipulation of the female reproductive organs that helps to increase general organ mobility and blood flow, which enhances optimal function.” A documentary on the protocol, Fertility: The Shared Journey with Merciér Therapy, premieres this month (MercierMovie.com).

Drinking Cow’s Milk While Nursing Linked to Infant Eczema

N

ew research has found that if a mother drinks cow’s milk during the period that she is breastfeeding, it raises her infant’s risk of experiencing skin allergies. The study, published in the Journal of the Medical Association of Thailand, followed 62 mothers and their infants from birth through 4 months of age. Researchers from Bangkok’s Mahidol University assembled the mothers and infants into two groups. Mothers in one group drank cow’s milk during the first four months of breastfeeding; the control group did not. Eight of the children with mothers drinking cow’s milk had skin allergies, versus two of the children in the control group. All of the mothers exclusively breastfed their infants throughout this period. An earlier study published in the British Medical Journal followed 124 mothers, 97 of which breastfed their babies. Of those that breastfed, 48 drank no milk or other dairy products and 49 drank milk. Infants in the milk-drinking group experienced 21 cases of eczema, while the no-milk group had only 11 cases. Overall, between the breastfed and non-breastfed infants, the breastfed infants had lower incidences of eczema regardless of the mother’s diet.

NaturalCinci.com


Vitamin D No Help for Bone Mass or Hip Fractures

U HEALTHY HOMEMADE INFANT FOOD REDUCES KIDSâ&#x20AC;&#x2122; ALLERGIES

A

study published in the Journal of Allergy and Clinical Immunology reports that infants that were fed more homemade foods comprising a higher percentage of fruits and vegetables were less likely to develop food allergies. In assessing youngsters of the same age, researchers from the University of Southampton Medical College, in the UK, followed 41 children that had developed food allergies by the age of 2, alongside 82 non-allergic infants. After tracking the toddlersâ&#x20AC;&#x2122; diets with food diaries and conducting allergy testing, the researchers found that infants fed more of the healthier homemade diet had a significantly lower incidence of food allergies as toddlers.

ROUNDUP TOXIN ACCUMULATES IN GM SOYBEANS

A

study published in the journal Food Chemistry tested soybeans grown from seeds that were genetically modified (GM) to be resistant to the herbicide Roundup. It compared these with organic soybeans and soybeans from non-GM seeds. The chemical and nutritional analysis of soybean samples from 31 different Iowa farms found the GM soy contained significantly higher levels of the toxin glyphosate, the central chemical in Roundup, than both the organic and the conventional non-GMO soybeans. The organic soybeans contained no glyphosate, plus significantly higher levels of protein and zinc, as well as lower levels of saturated fats.

niversity of Pittsburgh researchers that followed 29,862 women for 11 years have found that supplementing calcium with vitamin D does not reduce hip fractures. The study, published in the Journal of Womenâ&#x20AC;&#x2122;s Health, found that women taking calcium plus vitamin D had as many hip fractures as women taking a placebo. Women supplementing with more than 600 international units (IU) of vitamin D per day also had a 28 percent higher incidence of breast cancer. Because hip fractures are linked to a reduction in bone density, these findings are compounded by a review of research published in The Lancet, which established that vitamin D supplements typically taken with calcium did not increase bone density among elderly adults. The review analyzed 23 studies among 4,082 participants, 92 percent of whom were women.

*HQWOH/DVWLQJ 3$,15(/,() Â&#x201D;Â&#x2018;Â&#x2C6;Â&#x2018;Â&#x2014;Â?Â&#x2020; Â?Â&#x2020;ÇĄ Â&#x161;Â&#x2019;Â&#x2021;Â&#x201D;Â&#x2039;Â&#x2021;Â?Â&#x2026;Â&#x2021;Â&#x2021;Â&#x2013;Â&#x2122;Â&#x2018;Â&#x201D;Â?Â&#x2019;Â&#x2039;Â?Â&#x192;Â&#x17D;Â?Â&#x192;Â&#x17D;Â&#x203A;Â&#x2022;Â&#x2039;Â&#x2022;Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x192;Â&#x2019;Â&#x201D;Â&#x2018;Â&#x2C6;Â&#x2018;Â&#x2014;Â?Â&#x2020;ÇĄ Â&#x2022;Â&#x2019;Â&#x2039;Â?Â&#x2021;Ǥ Â&#x2030;Â&#x2021;Â?Â&#x2013;Â&#x17D;Â&#x2021;Â&#x192;Â&#x2019;Â&#x2019;Â&#x201D;Â&#x2018;Â&#x192;Â&#x2026;Â&#x160;Â&#x2013;Â&#x2018;Â&#x2021;Â&#x2DC;Â&#x192;Â&#x17D;Â&#x2014;Â&#x192;Â&#x2013;Â&#x2039;Â?Â&#x2030;Â&#x192;Â?Â&#x2020;Â&#x192;Â&#x2020;Â&#x152;Â&#x2014;Â&#x2022;Â&#x2013;Â&#x2013;Â&#x160;Â&#x2021;Â&#x2022;Â&#x2019;Â&#x2039;Â?Â&#x2021;Ǥ Â&#x2021;Â?Â&#x2021;Ď?Â&#x2039;Â&#x2013;Â&#x2022;Â&#x2C6;Â&#x201D;Â&#x2018;Â?Â&#x2013;Â&#x160;Â&#x2039;Â&#x2022;Â&#x2014;Â?Â&#x2039;Â&#x201C;Â&#x2014;Â&#x2021;Â&#x192;Â&#x2019;Â&#x2019;Â&#x201D;Â&#x2018;Â&#x192;Â&#x2026;Â&#x160;Â&#x192;Â&#x201D;Â&#x2021;ÇŁ Â&#x2018;Â?Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2C6;Â&#x2014;Â&#x17D;Â&#x17D; Č&#x2C6; Â&#x17D;Â&#x17D;Â&#x2018;Â&#x2122;Â&#x2022;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x2018;Â&#x201D;Â&#x192;Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x2018;Â&#x2C6;Â&#x2019;Â&#x201D;Â&#x2018;Â&#x2019;Â&#x2021;Â&#x201D;Â?Â&#x2021;Â&#x201D;Â&#x2DC;Â&#x2021;Â&#x2C6;Â&#x2014;Â?Â&#x2026;Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2C6;Â&#x2014;Â&#x17D;Â&#x17D; Â&#x2021; Â&#x160;Â&#x2021;Â&#x192;Â&#x17D;Â&#x2013;Â&#x160;Â&#x2021;Â&#x161;Â&#x2019;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2022;Â&#x2039;Â&#x2018;Â?Â&#x192;Â?Â&#x2020;Â&#x2019;Â&#x2021;Â&#x192;Â?Â&#x2019;Â&#x2021;Â&#x201D;Â&#x2C6;Â&#x2018;Â&#x201D;Â?Â&#x192;Â?Â&#x2026;Â&#x2021; Č&#x2C6; Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2021;Â&#x2DC;Â&#x2021;Â&#x2022;Â&#x2019;Â&#x192;Â&#x2039;Â?Â&#x192;Â?Â&#x2020;Â&#x2020;Â&#x2039;Â&#x2022;Â&#x2026;Â&#x2018;Â?Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2013;Â&#x2122;Â&#x2039;Â&#x2013;Â&#x160;Â?Â&#x2018;Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2026;Â&#x2021;Â&#x192;Â&#x2019;Â&#x2019;Â&#x17D;Â&#x2039;Â&#x2021;Â&#x2020; Â&#x2021;Â&#x192;Â&#x2019;Â&#x2019;Â&#x17D;Â&#x2039;Â&#x2021;Â&#x2020; Č&#x2C6; Â&#x2039;Â&#x2022;Â&#x2022;Â&#x2039;Â&#x2019;Â&#x192;Â&#x2013;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x2021;Â?Â&#x2022;Â&#x2039;Â&#x2018;Â?Â&#x2C6;Â&#x201D;Â&#x2018;Â?Â&#x2013;Â&#x160;Â&#x2021;Â&#x2022;Â&#x2019;Â&#x2039;Â?Â&#x2021; Č&#x2C6; Â&#x2018;Â&#x2026;Â&#x201D;Â&#x192;Â&#x2026;Â?Â&#x2039;Â?Â&#x2030;Â&#x2022;Â&#x2018;Â&#x2014;Â?Â&#x2020;Â&#x2022;Â&#x2018;Â&#x201D;Â&#x2013;Â&#x2122;Â&#x2039;Â&#x2022;Â&#x2013;Â&#x2039;Â?Â&#x2030;Â?Â&#x2018;Â&#x2DC;Â&#x2021;Â?Â&#x2021;Â?Â&#x2013;Â&#x2022; Â&#x2013;Â&#x2022; Č&#x2C6; Â&#x2018;Â&#x201D;Â&#x2021;Â&#x17D;Â&#x192;Â&#x2022;Â&#x2013;Â&#x2039;Â?Â&#x2030;Â&#x201E;Â&#x2021;Â&#x2026;Â&#x192;Â&#x2014;Â&#x2022;Â&#x2021;Â&#x2013;Â&#x160;Â&#x2021;Â&#x2026;Â&#x192;Â&#x2014;Â&#x2022;Â&#x2021;Â&#x2018;Â&#x2C6;Â?Â&#x2014;Â&#x2022;Â&#x2026;Â&#x17D;Â&#x2021;Â&#x192;Â?Â&#x2020; Â&#x2021;Â&#x192;Â?Â&#x2020; Â&#x2022;Â&#x2019;Â&#x2039;Â?Â&#x192;Â&#x17D;Â&#x2013;Â&#x2021;Â?Â&#x2022;Â&#x2039;Â&#x2018;Â?Â&#x2022;Â&#x192;Â&#x201D;Â&#x2021;Â&#x192;Â&#x2020;Â&#x2020;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2022;Â&#x2021;Â&#x2020; Č&#x2C6; Â&#x192;Â&#x2C6;Â&#x2021;Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2021;Â&#x2DC;Â&#x2021;Â&#x201D;Â&#x203A;Â&#x2018;Â?Â&#x2021; Â&#x201E;Â&#x2018;Â&#x2014;Â&#x2013; Â&#x192;Â&#x17D;Â&#x17D;Â&#x2013;Â&#x2018;Â&#x2020;Â&#x192;Â&#x203A;Â&#x2013;Â&#x2018;Â&#x17D;Â&#x2021;Â&#x192;Â&#x201D;Â?Â?Â&#x2018;Â&#x201D;Â&#x2021;Â&#x192;Â&#x201E;Â&#x2018;Â&#x2014;Â&#x2013; Â&#x201D;Â&#x2021;Â&#x2019;Â&#x201D;Â&#x2018;Â&#x2030;Â&#x201D;Â&#x192;Â?Â?Â&#x2039;Â?Â&#x2030;Â&#x203A;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2022;Â&#x2019;Â&#x2039;Â?Â&#x2021; Â&#x203A;Â&#x2022;Â&#x2039;Â&#x2022;Ǥ Â&#x2013;Â&#x160;Â&#x201D;Â&#x2018;Â&#x2014;Â&#x2030;Â&#x160;Â&#x2021;Â&#x2013;Â&#x2122;Â&#x2018;Â&#x201D;Â?Â&#x2019;Â&#x2039;Â?Â&#x192;Â&#x17D;Â?Â&#x192;Â&#x17D;Â&#x203A;Â&#x2022;Â&#x2039;Â&#x2022;Ǥ

Â&#x2014;Â&#x17D;Â&#x2039;Â&#x2021;Â&#x2039;Â&#x2026;Â&#x160;Â&#x2018;Â&#x17D;Â&#x2022;ÇĄǤǤ Â&#x2039;Â&#x2026;Â&#x160;Â&#x192;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2026;Â&#x160;Â&#x2018;Â&#x17D;Â&#x2022;ÇĄǤǤ

Â&#x2039;Â&#x2018;Â?

Â&#x2021;Â&#x2013;Â&#x2013;Â&#x160;Â&#x2021;Â&#x2039;Â?Â&#x2039;Â&#x2013;Â&#x2039;Â&#x192;Â&#x17D;Â&#x2021;Â&#x161;Â&#x192;Â?Â&#x2039;Â?Â&#x192;Â&#x2013;Â&#x2039;Â&#x2018;Â? Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2018;Â?Â&#x17D;Â&#x203A;Í&#x201E;͚͜ǤͲͲÂ&#x2122;Â&#x160;Â&#x2021;Â?Â&#x203A;Â&#x2018;Â&#x2014; Â&#x2014; Â?Â&#x2021;Â?Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x192;Â&#x2013;Â&#x2014;Â&#x201D;Â&#x192;Â&#x17D;Â&#x2122;Â&#x192;Â?Â&#x2021;Â?Â&#x2039;Â?Â&#x2030;Â&#x2022;Ǥ Â&#x2022;Ǥ Č&#x2039;Â&#x2021;Â&#x2030;Â&#x2014;Â&#x17D;Â&#x192;Â&#x201D;Í&#x201E;͚͝ǤČ&#x152;

0DLQ6WUHHW &LQFLQQDWL2KLR



ZZZ*DWHZD\VWR+HDOLQJFRP natural awakenings

May 2014

15


communityspotlight

TEN THOUSAND

VILLAGES Making a Difference with Fair Trade Shopping by Gayle Wilson Rose

T

raveling the U.S. can leave us with an unsettling feeling that franchises and faceless big-box stores are overtaking our country. Some use the term “Generica” to describe modern American cities and towns that appear nearly indistinguishable at first glance. Fortunately, there are still alternatives to seemingly mindless consumption. For conscious consumers that seek meaning in their purchases and want to know the details of a product’s origin, Ten Thousand Villages of Cincinnati offers that and more. Founded in 1946 by businesswoman Edna Ruth Byler after a life-changing trip to Puerto Rico, Ten Thousand Villages grew from a business she started out of her car trunk. Today, this vital

16

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

nonprofit network of more than 70 U.S. stores, which is run by a local board, ensures that every sale makes a difference—both locally and in the lives of artisans in 38 countries. For more than a decade, The Villages retail store in Cincinnati has been a beacon on the “eclectic mile” in the O’Bryonville shopping district. Executive Director and Store Manager Darlene Rohrer-Meck shares, “We’re a source for unique handmade gifts, jewelry, home decor, art and sculpture, textiles, serveware and personal accessories that represent the diverse cultures of artisans in Asia, Africa, Latin America and the Middle East.” She continues, “As one of the world’s largest fair trade organizations,


our company helps improve the livelihood of tens of thousands of disadvantaged artisans.” They accomplish this by establishing a sustainable market for handmade products in North America and by building long-term buying relationships in places where artisan partners lack stable income sources. According to Meck, “Product sales make food, education, healthcare and housing possible for the artisans who would be in many cases struggling to survive.”

Eyewitness to their impact In late February, Meck saw her company’s far-reaching impact firsthand while on a two-week guided tour in Peru with nine other store managers. “We visited 19 artisan workshops, mostly in remote villages,’ she says. They saw how products are crafted and heard stories about how family’s lives have changed since establishing a business relationship with The Villages. “I’ll never look at our products in the same way,” says Meck. “To see the work and hear their stories was inspiring. One family was able to move from living in a yurt to a solid home of concrete. That exemplified the value of our mission for me.” Her tour group visited a different village nearly every day of the two-week trek. “I was stunned at the remoteness of the villages and found myself wondering about simple details

such as how they get mail to conduct their business.” Meck explains that they must make a monthly trip to a mailbox in the nearest city for their mail. All of the products that Ten Thousand Villages sells are fairly traded and handcrafted. “Our wares are a feast for the eyes and soul because people know their sale makes a difference for families,” says Meck. The fair trade aspect means that The Villages provides the artisans 50 percent payment in advance of making an order, which allows them to purchase raw materials or pay labor to produce their wares. This frees artisans to avoid the expense of short-term loans (if any are even available), and helps them contain expenses. When they ship products to Ten Thousand Villages, they receive the balance of payment for the order. There’s little that’s not inspiring with The Villages’ business model; the

company vision is for all artisans in developing countries to earn a fair wage, be treated with dignity and respect and be able to live a life of quality. “Every purchase helps provide income and dignity to families by enabling them to meet their most basic everyday living needs,” shares Meck. Ten Thousand Villages intends to open a second Cincinnati store this year. Both the board and store staff have their sights aimed high and are committed to doubling their current support of 110 families by 2020. Location: 2011 Madison Rd., Cincinnati. For more information, call 513-8715840, email Cincinnati@TenThousandVillages.com or visit TenThousandVillages.com/Cincinnati. See ad, page 35. Gayle Wilson Rose is a frequent contributor to Natural Awakenings. For more information, visit DashWriter.com.

Healthy Parks, Healthy People Wellness & Sustainability Fair Sunday, May 18, 2014 Noon–5 p.m. Winton Woods

“As one of the world’s largest fair trade organizations, [Ten Thousand Villages] helps improve the livelihood of tens of thousands of disadvantaged artisans.”

Check out greatparks.org for a growing list of free exhibits and activities!

People and bicycles are always free, but vehicles require an MVP ($10 annual, $3 daily).

natural awakenings

May 2014

17


take a leap of faith—close her psychotherapy practice and enroll in a filmmaking class. Teague recognizes that a deeper wisdom activated her response. She observes, “The individuals I was counseling about their restless desire for something better mirrored my own discontent, and my restlessness was an emotional response to what was emerging. “Today, I no longer concern myself with making the right decision. I trust that whatever the circumstances are, I need to listen, observe and reflect, because ‘now’ contains information for my next step,” she advises. Amanda Owen, counselor, coach and author of Born to Receive: 7 Powerful Steps Women Can Take Today to Reclaim Their Half of the Universe, has studied the state of receptivity that Teague references. Owen explains, “Receiving is a dynamic and productive state. When the body is relaxed and the mind and nervous system are calm, we become receptive and can feel and intuit subtle information contained in the energy received from external and internal environments.

Trust Your Intuition Listen to that Still, Small Voice and Let it Lead You by Linda Sechrist

What if you could consistently tap into answers to life’s problems when you need them, knowing deep down that you are on the right track and that the decisions and choices you are making are the correct ones?

O

ur body is a wellspring of priceless wisdom. Yet heeding our innate voice seems constantly tested as society distracts us with the busy acquisition of external knowledge and rewards more visible work. Those used to focusing outwardly over-stimulate their five senses and so tend to disconnect from their body’s deep innate intelligence—our sixth sense, also known as intuition. The resulting joylessness, discontent, isolation, depression and illness have sent millions in search of a real solution that discerning experts believe already exists within. Our ultimate guide to the fountain of personal health and happiness, they believe, could well be our own intuition.

Changing Directions For years, Katie Teague, producer of the documentary film, Money & Life, lived with the consequence of sublimating her intuitive impulse. “I felt a restless itch in my soul,” relates Teague, who intuited that life was prompting her to change careers so she could use her talents in a more meaningful way. The vision of her 94-year-old self lying on her deathbed and faced with the question, “What are you not saying yes to?” pushed Teague to

18

Greater Cincinnati/Northern Kentucky Edition

“Our parasympathetic nervous system is engaged when we’re in this listening state. In contrast, rushing through the day engages our ‘fight-or-flight’ sympathetic nervous system. Busyness and mind chatter drowns out the valuable information that intuition provides,” Owen notes. An intuitive energy therapist, Marilyn Eppolite strongly relies on intuitive guidance in her southern New Jersey practice, believing it emanates from her body’s intelligence. “I listen and it’s always present,” she says. Eppolite shares an example of a time she received a clear image and perceived the bodily sensations of a grieving small child from a female client that a psychotherapist had referred. “When I described what I was sensing, her tears flowed and she also connected to the feeling,” she says. “It provided the needed breakthrough she needed to access her feelings and move forward in therapy.” Eppolite is keenly aware when roadblocks—busyness, willfulness and a fearful, restless mind—create interference. “These feed each other and can rarely be separated. I can’t hear or feel my intuition when my energy and attention are willfully directed outward,” she observes. Abandoning the drive for personal control and surrendering to stillness is how Eppolite signals her body’s intelligence that she’s ready for whispers of guidance. “I sense that surrender as strength and trust that the information received is for my greatest good, even if I don’t fully understand it,” she remarks. “Discernment is necessary because deep wisdom frequently comes in segments that I must piece together and put into action before more of it bubbles up from within.” The teachings of Yogeshwari Kamini Desai, Ph.D., combine Western psychology and Eastern philosophy. As the

NaturalCinci.com


director of education and lead teacher of because people are tired of taking medithe Amrit Method of Yoga, at the facility cations that don’t heal the root cause in Silver Springs, Florida, Desai instructs of health problems,” comments Dr. Sue on listening to the voice of intuition Morter, founder of Morter Health Cenidentified as prana in yogic tradition, ter, near Indianapolis, Indiana, and the which she characterizes as “the energy healing phenomenon she terms Energy that enlivens and carries out all balancCodes. ing and life-giving processes in nature. A regular practice of any one of these “It speaks through the body as disciplines expands sensory function sensations, impulses and urges,” she to encompass internal recognition and says. “This ‘inner divining rod’ informs referencing of subtle information. us what feelings, thoughts and actions Morter teaches how to awaken gut are moving us into alignment with our feelings, personal power and self-love to source and what is moving us out of restore wholeness left behind in pursuit alignment.” of external sources of happiness. “ParticiQuieting the mind and strengthening pants learn to trust their gut more than the directives of prana through meditathe opinions of others, which turns up the tion, yoga and being in nature moves us volume on the whispers of intuition,” she away from what we tell ourselves and back explains. Fearlessly following to directly responding to its promptings. After Pat Hall, a therapeutic body“Absorbed in the present moment and worker in Augusta, Georgia, read Jill Bolte our intuition frees us to bodily sensations, we connect with inner Taylor’s My Stroke of Insight, she was fully live an authentic guidance,” explains Desai. “With practice, certain a habit of listening to mental chatour mind becomes a servant to inner intelliter interfered with feeling and interpreting and satisfying life. gence. It can both direct our lives and make her body’s helpful promptings. “Jill’s expeus sensitive to early symptoms suggesting oncoming illness,” she rience of her body as energy and her mind as silent when the adds. left lobe of her brain shut down due to a stroke was my ‘Aha!’ “There is growing interest in energy medicine and moment,” says Hall. For her, heeding inner guidance took developing a deeper connection to the body’s intelligence practice and a commitment to dismantling reactive thought through yoga and energy practices like qigong and tai chi patterns and habits, plus discerning between intuition and

natural awakenings

May 2014

19


distracting chatter. “Mind chatter generally creates fear, negativity and pressure to do something,” she explains. “Intuitive guidance is gentle, expansive and undemanding.” Hall believes in the Buddhist concept that mindfulness of the body allows us to love fully. She finds, “It brings healing, wisdom and freedom.” She relates how she is led to direct a client’s attention to their own body’s intuition, which works best when she is following her instincts, rather than thinking. “After one session, my client, who had been silently experiencing numerous feelings in her stomach, asked me why I had touched her abdomen. I was just intuitively led to that part of her body.” Dr. Mona Lisa Schulz, also a Ph.D., medical intuitive and co-author of All is Well, notes that everyone has a connection to intuition. “We get a gut feeling and sadness in our heart from our inner intelligence that we don’t know what to do with. While some individuals consult a practitioner, others listen to their body’s intuitive language and reflect on their insights and dreams—the language of soul,” says Schulz. “Intuition can speak softly through symptoms,” she observes. “Eventually, when disregarded, it can become a full-blown illness.” Biochemist and author of Secrets of Our Cells: Discovering Your Body’s Inner Intelligence, Sondra Barrett, Ph.D., is awed by the body’s cellular intelligence.

“With practice, our mind becomes a servant to inner intelligence. It can both direct our lives and make us sensitive to early symptoms suggesting oncoming illness.” ~ Yogeshwari Kamini Desai “Our cells are invisible, so we don’t think of ourselves as cellular beings. However, a deeper understanding of our constitution and that our cells speak to each other and collaborate harmoniously could inspire us to befriend our body’s intelligence for life,” she says. “We might shift from wanting to fix an ache or pain to understanding that our cells are warning us of something.” Sonia Choquette, a global consultant who recommends we rely on our sixth sense as our first sense, has authored several books on intuition. She finds, “With intuition, we have a personal compass and an ally in discerning what is authentic and true for us so that we won’t be tugged and pulled in different directions when we make decisions.” Laurie McCammon, co-author of Enough: The Rise of the Feminine and the Birth of the New Story, was relaxing and reflecting with two friends when intuition graced her with a message of information-laden energy:

“I am enough. We are enough. I have enough. We have enough. Enough!” The experience inspired them to collaborate on an e-book celebrating the grassroots groundswell toward a major shift in the world. “I believe intuition is an aspect of The Grand Plan, which always moves us toward greater expansion, inclusion and an ever more mature and loving response to life,” says McCammon. Ute Arnold, founder, director and teacher of the Unergi School of BodyPsychotherapy, in Point Pleasant, Pennsylvania, describes several physical signatures of body intelligence that can foster improved self-care. “You feel more expansive, available and receptive—with a sense of a longer spine, a wider and deeper body and feet rooted in the Earth’s powerful energy,” explains the author of Touchback: A Self-Healing Journey with Body, Art and Nature, who also has a master’s degree in fine arts. “Expanded into a condition of soft relaxation, your mind stops talking; you enter a mind-body state of energetic receptive listening, where emotional intelligence is accessible. “These feelings and sensations are indicative of wholeness. From it, we have access to the eternal place of the fully healed soul, which whispers intuitively, nudging us toward what can heal our life, body and mind.” Linda Sechrist is a senior staff writer for Natural Awakenings. Visit ItsAllAboutWe.com for the recorded interviews.

