Issuu on Google+

FRIDAY, SEPTEMBER 4 2009

FREE – YOURS TO KEEP

THINGS ARE LOOKING UP What’s ahead for the Coast’s vibrant new city centre? ISSUE 55

RENTALS | PROPERTIES FOR SALE | MY HOME REVIEW SECTION & MORE...

Page 1.indd 1

2/09/2009 12:03:45 PM


Open for viewing this Saturday. And after you move in.

Spacious and light-filled, these Water Gallery apartments boast expansive water views at every turn. Featuring balconies over the water, a roof-top terrace, three bedrooms and the best in appliances and finishes, these stunning apartments are a must-see. However, limited opportunities remain to purchase in this beautiful gated community bounded by the Maroochy River and the ocean. Apartments start from $595,000*. So inspect them for yourself this Saturday between 2:00pm and 3:00pm. Water Gallery – 20 Anchorage Circuit, Twin Waters Property Sales Centre – David Low Way, Yaroomba Freecall: 1800 688 530 *Price correct as at 1 September 2009

HCR15059/0909

Page 2.indd 1

1/09/2009 2:45:09 PM


contents

65

On Tuesday the RBA left the official cash rate unchanged at its historic low, three per cent. Speculators anticipated this move and predict a rise of around a quarter of a per cent to come when the board meets again next month. Either way, we’ve had a pretty good run with low interest rates, making buying property all the more appealing. But when it comes to buying, the trickiest part can be knowing where to invest your dollars. Such a huge investment warrants some savvy research, and at MPR we aim to give readers the tools to keep in touch with the current property market. This week’s cover story is the final part in our infrastructure series on the future development of Maroochydore. We report on plans for the Big Top and other areas of Maroochydore as it develops into the Coast’s hub, or, as the council proposition paper calls it, the principle activity centre. With a bustling centre destined to be located so close to the beach, it doesn’t take much research to tell you that Maroochydore property is, and will continue to be, a wise buy.

de Harrison JaEditor

Publishers Anarr Higgins Darryl Olson Michael Kramer Noel Olson Editor Jade Harrison Sub Editor Jemma Pearson

Art Director Noel Harris Production Co-ordinator Kara Taylor Graphic Designer Stephanie Kesper Editorial Assistant Jarna Baudinette

Contributors: Todd Widdicombe, Dave Warner, Julie Gatehouse, Dorothy Drane, Jessica Ainscough, Allison Grant My Property Review is locally owned and published by Sunshine Coast Alliance Publishing Ltd. ABN 13 124 476 142 Distribution Enquiries: 1300 367 352 General & Sales Enquiries: (07) 5443 8866 PO Box 6362, Maroochydore BC, Qld 4558 Editorial: editorial@mypropertyreview.com.au Sales: sales@mypropertyreview.com.au Production: production@mypropertyreview.com.au

cover story 4 8

Cover Story

my world

REAL ESTATE AGENT INDEX

Building the Coast’s city centre

24

7 9 16 20 25 36 37 37 40 42 44 46 46 48 49 50 50 50 52 53 54 54 56 57 59 60 60 61 70

Feature Sell it, donate it or ditch it

18 Market Tracker The latest property sales at a glance

23 Auction Action Results from the latest auctions

24 My World Unique properties from overseas

36 My News & Views Who’s doing what in the industry

55 Commercial

36 my news & views

Commercial properties on offer

56 Hinterland

66 My Display Home Morcraft Homes’ tidy design

Dual-living homes for sale

60 Classifieds

68 My Trend

Property listings and rentals

63 MY HOME REVIEW

PVC fencing products

69 My Design

Building, renovating and styling

64 Jade’s Nail Bag

An Oliver Hume home

70 My Style

DIY problems solved and stories told

65 Cover Story

Country looks for every room

70 Directory

Fences for every yard

e First Homrant Owner G

26

DAYS LEFT

Property-related products & services

FIRST HOME OWNERS GRANT Time is running out to take advantage of the FHOG boost. First home owners who enter into a contract to purchase an established home before September 30 will be eligible for $14,000 (or $10,500 between October 1 and December 31) and those entering into a contract for a newly constructed home are eligible for $21,000 (or $14,000 between October 1 and December 31).

Henzells RE/MAX First National Platinum Properties Ken Guy Stewart Tandy LJ Hooker Kings Beach Realty Raine & Horne Gannon Realty waterfront & coastal property Insite Realty Property Today Brown Realty Buderim Pam Court Realty Colliers International Elders Palmwoods Harcourts RealWay Buderim Go Gecko Kawana Coast Realty Vic Murphy About Real Estate Leading Edge Victor Realty Woombye Real Estate Classifieds Rental Directory Please dispose of My Property Review responsibly, by recycling it after use. MPR is printed on paper manufactured from recovered paper & fibres from sustainably managed forests, produced in ISO 14001 certified mills. Our supplier, MYLLYKOSKI, strongly supports forest certification based on independent third party verification to ensure ongoing environmental compliance.

Helping you make the right move in property and business

www.gplaw.com.au

Our firm Specialises in: • Residential Conveyancing • Commercial Property Sales & Leasing • Management Rights & Body Corporate Law • Business Sales & Franchising

See Griffiths Parry Lawyers before you make your next Property move...

Maroochydore 7 Golf Street. Ph: 5451 1211 Caloundra 17 Wyreema Terrace. Ph: 5491 3133 35 years of Legal Practice on the Sunshine Coast My Property Review | September 4, 2009 3

Page 3.indd 1

2/09/2009 11:15:34 AM


cover story

City sites by Julie Gatehouse

In this third and final part of MPR’s series on Maroochydore, Julie Gatehouse investigates the latest on Emporio, the Big Top, Sunshine Plaza and other developments, and what these changes mean for the surrounding housing market.

T

Group spokesman Bill Darby. “With 25 years’ experience on the Coast, Reed is repositioning to ensure the best outcome for the new Maroochydore CBD.” That means it’s all systems go for Emporio, with residential pre-sales well underway, while the Big Top is

Locals have been buying near where everything’s happening. Before they only cared about being near the beach, now the CBD is becoming popular

wo major projects certain to up the ante in Maroochydore – and enhance the plan to have it as a live-work-play destination – have experienced delays this year. But new moves are generating fresh outlooks for both. A year ago, Reed Property Group revealed plans for Emporio, its cosmopolitan mixed-use precinct at the junction of Maroochy Boulevard and Plaza Parade. Construction was expected early to start this year. Last December Reed lodged an application with Sunshine Coast Regional Council to transform the Big Top shopping centre into a similar sustainable, multistorey, residential, retail and office development. Construction was due to start in 2010. What Reed couldn’t foresee was the surprise collapse during the global financial crisis of its new equity partner, the US investment bank Lehman Brothers. While not affecting Reed’s core business, “it’s meant this year has been quite a transition,” says Reed Property

to be sold to allow another – probably major national – company to take the reins. “Reed is focusing on high-quality residential land and mixed-use developments such as Emporio where we’ve already forged ahead,” says Bill.

The $250 million development covers 5.7 acres at the junction of Maroochy Boulevard and Plaza Parade. There will be nine buildings, including several medium-rise, offering almost 230 apartments, 12,200 square metres of prime office space and ground-level entertainment, shopping, fresh food marketplace and dining. The vibrant, green theme includes parkland and water frontage integrated with public infrastructure such as pathways, bikeways and a recreational plaza. Right from its launch last September, Emporio planned to be affordable for home buyers as well as cosmopolitan and sustainable in its designs. Prices range from $329,900 for a one-bedroom unit to $669,000 for a three-bedroom penthouse. Bill says this year’s delay has allowed the company to spend more time improving floor plans and amenities based on market feedback before the walls go up. “For example, the one-bedroom apartment has been redesigned to include a multi-purpose study/second

4 My Property Review | September 4, 2009

Page 4.indd 1

2/09/2009 11:36:24 AM


bedroom – without increasing the price. That’s what young professional singles and couples are wanting out of inner-urban living,” he says. “We’re getting good residential interest, even though the market’s been tighter generally. We’re continuing to make pre sales in stage one, which includes the first 66 apartments in No 5 Emporio Place, which has a piazza view, and No 7, which has a lake view.” Within the next six weeks, passers-by will notice new activity on site. Work will start on a sales and display centre, to open in November for the busy summer holiday period. It will include a mock unit for people to walk through and see the design standards, from kitchen fit-out and European appliances to high ceilings and air-conditioning. “Shortly after that we plan to commence excavation work on our basement, which covers much of the site,” Bill says. “Then we build the first two residential towers and a commercial building, with the aim of finishing stage one within 18 months.” When all three stages are finished, the development will house and employ more than 1000 people. Over at the Big Top, on the corner of Ocean Street and Duporth Avenue, locals will have to wait for the vision of a new owner. Reed is negotiating with “a couple of interested parties” who are “very successful, major national property developers”. Bill says the Big

the Real Estate Institute of Queensland’s Jean Hamer Top is recognised as a key site central to the Coast’s show Maroochydore’s median house price of $144,000 in growth and hopes for a sale by the end of this year. the year ending March 1999 jumped to $431,000 by the “It will be a positive for Maroochydore because they’ll year ending March 2009. “I always say Coast prices bring a new perspective.” double every seven to 10 years, but that’s just staggering,” Meanwhile the planned $240 million expansion says Jean, who’s been in real estate for 40 years. of the Coast’s biggest shopping centre, Sunshine Plaza, She says while Coast prices have plateaued in the is still in negotiation. Built in 1994 around Cornmeal past 12 months, “it won’t take much to move them up Creek, the Plaza already has several major department again”. “Everyone’s been sitting back waiting for prices to and grocery chains, the region’s biggest cinema complex, drop but, in my opinion, if we were going to get a huge waterfront dining and more than 220 specialty stores. It correction it would have happened by now. employs more than 3000 people. “Th e redevelopment of Maroochydore will give the In mid-2007, developer Lend Lease announced area new impetus, see it grow as a destination over the multiple upgrades which would increase the plaza’s size next few years, and I would expect to see a steady climb by about 25 per cent, adding thousands of square metres in prices. Smart investors won’t be sitting back.” of shop space (including double-level retail bridges) and Demographer Bernard Salt says upgraded hundreds of car parks. infrastructure enhances the enjoyment of a suburb for “Lend Lease Retail continues to work with residents, workers and visitors. People desire a good the council, David Jones and various stakeholders lifestyle where “everything’s on current and future plans,” flowing and workable” and public a spokesperson for the transport is key. Maroochydore company says. Maroochydore is getting will house a major transit centre Maroochydore property linking to planned State the focus it deserves. Clear agents say they’re fielding Government networks such as the inquiries from buyers who want direction from council has Multi-Modal Transport Corridor to move or invest closer to the (roads), CAMCOS (rail) and given developers a good jobs and lifestyle of the new CoastConnect (buses). principal activity centre. framework to supply product Now under construction in “The dynamics of the area are First Avenue is an $84.5 million to a diverse population and already changing,” says Glennis State Government office building. Schindler of Vic Murphy Real install a range of businesses To be owned and managed by the Estate. “More locals have been Department of Public Works, the to improve job prospects buying houses and particularly eight-storey building is expected units near where everything’s to be completed by contractor happening. Before they only Hutchinson Builders in November. Bulk excavation is cared about being near the beach, now the CBD is finished and 80 per cent of ground anchors are installed. becoming more popular. I’ve seen young couples and A departmental spokesperson says the building will singles looking at nice units around the $350,000 mark.” meet high environmentally-sustainable benchmarks Glennis, who has been selling in the Maroochydore/ emphasising energy and water efficiency, a healthy Alexandra Headland area for more than 20 years, also indoor environment and reduced greenhouse gas expects prices to rise as the new infrastructure takes emissions. It will accommodate state agencies including shape. “It’s going to be huge,” she says. “Maroochydore the departments of Communities, Transport and Main has been constrained because it’s all developed. In fact, Roads, Justice and Attorney General, Environment and we’ve got no stock at the moment. We’ve just had a great Resource Management and Public Works. run and if anyone beachside of Maud Street wants to Another office building is going up at Norval Court, sell their home, now is the time.” near the intersection of Maud Street and Sugar Road. The area’s price strength is obvious when comparing median prices over the past decade. Figures analysed for continued over > My Property Review | September 4, 2009 5

Page 5.indd 1

2/09/2009 11:37:04 AM


cover story < from overleaf The Corporate Centre is a new strata-titled development aimed at medical professionals. Developed by MCH Corporation, it will have 3600 square metres of office space and occupation is due mid-2010. Queensland Health has selected Maroochydore as the site of its expected multimillion-dollar community health precinct. It’s bought a 4.35-hectare land parcel adjacent to Dalton Drive to provide a range of medical services. A spokesperson says a review of the District Health Service plan will confirm the scope of this project and timing of construction. Rod McLean, whose agency has a rent roll of 300 landlords, predicts investors will return in numbers to the market in Maroochydore and surrounding areas. “The past year it’s been first-home buyers, but as more people get new jobs here, even during construction, tenant demand will rise along with investor opportunities,” he says. “With interest rates tipped to rise, investors will be back into buying mode.”

He points to streets behind Sunshine Plaza, Millwell and School roads and the nearby suburb of Kuluin. “A lot of people are already buying older homes in the Maroochydore Beach precinct and doing extensive renovations or pulling them down to rebuild,” says Rod. “This will become more prominent, and competition will increase. Plus we’ll have all the new housing and land products.” Bill Darby says Reed has “a lot of confidence in Maroochydore as a future cultural hub”. Its recently completed Riva building is one of Reed’s several luxury waterfront projects in Duporth Avenue. “The purchasers recently settled at Riva and, like Platinum and Aurora, this street has become a real jewel with penthouses going for more than $5 million,” Bill says. “Maroochydore is turning around and getting the focus it deserves. Clear direction from council has given developers like us a good framework to supply product to a diverse population and install a range of businesses to improve job prospects.”

Maroochydore Health Precinct land – Dalton Drive

Living Choice snaps up more land at Sunshine Cove

L

eading retirement village owner Living Choice has increased its property portfolio at Sunshine Cove (formerly Wises Farm) in Maroochydore, purchasing an additional 3.2 hectares for residential and commercial development. The investment adds to the six hectares it previously purchased at Sunshine Cove for the development of a waterfront retirement village. Included in the latest acquisition are residential north-facing, waterfront lots on Sunrise Drive, which should be available in February/March 2010. The residential lots can accommodate a maximum height of three storeys while the commercial/ mixed-use site, on the corner of Sunrise Drive and Maroochy Boulevard, can accommodate buildings of between three and six storeys. Living Choice director Ian Tregoning believes the Sunshine Cove site will prove to be the Sunshine Coast’s most sought-after residential and commercial precinct. “Sunshine Plaza is just minutes away and there is convenient and easy access to the Maroochy CBD and its many leisure and medical facilities.” The six-hectare retirement village site, to be called Living Choice Sunshine Cove, will include both independent and supported living apartments and will be the largest of the company’s eight retirement villages. With established villages at Twin Waters and Kawana Island, the Sunshine Cove village will significantly increase the company’s investment in the retirement industry on the Sunshine Coast.

An aerial view of Sunshine Cove with the Living Choice-owned land outlined in yellow Source: Queensland Government

6 My Property Review | September 4, 2009

Page 6.indd 1

2/09/2009 11:38:27 AM


www.henzells.com.au

CALOUNDRA – Brilliant waterfront position with brilliant views….. What you see is what you get… views, views and more views. Rarely would you find absolute beachfront living with all of life’s little luxuries like you’d find with this apartment located right on the water’s edge. • Enjoys the most stunning ocean panorama out to the Pacific Ocean, Moreton and Bribie Islands and Happy Valley • Unwind, kick back and take it all in…watch the whales and ships cruising by or head down to the beach for some surf, sand and sun! • Whether it’s fishing, surfing, sunbaking, shopping, dining or just relaxing, this unit and location has it all covered.

Auction: Saturday 3rd October onsite at 2pm Inspect: Saturday & Sunday 1 - 1.30pm Address: Unit 6 Monterey Lodge, 27 Warne Tce, Caloundra henzells.com.au property code: mont6 Agent: Doug Wilson 0417 734 592

• Perched on the hill to take full advantage of its position, complex is handy to both surf patrolled Kings Beach and seconds to the calm waters of Happy Valley and Bulcock Beach • Fully furnished, 3 bdrms, 2 bthrms, laundry, open plan living and an ocean facing balcony • Complex features secure underground parking + storage, pool, bbq facilities and private tennis court

MOFFAT BEACH – Affordable luxury must be sold!

CURRIMUNDI – Live the dream!

• Motivated seller, could be your lucky break • Modern,four bedroom, 3 bathroom, nothing to spend Price: Expressions of Interest just walk in and start living Inspect: Sat & Sun 11-11.45am • Spacious living option, guest room on lower level, Address: 15 Headland Court, Moffat Beach great gourmet kitchen opening to covered outdoor (off Edmund Street) living henzells.com.au property code: headl15 Agent: Donna Sheen 0431 412 599 • Private location within easy walking to beaches

• On the waters edge this 3rd floor furnished unit offers 2 bedrooms, 2 bathrooms and 3 balconies • The complex of 17 has secure parking, pool, lift and intercom – live-in or holiday let • Fishing, swimming, surfing, boating at your doorstep • Vendor instructs sell at or before Auction

Auction: Friday 11th Sept onsite at 10am Inspect: Sat, Sun & Wed 2-2.45pm Address: Unit 11 The Outlook Currimundi, 9 Hume Parade, Currimundi henzells.com.au property code: theo11 Agent: Julie Shirvington 0418 710 018

My Property Review | September 4, 2009 7

Page 7.indd 1

1/09/2009 1:53:22 PM


feature

Cashing in on the clutter Now is the perfect time to embark on a spring clean – especially if you’re getting your home ready to sell. But what should you do with all the things you no longer want or need? Make three piles – one to throw out, one to donate, and one to sell.

Parting is such sweet sorrow

It’s great to donate

Make the sale

Try to remove the emotion from the sorting process. If you haven’t used an item in the past 12 months, it’s time to rid your home of it. Don’t hang on to things because you think you might use them one day – odds are you won’t. We tend to hang on to old clothes that no longer fit or we haven’t worn in years in the belief that they will come me in n handy again one day, but they probably ably won’t. Look at each item through ugh objective eyes and remember that while you might no need d it any longer, someone will get some use out of it.

Local charities are grateful for your donations, especially goods they can sell in their op shops. The funds raised there go towards helping the needy in your community. Decide on a charity and give them a call to discuss your donation so they can advise you on the best way to deliver your goods. They s. may even be happy to collect larger items. While charity donation bins are handy, they are often full, so it’s best to deliver your goods directly to the non-profit organisation.

Who doesn’t love a good garage sale? They can be a lot of work but a garage sale will rid you of a large number of items in one day. It’s important to advertise your sale via a website such as egaragesales.com.au or your local paper. Also consider directional signage and a letterbox drop in your neighbourhood to ensure your sale is easy to find. Make sure you are reasonable with your pricing and be prepared to haggle – everyone loves a bargain. Also make certain you have plenty of change on the day.

eBay is the way If in doubt, throw it out Could someone use your stuff, or has it well and truly seen better days? While it’s generous to donate to local charities, make sure the items you are giving away are in a useable condition. If not, throw them out. There are many ways to dispose of rubbish. You could hire a skip (a large freestanding bin), which will be delivered to your home for an agreed period of time, and then taken away a few days or weeks later. If you have a trailer, consider taking a load to your local tip or dump. And don’t forget to recycle!

We have now dealt with two of the three piles of your useless stuff – you’ve dumped the rubbish and have donated some of the useful goods. So what about those valuable items that could fetch a good price? Why not sell them on eBay (www.ebay.com.au)? It’s an easy-touse and cost-effective online auction site designed to connect buyers with sellers all over the country. But do your research first to ensure you get the best price for your valuables.

odies Oldies but goodies Perhaps a flea market is more your style? The best thing about having a stall at a flea market is that you are guaranteed a steady flow of customers. It will cost you and you’ll have to set up early in the morning, but get a group of friends together and it can be a fun day out, too. If you really can’t face the crowds, taking out an ad in your local newspaper is still an effective way to part with your old stuff. Newspaper ads tend to be a little more costly than online sites such as eBay, and it’s likely that you’ll have to field many phone calls before finding the right buyer, but it’s still an option that works.

www.henzells.com.au

IVADALE LAKES – Circumstance forces auction

PELICAN WATERS – This is your chance!!

• 3 bedrooms, 2 bathrooms plus study • Master bedroom/ walk-in robe with ensuite and his and her basins Auction: Friday 11th Sept onsite at 3pm • Spacious separate formal lounge-dining with 9’ ceilings Inspect: Saturday 12-12.45pm • Open plan meals- living spilling off a functional family Address: 3 Parkhollow Mews, Ivadale Lakes size kitchen henzells.com.au property code: park3 • On 500sqm’s walking distance to Meridian College/ Agent: Matt Glynn 0404 315 066 shops

• This home ticks all the boxes in a quiet area of Pelican Waters close to shops, schools and beach • Pool, dual entertaining, side access • 4 bedrooms, ensuite, office, versatile living, air-con • Modern functional kitchen, big garage • Wheelchair friendly and lots, lots more • Cul-de-sac position

Auction: Friday 11th Sept onsite at 1pm Inspect: Sat & Sun 1-2pm Address: 30 Firefly Street, Pelican Waters henzells.com.au property code: fire30 Agent: Michael Lindsay 0421 017 046

8 My Property Review | September 4, 2009

Page 8.indd 1

1/09/2009 2:40:14 PM


17 Oceanic Drive WARANA ABSOLUTE BEACHFRONT! WILL SELL BELOW REPLACEMENT COST - Disregard any previous price indication: THIS MUST SELL! - Enjoy unsurpassed views of the Pacific Ocean and Warana surf beach and out to the glasshouse mountains - Absolute beach front with your own private access to the 14km of secluded beaches - Self contained teenagers retreat downstairs with kitchenette - Professional office with separate entry, suit home office - 3 car accommodation, plenty of room for the boat and caravan - Owners instructions are clear “Sell now or at Auction”!

BED 4

BATH 2

PARKING 3

PROUDLY PRESENTED BY

Grant Cheatham 0411 467 917 Prestige Property Consultant INSPECT Sat & Sun 12-12.45pm WEB remax.com.au ID# 1282487 AUCTION In-Room Garry Crick Mercedes September 22nd at 6pm

TOORBUL%SPLANADE

3

2

2

3

MALENY 13 Tamarind Street

2

2

PRIME REAL ESTATE – INVESTOR LIQUIDATING!

QUEENSLANDER - CHARACTER HOME IN THE TOWN AREA

s0RIMEWATERFRONTREALESTATE THISPROPERTYISAN investors wind fall and retirees dream!

s,ARGENORTHFACINGVERANDAH s2OOMFOREXPANSIONUNDERNEATH s-OSTLYRENOVATEDnORIGINALSTYLERETAINED s4WOLIVINGAREAS s%STABLISHEDLEVELBLOCKM§ s!BUNDANTBIRDLIFE ESTABLISHEDNATIVETREES s4ENNISCOURTSIZEDLANDTOTHESIDE s7ALKTOSHOPSANDSCHOOLS

s5NOBSTRUCTEDVIEWSACROSSTHE0UMICESTONE Passage to beautiful Bribie Island

INSPECT :: Saturday 12.30-1.15pm AUCTION :: In-Room 22nd September, 2009

sBEDROOMS BATHROOMS DOUBLELOCK UPGARAGE WEB :: remaxproperty.com.au ID# 1282542 + double side access for the boating enthusiast CONTACT :: Donna Conrad 0401 502 078 s#LOSETOBOATRAMPANDLOCALFACILITIES s-OTIVATEDVENDORANUNDERSTATEMENT

Exceed Expectations - Everybody Wins

BUDERIM 5445 6722 39 Main Street

CALOUNDRA 5438 5222 79 Bulcock Street

MOOLOOLABA 5452 4555 103 Brisbane Road

INSPECT :: Friday & Saturday 12-12.30pm AUCTION :: In-Room 22nd September, 2009 WEB

:: remaxproperty.com.au ID# 1264775

CONTACT :: Ray Scarfe 0414 943 269

COOLUM 5455 1600 5/21-37 Birtwill Street

NAMBOUR 5441 7008 Cnr Currie & Howard Sts

My Property Review | September 4, 2009 9

Page 9.indd 1

2/09/2009 9:08:05 AM


Proudly marketed by Andrew Kirby Australian Top 5 www.remaxproperty.com.au 3

BUDERIM7ILGUY#RESCENT SUBURB Address

2

2

RENOVATE, RE-DEVELOP OR MOVE IN NOW s!NDREW+IRBYn!USTRALIAS.UMBER2%-!8SALESCONSULTANT PRESENTSANOTHERHIGHQUALITYPROPERTY s0OSITIONEDJUSTMOMENTSFROMTHECENTREOF"UDERIM THISGREATINVESTMENTOFFERSSQUAREMETRESOFPRIME3UNSHINE#OASTREALESTATE INSPECT :: Saturday, 5th September, 11.30am-12noon s!RAREOPPORTUNITYTOSECUREAVALUABLE"UDERIMPROPERTY

AUCTION :: Saturday 26th September WEB

s4HISBEDROOMHOMEISIDEALFORRENOVATING RE DEVELOPTHESITEORJUSTMOVEINNOW

:: remaxproperty.com.au ID# 1282514

CONTACT :: Andrew Kirby 0407 588 636 s!DDALEVELTOTHISHOMEANDTAKEINTHEBEAUTIFULOCEANVIEWSCENERYTHATISTHEFAMOUSWORLDCLASS3UNSHINE#OASTBEACHES s02)/2/&&%23#/.3)$%2%$0HONE!NDREW+IRBYNOWON

Exceed Expectations - Everybody Wins

BUDERIM 5445 6722 39 Main Street

CALOUNDRA 5438 5222 79 Bulcock Street

MOOLOOLABA 5452 4555 103 Brisbane Road

COOLUM 5455 1600 5/21-37 Birtwill Street

NAMBOUR 5441 7008 Cnr Currie & Howard Sts

10 My Property Review | September 4, 2009

Page 10.indd 1

1/09/2009 11:24:18 AM


Australia’s Premier RE/MAX Agent Michael Knights www.michaelknights.com.au 4

MOUNTAIN CREEK 31 Kapilano Crescent

2

2

BIG BARGAIN PRICE = PARTY BY THE BBQ tEntertain all year around in the beautiful family home t)VHFDPWFSFEFOUFSUBJONFOUBSFBPWFSMPPLJOH TQBSLMJOHJOHSPVOEQPPM tSeparate lounge dining area, formal lounge and study t"JSDPOEJUJPOFEUISPVHIPVUomSFQMBDFGPSXJOUFS t4JUVBUFEJOUIF.PVOUBJO$SFFLTDIPPM[POF t1PTJUJPOFEBDSPTTUIFSPBEGSPNUIFMBLF t"TVQFSVSHFOUTBMFJTOFFEFE

INSPECT :: Saturday 1-1.30pm AUCTION :: On Site Saturday 12th September at 12.30pm WEB

:: remaxproperty.com.au ID# 1280759

CONTACT :: Michael Knights 0409 018 778

5

ALEXANDRA HEADLAND:BLPMB1BSBEF

2

1

THE SURFERS BEACH SHACK – RED HOT BUY t)JHIPO"MFYBOESB)FBEMBOE)JMM t3FBMNPOFZNBLJOHPQQPSUVOJUZ tTRNPGEFWFMPQNFOUQPUFOUJBM t/FFETBSFOPWBUJPOoCSJOHZPVSDIFRVFCPPL t1PMJTIFEUJNCFSnPPSToMBSHFLJUDIFO t7FSZTIPSUXBMLUP"MFYTVSGCFBDI t$MPTFUPUIFDMVC DBGFTBOEBMMBNFOJUJFT t1SJNF"MFY)FBETMPDBUJPOBUBCFMPXWBMVFQSJDF

INSPECT :: Saturday 12-12.30pm AUCTION :: On Site Saturday 12th September at 3.30pm WEB

:: remaxproperty.com.au ID# 1280803

CONTACT :: Michael Knights 0409 018 778

3

2

2

ON

SIT AUC E S TIO AT N 2.3 0P M

SIPPY DOWNS3JWFSPBL8BZ

RED HOT BUYING – YOU BET – SELLING REGARDLESS! t%POUNJTTPVUPOUIJTBCTPMVUFCBSHBJO t6OGPSUVOBUFQFSTPOBMDJSDVNTUBODFTIBWFGPSDFE UIFTFMMFSTUPTFMMOPNBUUFSXIBU t8JMMTVJUTUIPNFCVZFSTBOETNBSUJOWFTUPST t%JOJOHPWFSMPPLJOHMBSHFDPWFSFEQFSHPMB t&YDFMMFOUTJ[FECFESPPNT t7FSZRVJFUTUSFFUJOUIF#FMMnPXFS&TUBUF