@ atural. 4 eautiful. E mile. 

Dr. Michael T. Westendorf “It has been a great journey and an even greater privilege to be able to improve the health of so many patients for over 30 years.”



Mercury-Free Dentistry Quality Care Informed Patients Comfortable Settings Six Month Smiles® Procedure Cad/cam Dental Technology

Now accepting new patients. Financial Options Available. Call us today to make an appointment. westendorfdds.com • 11147 Montgomery Road • Suite 100 • Cincinnati • 513-489-5599 20

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com


healingways

'2<28<$081$" Â&#x203A;Â&#x192;Â?Â&#x2014;Â?Â&#x192;ĚžÂ&#x201E;Â&#x2018;Â&#x2020;Â&#x203A;Â&#x201D;Â&#x2018;Â&#x17D;Â&#x17D;Â&#x2039;Â?Â&#x2030;

ǤǤǤÂ&#x2039;Â?Â&#x2026;Â&#x201D;Â&#x2021;Â&#x192;Â&#x2022;Â&#x2021;Â&#x2022;

Â&#x201D;Â&#x192;Â?Â&#x2030;Â&#x2021;Â&#x2018;Â&#x2C6;Â?Â&#x2018;Â&#x2013;Â&#x2039;Â&#x2018;Â?ÇĄÂ?Â&#x2014;Â&#x2022;Â&#x2026;Â&#x17D;Â&#x2021;Â&#x2013;Â&#x2018;Â?Â&#x2021;ÇĄ ĆŞÂ&#x2021;Â&#x161;Â&#x2039;Â&#x201E;Â&#x2039;Â&#x17D;Â&#x2039;Â&#x2013;Â&#x203A;ÇĄÂ&#x2018;Â&#x201D;Â&#x2030;Â&#x192;Â?Â&#x2C6;Â&#x2014;Â?Â&#x2026;Â&#x2013;Â&#x2039;Â&#x2018;Â?ÇĄÂ&#x2021;Â?Â&#x2021;Â&#x201D;Â&#x2030;Â&#x203A;Â&#x17D;Â&#x2021;Â&#x2DC;Â&#x2021;Â&#x17D;ÇĄ Â&#x2026;Â&#x2018;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x201D;Â&#x2021;Â?Â&#x2030;Â&#x2013;Â&#x160;Â&#x192;Â?Â&#x2020;Â&#x201E;Â&#x2018;Â?Â&#x2021;Â&#x2022;Â&#x2013;Â&#x201D;Â&#x2021;Â?Â&#x2030;Â&#x2013;Â&#x160;

ǤǤǤÂ&#x2039;Â?Â&#x2019;Â&#x201D;Â&#x2018;Â&#x2DC;Â&#x2021;Â&#x2022;

Â&#x2019;Â&#x2018;Â&#x2022;Â&#x2013;Â&#x2014;Â&#x201D;Â&#x2021;ÇĄÂ&#x192;Â&#x17D;Â&#x2039;Â&#x2030;Â?Â?Â&#x2021;Â?Â&#x2013;Â&#x192;Â?Â&#x2020;Â&#x2026;Â&#x2039;Â&#x201D;Â&#x2026;Â&#x2014;Â&#x17D;Â&#x192;Â&#x2013;Â&#x2039;Â&#x2018;Â?

ǤǤǤÂ&#x201D;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2021;Â&#x2DC;Â&#x2021;Â&#x2022;

Â&#x192;Â&#x2026;Â&#x160;Â&#x2021;Â&#x2022;Â&#x192;Â?Â&#x2020;Â&#x2019;Â&#x192;Â&#x2039;Â?Â&#x2022;

ǤǤǤÂ&#x160;Â&#x2021;Â&#x192;Â&#x17D;Â&#x2022;Â&#x192;Â?Â&#x2020;Â&#x2019;Â&#x201D;Â&#x2021;Â&#x2DC;Â&#x2021;Â?Â&#x2013;Â&#x2022;

Â&#x2C6;Â&#x2014;Â&#x2013;Â&#x2014;Â&#x201D;Â&#x2021;Â&#x2039;Â?Â&#x152;Â&#x2014;Â&#x201D;Â&#x2039;Â&#x2021;Â&#x2022; Â&#x2021;Â&#x192;Â&#x201D;Â?Â&#x2013;Â&#x2018;Â&#x201D;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2021;Â&#x2DC;Â&#x2021;Â&#x2019;Â&#x192;Â&#x2039;Â?ÇĄÂ&#x201D;Â&#x2021;Â&#x17D;Â&#x2021;Â&#x192;Â&#x2022;Â&#x2021;Â?Â&#x2014;Â&#x2022;Â&#x2026;Â&#x2014;Â&#x17D;Â&#x192;Â&#x201D; Â&#x2013;Â&#x2021;Â?Â&#x2022;Â&#x2039;Â&#x2018;Â?Â&#x192;Â?Â&#x2020;Â&#x2018;Â&#x201D;Â&#x2030;Â&#x192;Â?Â&#x2039;Â&#x153;Â&#x2021;Â&#x203A;Â&#x2018;Â&#x2014;Â&#x201D;Â&#x2021;Â?Â&#x2013;Â&#x2039;Â&#x201D;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x201D;Â&#x2014;Â&#x2026;Â&#x2013;Â&#x2014;Â&#x201D;Â&#x2021;Ǥ

&DOOWRGD\WRVFKHGXOH \RXUSULYDWHVHVVLRQ

The Healing Power of Massage

Â?Â&#x203A;Â&#x192;Â&#x192;Â&#x201D;Â&#x17D;ÇŚ Â&#x2021;Â&#x2039;Â?Â&#x201E;Â&#x192;Â&#x2014;Â&#x2030;Â&#x160;ÇĄÇĄ Â&#x2021;Â&#x201D;Â&#x2013;Â&#x2039;ƤÂ&#x2021;Â&#x2020;Â&#x192;Â?Â&#x2014;Â?Â&#x192;Â&#x2018;Â&#x2020;Â&#x203A;Â&#x2018;Â&#x17D;Â&#x17D;Â&#x2039;Â?Â&#x2030; Â&#x192;Â?Â&#x2020; Â&#x2018;Â&#x2018;Â&#x2013; Â&#x2039;Â&#x2013;Â?Â&#x2021;Â&#x2022;Â&#x2022;Â&#x201D;Â&#x192;Â&#x2026;Â&#x2013;Â&#x2039;Â&#x2013;Â&#x2039;Â&#x2018;Â?Â&#x2021;Â&#x201D;

Â&#x2039;Â&#x2013;Â&#x203A;Â&#x2021;Â&#x192;Â&#x2013;Â&#x2021;Â&#x2022;Â&#x2013;Â&#x2018;Â&#x2C6;Â&#x2039;Â?Â&#x2026;Â&#x2039;Â?Â?Â&#x192;Â&#x2013;Â&#x2039; Í&#x161;Í&#x2DC;Í&#x2122;Í&#x153;Â&#x2021;Â&#x2026;Â&#x2039;Â&#x2019;Â&#x2039;Â&#x2021;Â?Â&#x2013;

From Body Repair to Reversing the Blues

I

Â&#x192;Â?Â&#x203A;Â&#x192;Â&#x2026;Â&#x192;Â&#x201D;Â&#x17D;ĚťÂ&#x2030;Â?Â&#x192;Â&#x2039;Â&#x17D;ǤÂ&#x2026;Â&#x2018;Â?

Â&#x2039;Â?Â&#x2020;Â&#x2014;Â&#x2022;Â&#x2018;Â?ÇŁÂ&#x2022;Â&#x192;Â&#x203A;Â&#x2022;Â&#x2018;Â&#x2022;Â&#x2013;Â&#x2014;Â&#x2020;Â&#x2039;Â&#x2018;

by Case Adams n 1886, Dr. William Murrell stated in the British Medical Journal, â&#x20AC;&#x153;Massage is of such inestimable value in the treatment of many intractable diseases that it is regretted that so little is known about it in this country, and that it is so rarely employed as a therapeutic agent.â&#x20AC;? A 2013 survey by the American Massage Association (AMTA) showed that a majority of us are choosing massage therapy to treat such conditions as stress and pain management, according to Winona Bontrager, the associationâ&#x20AC;&#x2122;s immediate past president. Of 1,007 adults surveyed, 75 percent opted for it within the previous year for stress or medical reasons, and 88 percent view massage as effective for pain relief. â&#x20AC;&#x153;A growing body of evidence shows that massage therapy can be effective for a variety of health conditions,â&#x20AC;? reports Bontrager, adding that massage is rapidly becoming recognized as an important part of health and wellness. Cody Landis, a licensed massage therapist and instructor at the Swedish Instituteâ&#x20AC;&#x2122;s College of Health Sciences, in New York City, explains, â&#x20AC;&#x153;In the last



few years, massage therapy research has been focusing more on the mechanisms by which the potential health benefits may be occurringâ&#x20AC;&#x201D;looking at the response of the brain, the immune system and the mechanisms of repair inside of muscle cells themselves.â&#x20AC;?

Relieves Stress An AMTA survey reported that 32 percent of positive respondents used massage to relieve stress, and numerous recent studies have confirmed this. Research from Harvard Medical School shows that massage reduces pain and anxiety while increasing sleep and quality of life among metastatic cancer patients. Boston Medical Center researchers saw similar results among 60 cancer patients that underwent port placement surgery; 20-minute massages before and after surgery reduced participantsâ&#x20AC;&#x2122; stress and anxiety. Australian researchers reporting in the Journal of Thoracic and Cardiovascular Surgery found that massage reduced pain, anxiety and muscle tension following heart surgery among 152 cardiac surgery patients. A study from Japanâ&#x20AC;&#x2122;s Toho University School of natural awakenings

May 2014

21


Pharmaceutical Sciences showed that aromatherapy massage significantly reduced psychological stress among elderly nursing home residents.

Reduces Depression A study from Nashvilleâ&#x20AC;&#x2122;s Meharry Medical College of 43 HIV patients revealed that Swedish massage reduced their symptoms of depression. Lead researcher Russell Poland, Ph.D., a professor of psychiatry and biobehavioral sciences, observes, â&#x20AC;&#x153;When we designed the study, we didnâ&#x20AC;&#x2122;t expect to see such a large effect of massage. We remain surprised.â&#x20AC;? The benefit was echoed by a University of California-Los Angeles study of 95 volunteers that displayed increases in their production of oxytocin hormone simultaneous with reductions in adrenocorticotropin hormone. Oxytocin is linked to compassion, empathy, maternal affection and social connection, while lowered adrenocorticotropin effects less stress.

Relieves Pain Researchers in the Gynecology and Obstetrics Department of Brazilâ&#x20AC;&#x2122;s University of Sao Paulo studied 46 birthing women and determined that lumbar

massage during labor reduced pain by 27 percent. In another study at Beijingâ&#x20AC;&#x2122;s Chinese PLA General Hospital, deep massage brought relief to 64 patients suffering from chronic low back pain. Relief was reported by a third of 110 headache patients in a Turkish medical school study. Dhaka Medical College Hospital, in Bangladesh, found similar results in a study of 500 headache sufferers, many of which had migraines. Research from the University of Miamiâ&#x20AC;&#x2122;s School of Medicine showed that massage reduced arthritis pain and increased both grip strength and range of motion among 42 rheumatoid arthritis patients. Lead researcher Tiffany Field, Ph.D., director of Miami Universityâ&#x20AC;&#x2122;s Touch Research Institute, says, â&#x20AC;&#x153;We have known that massage therapy reduces substance P, [a neuropeptide] which causes pain, and that it increases serotonin, the bodyâ&#x20AC;&#x2122;s natural pain killer. We also know that deep sleep is critical to lowering substance P, increasing serotonin and reducing pain.â&#x20AC;?

Expands Acceptance Lucy Liben, dean of massage therapy at the Swedish Institute, affirms the

recent research as evidence documenting the numerous health benefits of massage therapy. â&#x20AC;&#x153;More and more consumers are seeking massage therapy for help with a variety of medical issues and conditions. Doctors are increasingly referring patients for such treatment and hospitals are enlisting more therapists to provide care for patients,â&#x20AC;? says Liben. â&#x20AC;&#x153;Perhaps most importantly,â&#x20AC;? she adds, â&#x20AC;&#x153;research is offering us guidance in our work as massage therapists in how to provide the most effective care for chronic pain or musculoskeletal problems, during cancer treatment, during the changes of pregnancy or for any number of other health-related issues.â&#x20AC;? Case Adams is a California naturopath and author of 25 books on natural healing. Learn more at CaseAdams.com.

People Say They Feel Better and Have Increased Energy!

PDQWUDPDVVDJHDQGERG\ZRU[FRP &RRSHU5RDG &LQFLQQDWL2KLR  

You too could feel better, lose weight or increase energy and mental clarity with a few drops of Natural Awakenings DETOXIFIED IODINE daily in water or on your skin when used as directed. See for yourself, go online to NAWebstore.com and read the comment comments!

6SULQJEDFNWRKHDOWK %X\7:2PLQXWHPDVVDJHV *HWDIUHHPLQXWHDGGRQWRDVLQJOHVHVVLRQ PLQXWHVHVVLRQVFDQ¡WEHFRPELQHG

'RQ¡WIRUJHWWREX\\RXU0RWKHU¡V'D\JLIWVHDUO\ &RPPLWWHGWRH[FHOOHQFH &XVWRPL]HGERG\ZRUN

19.99

4-6 week supply $ shipping $5 for up to 8 bottles

Order Online Today

NAWebstore.com

Or Call: 888-822-0246

Wholesale Pricing Available for Stores and Practitioners Call: 888-822-0246

Shop Natural Awakeningsâ&#x20AC;&#x2122; Online Webstore for More Natural Products at www.NAWebstore.com

22

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com


is a No-Brainer What Researchers Thai Yoga Therapy hai yoga therapy is a combination of gentle rocking, range of motion, passive stretching and gentle pressure along energy Tpathways. Now Know It can help relax stiff joints, stretch muscles, tone Breast Cancer: A French study of 129 breast cancer patients found massage generally reduced lymphedema, a swelling of the lymphatic system, following treatments. The total reduction of lymphedema volume was 33 percent among those receiving massages, according to Gynecologic Oncology. Carpal Tunnel Syndrome: Thirty minutes of massage with trigger point reduced symptoms and improved function in a study of 21 carpal tunnel patients (Journal of Bodywork and Movement Therapies). Constipation: Massage therapy increased the average number of bowel movements among 33 hospitalized Korean children, as reported in the Journal of Korean Academy of Nursing. Dementia: Research from Spainâ&#x20AC;&#x2122;s Extremadura University on 120 institutionalized elderly adults diagnosed with dementia found massage therapy generally helped improve behavior and sleep. Migraines: Craniosacral massage reduced migraine occurrence in a study of 20 migraine sufferers from Icelandâ&#x20AC;&#x2122;s University of Akureyri, as published in Complementary Therapies in Clinical Practice. Osteoporosis: A study of 48 postmenopausal women receiving traditional Thai massage showed increased bone formation after just four weeks. The massage groupâ&#x20AC;&#x2122;s serum P1NP levelsâ&#x20AC;&#x201D;which assesses bone formationâ&#x20AC;&#x201D;increased by 15 percent, while the control group saw no increases (BMC Complementary & Alternative Medicine). Stroke: Massage therapy tended to speed rehabilitation after strokes for 45 Russian patients in a study published in Vopr Kurortol Fizioter Lech Fiz Kult.

internal organs, increase vitality and help induce a deep state of relaxation. Unlike Western massage therapy, Thai yoga therapy, also known Thai yoga massage or Thai bodywork, has been likened to having someone do yoga to you while simultaneously receiving acupressure and reflexology. Clients wear loose comfortable clothing and sessions lasting about two hours are performed on a floor mat. Folk legend has it that the Buddhaâ&#x20AC;&#x2122;s personal physician, Jivaka Kumar Bhaccha, developed Thai yoga, or Nuad-Bo-Rarn. The practice has been used by Buddhist monks for about 2,500 years and its ancient origins are linked to yoga, ayurveda and Chinese medicine, as well as to indigenous healing practices of ancient Siam. It is still used in Thailand as part of the healing regimen for many ailments. Location: Itâ&#x20AC;&#x2122;s Yoga, 346 Ludlow Ave., Clifton. For $35 off sessions booked before Jun. 15, call 513-961-9642 or visit YogaGarage.com. See ad, page 33.

Pain Relief Through the Rossiter System

T

he Rossiter system is a sequence of stretching techniques designed to increase the range of motion of muscles and connective tissue and help alleviate pain. The client usually lies on the floor and begins actively stretching while the practitioner provides a counterweight to anchor the client and allow as much stretching as possible. The goal of a Rossiter session is to relieve pain in the targeted area, but a session may also help adjacent areas of the body. Results are often apparent after the first session. A Rossiter session can be as short or as long as the client wants and can be combined with other bodywork, such as massage. Rob Jones and Marla Cohen, co-owners of Mantra Massage and BodywoRx, in Blue Ash and Glendale, are trained Rossiter coaches. For more information, call 513-891-1324 or visit MantraMassageAndBodywoRx.com. See ad, page 22.

$QFLHQW+HDOLQJ$UWV

3UDFWLFHGZLWK&RPSDVVLRQDWH 8QGHUVWDQGLQJ

$FXSXQFWXUH DWFRQYHQLHQWORFDWLRQV

:(676,'(6RXWK5G &/,)721:RUOG3HDFH<RJD 0RYHPHQW6WXGLR :(67&+(67(5*UDFH7UHH<RJD *URZWK6WXGLR ($676,'(6KHSSDUG&KLURSUDFWLF 3/($6$175,'*(0DULD+RHƲHU1'/07 %/8($6+0DQWUD0DVVDJH %RG\ZR5[

7KXUVGD\VSP 0D\WKURXJK6HSWHPEHU

&DOOWRGD\IRUD)5(( SKRQHFRQVXOWDWLRQ

$WWKHFRUQHURI 'DZVRQ5GDQG0LDPL$YH



ZZZ0DGHLUD)DUPHUV0DUNHWFRP

'RQQD/\QQH6WURQJ%URWW/$F

$FX&LQF\FRP

natural awakenings

May 2014

23


)LQG \RXU KHDOWK\ EDODQFH ([SHULHQFHDKROLVWLFDSSURDFK

YZ WRKHDOWKDQGZHOOQHVV +DYH\RXEHHQZDQWLQJWR LPSURYH\RXUHDWLQJKDELWV" XQGHUVWDQG\RXUERG\EHWWHU" PDNHVHOIFDUHDSULRULW\" FKRRVHDQGSUHSDUHEHWWHU IRRGVIRU\RX$1'\RXUIDPLO\" LQFUHDVHRYHUDOOKDSSLQHVVLQ\RXUOLIH"

5DGLFDOO\ LPSURYH \RXU KHDOWK DQG KDSSLQHVV ZLWK D SURJUDP XQLTXHO\WDLORUHGWR\RXUQHHGV &DOO

PRENATAL MASSAGE Benefits and Tips by Marla Cohen



WRGD\WRVFKHGXOHDIUHH KHDOWKKLVWRU\FRQVXOWDWLRQ ZZZ$OO$ERXW<RX+HDOWK&RDFKLQJ FRP

ĎŽĎ­Ďą>Ĺ˝Ç&#x20AC;Ä&#x17E;ĹŻÄ&#x201A;ĹśÄ&#x161;ͲDÄ&#x201A;Ä&#x161;Ä&#x17E;Ĺ?Ć&#x152;Ä&#x201A;ZÄ&#x161;Í&#x2DC;

gracetree yoga & growth studio

Yoga & Movement Classes Growth & Wellness Services Community & Education

P

renatal massage can ease the pain and discomfort of pregnancy and is widely accepted by physicians, chiropractors, midwives and doulas as a natural choice for managing the physical changes and demands of pregnancy. The benefits of prenatal massage are many, and research data supports the integration of massage therapy into a pregnancy care plan. Reduced back, joint and headache pain: A study of pregnant women that received massage twice weekly for five weeks found they experienced less anxiety, leg and back pain and reported better sleep, improved moods, fewer labor complications and fewer premature births.

uterus, as well as weight gain. Massage stimulates the lymphatic system by decreasing the swelling and assists in the removal of the tissue waste. Massage can also improve circulation and oxygenation of soft tissues and aid in recovery and discomfort. Reduced stress, anxiety and muscle tension: Prenatal massage can have a positive impact on the reduction of stress hormones, relieve anxiety and decrease symptoms of depression. This can help with positive outcome in labor and delivery. A relaxed mother will have a a much easier delivery. Here are some tips for expectant mothers.

New + Returning Students*! 5-class pass for $49 with this ad *returning students of a year or more

8933 Cincinnati-Dayton Rd. in Olde West Chester 513-759-4458 info@gracetreestudio.com

gracetreestudio.com

Grace Tree is a shala, or sanctuary, created for cultivating growth in a community of the heart.

24

Reduced nerve pain: During late pregnancy, sciatic nerve pain is common due to the uterus resting on the muscles of the pelvic floor and the lower back. Massage can relieve pressure on the muscle and reduce the inflammation on the nerve. Improved circulation and reduced swelling: Edema, or swelling of the tissue during pregnancy, is uncomfortable and common. It is caused by reduced circulation and increased pressure on the major blood vessels by the growing

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

Choose a certified prenatal massage therapist. Massage therapy schools often teach students the basics about working with pregnant women. A certified prenatal massage therapist holds additional qualifications and advanced training that may provide optimal relief and assurance. They can address specific pregnancy needs and sensitive areas of the body. Receiving prenatal massage during the first trimester. In the past, there were general concerns about massage in the


first trimester. Although there is a higher prevalence of miscarriage in the first trimester, there has been no scientific correlation for massage being the cause. Massages can be experienced during any trimester of the pregnancy. Be mindful of body positioning. The side-lying position is considered best for receiving a prenatal massage. For the majority of the massage, the momto-be will be placed on her left side to avoid pressure on the vagus nerve, depending on the position of the baby. Although some therapists use tables that have a hole for the belly, undue pressure and gravity pull to the abdomen can occur as a result. Some clients cite discomfort because of incorrect fit or a pulling sensation on the uterine round ligaments. Lying on the back during a massage for an extended period of time can cause undue pressure. Avoid certain essential oils. Absorption of essential oils on the skin occurs within 30 seconds of application. Many essential oils are not child-safe and their topical use is not indicated during pregnancy massage. Although not proven, varying opinions about their use exists. Err on the side of moderation and caution and utilize guidelines such as those given by International Federation of Professional Aromatherapists at ifaroma.org. Avoid excessive heat. Most pregnant women get hot very easily due to increased blood volume. A heated table is not recommended. Pregnancy massage can be an integral component in womenâ&#x20AC;&#x2122;s prenatal care, beneficial as an emotional and physical health addition, and can improve pregnancy outcome and maternal health. Discuss questions with a birthing support team or healthcare provider to make educated choices for incorporating massage into prenatal care. Marla Cohen is a licensed massage therapist specializing in pregnancy massage and is co-owner of Mantra Massage and BodywoRx, in Blue Ash, Ohio. For more information, call 513-891-1324 or visit MantraMassageAndBodyWoRx.com. See ad, page 22.

Medical Massage CINCINNATI Where Medical Bodywork Completes the Science of Wellness

We get to the cause & get you pain free! Call now or go online to schedule your session! www.MedicalMassageCincinnati d l .com â&#x20AC;˘ 513-827-0079

Â&#x2DC;Â&#x2021;Â&#x201D;Â&#x203A;Â&#x201E;Â&#x2018;Â&#x2020;Â&#x203A;Â&#x2026;Â&#x2018;Â&#x2014;Â&#x17D;Â&#x2020;Â&#x2014;Â&#x2022;Â&#x2021;Â&#x2022;Â&#x2018;Â?Â&#x2021;Â&#x2030;Â&#x2018;Â&#x2018;Â&#x2020;Â&#x192;Â&#x201D;Â?Â&#x192;Ǩ Â&#x2021;Â&#x17D;Â&#x17D;Â?Â&#x2021;Â&#x2022;Â&#x2022;Â&#x192;Â&#x2022;Â&#x2022;Â&#x192;Â&#x2030;Â&#x2021;

Â&#x2021;ĆŞÂ&#x2021;Â&#x161;Â&#x2018;Â&#x17D;Â&#x2018;Â&#x2030;Â&#x203A;

Â&#x2021;Â&#x2039;Â?Â&#x2039; Â&#x2021;Â&#x192;Â&#x17D;Â&#x2039;Â?Â&#x2030;

Â?Â&#x2013;Â&#x2014;Â&#x2039;Â&#x2013;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x2018;Â&#x192;Â&#x2026;Â&#x160;Â&#x2039;Â?Â&#x2030;

Â&#x2019;Â&#x203A; Â&#x2021;Â?Â&#x2039;Â?Â&#x192;Â&#x201D;Â&#x2022;ĆŹÂ&#x2018;Â&#x201D;Â?Â&#x2022;Â&#x160;Â&#x2018;Â&#x2019;Â&#x2022; Â&#x201D;Â&#x192;Â?Â&#x2039;Â&#x192;Â&#x17D;ÇŚÂ&#x192;Â&#x2026;Â&#x201D;Â&#x192;Â&#x17D;Â&#x160;Â&#x2021;Â&#x201D;Â&#x192;Â&#x2019;Â&#x203A;

Â&#x2018;Â&#x2018;Â?Â?Â&#x17D;Â&#x2039;Â?Â&#x2021;Â&#x2018;Â&#x2122; Â&#x2018;Â&#x201D;Â&#x192;Â&#x17D;Â&#x17D;Â&#x2C6;Â&#x2018;Â&#x201D;Â&#x2014;Â&#x201D;

Â&#x192;Â&#x201D;Â?Â&#x192;Â&#x2021;Â&#x17D;Â&#x17D;Â?Â&#x2021;Â&#x2022;Â&#x2022;Â&#x2013;Â&#x2014;Â&#x2020;Â&#x2039;Â&#x2018; Í&#x17E;Í&#x153;ͣ͢Â&#x2021;Â&#x2021;Â&#x2026;Â&#x160;Â?Â&#x2018;Â?Â&#x2013;Â&#x2DC;Â&#x2021;

Í&#x160;ÍĄÍŁ Â&#x192;Â&#x2022;Â&#x2022;Â&#x192;Â&#x2030;Â&#x2021;Â&#x2019;Â&#x2021;Â&#x2026;Â&#x2039;Â&#x192;Â&#x17D;

ÍĄÍ?Í&#x;ÇŚÍ&#x17E;Í&#x;Í&#x;ÇŚÍĽÍ&#x;ÍĄÍĄ ÍĄÍ?Í&#x; Â&#x192;Â&#x201D;Â?Â&#x192;Â&#x2021;Â&#x17D;Â&#x17D;Â?Â&#x2021;Â&#x2022;Â&#x2022;Â&#x2013;Â&#x2014;Â&#x2020;Â&#x2039;Â&#x2018;ǤÂ&#x2026;Â&#x2018;Â?Â&#x2021; Â&#x2013; Â&#x2020;Â&#x2039;

3FMBY:PVS8BZ UP#FUUFS)FBMUI FIT Bodywraps are the newest way to lose inches while banishing cellulite

quickly, easily and effortlessly! Burn up to 1,400 calories in just one FIT Bodywrap session!

4"7& VQUP 1 FIT Bodywrap for $59.00* or 5 FIT Bodywraps for $199.00* Go to FITBodyCinci.com and use Action Code NA2014 *Regular

price for a single Bodywrap is $118.00. Offer expires 04/30/14.

(513) 409-3174 FITBodyCinci.com natural awakenings

May 2014

25


dĹ&#x161;Ä&#x17E;&ĆľĆ?Ĺ?ŽŜŽĨ&Ä&#x17E;ĹśĹ?^Ĺ&#x161;ĆľĹ? Ç Ĺ?Ć&#x161;Ĺ&#x161;/ĹśĆ&#x161;Ä&#x17E;Ć&#x152;Ĺ?Ĺ˝Ć&#x152;Ä&#x17E;Ć?Ĺ?Ĺ?Ĺś

greenliving

Feng Shui Fashionista

Dressing with Conscious Intention by Gail Condrick

Í&#x17E;DÄ&#x201A;ĹśÇ&#x2021;Ä&#x201A;Ć&#x152;Ä&#x17E;Ä&#x201A;Ć?ŽĨĹľÇ&#x2021;ĹŻĹ?ĨÄ&#x17E;Ç Ä&#x17E;Ć&#x152;Ä&#x17E;Ć&#x161;Ć&#x152;Ä&#x201A;ĹśĆ?ĨŽĆ&#x152;ĹľÄ&#x17E;Ä&#x161;ĨĆ&#x152;ŽžÍ&#x161;Ć?Ć&#x161;Ä&#x201A;Ĺ?ĹśÄ&#x201A;ĹśĆ&#x161;Î&#x2DC;Ĺ?ĹśÄ&#x17E;ÄŤÄ&#x17E;Ä?Ć&#x;Ç&#x20AC;Ä&#x17E;Í&#x203A; Ć&#x161;Ĺ˝Í&#x161;Ĺ˝Ç&#x20AC;Ä&#x17E;Ć&#x152;Ĺ&#x2021;Ĺ˝Ç Ĺ?ĹśĹ?Ç Ĺ?Ć&#x161;Ĺ&#x161;Ä&#x201A;Ä?ƾŜÄ&#x161;Ä&#x201A;ĹśÄ?Ä&#x17E;Î&#x2DC;Ĺ˝Ć&#x2030;Ć&#x2030;Ĺ˝Ć&#x152;Ć&#x161;ƾŜĹ?Ć&#x;Ä&#x17E;Ć?Í&#x203A;Í&#x2DC;Í&#x;Î&#x2022;ZÄ&#x17E;ĹśÄ&#x17E;Ä&#x17E;

Ć&#x152;Ä&#x17E;Ä&#x201A;Ć&#x161;Ä&#x17E;Ä&#x201A;Ć?Ć&#x2030;Ä&#x201A;Ä?Ä&#x17E;Ć&#x161;Ĺ&#x161;Ä&#x201A;Ć&#x161; Ä?Ĺ˝Ć&#x161;Ĺ&#x161;ŜƾĆ&#x152;Ć&#x161;ĆľĆ&#x152;Ä&#x17E;Ć?Ä&#x201A;ĹśÄ&#x161; Ć?ĆľĆ&#x2030;Ć&#x2030;Ĺ˝Ć&#x152;Ć&#x161;Ć? ĹŻÄ&#x17E;Ä&#x201A;Ć&#x152;Ä?ĹŻĹ˝Ä?ĹŹÄ&#x201A;Ĺ?Ä&#x17E;Ć?Ĺ?Ĺś Ć&#x152;Ä&#x17E;ĹŻÄ&#x201A;Ć&#x;ŽŜĆ?Ĺ&#x161;Ĺ?Ć&#x2030;Ć?Í&#x2022;Ä?Ä&#x201A;Ć&#x152;Ä&#x17E;Ä&#x17E;Ć&#x152;Í&#x2022; Ç Ä&#x17E;Ä&#x201A;ĹŻĆ&#x161;Ĺ&#x161;Ä&#x201A;ĹśÄ&#x161;Ĺ&#x161;Ä&#x17E;Ä&#x201A;ĹŻĆ&#x161;Ĺ&#x161; ĹŻÄ&#x17E;Ä&#x201A;Ć&#x152;ŽůÄ&#x161;ĹśÄ&#x17E;Ĺ?Ä&#x201A;Ć&#x;Ç&#x20AC;Ä&#x17E; Ä&#x17E;ĹśÄ&#x17E;Ć&#x152;Ĺ?Ç&#x2021;Ç Ĺ?Ć&#x161;Ĺ&#x161;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ć&#x2030;Ĺ˝Ç Ä&#x17E;Ć&#x152; ŽĨYĆľÄ&#x201A;ĹśĆ&#x161;ƾžWĹ&#x161;Ç&#x2021;Ć?Ĺ?Ä?Ć?

Ä&#x201A;ĹŻĹŻĆ&#x161;Ĺ˝Ä&#x161;Ä&#x201A;Ç&#x2021;

Ć&#x161;ŽůÄ&#x17E;Ä&#x201A;Ć&#x152;ĹśžŽĆ&#x152;Ä&#x17E;Ä&#x201A;Ä?ŽƾĆ&#x161; ŽƾĆ&#x152;Ć&#x2030;Ć&#x152;Ĺ?ĹŻĆ&#x2030;Ć&#x152;ŽžŽĆ&#x;ŽŜÍ&#x160;

Ç&#x2021;Ä&#x161;ĹŻĆ&#x2030;Ä&#x17E;Ć&#x152;Ͳ^Ä&#x17E;Ä&#x161;Ĺ?Ç Ĺ?Ä?ĹŹÍ&#x2022;ĨĆ?Ĺ?

ϹϭϯÍ&#x2DC;ĎŻĎ­ĎąÍ&#x2DC;ϲϭϾϯ

Ç Ç Ç Í&#x2DC;ĨÄ&#x201A;Ä?Ä&#x17E;Ä?ŽŽŏÍ&#x2DC;Ä?Žž͏&ƾůůĹ?Ć&#x152;Ä?ĹŻÄ&#x17E;&Ä&#x17E;ĹśĹ?^Ĺ&#x161;ĆľĹ? Ä?Ç&#x2021;Ä&#x161;Ä&#x201A;ĹŻĆ&#x2030;Ä&#x17E;Ć&#x152;Î&#x203A;ĹľĆ?ĹśÍ&#x2DC;Ä?Žž

Ç&#x2021;Ä&#x161;ͲĹŻĆ&#x2030;Ä&#x17E;Ć&#x152;^Ä&#x17E;Ä&#x161;Ĺ?Ç Ĺ?Ä?ĹŹ Ĺ?Ć?Ä&#x201A;ĹśÄ&#x201A;Ç Ä&#x201A;Ć&#x152;Ä&#x161;Ç Ĺ?ŜŜĹ?ĹśĹ? /ĹśĆ&#x161;Ä&#x17E;Ć&#x152;ĹśÄ&#x201A;Ć&#x;ŽŜÄ&#x201A;ĹŻ&Ä&#x17E;ĹśĹ?^Ĺ&#x161;ĆľĹ? WĆ&#x152;Ä&#x201A;Ä?Ć&#x;Ć&#x;ŽŜÄ&#x17E;Ć&#x152;Î&#x2DC;Ä&#x17E;Ć?Ĺ?Ĺ?ĹśÄ&#x17E;Ć&#x152;

352)(66,21$/ +,*+48$/,7<

+20(&/($1,1*6(59,&(6

-DQ+DOO 6DQG\7UHERXU

Âł6WHSV7R$Q(IÂżFLHQW 'HWDLO&OHDQ6\VWHP´Â&#x152;

 3HUVRQDOFXVWRPL]HGVHUYLFHWR ÂżW\RXUQHHGVDQGEXGJHW  2IIHULQJJUHHQFOHDQLQJVROXWLRQV  VDWLVIDFWLRQJXDUDQWHHG RUUHFOHDQZLQKRXUV

)5((IULGJHIUHH]HU FOHDQRQVWFOHDQLQJ RUHTXLYDOHQW

&RQWDFWXVWRGD\IRUD)5((TXRWH



ZZZ'LDPRQG4XDOLW\&OHDQFRP 26

W

aking up on the morning of a big presentation to secure city funding for a new park, youâ&#x20AC;&#x2122;re confident that youâ&#x20AC;&#x2122;ve done your homework: Youâ&#x20AC;&#x2122;ve prepared handouts, memorized key points of an environmental impact study and lined up community supporters. Opening the closet presents a different kind of challenge: Whatâ&#x20AC;&#x2122;s the most effective way to dress?

Dressing Our Essence Wardrobe consultants that apply the principles of feng shui to clothing believe the jacket we choose to wear carries as much impact as our words. Clothing pieces and accessories selected with conscious awareness and intention can bring us into harmony and balance, energize our life and transmit subconscious messages about our values. Feng shui clothing stylists believe the five elements of natureâ&#x20AC;&#x201D;wood, fire, earth, metal and waterâ&#x20AC;&#x201D;connect in an unending cycle of harmony that keeps the world in balance. Following an authentic and harmonious lifestyle connects us with this cycle and the environment in a more natural balance of human motion and planetary sustainability. As pioneering stylist Evana Maggiore observed in Fashion Feng Shui: The Power of Dressing with Intention, â&#x20AC;&#x153;I came to the conclusion that cloth-

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

ing is your bodyâ&#x20AC;&#x2122;s most intimate environment and energetically influences your life in the same way that your home and business dĂŠcors do. Body coloring and shape, style, personality, lifestyle, goals and clothing design can align perfectly with the colors, shapes, substances and energies of feng shuiâ&#x20AC;&#x2122;s five elements. Because feng shui connects divine energy to physical form, I realized I could dress my clientâ&#x20AC;&#x2122;s spirits, as well as their surfaces.â&#x20AC;? Fashion Feng Shui, Maggioreâ&#x20AC;&#x2122;s international corporate legacy, maintains that combining intention and the five elements with awareness of our personal style attracts what we desire. Holistic image and lifestyle consultant and lead trainer AndrĂŠa Dupont, of Portsmouth, New Hampshire, states that the first step is discovering our â&#x20AC;&#x153;essenceâ&#x20AC;?, or primary element. â&#x20AC;&#x153;You canâ&#x20AC;&#x2122;t dress yourself until you know yourself. I ask clients, â&#x20AC;&#x2DC;If you could change one thing about your life, what would it be?â&#x20AC;&#x2122; Once we establish an individualâ&#x20AC;&#x2122;s inner strengths and core element, the results can be life changing.â&#x20AC;?

Green Choices For Denise Medved, of Hendersonville, North Carolina, owner of Feng Shui Style, wardrobe consciousness shows respect for our individuality and the environment. â&#x20AC;&#x153;When I choose to dress in natural fibers such as cottons, leathers,


silks or wools, or their vegan complements in manmade fibers, it represents the life force of plants and animals and builds qi, or energy,â&#x20AC;? says Medved. She suggests assembling an outfit embracing three of the five elements. â&#x20AC;&#x153;A water/wood/fire triad might be black, woven, silk trousers; an organic, cotton, floral print shirt; and a red, recycled wool jacket. Personalizing this with the surprise of grandmotherâ&#x20AC;&#x2122;s yellow stone pin on the lapel adds creative flair and earth and metal elements.â&#x20AC;? Natureâ&#x20AC;&#x2122;s jewelry energizes and circulates qi.

Reduce, Reuse and Recycle Practicing the three basic tenets of sustainability together with prin-

ciples of feng shui keeps our wardrobe and closet resonating with life. Consultants agree that a wardrobe representing the five elements allows endless possibilities of creative combinations and reduces the need for having to keep up with new fashion trends. Shopping for such treasures at consignment and thrift stores, plus estate sales, allows us to reuse and repurpose clothing, energizing our budgets, closets and attitudes. Recycling items that pack closets and no longer suit our needs frees space and energy to create a wardrobe that is authentically ours. The Practical Encyclopedia of Feng Shui, by Gill Hale, also contains helpful advice for bringing out an intended inner message and making

a statement. The color green conveys the wood element, or individuals that are public spirited and energetic. Red suggests fire, the color of inspiring leaders. Supportive and loyal earth personalities gravitate to khaki, while resolute, metal people may select grey. Natural communicators that view life holistically will be reflected in the water element of black. A feng shui philosophy provides guidelines for living in harmony with the natural world and in conscious awareness of life. Each choice expresses a stylistic living intention that will be noticed by the world. Gail Condrick is an archetypal consultant and Nia Technique faculty member. Connect at GaelaVisions.com.

%#!'$%#' "%""

$%#'%"'&'&% &#'!%"'$#'&&!#'

$' '!&'& !' &'&&#'!$'$' $%# $%'$'%"' $"'%'&%"'&"&#'  !&'%"' %&'$"&'$"'$#' &&!#''&%!& ' $#' %" ' !%#!'$"'%'$"& ' %" '#$'$&#' & ' &'$#&'&&!#'#%!& '# &'!&'$#&'$' %&' %"'!&' %#!&#'$'$$

%#!'$%#'$&#  ' $'$"&'$"'&% '!&# ' "%"&'$&'%& ' %&' &!'#&%&' $&# ' '&%"&#'#&&"&#'& !&' ' %#!'$%#' "%"&'%& '!

''&%   #'"'%& '!'"'!$'$' $%#



  

natural awakenings

   

   

May 2014

27


livingwellrecipes

Arugula, Tomato and Feta Cheese Salad Arugula is cancer-fighting, detoxifying cruciferous superfood. Toss some in salads or smoothies for a healthy treat. Prep Time: 10 minutes Serves: 3 to 4 as a side dish; 2 as a main course. Yield: 2 large salads

Ingredients

Directions

1 large bunch fresh arugula, stems removed 1 pint grape or cherry tomatoes, cut in halves Âź cup fresh basil, julienned (reserve some for garnish) 4 oz crumbled feta cheese (or goat cheese, Parmesan Reggiano, etc.) Kosher salt/fresh ground pepper 1 tbsp aged balsamic vinegar Extra virgin olive oil to taste

Combine arugula, tomatoes, and basil in a medium size bowl. Season to taste with salt and pepper. Toss with balsamic vinegar and olive oil. Sprinkle feta cheese (and nuts) on top and add strips of basil before serving. As main course, serve with crusty bread.

Garnish with several strips of basil and drizzle with extra virgin olive oil

Optional Items Sliced avocados Toasted pine nuts, walnuts, sliced almonds Spinach, baby kale or romaine lettuce

Healthy Tip Arugula is a flavorful, oak-leaf-shaped green vegetable with a peppery taste that adds a powerful health boost. You can blend it with other lettuces to help you acquire a taste for its slightly bitter flavor. High in fiber and antioxidants, it can help lower cholesterol, balance blood sugar, protect the brain and reduce risk of heart disease. Recipe courtesy of Mary Rasmussen, integrative health coach at the Alliance Institiute of Integrative Medicineindividualized coaching. For more information, email Mary.Rasmussen@ MyHealingPartner.com.

([SORUH7KH6SLFHDELOLWLHVÂŽ

8QLTXH6DOWV ([RWLF7HDV )LQH6SLFHV +HUEV 1DWXUDO6XJDUV $FFHVVRULHV *LIWV +DQG0L[HG%OHQGV &RRNLQJ'HPRQVWUDWLRQV 3DQWU\3DUWLHV 7KH6SLFH 7HD([FKDQJHRI&LQFLQQDWL ÂŽ

5RRNZRRG&RPPRQV_)DFHERRNFRP767(&LQFLQQDWL_

)(('<285+81*(5 )(('<285628/ $%<2%)DUPWR7DEOH5HVWDXUDQW  $OO)RRG0DGHIURP6FUDWFK  2UJDQLFDOO\*URZQ,QJUHGLHQWV  &RPIRUWDEOH5XVWLF6HWWLQJ  )DPLO\2ZQHG2SHUDWHG &DOOIRUD5HVHUYDWLRQ

 0HQWLRQWKLVDGIRU RII\RXUELOO 28

ZZZELWHIRRGLHFRP %LWH5HVWDXUDQW6W5W0LOIRUG2+

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

Vegetable Ratatouille Immerse yourself in seasonings with this light and appetizing entrĂŠe overflowing with flavor A colorful array of vegetables, sweet caramelized onions, make for a unique play on this traditional French dish. Preparation Time: 15 minutes Cook Time: 30 minutes Yield: 2-3 servings


Ingredients 4 Tbsp organic extra virgin olive oil 1 tsp smoked paprika ½ Tbsp thyme 2 to 4 bay leaves 1 Tbsp freshly squeezed lemon juice 1 clove garlic, minced 1 medium onion, sliced 1 medium eggplant, diced 1 each red and green bell peppers, diced 1 medium zucchini, diced 1 pt cherry tomatoes, halved 2 Tbsp fresh parsley, minced 2 Tbsp fresh basil, minced Italian seasonings to taste

Directions 1. In a small bowl, mix lemon juice, olive oil, paprika, thyme and Italian seasonings. Set one-half of the mixture aside and place remainder into a large frying pan. 2. Cook over medium heat until small bubbles form. Add garlic and onions and sautĂŠ until the onions become translucent. 3. Add the eggplant and cook for 10 additional minutes.

4. Add the red and green bell peppers, zucchini, bay leaves and tomatoes. 5. Lower the heat, cover and cook for 12-15 minutes or until all vegetables are tender. 6. Sprinkle with parsley and basil and pour in remaining sauce from step 1. 7. Stir until combined and serve

Â&#x192;Â?Â&#x2013;Â&#x2013;Â&#x2018;   Â&#x201E;Â&#x2014;Â&#x2013;Â&#x160;Â&#x192;Â&#x2DC;Â&#x2021; Â&#x2013;Â&#x2018;Â&#x2026;Â&#x2018;Â&#x2018;Â?ÇŤ

Healthy Tip This lively dish is great for vegans and due to the large amount of produce used, it also helps keep the cost of your dinner low and supports local farmers. Recipes courtesy of Julie Van Arsdale, owner of The Spice and Tea Exchange in Rookwood. See ad, page 28.

Â&#x2021;Â&#x2020;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x201D;Â&#x2020;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2026;Â&#x2039;Â&#x2018;Â&#x2014;Â&#x2022;ĆŹÂ&#x160;Â&#x2021;Â&#x192;Â&#x17D;Â&#x2013;Â&#x160;Â&#x203A;Â?Â&#x2021;Â&#x192;Â&#x17D;Â&#x2022;Ǥ Â&#x2018;Â&#x201D;Â&#x2030;Â&#x192;Â?Â&#x2039;Â&#x2026;Â&#x2021;Â&#x2030;Â&#x17D;Â&#x2014;Â&#x2013;Â&#x2021;Â?ÇŚÂ&#x2C6;Â&#x201D;Â&#x2021;Â&#x2021;Â&#x2021;Â&#x2022;Â&#x2014;Â&#x2019;Â&#x2021;Â&#x201D;Â&#x2C6;Â&#x2018;Â&#x2018;Â&#x2020;ÇŚÂ&#x201E;Â&#x192;Â&#x2022;Â&#x2021;Â&#x2020; â?§Â&#x2021;Â&#x2122;Â&#x2021;Â?Â&#x2014;Â&#x2021;Â&#x2021;Â?Â&#x17D;Â&#x203A; â?§Â&#x2021;Â&#x2039;Â&#x2030;Â&#x160;Â&#x2013;Â&#x2018;Â&#x2022;Â&#x2022;Â&#x2021;Â&#x192;Â&#x17D;Â&#x2022; â?§Â&#x2039;Â&#x2020;Â&#x2022;ÇŻÂ&#x2021;Â&#x192;Â&#x17D;Â&#x2022; â?§ Â&#x201D;Â&#x2021;Â&#x2022;Â&#x160; Â&#x2014;Â&#x2039;Â&#x2026;Â&#x2021;Â&#x2022; â?§Â&#x201D;Â&#x2021;Â&#x192;Â?Â&#x2C6;Â&#x192;Â&#x2022;Â&#x2013; Â&#x2013;Â&#x2021;Â?Â&#x2022; â?§Â&#x192;Â&#x2013;Â&#x2021;Â&#x201D;Â&#x2039;Â?Â&#x2030;Â&#x2DC;Â&#x192;Â&#x2039;Â&#x17D;Â&#x192;Â&#x201E;Â&#x17D;Â&#x2021;

ͳͲΨÂ&#x2018;Â&#x2C6;Â&#x2C6;

Â&#x203A;Â&#x2018;Â&#x2014;Â&#x201D;ÍłÂ&#x2022;Â&#x2013;Â&#x2122;Â&#x2021;Â&#x2021;Â?ÇŻÂ&#x2022; Â&#x2020;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x201D;Â&#x203A;Č&#x2014; Č&#x2014;Â&#x2022;Â&#x2021;Â&#x2026;Â&#x2018;Â&#x2014;Â&#x2019;Â&#x2018;Â?Â&#x2026;Â&#x2018;Â&#x2020;Â&#x2021;Â&#x192;Â&#x2122;Â&#x192;Â?Â&#x2021;Â&#x2122;Â&#x160;Â&#x2021;Â? Â&#x2018;Â&#x201D;Â&#x2020;Â&#x2021;Â&#x201D;Â&#x2039;Â?Â&#x2030;Â&#x2018;Â?Â&#x17D;Â&#x2039;Â?Â&#x2021;Â&#x2018;Â&#x201D;Â&#x2DC;Â&#x2039;Â&#x192;Â&#x2019;Â&#x160;Â&#x2018;Â?Â&#x2021;Ǥ Â&#x2C6;Â&#x2C6;Â&#x2021;Â&#x201D;Â&#x2021;Â&#x161;Â&#x2019;Â&#x2039;Â&#x201D;Â&#x2021;Â&#x2022;Ͳ;Č&#x20AC;;ͳČ&#x20AC;ͳ͜Ǥ

͡ͳ;Ǥ͚Ͳ͸Ǥͺ͚͸͜

Â&#x2021;Â&#x192;Â&#x17D;Â&#x2013;Â&#x160;Â&#x203A;Â&#x201D;Â&#x2030;Â&#x192;Â?Â&#x2039;Â&#x2026;Â&#x2021;Â&#x192;Â&#x17D;Â&#x2021;Â&#x17D;Â&#x2039;Â&#x2DC;Â&#x2021;Â&#x201D;Â&#x203A;ǤÂ&#x2026;Â&#x2018;Â?