INSPECT :: Saturday 2-2.30pm AUCTION :: On Site Saturday 5th September at 2.30pm WEB

:: remaxproperty.com.au ID# 1278597

CONTACT :: Michael Knights 0409 018 778

804 Sqm Block

TWIN WATERS7FFSJOHT3PBE

THE CHEAPEST WATERFRONT BLOCK BY FAR IN TWIN WATERS tQSDJFTMBTIFECZUIPVTBOETGPSBOJNNFEJBUFTBMF t5IJTCMVFDIJQQSJNFXBUFSGSPOUMBOENVTUCFTPME INSPECT t/PXBMMPGGFSTXJMMCFDPOTJEFSFESFHBSEMFTT AUCTION t:PVNBZOFWFSIBWFBOPUIFSPQQPSUVOJUZBTHPPE BTUIJTUPCVZMBOEBUUIJTMFWFM WEB t%POUNJTTPVUUIJTJTUIFIPUUFTUMBOEPOUIFNBSLFU CONTACT on the Sunshine Coast t1MBDFZPVSPGGFSUPEBZ

Exceed Expectations - Everybody Wins

BUDERIM 5445 6722 39 Main Street

CALOUNDRA 5438 5222 79 Bulcock Street

MOOLOOLABA 5452 4555 103 Brisbane Road

COOLUM 5455 1600 5/21-37 Birtwill Street

:: Anytime :: On Site 12th September at 11am :: remaxproperty.com.au ID# 1271592 :: Michael Knights 0409 018 778

NAMBOUR 5441 7008 Cnr Currie & Howard Sts

My Property Review | September 4, 2009 11

Page 11.indd 1

1/09/2009 10:37:18 AM


Proudly marketed by Paul Becker & Donna Danger www.remaxproperty.com.au 4

CHEVALLUM$IFWBMMVN4DIPPM3E

2

3+

PEACE, PRIVACY & SPACE ON 1 HECTARE + t5IFPXOFSTJOTUSVDUJPOTBSFDMFBSTFMMCZQVCMJDBVDUJPO t-BSHFGBNJMZIPNFTFUPON2PGCFBVUJGVMSVSBMMBOE tCFESPPNT CBUISPPNT TUVEZ NPEFSOLJUDIFOXJUIHBTDPPLUPQ t-BSHFGBNJMZSPPNXJUImSFQMBDFTFQBSBUFLJETQMBZBSFB t8JEFUJNCFSEFDLTPWFSMPPLJOHUIFQPPMXJUINBKFTUJDIJOUFSMBOEWJFXT t*ODMVEFTTQSJOHGFEEBNBOEJSSJHBUJPOTZTUFN t0WFS MJUSFTPGUBOLXBUFSPOTJUF t4PMBSIFBUJOHGPSIPUXBUFSTZTUFNBOEQPPM t$BSDBSQPSU QMVTCBZTIFEBOEPGGTUSFFUQBSLJOH t*ODMVEFTBEPXOTUBJSTCFETJUXJUICBUISPPN

INSPECT :: Saturday & Sunday 1-1.45pm AUCTION :: On Site Saturday 19th September @ 2.30pm WEB

:: remaxproperty.com.au ID# 1281075

CONTACT :: Paul Becker 0401 024 010 Donna Danger 0412 152 676

2, 3, 4

BUDERIM$OSPG4USJOHCBSL3E5PSBM%SJWF

2.5

1,2

“DOWNSIZING” – LOOK NO FURTHER t5PSBMQBSLUFSSBDFTSFQSFTFOUTRVBMJUZUPXOIPVTFMJWJOHJOBTFDVSFFOWJBCMF FOWJSPONFOUBUBGGPSEBCMFQSJDFT4FDVSFZPVSGVUVSFOPX t*ODMVEFTTUBJOMFTTTUFFMBQQMJBODFT EJTIXBTIFS HBTDPPLUPQ  t(SBOJUFCFODIUPQTBOETQMJUTZTUFNBJSDPOEJUJPOJOH t*ODMVEFT  CFESPPNT CBUISPPNTXJUIQSJWBUFDPVSUZBSEBOEEFDLT t)BOEZUPQSJWBUFBOEQVCMJDTDIPPMTBOEXBMLUP6OJWFSTJUZ t#VJMEJOHIBTDPNNFODFEBOEDPNQMFUJPOFYQFDUFE.BSDI t(SPTTSFUVSOTQSPKFDUFEGPSJOWFTUPSTBUDPNQMFUJPO t$POUSBDUTXJMMCFDPOTJEFSFETVCKFDUUPUIFTBMFPGZPVS4VOTIJOF$PBTU QSPQFSUZBOEmOBODFJTBWBJMBCMFUPBQQSPWFEQVSDIBTFST

Exceed Expectations - Everybody Wins

INSPECT :: On Site daily Mon-Fri 12-4pm Saturday 10-3pm PRICE

:: Starting from $359,000

WEB

:: remaxproperty.com.au ID# 1247110

CONTACT :: Paul Becker 0401 024 010 Donna Danger 0412 152 676

BUDERIM 5445 6722 39 Main Street

CALOUNDRA 5438 5222 79 Bulcock Street

MOOLOOLABA 5452 4555 103 Brisbane Road

COOLUM 5455 1600 5/21-37 Birtwill Street

NAMBOUR 5441 7008 Cnr Currie & Howard Sts

12 My Property Review | September 4, 2009

Page 12.indd 1

2/09/2009 11:09:51 AM


www.remaxproperty.com.au BUDERIM Unit 12/2 Box Street

3

2

1

3

2

2

LARGE GROUND FLOOR BUDERIM UNIT This modern 3 bedroom ground ï¬&#x201A;oor unit provides fantastic access to everything Buderim has to offer. Your own private courtyard and large undercover area adjoins the master, second bedroom and living areas, providing an exclusive sanctuary for entertaining or just relaxing. The expansive yard rivals many house blocks and allows for some pets. This property includes a master bedroom with WIR and ensuite, air-conditioning,

INSPECT :: Saturday 5th September 12-12.45pm PRICE

:: $448,000

WEB

:: remaxproperty.com.au ID# 1277307

CONTACT :: Russell Dell 0400409 000 Darren Rix 0416188259

security screens and extensive storage cupboards. All within walking distance to shops, medical centres, public transport and parks. Inspect now!

NAMBOUR6ISTA%STATE!SPLAND3TREET

1ST TIME BUYERS â&#x20AC;&#x201C; THE CLOCK IS TICKING sBEDTOWNHOUSESSETINANIDYLLICLOCATIONMINUTESFROM#"$ s3TYLISHANDSPACIOUSPROPERTIESATANINCREDIBLEPRICE

INSPECT :: Saturday 11am-1pm

s(IGHQUALITYEN SUITEDHOMESALLWITHALARMSANDAUTOGARAGES

PRICE

:: From $329,000

sSTHOMEBUYERSQUALIFYFOR UNTIL3EPTEMBER

WEB

:: remaxproperty.com.au ID# 1283508

s4ASTEFULLYlNISHEDTHROUGHOUTINNEUTRALCOLOURSCHEME

CONTACT :: David Hedley-Ward 0406 011 123 Russell Dell 0400 409 000 Craig Heppell (Victor Realty) 0400 180 515

s'REATLOCATIONFORACCESSTOSCHOOLS HOSPITALANDTRANSPORTLINKS s./34!-0$549 &INANCEAVAILABLETOAPPROVEDPURCHASERS s$EVELOPERHASPRICEDTOSELL$ONOTMISSOUT

Exceed Expectations - Everybody Wins

BUDERIM 5445 6722 39 Main Street

CALOUNDRA 5438 5222 79 Bulcock Street

MOOLOOLABA 5452 4555 103 Brisbane Road

COOLUM 5455 1600 5/21-37 Birtwill Street

NAMBOUR 5441 7008 Cnr Currie & Howard Sts

My Property Review | September 4, 2009 13

Page 13.indd 1

9/1/2009 1:57:54 PM


www.remaxproperty.com.au 4

3

2

O AU SE N SIT CTI PT E ON EM F R BE IDA R1 Y 1

AROONA0AKENHAM3TREET

LIVING ON CLOUD 39 s3PREADYOURWINGSANDRELAXINTHISBEAUTIFULLYSPACIOUSHOMEONAQUARTER OFANACREWITHOUTSTANDINGVIEWSFROMITSMASSIVEVERANDAH s4WOLEVELSOFLIVINGWITHFORMALANDCASUALLOUNGEANDDININGAREAS s%NVIABLEGAMESROOM LIBRARYSETUP OFlCEANDDEDICATEDWORKSHOP s%LEGANTBEDROOMS MASTERWITHENSUITE DESIGNERMASTERBATHROOMPLUSTWO ADDITIONALSEPARATETOILETSFORULTIMATEFAMILYLIVING s'ORGEOUSTERRACEDGARDENSWITHRETICULATIONSETUPFROMTWOWATERTANKS s$UCTEDAIRCOND SOLARPOWER SECURITYSCREENSANDEVENAv,#$46 s3OCLOSETO$ICKY"EACH SCHOOLS SHOPSANDCHILDCARECENTRES

KINGS BEACH 56ERNEY3TREET

2

INSPECT :: Saturday 3-3.30pm AUCTION :: On Site September 11 at 5.30pm WEB

:: remaxproperty.com.au ID# 1276735

CONTACT :: Michael Kettle 07 5438 5213 or 0419 728 807

2

2

QUIET SOPHISTICATION 4HELISTOFINCLUSIONSISENDLESS3UMPTUOUSFULLSIZE ENSUITE LARGEGOURMETKITCHEN SPACIOUSFORMAL LIVINGANDSEPARATEFAMILYROOM OUTDOORTERRACESON BOTHSIDES SECUREDOUBLECARACCOMMODATION M POOLANDON SITEGYMNASIUM*USTAMINUTEWALK FROM+ING"EACHPARKLANDS CAFES RESTAURANTSAND BEACH4HE/BSERVATORYISPERFECTFORLIVINGIN PER MANENTRENTALORLOCKUPANDLEAVEFORYOURHOLIDAYS ANDWEEKENDS#ALLTODAY

KAWANA FOREST"OOYONG3TREET

4

2

2

PRICE REDUCED TO SELL!! INSPECT :: Saturday 1-1.30pm PRICE

:: $498,000

WEB

:: remaxproperty.com.au ID# 1280847

CONTACT :: Brian Jones 5438 5225 / 0412 713 686 Eric Werne 5438 5221 / 0407 145 504

Exceed Expectations - Everybody Wins

BUDERIM 5445 6722 39 Main Street

s'ORGEOUSHOMEONELEVATEDBLOCKINCULDESAC STREET s$EDICATEDMEDIAROOM WIREDFORSOUND s&UNKYKITCHENWITHQUALITYAPPLIANCES s'OODSIZEBLOCK SIDEACCESS ROOMFORAPOOL s4RENDYANDSTYLISHlXTURESANDlTTINGS s,OCATEDINSUPERIORPOSITIONWITHPARKRESERVE ATENDOFTHESTREETANDJUSTMETRESTORAINFOREST WALKWAY

CALOUNDRA 5438 5222 79 Bulcock Street

MOOLOOLABA 5452 4555 103 Brisbane Road

INSPECT :: Saturday 12-12.45pm PRICE

:: $539,000

WEB

:: remaxproperty.com.au ID# 1280771

CONTACT :: Jackie Marker 0406 995 055 www.jackiemarker.com.au

COOLUM 5455 1600 5/21-37 Birtwill Street

NAMBOUR 5441 7008 Cnr Currie & Howard Sts

14 My Property Review | September 4, 2009

Page 14.indd 1

1/09/2009 11:15:41 AM


www.remaxproperty.com.au 4

MERIDAN PLAINS 63 Kurrajong Crescent

2

1

AFFORDABLE LIVING IN PARADISE t5IJTTUZMJTIDPNGPSUBCMF#FESPPN)PNFJO CFBVUJGVM,BXBOB'PSFTUBXBJUTJUTOFXPXOFS t.BTTJWFIJHIDFJMJOHTDSFBUFBGFFMJOHPG spaciousness throughout. t&OKPZFOUFSUBJOJOHPOUIFBMGSFTDPEFDLPWFSMPPLJOH the back yard. t&BTZBDDFTTUPTIPQT CFBDIFT XBMLJOHBOEDZDMF tracks and public transport.

4

WURTULLA 8 Mizzen Close

2

2

INSPECT :: Phone Andrew Kirby to inspect PRICE

:: $449,000

WEB

:: remaxproperty.com.au ID# 1281094

CONTACT :: Andrew Kirby 0407 588 636

4

BUDDINA 24 Adelong Crescent

THE MAGIC OF QUIET CANAL LIVING

CENTRAL BUDDINA OPPOSITE WATER

t1SJDFSFEVDFEUPVOEFS GPSRVJDLTBMF t&YDMVTJWFXBUFSGSPOUDBOBMMJWJOHJORVJFUDVMEFTBD tCFESPPNT MPVOHF GBNJMZ EJOJOH SVNQVT FOTVJUF  galley style kitchen. t*OHSPVOEQPPMPWFSMPPLJOHDBOBMBOESFBSQFSHPMB t%PVCMFMPDLVQHBSBHFQMVTTJEFBDDFTTGPSCPBU

t+VTUBGFXNJOVUFTXBMLUP,BXBOB4IPQQJOH8PSME  Tavern and Buddina Beaches t%JSFDUMZPQQPTJUF-BVSJFT.BSJOB tCFESPPNTXJUICVJMUJOSPCFT TQBDJPVTMJWJOHBSFB t'VMMZGFODFECBDLZBSEXJUIJOHSPVOEQPPM t.PUJWBUFETFMMFSTTFFLJNNFEJBUFTBMFoBMMPGGFST considered

INSPECT :: Saturday 2-2.30pm PRICE

:: $699,000

WEB

:: remaxproperty.com.au ID# 1278058

CONTACT :: Keven Hyde 0422 238 329 or 5438-5218

tClose to Kawana Lake, park, shops, schools, transport.

1

2

INSPECT :: By appointment PRICE

:: $520,000

CONTACT :: Chrissy Hamley & Paul Price 0409 575 361

FAST TRACK GUIDE TO OPEN FOR INSPECTIONS

AUCTION Maroochydore 2/81 Sixth Avenue SATURDAY 3PM Auction on site 3.30pm Michael Knights 0409 018 778

Sippy Downs 17 Riveroak Way SATURDAY 2 - 2.30PM â&#x20AC;&#x201C; AUCTION 2.30PM 3 brms, 2 bthrms, 2 car garage, 450sqm Michael Knights 0409 018 778

HOUSES Alexandra Headland 55 Yakola Parade SATURDAY 12 - 12.30PM 5 brms, 2 bthrms, 607sqm block Michael Knights 0409 018 778

Aroona 39 Pakenham Street SATURDAY 3 - 3.30PM Huge 4 bed home with breath-taking views Michael Kettle 0419 728 807

Bli Bli 78 Willis Road SATURDAY 11 - 11.45AM 5 brm, study, 3 bath, views, 2854m², $565K Steve G Pery 0448 884 093

Exceed Expectations - Everybody Wins

Buderim

50 Aspland Street SATURDAY 11AM - 1PM 2 & 3 bed townhouses from $329,000 David Hedley-Ward 0406 011 123 & Russell Dell 0400 409 000

Chevallum

SATURDAY 12 - 12.45PM 4 bed, 2 bath, 2 car & pool $459,000 Darren Rix 0416 188 259

Toorbul 28 Esplanade

Kawana Forest

SATURDAY 12.30 - 1.15PM

12 Booyong Street SATURDAY 12 - 12.45PM 4 bed, 2 bath, 621sqm, side access Jackie Marker 0406 995 055

Alexandra Headland Unit 35 â&#x20AC;&#x153;Grand Palaisâ&#x20AC;? 188 Alexandra Parade SUNDAY 12 - 12.30PM Seaviews, cute 1 bed, furn, resort $329K ONO Jenni Laughlin 0407 439 531

Sippy Downs 3 Franklin Place

69 Chevallum School Road SAT & SUN 1 - 1.45PM 4 bed, 2 bath, bedsit on 10960m² land Donna Danger 0412 152 676 Paul Becker 0401 024 010

Prime real estate â&#x20AC;&#x201C; investor liquidating

Buderim Cnr of Stringybark Road & Toral Drive ONSITE MON - FRI 12 - 4PM & SAT 10 - 3PM 2, 3, 4 bed, 2.5 bath, SLUG, DLUG Donna Danger 0412 152 676 Paul Becker 0401 024 010 Unit 12/2 Box Street SATURDAY 12 - 12.45PM 3 bed, 2 bath, 1 car unit with yard. $448K Darren Rix 0416 188 259 Russell Dell 0400 409 000

Kings Beach

Donna Conrad 0401 502 078

Warana

Maleny

17 Oceanic Drive SAT & SUN 12 - 12.45PM

13 Tamarind Street FRI & SAT 12 - 12.30PM Character home in town area Ray Scarfe 0414 943 269

U203 â&#x20AC;&#x153;The Observatoryâ&#x20AC;?0 5 Verney Street SATURDAY 1 - 1.30PM 2 bed, 2 bath, 2 living, 2 car, walk to beach, $498K Brian Jones 0412 713 686

4 bed, 3 bath, 2 car

Maroochydore

Grant Cheatham 0411 467 917

Wurtulla

Mountain Creek

8 Mizzen Close

31 Kapilano Crescent SATURDAY 1 - 1.30PM 4 bdrms, 2 bthrms, 2 garage, 776sqm, pool Michael Knights 0409 018 778

BUDERIM 5445 6722 39 Main Street

UNITS

Nambour

8 Rhapis Court SATURDAY 11 - 11.45AM 5 bed, 3 bath, classic Queenslander Donna-Lee Foster 0422 230 896 3 Wilguy Crescent SATURDAY 11.30AM - 12 NOON Prime Buderim position, 3 beds, 2 bath Andrew Kirby 0407 588 636

SATURDAY 2 - 2.30PM 4 bedroom canal waterfront home with pool Keven Hyde 0422 238 329 or 5438 5218

CALOUNDRA 5438 5222 79 Bulcock Street

MOOLOOLABA 5452 4555 103 Brisbane Road

Unit 35 â&#x20AC;&#x153;Elouera Towerâ&#x20AC;? 81 Sixth Avenue SATURDAY 1 - 1.30PM Spectacular seaview, 2 bed, ens $499,000 Jenni Laughlin 0407 439 531 Unit 22 â&#x20AC;&#x153;Regentâ&#x20AC;&#x2122;s Landing No 1â&#x20AC;? 19 Arwen St SAT & SUN 2.30 - 3.30PM 2 bed, 1 bath, big c/yard, 1 LU $299,000 ONO Jenni Laughlin 0407 439 531

COOLUM 5455 1600 5/21-37 Birtwill Street

NAMBOUR 5441 7008 Cnr Currie & Howard Sts

My Property Review | September 4, 2009 15

Page 15.indd 1

1/09/2009 2:01:33 PM


FIRST NATIONAL R E A L

www.firstnational.com.au

E S T A T E

25

Shane Purssell

CONTRACTS IN

Amanda McMullin Angeline Janssen Claire Parkinson

David Grenfell

Felicity Richardson

0402 012 142

PA to Shane Purssell

0418 210 070

0419 946 534

Administration

Karen Barker

Raewyn Porter

Keiran Burns

Katie Hoodless Kimberly Bourgois

0418 572 676

PM Reception

Letting Officer

Property Manager

36

Office Manager

0416 237 484

Mary Yates 0407 657 330

Katrine Stevens

Shannon Pugh

Sabrina Wilmes

Adam Bond

Tania Bell

Property Manager

Property Manager

Administration Manager

0404 211 281

Business Development Manager

DAYS

“We are the difference between For Sale & SOLD” Rod McLean - Principal

“We have Buyers but we need listings now” Maroochydore

Ph: (07) 5479 6600 www.mfnre.com.au

FIRST NATIONAL REAL ESTATE

Value For Money

Private Home / Private Position

Located opposite famous Alexandra Headland beach, this third level due north aspect apartment features 2 large bedrooms with the master having ensuite with spa bath, modern kitchen, large living area , air-conditioning, large north facing balcony. Single basement car space, pool and onsite management.

Three bedroom brick and tiled home with tiled air-conditioned living areas complimented by immaculate paint, blinds, fixtures and fittings including stainless steel fans. Small neat garden. Open garage with lock up storeroom and extra car park. Good quiet street walking distance to school, day care centre and public transport, only minutes drive to River and Maroochydore township and Plaza shopping.

Address:

Unit 54 Grand Palais 188-192 Alexandra Parade, Alexandra Headland Inspect: Saturday 12-12.30pm View: www.mfnre.com.au/1111144 Price: $299,000 Contact: Shane Purssell 0402 012 142 Maroochydore First National 5409 9910

Address: 36 Daintree Close, Kuluin Inspect: Saturday 11-11.30am View: www.mfnre.com.au/1132197 Price: $372,000 Contact: Shane Purssell 0402 012 142 Maroochydore First National 5409 9910

Ocean Views at Affordable Price

Hear The Surf Roll In You can just about throw your towel onto the famous surfing beach at Alexandra Headland from this luxury two bedroom fully furnished apartment. The apartment is light and airy, and is north facing which is all important to catch the breezes. Features includes both an indoor heated pool and an outdoor pool, a half tennis court, heated spa, 2 saunas, games room, BBQ area and onsite manager.

This 2 bedroom ensuite apartment features perfect north facing aspect, situated on fourth level of complex with good ocean views and large balcony. The unit is light bright and airy and comes fully furnished and air conditioned. Excellent complex facilities and located directly opposite Alexandra Surf club. The perfect holiday getaway.

Address:

Unit 435 Alexandra Beach Resort 180 Alexandra Parade, Alexandra Headland Inspect: Inspect by Appointment View: www.mfnre.com.au/1019027 Price: $355,000 Contact: Shane Purssell 0402 012 142 Maroochydore First National 5409 9910

Beerwah 5494 6444

Caloundra 5499 5600

Cooroy 5447 6888

Maroochydore 5479 6600

Address:

Unit 1 Headland Tropicana 274 Alexandra Parade, Alexandra Headland Inspect: Saturday 2-2.30pm View: www.mfnre.com.au/1120359 Price: Expression of Interest Contact: Shane Purssell 0402 012 142 Maroochydore First National 5409 9910

Mooloolaba 5444 3455

Nambour 5441 1344

Pacific Paradise 5448 8088

Palmwoods 5445 9666

16 My Property Review | September 4, 2009

Page 16.indd 1

1/09/2009 3:06:40 PM


FIRST NATIONAL R E A L

www.ďŹ rstnational.com.au

E S T A T E

FRPSHWLWLRQ Ă&#x20AC;UVWQDWLRQDOFRPDXTOG

*YPPXIVQWERHGSRHMXMSRWEZEMPEFPIEX[[[½VWXREXMSREPGSQEYUPH

Luxury Refurbished Apartment

Itâ&#x20AC;&#x2122;s Whatâ&#x20AC;&#x2122;s Inside That Counts!

Ocean views from this 4th level two bedroom, ensuite, fully furnished apartment, located beachside Maroochydore. Great size tiled living area, air conditioned. Modern kitchen. Only metres to the surf, shops, and all entertainment. Complex facilities include, swimming pool, bar be que area, on site management. Ideal investment or holiday apartment and location with great potential.

Donâ&#x20AC;&#x2122;t be fooled by the outside appearance of this complex! This two bedroom unit has been recently renovated with modern kitchen, combined lounge/ dining, generous sized bedrooms with two-way bathroom off master & single lock up garage with remote control access. This is a great opportunity for ďŹ rst home buyers looking to break into the market or perfect for the investor looking for a low maintenance property to add to their portfolio. This unit really does tick all the boxes.

Address:

Unit 11, Langley Park, 10 Aerodrome Road Inspect: Saturday 2-2.30pm View: www.mfnre.com.au/1133902 Price: $339,000 Contact: Shane Purssell 0402 012 142 Maroochydore First National 5409 9910

Inspect: By appointment only! Price: $279,000 Neg. View: www.mooloolabaďŹ rstnational. com/1126714 Contact: Neil Bickley 0412 473 196 Mooloolaba First National 5444 3455

Super Sized at Central Location

Dress Circle Location This home affords the occupants a tranquil view of the inground pool from the screened outdoor area. s,ARGEFAMILY CASUALDININGANDFUNCTIONALKITCHEN s,ARGEBEDROOMS MASTERWITHENSANDWIR s3TUNNINGLANDSCAPEDGARDENSWITHPOOLSIDEGAZEBO s,ARGEM2 block with mountain views This home is ideally positioned for living convenience, only a few minutes drive from local amenities

s#HIC#OSMOPLITIONLIVING AIR CONDITIONED THROUGHOUTs(OUSE SIZEDMODERNLIVINGM2 ONONELEVELs$ESIGNERKITCHENWITHSANDSTONE benchtops and European appliances s0RIVATE#OURTYARDWITHTWOLARGETERRACES s3ECUREDENTRYWITHDUALUNDERGROUNDPARKING s,ARGELANDSCAPEDINGROUNDSALTPOOLAND""1AREA central loaction to Maroochy CBD restaurants, cafes, shops and the river.

POSITIONED IN A SOUGHT AFTER AREA

Address:

3/71 Monterey, Duporth Ave, Maroochydore )NSPECT 3ATURDAY AM 6IEW WWWMFNRECOMAU Auction: On site September 26th @ 10am #ONTACT +AREN"ARKER Maroochydore First National 5409 9915

Beerwah 5494 6444

Caloundra 5499 5600

Cooroy 5447 6888

Maroochydore 5479 6600

Address: 14 Toriana Place, Beerwah )NSPECT 3ATURDAY AM View: www.beerwahrealestate.com.au Price: $670,000 Contact: Brad Collins 0427 946 411 Glasshouse Country First National 5494 6444

Mooloolaba 5444 3455

Nambour 5441 1344

PaciďŹ c Paradise 5448 8088

Palmwoods 5445 9666

My Property Review | September 4, 2009 17

Page 17.indd 1

1/09/2009 12:42:18 PM


market tracker

A list of whatâ&#x20AC;&#x2122;s recently sold on the Coast <$500,000 $500,000 â&#x20AC;&#x201C; $1 million >$1 million

9 Bringenbrong Drive, Buderim Sold for: $464,500 Features: 4 bed, 2 bath, 2 car Agency: Pam Court Realty

Lot 14 Byee Circuit, Aroona Sold for: $480,000 Features: 4 bed, 2 bath, 2 car Agency: Henzells Agency Sales Agent: Sandra West

A local family liked this homeâ&#x20AC;&#x2122;s great street appeal and convenient location. It was on the market for less than a week. 67 Gossamer Drive, Buderim Sold for: $555,900 Features: 4 bed, 2 bath, 2 car Agency: Pam Court Realty

This new home was snapped up by local buyers wanting to upgrade to a larger block for their family. 26 Mellumview Drive, Beerwah Sold for: $315,000 Features: 3 bed, 1 bath, 1 car Agency: Glasshouse Country First National Beerwah Sales Agent: Aaron Peckitt This home went under contract twice before selling to a local lady looking to upsize from a unit to an affordable house.

12/45 Glen Kyle Drive, Buderim Sold for: $452,500 Features: 3 bed, 2 bath, 2 car Agency: Ken Guy Maroochydore Sales Agents: Chris Pace & Rebecca Nolan

FIRST NATIONAL

www.ďŹ rstnational.com.au

E S T A T E

MagniďŹ cent Ocean Vista s4WODOUBLEBEDROOMS s4WOBATHROOMS MASTERBEDROOMWITHENSUITE s4WOMASSIVEBALCONIESOVERLOOKING"ULCOCK"EACH Moreton and Bribie Island s2EVERSECYCLEAIRCONDITIONING s#OMPLEXFEATURESPOOL GYM SPA SAUNA LIFTSAND on-site management and resort style living 4HEOWNERSARERELOCATINGANDSERIOUSABOUTSELLING 50 METRES TO BEACH, KEEN PRICE, BUY NOW!

Address: 28/30 Minchinton Street, Caloundra Inspect: Sat 1-2pm & Wed 5-5.30pm View: www.ďŹ rstnat.com.au/ 1132106 Price: $365,000 Contact: James Reynolds 0413 413 720 Webbers First National 5499 5600

Management Rights Permanent living in a spacious 3 bedroom + study + double lock-up garage. Managerâ&#x20AC;&#x2122;s unit overlooking the park and set on the shores of Currimundi Lake. Annual income is in excess of $37,000. Suit semi retired person or young couple looking for a secondary income.

CURIOUS!!

Inspect: View: Price: Contact:

By Appointment www.ďŹ rstnat.com.au/1072128 $499,000 Robert Webber 0412 713 457 Greg Hobbins 0421 990 692 Webbers First National 5499 5600 18 My Property Review | September 4, 2009

Page 18.indd 1

This home was under contract after two weeks on the market when local buyers saw the ad in MPR. The wanted a home on a flat block of land in Buderim.

9 Bega Street, Burnside Sold for: $405,000 Features: 3 bed, 2 bath, 2 car Agency: Victor Realty Nambour Sales Agent: Craig Heppell These buyers moved from interstate and were renting while looking to buy. They spotted this property in MPR and loved the quiet location and beautiful finishes. Unit 4 â&#x20AC;&#x2DC;Castleviewâ&#x20AC;&#x2122;, 10 Canberra Terrace, Caloundra Sold for: $292,500 Features: 2 bed, 2 bath, 1 car Agency: Henzells Agency Sales Agent: Matt Glynn

41 Lee Street, Buderim Sold for: $820,000 Features: 4 bed, 3 bath, 2 car Agency: Ken Guy Maroochydore Sales Agents: Minka Jenkins & Gaby McEwan

227 Ballinger Road, Buderim Sold for: $480,000 Features: 4 bed, 2 bath, 2 car Agency: Pam Court Realty

R E A L

3 Greenvale Court, Buderim Sold for: $540,000 Features: 4 bed, 2 bath, 2 car Agency: Ken Guy Maroochydore Sales Agents: Bree Charles & John Skerlak

6 Mark Street, Buderim Sold for: $530,000 Features: 3 bed, 2 bath, 1 car Agency: Platinum Properties Sales Agents: Steve Turner & Geoff Ohmsen Two sets of local buyers saw the ad in MPR and made offers within a week of this home going on the market. It sold to a small family looking for an entry-level Buderim property.

40 Nyes Crescent, Buderim Sold for: $870,000 Features: 4 bed, 2 bath, 4 car Agency: Brown Realty Buderim Sales Agents: Pam & Mike Paten

21 Pease Blossom Street, Coes Creek Sold for: $350,000 Features: 3 bed, 2 bath, 2 car Agency: RE/MAX Nambour Sales Agent: Neville Mayfield 16 Ashwood Place, Currimundi Sold for: $399,000 Features: 3 bed, 1.5 bath, 1 car Agency: RE/MAX Caloundra Sales Agent: Jackie Marker The vendors received two offers in three weeks on the market. The house sold to a local small family who loved the position opposite a water reserve. 35 Bahdilli Crescent, Diddillibah Sold for: $325,000 Features: Land Agency: RE/MAX Buderim Sales Agent: Fiona Browne

LOOKING FOR A CAREER IN REAL ESTATE? Studying with the REIQ ensures you have access to the most up-to-date courses and information possible. The REIQ is Queenslandâ&#x20AC;&#x2122;s most respected provider of quality real estate training. â&#x20AC;˘ 5 day Registration Course â&#x20AC;˘ Allows you to work legally in the real estate industry â&#x20AC;˘ Study in class or via distance education

For information or to enrol please call the REIQ Sunshine Coast Training Centre on 07 5479 6272 or email sctraining@reiq.com.au

Next Registration Course commences: 14 September 2009 www.reiq.com.au

2/09/2009 9:22:51 AM


market tracker Lot 2 ‘Glass House Ridges Estate’, Glass House Mountains Sold for: $280,000 Features: Land Agency: Glasshouse Country First National Beerwah Sales Agent: John King

83/19 Arwen Street, Maroochydore Sold for: $270,000 Features: 2 bed, 1 bath, 1 car Agency: Pam Court Realty

4 Silveroak Court, Mountain Creek Sold for: $460,000 Features: 4 bed, 2 bath, 2 car Agency: Pam Court Realty 12 Mt Pleasant Road, Nambour Sold for: $410,000 Features: 3 bed, 1 bath, 2 car Agency: Keyline Realty

3 ‘Marrakesh’, 84 Duporth Avenue, Maroochydore Sold for: $590,500 Features: 3 bed, 2 bath, 2 car Agency: M’dore First National Sales Agent: Adam Bond

33 Elvena Circuit, Little Mountain Sold for: $440,000 Features: 4 bed, 2 bath, 2 car Agency: RE/MAX Caloundra Sales Agent: Jackie Marker

20 Edgewater Place, Sippy Downs Sold for: $675,000 Features: 4 bed, 2 bath, 2 car Agency: RE/MAX Buderim Sales Agent: Wim Bannick

3/128 Duporth Avenue, Maroochydore Sold for: $575,000 Features: 3 bed, 2 bath Agency: Ken Guy Maroochydore Sales Agents: Chris Pace & Rebecca Nolan

Lot 337 Forest View Way, Little Mountain Sold for: $475,000 Features: 4 bed, 2 bath, 2 car Agency: RE/MAX Caloundra Sales Agent: Jackie Marker

5 ‘Panorama’, 26 Buderim Avenue, Mooloolaba Sold for: $840,000 Features: 4 bed, 2 bath, 2 car Agency: Mooloolaba Real Estate Sales Agent: Col Roper

2 Keith Court, Marcoola Sold for: $435,000 Features: 5 bed, 3 bath, 4 car Agency: LJ Hooker Marcoola Sales Agent: Jamima Suter

37 Petigrain Avenue, Palmwoods Sold for: $449,000 Features: 3 bed, 2 bath, 2 car Agency: Keyline Realty This three-bedroom home was on the market for a month and sold to buyers who have relocated from Far North Queensland. Unit 128 ‘Varsity Apartments’, 4-20 Varsity View Court, Sippy Downs Sold for: $196,000 Features: 4 bed, 4 bath, 1 car Agency: M’dore First National Sales Agent: Mary Yates

5 Rock Fig Court, Palmwoods Sold for: $475,000 Features: 4 bed, 3 bath, 2 car Agency: RE/MAX Buderim Sales Agent: Andrew Kirby 12 Mohr Close, Sippy Downs Sold for: $399,000 Features: 3 bed, 2 bath, 2 car Agency: Pam Court Realty

*As supplied by contributing real estate agencies

mortgage tracker Basic Rate

Intro Rate Variable

Intro Term

Standard Variable Rate

1 Yr Fixed

3 Yr Fixed

5 Yr Fixed

Total Fees

AMP

5.34%

5.24%

12 Months

5.89%

5.69%

7.19%

7.99%

$995

ANZ

5.11%

-

-

5.81%

5.45%

6.99%

7.74%

$750

Bankwest

5.58%

4.87%

3 years

5.70%

5.99%

7.14%

7.79%

$500

Commonwealth Bank

5.23%

4.71%

12 Months

5.74%

5.69%

7.14%

7.79%

$750

Citibank

5.64%

-

-

5.99%

5.99%

7.49%

7.99%

$649

Homeloans Ltd

5.09%

-

-

5.70%

5.76%

7.16%

7.81%

$1330

Homeside

5.33%

-

-

5.77%

5.69%

6.89%

7.09%

$560

ING

5.09%

-

-

5.69%

5.89%

7.09%

7.74%

$220

NAB

5.24%

4.65%

12 Months

5.74%

5.69%

6.89%

7.09%

$600

P. 0415 831 688

RAMS

5.06%

4.69%

2 Years

5.59%

5.29%

6.74%

7.44%

$845

rebecca@headstartpropertyfinance.com.au

RESI

5.22%

4.95%

2 Years

-

-

-

-

$632

St George

5.07%

4.66%

12 Months

5.79%

5.54%

6.94%

7.59%

$600

Suncorp

5.22%

-

-

5.80%

5.69%

6.99%

7.74%

$600

Westpac

5.11%

-

-

5.81%

5.59%

6.99%

7.64%

$600

Lender

Investing, Buying or refinancing?

Contact Rebecca Little today

www.headstartpropertyfinance.com.au

Rates supplied by Headstart Property Finance – Current as of 28 Aug 2009 – Rates Subject to change & total fees are based on a basic rate loan.

My Property Review | September 4, 2009 19

Page 19.indd 1

2/09/2009 9:25:34 AM


Platinum People Steve Turner 0412 679 488

Geoff Ohmsen 0412 103 147

Lisa Grobler Personal Assistant

Ian Howcroft 0402 246 791

Bill Howcroft 0431 354 076

Kate Duncan Personal Assistant

Marian Yates Principal

Platinum Results

‘The Platinum Experience’

Page 20.indd 1

1/09/2009 9:56:57 AM


Brad Bower 0408 243 011

Robyn Bower 0418 162 094

Greg Collis 0432 639 689

Jill Wright 0431 343 715

Lisa Storey 0418 247 020

Samantha Anning 0415 151 762

Eliza Irvine Property Manager

Alex Dale 0414 516 003

Emily Paynter 0409 394 733

Platinum Service

P: 07 5437 8806 F: 07 5437 8802 W: www.platinumproperties.net.au Shop 4 â&#x20AC;&#x2DC;Dwyer Houseâ&#x20AC;&#x2122; 256 Nicklin Way, Warana QLD 4575 E: platinum@platinumproperties.net.au

Page 21.indd 1

1/09/2009 9:56:25 AM


Proudly marketed by Steve Turner & 'EOFF/HMSEN

www.platinumproperties.net.au Shop 4 Dwyer House, 256 Nicklin Way, Warana. Tel: 5437 8806

Private, Exclusive and the Epitome of Waterfront Livingâ&#x20AC;¦ 20 St Vincents Court, MINYAMA 4HISLIGHTANDAIRYHOMEHASBEENDESIGNEDTOBREATHEUTILIZINGPOLISHEDTIMBERmOORSANDLARGEWINDOWANDDOOROPENINGSTOCAPTURETHEBREEZESONTHOSE HOT3UMMERDAYS sSQMOFLIVING LAVISHBEDROOMS

s*ETTYWITHSTUNNINGWATERVIEWSANDEASYACCESSTOTHEOCEAN

s0URPOSEBUILTOFlCE ELEGANTBATHROOMS

s-ULTIPLELIVINGAREASBOTHINSIDEANDOUT

sCARACCOMMODATION INTEGRATEDGASlREPLACE

s6ACU -AID3YSTEMTHROUGHOUT

5

3

Inspect By Appointment Price/N!PPLICATION Internet ID 1115784 Steve Turner 0412 679 488 Geoff Ohmsen 0412 103 147

s+ITCHENISGRACEDWITHGRANITEBENCHTOPSANDSTAINLESSSTEELAPPLIANCES

3TYLISH"USHLAND"EAUTYn.EEDS4O"E3OLD./7

-AKE-E!N/FFER

7 Jason Place, LITTLE MOUNTAIN

7 Barbuda Circuit, KAWANA ISLAND 4

2 2 4HEOWNERSOFTHISIMMACULATEHOMEDONTWANTTOGOBUTTHEYCANTKEEP 3 ITEITHER Inspect Saturday 1-1.45pm

s$UCTEDAIR CONDITIONINGTHROUGHOUTHOME

sSPACIOUSBEDROOMS MASTERWITHWALKINROBE ENSUITE

Price $465,000

s3IDEACCESSFORCARAVANBOAT

s PACKITCHEN BLACKSTONE)TALIABENCHTOPS STAINLESSSTEELAPPLIANCES

Internet ID 1115785

s#ENTRALVAC

s/PENPLANLIVING CEILINGFANS AMPLESTORAGE GLASSlNISHEDmOORTILES

Lisa Storey 0418 247 020 Samantha Anning 0415 151 762

s3ECURITYALARMSYSTEM

sMBLOCK ELEVATED OUTDOORENTERTAINING LANDSCAPEDGARDENS

4

sMLEVELALLOTMENT

s3EAMLESSmOORINGINDOUBLEGARAGE

3

2

Inspect Saturday 1-1.45pm Price -AKE-E!N/FFER Internet ID 1115870 Ian Howcroft 0402 246 791 Bill Howcroft 0431 354 076 Beverley Kelley 0412 205 040 (Harcourts Buderim)

Lisa Storey 0418 247 020

Samantha Anning 0415 151 762

We have buyers knocking down our door to buy property in the Currimundi, Creekside, Kawana Forest, Aroona, Battery Hill, Caloundra West & Little Mountain areas.

Weâ&#x20AC;&#x2122;ve had 30 contracts in just 30 weeksANDNEEDLISTINGSNOW Call the team that sells for a no nonsense, no obligation free appraisal on your property. www.platinumproperties.net.au Shop 4 Dwyer House, 256 Nicklin Way, Warana. Tel: 5437 8806

0 , !4 ) . 5 - 3 % 2 6 ) # % s 0 , !4 ) . 5 - 0 % / 0 , % s 0 , !4 ) . 5 - 2 % 3 5 ,4 3 22 My Property Review | September 4, 2009

Page 22.indd 1

1/09/2009 1:17:26 PM


auction action

Alexandra Headland Unit 54 ‘Grand Palais’, 188-192 Alexandra Parade Features: 2 bed, 2 bath, 1 car Auction date: 29 August Result: Passed in. On the market for $299,000. Agency: M’dore First National 5479 6600 Sales agent: Shane Purssell 0402 012 142

Dulong Du

Maroochydore

We had about 30 people at the auction, with some good bidding before the property was passed in. There is strong conditional interest post-auction, and the vendor has asked to see all offers Mike Burns

Kings Beach

There were about 50 people packed into the two-bedroom unit on the day. We had four registered bidders and bidding kicked off at $400,000, with two bidders fighting it out until the unit sold to Brisbane buyers who are planning to renovate and use it as a holiday rental Doug Wilson

10 Antigua Court, Kawana Island Auction details: On site September 11 @ 4pm Agency: Raine & Horne Kawana Waters 5477 7500 Contact: Steve Kealey 0437 935 369 & Julie Coffey 0416 141 065

Mountain Creek 10 Karloo Court 4 bed, 2 bath, 2 car 29 August Sold prior to auction. Jean Hamer Prime Properties 5444 5000 Sales agent: Jean Hamer 0419 034 500 Features: Auction date: Result: Agency:

55/7 Grand Parade, Kawana Island Auction details: On site September 11 @ 5pm Agency: Raine & Horne Kawana Waters 5477 7500 Contact: Steve Kealey 0437 935 369 & Julie Coffey 0416 141 065 Unit 30 ‘Linear’, 34 Queen Street, Kings Beach Auction details: On site September 11 @ 2pm Agency: Henzells Agency Contact: Doug Wilson 0417 734 592

Here’s a sneak peek at hot auctions taking place on the Sunshine Coast in the next seven days.

73 Martins Creek Road Features: Land Auction date: 29 August Result: Currently in negotiations. Looking for offers. Agency: M’dore First National 5479 6600 Sales agent: Kimberly Bourgois 0416 237 484

3 Park Hollow Mews, Ivadale Lakes Auction details: On site September 11 @ 1pm Agency: Henzells Agency Contact: Matt Glynn 0404 315 066

Auctions in Action

Unit 8 ‘Gazeaway’, The Esplanade 2 bed, 1 bath, 1 car Features: Auction date: 29 August Sold for $520,000. Result: Henzells Agency Agency: Sales agent: Doug Wilson 0417 734 592

Buderim

Agency: Henzells Agency Contact: Julie Shirvington 0418 710 018

15 Boongala Terrace 7 bed, 5 bath, 4 car (five units) Features: Auction date: 29 August Passed in. Currently in Result: negotiations with two parties. Raine & Horne Kawana 5477 7500 Agency: Sales agent: Warren Selvage 0411 433 500

65-85 Sherwell Road Features: 4 bed, 2 bath, 2 car Auction date: 30 August Result: Passed in. Agency: Elders Palmwoods 5478 9122 Sales agent: Mike Burns 0418 991 702

TThe he eeasiest asieest wa way ay to check out the latest auction results

18 Corella Drive, Parrearra Auction details: On site September 5 @ 1pm Agency: Property Today 5412 1600 Contact: Trevor & Glenys Martin 0400 818 777

18 Kalana Road, Aroona Auction details: On site September 5 @ 11.30am Agency: Webbers First National 5499 5600 Contact: Peter Morrison 0400 023 169

30 Firefly Street, Pelican Waters Auction details: On site September 11 @ 1pm Agency: Henzells Agency Contact: Michael Lindsay 0421 017 046

39 Pakenham Street, Aroona Auction details: On site September 11 @ 5.30pm Agency: RE/MAX Caloundra 5438 5222 Contact: Michael Kettle 0419 728 807

17 Riveroak Way, Sippy Downs Auction details: On site September 5 @ 2.30pm Agency: RE/MAX Mooloolaba 5452 4555 Contact: Michael Knights 0409 018 778

Unit 11 ‘The Outlook Currimundi’, 9 Hume Parade, Currimundi Auction details: On site September 11 @ 10am

www.platinumproperties.net.au Shop 4 Dwyer House, 256 Nicklin Way, Warana. Tel: 5437 8806

/PENFOR)NSPECTIONn3ATURDAYTH3EPTEMBER !LEXANDRA(EADLAND Saturday 11-11:45pm – 31 Wrigley Street ‘Huge Three Level Alex Beach House’ Greg Collis 0432 639 689 or Jill Wright 0431 343 745

"UDDINA Saturday 12-12:45pm – 54 Sunbird Chase @7IDE7ATER6IEWSn#ONTEMPORARY3TYLE 3TEVE4URNEROR'EOFF/HMSEN

"UDERIM Saturday 12-12:45pm – 18 McLaren Place @$ESIGNER,IVING7ITH0RIVATE2AINFOREST )AN(OWCROFTOR"ILL(OWCROFT

Beerwah JUST SOLD – 12 Heights Road @0ERFECTLY0OSITIONED Greg Collis 0432 639 689 or Jill Wright 0431 343 745

#URRIMUNDI Saturday 2-2:45pm – 4 Greygum Place @1UIET#UL $E 3AC ,IVING  3TUDY"ED 0OOL

-AGNIlCENT/UTDOOR%NTERTAINING!REA Lisa Storey 0418 247 020 or Samantha Anning 0415 151 762

+AWANA)SLAND Saturday 12-12:45 – 19 Sardinia Place @9ESn+AWANA)SLAND6ALUE )AN(OWCROFTOR"ILL(OWCROFT

Saturday 12-12:45pm – 6 Santorini Court ‘Stunning Executive Family Home’ Greg Collis 0432 639 689 or Jill Wright 0431 343 745 Saturday 1-1:45pm – 7 Barbuda Circuit @-AKE-E!N/FFERv )AN(OWCROFTOR"ILL(OWCROFT Saturday 2-2:45pm – 8 Fitzroy Court @3TUNNING)SLAND(OMEn0RICEDTO3ELL )AN(OWCROFTOR"ILL(OWCROFT Saturday 3-3:45pm – 33 Bahamas Circuit @3PACEAND3PLENDOUR )AN(OWCROFTOR"ILL(OWCROFT JUST LISTED – 5 Bega Place – By Appointment @-ODERN3PACIOUS)SLAND(OME Greg Collis 0432 639 689 or Jill Wright 0431 343 745

Kawana Forest Saturday 12-12:45pm – 47 Kurrajong Place @"ED ,IVING!REAS 0OOL /PPOSITEPARK 7/7&ACTOR Lisa Storey 0418 247 020 or Samantha Anning 0415 151 762

Little Mountain Saturday 1-1:45pm – 7 Jason Place @)MMACULATE "USH3ETTING -OTIVATED/WNERSNEED4O3ELL Lisa Storey 0418 247 020 or Samantha Anning 0415 151 762

-ERIDAN0LAINS JUST LISTED – 10 Riberry Place – By Appointment @3TEAL-E@ Greg Collis 0432 639 689 or Jill Wright 0431 343 745

Minyama JUST LISTED – Saturday 1-1:45pm - 26 Bangalow Street @&ULLY2ENOVATED -ODERN -INYAMA(OME Greg Collis 0432 639 689 or Jill Wright 0431 343 745 JUST LISTED – 9 Kardinia Street – By Appointment ‘So Close To The Water’ )AN(OWCROFTOR"ILL(OWCROFT

-OOLOOLABA Saturday 11-11:45am – 502 ‘Cocos Apartments’ 79 First Avenue @,UXURY-OOLOOLABA,IVING7ITHOUT4HE"EACH&RONT0RICE Greg Collis 0432 639 689 or Jill Wright 0431 343 745 Saturday 2-2:45pm – 49 Tarcoola Avenue @0EACEFUL-OOLOOLABAn7ATERFRONT(OME Alex Dale 0414 516 003 or Jill Wright 0431 343 745

Wurtulla Saturday 11-11:45am – 7 Turnbuckle Court @7ATERFRONT,IVING7ITHOUT4HE0RICE4AG 3TEVE4URNEROR'EOFF/HMSEN JUST SOLD – 7 Rainbird Place ‘No Income Means Urgent Sale’ "RAD"OWEROR2OBYN"OWER

0 , !4 ) . 5 - 3 % 2 6 ) # % s 0 , !4 ) . 5 - 0 % / 0 , % s 0 , !4 ) . 5 - 2 % 3 5 ,4 3 My Property Review | September 4, 2009 23

Page 23.indd 1

9/1/2009 3:14:40 PM


world

Gaze

Around the World

Historic homes from around the globe feature in this week’s catalogue of unusual dwellings.

$1.7 million

Price on application

Surrey, England

This windmill dates back to 1842 and has been converted into a threebedroom house. It is surrounded by woodlands.

Poitiers, France

This 11th-century fortress has three towers and has been fully restored. It now features six bedrooms and is set on 4.5 acres of land.

Can building green deliver $$$ in a regional market?

Price on application

Including a case study of ‘The Edge’ – the Sunshine Coast’s first Green Star project.

$690,000

Cantick Head, England

These two lighthouse cottages are located on one acre of grounds and offer beautiful views. The lighthouse itself isn’t for sale.

What are the market advantages for owners and tenants in a Green Star certified building? What regional factors might impede delivery of economically viable Green Star certified buildings?

Aurignac, France

This centuries-old chapel features views of the Pyrenees and would be perfect for conversion into a unique and secluded family home.

How would GBCA approach / determine an appropriate green star threshold that would reward investment in green building and provide value in a regional market?

$1.7 million

A UDIA Sunshine Coast Breakfast

Sponsored by

When: Thursday 10 September 2009, 7.15am for 7.30am until 9.00am Venue: Maroochy Surf Club, Maroochydore Cost: Regional Members: $44.00 Non Members: $55.00 Table of 10: $396.00 RSVP: Wed 2 September, ph: (07) 5493 9091, email: sunshinecoast@udiaqld.com.au

$4.2 million

Ontario, Canada

This hunting and fishing retreat features a 1920s lodge and is located on 11 acres of forest. The property can accommodate 20 people. California, USA

Wildflower Island is an hour’s drive from the famous Napa Valley and operates as a private resort and wilderness retreat.

Source: www.property.org.uk, www.privateislandsonline.com

Guest Speakers: Andrew Aitken, State Manager Qld, Green Building Council of Australia Matt Wotton, RGD Property Group Dave Bell, Director, Bell Engineering Group

Heads or Tails? Your Call. Both of these Buderim homes feature ‘bells & whistles’. Watch the grand final in the comfort of your own home, knowing you have a sound investment in a fabulous area; whilst your children continue ‘clowning around’ in the safety of their own back yard well beyond the seasons end. Located in close proximity to Matthew Flinders College, Siena College and Sunshine Coast University. Minutes to the beach and approx. 1 hour drive to Brisbane.

$599,000

Inspect these Grandview homes before you decide which one to buy.

$639,000

Address: 14 & 16 Eungella Way, Buderim Inspect: Saturday & Sunday 1.00-1.45pm & Wednesday twilight viewing 5.00-5.45pm Contact owners: 0403 000 046 or 0422 433 366 24 My Property Review | September 4, 2009

Page 24.indd 1

1/09/2009 1:45:47 PM


EVERYTHING THE FAMILY NEEDS - TANAWHA 2 Kirby Court, Tanawha Executive living on small acreage close to elite schools is a highly sought after blue chip commodity. Set in a quaint cul-de-sac on 6545m² this exceptional package offers a large 5 bedroom (plus 2 offices) home with triple bay garaging and a 22m lap pool . The master built home oozes quality from the french polished floors to the imported Gosford quarry stone. You will enjoy guests this summer around the entertainment pavilion with a stainless steel preparation bench and a built in Bar-B-Q. A quality kitchen with freestanding 900mm oven and granite benches along with the professional media room completes this wonderful family home. All this set amongst a lush green setting just minutes to Sienna, Matthew Flinders and Sunshine Grammar School.

Price: On Application. Inspect: Saturday 12-12.45pm. Contact: Damien Michael 0413 024 124. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1054

BUDERIM

CALOUNDRA

MAROOCHYDORE

MOOLOOLABA

NOOSA

My Property Review | September 4, 2009 25

Page 25.indd 1

1/09/2009 2:09:41 PM


THE PENTHOUSE

C<>/@/::3:32/0A=:CB3:G7@@3>:/13/0:3 /<2=443@32B=B63;/@93B4=@B63D3@G47@ABB7;3

Â&#x2019; /?C/@B3@/1@3; =4 0@3/B6B/97<5E/B3@4@=<B=>C:3<13 ACA>3<232!%;7<B63/7@ Â&#x2019; /0A=:CB3E/B3@4@=<BE7B6 =

AE33>7<5!$ D73EA/<23F13>B7=</: /BG=C@2==@1=<D3<73<13 Â&#x2019; 3FB@/=@27</@G/>>=7<B;3<BA7<14=C@ 3<AC7B32032@==;AB6@3397B163<A BE3:D3>3@A=<17<3;/07::7/@2@==; @==4B=>>==:8/1CHH75G;E7<3 13::/@/<24=C@1/@/11=;;=2/B7=< Â&#x2019; 1=<137D32/<21=<AB@C1B32E7B6=CB 0C253B=@:7;7B/B7=< 741=;>@=;7A37A<=B/<=>B7=<E3AB@=<5:G@31=;;3<2/>@7D/B37<A>31B7=<

Page 26.indd 1

9/1/2009 2:12:12 PM


j@==4B=>>:/G5@=C<2 j@==4B=>>:/G5@=C<2

4=@1=<4723<B7/:>C@16/A7<523B/7:A=<B67A3FB@/=@27</@G>@=>3@BG >:3/A31=<B/1B3F1:CA7D3/53<BA( 2/;73<;716/3:>6("! " " :=@3<E7;6C@AB>6("#!&  EEE>:/B7<C;>3<B6=CA31=;/C

Page 27.indd 1

93<5CG;/@==16G2=@3 %#""! 

9/1/2009 2:13:53 PM


BUDERIM BEAUTY – URGENT SALE NEEDED 20 Shrapnell Street, Buderim Beautifully presented and positioned in one of Buderim’s preferred cul-de-sac locations is 20 Shrapnel Street. The home offers plenty of space with great separation from the Parents retreat upstairs (with awesome North Easterly ocean and hinterland views) to the guest accommodation or teenager haven on the lower level. Four bedrooms, three bathrooms and a fully designated office in total. The timber deck flows out from the centre of the home, gourmet kitchen and two of the four separate living areas; all boasting a gorgeous view out to the North. The owners have regretfully put this one up for immediate sale and have priced accordingly.

Price: $1,195,000. Inspect: Saturday 1-1.45pm by prior registration. Contact: Craig Porter 0411 554 880. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1060

BUDERIM

CALOUNDRA

MAROOCHYDORE

MOOLOOLABA

NOOSA

28 My Property Review | September 4, 2009

Page 28.indd 1

1/09/2009 11:03:29 AM


RESORT STYLE BUDERIM LIVING 117 Cogill Road, Buderim Strolling out of your bedroom each morning, you could easily feel that you’re on holidays at a beautiful tropical resort. The living areas (kitchen included) all flow out to the stunning inground pool, with the floodlit tennis court as your backdrop! Magic! Privately set amongst other million and multi-million dollar homes – you will love to entertain your family and friends at this beautiful Buderim residence. A two-minute drive will find you in Buderim’s unique village – a two-minute stroll will find your kids at Matthew Flinders. All in all this is an easy care Buderim acreage resort. Owners want this sold now.

Price: Offers over $1.5 million. Inspect: Saturday 2-2.45pm. Contact: Craig Porter 0411 554 880, Damien Michael 0413 024 124. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1063

BUDERIM

CALOUNDRA

MAROOCHYDORE

MOOLOOLABA

NOOSA

My Property Review | September 4, 2009 29

Page 29.indd 1

1/09/2009 10:58:41 AM


GREAT NEWS! … OUTSTANDING VIEWS! 901 “Aurora” 4 Duporth Avenue, Maroochydore There’s so much great news attached to this superb sub-penthouse it’s hard to know where to start! From the entry you’ll be drawn through to outstanding river and ocean views over to Cotton Tree. Inside, you’ll find a very spacious kitchen with Miele appliances, a spectacular lounge/dining area, 3 bedrooms, 2 bathrooms plus powder room, separate media room and a study, plus 2 car parking and storage. Aurora is residential style so no holiday letting and boasts a gym, library and heated pool. The unit offers 277sqm of total floor space with a design and finish second to none! So, it is all great news! Join the lifestyle!