Are you using antibiotics, steroids or anti-fungals to treat a respiratory infection? Still sick and feeling worse? We use a natural, laboratory and clinically proven antimicrobial that kills bacteria, fungus and virus without harming the patient.

We use RESPIRATORY RELIEF ELIEF F from

20%OFF with coupon code RESP20

We get calls & orders from people who have tried all sorts of prescription medications that do NOT get rid of their respiratory infections. Time after time the infections clear up in a few days with Respiratory Relief. We shake our heads and wonder, â&#x20AC;&#x153;Why donâ&#x20AC;&#x2122;t they try this ďŹ rst?â&#x20AC;? Now you can.

For use in a ne nebulizer zer

Order online att M MyNaturesRite.com N t Rit or call 800-991-7088 natural awakenings

May 2014

29


fitbody

Body Ease Fluid, Flexible Movement Can Be Ours by Sarah Todd limiting positions. This calls for body movement re-education.

B

ad habits are hard to breakâ&#x20AC;&#x201D;and itâ&#x20AC;&#x2122;s even harder to eliminate those we are unaware of. Many people experience pain from unconscious physical patterns such as hunching over a computer keyboard or holding a musical instrument at an uncomfortable angle, but donâ&#x20AC;&#x2122;t know how to identify and change

Alexander Technique â&#x20AC;&#x153;Letâ&#x20AC;&#x2122;s say youâ&#x20AC;&#x2122;re a runner and didnâ&#x20AC;&#x2122;t realize that you were running in a lopsided way,â&#x20AC;? explains Alexander Technique practitioner Beret Arcaya, who has taught the practice in New York City for almost 30 years. Students learn to retrain their thinking, movements and

posture for better natural alignment. â&#x20AC;&#x153;It helps you understand how youâ&#x20AC;&#x2122;re making an argument between yourself and gravity,â&#x20AC;? she says. Invented by Australian thespian F. Matthias Alexander at the end of the 19th century as a means of improving his onstage presence, the Alexander Technique is highly regarded by actors and entertainers, yet anyone can benefit from it, according to Arcaya. In typical one-on-one sessions, Alexander movement practitioners use a light, gentle touch and verbal instruction to show students how to realign their head, neck and upper back while standing in front of a mirror, which helps the rest of the body attain a more natural position. Next, students learn to move through routine activities like sitting, walking and bending in ways that replace damaging habits with easier movements. The technique is easily modified to meet individual needs, Arcaya says, citing a former student that suffered from hemophilia. â&#x20AC;&#x153;He could hardly bend his knees, and he had little mobility in one

6WRS,WFKLQJ :LWKLQ6HFRQGV

,QWURGXFLQJ'HUPD&OHDU WKH $PD]LQJ1HZ6NLQ5HSDLU6DOYHIURP 1DWXUDO$ZDNHQLQJV TM

6DWXUGD\-XQHWK$0²30 )LYH6HDVRQV6SRUWV&OXE²&LQFLQQDWL 6QLGHU5G&LQFLQQDWL2+

)LWQHVV&ODVV6DPSOHU .H\QRWH6SHDNHUÂ&#x2021;/HFWXUHV 6LOHQW$XFWLRQÂ&#x2021;1HWZRUNLQJ 9HQGRU%RRWKVÂ&#x2021;5RXQGWDEOHV



4-oz jar- + $5 shipping-up to 5 jars

Order Online Today at

/HDUQPRUHDQGUHJLVWHUDW

NAWebstore.com

ZZZ:RPHQV)LWQHVV$VVRFLDWLRQRUJ 30

Greater Cincinnati/Northern Kentucky Edition

Our all natural personal skin care product brings comforting relief to sufferers of many skin irritations. DermaClear has proven to be effective against: t4IJOHMFT t1TPSJBTJT t&D[FNB t*OTFDU#JUFT t"MMFSHJD3BTIt+PDL*UDIt#VSOT tBOENPSF DermaClear will simply feel good putting it on. Cooling and TPPUIJOH UIF$BMDJVN.POUNPSJMMPOJUF$BMDJVN#FOUPOJUFDMBZ penetrates pores and open areas of the skin and pulls out toxins and inflammation. The proprietory blend of homeopathics go even deeper, address the root causes and assist to bring even deeper toxins to the surface.

or call 888-822-0246

Wholesale Pricing Available to Stores and Practitioners

NaturalCinci.com


elbow; he was terribly stiff,â&#x20AC;? she recalls. While the technique couldnâ&#x20AC;&#x2122;t treat the disease, â&#x20AC;&#x153;It allowed him to skillfully use his remaining uninjured tissue.â&#x20AC;? One day, when he returned from a three-mile walk with his young son, he was beaming. â&#x20AC;&#x153;â&#x20AC;&#x2DC;I walked with a freedom and a lightness,â&#x20AC;&#x2122; he said, â&#x20AC;&#x2DC;I didnâ&#x20AC;&#x2122;t want to stop.â&#x20AC;&#x2122;â&#x20AC;? A 2008 study in the medical journal BMJ found that patients with chronic back pain experienced long-term benefits from Alexander Technique exercises and lessons. People with Parkinsonâ&#x20AC;&#x2122;s disease also improved their walking, speech, posture and balance through Alexander training, according to a 2002 study in Clinical Rehabilitation.

Feldenkrais Method Others in need of movement re-education use the method founded by physicist, electrical engineer and judo black belt holder MoshĂŠ Feldenkrais in the mid-20th century. Feldenkrais was familiar with the Alexander Technique, and the two methods share the same fundamental goal of helping students change harmful patterns through movement exploration, touch and dialogue. The Feldenkrais Method avoids concepts of â&#x20AC;&#x153;rightâ&#x20AC;? and â&#x20AC;&#x153;wrongâ&#x20AC;?. Instead, the practitioner leads students through gentle, slow-movement sequences, mostly on the floor, while asking questions about subtle details as they experience options. This sharpens sensory awareness of how to perform each movement with maximum ease. In one-on-one sessions, the student is passive while the practitionerâ&#x20AC;&#x2122;s hands suggest various non-habitual movements to widen his repertoire. It all increases flexibility, balance, fine motor skills and overall physical self-awareness. Feldenkrais stated, â&#x20AC;&#x153;What Iâ&#x20AC;&#x2122;m after isnâ&#x20AC;&#x2122;t flexible bodies but flexible brains; to restore each person to their human dignity.â&#x20AC;? Seniors that practiced the Feldenkrais Method enhanced their balance and mobility, according to a 2010 study published in The Journal of Alternative and Complementary Medicine. It may also alleviate symptoms of nonclinical depression, according to a 2011 pilot study reported in the Journal of the South Carolina Medical Association.

Trager Approach

reawakening is the Trager Approach, invented by Dr. Milton Trager, an athlete who suffered from a congenital spinal deformity. â&#x20AC;&#x153;The intention of the practitioner in a Trager session is to introduce the client to a series of playful and pleasurable sensations as the session unfolds,â&#x20AC;? says practitioner Martha Partridge, of New York City, who works primarily with people that have Parkinsonâ&#x20AC;&#x2122;s disease. During tablework sessions, practitioners â&#x20AC;&#x153;bring awarenessâ&#x20AC;? of a specific movement by rocking, cradling and gently rotating a clientâ&#x20AC;&#x2122;s body, Partridge explains. The feeling of effortless move-

ment is further ingrained through a series of mental gymnastics, termed mentastics, that clients can do at home. The objective, says Partridge, is to help people have a sense of joy in everyday, common movement. All three bodywork techniques can help people banish bad habits for good. â&#x20AC;&#x153;Gradually, aches and pains will go away,â&#x20AC;? Arcaya says. â&#x20AC;&#x153;You can undo the imbalances that have done you wrong.â&#x20AC;? Then go forward, doing things right. Sarah Todd is a freelance writer in Brooklyn, NY. Connect at SarahToddInk.com.

7UL6WDWH&RPSRXQGLQJ3KDUPDF\ 1RZ$FFHSWLQJ0RVW,QVXUDQFH3ODQV Éľ+RUPRQH5HSODFHPHQW7KHUDS\ Éľ(UHFWLOH'\VIXQFWLRQ Éľ3DLQ :RXQG*HOV Éľ6WHULOH&RPSRXQGLQJ Éľ3DWLHQW&RQVXOWDWLRQV Éľ6DOLYD7HVWLQJ Éľ1XWULWLRQDO6XSSOHPHQWV Éľ9HWHULQDU\DQGPRUH

$W7UL6WDWH&RPSRXQGLQJ3KDUPDF\ ZHSURYLGHRXUSDWLHQWVZLWKPHGLFDO VROXWLRQVWDLORUHGWRWKHLUQHHGV <HDUVRI7RWDO([SHULHQFH

+RXUV0RQ)UL6DW)ROORZXVRQIDFHERRN

/RFDWHGLQVLGH.XQNHO3KDUPDF\ %HHFKPRQW$YHÂ&#x2021;&LQFLQQDWL2KLR 75,67$7(&203281',1*3+$50$&<

Â&#x2021;ZZZWULVWDWHU[FRP

*HW:HOO6WD\:HOO/LYH:HOO )DPLO\&KLURSUDFWLF&DUH Â&#x2021; 3UHJQDQF\ Â&#x2021; &KLOGUHQ RX FK\ D $ZKRO H U  R W  HERG\DSSURDFK

U K H D OW

Â&#x2021;,QIDQWV

KJRDOVQDWXUDOO\



7\OHUVYLOOH5G6WH 0DVRQ2+

ZZZOLYHZHOOFFFRP

Another entry point to such a bodily natural awakenings

May 2014

31


Saving Lives with Infrared Thermal Imaging by Anthony Piana and Alexander Sepper

T

he history of thermography can be traced to the first cave woman that felt the forehead of the first cave baby. Even then, they knew that excess heat signals inflammation, infection or another pathological process in the body. Many early physicians knew this, too. Hippocrates put a clay/mud mixture on his patients to see which dried first. He labeled them â&#x20AC;&#x153;areas of pathologyâ&#x20AC;?.

Temperature Taking and Insurance Funding Most of us grew up in households where school could only be missed if we had a fever. Typically, a parent would take our oral temperature to determine if we had a systemic infection and decide if we stayed in bed. Early 20th-century medical research focused on taking temperature readings of smaller body regions. The theory that the body is symmetrical both anatomically and physiologically was explored. Point-to-point comparative temperature analyses were made and shown to be effective in diagnosing diseases. Early medical thermographers used liquid crystal testing to compare colored temperature patterns of the body. For example, if the liver had an area of inflammation, the skin surface tem-

32

perature would show a different color pattern. As technology improved, finer temperature differences were studied with infrared detectors. Modern hospitals take body temperatures as standard procedure for all arrivals. Imagine what could be done if they used infrared scanning technology. In 1956, Dr. Robert Lawson, of Montreal, published the first paper on diagnosing breast cancer with thermal studies. This approach caught on quickly and many researchers have dedicated their careers to refining this science. Other pathologies were also explored with thermography, including thyroid disease, cerebrovascular function, neurology and other systemic diseases. The use of thermography for disease exploration got FDA approval in 1982 and was covered by Medicare. However, special interest groups heavily promoted radiographic methods and by the summer of 1984, Medicare stopped paying for thermography for breast cancer screening. This led to physicians recommending mammography instead of thermography. Only a few thermography proponents stayed on course, and today thermography is practiced mostly by alternative doctors. More than 800 research articles have been published on breast cancer screening and thermography, a proven technology with an approximate mean accuracy of 95 percent. A recent study performed by New York-Presbyterian Hospital at Cornell University showed 97 percent sensitivity as it accurately identified 58 of 60 tumors.

Tumors Found Sooner Long before breast cancer registers as a solid, impenetrable density on an X-ray, more commonly referred to as a mammogram, it develops a network of vascularity called angioneogensis, which feeds the developing tumor. The heat

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

associated with blood flow in these vessels is picked up by thermal sensing cameras. A good analogy is newly planted grass: Long before new grass can be seen, a network of roots must develop. A mammogram cannot see anything until the grass sprouts, while a thermal camera can show developing roots. Two parallel studies, one undertaken in the former Soviet Union and the other conducted at the University of Wisconsin, showed that approximately 70 percent of tumors will register on a thermogram eight to 10 years before they can be seen on a mammogram. This extra time allows patients and doctors that work with this technology to reverse many risk factors and developing cancers. With the current poor outcomes of mammograms, as recently reported in the New England Journal of Medicine, it is time for all tools to be considered. Mammograms are only 83.3 percent effective at identifying breast cancer in women 50 and older. The effectiveness is much lower when applied to the general female population, due to breast density differences. Currently, there is no routine screening available for women in their 20s and 30s; approximately 20,000 young American women are diagnosed with breast cancer each year, many times finding their own cancers when they are in stage 3 and have spread to the lymph nodes. Annual thermography can significantly address this population and need.

Lymphatic System and Immunity The most ignored and abused system in the body is the lymphatic system. There is no anatomical test that can locate areas of non-pathological lymphatic blockages. But thermography does identify congestion where blocked


fluids have accumulated in the surface areas of the body. Contributing factors include poor posture, inflammatory foods, injuries and many other assaults on the delicate nature of the lymphatic vessels. An overabundance of toxins and lack of lymphatic circulation will wall off the system to create a stagnant pool of toxicity in localized areas. These putrid pools become breeding grounds for disease and cancer. The effect of this is widely known, but these pools of toxicity were impossible to see and therefore, were ignored. With recent advances in thermal technology, we now are able to identify these regions and address them with natural methods. Keeping in mind that our entire well-being and resistance to cancer and disease relies on a healthy immune system, it is imperative that we evaluate the lymphatic system and make lifestyle adjustments accordingly.

Inflammatory Response The human inflammatory response is a primitive reaction to wall off injuries and infection. It does this ineffectively, though. The challenge is when we respond to these conditions we overproduce scar tissue in all affected areas. Many important filters in our body self-destruct in the process of detoxification. We are exposed to so many toxins that our small liver and kidney filters cannot keep up with the demand. Inflammation is the result and this creates scarring. The filtration system in our bodies evolved over time, when there were fewer environmental toxins than today. The filter size was made for a go-cart, but todayâ&#x20AC;&#x2122;s environment calls for a diesel truck-sized filter. Thermography is useful in identifying these areas of toxic load and is an integral part of any detox program. Other inflammatory diseases may be identified with thermal imaging including thyroid dysfunction, skin cancer, arthritis and some abdominal disorders.

Radiation-Free Thermal imaging senses infrared radiation emitted from our bodies and does not produce radiation. It is safe to use thermography as often as needed; there

is no need to wait between screenings. This makes it useful for performing comparative imaging to see a response from treatment. While thermal imaging does not see inside the body, it reveals the physiologic and metabolic function of the area studied. In a world where medicine, radiation and surgery are commonly over-prescribed, thermography can visualize health function. There is a slow crossover occurring from anatomical medicine to functional medicine by mainstream practitioners. Thermogra-

phy remains ahead of the curve and is a valuable method of testing. Full-body exams for men and women of all ages can be very useful as an annual preventive and safe screening device. Dr. Anthony Piana is a board-certified clinical thermologist, and Dr. Alexander Sepper is a leading authority on thermographic imaging. Mindful Wellness Medical Thermography offers full body thermography. For more information, call 513-382-3132 or visit MindfulWellnessMedicalThermography.com.

/RRNLQJIRUD6DIHU3URDFWLYH:D\WR0RQLWRU<RXU+HDOWK" 0LQGIXO:HOOQHVV0HGLFDO 7KHUPRJUDSK\RIIHUV )XOO%RG\7KHUPDO,PDJLQJ %UHDVW+HDOWK6FUHHQLQJ 7K\URLG6FUHHQLQJ /\PSKDWLF&RQJHVWLRQ 1HUYRXV6\VWHP'LVRUGHUV $EGRPLQDO,QĂ DPPDWLRQ 9DVFXODU6\VWHP$QDO\VLV 1HXURPXVFXODU'LVRUGHUV 0XVFXODU'LVRUGHUV 9DVFXODU6FUHHQLQJ 2WKHU3DWKRORJLHV

(DUO\'HWHFWLRQ,V.(< 7KHUPRJUDSK\GHWHFWVEUHDVWDEQRUPDOLWLHV($5/,(5WKDQDQ\RWKHUWHVW

12UDGLDWLRQâ&#x153;Ś12FRPSUHVVLRQâ&#x153;Ś12FRQWDFW

&OLQLFDO7KHUPRJUDSK\PDSVSK\VLRORJLFDOSDWWHUQVLQGLFDWLQJERWKQRUPDOKHDOWKDQGGLVHDVH 7KHUPRJUDPVDUHLQWHUSUHWHGE\3$&7DFFUHGLWHGSK\VLFLDQV)'$FOHDUHGVLQFH

0HQWLRQWKLVDGDQGUHFHLYHRIIDQ\VFUHHQLQJ &DOOWRERRN\RXUDSSRLQWPHQWWRGD\ 0LQGIXO:HOOQHVV0HGLFDO7KHUPRJUDSK\FRP â&#x153;Ś 

PRQWKXQOLPLWHG\RJDSDVVIRUMXVW 0HQWLRQWKH1DWXUDO$ZDNHQLQJVDGDQGUHFHLYHRII\RXUQGPRQWK











1HZFXVWRPHUVRQO\

<RJD7HDFKHU7UDLQLQJVWDUWV-XQH $VKWDQJDâ&#x20AC;˘9LQ\DVDâ&#x20AC;˘3RZHU<RJDâ&#x20AC;˘+DWKD â&#x20AC;˘ <LQ<RJDâ&#x20AC;˘ <RJDIRUâ&#x20AC;˘6KDPDQLF<RJD 7UDGLWLRQDO7KDL<RJD7KHUDS\ /XGORZ$YH&LQFLQQDWL 5HJLVWHUHG <RJD6FKRRO

 \RJDJDUDJHFRP

Every moment in our lives is a miracle we should enjoy instead of ignoring. ~Yoko Ono

natural awakenings

May 2014

33


photo courtesy of Naples Equestrian Challenge

healthykids

Whoa! to Limitations Therapeutic Horseback Riding Strengthens Kids by Cyndee Woolley

Z

ach “Zachman” Aldridge was born healthy, but at just 10 weeks, he was hospitalized at the hands of his birth father. Suffering from a brain aneurism, partial paralysis and multiple broken bones from shaken baby syndrome, Zach’s mother, Rebekah, was told that he might live for a year. Rebekah’s hope for a miracle was granted as her son’s life extended into weeks, months and years. Yet, at 4, the effects of the injury still prevented Zach from walking or talking like other children. “While some people are resigned to leave special children like Zach confined to a wheelchair, therapeutic horseback riding gives them more options and improves their quality of life,” advises Kim Minarich, execu-

34

tive director of Southwest Florida’s nonprofit Naples Equestrian Challenge therapeutic riding program. A medical examination ensures a child is qualified for safe participation. During his first lessons, riding instructors had to prop up Zach’s head using “boppy pillows”. However, after just a few months, the Aldridge family saw dramatic improvements as the boy began speaking and telling his horse to “trot on.” Next, Zach began walking, a surprise to all. His growing strength had worked to overcome the paralysis and the gentle rocking motion of his therapeutic riding sessions gently pushed his displaced hip back into place, ultimately enabling him to take steps on his own. Zach’s achievements are not unique. Life-changing milestones like

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

this are common occurrences at the 850 nationwide therapeutic riding centers registered with the Professional Association of Therapeutic Horsemanship (PATH) International. Now in its 21st year, Dream Catchers, at the Cori Sikich Therapeutic Riding Center, in Toano, Virginia, is one such center celebrating its many success stories. Kendall Lecker, a PATH International-certified advanced instructor, describes the rapid progress of a new 6-year-old student living with autism as illustration. In his first session, he slumped over in the saddle and struggled to hold himself up; by his third session, he was sitting up straight and confidently giving commands to his horse. “Often, our riders start with insufficient core strength and may not be able to hold themselves upright, something the average person takes for granted. But, in a relatively short time, most riders can see dramatic improvements,” says Lecker. Both Naples Equestrian Challenge and Dream Catchers have achieved premier accreditation by demonstrating the highest levels of training, safety standards and quality controls in the industry developed to protect the riders, staff and volunteers. Feedback from approximately 56,000 participants nationwide, including nearly 41,000 under the age of 18, show that therapeutic horseback riding helps participants in five key areas: Normalizes muscle tone. Riding a horse helps children of all abilities build core strength and exercise muscles that they may not be able to work from the confines of a wheelchair. Increases flexibility and relaxation. The natural rhythm of a horse’s gait provides a relaxing effect on tense muscles and can gently rock joints back into place. It’s a unique therapeutic benefit not easily achieved through traditional physical therapy. Improves coordination, balance and strength. Completing tasks like picking up an object, riding across the arena and placing it in a bucket helps riders develop hand/eye coordination. The movements also help improve balance and strength. Promotes spatial orientation and fine motor skills. Working side-by-side


photo courtesy of Dream Catchers

L

â&#x20AC;&#x153;The riding center gave me a place to realize I wasnâ&#x20AC;&#x2122;t the only one with challenges. It was a place that I could go to and be normal for part of the week.â&#x20AC;?

ocally, Cincinnati Therapeutic Riding and Horsemanship in Milford has been providing recreational horseback therapies since 1985. Kacey Farrellâ&#x20AC;&#x2122;s daughter Blake suffers from Spinal Muscular Atrophy. She states, â&#x20AC;&#x153;When Blake was diagnosed with this heart-breaking disease, we promised that we would do everything to give Blake the best quality of life. The horses, therapists, instructors and volunteers at CTRH have given her that and more.â&#x20AC;? For more information, call 513-8317050 or visit Ctrh-online.org.

NWZ UW\PMZ[ LIa

~ Tiffany Billings, a college student with cerebral palsy with their assigned volunteers and horses and reaching for objects from a different perspective than usual helps youths develop their spatial sense and fine motor skills. Enhances self-esteem, self-confidence and self-control. Riders are encouraged to give verbal commands to their horse during sessions, which effects a command of vocabulary and boosts confidence while they bond with the horse. While the documented benefits are derived from personal testimonials rather than clinical studies, the positive results for children like Zach are indisputable. Meanwhile, therapeutic horseback riding is gaining increased acceptance in the medical community as more doctors are recommending this life-changing activity for their patients. PATH International spokesperson Cher Smith says, â&#x20AC;&#x153;Our mission is to help certified centers provide safe access for all individuals living with special needs.â&#x20AC;?

In honor of the women, our mothers and others, who have shown us, in their nature and nurture, the art of balance â&#x20AC;&#x201D; bending, ever giving, never breaking, ever strong â&#x20AC;&#x201D; we present fairly traded gifts with easy, earthy elegance.

Willow Bud Necklace, $110 HANDCRAFTED IN NEPAL

Bring in this ad to receive

2011 Madison Rd, Cincinnati, OH 45208

25% OFF one item.

Offer valid at participating stores until 5/31/14. Not valid with other discounts, purchase of gift cards, Oriental rugs or Travelerâ&#x20AC;&#x2122;s Finds.

513-871-5840 Cincinnati.TenThousandVillages.com

new from

Pleasant Dreamsâ&#x201E;˘ contains a blend of safe, natural sleepinducing ingredients including chamomile, valerian root and melatonin which may help to: t'BDJMJUBUFSFMBYBUJPOXJUIPVU NPSOJOHESPXTJOFTT t.BJOUBJOTMFFQBMMOJHIU t3FEVDFBOYJFUZTZNQUPNT t*NQSPWFQBJOUPMFSBODF

For more information, visit PathIntl.org.

60 capsules: $34.99 â&#x20AC;&#x201C; shipping: $5 (up to 8 bottles) â&#x20AC;&#x201C; ORDER TODAY!

Cyndee Woolley works as an advocate for therapeutic riding centers.