Auction: Saturday 19th September at 10am (offers considered prior to auction). Inspect: Saturday 11-11.45am. Contact: Jodie McDonell 0419 762 309. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1021

ROOM TO MOVE ... AND LIFESTYLE 201 “Aurora” 4 Duporth Avenue, Maroochydore How can you have everything in one package? You can in this very generous 5 bedroom, 3 bathroom, 2 separate living zone, inner city apartment with the best design and finishes. High pitched ceilings and ample windows gives you lots of light and you catch the breezes from the beautiful Maroochy River. Living here comes with the lifestyle of walking to the river, the beach, shops, restaurants and, apartment living allows you extra time to do it all!

Price: Expressions of Interest. Inspect: Saturday 12-12.45pm. Contact: Jodie McDonell 0419 762 309. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY877

AFFORDABLE ACREAGE IN GLENVIEW 9 Tolson Road, Glenview This property is nestled on one and a quarter acres in gorgeous Glenview. Spread over two levels, this residence needs some TLC but offers plenty of potential, with 5 bedrooms, 3 bathrooms throughout – ideal for extended family, dual living or a home business. Upstairs boasts polished timber floors plus a large white kitchen and a potbelly stove. Complete a triple-bay shed, this is a great opportunity to buy a small acreage at an affordable price.

Auction: On-site Saturday 26th September at 11am. Inspect: Saturday 10-10.45am. Contact: Matt O’Grady 0414 317 375, Richard Scrivener 0416 799 188. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1028

BUDERIM

CALOUNDRA

MAROOCHYDORE

MOOLOOLABA

NOOSA

30 My Property Review | September 4, 2009

Page 30.indd 1

1/09/2009 12:16:55 PM


12HA RURAL RETREAT – CLOSE TO TOWN 304 Cooroy-Belli Creek Road, Cooroy Trevelyan, homestead on the hill, is a traditional Australian Colonial style residence centred on 12.23 hectares, just 3 kilometres from the hinterland township of Cooroy. Facing North-East, this sandstone residence consists of a U-shaped design with entertainment area around a salt-water pool in the protected courtyard. Stroll through improved pastures along the Cooroy Creek or relax on any of the 3 wrap-around verandahs and enjoy scenic views stretching from Mt. Tinbeerwah, Mt. Cooroy to Mt. Eerwah. Breed cattle, horses or run a small crops business and enjoy living in this open plan home.

Price: Expressions of Interest. Inspect by Appointment. Contact: Richard Scrivener 0416 799 188, Matt O’Grady 0414 317 375. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1127

AFFORDABLE PRESTIGE LIVING ON TOP OF BUDERIM 9 Eckersley Avenue, Buderim

This fabulous home is perfectly situated in a very sought-after and well-regarded street on top of Buderim. Set behind security gates and surrounded by lush lawns and botanical gardens, this residence is near-new throughout and features four double-sized bedrooms and two bathrooms. The master wing is well separated from the other bedrooms to create a parent’s retreat – ideal for family living. Featuring sleek caesarstone benches and white two-pac cabinetry, the large kitchen features Smeg appliances and a serving window onto the patio plus a peaceful green outlook. There’s also a free-standing entertaining area and attached multi-purpose room which could easily be converted to a games room or bar. This is blue-chip real estate located on top of Buderim – move straight in and enjoy capital growth matched with a relaxed, quiet Buderim lifestyle.

Inspect: Saturday 11-11.45am. Contact: Richard Scrivener 0416 799 188, Matt O’Grady 0414 317 375. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1016

BUDERIM

CALOUNDRA

MAROOCHYDORE

MOOLOOLABA

NOOSA

My Property Review | September 4, 2009 31

Page 31.indd 1

9/1/2009 11:09:17 AM


5-BEDROOM RESIDENCE ON TOP OF BUDERIM 1 Grant Street, Buderim Positioned in one of Buderim’s most prestigious ‘on top’ locations, this multi-level 5-bedroom, 5-bathroom residence occupies a prime 1232m² block and boasts eclectic character throughout. There’s a gourmet kichen, fireplace and multiple living zones which merge with the outdoor living area which is set amongst the lagoon-style pool, timber decks and lush gardens. There’s even a self-contained granny flat on the lower level which also has separate entry, making it ideal for dual living.

Price: Expressions of Interest Close Monday 14th Sept at 5pm. Inspect: Saturday 1-1.45pm. Contact: Bree Charles 0416 435 391, John Skerlak 0413 441 834. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1008

ATTENTION INVESTORS AND FIRST HOME BUYERS! 35 Carter Road, Nambour These brand new, chic townhouses are exceptional value for money and located within walking distance to all public facilities – Including Nambour Hospital, shops, schools, train line and bus services. First home buyers - you should be eligible for the Governments first home buyers grant! Investors, great rental returns, low maintenance and great tax deduction benefits from buying brand new!

Price: From $315,000. Inspect: By Appointment. Contact: Bree Charles 0416 435 391, John Skerlak 0413 441 834. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY873

PRIME FIRST-HOME/INVESTMENT – BEACHSIDE Unit 7 ‘Majorca Isle’ 27 Sixth Ave, Maroochydore/Cotton Tree This beachside apartment is just a stone’s throw from the ocean, Cotton Tree’s cafes and shops, and the river. This unit is absolutely ideal for a young couple or would make an excellent weekender. Positioned on the prime northern end of the complex the unit enjoys year-round sunlight and sea breezes. There are two balconies to enjoy, plus two bedrooms and two bathrooms. Well presented, this complex boasts a tennis court, pool, BBQ areas and secure parking all just a 30-sec stroll from the beach

Price: Buyers in the Low $400,000’s. Inspect: Sat 11-11.45am. Contact: Bree Charles 0416 435 391, John Skerlak 0413 441 834. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1032

DESIGN AND NATURE COME TOGETHER…. Wattlebird Drive, Doonan Feel the balance of design and nature in this beautifully positioned architecturally planned home. Nestled away in a tranquil bushland setting this three bedroom, two bathroom abode with detached studio and workshop, is wrapped with decking and features warming sun trap areas overlooking a sizeable pool and picture perfect dam. Offering approximately 1 hectare just 10 minutes drive to Noosa, Doonan is a popular choice when looking for that combination of privacy and lifestyle.

Inspect: By Appointment. Contact: Trudi Gower 0416 018 770. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1025

BUDERIM

CALOUNDRA

MAROOCHYDORE

MOOLOOLABA

NOOSA

32 My Property Review | September 4, 2009

Page 32.indd 1

1/09/2009 12:07:53 PM


BLANK CANVAS – FOR YOUR MASTERPIECE 40 Rainforest Road, Chevallum

Are you looking for acreage to build your masterpiece on? Thought it impossible to find a decent and affordable block of land, yet be within minutes of Buderim, shops and the Grammar school? This tranquil property is set on a private 16 acres of useable land with an outlook to the ranges in an acreage hotspot - Rainforest Road. Rent out the 2 bedroom liveable shed (with kitchen and bathroom) whilst you draw up your plans. With power to the land, a dam and irrigations points throughout the property, this was once a former turf farm. Agist horses, ride your bike, run livestock, park your truck or have room to play on the weekend – the possibilities are yours! Encouraging all acreage buyers that had given up on their dream! Motivated sellers are happy to listen to the market. It’s your move!

Auction: Saturday 12 September at 12 noon. Inspect: Saturday 2-2.45pm. Contact: Gaby McEwan 0401 781 116, Minka Jenkins 0488 550 063. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY767

PRIME BEACHSIDE POSITION – ENTERTAIN IN STYLE 37 Parari Street, Warana Positioned just a few streets from the ocean in the tightly-held beachside Warana, this home is ideal for a young family or purely as a beachside investment. Near-new inside, the residence boasts separate lounge and dining areas plus a gourmet kitchen which overlooks the lagoon-style pool and botanical gardens in the backyard. There is an emphasis on entertaining, with a huge Balinese pavilion nestled poolside. Unassuming from the road, this one will surprise you. Inspect and be delighted.

Price: Buyers in the mid $500,000s. Inspect: Sat 1-1.30pm. Contact: Minka Jenkins 0488 550 063, Gaby McEwan 0401 781 116. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1030

LIVE 200 PACES FROM THIS 2 Gerbra Place, Bokarina Look at this beauty! Four bedrooms, 2 bathrooms, double lock-up garage with fantastic pool and entertainment area. This home needs you to come and create your own masterpiece with this original canvas. Very rarely do land sizes like this become available @ 842sqm, situated in a cul-de-sac, approximately 200 paces from the beach access – No 46. The potential here is to create your dream home without over-capitalising. Add this to your portfolio – or make this your next home!

Auction: Sat 19th Sept at 1pm. Inspect: Saturday 11-11.45am. Contact: Minka Jenkins 0488 550 063, Gaby McEwan 0401 781 116. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1035

BUDERIM

CALOUNDRA

MAROOCHYDORE

MOOLOOLABA

NOOSA

My Property Review | September 4, 2009 33

Page 33.indd 1

1/09/2009 11:57:40 AM


INDUSTRIAL WAREHOUSE Charlston Place, Kuluin This is a great investment opportunity for the smart investor. Offering 210m2 of building area, including 60m2 of office space with air-conditioning, and an additional 60m2 of mezzanine area. The industrial complex has a total of 5 tenants, and is all located in Kuluin, which is only a 5 minute drive from Maroochydore. Will be sold vacant, opportunity to run your own business from here, or lease out the property and secure the potential of a great return.

Price: $345,000 + GST. Inspect: by appointment. Contact: Bree Charles 0416 435 391, John Skerlak 0413 441 834. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY989

%2.$5,1$

&+(9$//80

6DWDP±*HUEUD3ODFH EHGEDWKSRRO±DIIRUGDEOHJHP 0LQND-HQNLQV

6DWSP±5DLQIRUHVW5RDG OHYHO35,9$7(FRPSOHWHO\XVHDEOHDFUHV EHGFRWWDJH±PRWLYDWHG DIIRUGDEOH 0LQND-HQNLQV

.$:$1$,6/$1'

0,1<$0$

6DWSP±0DOGLYHV3ODFH 2QHOHYHOOLYLQJRQWKHZDWHUIURQWUHQRYDWHG KRPHZLWKWKHSHUIHFWDVSHFW RXWORRN $QWKRQ\*RUPDQ

6DWDP±&RRPDURR&UHVFHQW PZDWHUIURQWDJHLQVRXJKWDIWHUVWUHHW $QWKRQ\*RUPDQ 6DWDP±.XPEDGD&RXUW (QWU\OHYHOWRGHHSZDWHUPDUNHWKRWDXFWLRQ $QWKRQ\*RUPDQ

*/(19,(: 6DWDP±7ROVRQ5RDG EHGEDWKOLYLQJDUHDVDQGKXJHSRWHQWLDO VHWRQóDFUHVLQWKHSRSXODU*OHQYLHZDUHD 0DWW2¶*UDG\

.$:$1$)25(67

0$522&+<'25( 6DWDP 7KXUVSP ±µ-XQHDX¶$SDUWPHQWV'XSRUWK$YH %UDQGQHZEHGEDWKSOXVVWXG\QRRN$& ULYHURFHDQYLHZV &KULV3DFH

:$5$1$ 6DWSP±3DUDUL6WUHHW *RUJHRXV%DOLLQVSLUHGKRPHEHDXWLIXOSRRO DUHDEHGVKPLFN 0LQND-HQNLQV

:8578//$ 6DWDP±7XUQEXFNOH&RXUW '(6,*1(5+20(ODUJHEHGURRPVRI¿FH JRXUPHWNLWFKHQVWXQQLQJSRROJDUDJH $OYLD7XUQH\ 6DWSP±.DUXQGD6WUHHW 5HQRYDWHGKRPHZLWKEHGEDWKZDONWR &XUULPXQGL3DUN ODNH 0LQND-HQNLQV

$8 5DLQIRUHVW5RDG&KHYDOOXP 6DWWK6HSW#SPRQVLWH *DE\0F(ZDQ

BUDERIM

GRUH 0DURRFK\ 0 SRUWK$YH X '  ´ LWH UD RQV $XUR 8QLW³ WK HSWHPEHU#DP  6  \  D  UG  WX  D  6 RQHOO -RGLH0F'

CALOUNDRA

MAROOCHYDORE

& 8

7ROVRQ 5RD 6DWXUGD\ WK G*OHQYLHZ  6HS WH 0DWW2¶* UDG\ PEHU#DPR QVLWH  

$

&7

,2

7, 2

1

1

$

8

&

7,

&

7,

$8

\DPD &RXUW0LQ .XPEDGD WK DPRQVLWH 6HSWHPEHU#  6DWXUGD\ RUPDQ7HDP * Q\ KR QW $ H 7K

8

21

, &7

2 1

6DWSP±6XQELUG&KDVH :DWHUIURQWPIURQWDJHPRGHUQKRPHZLWK GLUHFWRFHDQDFFHVV $QWKRQ\*RUPDQ

2 1

81'(57+(+$00(5

3$55($55$

$

6DWDP±(FNHUVOH\$YHQXH 6WXQQLQJKRPHEHGEDWKJUHDWORFDWLRQ 5LFKDUG6FULYHQHU 6DWDP/DUD'ULYH EHGVWXG\SRROòDFUHVFORVHWRVFKRROV 'DPLHQ0LFKDHO 6DWSP±*UDQW6WUHHW EHGEDWKGXHODFFRPPRGDWLRQWRSRI %XGHULPSRRO'/8*FORVHWRDOOIDFLOLWLHV -RKQ6NHUODN 6DWSP±,OODZRQJ6WUHHW EHGEDWKVZHHSLQJRFHDQ KLQWHUODQGYLHZV 'DPLHQ0LFKDHO 6DWSP±%\3ULRU5HJLVWUDWLRQ 6KUDSQHO6WUHHW 6WXQQLQJFRQWHPSRUDU\EHGKRPH1(RFHDQ YLHZVSRRO±PXVWVHOO &UDLJ3RUWHU 6DWSP±0RQV6FKRRO5RDG 3ULYDWHDQGSHDFHIXOEHGEDWKKRPHZLWK EHDXWLIXOEXVKRXWORRN &KULV3DFH 6DWSP±&RJLOO5RDG 5HVRUWVW\OHOLYLQJWHQQLVFRXUWSRRO±ZDONWR 0DWKHZ)OLQGHUV &UDLJ3RUWHU

6DWSP±0RXQWDLQ&UHHN5RDG &KDUPLQJEHGSOXVVWXG\IDPLO\KRPHLQ0WQ &UHHNVFKRRO]RQH±WULSOHJDUDJH &KULV3DFH

,2

%8'(5,0

02817$,1&5((.

&7

6DWE\DSSRLQWRQO\±:DWWOHELUG3ODFH $UFKLWHFWXUDOO\SODQQHGKRPHEHGEDWK GHWDFKHGVWXGLRSRRODQGODJRRQ 7UXGL*RZHU

6DWSP±$OGLQJD3ODFH EHGIDPLO\KRPHRQRIDQDFUHVRQ 0RRORRODEDFDQDO $OYLD7XUQH\ 6DWSP±%ORRGZRRG&RXUW *UHDWIDPLO\KRPHPEORFN -RGLH0F'RQHOO

1

6DWSP±6FULEEO\*XP'ULYH $VQHZ4XDOLW\KRPHZLWKEHGHQVXLWHVWXG\ DFFORVHWR3DFL¿F/XWKHUDQ&ROOHJH $OYLD7XUQH\

'221$1

6DWSP±3DUNDQD&UHVFHQW %XGGLQDSODWLQXPSRFNHWSUHFLQFWZDWHUYLHZV SRROEUDQGQHZ 0LQND-HQNLQV

022/22/$%$

$8

%8'',1$

6DWDP±8QLWµ0DMRUFD,VOH¶ ±6L[WK$YHQXH EHGEDWKVHFZDONWREHDFK/DUJH ORXQJHURRPWHQQLVFRXUW SRROLQFRPSOH[ %UHH&KDUOHV 6DWDP±8QLWµ$XURUD¶ 'XSRUWK$YH 2YHUVTPÃ&#x20AC;RRUVSDFHRXWVWDQGLQJYLHZV IDQWDVWLFORFDWLRQ -RGLH0F'RQHOO 6DWSP±&HQWHQDU\&UHVFHQW 5HQRYDWHGEHGEDWKKRPHZLWKSRROLQ EULOOLDQWEHDFKVLGHSRFNHW &KULV3DFH 6DWSP±8QLWµ$XURUD¶'XSRUWK$YH (QRUPRXVEHGEDWKFORVHWRHYHU\WKLQJ -RGLH0F'RQHOO 6DWSP±8QLWµ$TXDUHOOH¶'XSRUWK$YH WRWDOÃ&#x20AC;RRUVSDFHDEVROXWHULYHUIURQW -RGLH0F'RQHOO 6DWSP±8QLW³5LYD´'XSRUWK$YH 6SHFWDFXODUULYHURFHDQYLHZV±ELJEDOFRQ\ -RGLH0F'RQHOO 6DWSP±8QLW³5LYD´'XSRUWK$YH 7RWDOVTPÃ&#x20AC;RRUVSDFH±EUDQGQHZ -RGLH0F'RQHOO

$GHORQJ&UHVFHQW%XGGLQD )RUWKFRPLQJ$XFWLRQ $QWKRQ\*RUPDQ

*HUEUD3ODFH%RNDULQD 6DWXUGD\WK6HSWHPEHU#DPRQVLWH 0LQND-HQNLQV

MOOLOOLABA

NOOSA

34 My Property Review | September 4, 2009

Page 34.indd 1

1/09/2009 1:56:19 PM


UNIQUE CHARACTER – BRILLIANT LOCATION 15 Mountain Creek Road, Mountain Creek

Arguably the iconic property within the prestigious Mountain Creek School zone, this standout home exudes that special quality which sets it apart from the rest. From its unique street appeal, soaring cathedral ceilings and open plan design, this fantastic family home boasts brilliant warmth, charm and character. The spacious master bedroom is complimented by a walk-in-robe and ensuite with 3 more large bedrooms and an office upstairs. The chef will relish the kitchen with gas cooktop, granite benchtops and outdoor servery while the choice of separated indoor living means there’s room for all the family. Parked beside a lush nature strip on an 848m² block, you can entertain all year round in complete privacy on the expansive decking. Ducted air-conditioning, fire place, triple garaging, side access and immaculate landscaping complete a perfect picture.

Price: Mid $700,000’s. Inspect: Saturday 1-1.45pm. Contact: Chris Pace 0417 196 600. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1056

NORTHERN WATERFRONT HOME TO BE ENJOYED 7 Maldives Place, Kawana Island

Privately located at the end of a cul-de-sac, this property has plenty of appeal for all. With three spacious bedrooms plus an office all set on one level, this home is ideal for the easy living lifestyle that we are all craving. The Northern aspect has been utilized perfectly with the home. Some highlights of the residence are the remodelled bathrooms and the new kitchen with quality Bosch appliances and the stone bench tops. You’ll enjoy the alfresco living area for its sunbathed poolside decks and entertaining area as well as the privacy that the established landscaping provides.

Inspect: Saturday 12-12.45pm. Contact: Anthony Gorman 0417 587 758. Ken Guy Maroochydore 1300 KEN GUY. Internet Code: MCHY1029

YOUR ENTRY TO THE WATERFRONT MARKET 9 Kumbada Court, Minyama

Without doubt, this will be the easiest entry point to the deepwater market this year. The cute home is set amongst some of the finest, multi-million dollar homes that the Sunshine Coast has to offer making this an extremely secure investment. With a compact 3 bedroom home on a huge, 896sqm land parcel and deep water access, you simply can’t go wrong. The land has the ability to be developed into duplexes (S.T.C.A.) which would approve a unique development opportunity for the astute investor.

Auction: Saturday 19th September @ 11am on site. Inspect: Saturday 11-11.45am. Contact: Anthony Gorman 0417 587 758 Ken Guy Maroochydore 1300 KEN GUY or Trevor Martin of Property Today on 0400 818 777. Internet Code: MCHY1034

BUDERIM

CALOUNDRA

MAROOCHYDORE

MOOLOOLABA

NOOSA

My Property Review | September 4, 2009 35

Page 35.indd 1

9/1/2009 2:07:29 PM


news & views

A snapshot of who’s doing what in the industry He’s a hit

Moving around Esteemed Buderim real estate agent Craig Porter has moved from the Buderim Ken Guy office to join Loren Wimhurst’s Ken Guy office in Maroochydore. Craig will still focus on selling the Buderim area as he has for almost nine years. Loren says Craig’s addition adds a great dynamic to her agency. “It’s great to have Craig join our team. He is an excellent agent and brings with him a wealth of industry experience, especially in the Buderim precinct.”

Green lessons for local developers

Darren Rix from Re/Max Property Associates participated in the Sunshine Coast leg of the Queensland PGA’s professional golf circuit on Sunday August 16 at the Caloundra Golf Club. He may be a top real estate agent, but Darren proved he’s no slouch on the golf course, either. He took out fourth position with a course-beating score of three under par 68, playing in a field of approximately 100 local and interstate professionals. And this wasn’t a fluke. Darren lived for a number of years in Asia and spent 13 years in Europe as a professional golfer before trading in his pro swing for a career in real estate.

The Sunshine Coast development industry will get up to speed on the advantages of green commercial building at an Urban Development Institute of Australia (Sunshine Coast) presentation of the region’s first Green Star-certified project The Edge on September 10. Following the four-star Green Star certification of commercial building The Edge, and growing market demand for sustainable commercial developments, Sunshine Coast developers will hear how to take advantage of this future building trend. Green Building Council’s state manager in Queensland, Andrew Aitken, will outline the regionally specific means of making these projects economically viable. UDIA Sunshine Coast branch president David Oliver says the event is a must for regional developers looking to position themselves at the forefront

of future building requirements on the Sunshine Coast. “To put this into perspective,” he says, “according to the Sunshine Coast Regional Council’s Maroochydore Centre Position Paper, there will be an additional 50,000 square metres of office space delivered over the next 11 years. “With the council’s plans on imposing minimum five-star Green Star ratings for all new office developments, this indicates a strong trend for sustainable development in the region, and one which developers need to understand thoroughly.” The presentation, ‘Can Green Building Deliver Commercial Returns in a Regional Market?’, takes place from 7.15am until 9am at the Maroochy Surf Club, Maroochydore on Thursday September 10. For more information phone 5493 9091 or visit www.udiaqld.com.au.

A Designer Rural Retreat

55c Mannikin Road, TANAWHA

5

UÊÊ/…ˆÃÊ>“>∘}]Ê>˜`ʈ““>VՏ>ÌiÞÊ«ÀiÃi˜Ìi`ʅœ“iʈÃʘiÃ̏i`ʜ˜Ê>˜ÊiiÛ>Ìi`]Ê vՏÞʏ>˜`ÃV>«i`]Êi>ÃއV>ÀiÊÓÊ>VÀiÃÊ­Ên{ä{“Ó) UÊÊxÊ`œÕLiÊLi`Àœœ“Ã]ÊLÀi>̅Ì>Žˆ˜}ʓ>ÃÌiÀÊLi`Àœœ“]Ê܈̅Ê`iÈ}˜iÀÊi˜ÃՈÌi]Ê `œÕLiÊL>ȘÃ]ÊÃ̜˜iÊ>˜`ʓ>ÀLiÊ>˜`Ê>ÊÃi«>À>ÌiÊ`ÀiÃȘ}ÊÀœœ“ UÊÊ iÈ}˜iÀʎˆÌV…i˜ÊqÊ܈̅ʼi>À̅޽ÊÃÌޏiÊ}À>˜ˆÌiÊLi˜V…Ìœ«Ãʈ˜VÕ`ˆ˜}ʈÏ>˜`Ê Li˜V…Ìœ«]ÊÜ>Ž‡ˆ˜Ê«>˜ÌÀÞ]Ê̜«ÊœvÊ̅iÊÀ>˜}iÊ>««ˆ>˜ViÃÊ܈̅Ê>Ê`œÕLiʜÛi˜

UÊÊi˜iÀœÕÃʏˆÛˆ˜}Ê>Ài>ÃÊ܈̅Ê>ÊÃi«>À>ÌiÊÊvœÀ“>ÊœÕ˜}i]ʏ>À}iÊLˆ‡vœ`Ê`œœÀÃÊ iÝÌi˜`Ê̜Ê̅iʜÕÌ`œœÀʏˆÛˆ˜}Ê>Ài>ÃÊ>˜`Ê>œÜÊޜÕÊ>««ÀiVˆ>ÌiÊ̅iÊÃiÌ̈˜}]Ê >˜`��̅iʘœÀ̅iÀÞÊLÀiiâiÃ°Ê UÊÊ …>“«ˆœ˜Ã…ˆ«ÊÌi˜˜ˆÃÊVœÕÀÌ]Ê}À>ÃÃÊ܈̅ʏˆ}…ÌÃÊ>˜`Ê>˜Ê˜w˜ˆÌÞÊ«œœ UÊ>À}iÀÊ̅>˜Ê˜œÀ“>Ê`œÕLiʏœVŽ‡Õ«Ê}>À>}iÊ>˜`ʅi>«ÃʜvÊÃ̜À>}iÊë>Vi

3

2

TENNIS COURT

Price:

Formal Tender closes at 4pm on the 17th September 2009 View: Saturday 2-2.45pm Contact: Exclusive Agents Vicki Stewart 0412 713 041 Mary Tandy 0408 389 199 Internet ID: STA129

P| (07) 5457 8100 E| info@stewarttandy.com.au W| www.stewarttandy.com.au Shop 3, Pandanus Building, 15-21 Smith Street, Mooloolaba 36 My Property Review | September 4, 2009

Page 36.indd 1

2/09/2009 9:44:48 AM


First National awards night

Time to revitalise

The 2009 Sunshine Coast First National Awards were held at Maroochy Surf Club on August 15. The night drew a number of industry professionals and MPR publisher Michael Kramer fully embraced the roaring â&#x20AC;&#x2122;20s theme to present some

Australia leading speaker on real estate marketing and technology, Julie Ryan, has teamed up with auctioneer and business coach Simon Thomas to present a series of workshops for local professionals. Revitalisenow.com will have monthly sessions available to the public where a range of guest speakers will share

Bond Clare Gorfine, Adam & David Grenfell

awards. Maroochydore First National received the gong for highest number of residential sales, while Shane Purssell, David Grenfell, Adam Bond, Karen Barker, Sabrina Wilmes and Raewyn Porter all picked up awards on the night.

their industry and business success. The first one kicks off on September 9 at Surfair at Marcoola and will feature Kristy Spraggon who will introduce her session â&#x20AC;&#x2DC;Opening a Relationship, Not Just Closing a Saleâ&#x20AC;&#x2122;. Phone Julie Ryan on 0409 770 000 or visit www.revitalisenow.com for more information.

Karen Barker, John Penny & Kerrie Penny

1 Waterlilly Place, TWIN WATERS

4+

Massive Family Home....

3

2

Auction Gala In-Room Tuesday 29/9/09 â&#x20AC;&#x2DC;Surfair Resortâ&#x20AC;&#x2122;, Marcoola @ 6 pm bedrooms and 3 fantastic living areas with ample space View Saturday & Sunday @ 3-3.30 pm Contact Doug Finlay 0412 692 323 for the growing family. This 2 storey home has incredible dďŹ nlay.twinwaters@ljh.com.au side access for the caravan, boat and trailer and the ljhooker.com/1W4GZT Set on 905 square metres, this massive home has 4

Adam Bond & MPRâ&#x20AC;&#x2122;s Michael Kramer

Katrine Stevens & Raewyn Porter

Shannon Pugh & Dean Tomlinson

kids will love the large open backyard and spend hours in the swimming pool.