$POTVMUBIFBMUIDBSFQSPGFTTJPOBMCFGPSFUBLJOHUIJTQSPEVDU1MFBTBOU%SFBNTJTOPUJOUFOEFEUPDVSF USFBU EJBHOPTFPSNJUJHBUF BOZEJTFBTFPSPUIFSNFEJDBMDPOEJUJPO5IFTFTUBUFNFOUTIBWFOPUCFFOFWBMVBUFECZUIF64'PPEBOE%SVH"ENJOJTUSBUJPO

NAWebstore.com or call 1-888-822-0246

natural awakenings

May 2014

35


businessspotlight

Live Well Chiropractic Prenatal Care through Child Development by Lucy Moorman

N

ew healthcare laws emphasize prevention and early detection of disease and offer some services at no charge, such as pap smears, mammograms, yearly physicals and colonoscopies. The theory is that if we prevent disease before it starts or catch it early on, that will save millions of lives and millions of dollars in treatment. Chiropractors have been aligned with this approach for a long time. Chiropractic care can help the body maintain homeostasis, or get it back in balance to its natural state, through adjustments that remove interference from the nervous system. Chiropractic care can also be beneficial for pregnant women and those in all the stages of child bearing, including adjustments for the baby after the birthing process. Pregnancy and childbirth take a toll on a woman’s body, and chiropractic care can ease back pain for expectant women. Dr. Kimberly Muhlenkamp, of Live Well Chiropractic, in Mason, Ohio, specializes in working with women throughout their pregnancy. Muhlenkamp utilizes a technique known as the Webster Technique, a specific chiropractic analysis and adjustment that can reduce the effects of sacral dysfunction, developed by Dr. Larry Webster. It is used for people of all ages, but is especially helpful during pregnancy. Webster developed his technique as a safe means to restore and maintain proper pelvic balance by reducing stress on the ligaments that support the uterus. This allows the baby to shift, move freely in the womb and prepare for the proper delivery position. Sacral misalignment in pregnant mothers can contribute to difficult labor and delivery, and studies show that adjusting the pelvis to correct these misalignments

36

Dr. Kimberly Muhlenkamp

decreases back labor. Muhlenkamp frequently gets referrals from midwives and OB/GYNs and maintains a thriving family practice. She enjoys helping people that recognize the value of chiropractic care, noting, “It helps the body adapt to the changes that occur during pregnancy. If you keep the body aligned and take stress off the nervous system, pregnancy can be a lot less painful and a more comfortable experience.” Chiropractic adjustments are also good for the baby after the trauma of childbirth. Muhlenkamp is no stranger to labor, having given birth to her first child just a few months ago. She says, “I adjusted my daughter on the first day of her life,” and frequently checks to see if the baby is in need of further adjustment. “Babies respond well to adjustments because they are so new, with very little stress in their bodies, as opposed to an adult with years of conditioned stress and accumulated physical injuries,” advises Muhlenkamp. “An adjustment to a baby is much different to that of an adult. Adjustments are gentle; the pressure used is comparable to that of testing the ripeness of a tomato.” Chiropractic adjustments can help children through all stages of life; from

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

the trauma of the birthing process, when they first sit up, when they first crawl and when they take their first steps, to make sure their bodies are adapting well. Regular adjustments remove interference from the nervous system, allowing the body to function at its maximum potential. From their first days as the development of the child is changing, chiropractic adjustments can improve their quality of life. For children, the frequency of adjustments depends on the individual and their activity level. If they are active in contact sports at a very young age, regular adjustments can be very beneficial. The skeletal system does not fully mature until the early 20s and the body can develop many asymmetries due to sports injuries. Muhlenkamp was exposed to chiropractic very early in life and has been getting adjustments since she was a child. At 6 months of age, she was diagnosed with torticollis, a painfully twisted and tilted neck. After a few visits to the family chiropractor, she was restored to good health. Muhlenkamp entered the chiropractic field via a side door five years ago. As a biomedical engineer sitting at a computer designing surgical tools for knee replacements, she realized she would rather be working with people toward the prevention of requiring knee replacements and chose chiropractic. She is passionate about prevention and wellness and shares, “If you keep the body healthy and in balance, you will have better quality of life, with fewer injuries and hospital visits.” Muhlenkamp believes in maintaining wellness instead of reacting to an illness after it occurs. Prevention is the answer, she says, “Chiropractic should be a part of your healthy lifestyle with regular wellness adjustments.” Location: 6860 Tylersville Rd., Ste. 7, Mason, OH. For more information, email Info@ LiveWellCC.com, call 513285-7482, or visit LiveWellCC.com. See ad, page 31. Lucy Moorman is a writer/reviewer, photographer and massage therapist. Contact her at LucyMoorman1. blogspot.com.


Iridology as a Diagnostic Tool by Victoria Smith

I

ridology is an alternative diagnostic technique that compares colors, patterns and various other characteristics of the iris (colored area of the eye surrounding the pupil) to gather information about the overall health of its owner. Practitioners often take detailed photographs or use high-tech viewers to magnify their view of each iris so that they can then compare it to a set of standard iris reference charts. These charts are divided into zones representing specific areas and organs of the body. When an experienced iridology practitioner compares the patient’s iris to the charts, distressed systems and organs can be identified by changes in colors and patterns. Healthy systems can be distinguished from those that are stressed, subject to nutritional deficiencies or not working to full capacity. Often, a practitioner can assess a patient’s susceptibility to future health problems allowing one to take steps to avoid future issues. Conventional medical testing often reveals no illness or disease, but a patient may still feel overtired, stressed, have digestive disturbances or feel generally unwell.

An iridology analysis can identify weaknesses or hyperactivity in the body while also revealing individual physical traits and information about health that was previously unexplained. Iridology was brought to prominence in the 1952 book, The Science and Practice of Iridology, by Bernard Jensen, DC, Ph.D., which provided detailed charts, drawings and photographs of the iris that reflect the status of tissues and organs in the body. His work indicated that body conditions translate into noticeable changes in the appearance of the iris. While the practice is not generally supported by conventional practitioners, the International Iridology Practitioners Association, started in 1982, has grown considerably, uniting iridology

practitioners and furthering education about the practice through education and worldwide annul symposiums. Iridology is not a restorative therapy; it does not cure and it does not pinpoint a particular disease or illness. Rather, it provides information to determine a general state of health, as well as genetic strengths and weaknesses and the level of environmental stress that the body may be experiencing. For this reason, it is important to work with an iridologist that is also a certified natural health practitioner to provide guidance in restoring the body’s natural balance. While iridology is not a definitive science, it is another tool in a wellarmed health practitioner’s toolbox. Victoria Smith is a certified natural holistic health care professional, with a master’s degree in holistic iridology. Her practice is located in Florence, Victoria Smith KY, and online. For more information, call 859-282-0022 or visit SignificantHealing.com. See ad on page 2.

)ROORZXVRQ)DFHERRN

RI*UHDWHU&LQFLQQDWL 1RUWKHUQ.HQWXFN\

#)DFHERRNFRP1DWXUDO&LQFL

*RJUHHQDQGVLJQXS IRUDGLJLWDOFRS\DW 1DWXUDO&LQFLFRP

&RQWDFW&DURO#1DWXUDO&LQFLFRPWROHDUQPRUHDERXWRXUHIIHFWLYHDQGDIIRUGDEOHPDUNHWLQJ SURJUDPVRXWRIUHDGHUVEX\WKHSURGXFWVDQGVHUYLFHVIURPDGVVHHQLQ1DWXUDO$ZDNHQLQJV

IHHOJRRG‡OLYHVLPSO\‡ODXJKPRUH

natural awakenings

May 2014

37


Publish a Natural Awakenings Magazine in Your Community Share Your Vision and Make a Difference t.FBOJOHGVMNew Career t-PX*OJUJBM*OWFTUNFOU t1SPWFO#VTJOFTT4ZTUFN t)PNF#BTFE#VTJOFTT t&YDFQUJPOBM'SBODIJTF 4VQQPSU5SBJOJOH

Natural Awakenings is now expanding into new markets across the U.S. Contact us about starting a magazine in your community or you may wish to purchase one of our existing publications (see below). Natural Awakenings publishes in over 88 markets across the U.S. and Puerto Rico. r #JSNJOHIBN "-

r )VETPO$PVOUZ /+

r )VOUTWJMMF "-

r .FSDFS$PVOUZ /+

r .PCJMF#BMEXJO "-

r .PONPVUI 0DFBO /+

r -JUUMF3PDL )PU4QHT "3

r /PSUI$FOUSBM/+

r 5VDTPO ";

r 4PVUI/+

r &BTU#BZ"SFB $"

r 4BOUB'F"CR /.

r 4BO%JFHP $"

r -BT7FHBT /7

r %FOWFS#PVMEFS $0 r "MCBOZ /: r 'BJSÃ FME$PVOUZ $5

r $FOUSBM/:

r )BSUGPSE $5

r -POH*TMBOE /:

r /FX)BWFO .JEEMFTFY $5

r .BOIBUUBO /:

r 8BTIJOHUPO %$

r 3PDLMBOE 0SBOHF /:

r %BZUPOB7PMVTJB 'MBHMFS '-

r 8FTUDIFTUFS 1VUOBN$PT /:

r /8'-&NFSBME $PBTU

r $FOUSBM0)

r 'U-BVEFSEBMF '-

r 5PMFEP 0)

r +BDLTPOWJMMF 4U"VHVTUJOF '-

r 0LMBIPNB$JUZ 0,

r .FMCPVSOF7FSP 'r .JBNJUIF 'MPSJEB,FZT r /BQMFT'U.ZFST 'r /PSUI$FOUSBM'- r 0SMBOEP '-

As a Natural Awakenings publisher, you can enjoy learning about healthy and joyous living while working from your home and earn a good income doing something you love! No publishing experience is necessary. Youâ&#x20AC;&#x2122;ll work for yourself but not by yourself. We offer a complete training and support system that allows you to successfully publish your own magazine. To determine if owning a Natural Awakenings is right for you and your target community, call us at:

239-530-1377 or visit Greater Cincinnati/Northern Kentucky Edition 38 NaturalAwakeningsMag.com/mymagazine

NaturalCinci.com

r /PSUI/+

r 1IPFOJY ";

r $JODJOOBUJ 0)

r 1PSUMBOE 03 r #VDLT.POUHPNFSZ $PVOUJFT 1" r )BSSJTCVSH:PSL 1" r -BODBTUFS 1" r -FIJHI7BMMFZ 1"

r 1BMN#FBDI '-

r 1PDPOP 1" 8BSSFO$P /+

r 1FBDF3JWFS '-

r 3IPEF*TMBOE

r 4BSBTPUB '-

r $IBSMFTUPO 4$

r 5BNQB4U1FUF '-

r $PMVNCJB 4$

r '-T5SFBTVSF$PBTU

r (SBOE4USBOE 4$

r "UMBOUB ("

r (SFFOWJMMF 4$

r $IJDBHP *-

r $IBUUBOPPHB 5/

r *OEJBOBQPMJT */

r ,OPYWJMMF 5/

r #BUPO3PVHF -"

r .FNQIJT 5/

r -BGBZFUUF -"

r /BTIWJMMF 5/

r /FX0SMFBOT -"

r "VTUJO 59

r #PTUPO ."

r %BMMBT.FUSPQMFY 59

r "OO"SCPS .*

r %BMMBT'8.FUSP/

r &BTU.JDIJHBO

r )PVTUPO 59

r 8FTUFSO.*

r 4BO"OUPOJP 59

r 8BZOF$PVOUZ .*

r 3JDINPOE 7"

r .JOOFBQPMJT ./

r 7"T#MVF3JEHF

r "TIFWJMMF /$

r 4FBUUMF 8"

r $IBSMPUUF /$

r .BEJTPO 8*

r -BLF/PSNBO /$

r .JMXBVLFF 8*

r 5SJBOHMF /$

r 1VFSUP3JDP

r $FOUSBM /+

&YJTUJOHNBHB[JOFT GPSTBMF




wisewords

With your busy schedule, how do you find time to work out and stay in shape? I think it’s been about momentum. I had the good fortune of training and eating well since I went off to play volleyball in college. That sort of steam made it easier as I added work, a partner and children. I think it’s more difficult for women that don’t have that experience. When they enter “the real world” and add a big career or long hours, a partner or family, it becomes difficult to establish that grounding in healthy practices. You have to create the environment in which you are going to succeed. That takes years. At some point, you have to be honest with yourself. For me, I know I won’t get exercise or anything else done if I stay home. There are some things I can go to a gym to do that I can also do at home but know I won’t, so it’s about creating an environment that activates good intentions.

Volleying Life Gabrielle Reece on Her Balancing Act by Christine MacDonald

G

abrielle Reece has been called one of the world’s most influential women in sports and one of its most beautiful athletes. In her 20s, she built a career as both a fiercely competitive pro volleyball player and a fashion model. Since then, she’s written books and become an expert on women’s peak fitness and overall well-being, all while raising three daughters with her husband, Hawaiian surfer Laird Hamilton. Plus, she volunteers for environmental organizations such as the National Resources Defense Council and RainCatcher, a nonprofit bringing safe drinking water to people in need.

How do you choose to expend your volunteer efforts?

take your kids and you’ll take theirs. I think that is an underutilized tool. I always encourage women to approach life with a strategy and use each other to help navigate it, because that makes it a little easier.

How do you find time for and balance all the roles you play in life—athlete, spouse, parent, businesswoman and volunteer?

Which role is most important to you and where does selfcare fit in?

Juggling life is hard for everyone. Living day-to-day, taking care of kids and paying bills is a challenge. There are ways to make it all more manageable, but for me, there is a level of discomfort, challenge and difficulty, as well as moments of joy. I think women are sometimes thrown off-balance by some difficulty, instead of saying, “OK, how am I going to strategize and make it all work for me and my family?” We don’t give enough credit to having great girlfriends. I don’t mean people you go to lunch with—I mean real allies. People that give you good advice and are strong for you, that will

At this time in my life, being a mother is the most important. When my girls are older and more independent, then their demands on my time will lessen. But I don’t think I’d ever blindly put one role over the other, because they are all connected. I just approach them with different parts of my personality. My work is intellectual, while being a mom is instinctual. Being in a relationship is a whole other ball of wax that I approach with the same diligence. Taking care of myself is at the center because I wouldn’t be able to do anything successfully if I am not well myself.

Laird and I are usually quick to be on board with anything that involves the environment and people. These causes are near and dear to everybody, but make special sense for us, given the amount of time we have lived and worked outside.

As a mother, do you feel a special concern for being a good environmental steward? I felt this way even before I had children because I had the luxury of playing beach volleyball. I grew up in the Caribbean and have always tried to be a benefactor of the beautiful outdoors. It adds another layer of motivation when you start thinking about your kids and the opportunities they will or will not have in their future. In Hawaii, the Polynesians traditionally didn’t believe in ownership, but in being stewards of an area. That’s how I feel about the place where we live now. The ultimate for me would be to leave it better than I found it. Christine MacDonald is a freelance journalist in Washington, D.C., whose specialties include health and science. Visit ChristineMacDonald.info.

natural awakenings

May 2014

39


Coming Next Month

BE INSPIRED This Summer Physically Emotionally

calendarofevents NOTE: All calendar events must be received via email by the 10th of the month and adhere to our guidelines. Email Carol@NaturalCinci.com for guidelines and to submit entries.

markyourcalendar (DUWK6KDUHV&6$ 1RZDFFHSWLQJPHPEHUVIRUJURZLQJ VHDVRQ86'$FHUWL¿HGRUJDQLFRYHU SURGXFHYDULHWLHV )RUPRUHLQIR(DUWK6KDUHV&6$RUJ

Spiritually

<0&$PHPEHUVQGFKLOGQRQPHPEHUV QG FKLOG<0&$ &DPS (UQVW  &DPS (UQVW5G%XUOLQJWRQ.<7RUHJLVWHU RU0\<&DPSRUJ

SATURDAY, MAY 3 THURSDAY, MAY 1 %X\$ 3LJ DQG *LYH +LP :LQJV ± 0D\  7KH )O\LQJ 3LJ 0DUDWKRQ KDV DUULYHG:KHQ \RX EX\DSLJLQWKHVWRUHZHZLOOJLYH\RXZLQJVIRU KLP 'HFRUDWH WKH ZLQJV KRZHYHU \RX OLNH ZLWK FRORUV DQG PHVVDJHV VKRZ \RXU FUHDWLYLW\ 7HQ 7KRXVDQG9LOODJHV0DGLVRQ5G&LQFLQQDWL 7HQ7KRXVDQG9LOODJHVFRP

FRIDAY, MAY 2

markyourcalendar

%OXH$VK<0&$$UWKULWLV([SR±)UHHDQGRSHQ WRWKHSXEOLF%OXH$VK<0&$<0&$'U &LQFLQQDWL &DUO+/LQGQHU<0&$<DUG6DOH±DPVHW XSDPSPVDOH7DEOHUHQWDOLVDOOSUR¿WV ZLOOEH\RXUVWRNHHS7KHSURFHHGVIURPWKHWDEOH UHQWDOV EHQH¿W WKH<0&$¶V DQQXDO VXSSRUW FDP SDLJQ&DUO+/LQGHU)DPLO\<0&$%/LQQ 6W&LQFLQQDWL<0&$   *URXS ,QWXLWLYH 5HDGLQJ ± SP :LWK /LVD 3UDWW*UDFHWUHH<RJDDQG*URZWK6WXGLR &LQFLQQDWL 'D\WRQ 5G :HVW &KHVWHU 5HJLVWHU *UDFHWUHH6WXGLRFRP

&LYLF*DUGHQ&HQWHU3ODQW SUNDAY, MAY 4 6DOH3UHYLHZ3DUW\ ,W¶VFDOOHG³WKHEHVWOLWWOHSODQWSDUW\LQWRZQ´ IRUDUHDVRQ&RPHGRZQIRUVRPH6RXWKHUQ %%4DQG¿UVWGLEVRQDQDVWRXQGLQJYDULHW\ RISODQWVEHIRUHWKHSXEOLFVDOHRQ6DWXUGD\ DQG6XQGD\GD\RIHYHQWDQGLQFOXGHV WZRGULQNWLFNHWVDQGIUHHYDOHWSDUNLQJWR KRVWDQGEHHQWHUHGIRUGUDZLQJRIDIDEXORXV HQWHUWDLQPHQWSDFNDJH

SP 7KH&LYLF*DUGHQ&HQWHU 5HDGLQJ5G&LQFLQQDWL 7LFNHWV&LYLF*DUGHQ&HQWHURUJ

To advertise or participate in our June edition, call

513-943-7323 40

< DW 'XFN &UHHN 3DUHQW¶V 1LJKW 2XW ±  SP(QMR\DQHYHQLQJRXWZKLOH\RXUFKLOGLV KDYLQJ IXQ DW WKH< FKLOG<0&$ PHPEHUV FKLOGQRQPHPEHUV7KH<DW'XFN&UHHNDQG &KLOG 'HYHORSPHQW 6HUYLFHV  .LQJVOH\ 'U &LQFLQQDWL <0&$&DPS(UQVW.LGV1LJKW2XW±SP )ULDP6DW$JUHDWFKDQFHWRJHWWKHNLGVEDFN WRFDPSWRHQMR\DTXLFNURXQGRIFDPSDFWLYLWLHV DQGIULHQGVKLSPDNLQJ&DPSHUVZLOOKDYHDSL]]D SDUW\KLNHSOD\FDPSJDPHVPDNHDV¶PRUHDQGJR WREHGZLWKVRPHFODVVLFFDPSEHGWLPHVWRULHV

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

markyourcalendar <0&$&DPS(UQVW 2SHQ+RXVH

(QMR\DQDIWHUQRRQDWFDPSZLWK\RXUIDPLO\ ([SORUHRXUDFUHVPHHWVRPHRIRXUVWDII PDNHDV¶PRUHH[SHULHQFHWKH5RFNLQ¶( 5DQFK WKHQHZKRPHIRURXUKRUVHVDQG5DQFK 3URJUDP DQGFKHFNRXWRXUFDELQVDQGGLQLQJ KDOOV1RIHHMXVWFRPHDQGJHWWRNQRZXV

SP &DPS(UQVW5G%XUOLQJWRQ.< 0\<&DPSRUJ

MONDAY, MAY 5 $ )LHVWD RI +HUEV IRU &LQFR GH 0D\R ± DP SP+HUEVRI0H[LFRDQGWKH6RXWKZHVWDUHQRW RQO\WUHQG\WKH\DUHJRRGIRU\RX-RLQWKH¿HVWDDQG OHDUQKRZWRJURZDQGFRRNZLWK0H[LFDQFXOLQDU\ KHUEV5RQZLOOSXWRQKLVSODQWGRFWRUVRPEUHURWR DQVZHUDOORI\RXUODQGVFDSHDQGJDUGHQLQJTXHV WLRQVDQG5LWDZLOOSUHSDUHDQDXWKHQWLF0H[LFDQ PHDO-XQJOH-LP¶V'L[LH+Z\)DLU¿HOG 5HJLVWHU-XQJOH-LPVFRP&RRNLQJ6FKRRO


markyourcalendar +LJK,QWHQVLW\,QWHUYDO 7UDLQLQJ +,,7

+,,7LVDQHQKDQFHGIRUPRILQWHUYDOWUDLQLQJ DQH[HUFLVHVWUDWHJ\DOWHUQDWLQJSHULRGVRIVKRUW LQWHQVHDQDHURELFH[HUFLVHVZLWKOHVVUHFRYHU\ SHULRGV+,,7H[HUFLVHVSURYLGHLPSURYHG DWKOHWLFFDSDFLW\DQGFRQGLWLRQLPSURYHG JOXFRVHPHWDEROLVPDQGKLJKHUIDWEXUQLQJ

0RQGD\V0D\-XQH SP 7UL+HDOWK)LWQHVVDQG+HDOWK3DYLOOLRQ 3IHLIIHU5G0RQWJRPHU\ )RUPRUHLQIR /HW¶V'HFOXWWHUDQG*HW2UJDQL]HG)RU6SULQJ ± SP /HDUQ 6SULQJ FOHDQLQJ VWUDWHJLHV IURP SURIHVVLRQDO RUJDQL]HU 'DUD )DLUPDQ RI 6LPSOH %HWWHU6ROXWLRQV6KHZLOOSURYLGHVLPSOHGRDEOH VXJJHVWLRQV WKDW FDQ EH LPSOHPHQWHG ULJKW DZD\ WRKHOSDWWHQGHHVWRJHWPRUHRUJDQL]HG0RQIRUW +HLJKWV %UDQFK  : )RUN 5G 5HJLVWUDWLRQ UHTXLUHG &DPS&RRNLQJ%DVLF±SP'R\RX ZDQWWRPDNHHDV\DQGIXQPHDOVDWFDPS EXWIHHOXQVXUHKRZWRFRRNWKHP":H¶GOLNHWRKHOS \RXOHDUQKRZWRVHWXS\RXUNLWFKHQDQGFUHDWHHDV\ DQGIXQPHDOVIRUWKHIDPLO\)UHH5(,&LQFLQQDWL (GPRQVRQ5G0XVWUHJLVWHU 5(,FRP6WRUHV&LQFLQQDWL (VVHQWLDO 2LOV  ± SP &RXUVH GHVLJQHG WR LQWURGXFH\RXWRDOORIWKHEHQH¿WVRIHVVHQWLDORLOV 7DNHKRPHVDPSOHVUHVRXUFHVDQGRXUH[FOXVLYH JXLGH WR HVVHQWLDO RLOV SOXV DFFHVV WR KXQGUHGV RI LQWHUYLHZV ZLWK ZRUOGUHQRZQHG HVVHQWLDO RLO SUDFWLWLRQHUV  ),7 0RQWJRPHU\  0RQW JRPHU\5G.HQZRRG)RUPRUHLQIR WRUHJLVWHU 

TUESDAY, MAY 6 6RDS 0DNLQJ  ± SP -RLQ &DULVD +XQG %XQWHQRI6HYHQWK6WUHHW*LIWVWROHDUQDERXWWKH KLVWRU\RIVRDSVDQGKRZWRPDNHVRDSEDVHV(DFK DWWHQGHHZLOOPDNHDVDPSOHVRDSWRWDNHKRPHXV LQJDVSHFLDOVRDSEDVHDQGHVVHQWLDORLOVDQG¿QH ERWDQLFDOV)UHHDOOVXSSOLHVSURYLGHG*URHVEHFN %UDQFK/LEUDU\:*DOEUDLWK5G5HJLVWUDWLRQ UHTXLUHG

WEDNESDAY, MAY 7

,QWURGXFWLRQWR6WDQG8S3DGGOHERDUG LQJ&LQFLQQDWL±SP-RLQ5(,DQG ORFDOVWDQGXSSDGGOHERDUGH[SHUW-RKQ$QWRQF]DFN DVKHLQWURGXFHVWKHEDVLFVRIVWDQGXSSDGGOHERDUG LQJDQGZKHUHWRGRLWLQWKH&LQFLQQDWLDUHD)UHH 5(,&LQFLQQDWL(GPRQVRQ5G 0XVWUHJLVWHU5(,FRP6WRUHV&LQFLQQDWL

THURSDAY, MAY 8 /RZ&RXQWU\ 6KULPS %RLO ± SP 7KH XOWLPDWHVXPPHUSDUW\H[SHULHQFH%HWKH¿UVWLQ \RXUQHLJKERUKRRGWRKRVWDWUDGLWLRQDOVKULPSERLO 3HUIHFW IRU ODLGEDFN FDVXDO HQWHUWDLQLQJ /HDUQ KRZWRSUHSDUHWKHWDEOHDQGWKHQPDNHWKLVHDV\ SUHSRQHSRWPHDOWKDWWXUQVDQRUGLQDU\VXPPHU HYHQLQJLQWRDIHVWLYHRFFDVLRQ-XQJOH-LP¶V  'L[LH +Z\ )DLU¿HOG 5HJLVWHU -XQJOH-LPV FRP&RRNLQJ6FKRRO /HXNHPLD/\PSKRPD6RFLHW\7HDPLQ7UDLQLQJ ,QIRUPDWLRQ6HVVLRQ±SP/HDUQKRZ\RX FDQUDLVHPRQH\WRZDUGVFXUHVIRUEORRGFDQFHUV ZLWK7HDPLQ7UDLQLQJ7HDPLQ7UDLQLQJKDVWUDLQHG RYHUDKDOIDPLOOLRQSHRSOHDQGUDLVHGRYHU ELOOLRQWRIXQGOLIHVDYLQJUHVHDUFK)UHH5(,&LQ FLQQDWL(GPRQVRQ5G0XVW UHJLVWHU5(,FRP6WRUHV&LQFLQQDWL :RUNVKRSVIRUWKH:RUNLQJ:RPDQ:RUN/LIH %DODQFH±SPUGLQDVHULHVRIHGXFDWLRQDO ZRUNVKRSVIRUZRPDQSURIHVVLRQDOV3UHVHQWHGE\ WKH :RPHQ¶V )LWQHVV$VVRFLDWLRQ )UHH )UHHGRP *HDU &\FOHU\  %HHFKPRQW$YH &LFQLQQDWL 5693$VKOH\#:RPHQV)LWQHVV$VVRFLDWLRQRUJ RUYLD)DFHERRNHYHQW