LJ Hooker Twin Waters 5450 6188 Twin Waters Shopping Village, Ocean Drive QLD 4564

Lifestyle For Sale

14 Verney Street, Kings Beach

22 Kestrel Street, Aroona

4/24 Moreton Pde â&#x20AC;&#x153;Tahitian Surfâ&#x20AC;? Kings Beach

MORE THAN MEETS THE EYE

ELEVATED POSITION

GREAT STARTER

4HISBED BATHBEACHSIDEHOMEISSITUATEDONALARGELEVELBLOCKM§ ISFULLYFENCEDWITHELECTRICFRONTGATE)TISWITHINMINUTES WALKTOBEAUTIFUL+INGS"EACH PARK TAVERN SURFCLUB SHOPSANDFACILITIES4HEmOORSAREPARTORIGINALTIMBERANDTILESTHROUGHOUT THE UPSTAIRSLIVINGISCOMPLIMENTEDBYALARGEÂ&#x17E;XMUNDER COVEREDDECKWHICHISWELLSUITEDFORTHECOASTALLIFESTYLE(ASCARACCOM SEPLOCKABLEUNDERHOUSESTORAGEWORKSHED PADFORBOATORSIMILARANDPLENTYOFROOMFORAPOOL:ONEDMULTIUNITRESIDENTIAL

s/PENPLANLIVINGANDAIR CONDITIONED sBRMS SGLEGARAGEHASBEENCONVERTEDTOTHBRM s.EWPAINT TILEDANDCARPET s,ARGEUNDER COVEREDAREAANDINGROUNDPOOL

sBEDROOMSsBATHROOMs3,5' s7ITHINMINSWALKTO+INGS"EACHAND#"$ANDSHOPS s'REATINVESTMENTOPPORTUNITY s0ERMANENTLYTENANTED

Price:   INSPECT: SATURDAY 1-1.45PM Contact: #AROLA

Price: $399,000 INSPECT: SATURDAY 1-1.45PM Contact: $AVID

Price:   INSPECT: SATURDAY 12-12.45PM Contact: #AROLA

â&#x20AC;&#x153;Shearwater Resortâ&#x20AC;? Esplanade, Kings Beach

14/18 Mahia Tce, â&#x20AC;&#x153;Kings Bayâ&#x20AC;? Kings Beach

8/13 Mahia Tce, â&#x20AC;&#x153;Salt on Kingsâ&#x20AC;? Kings Beach

12-14 Atranto Avenue, Caloundra

GREAT WATERFRONT OPPORTUNITY

WALK TO BEACH

GREAT LOCATION

MONACO

sBDM BATH FULLYFURNAPARTMENT OCEANVIEWS

s4HISSPACIOUSAPARTMENTISLOCATEDONTHENDmOOR s(ASBEDROOMSANDBATHROOMS s)SJUSTASHORTWALKTO+INGS"EACH LOCALRESTAURANTS shops and park s#OMPLEXFEATURESSWIMMINGPOOL LIFT SECUREDPARKING Price:   INSPECT: CALL AGENT Contact: 2OZ

s1UALITY ANDBEDROOMAPARTMENTS s#URRENTLYUNDERCONSTRUCTION COMPLETIONDUEEND s3ENSATIONALOCEANAND0UMICESTONE0ASSAGEVIEWS s&ACILITIESINCLUDE0OOL SPA SAUNA WELL EQUIPPED GYM PROFESSIONALON SITEMANAGERS RESTAURANTS Price: From $359,000 INSPECT: CALL AGENT Contact: 2OZ

s4HESEAPARTMENTSHAVERECENTLYBEENREFURBISHED HAVEFANTASTICOCEANVIEWS NEVERTOBEBUILTOUT s4HEAPARTMENTSAREAIR CONDITIONED FULLYFURNISHED SHOWEXCELLENTRENTALRETURNS s#OMPLEXFEATURESPOOL SPA GYM SAUNA LIFTSAND PROFESSIONALON SITEMANAGEMENT Price: &ROM  INSPECT: CALL AGENT Contact: #AROLA

36 The Esplanade, Kings Beach

s#OMPLEXFEATURES/N SITEMANAGEMENT HEATED POOL BARBECUEAREA TROPICALGARDENS s7ITHINWALKINGDISTANCETO+INGS"EACH Price: $439,000 INSPECT: CALL AGENT Contact: $AVIDOR2OZ

Ph: 5492 5644

www.kbr.com.au My Property Review | September 4, 2009 37

Page 37.indd 1

2/09/2009 9:54:23 AM


11 Karinya Place, â&#x20AC;&#x2DC;Karinya Islandâ&#x20AC;&#x2122; TWIN WATERS

4

â&#x20AC;&#x2DC;Karinya Islandâ&#x20AC;&#x2122; Auction This Saturday Set amidst quality homes on the prestigious â&#x20AC;&#x2DC;Karinya Islandâ&#x20AC;&#x2122; precinct of Twin Waters, this magniďŹ cent property boasts an unparalleled position with north east elevation over broad water. Sit back relax and enjoy all that is on offer with this true masterpiece. Where else can anyone say â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ll take it just the way it isâ&#x20AC;?. Interstate owner says â&#x20AC;&#x2DC;Sellâ&#x20AC;&#x2122;, this superb residence is being offered to the market on a walk-in walk-out basis if desired, beautifully presented & furnished to impress the most discerning buyer. Be amazed no matter where you look, a host of magniďŹ cent features:Â&#x2021;(QVXLWHGEHGURRPVKRPHRIÂśFHZLWKVHSDUDWHHQWU\IRUPDOVLWWLQJURRPODYLVKRSHQSODQOLYLQJDUHDV Â&#x2021;6XSHUEEHDXWLIXOO\PDQLFXUHGJURXQGVFRPSOLPHQWHGE\DKRVWRIZDWHUIHDWXUHVWKDWVXUURXQGWKHSULYDWHPODSSRRO Â&#x2021;+RVWHVVNLWFKHQZLOOLPSUHVVWKHDYLGFKHIÂ&#x2021;0RWLYDWHG6HOOHULQYLWHVRIIHUVSULRUWR$XFWLRQ

Baywater Drive, TWIN WATERS

Private Oasis... Be amazed by the size and space of this 4 bedroom UHVLGHQFH+XJHPĂ&#x2122;FRUQHUEORFNHQMR\DOHDI\RXWORRN WRWDOSULYDF\$EXQGDQFHRIVSDFHIRUERDWYDQZLWK street accesses. Impressive pool in tropical setting creates \RXUYHU\RZQSULYDWHRDVLV0DURRFK\5LYHULVRQO\DVKRUW stroll away. There is no shortage of space inside including parents retreat, modern kitchen, two gracious open plan living areas. Investor owner requires a result!

4

2

2

Auction*DOD,Q5RRP7XHVGD\ ­6XUIDLU5HVRUW®0DUFRROD#SP View By appointment Contact*UDQW2UPURG JRUPURGWZLQZDWHUV#OMKFRPDX OMKRRNHUFRP)*=7

/-+RRNHU7ZLQ:DWHUV 7ZLQ:DWHUV6KRSSLQJ9LOODJH2FHDQ'ULYH4/'

3+

2

Auction2Q6LWH7KLV6DWXUGD\6HSWHPEHU#SP View 7ZLOLJKWYLHZLQJ)ULGD\#SP $XFWLRQGD\6DWXUGD\YLHZIURPSP SULRUWR$XFWLRQ#SP Contact*UDQW2UPURG 2U0LFKDHO$GDPV OMKRRNHUFRP4*=7

/-+RRNHU7ZLQ:DWHUV 7ZLQ:DWHUV6KRSSLQJ9LOODJH2FHDQ'ULYH4/'

104 River Gum Drive, DIDDILLIBAH

Cheapest Acreage With The Works! Â&#x2021;PDJQLÂśFHQWOLIHVW\OHDFUHVIRU\RX\RXUIDPLO\ friends and your toys! Â&#x2021;7URSLFDOSULYDWHVHWWLQJRIIHULQJDVHUHQHHQYLURQPHQW Â&#x2021;EHGEDWKKRPHZLWKJUHDWSODQDQG'/8* Â&#x2021;/DUJHODJRRQVW\OHSRROEHJVIRUXVH Â&#x2021;%LJPDQÂŽVVKHGŠPDVVLYHHQWU\SRLQWVSKDVHSRZHU Â&#x2021;%RDVWLQJWKHODUJHVWDFUHDJHLQRQHRI'LGGLOOLEDKÂŽV most prestigious streets

4

2

6

Price Buyer to Price View%\$SSRLQWPHQW Contact-DPLPD6XWHU OMKRRNHUFRP**=7

/-+RRNHU0DUFRROD 'DYLG/RZ:D\0DUFRROD4/'

38 My Property Review | September 4, 2009

Page 38.indd 1

1/09/2009 12:06:44 PM


Anchorage Circuit, â&#x20AC;&#x2DC;Water Galleryâ&#x20AC;&#x2122; TWIN WATERS

Luxury Apartment Living With A Difference! ­:DWHU*DOOHU\®1HVWOHGEHDXWLIXOO\EHWZHHQJDUGHQ UHVHUYH SLFWXUHVTXHZDWHUZD\V\RXIHHOVRVHFOXGHG WKDW\RXZLOOIRUJHWWKDW\RXHYHQKDYHQHLJKERXUV<RXU YHU\RZQSULYDWHSRROLVDOVREDFNHGE\JDUGHQUHVHUYH WKHVRXQGRIWKHZDWHUIHDWXUHFUHDWHVDORYHO\IHHOLQJ WKURXJKRXW1RUWKIDFLQJGHFNZKLFKJHWVDQDEXQGDQFH RIZLQWHUVXQ FDSWXUHVDOOWKHSHDFH WUDQTXLOOLW\RQ RIIHU%HDXWLIXO¶QLVKHV WRSTXDOLW\¶WWLQJVWKURXJKRXW

82 Suncoast Beach Drive, MOUNT COOLUM

Mt Coolum Entertainer Do not be mistaken, owners have instructed sale at or EHIRUH$XFWLRQÂ&#x2021;ODUJHEHGURRPVGRXEOHHQVXLWHG PDVWHUZLWK:,5Â&#x2021;0XOWLSOHHQWHUWDLQLQJDUHDVUHPRWH '/8*ZLWKLQWHUQDOHQWU\Â&#x2021;/RFDOWRDOODPHQLWLHV LQFOXGLQJPHGLFDODQGSXEOLFWUDQVSRUW$VSDFLRXV RSHQSODQGHVLJQZLWKDEXQGDQWOLYLQJDUHDV([SHUWO\ GHVLJQHG EXLOWDPDMRUIHDWXUHRIWKLVSURSHUW\LVWKH ODUJHSURSRUWLRQRI·RRUVSDFHGHGLFDWHGWROLYLQJDUHDV

3

7KHRZQHUVRIWKLVIDQWDVWLFEHGURRPKRPHZLWK ocean views need a result and need it now! &LUFXPVWDQFHVKDYHFKDQJHGDQGKHUHLV\RXUFKDQFHWR SXUFKDVHDUHVRUWVW\OHSURSHUW\ZLWKSRROJ\PDQG RQVLWHPDQDJHPHQW%X\WKLVEHDFKKRXVHDQGEH WKHHQY\RIDOO\RXUIULHQGVDV\RXHQMR\WKHURRIWRS VSDDQGVRFLDOLVHZLWKDJODVVRIZLQHZKLOHOLYLQJWKH FRDVWDOOLIHVW\OH0DNHQRPLVWDNH©ZHDUHVHOOLQJ

/-+RRNHU0DUFRROD 'DYLG/RZ:D\0DUFRROD4/'

/LQHGZLWKNPRIELNHSDWKV EHDFKIURQWDJHWRWKH 3DFL¶FRFHDQLVWKLVIDQWDVWLFDSDUWPHQWORFDWHGRQWKH IRXUWK·RRURI­0DUFRROD%HDFK5HVRUW®6SDFLRXVRSHQ SODQOLYLQJ NLWFKHQDUHDVZLWKJUDQLWH SDNODUJH EDOFRQ\ZLWKRFHDQJOLPSVHVEHGURRPVERWKZLWKODUJH %,5®VPDVWHUZLWKHQVXLWH6HFXUHGXQGHUJURXQGSDUNLQJ  SURIHVVLRQDORQVLWHPDQDJHPHQW,GHDOIRURZQHURFFXSLHUV RUDQ\LQYHVWPHQWSXUSRVH$FFHVVWR5HVRUWIDFLOLWLHV

3

2

2

Auction Gala In-Room Tuesday 29/9/09 ­6XUIDLU5HVRUW®0DUFRROD#SP View6DWXUGD\ 6XQGD\SP Contact'RXJ)LQOD\ G¶QOD\WZLQZDWHUV#OMKFRPDX OMKRRNHUFRP%*=7

/-+RRNHU7ZLQ:DWHUV 7ZLQ:DWHUV6KRSSLQJ9LOODJH2FHDQ'ULYH4/'

101/885 David Low Way, â&#x20AC;&#x2DC;Marcoola Beach Resortâ&#x20AC;&#x2122;

Beachfront Property For Auction

2

Auction Gala In-Room Tuesday 29/9/09 ­6XUIDLU5HVRUW®0DUFRROD#SP View6DWXUGD\QRRQ Contact-DPLPD6XWHU MVXWHUWZLQZDWHUV#OMKFRPDX OMKRRNHUFRP*6*=7

10/130 Mudjimba Esplanade, â&#x20AC;&#x2DC;Sand Dunesâ&#x20AC;&#x2122; MARCOOLA

Upcoming Beach House Auction

2

2

2

1

Auction Gala In-Room Tuesday 29/9/09 ­6XUIDLU5HVRUW®0DUFRROD#SP View6DWXUGD\DP Contact-DPLPD6XWHU OMKRRNHUFRP)0*=7

/-+RRNHU0DUFRROD 'DYLG/RZ:D\0DUFRROD4/'

3+

/-+RRNHU7ZLQ:DWHUV 7ZLQ:DWHUV6KRSSLQJ9LOODJH2FHDQ'ULYH4/'

5

P2RIOLYLQJVSDFHWKLVVSHFWDFXODUSURSHUW\RYHUORRNV SLFWXUHVTXHZDWHUZD\V LVH[TXLVLWHO\¶WWLQJWRLQFOXGH FEXVVPDUWZLULQJGXFWHG ]RQHGDLUFRQGH[WHQVLYH XVHRIJUDQLWH SROLVKHGVSRWWHGJXP·RRULQJEHGV EDWKURRPVVHSDUDWHSRZGHUURRPVHYHUDORXWGRRUGHFNV LQFOXGLQJSULYDWHEDOFRQ\RIIPDVWHUEHGURRP URRIWRS JDUGHQ6SDFLRXVOLYLQJDUHDVIXOO\IXQFWLRQDOPHGLDURRP that makes you feel like you are at the cinemas.

7ZLQ:DWHUV6KRSSLQJ9LOODJH2FHDQ'ULYH4/'

2

2

Price/RZWRPLG®V View6DWXUGD\SP Contact*UDQW2UPURG JRUPURGWZLQZDWHUV#OMKFRPDX OMKRRNHUFRP9*=7

/-+RRNHU7ZLQ:DWHUV 7ZLQ:DWHUV6KRSSLQJ9LOODJH2FHDQ'ULYH4/'

6 Tassel Place, TWIN WATERS

Beautifully Presented Family Home.... 7KHRZQHUVRIWKLVEHGURRPKRPHDUHORRNLQJWRPRYH RQWREHFORVHUWRZRUN DUHVDGWROHDYHWKHLU¶UVWIDPLO\ KRPHEXWWKHWLPHKDVFRPHWRSDVVLWRQWRVRPHRQH HOVH1HVWOHGLQDSHDFHIXOVWUHHW VXUURXQGHGE\KRPHV ZLWKRZQHUVRIHTXDOSULGH\RXFDQVLPSO\PRYHLQ  HQMR\WKLVGHOLJKWIXOKRPH7KHODUJHPDLQEHGURRPZLWK IDQWDVWLFHQVXLWHLVLQDSULYDWHZLQJRIWKHKRPH JLYHV \RXDSHDFHIXORXWORRNWRWKHORZPDLQWHQDQFHEDFN\DUG

2

/-+RRNHU7ZLQ:DWHUV

5

([FHOOHQWIDPLO\KRPHZLWKGLUHFWJROIIURQWDJH3HUIHFWO\ GHVLJQHGIRUWKHODUJHUIDPLO\ERDVWLQJEHGURRPV ORFDWHGLQRQHZLQJRIWKHKRPHDVZHOODVVSDFLRXVPDVWHU EHGURRPORFDWHGRQWKHRSSRVLWHVLGHRIWKHKRPH+LJK UDNHGFHLOLQJVGXFWHGDLUFRQ7KHUHLVDOVRWKHFKRLFHRI OLYLQJDUHDVWRHQWHUWDLQJXHVWVZKLOHWKHNLGVDUHLQWKH PHGLDRUFDVXDOIDPLO\URRP7DNHLQWKHJROIDFWLRQZKLOH ZDWFKLQJWKHNLGVLQWKHVRODUKHDWHGSRRO

4

Auction Gala In-Room Tuesday 29/9/09 ­6XUIDLU5HVRUW®0DUFRROD#SP View6DWXUGD\DP Contact*UDQW2UPURG JRUPURGWZLQZDWHUV#OMKFRPDX OMKRRNHUFRP1<*=7

24 Hetherington Drive, TWIN WATERS

Bring The Clubs and The Kids...

2

Price/RZWR0LGV View%\$SSRLQWPHQW Contact*UDQW2UPURG JRUPURGWZLQZDWHUV#OMKFRPDX OMKRRNHUFRP*1*=7

1 River Edge Court, TWIN WATERS

Masterpiece on â&#x20AC;&#x2DC;River Edgeâ&#x20AC;&#x2122;

2

3

2

2

Auction Gala In-Room Tuesday 29/9/09 ­6XUIDLU5HVRUW®0DUFRROD#SP View6DWXUGD\DP Contact'RXJ)LQOD\ G¶QOD\WZLQZDWHUV#OMKFRPDX OMKRRNHUFRP((*=7

/-+RRNHU7ZLQ:DWHUV 7ZLQ:DWHUV6KRSSLQJ9LOODJH2FHDQ'ULYH4/'

My Property Review | September 4, 2009 39

Page 39.indd 1

1/09/2009 10:20:17 AM


Exclusively Listed By Julie Coffey and Steve Kealey

Meticulous Waterfront Home 5

3

2.5 Pool

VIEW Saturday 12-12.30pm AUCTION Saturday 3rd October @ 1pm JULIE COFFEY 0416 141 065 STEVE KEALEY 0437 935 369

Kawana Waters 5477 7500

7 Ê- ÊÎÎÊ >ÀLÕ`>Ê ˆÀVÕˆÌ 1«œ˜Êi˜ÌiÀˆ˜}Ê̅ÀœÕ}…Ê̅iÊÀÕÃ̈VÊܜœ`i˜Ê«ˆ>ÀÃÊ̅>ÌÊ}À>ViÊ̅iʓ>ˆ˜Êi˜ÌÀ>˜ViÊޜÕÊ܈ÊLiÊ}ÀiiÌi`ÊÊLÞʜ˜iʜvÊ̅iʈÏ>˜`ÃʓœÃÌÊ Ì>ÃÌivՏÞÊ>««œˆ˜Ìi`Ê>˜`ʈ“«iVV>Liʅœ“ið UÊ-Ì՘˜ˆ˜}ʎˆÌV…i˜]Ê >iÃ>ÀÊÃ̜˜iÊ>˜`ʈiiÊ>««ˆ>˜ViÃÊÊ

UÊxÊë>VˆœÕÃÊLi`Àœœ“Ã]ʈ˜VÕ`ˆ˜}Ê£ÊÕiÃÌÊLi`Àœœ“

UÊ>ÃÌiÀÊLi`Àœœ“Ê܈̅ʏÕÝÕÀˆœÕÃÊi˜ÃՈÌiÊ>˜`Êë>ÊL>̅ÊÊ

UÊՏÞÊ܈Ài`Ê̅i>ÌÀiÊÀœœ“Ê}Ài>ÌÊvœÀÊ̅iÊv>“ˆÞ

UÊ Ý«>˜ÃˆÛiÊ œÀ̅Ê>˜`Ê-œÕ̅ÊÜ>ÌiÀÊۈiÜÃÊ

UÊ ii«ÊÜ>ÌiÀʜVi>˜Ê>VViÃÃÊ>˜`ÊÀiÜÀÌÊÃÌޏiÊ«œœ

Waterfront Investor Liquidates 7 Ê- Ê£äʘ̈}Õ>Ê œÕÀÌ /…ˆÃÊÃÌޏˆÃ…ÊxÊLi`Àœœ“Ê…œ“iÊ܈̅Ê>ÊÓäʓiÌÀiÊV>˜>Ê vÀœ˜Ì>}iÊ>˜`ÊʏœV>Ìi`ʈ˜ÊµÕˆÌiÊVՏ‡`i‡Ã>VÊ«ÀœÛˆ`iÃÊޜÕÊ ÜˆÌ…Êv>LՏœÕÃÊÜ>ÌiÀÊۈiÜÃ]Ê«ÕÃÊ̅iÊ«œÌi˜Ìˆ>Ê̜Ê>``Ê>Ê «œ˜Ìœœ˜ÊvœÀÊޜÕÀÊ«i>ÃÕÀiÊVÀ>vÌÊ>˜`Êi˜œÞÊ̅iÊ`ii«ÊÜ>ÌiÀÊ ocean access. UÊxÊë>VˆœÕÃÊLi`Àœœ“à UÊÎÊL>̅Àœœ“Ã]Ê{Ê̜ˆiÌà UÊÎÊÃi«>À>ÌiʏˆÛˆ˜}Ê>Ài>à UÊ"«i˜Ê«>˜ÊŽˆÌV…i˜ÊÜˆÌ…Ê >iÃ>ÀÊ-̜˜iÊ UÊÓäʓiÌÀiÊV>˜>ÊvÀœ˜Ì>}iʜ˜Ê>ÊÇÓӓÓÊLœVŽ UÊ>ÃÌiÀÊ܈̅Êi˜ÃՈÌi]Êë>�� UÊ-œ>Àʅi>Ìi`ʈ˜}ÀœÕ˜`ÊÃ>ÌÊÜ>ÌiÀÊ«œœ UÊ"/6/ Ê6 ",ÊqÊ , ÊÊ" ,-

5

3

2 + Pool

Luxury Waterfront Lifestyle – Seriously Motivated Vendor KAWANA ISLAND, 55/7 Grand Parade Forget any previous price indications. Hardly lived in, never tenanted and used only as a holiday retreat and the vendor needs this sold at or before auction. UÊ Ý«>˜ÃˆÛiÊÜ>ÌiÀÊۈiÜÃʜÛiÀÊ̅iÊV>˜>° UÊ>À}iʎˆÌV…i˜]ÊÃ̜˜iÊLi˜V…iÃʳÊ̜«Êi˜`Ê>««ˆ>˜ViÃÊ UÊÎÀ`ʏiÛi]ÊÎʏ>À}iÊLi`Àœœ“ÃÊi>V…Ê܈̅ʜܘÊL>Vœ˜Þ UÊ"«i˜Ê«>˜ÊˆÛˆ˜}Ê܈̅Ê`ÕVÌi`Ê>ˆÀÊVœ˜ UÊÓÊV>ÀÊë>ViÃÊÈ`iÊLÞÊÈ`iÊ«ÕÃÊÃ̜À>}i UÊ"˜ÊÈÌiÊv>VˆˆÌˆiÃ\ÊÓÊ«œœÃ]Êë>]Ê}ޓ]ÊÃ>՘>

3

2

2 + Pool

VIEW Saturday 1-1.30pm AUCTION On site Friday 11th September at 4pm INTERNET ID 105844383 STEVE KEALEY 0437 935 369 JULIE COFFEY 0416 141 065

VIEW Saturday 2-2.30pm AUCTION On site Friday 11th September at 5pm INTERNET ID 105867865 STEVE KEALEY 0437 935 369 JULIE COFFEY 0416 141 065

Kawana Waters 5477 7500

Kawana Waters 5477 7500

rhq.com.au

we’ll look after you®

40 My Property Review | September 4, 2009

Page 40.indd 1

1/09/2009 3:21:11 PM


AU C

TI

ON

Will Be Sold at a Loss!

Family Inheritance Up For Grabs

7 Ê- Ê{£É{ÊÀ>˜`Ê*>À>`i

""""  21 and 23 Culbara St

>Ü>˜>ÊÏ>˜`Ê՘ˆÌÊëiVˆ>ˆÃÌÊ7>ÀÀi˜Ê-iÛ>}iʜvviÀÃÊ Ì…ˆÃÊÃÌޏˆÃ…Ê>«>À̓i˜Ì]ʈ˜Ê̅iÊÛiÀÞÊ`iÈÀ>Liʼ >ÀˆLLi>˜½Ê Vœ“«iÝ]Ê܈̅ÊÃÌ՘˜ˆ˜}]ʘœÀ̅iÀÞÊۈiÜÃʜÛiÀÊ œÕLiÊ >ÞÊ i>V…°Ê/…iÊVœ“«iÝʅ>ÃÊv>LՏœÕÃÊÀiÜÀÌÊÃÌޏiÊ v>VˆˆÌˆiÃʈ˜VÕ`ˆ˜}Ê«œœ]ÊLLµÊ>Ài>]ÊvՏ‡ÃˆâiÊÌi˜˜ˆÃÊVœÕÀÌ]Ê plus an extra storage area. The current owners are very motivated and will meet the market.

Tightly held within the family vault for over twenty years circumstances have necessitated the urgency to sell these two adjoining deep water blocks in Mooloolaba.

UÊ£ÎÊõ“Ê œÀ̅Êv>Vˆ˜}ÊL>Vœ˜ÞÊ܈̅ÊÜ>ÌiÀÊۈiÜà UÊ-iVÕÀiÊV>ÀÊ«>ÀŽˆ˜}Ê܈̅ʏˆvÌÊ>VViÃà UʈÀ‡Vœ˜`ˆÌˆœ˜ˆ˜}Ê̜ʓ>ˆ˜ÊˆÛˆ˜}Ê>Ài> Uʼ*iÌÊvÀˆi˜`Þ½ÊVœ“«iÝ

œ˜ÕÃ\ÊÊÊvœÕÀÊLi`Àœœ“Ê…œÕÃiʜ˜Êœ˜iʜvÊ̅iÊLœVŽÃ° UÊ œÀ̅iÀÞÊ>ëiVÌ]ÊÎǓÊÜ>ÌiÀÊvÀœ˜Ì>}i]Ê£{xÈõ“Êœvʏ>˜` UÊÊ7>Žˆ˜}Ê`ˆÃÌ>˜ViÊ̜ÊۈLÀ>˜ÌÊV>vjÊÃVi˜iÊ>˜`Ê«>ÌÀœi`Ê beach UÊ"ܘÊ̅ˆÃÊLÕiÊV…ˆ«Êˆ˜ÛiÃ̓i˜ÌÊ UÊ`i>ÊvœÀÊʅœ“iʜܘiÀ]Ê`iÛiœ«iÀʜÀʏ>˜`ÊL>˜ŽiÀ UÊ1˜ˆ“ˆÌi`ʜ««œÀÌ՘ˆÌˆiÃÊ܈̅Ê̅ˆÃÊëiVˆ>Ê«>ÀViÊœvʏ>˜` TAKE ADVANTAGE NOW

1

AU C

1

1 + Pool

4

2

2 Canal Front

VIEW Saturday 12-12.45pm AUCTION On Site 19th September at 1pm INTERNET ID 105937365 WARREN SELVAGE 0411 433 500

VIEW By Appointment AUCTION On Site Sunday 27th September at 1pm INTERNET ID 105963083 ANN JELF 0413 335 541 DIANA STEWART 0411 442 114

Kawana Waters 5477 7500

Kawana Waters 5477 7500

Owner Will Sell Under Cost!

TI

ON

7 Ê- Ê{nÉ{ÊÀ>˜`Ê*>À>`i An amazing chance to secure a luxury apartment at a bargain price. This will be sold on auction day if not sold prior. UÊ7>ÌiÀÊۈiÜà UÊ*iÌÊvÀˆi˜`ÞÊVœ“«iÝ UÊÎÊL>̅Àœœ“à UÊ*œœÊ>˜`ÊÌi˜˜ˆÃÊVœÕÀÌ UÊ-ˆ`iÊLÞÊÈ`iÊ«>ÀŽˆ˜} UÊÓÊL>Vœ˜ˆià DON’T MISS THIS INCREDIBLE OPPORTUNITY

3

3

2 + Pool

VIEW Saturday 12-12.45pm AUCTION Saturday 19th September On Site at 2pm KERRY CROOK 0400 454 351 WARREN SELVAGE 0411 433 500

Kawana Waters 5477 7500

Spacious, Immaculate and Priced Right

Location, Location, Location!

7 Ê- ÊÎÓÉ£ÊÀi˜>`>Ê7>Þ

This family home situated in the sought after Kawana Lakes Precinct is a rare and exciting find. This house could be moved straight into or has the potential to be renovated.