FRIDAY, MAY 9 +RPH6FKRRO7DNHRYHURI*UDFHWUHH±SP /HGE\(OL]DEHWK+XOVPDQ6KDQWL0RP&HUWL¿HG DQG$URPDWKHUDSLVWFKLOG*UDFHWUHH<RJDDQG *URZWK6WXGLR&LQFLQQDWL'D\WRQ5G:HVW &KHVWHU5HJLVWHU*UDFHWUHH6WXGLRFRP 5HGWUHH*DOOHU\$UW2SHQLQJ±SP&RPHWR RSHQLQJQLJKWIRUWKH³)LUVW:RUOG3UREOHPV´$UW ([KLELW(QMR\ZLQHDQGOLYHPXVLFZKLOHPHHWLQJ ORFDO DUWLVWV VKRZFDVLQJ WKHLU ZRUN ([KLELW UXQV WKUX-XQH5HGWUHH$UW*DOOHU\0DGLVRQ5G 2DNOH\

SATURDAY, MAY 10 :RUOG )DLU 7UDGH 'D\ 0RWKHU¶V 'D\ 3RWWLQJ (YHQW±%X\DSRWDQGOHWXVSODQWÃ&#x20AC;RZHUVIRU\RX $QHDV\DQGEHDXWLIXOJLIWIRUWKH0RWKHUVLQ\RXU OLIH 7HQ 7KRXVDQG 9LOODJHV  0DGLVRQ 5G &LQFLQQDWL7HQ7KRXVDQG9LOODJHVFRP

markyourcalendar 4XDQWXP7RXFK&RXUVH /HGE\&HUWL¿HG,QVWUXFWRU-XOLH(%UHQW 4XDQWXP7RXFKZRUNVGHHSRQDFHOOXODUOHYHO UDLVLQJ\RXUHQHUJ\FUHDWLQJDQHQYLURQPHQW IRUWKHLQQDWHKHDOLQJLQWHOOLJHQFHRIWKH ERG\WRDFWLYDWH$Q\RQHFDQOHDUQ47QR H[SHULHQFHQHHGHG0DVVDJHWKHUDSLVWVDQG QXUVHV&(V&1(V DGG DW GRRUSUHSDLG

0D\ DPSP +HOGLQSULYDWHKRPH/H[LQJWRQ.< 7RUHJLVWHU-XOLHRU 5HLNL&HQWHU2I)DLU+RSH#JPDLOFRP :LQHDQG)RRGIRUD6XPPHU3DUW\±SP &DURO DQG 'DYH KDYH SODQQHG DQ H[FHOOHQW PHQX WKDW¶VSHUIHFWIRUDVXPPHUSDUW\,WLVWKHVHDVRQ ¿OOHG ZLWK WKH IUHVKHVW IUXLWV DQG YHJHWDEOHV DQG WKLVPHQXFRYHULWDOO'DYHZLOOFRPSOHPHQWWKH PHDOZLWKFULVSDQGOLJKWZLQHV-XQJOH-LP¶V  'L[LH +Z\ )DLU¿HOG 5HJLVWHU -XQJOH-LPV FRP&RRNLQJ6FKRRO 6RDS0DNLQJ:RUNVKRS±SP-RLQ&DULVD+XQG %XQWHQRI6HYHQWK6WUHHW*LIWVWROHDUQDERXWWKH KLVWRU\RIVRDSVDQGKRZWRPDNHVRDSEDVHV(DFK DWWHQGHHZLOOPDNHDVDPSOHVRDSWRWDNHKRPHXV LQJDVSHFLDOVRDSEDVHDQGHVVHQWLDORLOVDQG¿QH ERWDQLFDOV)UHHDOOVXSSOLHVSURYLGHG+\GH3DUN %UDQFK/LEUDU\(ULH$YH (YHU\GD\,QVSLUDWLRQLQ0RGHUQ4XLOWV±SP -RLQ+HDWKHU-RQHVIURP2OLYHDQG2OOLH0RGHUQ 4XLOWLQJDQG'HVLJQIRUDQH[FLWLQJORRNDWKRZ VRPHRIWRGD\¶VTXLOWHUVDUH¿QGLQJLQVSLUDWLRQIURP MXVWDERXWDQ\ZKHUHDQGHYHU\ZKHUHIURPDSDUNLQJ

This Way to Pain Relief Natural Awakenings

NEW Natural Pain Relief STOPS PAIN PLUS can quickly relieve:

0RWKHU¶V'D\%UXQFK&RRNLQJ'HPRQVWUDWLRQ± VHVVLRQVSP SP-RLQUHJLVWHUHGGLHWLWLDQ .DWK\+DXJHQDVVKHVKDUHVZRQGHUIXOEUXQFKUHFL SHVDQGGHOLFLRXVVDPSOHV:HZLOOVHWWKHWDEOHDQG SDPSHU\RXIRUDOLWWOHWDVWHRI0RWKHU¶V'D\)UHH PHPEHUVQRQPHPEHUV7UL+HDOWK)LWQHVVDQG +HDOWK 3DYLOOLRQ  3IHLIIHU 5G 0RQWJRPHU\ 7RUHJLVWHU

t"SUISJUJT t/FVSPQBUIZ t#BDL1BJO t/FDL1BJO t)BOE1BJO t,OFF1BJO t'PPU1BJO t4UJOHT t$BSQBM5VOOFMt'JCSPNZBMHJB t4DJBUJDB t5FOEPOJUJT t)FBEBDIFT t$SBNQT t4QPSUT*OKVSJFTNVDINPSF

)LQG<RXU:D\WR)ODYRU6HULHV±SP6SLFH XS\RXUVSULQJZLWK/DXUHQ$EHORZQHURI$EHOWR &RRNSHUVRQDQ\FODVVHVLQWKHVHULHV 7KH6SLFHDQG7HD([FKDQJH(GPRQVRQ5G 5RRNZRRG5693RU&LQFLQQDWL# 6SLFH$QG7HDFRP

t4UJNVMBUF&OFSHZt*ODSFBTF$JSDVMBUJPO t%FUPYJGZ3FWJUBMJ[F4PSF+PJOUT .VTDMFT5FOEPOT t1SPNPUFB)FBMUIJFS2VBMJUZPG-JGF

STOPS PAIN PLUS also helps to:

/088*5) Hemp & Sea Buckthorn Oils

19.99 â&#x20AC;&#x201C; 8-oz spray $34.99 â&#x20AC;&#x201C; shipping $5/up to 8 bottles

4-oz spray $

Wholesale pricing available for stores and practitioners

Shop online today at NAWebstore.com or call: 888-822-0246 natural awakenings

May 2014

41


ORWWRDZRUNVRI¿QHDUWDQGHYHU\WKLQJLQEHWZHHQ /RYHODQG%UDQFK/LEUDU\/RYHODQG0DGLHUD 5G5HJLVWUDWLRQUHTXLUHG

MONDAY, MAY 12 :KLFK:HHG,V,W"±SP-RLQ&DUROIURP*OHQ ZRRG*DUGHQVDQGOHDUQWRLGHQWLI\FRPPRQZHHGV 1RUHJLVWUDWLRQUHTXLUHG*UHHQKLOOV%UDQFK/LEUDU\ (QGLFRWW6W <HDU5RXQG*DUGHQLQJ±SP/HDUQQHZLGHDV IRUSODQWLQJDQGPDLQWDLQLQJ\RXUJDUGHQWKURXJKRXW WKH\HDUIURPWKHVWDIIRI:KLWH2DN*DUGHQ&HQWHU 0RQIRUW+HLJKWV%UDQFK/LEUDU\:HVW)RUN 5G5HJLVWUDWLRQUHTXLUHG 0DQLIHVW<RXU+DSSLHVW/LIH±SP/HDUQ WRROV WR FUHDWH WKH OLIH \RX GHVLUH MXVW ³DVN´ DQG ³DOORZ´  :KDWHYHU :RUNV :HOOQHVV &HQWHU 0RQWJRPHU\5G5HJLVWHU :HOOQHVV ,QYHQWRU\ ± SP 6WUHQJWKHQ WKH  GLPHQVLRQV RI SK\VLFDO PHQWDO HPRWLRQDO DQG VSLULWXDO ZHOOQHVV 5HFHLYH WKH WRROV WR WUDQVIRUP DZDUHQHVVLQWRODVWLQJOLIHVW\OHFKDQJHDQGDKHLJKW HQHGVHQVHRIKHDOWKDQGZHOOEHLQJ)LUVWWLPH DWWHQGHHV LQFOXGHV ZKROH SHUVRQ DVVHVVPHQW  RU  UHWXUQLQJ DWWHQGHHV ),7 0RQWJRPHU\  0RQWJRPHU\ 5G .HQZRRG 5HJLVWHU  RU([SHULHQFH&UHDWH6XVWDLQFRP

TUESDAY, MAY 13 6RDS 0DNLQJ  ± SP -RLQ &DULVD +XQG %XQWHQRI6HYHQWK6WUHHW*LIWVWROHDUQDERXWWKH KLVWRU\RIVRDSVDQGKRZWRPDNHVRDSEDVHV(DFK DWWHQGHHZLOOPDNHDVDPSOHVRDSWRWDNHKRPHXV LQJDVSHFLDOVRDSEDVHDQGHVVHQWLDORLOVDQG¿QH ERWDQLFDOV)UHHDOOVXSSOLHVSURYLGHG*URHVEHFN %UDQFK/LEUDU\:*DOEUDLWK5G5HJLVWUDWLRQ UHTXLUHG

WEDNESDAY, MAY 14 $ERXW )DFH ± SP 'LVFRYHU KRZ WR EHVW FDUH IRU \RXU VNLQ ¿QG RXW KRZ SURSHU QXWULWLRQ HQKDQFHV VNLQ IURP WKH LQVLGH RXW DQG OHDUQ WKH ODWHVWVNLQFDUHWLSVIURPRXUYHU\RZQH[SHUWV PHPEHUVQRQPHPEHUV7UL+HDOWK)LWQHVVDQG +HDOWK 3DYLOOLRQ  3IHLIIHU 5G 0RQWJRPHU\ 7RUHJLVWHU *HWWLQJ WR .QRZ<RXU *R3UR *R3UR %DVLFV±SP/RRNLQJWRJHWD*R3UR RU\RXKDYHRQHDQGZRXOGOLNHVRPHLQVLJKWLQWR WKH EHVW SUDFWLFHV IRU FDSWXULQJ \RXU OLIH¶V PRVW H[FLWLQJPRPHQWV"-RLQRXU*R3URH[SHUWVDQGJHW WRNQRZ\RXU*R3UR)UHH5(,&LQFLQQDWL (GPRQVRQ5G0XVWUHJLVWHU5(, FRP6WRUHV&LQFLQQDWL 6KRS6PDUW7RXU±SP-RLQ&HUWL¿HG+HDOWK &RDFK 5HEHFFD 0F*UDQH DV VKH DUPV \RX ZLWK VPDUWZD\VWRQDYLJDWHWKHJURFHU\VWRUHDQGFKRRVH IRRGV WKDW ZLOO KHOS \RX RQ WKH URDG WR RSWLPDO KHDOWK ),7 0RQWJRPHU\  0RQWJRPHU\ 5G )RUPRUHLQIR WRUHJLVWHUFDOORU 6KRS6PDUW7RXUVFRP

THURSDAY, MAY 15 1DWLRQDO&KRFRODWH&KLS'D\±6WRSE\WKHVWRUH IRUDWUHDW7HQ7KRXVDQG9LOODJHV0DGLVRQ 5G&LQFLQQDWL7HQ7KRXVDQG9LOODJHVFRP +DQGV2Q /HDUQ WR 0DNH *ULOOHG 3L]]D ± SP *HW D ¿UVWKDQG H[SHULHQFH RQ KRZ WR PDNHWKLVVXEOLPHGLVKFULVSRQWKHRXWVLGHZLWKD FKHZ\LQWHULRU7KHGRXJKLVDVQDSWRPDNHDQGLV

42

WKHSHUIHFWPHDORQDZDUPVXPPHUHYHQLQJ$IWHU \RXKDYHWULHG-DQHWDQG&DURO¶VWHFKQLTXH\RX¶OO QHYHUHDWGHOLYHUHGSL]]DDJDLQ-XQJOH-LP¶V  'L[LH +Z\ )DLU¿HOG 5HJLVWHU -XQJOH-LPV FRP&RRNLQJ6FKRRO 7DL&KL&ODVV±SPZNOHYHORQHFODVV'RQ¶W OHWWKH³OHYHORQH´IRRO\RXWKLVLVD³PDVWHUFODVV´ RIERG\PHFKDQLFVPRYHPHQWDQGKHDOLQJWKDWLV GHVLJQHGIRURXWRIVKDSHEHJLQQHUV\HWVWLOOFKDO OHQJHV WKH ¿WQHVV HQWKXVLDVW &KDQJH \RXU ERG\ H[SDQG\RXUSHUFHSWLRQHOLPLQDWHDQGFRQWURO\RXU VWUHVV :KLWH :LOORZ 6FKRRO RI 7DL &KL4LJRQJ 0RQWJRPHU\5G&LQFLQQDWL5HJLVWHU :KLWH:LOORZ7DL&KLFRP

FRIDAY, MAY 16 0HHWWKH'RXODV±SP/HGE\(ULFD.RQ\D &HUWL¿HG'RXODDQG&KLOGELUWK(GXFDWRU*UDFHWUHH <RJDDQG*URZWK6WXGLR&LQFLQQDWL'D\WRQ 5G:HVW&KHVWHU5HJLVWHU*UDFHWUHH6WXGLRFRP &OHUPRQW<0&$)DPLO\0RYLH1LJKW±SP7KH IHDWXUHPRYLHLV0RQVWHU¶V8QLYHUVLW\%ULQJ\RXU SLOORZVDQGEODQNHWVIRUDIDPLO\VW\OHYLHZLQJ:H ZLOOPDNHWKHSRSFRUQ)UHHDQGRSHQWRWKHFRP PXQLW\ &OHUPRQW &RXQW\<0&$  -DPHV ( 6DXOV6U'U%DWDYLD

SATURDAY, MAY 17 &DUO+/LQGQHU<0&$*2&LQFLQQDWL±DP SP(QMR\³)DPLO\)XQDQG)LWQHVV´7KH<LV SDUWQHULQJZLWK&URVVURDGV&KXUFKIRUWKHDQ QXDO*R&LQFLQQDWL(YHQW+HDOWK\IRRGDQGGULQNV SURYLGHGDQGWKHUHZLOOEHPXVLFOLYHSHUIRUPDQFHV DQGIDPLO\RULHQWHGDFWLYLWLHV)UHHDQGRSHQWRWKH SXEOLF&DUO+/LQGQHU)DPLO\<0&$%/LQQ 6W&LQFLQQDWL<0&$ &RPPXQLW\ 3ODQW 6ZDS ± SP &DOOLQJ DOO JDUGHQHUV %ULQJ SODQWV WR VZDS DQG JHW VRPH LQ UHWXUQ 3OHDVH EULQJ SODQWLQJ LQVWUXFWLRQV 3OHDV DQW5LGJH%UDQFK/LEUDU\0RQWJRPHU\5G  3HUHQQLDO 3ODQW ([FKDQJH ± SP +DYH \RXU KRVWDVJRQHFUD]\"'R\RXUGD\OLOLHVQHHGGLYLG LQJ"$UH\RXUEODFNH\HG6XVDQ¶VVSUHDGLQJDWDQ DODUPLQJUDWH"3XOOWKHPRXWEULQJWKHPLQDQGVZDS WKHPIRUVRPHWKLQJQHZ%ULQJLQ\RXUSHUHQQLDOV WRH[FKDQJHIURPDPSP0D\7KHQFRPH EDFN WR ¿QG VRPHWKLQJ QHZ RQ 6DWXUGD\ 1RUWK &HQWUDO %UDQFK /LEUDU\  +DPLOWRQ$YH 

SUNDAY, MAY 18 %H6WLOO0HGLWDWLRQ:RUNVKRS±SP/HG E\ 5HQHH *URHQHPDQQ  *UDFHWUHH<RJD DQG *URZWK6WXGLR&LQFLQQDWL'D\WRQ5G:HVW &KHVWHU5HJLVWHU*UDFHWUHH6WXGLRFRP 0DNH<RXU2ZQ6SD3URGXFWV±SP /HDUQ KRZ WR PDNH D &RFRQXW 7HD %RG\ 6FUXE WRGD\WRXVHWRQLJKW%\LQIXVLRQRIVW\OHV+LJKHU %UDQFKHV  0DLQ 6W &LQFLQQDWL 7R UHJLVWHU  ,URQ0DQ 0HGLWDWLRQ 0HHWXS ± SP /HG E\ 5HQHH *URHQHPDQQ  GRQDWLRQ UHFRP PHQGHG*UDFHWUHH<RJDDQG*URZWK6WXGLR &LQFLQQDWL'D\WRQ 5G :HVW &KHVWHU 5HJLVWHU *UDFHWUHH6WXGLRFRP

MONDAY, MAY 19 &RXSRQ&OLSSHUV±SP-RLQ6KHUUL3HDNWRVZDS FRXSRQVDQGVKDUHWLSVRQVDYLQJPRQH\LQDFDVXDO

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com

JURXSVHWWLQJ&OLSSLQJFRXSRQVLVIXQDQGHDV\%HD VPDUWVKRSSHU+DUULVRQ%UDQFK/LEUDU\1HZ +DYHQ5G5HJLVWUDWLRQUHTXLUHG 0RYH:DVWHIURP<RXU:DLVW±SP:DLVWVL]HLV DVWURQJLQGLFDWRURIRXURYHUDOOKHDOWK7KLVSK\VL FLDQGHYHORSHGFODVVWHDFKHV\RXKRZWRVWRSWR[LF ZDLVWDQGHOLPLQDWHWKHKHDOWKKDUPLQJFKHPLFDOV SURGXFHGE\EHOO\IDWLQFOXGHVZRUNERRN),7 0RQWJRPHU\  0RQWJRPHU\ 5G .HQZRRG 5HJLVWHURU6WRS7R[LF:DLVWFRP

TUESDAY, MAY 20 6KRS6PDUW7RXU±SP-RLQ&HUWL¿HG+HDOWK &RDFK 5HEHFFD 0F*UDQH DV VKH DUPV \RX ZLWK VPDUW ZD\V WR QDYLJDWH WKH JURFHU\ VWRUH DQG FKRRVHIRRGVWKDWZLOOKHOS\RXRQWKHURDGWRRS WLPDOKHDOWK),70RQWJRPHU\0RQWJRPHU\ 5G)RUPRUHLQIR WRUHJLVWHURU 6KRS6PDUW7RXUVFRP

WEDNESDAY, MAY 21 &OLSSDUG<0&$6HQLRU+HDOWKDQG)LWQHVV([SR ±DPSP$IXQHGXFDWLRQDODQGLQVSLUDWLRQDO GD\DWWKH&OLSSDUG<0&$)UHHDQGRSHQWRWKH SXEOLF&OLSSDUG)DPLO\<0&$&KHYLRW5G &LQFLQQDWL  )RU PRUH LQIR 1RUD 'DVKHO\RU1'DVKOH\#0\<RUJ +HDOWK\6KRXOGHUV±SP7KHVKRXOGHUFRPSOH[ LVGHVLJQHGIRUPRELOLW\DOORZLQJXVWRUHDFKLQDOO GLUHFWLRQV0DLQWDLQLQJKHDOWK\VKRXOGHUVZLOOLP SURYH\RXUSRVWXUHDVZHOODVNHHS\RXUQHFNSDLQ IUHH/HDUQH[HUFLVHVWRNHHSWKHVKRXOGHUVPRYLQJ WKURXJKWKHLULQWHQGHGUDQJHRIPRWLRQ/HDUQZD\V WRKHOSVWUHQJWKHQWKHURWDWRUFXIIPXVFOHVZKLFK KHOSWRVWDELOL]HWKHDUPDVLWPRYHVLQDOOGLUHFWLRQV )LWQHVV3K\VLTXHV.HQZRRG5G%OXH $VK )HVWLYDOV DQG )UROLFV ± SP -RLQ &KHUL %ULQN PDQDXWKRURI&LQFLQQDWLDQG6RXS)HVWLYDOVDQG )UROLFV DQG H[SORUH WKH JUHDW &LQFLQQDWL IHVWLYDO HYHQWVEHJLQQLQJZLWKRQHRIWKHHDUOLHVW6W5LWD¶V  WRWKHHYHUSRSXODU2NWREHUIHVWV*RHWWD)HVW 3DQHJ\ULHWFDVZHOODVRWKHUDUHDIDYRULWHVOLNHWKH &RXQWU\$SSOH)HVWLYDODQGWKH%OXHVDQG%DUEHTXH )HVWLYDOLQ/HEDQRQ$IXQWULSGRZQPHPRU\ODQH ZLWKGHWDLOVRQWKHHYHUSRSXODUUHFLSHVJHQHUDWHG IURPWKHVHHYHQWV*UHHQ7RZQVKLS%UDQFK/LEUDU\ %ULGJHWRZQ5G

THURSDAY, MAY 22 (GQD 5XWK %\OHU¶V %LUWKGD\ ± 0D\  :H ZLOOEHFHOHEUDWLQJ(GQD¶VOLIH(GQDVWDUWHGZRUN LQJ ZLWK DUWLVDQV LQ  +HU YLVLRQ DQG OLIH¶V ZRUNHYHQWXDOO\EHFDPHNQRZQDV7HQ7KRXVDQG 9LOODJHV :H ZLOO KDYH GHOLFLRXV KRPHPDGH FLQQDPRQ UROOV WR FHOHEUDWH 7HQ 7KRXVDQG 9LO ODJHV0DGLVRQ5G&LQFLQQDWL7HQ7KRXVDQG 9LOODJHVFRP 7LSVIURPD6HDVRQHG7UDYHOOHU±SP:DQWWRVHH WKHZRUOG"<RXFDQ/HDUQWRSODQIRUWUDQVSRUWDWLRQ ORGJLQJSDFNLQJLWLQHUDULHVDQGPRUH7UDYHOH[SHUW DQGJOREHWURWWLQJHQWKXVLDVW.HWNL0RG\RI([FHO 7RXUVDQG7UDYHOVVKDUHVKHUEHVWDGYLFHRQKRZWR JHWWKHPRVWRXWRI\RXULQWHUQDWLRQDOWUDYHOH[SHUL HQFH6KDURQYLOOH%UDQFK/LEUDU\7KRUQYLHZ 'U .LUWDQZLWK&DQDGLDQ$UWLVW-LP*HOFHU±SP DGYDQFH DW GRRU ,W¶V<RJD  /XGORZ $YH&OLIWRQ)RUPRUHLQIR-LP*HO FHU.LUWDQFRPRU<RJD*DUDJHFRP


SATURDAY, MAY 24 2XWGRRU 3RROV 2SHQ DW DOO<0&$ RI *UHDWHU &LQFLQQDWL%UDQFKHV±&RPHMRLQXVWRJHW\RXU VXPPHURQ)RUPRUHLQIR<0&$

markyourcalendar /RFDO)HVW &HOHEUDWLQJORFDOIRRGDUWDQGPXVLFWKH IHVWLYDOLQVSLUHGGD\IHDWXUHVWKHDUWZRUNRI ORFDODUWLVDQVDQGWKHLUZDUHVELWHVDQGOLJKW IDUHIURPRUJDQLFDQGORFDOIRRGYHQGRUVDQG WKHORFDOEOXHJUDVVEDQG&RPHW%OXHJUDVV$OO 6WDUV)UHHZLWKQRPLQDOSDUNLQJIHH

SP *UDLOYLOOH5HWUHDWDQG3URJUDP&HQWHU 2¶%DQQRQYLOOH5G/RYHODQG )RUPRUHLQIRRU*UDLOYLOOHRUJ &DUO + /LQGQHU<0&$ SUHVHQWV WKH &LQFLQ QDWL 3OD\KRXVH ± SP ³7KH 6KRUW 7UHH DQG WKH %LUG7KDW&RXOG1RW6LQJ´DSOD\SURGXFWLRQE\ 6ZHHW6LVWDK6SODVKDQGWKH&LQFLQQDWL3OD\KRXVH $GPLVVLRQIUHHDQGRSHQWRWKHFRPPXQLW\&DUO+ /LQGQHU)DPLO\<0&$%/LQQ6W&LQFLQQDWL <0&$