>Ü>˜>ÊÏ>˜`ʼ՘ˆÌÊëiVˆ>ˆÃ̽Ê7>ÀÀi˜Ê-iÛ>}iÊ«ÀœÕ`ÞÊ «ÀiÃi˜ÌÃÊ̅ˆÃʈ““>VՏ>ÌiÞÊ«ÀiÃi˜Ìi`]ÊÎÊLi`Àœœ“Ê >«>À̓i˜ÌÊ܈̅Ê>ʘœÀ̅iÀÞʜÕ̏œœŽÊ̜Ê̅iʼÀiÜÀÌÊÃÌޏi½Ê pool and entertainment complex. Uʼ,iÜÀÌÊ-Ìޏiʼ«œœÊVœ“«iÝ UÊޓ˜>ÈՓ UÊ/i˜˜ˆÃÊVœÕÀÌ UÊÓnÊõ“ʘœÀ̅Êv>Vˆ˜}ÊL>Vœ˜Þ

3

rhq.com.au

2

2

WURTULLA 3 Keel Court

UÊnÈä“ÔÊLœVŽt UÊ Õ>ÊÈ`iÊ>VViÃÃÊqÊ«iÀviVÌÊvœÀÊ>ÊLœ>ÌʜÀÊV>À>Û>˜ UÊÀ>˜ˆÌiÊLi˜V…Ìœ«Ã UÊ/ܜʏˆÛˆ˜}Ê>Ài>à UʈÀ‡Vœ˜`ˆÌˆœ˜ˆ˜} UÊ>LՏœÕÃʏœV>̈œ˜ UÊ"˜iʓˆ˜ÕÌiÊÃÌÀœÊ̜Ê>Ü>˜>Ê>ŽiÃÊ

4

2

VIEW Saturday 1-1.45pm & Sunday 2-2.45pm PRICE $449,000 INTERNET ID 105897735 WARREN SELVAGE 0411 433 500

VIEW Saturday 10-10.45am PRICE Owners request all offers INTERNET ID 105952252 MELISSA PIKE 0410 942 186

Kawana Waters 5477 7500

Kawana Waters 5477 7500

2

we’ll look after you® My Property Review | September 4, 2009 41

Page 41.indd 1

1/09/2009 12:31:12 PM


property reviews Looking For New Owner! LITTLE MOUNTAIN 33 Alicia Cct UÊ7iÊ«ÀiÃi˜Ìi`]ʘi>ÌÊ>˜`Ê̈`Þ UÊ-ˆÌÕ>Ìi`ʜ˜Ê{{xõ“ UÊÀi>ÌÊ«œÃˆÌˆœ˜]ʵՈiÌÊÃÕÀÀœÕ˜`ÃÊ UÊ >ÃÞÊ>VViÃÃÊÌœÊ ÀˆÃL>˜i UÊ*ÀˆVi`ÊvœÀʈ““i`ˆ>ÌiÊÃ>i UÊ œÃiÊ̜ÊÃV…œœÃ]ÊŜ«ÃÊ>˜`ÊÌÀ>˜Ã«œÀÌÊ

4

2

2

VIEW Saturday 11-11.30am SET SALE® OFFERS CLOSE SEPTEMBER 15 UNLESS SOLD PRIOR BUYER INQUIRY RANGE® $400,000 - $485,000 VALUE AT $445,000 INTERNET ID 105932918 STUART BORDER 0414 349 424

Caloundra 5436 8108

Trendy Entertainer MERIDAN PLAINS 50 Kurrajong Crescent

The Island’s Little Gem KAWANA ISLAND, 2/4 Solomon Court

Situated in the heart of Kawana Forest this contemporary 3 bedroom, 2 bath home perfectly suited to the First home Buyer, Investor or Retiree is priced to Sell. Inspection a Must.

This delightful two bedroom, two bathroom property is conveniently located in a quiet cul-de-sc, on the prestigious Kawana Island. With its modern interior and open plan design the home has a charm and warmth of its own. The large living area flows out to the alfresco area with timber deck & landscaped garden.

3

2

2

2 + Pool

2

1

VIEW Saturday 12-12.30pm PRICE Offers over $399,000 INTERNET ID 105381370 JULIE COFFEY 0416 141 065 STEVE KEALEY 0437 935 369

VIEW Saturday 1-1.30pm PRICE Offers Over $388,000 INTERNET ID 105933970 JULIE COFFEY 0416 141 065 STEVE KEALEY 0437 935 369

Kawana Waters 5477 7500

Kawana Waters 5477 7500

we’ll look after you®

Address: Features: Price: Agent: Contact:

3 Traill Crescent, Currimundi 4 bed, 2 bath, 3 car $549,500 Go Gecko Caloundra 5499 7859 Maree Best 0409 423 063

Kawana Island stunner Address: Features: Price: Agent: Contact:

7 Melos Place, Kawana Island 4 bed, 2 bath, 2 car Buyers over $590,000 Harcourts Buderim 5476 7822 Trish Kelly 0400 344 314 and Beverley Kelley 0412 205 040

This stunning contemporary home offers a master bedroom with balcony, walk-in robe and ensuite, housed in a separate wing. The fourth bedroom or office on the ground floor has easy access from the front entry foyer. The home also has an open-plan kitchen, dining, family and lounge rooms, plunge pool and outdoor entertainment areas. Other features include high ceilings, air-conditioning and central vacuum.

SA T & INS SU PEC N T 1. 15 -2 P

M

rhq.com.au

Relax in Currimundi

Designed for comfort and relaxation, this home offers four or five bedrooms, formal lounge and dining and a kitchen that overlooks an informal living area. There is a large undercover deck and saltwater pool and an extra toilet outside to cater for the swimmers and versatile garaging and car parking. This home offers quality and position.

LOW MAINTENANCE, IMMAC HOME, REDUCED PRICE, SELLER WANTS SOLD!! 126 Glenfields Boulevard, MOUNTAIN CREEK Ideally suited for an upwardly mobile couple, who desire the lifestyle yet don’t want to spend all their free time maintaining it, this is the home you’ve been looking for. Positioned on the sunny side of the street, everything is in place for a fantastic coastal lifestyle. UÊ-œˆ`ÊLÀˆVŽÊ>˜`Ê̈iÊVœ˜ÃÌÀÕV̈œ˜ UÊ{Ê`œÕLiÊÈâi`ÊL`“ÃÊ܈̅ÊLɈ˜ÊÀœLiÃ]ʓ>ÃÌiÀÊ܈̅Êi˜ÃՈÌiÊ>˜`Ê7,

4

2

2

UÊi`ˆ>ÊÀœœ“Ê܈̅ʫÀœiV̜ÀÊ>˜`ÊÃVÀii˜ UÊ-«>ÀŽˆ˜}ÊÃÌ>ˆ˜iÃÃÊÃÌiiÊŽˆÌV…i˜ UÊœÀ“>Ê`ˆ˜ˆ˜}ÊÀœœ“Ê܈̅ÊÃi«>À>ÌiÊv>“ˆÞÊÀœœ“ UÊ ÕVÌi`ÊÉ Ê«ÕÃÊL>VŽÊ̜ÊL>ÃiÊÃiVÕÀˆÌÞÊÃÞÃÌi“ UÊ-«>ÀŽˆ˜}ÊÃ>ÌÊÜ>ÌiÀʈ˜}ÀœÕ˜`Ê«œœ UÊ/ܜÊV>ÀÊÀi“œÌiÊ}>À>}i]ÊÛiÀÞʏœÜʓ>ˆ˜Ìi˜>˜ViÊ}ÀœÕ˜`ÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊÊ

Buyers Around High $400K Should Inspect Internet: #105959134

Clive Gannon 0402 825 262, Brad Gannon 0404 534 296

42 My Property Review | September 4, 2009

Page 42.indd 1

1/09/2009 2:14:16 PM


SA I TU NS RD PE AY CT 10 -1 1A M NORTH FACING BUDERIM BEAUTY 1 Cooba Close, BUDERIM If you’re in the market for a home on the Sunshine Coast that speaks volumes about character and style look no further, you’ve just found it. From the moment you pass through the double gates on the driveway you know that you’re in for a real treat and your expectations are only heightened as you move effortlessly from one living area to the next in this magnificently presented family home.

4

2

2

Internet: #105908904

UÊ““>VՏ>ÌiÞÊ«ÀiÃi˜Ìi`ʓՏ̈‡iÛiÊv>“ˆÞʅœ“iÊ UÊœÕÀÊë>VˆœÕÃÊLi`Àœœ“ÃÊ܈̅ÊLՈÌ‡ˆ˜ÊÜ>À`ÀœLiÃÊ UÊ>ÃÌiÀÊLi`Àœœ“Ê܈̅Êi˜ÃՈÌiÊ>˜`Ê«ÀˆÛ>ÌiÊ`iVŽÊ UÊ ˜ÌiÀÌ>ˆ˜iÀÃÊ`iÕÝiʎˆÌV…i˜ÊUÊ>ÃÈÛiʜ«i˜Ê«>˜Ê`iÈ}˜Ê Uʘ}ÀœÕ˜`ÊÃ>ÌÊÜ>ÌiÀÊ«œœÊUÊœÜʓ>ˆ˜Ìi˜>˜ViÊ}>À`i˜ÃÊ>˜`Ê}ÀœÕ˜`ÃÊ UÊ/ܜÊV>ÀʏœVŽ‡Õ«Ê}>À>}iÊUÊ>À}iÊnÈä“ÔÊLœVŽÊ̅>ÌʈÃÊVœ“«iÌiÞÊÃiVÕÀi`

Sale by Negotiation Clive Gannon 0402 825 262, Brad Gannon 0404 534 296

NO NOISE, NO NEIGHBOURS, NO WORRIES 149 Towen Mountain Road, WEST WOOMBYE The first thing you notice when you inspect this magnificent family home is the only noise you hear is the sound of the native birds and their sweet melodic sound. Completely embraced by nature and delightfully presented the living just doesn’t get any better than this. UÊÓ°xÊVÀiÃÊ>˜`Ê̜Ì>ÞÊ«ÀˆÛ>ÌiÊ܈̅ÊÓxÊvÀՈÌÊLi>Àˆ˜}ÊÌÀiià UÊÎʏ>À}iÊLi`Àœœ“ÃÊ܈̅ÊLՈÌ‡ˆ˜ÊÜ>À`ÀœLiÃ

3+

2

2

Internet: #105959389

UÊ-ÌÕÀ`ÞÊLÀˆVŽÊ>˜`Ê̈“LiÀÊVœ˜ÃÌÀÕV̈œ˜Ê܈̅ʙvÌÊViˆˆ˜}à UÊœÕÀ“iÌʎˆÌV…i˜Ê܈̅Ê}À>˜ˆÌiÊLi˜V…Ê̜«Ã UÊ/ܜÊÃi«>À>ÌiʏˆÛˆ˜}Ê>Ài>ÃÊUÊœÀ“>Ê`ˆ˜ˆ˜}Ê>Ài> UÊ>}ˆV>Ê}>À`i˜ÃÊ܈̅ÊÜ>ÌiÀÊvi>ÌÕÀiÃÊUÊ>LՏœÕÃʅˆ``i˜ÊÃ܈““ˆ˜}Ê«œœ UÊ ÕLLˆ˜}Êë>Ê̅>ÌʜÛiÀʏœœŽÃÊ̅iÊÛ>iÞÊLiœÜ UÊÓÊV>ÀÊÀi“œÌiÊ}>À>}iÊUÊ>}ˆVÊ>ÌÊiÛiÀÞÊÌÕÀ˜

Buyers Around $700K Should Inspect Clive Gannon 0402 825 262, Brad Gannon 0404 534 296 My Property Review | September 4, 2009 43

Page 43.indd 1

2/09/2009 9:38:09 AM


property reviews Affordable Sippy Downs land

Address: Features: Price: Agent: Contact:

This could be the cheapest 501-square metre block available in the Sippy Downs area. Build your dream home in a growing community, located close to shops, the University of the Sunshine Coast, medical centre and schools. The land is ready and waiting.

16 Chestwood Crescent, Sippy Downs Land $220,000 Pam Court Realty 5456 1599 Rod Bennett 0416 724 244

Comfortable Warana home

Address: Features: Price: Agent: Contact:

Waterfront Sub Penthouse on Lake Kawana 195m2 55 /11 Innovation Way, Kawana 3

2

This brick home in popular Warana has an easterly aspect close to the ocean. It has huge living, lounge and dining areas, three built-in bedrooms (two are air-conditioned) and ensuite to main. A large pergola at the rear offers space to relax and there is a large rainwater tank, tool shed and low maintenance garden.

8 Karumba Street, Warana 3 bed, 2 bath, 3 car $539,000 Colliers International Sunshine Coast Rod Saunders 0407 713220

ect Insp by t tmen n i o p Ap

2

This magnificent apartment offers the best of both worlds from relaxation to action to all your every day conveniences. Positioned on a north eastern aspect on the regatta rowing lake where you can enjoy on a weekend the professional rowers race and train. Adjacent the lake you also have the Kawana entertaining community centre where you watch concerts, plays and theatre. If you wish to go for

an afternoon or morning stroll you can walk around the lake with 10 kilometres of concrete pathway. This is a truly amazing apartment. This sub penthouse apartment offers a very large open floor plan to take in the views at 195m2 and also a 38m2 double garage. The internal finishing’s are elegant and finished with the highest standards.

$799,000 Dean Ind 0438 046 677

Single Level Villa

Life's a Holiday

42 Dalton Drive, Maroochydore

Unit 12 "Headland Tropicana" 274 Alexandra Pde, Alexandra Headland

2 3 ect Insp ay rd Satu pm 2 1 11-

2

1

Small complex (Total of 12), well organised, very healthy sinking fund, lowest body corporate, beautifully maintained. Long term mature owners and tenants live here because they are happy. One thing that guarantees a quick sale is the motivation of the seller who is WIDE OPEN to an offer and WILL SELL NOW! Buyers around $300k should investigate. Phone now for a full details 1300 REAL ESTATE

No Reserve Auction Unless Sold Prior Steve Suter 0400 507 000

ect Insp ay rd Satu 0pm .3 2 1 12-

2

1

Enjoy your holidays from this beachfront unit while letting it out the rest of the time through professional on-site management. Situated high on the headland, this elevated ground floor, fully furnished holiday apartment is positioned on the prime north easterly side of the complex enjoying extensive ocean views. "Headland Tropicana" offers the holiday makers a large resort style pool, heated indoor pool with spa, sauna, games room, half sized tennis court, a fully serviced outdoor BBQ area and is a short walk to the patrolled beaches, cafes and restaurants of Alexandra Headland and also Mooloolaba. "Make this your next holiday destination"

Reduced for quick sale $398,000 Nigel Baker 0409 511 622

44 My Property Review | September 4, 2009

Page 44.indd 1

1/09/2009 2:13:13 PM


ect Insp ay rd Satu om r 5th f pm 2 11-1

â&#x20AC;&#x153;Absolutely one of a kindâ&#x20AC;? Platinum Beach Front 360 Degree of total top ďŹ&#x201A;oor penthouse 1/923 David Low Way, Marcoola (Surfair Apartments) The Central Tower Penthouse will have to be one of the most unique properties on the Sunshine Coast. Boasting 835sqm this penthouse occupies the entire top ďŹ&#x201A;oor and roof deck with 360 degree views over the PaciďŹ c Ocean and Western Hinterland from every room.

The Central Tower Penthouse includes... t'PVSMBSHFCFESPPNTFBDIXJUIESFTTBSFBBOESBJTFEFOTVJUFT t&YQBOTJWFMJWJOHBOEEJOJOHBSFBTXJUIQPMJTIFEUJMFEnPPST t1SJWBUFEBZCFE t'VMMZFRVJQQFE(BHHFOBVTUBJOMFTTLJUDIFOBQQMJBODFTXJUITUPOFCFODIFTBUSVFDIFGTESFBN t.FEJBSPPNXJUIMBSHFQMBTNBTDSFFOBOEDBCMF57 t4FQBSBUFGBNJMZSPPNXJUILJUDIFOFUUF t1PXEFSSPPNBOETFQBSBUFMBVOESZ t5XPTFDVSFELFZMJGUBDDFTTPQFOJOHUPQSJWBUFGPZFS t5ISFFTFDVSFCBTFNFOUDBSQBSLT t'PVSMBSHFCBMDPOJFTPGGMJWJOHBOECFESPPNBSFBT t*OUFSOBMTUBJSBDDFTTUPSPPGEFDLXJUIQSJWBDZTDSFFOTXJUISPPGUPQ##2 tEFHSFFWJFXTPGUIFPDFBOBOEUIFNPVOUBJOT t'VMMZEVDUFEBOE[POFESFWFSTFDZDMFBJSDPOEJUJPOJOH t"DDFTTUP3FTPSUGBDJMJUJFT t%JSFDUBDDFTTUPCFBDIBOEQBUSPMMFEBSFB t-BSHFIFBUFESFTPSUQPPMBOETFQBSBUFLJETQPPM t3FTUBVSBOUXJUISPPNTFSWJDF t'VMMZFRVJQQFEHZNOBTJVN t$MPTFQSPYJNJUZUP4IPQQJOHBU/PPTBBOE.BSPPDIZEPSF t5ISFFHPMGDPVSTFTBOEOBUJPOBMQBSLTBUZPVSEPPSTUFQ This penthouse can be lived in as a permanent place to live or as a holiday home due to, the penthouse ďŹ&#x201A;oor plan layout can be separated into two distinct living areas/units, and that the four bedrooms all have separate locks on them if you wish to create accommodation returns on your investment.

Price $2,850,000 | Exclusive Dean Ind 0438 046 677 | Email dean@waterfrontcoastal.com.au | Inspect 5th, 12th, 19th, 26th September 11am to 12pm

My Property Review | September 4, 2009 45

Page 45.indd 1

1/09/2009 2:06:46 PM


1300 651 588

property reviews

www.insiterealty.com.au N SU & T SA 45PM N E 2. OP 2-

MONEY IN THE BANK 5 Nanyima Street, BUDDINA

Maroochydore apartment

Position, Position, Position. Close to the beach, shopping, sporting complexes and parks. Priced to sell and motivated to start his new life. Room to move! 5 bedrooms main with ensuite and WIR, 2 bathrooms, multiple living areas, capped by the beautiful pool area which is private. A pure lifestyle which will become one of the best investments you have ever made!!

Address: Features: Price: Agent: Contact:

PRICE: HIGH $600,000â&#x20AC;&#x2122;S

Perched on the 11th floor, this unit offers stunning ocean, river and hinterland views. Positioned at the end of the block to capture the light and breezes, this property also has three bedrooms and an ensuite to the master, and a large living area, which captures the perfect views. The complex has a heated pool, spas, sauna, tennis court and immaculate grounds right beside the ocean.

Unit 46 â&#x20AC;&#x2DC;Majorca Isleâ&#x20AC;&#x2122;, 27 Sixth Avenue, Maroochydore 3 bed, 2 bath, 1 car Expressions of interest Maroochydore First National 5479 6600 David Grenfell 0419 946 534

CONTACT: Gary Saunders 0407 671 202

T CT MEN E SP T IN POIN AP BY

This is five-star Sunshine Coast land on Buderim mountain, only five minutes to beach. The soil test and architect plans are available. This million-dollar neighbourhood, in this tranquil cul-de-sac, offers an exclusive lifestyle. To be able to purchase this land and create your own signature property represents the best value entry into this area.

INCOMPARABLE DESIGNER RESIDENCE 17 Hastings Place, BUDERIM Relax in the saltwater pool, on the screened verandah or at the sandstone ďŹ nished decking, while preparing a feast in the meticulously designed gourmet kitchen. Invite the guests to stay as they have their own living space, 2 bedrooms and bathroom. The remaining 2 bedrooms in the home have ensuites attached. Towering over the neighbours, insuring privacy while enjoying the low maintenance large ďŹ&#x201A;at yard. When its time to get back to business retreat downstairs to your spacious home ofďŹ ce with separate side access.

Desirable Buderim land Address: Features: Price: Agent: Contact:

16 Mayfair Lane, Buderim Land $599,000 Brown Realty Buderim 5445 6144 Mike Paten 0412 070 833, Pam Paten 0412 957 403

PRICE: LOW-MID $700,000â&#x20AC;&#x2122;S CONTACT: Mel 0434 486 347, Linda 0438 952 462

HOUSE & LAND PACKAGES

N SU T/ PM A S 5 EN 12.4 P O 12-

Chancellor Park TO BE FULLY COMPLETED Nothing more to do!

$419,000 5476 9422 Buderim

STYLISH EXECUTIVE HOME! 5 Creekside Drive, SIPPY DOWNS s7ELLBELOWREPLACEMENTCOSTs%XDISPLAYHOME MASTERPIECEsM2BLOCKsSEPLIVINGAREAS s$UCTEDAIRCONsBDRMS STUDYs,ARGEMASTER WHUGE7)2LUXURYBTHRMs)MMACLANDSCAPING PRICE: $595,000 Nick Boundford 5476 5588 / 0403 050 111

Chancellor Park

Sippy Downs

Exceptional Buderim home Address: Features: Price: Agent: Contact:

24 Atherton Close, Buderim 4 bed, 1 ofďŹ ce, 2 bath, 2 car Mid $600,000s Re/Max Property Associates 5456 0225 Darren Rix 0416 188 259

This well-presented home has four bedrooms and study, complete with built-ins. The large open-plan living area flows onto the al fresco area and saltwater pool. Large double entry doors reveal a spacious and bright residence. The fully fenced 717-square metre block has side access for a car or trailer, and a grassed area for kids to play. Just two years old, this stylish home also has a double lock-up garage.

Mountain Creek Serg Gubecka 0410 557 975 Jamie Holbrook 0418 500 081 Trevor & Glenys Martin 0400 818 777

p: 07 5412 1600 e: info@propertytoday.net.au EN OP AT AM S .30 1 -1 11

EN OP AT M S 0P 2.3 2-

Penthouse Liquidation Sale 1006/36 â&#x20AC;&#x2DC;Wavesâ&#x20AC;&#x2122; Duporth Ave, Mâ&#x20AC;&#x2122;dore 3 2 2 Rooftop spa, gym Positioned on the Eastern wing of the higly desirable â&#x20AC;&#x2DC;Wavesâ&#x20AC;&#x2122; residential building is this absolute waterfront penthouse apartment with private roof top entertaining. This prime location is central and the views are virtually unmatched. Unfortunate circumstances now call for an immediate sale. Jamie Holbrook 0418 500 081 $1,000,000+ buyers!

Family Living At Its Best! 5

2 Sundown Close, Tanawha + ofďŹ ce 3 2 12,050m²

Level north facing properties rarely last long within the â&#x20AC;&#x2DC;dress circleâ&#x20AC;&#x2122; of Tanawha. Elevated and positioned on a mind blowing 12,050m² is this new designer home complete with its very own exclusive rainforest on the title with the possibility of subdividing at a later date. This is a rare offering. Jamie Holbrook 0418 500 081 $1,400,000

46 My Property Review | September 4, 2009

Page 46.indd 1

1/09/2009 2:21:11 PM


Serg Gubecka 0410 557 975 Jamie Holbrook 0418 500 081 Trevor & Glenys Martin 0400 818 777

M P 1 T A T A S S I H T N O I T C AU

M RO TF SA PM EN .30 OP 12 Panoramic Designer Waterfront Must Be Sold ASAP! 18 Corella Drive, Parrearra 4

+ OfďŹ ce

2

2

+ Heated Pool

Waterfront living at its best, prestigiously addressed in The Quays, Parrearra this superb Reitsma designed 4 bedroom, 2 bathroom master built home boasts a great outdoor living area to relax and entertain your guests, impressive living and dining areas, large separate study with plenty of storage and a huge double lock-up garage. s'LORIOUSLONGANDWIDEWATERVIEWSFROMEVERYASPECTOFTHEHOME s#ENTERPIECEDESIGNERKITCHENWITHQUALITYSTAINLESSSTEELAPPLIANCES s)TALIANTILESTHROUGHOUTWITHBATHROOMSTILEDmOORTOCEILING s1UALITYWOOLCARPETS SPACIOUSBEDROOMSWITHPATIOOFFMASTERBEDROOM s#HELMSTONEPAVINGANDTIMBERDECKINGTOWATERSEDGE HEATEDSALTWATERPOOL sM§LANDSCAPEDALLOTMENT PROVIDINGPLENTYOFSPACEFORBOATCARAVAN Sellers have purchased interstate and MUST MOVE ON!

Auction Saturday 5/9/09 @ 1.00pm

p: 07 5412 1600

e: info@propertytoday.net.au

Trevor & Glenys Martin 0400 818 777

â&#x20AC;&#x2DC;Holbrook Houseâ&#x20AC;&#x2122; 48-50 Sugar Road, Maroochydore My Property Review | September 4, 2009 47

Page 47.indd 1

1/09/2009 9:09:11 AM


we love it! we live in it! we specialise in it! 4

BUDERIM 7 Dawson Parade

brown realty putting the â&#x20AC;&#x2DC;realâ&#x20AC;&#x2122; back in real estate 2

1

4

BUDERIM 13-15 Settlers Ridge

3

2

COTTAGE STYLE LIVING WITH SEA VIEWS

FINALLY AFFORDABLE ACREAGE CLOSE TO BUDERIM!

4HISDELIGHTFULHOMEISNESTLEDINONEOF"UDERIMSUPMARKETESCARPMENTCULDESACSANDFEATURES s%XCELLENTSEAANDCOASTALVIEWSsBEDROOMSWITHNEWCARPET MAINWITHWALKINROBE sSEPARATELIVINGAREAS INCLUDINGASELFCONTAINEDGRANNYmATs0OLISHEDTIMBERmOORS s3TAINED&RENCHDOORSTHROUGHOUTs7RAPAROUNDCOVEREDVERANDAHSs#OVEREDOUTDOORENTERTAINMENTAREA s&ABULOUSLOCATIONJUSTMINUTESTOSHOPSs3URROUNDEDBYQUALITYHOMES

#LOSETO"UDERIMVILLAGEANDAVERYPRIVATE ALMOST ACREBLOCKMAKESTHISWELLMAINTAINEDHOMEQUITESPECIAL1UALITY NEIGHBOURHOOD4HOUGHTFULLYSITEDTOTHENORTHEASTTOCAPTUREALLBREEZES 5PSTAIRSFEATURESPOLISHEDTIMBERmOORS BED BATH OPENPLANLIVINGANDGENEROUSCOVEREDDECKSONTHENORTHAND EASTERNSIDES3ELFCONTAINEDPOSSIBILITIESEXISTDOWNSTAIRSWITHATHBEDROOM BATHROOM HUGESTORAGEAREAANDX SQMRUMPUSROOM,OWMAINTENANCEGARDENS

Self Contained Area $569,000 Open Sat 11-11.45am

Close to Town but away from it all! $679,000 Open Sat 2-2.45pm

2ICHARD4UCKER 

-ARGARET$EIGHTON 0411 399 514 0AM0ATEN

Land

BUDERIM 13 Mons School Road

Helen La Grange

!NOTHER

SUCCESSIN"UDERIM

31 Elliot Drive, Buderim

SOLD IN 3 DAYS

RARE GEMâ&#x20AC;¦ BUILD YOUR DREAM HOME "UILDYOURDREAMHOMEONTHISGORGEOUSSQMPARCELOFLAND s-AGICALPARCELOFLANDINPRICELESSPOSITIONANDENDLESSPOSSIBILITIES s3UPERB.ORTHERLYASPECTWITHVIEWSTOTHE"LACKALL2ANGESANDRAINFORESTBACKDROP s!NOPPORTUNITYTOSECUREYOURDREAMHOMEINABLUECHIPADDRESSATAVERYA»ORDABLEPRICE s0RIVATEAND4RANQUILANDTUCKEDAWAYFROMALLTHEHUSTLEANDBUSTLE LARGEBAYSHED WORKFROMHOME s9ETSOCLOSETO"UDERIM6ILLAGEANDLOCALAMENITIES

&ANTASTIC3UCCESS 3ELLER$ELIGHTED #ALLFORAN!PPRAISALONYOUR(OME (ELEN,A'RANGE BUDERIM 7 Shandon Court

$629,000 3

2

2

(ELEN,A'RANGE 0412 291 442

Call Helen for an inspection 4

BUDERIM 16 Peter Court

2

2

Pool

VIEWS FOREVER!

PRESENTATION, LOCATION AND LIFESTYLE

4HISUNIQUEHOMEINAQUIET ELEVATEDPOSITIONWITHSTUNNINGCOASTALVIEWSFROM!LEX -OOLOOLABATOTHESANDSOF-ORETON )SLAND ISSETONNEARLYHALFANACREOFPRIVACY 0OSITIONEDATTHEENDOFASMALLCULDESAC THISDELIGHTFULHOMEFEATURESBEAUTIFULBRUSHBOXTIMBERmOORSTHROUGHOUT HIGH CEILINGSANDEXCELLENTDIMENSIONSANDHASBEENDESIGNEDTOMAXIMISETHEVIEW&ORMALLOUNGE KITCHEN DININGROOMAND HUGEMASTERBEDROOMTAKEINTHEVIEWANDALLACCESSTHECOVEREDDECK

%XCELLENTOPPORTUNITYTOPURCHASETHISIMMACULATEBEDHOMEINAQUIETCULDESACMINUTESTOBEACHES -AROOCHYDORE ANDTO)MMANUEL,UTHERAN#OLLEGE s3PACIOUSOPENPLANFORMALANDCASUALAREAOVERLOOKINGAPRIVATEINGROUNDPOOLANDSPA s)DEALNORTHEASTERNOUTDOORLIVINGAREASWATERTANKS s-ODERNPRACTICALKITCHENPLUSTEMPERATURECONTROLLEDPANTRY s%NSUITEDMASTERBEDROOMWITHEXCELLENTSEPARATIONFROMOTHERROOMS

Miles of Storage, Workshop and Room for a Boat or Caravan

$925,000

Open Sat 12-12.45pm

BUDERIM 10 Hayman Court

Mike Paten 0412 070 833 0AM0ATEN 3

2

$559,000 2

-ARGARET$EIGHTON 0411 399 514

Open Sat 11-11.45am

BUDERIM 216 Mons Road

BUDERIM 87 Buderim Pines Drive

EASY STYLE FOR EASY LIVING

BUDGET ACREAGE SECLUSION BUY ME, Iâ&#x20AC;&#x2122;M GREAT VALUE

3ITUATEDINAQUIETCULDESACINANELEVATEDPOSITIONIN(EADLAND0ARK THISWELLAPPOINTEDDELIGHTFULPROPERTYISIDEALFOR THEPROFESSIONALCOUPLE RETIREEORSMALLFAMILY $ESIGNEDFORPRIVACYANDTOENJOYTHEINDOOROUTDOOR1UEENSLANDLIFESTYLEs3PACIOUSBEDROOMS LARGEAIRCONDITIONED MASTERWITHENSUITEs,IGHTANDAIRYAIRCONDITIONEDLIVINGAREASs0RIVATEINGROUNDPOOLANDLOWMAINTENANCEGARDENS s7ELLDESIGNEDKITCHENs$,5'ANDGARDENSHED

sACRESOFLOWMAINTENANCEPRIVACY s4ILEDOPENPLANLIVING BEDROOMS BATHROOM s3INGLECARPORTANDNORTHFACINGPATIO s%XTRASINGLEGARAGESIZEDSHEDANDSTUDIO s#OMFORTABLEASISORSUITABLEFORFURTHERIMPROVEMENT

s-INUTESTOSHOPSANDBEACH s&OURBEDROOMS OPENPLANLIVING sBATHROOMS s,OTSOFLIGHTANDBREEZES s3ENSATIONALPOOLANDPRIVATEYARD s,ETSNEGOTIATE

$489,000

$525,000

Just Minutes to Maroochydore CBD, Schools and Beaches $499,000 Open Sat 3-3.45pm -ARGARET$EIGHTON

Ph : 5445 6144 56 Burnett Street, Buderim QLD 4556

Open Sat 11-11.45am

0AM0ATEN -IKE0ATEN

Open Sat 12-12.45pm

Mike Paten 0412 070 833

www.brownrealty.com.au propertysales@brownrealty.com.au

48 My Property Review | September 4, 2009

Page 48.indd 1

1/09/2009 1:59:08 PM


pam court realty

BUDERIM

4

3

2

24 Janderra Street

MOUNTAIN CREEK

4

2

2

1 Kona Court

Dual Living Opportunity....

$553,000

• Ideal for families looking for separation

Pam

Bob

Debbie

Rod

Stuart

Ben

0412 708 313

0412 714 326

0411 832 325

0416 724 244

0430 911 848

0403 668 843

SIPPY DOWNS

4

2

SIPPY DOWNS

2

249 University Way

Very Committed Seller!!!

$520,000neg

3

As Good As New

$489,000

"Sensational Value For Money" $435,000 • Study or 4th bedroom, 567m² block

Open Saturday • Large inground pool and undercover patio 1-1.45pm

• Perfectly presented with ducted air-conditioning Open • Relax all the hard work has been done Saturday 1-1.45pm • Why bother building it's all here

BUDERIM

SIPPY DOWNS

BUDERIM

MOUNTAIN CREEK

4

2

2

7 Connors Close

4

2

2

34 Statesman Circuit

Space and Style.....

$579,000

• Backing onto park and in a quiet cul-de-sac

4

2

$440,000

A Home That Has It All!

Open • Two large separate living areas Saturday • Undercover patio with built-in barbecue 11-11.45am

SIPPY DOWNS

SIPPY DOWNS

BUDERIM

2

48 Riveroak Way

Be The First To See This One!!

3

2

2

40 Windermere Way $449,000

3

$649,000

• Side access, 6x3 shed and 3 car lock up

2

• Walking tracks, shops etc all close by

4

2

2

1 Mountain Ash Drive

• Great open plan living area, large 608m² block Open • Room for a pool or shed, don't hesitate Saturday 12-12.45pm • Room for the growing family

4

Open Saturday 2-2.45pm

• Pool and room for the kids to play

27 Kristen Close

Must Be Sold Today!!

2

12 Bernheid Crescent

• Owner has to go..inspect and make your offer TODAY Open • 839m² block with side access with pool Saturday 1-1.45pm • Perfect family home in a perfect area

• Set on a private 1004m² block

2

• Huge family home with huge potential

Open • Open plan living, fully air-conditioned Saturday • Designer pool, large patio, quiet location 2-2.45pm

4

2

Owner Says SELL!! Offers over $450,000 Open Saturday 2-2.45pm

• First home buyers must inspect • Ex "prize home" in need of a bit of luv!

MOUNTAIN CREEK

2

44 Bribie Pine Court

2

1

1

3/39 Cootamundra Drive

Why Rent? New To The Market...$400,000

Buderim Bargain!

$439,000

Price Drop!!!! Must Sell!!!! Now $279,000

• Modern 2 year old family home in a new estate Open • Large 579m² room for pool/entertainment Saturday 12-12.45pm • Great street, could not ask for better!

• Perfect for the 1st home buyer or retiree

• 706m² block with side access in quiet cul-de-sac Open • Vacant and ready to move into.. enjoy! Saturday • Walk to public transport and local shops 12-12.45pm

• Large open style living and dining combination Open • Double size master bedroom with built-in Saturday 11-11.45am • Air-con, separate toilet and LUG

SIPPY DOWNS

SIPPY DOWNS

PALMVIEW

BUDERIM

16 Chestwood Crescent Very Affordable Land..

• Could be the cheapest block around

• 2 separate living areas, patio area

3

2

1

9 Sorbonne Close $220,000

• Large 501m² vacant block, ready to build • Build your dream home here

Open Saturday 11-11.45am

• 9 foot ceilings, 455m² block

What A View!

Reduced to $379,950

• Quiet location, close to shops, schools etc Open • Good size gardens with great aspect Saturday • Suit retiree, 1st home buyer or investor 11-11.45am

Mountain Creek: 5477 7600

3

1

2

65 Nina Drive

Room To Move

$529,000 neg

• 3552m² block, man's sized 6x9m shed • Fully renovated, ducted air-conditioning • Private & peaceful location, tank & bore

www.pamcourtrealty.com.au

4

2

2

5 Attenborough Close

Open Saturday 1-1.45pm

Buyers Wanted – No Experience!! Now $529,000 • Great family home on 732m² block in a great area Open • Quiet cul-de-sac location by • Huge inground pool with sail & waterfall appointment

Sippy Downs: 5456 1599 My Property Review | September 4, 2009 49

Page 49.indd 1

1/09/2009 11:41:18 AM


property reviews

0VS,OPXMFEHFJTZPVS1SPQFSUZ

0OF4USFFUGSPNUIF#FBDI '034"-&

,BSVNCB4USFFU 8BSBOB r4PMJECSJDLIPNFXJUIFBTUFSMZBTQFDUUPPDFBO r*NNBDVMBUFQSFTFOUBUJPOXJUIIVHFMJWJOH BOEEJOJOH r5ISFFCFESPPNT UXPBJSDPOEJUJPOFE BOEFOTVJUF r%PVCMFHBSBHFXJUIBEEJUJPOBMTUPSBHF QMVT VOEFSDPWFSQBSLJOHGPSCPBUPSDBSBWBO r$MPTFUPTIPQT USBOTQPSU QBSLTBOETDIPPMT r4FFJOHJTCFMJFWJOH 'PS4BMF  7JTJUXXXDPMMJFSTDPNTVOTIJOFDPBTU XXXSFBMFTUBUFDPNBV

Immaculate Buderim abode

3PE4BVOEFST  $OS4NJUIBOE8BMBO4USFFU .PPMPPMBCB2-%]]XXXDPMMJFSTDPNTVOTIJOFDPBTU

Address: Features: Price: Agent: Contact:

56 Oakmont Drive, Buderim 4 bed, 2.5 bath, 2 car, 1 of๏ฌce Auction in-room at Uni of Sunshine Coast, September 18 @ 11am Amber Werchon Property 5443 7733 Paul Love 0410 855 616

Looking for a low-maintenance, immaculate property in a great location? Downstairs, this large home has a study with external access, open-plan living and dining area, a kitchen and master bedroom with ensuite, courtyard and entertaining area with spa. Upstairs are three additional bedrooms, bathroom, air-conditioning with ceiling fans and quality kitchen.

elderspalmwoods.com.au This versatile home has three separate living areas plus an open-plan living/dining area and computer nook. There is a spacious, functional kitchen and four bedrooms, the master with ensuite and double glass robes. The family cars are easily accommodated in the large auto garage with extra enclosed storage, and the landscaped gardens are easily managed. There is a pool and enclosed entertaining area.

Auction

5

Palmwoods

2 2

156 McKees Road Inspect Sat & Sun 12.00pm to 12.45pm | Auction On Site Sunday 20 September @ 1.00pm 5 Bedroom home on 5 rural acres ยœ-Z]\$*ZYl`$*klgj]qIm]]fkdYf\]jklqd]`ge] ยœ;]fljYdj]fgnYl]\cal[`]f ยœAf_jgmf\hggdoal`kda\]#dgn]dq\][cYj]Y

ยœ>dYlqYj\^gjl`]ca\k#ogg\ร‡j]\harrYgn]f ยœMf\mdYlaf_dYf\$^]f[]\oal`*\Yek ยœN=F<GJK@9N=HMJ;@9K=<=DK=O@=J=

Mike Burns 0418 991 702 Elders Palmwoods Web Id 387580

Pelican Waters stunner Address: Features: Price: Agent: Contact:

30 Fire๏ฌ‚y Street, Pelican Waters 4 bed, 2 bath, 2 car Auction on site Friday September 11 @ 1pm Henzells Agency 5437 5903 Michael Lindsay 0421 017 046

Auction

www.harcourts.com.au CALOUNDRA

Auction

3

Woombye

1 2

/(;gZZkJgY\ Inspect Sat & Sun 1.00pm to 1.45pm | Auction On Site Sunday 20 September @ 2.00pm Revitalise and capitalise ยœ+Z]\$)ZYl`$lYf\]e[Yjhgjl ยœ9aj[gf$f]Yjf]o[Yjh]l$ZjYf\f]ocal[`]f ยœOgjck`ghYj]Yoal`ghlagflg]f[dgk]\gofklYajk

ยœHgkkaZadalqlghmj[`Yk]Y\bgafaf_hjgh]jla]k ยœL]fYfl]\Yl+((hogj^YflYkla[j]fgnYlgj ยœ9;LFGOGJEAKKGML

Brad Milton 0421 965 226 Elders Palmwoods Web Id 388057

Auction

Auction

2

Woombye

1 1

.(9E[C]fra]JgY\ Inspect Sat & Sun 2.00pm to 2.45pm | Auction On Site Sunday 20 September @ 3.00pm Almost an acre with views to the ranges ยœ*Z]\$)ZYl`$Zdg[c`ge]gf+//.e ยœ>mddqj]fgnYl]\*%hYccal[`]f ยœDYj_]dYmf\jq$kaf_d][Yjhgjl

ยœRgf]\F]a_`Zgmj`gg\J]kยบkmZ\anakagfhgl]flaYd ยœ>jmallj]]k$n]_a]_Yj\]f$]p[]dd]fldYf\ ยœL@AKAK9EMKLK==ยบGHLAGFK?9DGJ=

Mike Burns 0418 991 702 Elders Palmwoods Web Id 383143

Elders Palmwoods, 5 Margaret Street, 5478 9122

Auction

THE BEST WATERFRONT BUY AROUND! PELICAN WATERS 70 Mahogany Drive s.ONEIGHBOURSACROSSTHEWATER COMPLETEPRIVACYs/PENPLANLAYOUT SEPARATE ENSUITEDGUESTQUARTERSs3OLARHEATEDINlNITYEDGEPOOL TIMBERDECKS TRIPLECAR PRICE: s'OURMETKITCHENWITH-EILEAPPLIANCESGASCOOKTOPs$UCTEDZONALAIR OPEN HOME: CONDITIONING3OMANYMOREFEATURESxs!BSOLUTElVESTARQUALITYTHROUGHOUT VIEW AT: INTERNET ID: /WNERSWANTARESULT MAKEYOURINSPECTIONTHISWEEKEND Stuart Cordingley M: 0419 769 894 E: stuart.cordingley@harcourts.com.au Harcourts P: 5438 0055

5

3

$1,050,000 Sat & Sun 2 - 2.45pm www.harcourts.com.au QCL090608

3

Study

50 My Property Review | September 4, 2009

Page 50.indd 1

1/09/2009 2:18:19 PM


Proudly Marketed by Trish Kelly & Beverley Kelley Harcourts Buderim

LIVING IN THE GREAT OUTDOORS!! KAWANA ISLAND 3 Sable Court s3TUNNINGCONTEMPORARYHOMEONTWOLEVELS PLUNGEPOOL PRIVATEGARDENS COURTYARDSs'ALLEYKITCHENWITHCOFFEEMAKER MICROWAVE STEAMOVEN DISH WASHERs'ENEROUSMASTERBEDROOM PRIVATEBALCONY LUXURIOUSENSUITE DOUBLE VANITIES mOORCEILINGTILESs/PENPLANLIVING CRIMSAFESECURITY AIRCOND TIMBER SHUTTERSs/PPOSITEPARKANDWALKBRIDGE ACCESSFORBOAT QUIETCUL DE SAC Trish Kelly & Beverley Kelley M: 0400 344 314 / 0412 205 040 E: trish.kelly@harcourts.com.au

4

PRICE: $700,000+ Buyers OPEN HOME: View By Appointment between 3-3.30pm VIEW AT: www.harcourts.com.au INTERNET ID: QBD090217

2

2+

2

KISS YOUR SEARCH FOR A HOME GOODBYE!!

FABULOUS VILLA- ROOM FOR MOTORHOME, BOAT, CARAVAN

KAWANA ISLAND 7 Melos Place

KAWANA ISLAND Villa 89, Island Point Villas, 239 Kawana Way

s#ONTEMPORARYTWOSTOREYHOME PLUNGEPOOL PRIVATECOURTYARDS s3EPARATEMASTERWING PARENTSRETREAT PRIVATEBALCONY DOUBLEVANITYENSUITE s/PENPLANLIVINGAREAS NEUTRALTILESCARPETS HIGHCEILINGS CENTRALVAC AIR CON s*USTAFEWSTEPSTOCANALS PATHWAYS $OUBLE"AYBEACH RESTAURANTS CAFE s1UIETCUL DE SACPOSITION CLOSETOPARKANDPUBLICTRANSPORT

s-ODERNLOWSETOPENPLANFREESTANDINGVILLAINPRIVATEPOSITIONINCOMPLEX s4ILEDOPENPLANLIVINGAREASWITHNEUTRALTONES SECURITYDOORSAIRCON s4RENDYKITCHENWITHBREAKFASTBARLOOKINGOUTTOLOWMAINTENANCECOURTYARD s'ENEROUSBEDROOMSONEWITHENSUITEANDASECONDFULLBATHROOM s0ETFRIENDLYCOMPLEX ,OW"ODY#ORP,EVIES MANYAMENITIESWITHHEATEDPOOL

Trish Kelly & Beverley Kelley M: 0400 344 314 / 0412 205 040 E: trish.kelly@harcourts.com.au

4

PRICE: OPEN HOME: VIEW AT: INTERNET ID:

2.5

Offers Over $590,000 Saturday 11-11.45am www.harcourts.com.au QBD090810

2

Trish Kelly M: 0400 344 314 / 0412 205 040 E: trish.kelly@harcourts.com.au

2

3

PRICE: OPEN HOME: VIEW AT: INTERNET ID:

2

$450,000 Saturday 2-2.45pm www.harcourts.com.au QBD090809

2+

1

TOWNHOUSE - SURE TO GET YOUR VOTE GONE SAILING!! â&#x20AC;&#x201C; OWNERS SAY SELL HURRY, HURRY! OWNERS RELOCATING URGENT SALE! - DOWNSIZING TO VILLA KAWANA ISLAND Villa 20, Island Point Villas, 239 Kawana Way KAWANA ISLAND Villa 137, Island Villas, 2 Grand Pde

KAWANA ISLAND Villa 88, Island Point Villas, 239 Kawana Way KAWANA ISLAND 5 Bonaire Court

s5NIQUETWOLEVELTOWNHOUSEWITHGENEROUSBEDROOMSUPSTAIRS s%NSUITE WALK INROBEANDPRIVATEBALCONYPLUSSECONDFULLBATHROOM s/PENPLANLIVINGZONES AIR CON SECURITYDOORS THIRDTOILETDOWNSTAIRS s0RIVATENEFACINGCOURTYARDBACKINGONTONATURERESERVERIVER s3INGLELOCK UPGARAGEWITHSECONDPERMANENTPARKINGSPACE

s&ANTASTICFREEHOLDVILLAINQUIETPOSITIONINCOMPLEX s.ORTH%ASTFACINGPRIVATEFRONTCOURTYARD s4RENDYKITCHENWITHGLASSSPLASHBACK DISHWASHER s/PENPLANKITCHENDININGLOUNGEWITHAIR CONSECURITY s,OW"ODY#ORP 0ETFRIENDLY HEATEDPOOLMANYAMENITIES

s)MMACULATELOWSET6ILLAnQUIETPOSITIONINCOMPLEX s0RIVATENORTHEASTFACINGCOURTYARDWITHLANDSCAPEDGARDENS s/PENPLANLIVINGAREAS GENEROUSBEDROOMS ENSUITESECONDBATHROOM s!IR CON SECURITYSCREENSDOORS INSULATIONANDNEUTRALTONESTHROUGHOUT s0ETFRIENDLYCOMPLEX ,OW"ODY#ORPORATE,EVIES AMENITIESWITHHEATEDPOOL

s3UPERBSQUAREFAMILYHOMEPLUSHUGECOVEREDENTERTAINMENTAREA s'ALLEYKITCHENnTWOPAKWITH"LANCOAPPLIANCESBREAKFASTBAR sFTCEILINGS DUCTEDAIRCON CENTRALVAC INSULATEDROOF SPAENSUITE s3IDEACCESSFORCARAVANBOAT CLOSETOSHOPS TRANSPORT CANALWALKWAYS s,ARGEFULLYFENCEDALLOTMENTWITHROOMFORPOOLORKIDSTOPLAY

PRICE: $450,000+ Buyers OPEN HOME: Sat 12-12.45pm

PRICE: $350,000+ Buyers OPEN HOME: Sat 1-1.45pm

PRICE: $420,000+ Buyers OPEN HOME: Sat 1-1.45pm

PRICE: All serious offers considered VIEW AT: www.harcourts.com.au Priced at $569,000 OPEN HOME: Sat 12-12.45pm INTERNET ID: QBD090601

3

VIEW AT: www.harcourts.com.au INTERNET ID: QBD090802

2.5

2

1

3

Trish Kelly M: 0400 344 314 E: trish.kelly@harcourts.com.au

VIEW AT: www.harcourts.com.au INTERNET ID: QBD090604

1.5

1

1

Trish Kelly M: 0400 344 314 E: trish.kelly@harcourts.com.au

VIEW AT: www.harcourts.com.au INTERNET ID: QBD090803

3

2

1

1

Trish Kelly M: 0400 344 314 E: trish.kelly@harcourts.com.au

5

2.5

2

2

Trish Kelly & Beverley Kelley M: 0400 344 314 / 0412 205 040 E: trish.kelly@harcourts.com.au

Having the right agents market your property can make a difference of many thousands of $$$â&#x20AC;&#x2122;s

THINKING ABOUT SELLING? PROPERTIES REQUIRED URGENTLY

Call to achieve a

WATER VIEWS WITHOUT THE WATERFRONT PRICE!!! KAWANA ISLAND 12 Maldives Place s&ABULOUSENTERTAINERSHOMEONTWOLEVELS MASTERBEDROOMPARENTSRETREAT SPAENSUITEs#HEFSKITCHENWITHGRANITEBENCHTOPSBREAKFASTBAR GASHOB LARGE PRICE: OVEN HUGEPANTRYs/PENPLANFAMILYDININGOVERLOOKINGSPARKLINGPOOLOUTDOOROPEN HOME: AREASs1UIETCUL DE SAC BACKSONTOPARK VIEWSOFCANAL CLOSETOWALKWAYS VIEW AT: INTERNET ID: $OUBLE"AYRESTAURANTSs3IDEACCESSFORCARAVANBOATORMOTORHOME Trish Kelly & Beverley Kelley M: 0400 344 314 / 0412 205 040 E: trish.kelly@harcourts.com.au

4

2

$800,000+ Buyers Saturday 11-11.45am www.harcourts.com.au QBD090221

2

2

SOLD

Trish Kelly 0400 344 314

sign on your property TODAY!!!

Beverley Kelley 0412 205 040

Call The Kellie Girls Today!

www.harcourts.com.au My Property Review | September 4, 2009 51

Page 51.indd 1

2/09/2009 8:42:03 AM


property reviews Affordable Minyama unit

Address: Features: Price: Agent: Contact:

This unit boasts a great orientation, functional layout, immaculate presentation, a third bedroom/study, spacious all-weather outdoor entertaining area with two garden sheds and side access. There are Crimsafe screens, reverse cycle airconditioning and a sun room/ separate lounge.

265/25 St Vincents Court, Minyama 3 bed, 1 bath, 2 car Low to mid $300,000s Raine & Horne Kawana Waters 5477 7500 Conon Begley 0413 257 247

Little Mountain beauty

Address: Features: Price: Agent: Contact:

7 Jason Place, Little Mountain 3 bed, 2 bath, 2 car $465,000 Platinum Properties Sunshine Coast 5437 8806 Lisa Storey 0418 247 020

This almost-new home is nestled amongst bushland and is immaculately presented with three large bedrooms, all with ceiling fans. The master has a walk-in robe and ensuite. There is an open-plan living/dining area, glass-finished floor tiles and user-friendly kitchen.

â&#x20AC;¢ Buderim â&#x20AC;¢ Caloundra â&#x20AC;¢ Maroochydore â&#x20AC;¢ North Shore

INVESTORS TAKE NOTE â&#x20AC;&#x201C; LOW MAINTENANCE BLOCK â&#x20AC;&#x201C; LEASED TILL MARCH 2010

NOTHING TO DO BUT ENJOY!

60 WINDERMERE WAY, BUDERIM

9 IVY COURT BUDERIM

%ASYLIVINGONAPRIVATEBLOCKWITHINCLOSEPROXIMITYTOTRANSPORT SCHOOLSANDUNIVERSITYs,ARGEOPENPLAN DINING AND LOUNGE WITH HIGH VAULTED CEILING s &LOATING TIMBER mOORBOARDS s 3EPARATE 2UMPUS ROOM s  BEDROOMS BATHROOMS LARGESTUDYTHBEDROOMs$OUBLELOCKUPGARAGEPLUSOFFSTREETPARKINGFORCARS s0ATIOsSQMBLOCKWITHGOODTENANTSINPLACE NOTHINGMORETODO#ALLNOWFORANINSPECTION

0ROMINENTLY POSITIONED ON AN ELEVATED BLOCK THIS MODERN HOME ENSURES STYLE PRIVACY AND LOCATION s  BEDROOMS THE MAIN HAVING A WALK IN ROBE AND ENSUITE s #ENTRALLY LOCATED KITCHENDINING SEPARATES THE BEDROOMSFROMTHELIVINGAREAs3UNKENLOUNGEOVERLOOKINGTHEPOOLANDOUTDOORPATIOWHICHISPERFECTFOR ENTERTAINING/NLYMINUTESTO3UNSHINE0LAZA "EACHESAND)MMANUEL#OLLEGE

OPEN SATURDAY 12.00-12.45 PM AND SUNDAY 11:00-11:45AM

OPEN SATURDAY 11:00-11:45AM

$469,000 Steve Mellor 0408 673 354 / 5456 0309

$579,000 Liz Millroy 0417 079 125 / 5445 2777

Internet Ref. No. 105949475

â&#x20AC;&#x201C; Y E!!! A C D I TO N PR R E IO FF T O A U N E A W VAL K MA BELO LL E S LL

WI

Internet Ref. No. 105864384

HOWEVER YOU LOOK AT IT â&#x20AC;&#x201C; THERE IS MONEY TO BE MADE HERE 3 CAROLINE CRESCENT, BUDERIM  SPACIOUS BEDROOMS ALL SPREAD OUT TO GIVE MAXIMUM PRIVACY s  VERY SEPARATE LIVING AREAS s -ASSIVE ENTERTAININGDECKWITHBEAUTIFULOCEANVIEWSANDWETBARs!BLETOBESETUPINADUALLIVINGARRANGEMENT s)NGROUNDPOOLWITHTROPICALLANDSCAPINGs$OUBLELOCK UPGARAGEPLUSSEPARATELOCK UPGARAGESUITABLE FORATRAILER EXTRASTORAGEORASMALLBOATsSQMBLOCKWITHSPACIOUSmATYARDAREA

SATURDAY & SUNDAY 2:00-2:45PM

All Offers Considered â&#x20AC;&#x201C; Will Sell Below Valuation Report Price Jarrad McCarthy 0410 052 219 Internet Ref. No. 105734911

View 24 hours / 7 days a week on

www.realway.com.au

52 My Property Review | September 4, 2009

Page 52.indd 1

1/09/2009 2:15:41 PM


No Up Front Fees No Hidden Costs

Offers over $500,000

Buderim, 'LENALPIN#OURT

Offers over $695,000

Sa Ope t1 nH 2. om 45 -1 e .1 5

Sa Op t/S en un Ho 11 me .30 -1 2

Buderim, 209 Mooloolaba Road

SENSATIONAL OCEAN VIEWS â&#x20AC;&#x201C; BUILT BY CRAFTSMEN s&EATURINGGENEROUSBDMS ALLWITHBINROBESANDSTORAGE s3TEPINSIDEBEYONDTHESIMPLEFACADEINTOTHISBRIGHTAND CHARACTERlLLEDHOME s2ENOVATEDBATHROOM WITHSEPTOILET AGOODSIZEDKITCHEN WITHNEWAPPLIANCESANDWALK INPANTRY HUGEREARDECK s"EAUTIFULHARDWOODmOORS WALLSANDHIGHCEILINGS s-ASSIVEGLASSTIMBERFRAMEDWINDOWSSLIDEBACKTOLETTHE s0LENTYOFSCOPETOEXTENDADDVALUE THISPROPERTYISA @-UST)NSPECT OUTDOORSINFRAMEWONDERFULBUSHLANDANDOCEANVIEWS

3

1

2

Elizabeth 0410 277 262

Offers over $499,000

Sa Ope t1 n 0. Ho 45 m -1 e 1. 15

Aroona, 2ATHDOWNEY!VENUE

SOMETHING SPECIAL

ABSOLUTELY BEAUTIFUL â&#x20AC;&#x201C; SO MUCH MORE THAN MEETS THE EYE!

s4HECENTRALKITCHENOFFERSCLEARVIEWOFTHELARGEFAMILY s4ASTEFUL SUPERIORDESIGNANDBEAUTIFULLYPRESENTED RUMPUSROOM BEAUTIFULPOOLANDOUTDOORENTERTAININGAREA sBRIGHTLIVINGAREASFULLOFNATURALLIGHT s,ARGEMASTERBEDROOMBOASTINGA7)2EXCELLENTENSUITE s%ASYTOMAINTAINGARDENS $,5' AIR CONDITIONING CEILING FANSANDFULLYFENCED WITHDOUBLESHOWER/THERBDRMSARELARGEWITH")2SFANS s#LOSETO3CHOOLS SHOPSANDBEACHES INSPECTNOW s4HESPECIALDESIGNCREATESAmOWFROMFRONTTOBACK

s$5!,,)6).'OPPNITYSTOREYBEDROOMFULLYACOND s$3TAIRSSEPLIVINGQUARTERWITHKITCHENETTE SEPBATHROOM HOMEBEAUTIFULLYRENOVATEDINSIDETOSUITEALLTASTES HUGEMASTERWITHGORGEOUSENSUITE")2SPLUSANOTHERBDRM s5PSTAIRSBTHRM BDRMSWITHFANSAND")23 ONEIS WITH")2S!LSOHOUSESSEPBUNGALOWARTISTSSTUDIOOUTSIDE MASTERSIZEWITHENSUITE 7)2ANDACCESSTOOUTSIDE s)'POOL LANDSCAPEDGARDENS BAYPWDSHED PLENTYOF s3PACIOUSSEPLOUNGE FORMALDININGANDKITCHENMEALSAREA /3PARKINGANDWRAP AROUNDVERANDAH