MONDAY, MAY 26 7RXULQJWKH1DWFKH]7UDFH±SP -RLQ&LQFLQQDWL¶VRZQ5(,VSHFLDOLVWDVVKH WDNHV\RXWKURXJKKHUWRXURIWKH1DWFKH]7UDFHDQG SURYLGHVWLSVRQSODQQLQJ\RXURZQWULS)UHH5(, &LQFLQQDWL  (GPRQVRQ 5G  0XVWUHJLVWHU5(,FRP6WRUHV&LQFLQQDWL )RRG 0L[RORJ\ ± SP &HUWL¿HG +HDOWK &RDFK 5HEHFFD 0F*UDQH HPSRZHUV \RX ZLWK WKH H[DFW IRUPXODWRDFKLHYHQXWULWLRQDOHQGXUDQFHDQGZHLJKW ORVV&ODVVIHDWXUHVQXWULHQWGHQVHYHJDQQXWIUHH UHFLSHV  ),7 0RQWJRPHU\  0RQWJRP HU\ 5G .HQZRRG 5HJLVWHU  RU )RRG0L[RORJ\FRP

TUESDAY, MAY 27 5& 'XUU<0&$ 6HQLRU +HDOWK DQG )LWQHVV ([SR±DPSP$IXQHGXFDWLRQDODQGLQVSLUD WLRQDOGD\DWWKH5&'XUU<0&$)UHHDQGRSHQWR WKHSXEOLF5&'XUU<0&$9HWHUDQV:D\ %XUOLQJWRQ.<

markyourcalendar

GHVLJQHGIRURXWRIVKDSHEHJLQQHUV\HWVWLOOFKDO OHQJHV WKH ¿WQHVV HQWKXVLDVW &KDQJH \RXU ERG\ H[SDQG\RXUSHUFHSWLRQHOLPLQDWHDQGFRQWURO\RXU VWUHVV :KLWH :LOORZ 6FKRRO RI 7DL &KL4LJRQJ 0RQWJRPHU\5G&LQFLQQDWL5HJLVWHU :KLWH:LOORZ7DL&KLFRP

SATURDAY, MAY 31 6XPPHU &HOHEUDWLRQ ± DPSP &KLOGUHQ¶V &DUQLYDO FHQWVHDFKJDPH WRUDLVHPRQH\IRUWKH 'UDJRQÃ&#x20AC;\)RXQGDWLRQ+HDOWK\6ROXWLRQVDQGVXU URXQGLQJEXVLQHVVHV&ROXPELD5G/RYHODQG )RUPRUHLQIR'DQLHOOH +DQGV2Q9HJHWDULDQ,QGLDQ&XUULHV±DP SP,I\RXHQMR\WKHFRPSOH[FRPELQDWLRQRI VSLFHV MRLQ 0DGKX IRU D IRUD\ LQWR WKH ZRUOG RI ,QGLDQFXUULHV0DGKXVKDUHVKHUH[WHQVLYHNQRZO HGJH RI DQG ORYH IRU VDYRU\ FXUU\ GLVKHV  -XQJOH-LP¶V'L[LH+Z\)DLU¿HOG5HJLVWHU -XQJOH-LPVFRP&RRNLQJ6FKRRO 6SULQJ 3ODQW ([FKDQJH ± SP %ULQJ \RXU XQZDQWHGDQGH[FHVVSODQWVWRWKHOLEUDU\DQGH[ FKDQJHWKHPZLWKIHOORZJDUGHQHUV0DGLHUD%UDQFK /LEUDU\  0LDPL$YH 5HJLVWUDWLRQ UHTXLUHG 

plan ahead SATURDAY, JUNE 28

markyourcalendar QG$QQXDO)LWQHVV7KURZ 'RZQDQG6\PSRVLXP +RVWHGE\7KH:RPHQ¶V)LWQHVV$VVRFLDWLRQ WKLVHYHQWLVDFRPSHWLWLRQRIWKHWRS¿WQHVV LQVWUXFWRUVLQWKH*UHDWHU&LQFLQQDWLDUHD ZKHUHWKH¿WQHVVSDUWLFLSDQWFKRRVHVWKHEHVW LQVWUXFWRU3DUWLFLSDQWVZKRSUHUHJLVWHUJHWWR WDNHXSWR¿YHPLQXWHH[HUFLVHFODVVHVDQG RUOHFWXUHVDORQJZLWKQHWZRUNLQJZLWKYHQGRUV NH\QRWHVSHDNHUDQGDOXQFKHRQ$OO¿WQHVV OHYHOVZHOFRPHDQGLVIRUERWKPHQDQGZRPHQ

DPSP )LYH6HDVRQV6SRUWV&OXE 6Q\GHU5G&LQFLQQDWL )RUPRUHLQIR:RPHQV)LWQHVV$VVRFLDWLRQRUJ RU/LVD#:RPHQV)LWQHVV$VVRFLDWLRQRUJ

classifieds Fee for classifieds is $20 per month for up to 20 words. Each additional word is $1 per month. To place listing, email content to Carol@NaturalCinci.com. Deadline is the 10th of the month.

HELP WANTED .$50$ :(//1(66 678',2 ± 6HHNV D SURIHVVLRQDONQRZOHGJHDEOHDQGFRPSDVVLRQDWH /07$FXSXQFWXULVWDQG+HDOWK:HOOQHVV&RDFK 5HEHFFD.DUPD:HOOQHVV6WXGLR#JPDLOFRPRU 

WELLNESS PROGRAMS )/(;,%,/,7<)2$0 52// 6(/) 0<2)$6&,$/ 5(/($6(  3(5621$/ 75$,1,1* 6(66,216 ± 0D[LPL]H \RXU VWUHWFKLQJSURJUDPE\HPSOR\LQJRXUNQRZOHGJH RIPXVFOHDQDWRP\SK\VLRORJ\DQGNLQHVLRORJ\ 7KHVHPLQVHVVLRQVZLOODOORZ\RXWRLPSURYH \RXUSRVWXUHPXVFXODUEDODQFHDQGSHUIRUPDQFH VHVVLRQVVHVVLRQV7UL+HDOWK)LW QHVVDQG+HDOWK3DYLOOLRQ3IHLIIHU5G)RU PRUHLQIR 62/)(**,2 6281' 7+(5$3< :,7+ 781,1* )25.6 ± KU VHVVLRQ (QMR\ WKHEHQH¿FLDOUHVRQDQFHRIWRQHVWKDWEDODQFHDQG EULQJKDUPRQ\WRWKHERG\)RUPRUHLQIR7KHD RUDWDELW]#JPDLOFRP 75,+($/7+&$1&(5:(//1(66352 *5$0 ± ZN VHVVLRQV GHVLJQHG IRU WKRVH XQGHUJRLQJ FDQFHU WUHDWPHQWV RU WKRVH ZKR UHFHQWO\KDYHFRPSOHWHGWUHDWPHQW7KHSURJUDP LVFRPSULVHGRIZNVRIH[HUFLVHVHVVLRQVDQG ZNVRILQGLYLGXDOFRQVXOWDWLRQVDQGDVVHVVPHQWV 3UHUHJLVWUDWLRQDQGSK\VLFLDQFOHDUDQFHDUHUH TXLUHG7UL+HDOWK)LWQHVVDQG+HDOWK3DYLOOLRQ 3IHLIIHU5G0RQWJRPHU\)RUPRUHLQIR RU WR UHFHLYH D UHJLVWUDWLRQ SDFNHW IUHH .DUHQ 6LPV

%LNLQJLQWKH*UHDW3DUNV RI+DPLOWRQ&RXQW\ /HDUQKRZWRKDYHIXQDQGEHVDIHZKLOH FRPPXWLQJWRZRUNHPEDUNLQJRQORQJ GLVWDQFHWRXUVULGLQJRQSDYHGSDWKVRU H[SORULQJPRXQWDLQWUDLOV)UHH

SP 5(,&LQFLQQDWL(GPRQVRQ5G  0XVWUHJLVWHU5(,FRP6WRUHV&LQFLQQDWL 7DL&KL&ODVV±SPZNOHYHORQHFODVV'RQ¶W OHWWKH³OHYHORQH´IRRO\RXWKLVLVD³PDVWHUFODVV´ RIERG\PHFKDQLFVPRYHPHQWDQGKHDOLQJWKDWLV

natural awakenings

May 2014

43


ongoingevents sunday 6KDNWL<RJD±DP/HGE\5DPHVK*DPE KHHUD 5<7 %DVHG RQ WKH DVKWDQJD YLQ\DVD VW\OH RI \RJD SUDFWLFH (DFK \RJD SRVWXUH KDUQHVVHV RQH¶VLQWHUQDOSRZHUXWLOL]LQJWKHEXLOGLQJEORFNV RIEUHDWKDOLJQPHQWHQHUJ\ORFNVDQGIRFXV GURSLQ*UDFHWUHH<RJDDQG*URZWK6WXGLR &LQFLQQDWL'D\WRQ 5G :HVW &KHVWHU 5HJLVWHU *UDFHWUHH6WXGLRFRP $VKWDQJD<RJD&ODVV±DP$OOOHYHOV)HHO VWURQJHU DQG FDOPHU <RJD$K 6WXGLR  +DPLOWRQ$YH1RUWKVLGH 6KDPDQLF <RJD ± DPSP  ,W¶V <RJD  /XGORZ$YH &OLIWRQ )RU PRUH LQIR RU<RJD*DUDJHFRP 6DPSOH6LS6KDUH7HD%DU±SP*HWWKHRS SRUWXQLW\WR³WU\LWEHIRUH\RXEX\LW´DQGVDPSOH WKHZRQGHUIXOWHDV7KH6SLFHDQG7HD([FKDQJH  (GPRQVRQ 5G &LQFLQQDWL  6SLFH$QG7HDFRP

monday 7XPP\ 7LPH ± DP &ODVV KHOSV LP SURYH RYHUDOO WXPP\ IXQFWLRQ IDFLOLWDWHV VHQVRU\ DZDUHQHVVDQGSURPRWHVQDWXUDOKHDOWK\KHDGDQG ERG\ VKDSHPRYHPHQWV ,QFRUSRUDWHV EDE\ PDV

ŠŠŠǤǤǤ ’”‹‰–‹‡ǡ ‹†‘—” ‘—Žƒ–‡Ǩ

VDJHUHÀH[RORJ\DQGEDE\\RJDZLWKWXPP\WLPH SRVLWLRQWRKHOS\RXUEDE\¶VH[SHULHQFHEHIXQDQG UHOD[LQJ GURSLQ  ZNV %OXH &RFRRQ 0RQWJRPHU\5G0RQWJRPHU\ %OXH&RFRRQ%DE\FRP <RJD%DE\ ± DP (DFK FODVV LV ¿OOHG ZLWKFDOPLQJQXUWXULQJZD\VWRHQKDQFHERQGLQJ DQGLPSURYHEDE\¶VVOHHS%DELHVFDQHQMR\\RJD ZKLOHRQWKHLUEDFNVWXPPLHVRUKHOGLQORYLQJDUPV )RUSDUHQWVWKLVLVDVSHFLDORSSRUWXQLW\WRPHHWRWKHU PRPVJHWVXSSRUWDQGOHDUQDERXWEDE\¶VHPHUJLQJ SHUVRQDOLW\GURSLQZNV%OXH&RFRRQ 0RQWJRPHU\5G0RQWJRPHU\ %OXH&RFRRQ%DE\FRP 5RFNHW<RJD±SP)HHOVWURQJHUDQGPRUH ÀH[LEOH<RJD$K6WXGLR+DPLOWRQ$YH 1RUWKVLGH 6PDUW0RYHVIRU7HHQV±SP,QWHQWLRQDO PRYHPHQWIRUVFKRROVXFFHVV)XOO%RG\<RJD 6WXGLR%2DNEURRN5G)ORUHQFH.<  +LJK,QWHQVLW\,QWHUYDO7UDLQLQJ +,,7 ±0D\ -XQHSP+,,7LVDQHQKDQFHGIRUP RILQWHUYDOWUDLQLQJDQH[HUFLVHVWUDWHJ\DOWHUQDWLQJ SHULRGVRIVKRUWLQWHQVHDQDHURELFH[HUFLVHVZLWKOHVV UHFRYHU\SHULRGV+,,7H[HUFLVHVSURYLGHLPSURYHG DWKOHWLFFDSDFLW\DQGFRQGLWLRQLPSURYHGJOXFRVH PHWDEROLVPDQGKLJKHUIDWEXUQLQJ7UL+HDOWK)LW QHVVDQG+HDOWK3DYLOOLRQ3¿HIIHU5G0RQW JRPHU\)RUPRUHLQIR %DNHU :HHNO\ +HDOWK 7DONV ± SP %DNHU &KLURSUDFWLF0DGLHUD&OLQLF(XFOLG$YH)RU LQIR WR5693 )RFXVHG)ORZ<RJD±SP:LWK0D\$QQ 0RQWJRPHU\$YLQ\DVDÀRZWKDWIRFXVHVHLWKHURQ DQDUHDFKRVHQE\WKHFODVVRURQDZDUHQHVVEUHDWK WZLVWLQJDQGEDODQFHGURSLQ&HQWHQQLDO%DUQ &RPSWRQ5G&LQFLQQDWL :2::RPHQRI:LVGRP±SP$QHYH QLQJRIODXJKWHUSUD\HU QRQGHQRPLQDWLRQDO VKRUW PHGLWDWLRQDQGORWVRIZLVGRP6KDUH\RXUWKRXJKWV RQOLIHLVVXHVDQGVSLULWXDOLW\LQDVDIHHQYLURQPHQW GRQDWLRQ7UXH%OXH+HDOLQJ7UHHKRXVH+HDOLQJ &HQWHU6WDQOH\$YH XSVWDLUVLQWKHORIW )RU PRUHLQIR7UXH%OXH+HDOLQJFRP %DNHU:HHNO\ +HDOWK7DONV ± SP %DNHU &KL URSUDFWLF)DLU¿HOG&OLQLF'HLV'U7R5693  0L[HG/HYHO<RJDZLWK3KRHQL[±SP GURSLQ7KH.XOD&HQWHU(WK6W1HZ SRUW.<<RJD#PDFFRP

44

=XPELQL3URJUDP±7KUX0D\DP 'HVLJQHG WR OHW \RX DQG \RXU OLWWOH RQHV  \UV ROGZLJJOHVLQJDQGOHDUQWRJHWKHU7KH=XPELQL SURJUDPLVZKHUHWKHVFLHQFHRIFKLOGGHYHORSPHQW PHHWVWKHPDJLFRI=XPEDIRUWKHXOWLPDWHERQGLQJ H[SHULHQFH VHULHV )LWQHVV 3K\VLTXHV  .HQZRRG5G%OXH$VK <RJD IRU  ± DP  ,W¶V<RJD  /XGORZ$YH &OLIWRQ  <RJD *DUDJHFRP 6HDVRQDO6L]]OH/XQFK6SHFLDO±DPSP)HD WXUHGLVDRQHWLPHIRRGYHQXHDWDIDQWDVWLFSULFHRI )URP%DNHG3RWDWR%DUWRJULOOHGFKHHVHVWLUIU\ WR3DVWD%DUDXQLTXHOXQFKWLPHWUHDWDZDLWV\RX :KROH)RRGV0DUNHW(GPRQVRQ5G&LQFLQ QDWL &KDLU<RJD&ODVV±SP&ODVVOLPLWHGWR PXVWUHJLVWHU0RQNH\%UHZ&RIIHH%DNHZHOO 6W&RYLQJWRQ.<5HJLVWHU-DPLH&RRS%RG\ZRUN $QG3DLQU5OLHI#\DKRRFRP /RYHODQG )DUPHUV¶ 0DUNHW ± 0D\2FW SP 'RZQWRZQ /RYHODQG 6WDWLRQ SDUNLQJ DUHD DFURVV IURP 3D[WRQ¶V UHVWDXUDQW RQ RQH VLGH DQG (DG¶V )HQFHRQWKHRWKHU)RUPRUHLQIR/RYHODQG)0FRP +DWKD<RJD±SP%HOHGLQWREDVLF\RJDSRV WXUHV DQG EUHDWKLQJ WHFKQLTXHV WKDW ZLOO HQKDQFH \RXUERG\DQGPLQG)LWQHVV3K\VLTXHV .HQZRRG5G%OXH$VK 7DL&KLIRU$GXOWV±SP$QLQYLJRUDWLQJVHV VLRQRIWDLFKL0DGLVRQYLOOH%UDQFK/LEUDU\ :KHWVHO$YH %HJLQQHU,QWHUPHGLDWH<RJDZLWK5REDQG6WHYH ±SP7KH.XOD&HQWHU(WK6W 1HZSRUW.<7KH%R\]#IXVHQHW 7XHVGD\ RQ7DS ± SP 6L[ 'UDXJKWV DQG 6L[ %LWHV:KROH)RRGV0DUNHW0DVRQ'HHU ¿HOG%OYG 5HVWRUDWLYH<RJD±SP:LWK.\OLH0DH 6WHLQ 5HVWRUDWLYH \RJD LV GHVLJQHG WR SURJUHVV IURP VPDOO VHDWHG PRYHPHQWV WR KROGLQJ SDVVLYH SRVHVIRUPLQV%HQH¿WVLQFOXGHLPSURYHGEDO DQFHÀH[LELOLW\VWDELOLW\FLUFXODWLRQUHOLHIRIVWLII PXVFOHVDQGDFKLQJMRLQWVGURSLQ&HQWHQQLDO %DUQ&RPSWRQ5G&LQFLQQDWL %DNHU:HHNO\+HDOWK7DONV±SP%DNHU&KLUR SUDFWLF:HVW&KHVWHU&OLQLF92$&HQWUH'U 7R5693

wednesday

<RJD ZLWK 3DP ± DP  )XOO %RG\ <RJD6WXGLR%2DNEURRN5G)ORUHQFH.< 

*HQWOH +HDOLQJ<RJD ± DP 0LQGIXO PRYHPHQWDQGPHGLWDWLRQ6XLWDEOHIRUEHJLQQHUV DQGPDWXUHVWXGHQWV3DVVHVDYDLODEOH1HZVWXGHQW VSHFLDO  FODVVHV 9LWDOLW\ &LQFLQQDWL  0RQWJRPHU\ 5G 5HJLVWHU 6KHUU\ -R\  RU-R\IXO/LIH<RJDFRP

<RJD±DPGURSLQ6HUHQLW\1RZ +ROLVWLF+HDOLQJ&HQWHU86+Z\8QLRQ .<

+DOI3LQWV.LGV&OXE±DP:KROH)RRGV 0DUNHW0DVRQ'HHU¿HOG%OYG5HJLVWUDWLRQ UHTXLUHG

3UHVFKRRO 3OD\GDWH ± DP &UHDWLYH SOD\ PRYHPHQWDQGFUDIWV)XOO%RG\<RJD6WXGLR %2DNEURRN5G)ORUHQFH.<

3UHVFKRRO 3OD\GDWH ± DP &UHDWLYH SOD\ PRYHPHQWDQGFUDIWV)XOO%RG\<RJD6WXGLR% 2DNEURRN5G)ORUHQFH.<

tuesday

-RLQIRU)5((DW 1DWXUDO$ZDNHQLQJV6LQJOHVFRP

7DL &KL ZLWK -HQQLIHU :RRGV ± DP  PR GURSLQ7KH .XOD &HQWHU  ( WK 6W 1HZSRUW .<  -HQQLIHU:RRGVUG# JPDLOFRP

Greater Cincinnati/Northern Kentucky Edition

NaturalCinci.com


7XQLQJ )RUNV ZLWK 7KHD ± SP /HDUQ DERXW6ROIHJJLR6RXQG7KHUDS\FRXSRQJLYHQ WRDOOWKDWDWWHQG2QHDWWHQGHHZLOOEHFKRVHQ UDQ GRP GUDZLQJ  IRU IUHH IXOO VHVVLRQ DV SDUW RI WKH GHPRQVWUDWLRQ&HQWHQQLDO%DUQ&RPSWRQ5G +DUWZHOO:\RPLQJ)RUPRUHLQIR RUDWDELW]#JPDLOFRP /LYH:HOO<RJD1LJKW±SP/LYH :HOO&KLURSUDFWLF&HQWHU7\OHUVYLOOH5G6WH 0DVRQ5693 /DXJKWHU<RJD±SPUG:HG/DXJKWHU<RJDLV DPLQGERG\H[HUFLVHZKLFKSRZHUIXOO\FRXQWHUDFWV WKH QHJDWLYH HIIHFWV RI VWUHVV DQG KDV D SURIRXQG HIIHFW RQ \RXU KHDOWK DQG ZHOO EHLQJ 6\PPHV 7RZQVKLS /LEUDU\  (Q\DUW 5G /RYHODQG  9LQ\DVD<RJD±SP:LWK5KHD&DVWUXFFL 3UDFWLFH WKDW EXLOGV VWUHQJWK GHYHORSV HQGXUDQFH DQGÃ&#x20AC;H[LELOLW\DQGIRFXVHVRQWKHEUHDWKWKURXJKRXW DOOWKHSRVHV%DVHGRQWKH$VKWDQJD3ULPDU\6HULHV GHYHORSHGE\3DWWDEKL-RLV&ODVVIRU¿WEHJLQQHUVWR LQWHUPHGLDWHOHYHOVWXGHQWVGURSLQ&HQWHQQLDO %DUQ&RPSWRQ5G&LQFLQQDWL

thursday <RJDIRU±DP,W¶V<RJD /XGORZ$YH&OLIWRQ)RUPRUHLQIR RU<RJD*DUDJHFRP 0(/7 0HWKRG ± DP 5HDS WKH EHQ H¿WVRIWKLVXQLTXHKDQGVRIIERG\ZRUNDSSURDFK WKDW KHOSV SUHYHQW SDLQ KHDO LQMXU\ DQG HUDVH WKH QHJDWLYHHIIHFWVRIDJLQJDQGDFWLYHOLYLQJ7KURXJK VLPXODWHGWHFKQLTXHVXVHGLQPDQXDOWKHUDS\\RX ZLOOKHOSHOLPLQDWHVWUHVVHQKDQFHERG\DZDUHQHVV UHK\GUDWHFRQQHFWLYHWLVVXHDQGTXLHWWKHQHUYRXV V\VWHP)LWQHVV3K\VLTXHV.HQZRRG5G %OXH$VK <RJD±DPGURSLQ6HUHQLW\1RZ +ROLVWLF+HDOLQJ&HQWHU86+Z\8QLRQ .< :KROH)LWQHVV7KXUVGD\V±DP-RLQXVLQWKH FDIpIRUDIUHH\RJDFODVV3OHDVHEULQJRZQPDW :KROH )RRGV 0DVRQ  'HHU¿HOG %OYG   $JHOHVV %DODQFH DQG &KDLU <RJD ±  DP/HGE\%HWV\DQG$QWRQLD$EOHQGRIFKDLU DQG EDODQFH \RJD SRVWXUHV IRU DOO DQG HVSHFLDOO\ IRUWKRVHZLWKGLI¿FXOWLHVZLWKJHWWLQJRQWKHÃ&#x20AC;RRU DQGZLWKEDODQFHGURSLQ*UDFHWUHH<RJDDQG *URZWK6WXGLR&LQFLQQDWL'D\WRQ5G:HVW &KHVWHU5HJLVWHU*UDFH7UHH6WXGLRFRP )RRG)DFWVDQG)XQ±SP+DQGVRQDFWLYLWLHV JDPHV DQG KDQGRXWV DERXW 0\ 3ODWH WKH IRRG JURXSV DQG IRRG VDIHW\ 6SRQVRUHG E\ WKH 2KLR 6WDWH8QLYHUVLW\([WHQVLRQ2I¿FH1RUHJLVWUDWLRQ UHTXLUHG:DOQXW+LOOV%UDQFK/LEUDU\.HPSHU /Q 0DGHLUD¶V )DUPHUV¶ 0DUNHW ± 0D\6HSW  SP 'DZVRQ 5G 0DGHLUD 0DGHLUD)DUPHUV 0DUNHWFRP /LQH 'DQFLQJ ± SP (QMR\ WKH IXQ RI GDQFLQJ ZKLOH LPSURYLQJ \RXU FDUGLRYDVFXODU KHDOWK)LWQHVV3K\VLTXHV.HQZRRG5G %OXH$VK 7DL&KL±SP/HGE\/DUU\%REEHUW GURSLQ*UDFHWUHH<RJDDQG*URZWK6WXGLR

&LQFLQQDWL'D\WRQ 5G :HVW &KHVWHU 5HJLVWHU *UDFHWUHH6WXGLRFRP +DWKD<RJD ± SP :LWK -DQHW 2VPRQG RU -R +HQGHUVRQ$VORZSDFHGVWUHWFKLQJFODVVZLWKVRPH VLPSOHEUHDWKLQJH[HUFLVHVDQGSHUKDSVVHDWHGPHGL WDWLRQ$JRRGSODFHWROHDUQEDVLFSRVHVUHOD[DWLRQ WHFKQLTXHVDQGEHFRPHFRPIRUWDEOHZLWK\RJD3HU IHFWIRUWKRVHQHZWR\RJDGURSLQ&HQWHQQLDO %DUQ&RPSWRQ5G&LQFLQQDWL &RPH'DQFH1LDZLWK7ULVK±SPVWFODVV IUHH7KH.XOD&HQWHU(WK6W1HZ SRUW.<7ULVK#1LD6ZRKQN\FRP <RJD ± SP GURSLQ 6HUHQLW\ 1RZ +ROLVWLF+HDOLQJ&HQWHU86+Z\8QLRQ .< <RJD IRU WKH +HDUW ± SP 6XLWDEOH IRU EHJLQQHUV DQG DGYDQFHG OHYHOV 3DVVHV DYDLODEOH 1HZVWXGHQWVSHFLDOFODVVHV9LWDOLW\&LQFLQ QDWL0RQWJRPHU\5G5HJLVWHU6KHUU\-R\ RU-R\IXO/LIH<RJDFRP

markyourcalendar &DQFHU(GXFDWLRQDQG 6XSSRUW*URXS

&KDLU<RJD±SP:LWK$SULO$ORLVLR)RU SHRSOHZLWK3DUNLQVRQ¶VGLVHDVHDQG6SHFLDOSRSX ODWLRQV7KLV LV D JHQWOH SUDFWLFH EULQJLQJ FDUH WR WKHZKROHSHUVRQERG\EUDLQKHDUWDQGVRXO &HQWHQQLDO %DUQ  &RPSWRQ 5G &LQFLQQDWL  /HWWXFH (DW :HOO )DUPHUV¶ 0DUNHW ± SP <HDUURXQGPDUNHWIHDWXULQJPDQ\IRRGDQGFUDIW LWHPV$OOIUHVKIUXLWVDQGYHJHWDEOHVDUHORFDOO\DQG VXVWDLQDEO\JURZQZLWKRXWV\QWKHWLFFKHPLFDOV(%7 IRRG VWDPSV DFFHSWHG &KHYLRW 8QLWHG 0HWKRGLVW &KXUFK:HVWZRRG1RUWKHUQ%OYG&KHYLRW )RUGHWDLOV/(:)0RUJ :LQH 7DVWLQJ ± SP &RXQWU\ )UHVK 0DUNHW DQG:LQH'HSRW%HHFKPRQW$YH$QGHUVRQ 7RZQVKLS )LYHDIWHU)LYH±SP$GPLVVLRQOLPLWHGWR (QMR\GHOLFLRXVGLVKHVSOXVGHVVHUWSDLUHGZLWK  IDEXORXV ZLQHV  WLFNHWV IURP SP RU XQWLOVHOORXW&RVWLQFOXGHVZLQHIRRGWDVWLQJDQG D:KROH)RRGVZLQHJODVV%ULQJ\RXUJODVVEDFN WR WKH QH[W WDVWLQJ IRU  RII SXQFK FDUG :KROH )RRGV5RRNZRRG(GPRQVRQ5G&LQFLQQDWL  8QFRUNHG:LQH7RXU±SP:KROH)RRGV 0DUNHW0DVRQ'HHU¿HOG%OYG

(QKDQFHWKH&XUH (QULFK(QKDQFH(PSRZHU 'HGLFDWHGWRHQKDQFLQJFKHPRWKHUDS\DQG GHDOLQJZLWKWKHVLGHHIIHFWVE\XVLQJQRQ WR[LFWKHUDSLHVVXFKDVHQ]\PHVHVVHQWLDORLO QXWULWLRQLQIUDUHGSDLQPDQDJHPHQWWHFKQLTXHV DQGRWKHUVFLHQFHEDVHGQRQLQYDVLYH PHWKRGV7KLVLVWKHSODFHWRDVNTXHVWLRQV IURPRWKHUVZKRKDYHEHHQWKHUH2SHQWR FDQFHUSDWLHQWVDQGFDUHJLYHUV

QG7KXUVÂ&#x2021;SP ),70RQWJRPHU\ 0RQWJRPHU\5G.HQZRRG )RUPRUHLQIR6X]DQQ:DUGHQ

<LQ DQG <DQJ )ORZ ± SP /HG E\ .LP 'DZHV5<7$ZDUPDQGEDODQFHGUHVSHFWIXOSUDF WLFHIRUVWXGHQWVGURSLQ*UDFHWUHH<RJDDQG *URZWK6WXGLR&LQFLQQDWL'D\WRQ5G:HVW &KHVWHU5HJLVWHU*UDFHWUHH6WXGLRFRP 0HGLWDWLRQ &ODVV ± SP QG 7KXUV :LWK *DU\0DWWKHZV7KH6WLOOSRLQW&HQWHU &RUQHOO3DUN'U%OXH$VK <LQ<RJDZLWK&KULVWLDQ±SP7KH .XOD&HQWHU(WK6W1HZSRUW.< ;WLDQ]RPELH#\DKRRFRP

friday =HQNLQL±DP/HGE\'DQLHOOH&R[DQG -HVVLFD+HL]PDQ&ODVVLVDFRPELQDWLRQRISRZHUIXO \RJDDQG3LODWHVGURSLQ*UDFHWUHH<RJDDQG *URZWK6WXGLR&LQFLQQDWL'D\WRQ5G:HVW &KHVWHU5HJLVWHU*UDFHWUHH6WXGLRFRP <RJD IRU  ± DP  ,W¶V<RJD  /XGORZ$YH &OLIWRQ  <RJD *DUDJHFRP

6KDPDQLF-RXUQH\±SPQG)UL:LWK *DU\0DWWKHZV6WLOOSRLQW&HQWHUIRU+HDOLQJ $UWV&RUQHOO3DUN'U%OXH$VK 

saturday :HHNHQG:RUNRXWVLQWKH3DUN±DP*HWRXWVLGH DQGJHWLQVKDSHZLWKWKH<0&$RI*UHDWHU&LQFLQ QDWL7KH<RIIHUVIUHH6DWXUGD\PRUQLQJZRUNRXWVDW EHDXWLIXO:DVKLQJWRQ3DUNLQGRZQWRZQ&LQFLQQDWL $OODJHVZHOFRPH)UHHDQGRSHQWRWKHSXEOLF)RU PRUHLQIRRU0\<2UJ 4LJRQJ±DPGURSLQ*UDFHWUHH<RJDDQG *URZWK6WXGLR&LQFLQQDWL'D\WRQ5G:HVW &KHVWHU5HJLVWHU*UDFHWUHH6WXGLRFRP +DOI3LQWV.LGV&OXE±DP:HLQYLWHNLGV WRMRLQXVRQDIXQDGYHQWXUHDVZHH[SORUHJUHDW IRRGDQGJRRGQXWULWLRQ:KROH)RRGV5RRNZRRG (GPRQVRQ5G&LQFLQQDWL5HJLVWHU RU&LQ5HJLVWUDWLRQ#:KROH)RRGVFRP <RJDZLWK5RVDOLH±0D\ DP $GXOWVZLOOKDYHWKHRSSRUWXQLW\WRVKDUHWKHLU\RJD SUDFWLFHZLWKLQVWUXFWRU5RVDOLH6RYLOOD$QGHUVRQ %UDQFK/LEUDU\6WDWH5G$QGHUVRQ7RZQVKLS  9LWDPLQ % 6KRWV ± DP 6XVDQ¶V 1DWXUDO :RUOG  %HHFKPRQW$YH$QGHUVRQ 7RZQVKLS)RUPRUHLQIR ,QWURGXFWLRQ WR 1HWZRUN 6SLQDO$QDO\VLV 7DON ± DPSP QG 6DW /HDUQ KRZ VWUHVV DI IHFWVSRVWXUHDQGEUDLQIXQFWLRQ)UHH*DWHZD\VWR +HDOLQJ0DLQ6W&LQFLQQDWL0XVWUHJLVWHU  $\XUYHGLF0HULGLDQ<RJD±SP ,W¶V<RJD/XGORZ$YH&OLIWRQ)RUPRUHLQIR RU<RJD*DUDJHFRP :LQH 7DVWLQJ ± SP &RXQWU\ )UHVK 0DUNHW DQG:LQH'HSRW%HHFKPRQW$YH$QGHUVRQ 7RZQVKLS

natural awakenings

May 2014

45


naturaldirectory Connecting you to the leaders in natural healthcare and green living in our community. To find out how you can be included in the Natural Directory, call 513-943-7323 to request our media kit.

ACUPUNCTURE BEVERLY WELBOURNE, LMT, L.Ac. 11223 Cornell Park Dr, Blue Ash, OH 45242 513-489-9777 StillpointTherapy.com %\JXLGLQJWKHÃ&#x20AC;RZRITL RUOLIHIRUFHDFXSXQFWXUH UHVWRUHV KDUPRQ\ RQ PDQ\OHYHOV7KLVDQFLHQW PHWKRGHQMR\VDUHDZDN HQLQJ LQ WRGD\¶V ZRUOG 6HHDGSDJH

BODYWORK

COMPOUNDING PHARMACY

CHIROPRACTIC CARE GATEWAYS TO HEALING CHIROPRACTIC AND NUTRITION

TRI-STATE COMPOUNDING PHARMACY

Drs. Michael and Julie Nichols 1206 Main St, Cincinnati, OH 45202 513-321-3317 GatewaysToHealing.com

7715 Beechmont Ave, Anderson Township 513-624-7333 TriStateRX.com $W7UL6WDWH&RPSRXQG LQJ 3KDUPDF\ ZH SUR YLGH RXU SDWLHQWV ZLWK PHGLFDO VROXWLRQV WDL ORUHGWRWKHLUQHHGV \HDUV H[SHULHQFH 6HH DGSDJH

3K\VLFDO HPRWLRQDO DQG PHQWDOVWUHVVRUVFDQGLV UXSW RXU OLYHV FDXVLQJ WXUPRLODQGSDLQ:HXVH 1HWZRUN6SLQDO$QDO\VLV DQGQXWULWLRQWRKHOS\RX UHFRQQHFW SURFHVV WKH VWUHVVDQGUHOLHYH\RXUSDLQ6HHDGSDJH

MANTRA MASSAGE AND BODYWORx 4675 Cooper Rd 513-518-2719 Info@MantraMassageAndBodyworx.com MantraMassageAndBodyworx.com &XVWRPL]HGVHVVLRQV XVLQJDYDULHW\RI WHFKQLTXHVIRU\RXU XQLTXHH[SHULHQFH :HOLVWHQDQGZRUN WRUHOLHYHSDLQDQG WHQVLRQ7KHUDSHXWLFPDVVDJHDFXSXQFWXUH5HLNL DQGUHÃ&#x20AC;H[RORJ\&DOORUERRNRQOLQH6HHDG SDJH

LIVE WELL CHIROPRACTIC CENTER Dr. Kim Muhlenkamp-Wermert 6860 Tylersville Rd, Ste 7 Mason, OH 45040 Ph: 513-285-7482 Fax: 513-285-7483 DrKim.LiveWell@gmail.com LiveWellCC.com :HORRNDWWKHZKROHERG\WR ¿QGWKHFDXVHRIWKHSUREOHP KHOSLQJ\RXJHWZHOOVWD\ZHOO DQG/LYH:HOO6SHFLDOL]LQJLQ SUHJQDQF\ DQG FKLOGUHQ 6HH DGSDJH

MEDICAL MASSAGE CINCINNATI Suzanne Lautz Singh, LMT 2330 Eight Mile Rd, Anderson Township 513-827-0079 MedicalMassageCincinnati.com :KHUH 0HGLFDO %RG\ZRUN FRPSHWHVWKH6FLHQFHRI:HOO QHVV 0HGLFDO %RG\ZRUN WUHDWLQJ WKH FDXVH RI \RXU SUREOHPV 9LVLW RQOLQH IRU GHWDLOVRIRXUWKHUDSLHVDQGWR VFKHGXOHDQDSSRLQWPHQW6HH DGSDJH

YAMUNA BODY ROLLING Anya Carl-Heinbaugh, BA, MBA 513-405-4307 AnyaCarl@gmail.com Facebook: Sayso Studio ([SHULHQFH <DPXQD %RG\ 5ROOLQJ WR UHOLHYH SDLQ UH OHDVH PXVFXODU WHQVLRQ DQG RUJDQL]H\RXUHQWLUHVWUXFWXUH DOORZLQJ\RXUERG\WRPRYH ZLWKHDVHDQGOHDYH\RXIHHO LQJDOLYHZLWKHQHUJ\:KHUH 0HGLFDO%RG\ZRUNFRPSHWHV WKH6FLHQFHRI:HOOQHVV0HG LFDO%RG\ZRUNWUHDWLQJWKHFDXVHRI\RXUSUREOHPV 9LVLW ZHEVLWH IRU GHWDLOV RI RXU WKHUDSLHV DQG WR VFKHGXOHDQDSSRLQWPHQW³&LW\%HDW%HVWRI&LQFLQ QDWL5HFLSLHQW´6HHDGSDJH

46

FITNESS SIGNIFICANT HEALING WELL CARE PRACTICE Pounds & Inches Weight Loss Center 157 Lloyd Ave, Florence, KY 41042 859-282-0022 PIWeightLoss.com &HUWL¿HG SHU VRQDOWUDLQHUV QXWULWLRQ DQG V X S S O H P H Q W FRQVXOWV KR OLVWLFZHOOFDUH&XVWRPL]HGH[HUFLVHSURJUDPWR VWUHQJWKHQWKHERG\LPSURYHEDODQFHDQGÃ&#x20AC;H[LELO LW\LQFUHDVHHQGXUDQFHVXSSRUWZHLJKWORVV6HH DGSDJH 

CLEANING SERVICES DIAMOND QUALITY CLEAN 513-583-5855 DiamondQualityClean.com ([SHULHQFH 'LDPRQG 4XDOLW\ FOHDQV H[FOXVLYH ³4XDOLW\ 'HWDLO &OHDQ´ V\VWHP :H JXDUDQWHH  VDWLVIDFWLRQ RU D UHFOHDQ LV GRQH LQ  KRXUV 2XU FOHDQLQJ VHU YLFHVLQFOXGHWKHIROORZLQJUHFXUULQJFXVWRPGH WDLOVSHFLDOHYHQWRQHWLPHPRYHLQRXWZLQGRZV DQGEOLQGVGHFOXWWHULQJRUJDQL]DWLRQDODVVLVWDQFH DQGPXFKPRUH6HHDGSDJH

Greater Cincinnati/Northern Kentucky Edition

FUNCTIONAL MEDICINE THE LIVING PROOF INSTITUTE 9277 Centre Pointe Dr, Ste 350 West Chester, OH 45069 513-785-0686 LivingProofInstitute.com 7 K H  / L Y L Q J 3URRI ,QVWLWXWH SURYLGHV)XQF W L R Q D O  D Q G /LIHVW\OH0HGLFLQH8QFRYHUWKHURRWFDXVHRI\RXU GLVHDVHWKURXJKDIIRUGDEOHIXQFWLRQDOWHVWLQJDQG UHFHLYH D GUXJIUHH DFWLRQ SODQ WR UHVWRUH \RXU YLWDOLW\6HHDGSDJH

HAIR SALONS ALLURE SALON 5250 Courseview Dr, Mason, OH 45040 513-459-0606 AllureMason.com )XOO KDLU VHUYLFH $9 ( ' $ & 2 1  &(37VDORQZLWKD KLJKO\WUDLQHGWHDP RIIHULQJDSHUVRQDOL]HGH[SHULHQFH&DOOWRUHVHUYHD FRPSOLPHQWDU\FRQVXOWDWLRQ6HHDGSDJH

NaturalCinci.com


HEALTH INSURANCE

MASSAGE

JULIE CHAFIN HEALTH INSURANCE

SIGNIFICANT HEALING WELL CARE PRACTICE

513-315-0380 JulieChafinHealthInsurance.com 2SHQ HQUROOPHQW IRU KHDOWK LQVXUDQFH HQGHG 0DUFK  <RXZLOOKDYHWRKDYHDTXDOL I\LQJ HYHQW LQ RUGHU WR SXU FKDVHLQVXUDQFHXQWLOWKHQH[W RSHQHQUROOPHQW3OHDVHFDOOLI \RX DUH ORVLQJ FRYHUDJH RU YLVLWP\ZHEVLWHWRJHWDTXRWH DQG ORRN DW RSWLRQV )HGHUDO ([FKDQJH$JHQW RQ +HDOWK FDUHJRY)RUPRUHLQIRUPDWLRQFRQWDFW-XOLH

HOLISTIC WELL CARE SIGNIFICANT HEALING WELL CARE PRACTICE 157 Lloyd Ave, Florence, KY 41042 859-282-0022 Victoria@SignificantHealing.com SignificantHealing.com 9LFWRULD6PLWKFHUWL¿HGKROLV WLFSUDFWLWLRQHULULGRORJLVW,Q GLYLGXDOL]HG ZHOO FDUH SODQ (PSKDVLV RQ QDWXUDO VXSSOH PHQWVDQGUHPHGLHV1XWULWLRQ DQG VXSSOHPHQW HGXFDWLRQ )LWQHVVDQGSHUVRQDOWUDLQLQJ 7KHUDSXHWLF DQG UHOD[DWLRQ PDVVDJH ,QWXLWLYH JXLGDQFH 6HHDGSDJH

HYDROCOLONTHERAPY CINCINNATI COLON HYDROTHERAPY Trisha DeHall 7923 Blue Ash Rd Cincinnati, OH 45236 513-356-6215 CincinnatiColonHydrotherapy.com &RORQLFV DUH D VDIH PHWKRG RI UHPRYLQJZDVWH IURPWKHFRORQ ZLWKRXWWKHXVH RIGUXJV%\LQWURGXFLQJ¿OWHUHGERG\WHPSHUDWXUH ZDWHULQWRWKHFRORQLWUHVXOWVLQHYDFXDWLRQWKURXJK QDWXUDOSHULVWDOVLV6HHDGSDJH

HYPNOTHERAPY GWENDOLINE JOSEY, CHT 7434 Honeysuckle Ct Maineville, OH 45039 513-620-1453 HypnosisOnline.com/Gwendoline 5HGXFHZHLJKWQDWXUDOO\DQG HIIHFWLYHO\+\SQRWKHUDS\FDQ UHSURJUDP\RXUHDWLQJKDELWV DQG VSHHG XS \RXU PHWDER OLVP*HWEDFN\RXUVHOIORYH DQG FRQ¿GHQFH %HQH¿WV DUH PRUHHQHUJ\EHWWHUKHDOWKDQG D KDSSLHU \RX 0HPEHU RI ,QWHUQDWLRQDO )HGHUDWLRQ RI +\SQRVLV DQG 1DWLRQDO )HG HUDWLRQ RI 1HXUROLQJXLVWLF 3V\FKRORJ\  \HDUV H[SHULHQFH)UHHFRQVXOWDWLRQ

SHAMANISM

157 Lloyd Ave, Florence, KY 41042 859-282-0022 Victoria@SignificantHealing.com SignificantHealing.com 0HGLFDO DQG WKHUDSHXWLF PDVVDJH5HOHDVHVWLIIDQG VRUHPXVFOHVVWLPXODWHLP PXQH V\VWHP PRYH O\P SKDWLFV\VWHPUHOLHYHSDLQ 5HOD[DWLRQ GHHS WLVVXH O\PSKDWLF QHXURPXVFXODU IDFLDOFUDQLRVDFUDO5HLNL6HHDGSDJH

 MEAL DELIVERY SERVICE HEALTHSAVOR Brandon Schlunt, Executive Chef 513-706-8764 HealthyOrganicMealDelivery.com

GARY MATTHEWS Stillpoint Center for Healing Arts 11223 Cornell Park Dr, Blue Ash, OH 45242 513-772-1917 ShamanicCounselor.com StillpointTherapy.com &RXQVHOLQJVKDPDQLFMRXUQH\ VRXOUHWULHYDOHPSRZHUPHQW ERG\ZRUN6HHDGSDJH

SPECIAL NEEDS RESOURCE CENTER BRAIN BALANCE ACHIEVEMENT CENTER OF CINCINNATI

6HUYLQJDZLGHDUUD\RIKHDOWK\RUJDQLFJOXWHQ IUHH VXSHUIRRGEDVHG PHDOV E\ SUHSDULQJ D QHZ PHQX ZHHNO\ DQG GHOLYHU\ WR \RXU GRRU:HLJKW ORVVPHQXDOVRDYDLODEOH6HHDGSDJH

NUTRITION SIGNIFICANT HEALING WELL CARE PRACTICE 157 Lloyd Ave, Florence, KY 41042 859-282-0022 Victoria@SignificantHealing.com SignificantHealing.com

12084 Montgomery Rd, Cincinnati, OH 45249 513-257-0705 BrainBalanceCincinnati.com *URXQGEUHDNLQJ SURJUDP FRP ELQLQJ VHQVRU\ PRWRUFRJQLWLYH D Q G  Q X W U L W L R Q FRDFKLQJLQWRRQHVROXWLRQIRUFKLOGUHQZLWK$'+' '\VOH[LD$XWLVP DQG RWKHU OHDUQLQJSURFHVVLQJ GLVRUGHUV6HHDGSDJH

THERMOGRAPHY

1XWULWLRQ DQG VXSSOHPHQW HGXFDWLRQ(PSKDVLVRQQDW XUDOVXSSOHPHQWVDQGUHPH GLHV /HDUQ WR UHDG IRRG OD EHOV OLPLW FKHPLFDO DGGL WLYHVEDODQFHLQWDNHRIQXWUL HQWVPDQDJHZHLJKW6HHDG SDJH

ONCOLOGY MASSAGE ROBERT REPASKY, MS, LMT Stillpoint Center for Healing Arts And Florence, KY 513-505-5737 DancingHeartMassage.com

MINDFUL WELLNESS MEDICAL THERMOGRAPHY Jacky Groenwegen, LMT, CTT 8859 Cincinnati-Dayton Rd, Ste 007 West Chester, OH 45069 513-382-3132 MindfulWellnessMedicalThermography.com 2IIHULQJDSDLQIUHHVFUHHQLQJ SURFHGXUH WKDW XVHV KHDW GH WHFWLRQWRORFDWHDQGPRQLWRU EUHDVW DEQRUPDOLWLHV DQG FKDQJHVLQRYHUDOOERG\FRQ GLWLRQV HDUOLHU 6HH DG SDJH 

WEIGHTLOSS

 )UHH PDVVDJHV IRU SHRSOH OLYLQJZLWKFDQFHUIURP&DQ FHU)DPLO\&DUHFDOO WRVFKHGXOHDQDSSRLQW PHQW:KLOHIXQGLQJODVWV

FIT MONTGOMERY 9030 Montgomery Rd Kenwood, Ohio 45242 513-409-3174 Relax@FitMontgomery.com FitBodyCinci.com )XOOVSHFWUXPLQIUD UHG ZHOOQHVV VWXGLR /RVH ZHLJKW VWRS SDLQ ORRN DQG IHHO \RXQJHU ,QFUHDVH HQHUJ\ FROODJHQ HODVWLQ DQG PHQWDO IRFXV ,PSURYH OLIHVW\OH H[HUFLVH DWWLWXGH DQG QXWULWLRQ KDELWV XVLQJ SHHU UHYLHZHG SXEOLVKHG PHGLFDO¿QGLQJV6HHDGSDJH

natural awakenings

May 2014

47


+ 6 $ / 6,13726800(5

/7 8 ' $  1 $ )25      <25 %/(12: / , 0 $ )  2/( 9$,/$ + $  : 6  3 ( , + + %(56 257 ) 6800(50(0 <0&$2)*5($7(5&,1&,11$7,

5DLQRUVKLQHVHYHQGD\VDZHHNWKH<LVWKHSODFHWREHWKLVVXPPHU:LWKDFFHVVWR LQGRRUDQGRXWGRRUSRROVZDWHUSDUNVDQGVSODVKDUHDV\RXµOOEHDEOHWRHQMR\DYDULHW\RI IXQ SURJUDPV VXFK DV VZLP OHVVRQV ZDWHU DQG ODQG JURXS ILWQHVV FODVVHV RU MXVW VSODVK DURXQGLQWKHZDWHU)UHHGURSLQFKLOGFDUHLVDYDLODEOHIRUIDPLOLHV 6WRSE\IRUDWRXURUFDOO\RXUORFDO<0&$WRVHWXSDQDSSRLQWPHQWZLWKDPHPEHURIRXU PHPEHUVKLSWHDPWRKHOS\RXJHWVWDUWHGWRGD\ )RUPRUHLQIRUPDWLRQYLVLW0\<RUJRUFDOO  <0&$

Natural Awakenings Greater Cincinnati / Northern Kentucky May 2014  

Special Women's Wellness Issue