3

2

2

Maree 0409 423 063

5

4

4

Elizabeth 0410 277 262

$559,000

Buderim, (ARDWOOD#OURT

$585,000

O Sa pen t1 H .3 om 0- e 2p m

Sa Ope t/S n un H 12 om -12 e .30 pm

Buderim, 'UMNUT#OURT

VALUE PACKED IN QUIET COURT

BUDERIM FAMILY HAVEN OFFERING PRIVACY

$ONTMISSTHEOPPORTUNITYTOBUYTHISIMPECCABLYPRESENTED HOME*USTMINUTESAWAYFROMALL-AROOCHYDOREFACILITIES INCLUDING3UNSHINE0LAZA3HOPPINGAND)MMANUEL,UTHERAN #OLLEGE#OMPRISING BEDROOMSALLWITH")2S MAINHAS ENSUITE+ITCHENMEALSANDSPACIOUSFAMILYROOM

)NADDITIONTHEREISALARGESEPFORMALLOUNGEROOMWITHGLASS s3TOREYHOMEOOZINGCHARACTERANDCOMFORT.EIGHBOURSTO ONESIDEONLYANDTASTEFULLYRENOVATEDTHROUGHOUT WINDOWSPOSITIONEDTOTAKEFULLADVANTAGEOFTHEMORNING SUN/UTSIDEISANEASYTOLOOKAFTERGARDEN UNDERCOVERPATIO s&EATURESSPACIOUSOPENLOUNGE COMBINEDDININGAND STYLISHKITCHEN AIR CONANDBATHROOMS RAINWATERTANK VEGGIEPATCH $,5'ANDROOMTOPARKYOUR sGOODSIZEBEDROOMSWITH")2SWITHFANS WITHAC BOAT1UALITYPROPERTY

4

2

s,OVELYMASTERINCLUDES7)2 ENSUITEANDAIR COND s"I FOLDDOORSOPENOUTTOBEAUTIFULLEVELSOFDECKING OFFERING PLENTYOFROOMFORENTERTAININGWITHCOVEREDOUTDOORSPAAREA s&ANTASTICBUILT INKIDSPLAYGROUNDANDSANDPIT $,5' s1UIETLOCATION NEAR"UDERIMSHOPS SCHOOLSANDPARKS

2

Maree 0409 423 063

4

3

2

Elizabeth 0410 277 262

$799,000 Currimundi, 4RAILL#RES

Reduced to $549,500

Sa Ope t1 n 0- Ho 10 m .3 e 0a m

$870,000 Neg Rosemount, 0ETRIE#REEK2OAD O Sa pe t1 nH -1 om .3 e 0p m

$1,095,000 Woombye, !TKINSONS2OAD Sa Op t 1 en 0. Ho 15 m -1 e 0. 45

Bokarina, $RIFTWOOD#OURT

THE BEACH

LARGE PRIVATE ACREAGE PLUS INCOME

BACKS ONTO PETRIE CREEK

IT TICKS ALL THE BOXES

4HESANDISLITERALLYONYOURDOORSTEPHERE4HISSTEELFRAMED HOMEISSITUATEDINAPOPULARQUIETCUL DE SACSURROUNDEDBY QUALITYPROPERTIES#OMPRISINGBDRMS OFlCE FORMALLOUNGE KITCHENMEALSFAMILYRM $,5'ANDINGROUNDPOOL4HEREISNO BETTERPOSITIONONTHE3UNSHINE#OAST

"EAUTIFULPROPERTYFEATURINGSPACIOUSBEDRMSWITH")2S s3ETONACRES ()!AWARD WINNINGKITCHEN s"EDROOMSPLUSOFlCEBEDROOM&LEXIBLELIVINGAREAS MAINWITHENSUITEANDLARGE7)2 STUDYANDBATHROOM,OVELY sBDRMHOME MAINWITHENSUITEAND7)2+ITCHEN MEALS sX4ITANSHEDINCLUDINGOUTSIDETOILETFORPARTY KITCHEN DINING SEPLOUNGE LARGEUNDERCOVERENTERTAINING LIVINGAREAWHICHOPENSTOALARGEDECKWITHVALLEYVIEWS s)NGROUNDSALTWATERPOOLADJACENTTOLARGEUNDERCOVERDECK AREA3PRINGFEDDAMWITHIRRIGATION POWEREDBAYSHED s,ARGEOFlCE $,5' LARGERUMPUSWITHBTHRMGRANNYmAT s,OADSOFGARAGINGANDCARPARKING 4HRIVINGmOWERGROWINGBUSINESSONACRES POTENTIAL KITCHENETTE SECURELYFENCEDANDSHED s(OMEISPRESENTEDINIMMACULATECONDITION

Inspect: By appointment

3

2

Maree 0409 423 063

www.gogecko.com.au

2

4 Elizabeth 0410 277 262

2

3

4 Maree 0409 423 063

2

4

4

2

6

Maree 0409 423 063

Office: Shop 5, 9 Bulcock Street, Caloundra. Ph 5499 7859 My Property Review | September 4, 2009 53

Page 53.indd 1

1/09/2009 12:03:03 PM


property reviews Spectacular Marcoola penthouse

Stunning and rare Buderim offering

This stunning penthouse occupies the entire top floor and roof deck with 360-degree views. It has four large bedrooms each with an ensuite, expansive living areas with tiled floors, kitchen with Gaggenau appliances and stone benches, media room, separate family room with kitchenette, powder room and separate laundry. There are three secure basement car parks, four large balconies, fully ducted and zoned reverse-cycle airconditioning and access to resort facilities, which include pools, restaurant and gym.

This rare offering is on Buderim’s tightly held northern escarpment. With high ceilings and natural light in every room, this home features a new gourmet kitchen, brushbox, natural travertine and commercial carpet flooring, and a generous two-person study with sea views. The home is on a useable 799-square metre home site, with a warmth and personality absent in many contemporary properties, and with ample scope for personalisation and/or extensive value adding at any time.

Address: Features: Price: Agent: Contact:

Address: Features: Price: Agent: Contact:

Penthouse, ‘Surfair Central’, 923 David Low Way, Marcoola 4 bed, 5 bath, 3 car $2.85 million Waterfront & Coastal 5444 6400 Dean Ind 0438 046 677

27 Illawong Street, Buderim 4 bed, 2 bath, 2 car, 1 office $1 million-plus Ken Guy Maroochydore 5443 2222 Rebecca Nolan 0404 866 358, Damien Michael 0413 024 124

LITTLE MOUNTAIN

LAND

MAROOCHYDORE 31/5 Parker Street VIEW SATURDAY, TUESDAY & THURSDAY 12-12.30PM ROOF TOP UNIT AT BASEMENT PRICE • Situated on top floor, this massive two bedroom unit boasts a sunny N/E facing balcony • Directly opposite the beach, and a flat 350 metre stroll to Alex Surf Club and patrolled beach • Fully furnished with two separate living areas, two bathrooms PLUS a private courtyard • Owners have committed elsewhere and this property WILL BE SOLD!! High $300,000 buyers must inspect Greg Mills 0407 750 603

SCHINDLER’S LIST AGENT ON SITE EVERY SATURDAY 1 - 2PM UNTIL ALL SOLD NATURAL BUSH SETTING - VARIOUS BLOCKS TO CHOOSE FROM Situated in a Small Estate. Centrally located to all the coast has to offer, walk to schools, minutes drive to beaches and Currimundi market place.

LOT 3 LOT 10 LOT 11 LOT 14 LOT 15

GREENSBORO PL 592m2 .................. $259,000 GREENSBORO PL 587m2 .................. $269,000 GREENSBORO PL 615m2 .................. $269,000 GREENSBORO PL 536m2 .................. $249,000 GREENSBORO PL 542m2..SOLD .... $259,000

Home design drafting to the value of $3,000 Melinda Fraser 0409 272 014 – Office 07 5437 6444 www.kawanacoastrealty.com.au 3/700 Nicklin Way Currimundi Qld 4551

Buddina - 29 Beltana Cres. Inspect to appreciate. Solid 3 bed, 1 bath, 2 car. Great position for a “paint & profit”. Opposite canal homes and short walk to river & beach. View Sat 12-12:30 Maroochydore Riverfrontage position. Magnificent river views from 2 bed, 2 bath, 2 car unit with rooftop & close to C.B.D. Best buy in low $500,000’s Maroochydore - $330,000. Immaculate 3 bed, ensuite townhouse, courtyard overlooking lake, close to C.B.D & beach.

Glennis Schindler 0412 737 324

Cotton Tree - $479,000. 3 bed, ensuite townhouse, pool, massive courtyard, 2 car accom, 300 metres to beach, bowls & shopping. Maroochy Waters - $399,000. 3 bed home, only 100 metres to river, sit as investment or detonate and dream. THINKING OF SELLING? EXPERIENCE COUNTS WHEN YOU SELL IN THIS MARKET. CONTACT TWO OF MAROOCHYDORE’S MOST EXPERIENCED AGENTS FOR A FRIENDLY APPRAISAL AND HASSLE FREE SALE ON YOUR PROPERTY.

MAROOCHY SANDS BUILDING, SIXTH AVE, MAROOCHYDORE

Greg Mills 0407 750 603

(07) 5443 2433

54 My Property Review | September 4, 2009

Page 54.indd 1

1/09/2009 2:16:34 PM


commercial property

Office opportunity Caloundra mine in Maroochydore site up for sale A prominent commercial location is being offered for lease.

A natural resource presents a huge opportunity in Caloundra.

ocated on the corner of Newspaper Place and Dalton Drive in the prominent Dalton Centre, this tenancy represents excellent value for money in leasing rates. Currently tenanted by Front Line Recruitment, the tenancy is well appointed with a welcoming reception area, four individual offices, plus an open-plan work room/boardroom of approximately 40 square metres. Substantial kitchen and bathroom facilities complement the tenancy, while the parking and a rear courtyard makes this a desirable property.

his property is part of the Meridan Plains Sand Resource identified by the Queensland Government as the largest sand resource in Queensland, comprising an estimated 101 million tonnes of building-quality sand. The property covers approximately 30 per cent of this newly discovered resource and in 2004, the sand on this property alone was estimated to be worth in excess of $300 million in wholesale value terms. Considered estimates show that this property alone has the potential to supply the entire Sunshine Coast with building-quality sand for the next 60 years. Honey Farm Road (formerly Sattler

L

Dalton Drive adjoins Maroochy Boulevard, which is due to be opened in coming months, making access to Sunshine Plaza and the CBD more convenient. Address: Price:

Agent: Contact:

18/1 Newspaper Place, Maroochydore For lease at $2053.75 a month including GST. Rates – $2280 per annum, body corporate fees – $923 per annum including GST Lucas Commercial Steve Horridge 0419 805 032

T

Road) is opposite Corbould Park race track. This property is made up of three separate titles and forms an irregular shape. The western boundary is approximately 2.3 kilometres east of the Bruce Highway along Caloundra Road and is 2.1 kilometres wide at its widest point (from east to west). From north to south at its widest, the property is approximately two kilometres and extends to the northernmost boundary, which terminates at the Mooloolah River. Address: Price: Agent: Contact:

Honey Farm Road (formerly Sattler Road), Meridan Plains $16 million COMMERCIALFN.COM Robert Webber 0412 713 457

www.remaxproperty.com.au COMMERCIAL UNIT – 147SQM

ON A SIT UC E S TIO AT N 3.3 0P M

MAROOCHYDORE 2/81 Sixth Avenue

RED HOT GROUND FLOOR COMMERCIAL UNIT – AUCTION s0RIMECENTRAL-AROOCHYDORELOCATION s3ITUATEDONTHEGROUNDmOOROFTHE%LOUERA4OWER s7ASPREVIOUSLYANUPMARKETDAYSPA s"UYEITHERFULLYDECKEDOUTORRE lTTOSUIT s"USINESSHASEXPANDEDSELLERSHAVEBOUGHT ELSEWHERE s4HEYARENOWINAFORCEDTOSELLPOSITION s&ULLYCOMMITTEDSELLERSREQUIREANURGENTSALE

INSPECT :: By Appointment AUCTION :: On Site Sat September 5 at 3.30pm WEB

:: remaxproperty.com.au ID# 1278310

CONTACT :: Michael Knights 0409 018 778

My Property Review | September 4, 2009 55

Page 55.indd 1

1/09/2009 2:36:56 PM


hinterland

Doubling up by Dorothy Drane

Demand for dual-living homes is on the rise, and the hinterland offers plenty of properties to suit families who need more space. nce upon a time, there was the granny flat – a handy residential attachment where elderly parents could come and live with their families while retaining their independence. But demographics have changed and it’s the children who aren’t leaving home, making dual living a sensible alternative for housing lots of adults on one property. Large properties can be built under, have wings attached or have completely separate buildings added to create dual-living spaces. For those who can’t afford to buy, even with the help of the First Home Owner Grant, it’s an easy option to move back to the large four- to six-bedroom family home. Scattered around the hinterland, there are lots of dual-living choices for families who want to stay together but do not want to live in each other’s pocket. Here are some examples:

O

409 Blackall Range Road, West Woombye

48-66 Christensens Road, Hunchy

55 Main Street, Montville This home has four bedrooms configured so that there is a two-bedroom fully self-contained separate apartment with its own kitchenette, separate bathroom and toilet. On the Montville escarpment, the property has outstanding views. $929,00. Day and Grimes Real Estate. 22 Yvonne Street, Highworth

A rendered brick home with three bedrooms and a media/rumpus room is the main dwelling, while theseparate guest wing has a bedroom, ensuite and office. The outdoor entertainment area includes a north-facing inground pool plus a gazebo. A long concrete driveway leads through an electric security gate to the elevated home site, which has exceptional views of the area. The property also has a spring-fed dam and orchard trees. $949,000. Leading Edge Real Estate.

There are two full-size homes on this property. One is high-set with two bedrooms, open-plan kitchen, dining and lounge area and a three-car lock-up garage. The downstairs storage area could be converted to extra bedrooms. The second home is low-set and has three bedrooms, a large timber kitchen and air-conditioning. The property has 100 mango trees, unlimited water from spring-fed dams and several sheds as well as a tennis court with lighting. $995,000. Leading Edge Real Estate.

This spacious home has six bedrooms on two levels. At ground level are three bedrooms with built-ins, rumpus or continued page 58 >

PEACHESTER RANGE PRESTIGE PROPERTY

4

2

2

4

2

2

Set on 5 acres, north facing, only 8 minutes to Beerwah, 25 minutes to coast, “KILLARA” boasts 5 oversized bedrooms, 2 ensuites, 3 walk-in-robes, parent’s retreat, home office (3.5x4m), multiple living areas, “Jarrah” kitchen, granite bench tops, ILVE commercial stove, built-in coffee machine and ice maker, Bluegum flooring, resort style pool with gazebo, 3-bay shed, 1 bedroom fully self-contained granny flat, sufficient parking for 5 cars, ample water (bore and tanks), electronic entrance gate.

Price $1,275,000

Call Ursula for your private viewing (24 hrs notice) 0415 978 344 E

S

T

A

T

E

48 Simpson Street, Beerwah Qld. 4519 Ph: (07) 5494 6244 www.aboutrealestate.com.au

56 My Property Review | September 4, 2009

Page 56.indd 1

1/09/2009 2:23:36 PM


!CREAGE(OMES 6ACANT,AND and,AND%STATES in the3UNSHINE#OASTHINTERLAND



!VAILABLE$AYS (OWARD3TREET.AMBOUR

“AURORA”, a spectacular new prestige acreage development that offers rich fertile soil (formally an organic farm) and big north easterly views over picturesque Valdora… It’s inspiring!

N

20 individual rural-residential allotments of approximately 1½ acres in size, each one uniquely designed for maximum space and visibility. Located a very comfortable 10 minute drive to fabulous Coolum Beach, which offers alfresco dining, boutique shopping, great schools, and world class golfing... not to mention the surfing.

$ULONGHA 

!CREAGE,AND   .INDERRY¬ACRESTUCKEDAWAYAT ENDOFCUL DE SAC GENTLYSLOPINGWITHDECENT HOMESITE TIMBEREDVIEWS CLOSETOSCHOOL   ¬ACRES ELEVATEDHOMESITEWITH LOVELYVIEWSOFHINTERLAND GOODSIZEDDAM EXCELLENTPOSITION GREATPIECEOFACREAGE

/PEN3ATTH3EPTPM PM "ROLGA,ANE $ULONG

4HE'RAND-ANOR(ISETBRICKRESIDENCE WITHGREATOCEANANDHINTERLANDVIEWS  BDRMS BTHRM SEPARATELIVING MODERN KITCHENANDDININGWITHHIGHCEILINGS UNDULATINGGRASSYLANDWITHDAMS $,5' LOCATEDATENDOFQUIETCOUNTRYLANE 4ONY3TORY

+IAMBAACRES 

  ACREELEVATEDBLOCK VIEWSOUT ACROSS-AROOCHY2IVERTOWARDS#OAST M FRONTAGE BRANDNEWACREAGEESTATE   /VERACRESATBACKOF.INDERRY MAINLYSTEEPLANDWITHSOMEGREATmAT HOMESITES NORTHERNASPECTWITHRURALVIEWS   ³ACREBIGmAT ALLUSEABLELAND HOMESITE LONGCONCRETEDRIVEWAYALREADYIN PLACE EXCELLENT"UDERIMLOCATION7ONT,AST   ©ACRESOFCLEARED mATLANDWITH PICTURESQUE-T.INDERRYASABACKDROP/NE OF4(%BESTBLOCKSINTHEESTATE   ACREOFMOSTLYTIMBEREDLAND WITH37ASPECT SWEEPINGHINTERLAND RIVER ANDOCEANVIEWS BLOCKRISESUPFROMROAD   ACRESOFCLEAREDFERTILELAND GENTLESLOPEWITHNORTHERNRURALVIEWS LEVEL AREASAROUNDHOMESITE OLDPACKINGSHED

Pre-sales available now Construction starts soon

4HISBEDROOMPLUSOFlCEHOMEOOZES CHARACTERANDWARMTH3ETTLEDINAMONGST NATURALRAINFOREST PRIVACYISASSURED #ONSTANTmOWINGCREEKWITHSWIMMINGHOLE 0ROPERTYBORDERSFORESTRESERVE3ELFSUSTAIN ABLEWITHPOWERFROMNEWSOLARSUPPLY 4ONY3TORY

Prices start from $340,000

2IVER&RONTAGE 

  ACRES CLEAREDTIMBERED NUMEROUSHOMESITES LARGEDAM STEELGATE ENTRANCE  PHASEPOWER VERYPRIVATE   HACLEAREDLAND FERTILESOIL NORTHASPECT RURALVIEWS DAM GOODELEVATION ANDVARIOUSCHOICEOFHOMESITES

(OMES/N!CREAGE   MXMLIVABLESHED BDRMS MODKITCHEN !#  PHASEPOWER DAM ACRES WITHAPPROXMOPENGRASSYPADDOCK   YROLD MXMLIVABLESHED  BDRMS OFlCE BTHRMS OPENPLANKITCHEN $,5' PRIVATE³ACRES CONCRETEDRIVEWAY

Make an Offer!!

#VEFSJN&TDBQF 

5 ) &5 ) * 3 %' * / " -3 & - & " 4 &



/VERACRESOFMOSTLYUSEABLELEVELLAND WITHACCESSTOTHENORTHARMOFTHE -AROOCHY2IVER)DEALFORHOBBYFARM PURSUITS ORFORTHOSEWHOPREFERARELAXED LIFESTYLECANSITBYTHERIVERANDDROPALINE /NLYMINSTO9ANDINA MINSTO#OOLUM 4ONY3TORY

6ALDORA³ACRES  3TAGEIIIISTHElNALRELEASEOF@"UDERIM%SCAPE 4HISISYOURlNALCHANCETOSECUREAUNIQUE USEABLE³ACRE ALLOTMENTINASMALLBOUTIQUEESTATEON"UDERIMS.ORTHERNSLOPES 4HElRSTSTAGESWEREHIGHLYSUCCESSFUL SELLINGOUTQUICKLY 4HISNEWDEVELOPMENTISBOUTIQUESIZEWITHONLYALLOTMENTS -OSTBLOCKSWILLEASILYTAKEASLABCONSTRUCTION ,OCATEDJUSTMINUTESFROMTHENEWPROPOSEDXHOLEGOLF COURSEANDJUSTMINUTESFROM-AROOCHYDORESSHOPS RESTAURANTSANDBEACHES THISISTHEPerfectLOCATION

!VERAGESIZEIS³ANACREWITHPRICESSTARTINGFROM 

4ONY3TORY

  YROLD LOWSET BDRM MEDIA ROOM FRONTVERANDAH POWEREDMXMSHED XGALTANKS GOODLAWNS©ACRES   (ISETPOLEHOME BDRMS  BTHRMS POLISHEDTIMBERmOORS HIGHCEILINGS WIDEVERANDAHS RURALVIEWS2ENOVATOR   BDRM OFlCESPLITLEVELHOME BTHRMS FRONTPATIO LRGFAMILYROOM BAY CARPORT XMSHED LOTSOFTREES RURALVIEWS   YROLDRENDEREDBRICKHOME  BDRMS OFlCE BTHRMS HOMETHEATRE !# ALFRESCODINING TOWNWATER $,5'   "EAUTIFULACRES FULLYFENCED DAM BDRMHOME COVEREDENTERTAINMENT AREA LARGESHEDWORKS POOL AMPLETANKS   BDRM BTHRMSTOREYHOME TIMBERmOORING ENTERTAINMENTDECK VIEWSTO OCEAN-T#OOLUM lREPLACE CARACCOM

.EARLEVELMALLOTMENTWITHA GREATCHOICEOFHOMESITES0ICTURESQUE COUNTRYSETTINGONLYASHORTDRIVETOPOPULAR #OOLUM"EACH RESTAURANTSANDSHOPS $ONTDELAY YOULLHAVETOBESTOFTHE BUSHANDTHEBEACH 4ONY3TORY

  -ODERN LOWSET BDRMS MASTER WENSUITEOFlCE LIVINGAREAS lREPLACE )' POOL LARGESHEDWORKS ACRES DAMS   BDRM BTHRM SPACIOUSKITCHEN HIGHCEILINGS VERANDAH $,5' HINTERLAND OCEANVIEWS GRASSY³ACRES DAMS

Visit our web site : WWWLEADINGEDGEREALESTATECOMAU My Property Review | September 4, 2009 57

Page 57.indd 1

2/09/2009 9:17:55 AM


hinterland < from page 56

media room, lounge, kitchenette, bathroom and separate entrance. Above is a formal lounge, master bedroom with ensuite and walk-in robe and another two bedrooms and two bathrooms. It is air-conditioned and has a large deck to enjoy the property’s commanding rural views. $519,000. Victor Realty. 156 McKees Road, Palmwoods There are five bedrooms and two bathrooms in this Queenslander-style home on five acres with two dams. There are three bedrooms upstairs, a fully renovated kitchen, study and lounge and the self-contained area under has two bedrooms, a bathroom and a separate entrance. The property has an inground pool with slide and a wood-fired pizza oven. Auction. Elders Palmwoods. 75 Highlands Hill Road, Maroochy River This four-bedroom house on 1.5 acres has two bathrooms upstairs and a fully self-contained tiled area downstairs. Large L-shaped verandahs are both up and down to enjoy the enviable northeasterly aspect. The property is fully fenced with a remote-control gate, has a lychee orchard and backs on to the Maroochy Forest Reserve. $680,000. Day and Grimes.

7 Creightons Road, Yandina This four-bedroom home with two bathrooms, ensuite, spacious kitchen and open-plan living has a separate self-contained studio. The property has a large entertaining area, pool and gazebo. There’s a double carport and plenty of parking available on the 1.25-acre property, which backs on to a bushland reserve. $635,000. Leading Edge. 583 Hunchy Road, Palmwoods This three-bedroom ranch-style brick home with two bathrooms and a double lock-up garage on 10 acres is accessed by a long driveway past a dam. It has an attached cottage with its own deck and patio. The main home has a granite kitchen and covered outdoor entertaining area. The master bedroom has ensuite and dressing room. There’s also a large shed, workshop and garden shed. $750,000. Keyline Realty. 464 Image Flat Road, Nambour This four-bedroom Queenslander with two bathrooms and two carports is on 15 acres and has a spring-fed dam with views to Mt Coolum. The home is on a knoll but there are plenty of sites for a home-based business or additional living space. $689,000. Keyline Realty.

West Woombye retreat Address: Features: Price: Agent: Contact:

149 Towen Mountain Road, West Woombye 3 bed, 2 bath, 2 car, 1 office Around $700,000 Gannon Realty 5479 6688 Clive Gannon 0402 825 262 or Brad Gannon 0404 534 296

Coes Creek sanctuary Address: Features: Price: Agent: Contact:

7 Chiltern Court, Coes Creek 5 bed, 3 bath, 3 car $499,000 The Introducers Property Consultants 5476 4482 Sarah Johnson 0419 851 226

The only noise you hear in this home is the sound of the native birds. This sturdy brick and timber home features nine-foot ceilings, master bedroom with ensuite and separate office. There is a large kitchen, two separate living areas and formal dining room. The front verandah features a multiperson spa that overlooks the valley below and there is a pool. The home is on 2.5 acres with fruit trees and dam

This delightful home has plenty of room for the family and guests, and is located in an enviable position. It features five bedrooms, two bathrooms, air-conditioning, fireplace and high ceilings in living area, double lock-up garage and single undercover carport. The backyard is level and has plenty of space for the kids or pets and is surrounded by established gardens.

Diddillibah acreage Address: Features: Price: Agent: Contact:

104 River Gum Drive, Diddillibah 4 bed, 2 bath, 6 car Buyer to price LJ Hooker Marcoola & Twin Waters 5450 7000 Jamima Suter 0418 534 200

Palmwoods first home Address: Features: Price: Agent: Contact:

2 Brudo Court, Palmwoods 3 bed, 2 bath, 2 car $398,000 Elders Palmwoods 5478 9122 Brad Milton 0421 965 226

Affordable Nambour home Address: Features: Price: Agent: Contact:

26 Burruma Court, Nambour 3 bed, 2 bath, 1 car $377,500 Victor Realty 5476 0050 Craig Heppell or Toni Bielby

Stunner in Image Flat Address: Features: Price: Agent:

464 Image Flat Road, Image Flat 4 bed, 2 bath, 2 car $689,000 Keyline Realty 5441 2511

This undulating cleared block is at the end of a cul-de-sac. The master bedroom has an ensuite and external entry doors with views out over the property. There is a rumpus/ lounge area, separate adjacent formal lounge and three other large bedrooms. Also under the roofline is a double lock-up garage and there is a pool, shed and ample parking space.

This low-maintenance home would ideally suit a family, investors or first-home owners. It features three bedrooms, all with built-ins, plus ensuite and walk-in robe to the master bedroom. It has a renovated kitchen, separate laundry and is security screened. The backyard is fully fenced, with a covered entertaining area that overlooks the pool. There is a double lock-up garage and garden shed.

The location alone will sell this unpretentious, yet comfortable brick home. Situated just around the corner form schools, transport and a short drive to Nambour CBD, the home has three bedrooms with built-ins, two-way bathroom, open-plan living and dining area, airconditioning, rear indoor/ outdoor area, huge shed and single lock-up garage. It is on a north-facing 665-square metre fenced block.

Waiting to be discovered is this property on 15 acres with a majestic high-set four-bedroom home. Created in the style of a contemporary Queenslander, it sits on a knoll with spectacular views to Mt Coolum and Mt Ninderry. The spring-fed dam provides all the water you could ask for (it has been used to water a wholesale nursery), and there are great sites to establish sheds for a hobby or home-based business.

58 My Property Review | September 4, 2009

Page 58.indd 1

1/09/2009 2:25:08 PM


FULL SERVICE Craig Heppell 0400 180 515 Toni Bielby 0417 640 585 Karen Heppell 0400 330 485

LOWEST FEES

MAXIMUM RESULTS

5476 0050

Victor Realty www.victorrealty.com.au

Historic Enchanting Queenslander

NAMBOUR $455,000

4IMBER mOORS ORNATE CEILINGS PICTURE RAILS EVERLASTING HARDWOOD THIS HOME HAS EVERYTHING THAT EMBODIESTHETRUEESSENCEOF1UEENSLAND)TOFFERSLARGEBEDROOMS LARGEKITCHENLEADINGONTOA DECKTAKINGINHINTERLANDVIEWS FAMILYSIZEDBATHROOM LARGELOUNGE SEPARATEDINING GLORIOUSSUN SITTINGROOM GARAGECARPORT UNDERHOMESTORAGEWORKSHOPAREA SQMACRE BLOCKON TWOTITLESDIVIDEDINTOSEPARATELOTS6ERYHANDILYLOCATEDJUSTASTONESTHROWFROM.AMBOUR#"$ SHOPS SCHOOLSANDPUBLICTRANSPORT THECARWILLHARDLYNEEDARUN4HEOWNERHASGONETOGREAT LENGTHSTOENSUREPRICEOFTHISCHARMINGHOMEMEETSTHEMARKET

8 Lamington Terrace Open Saturday 11.30-12pm

Light, Bright and Spacious

NAMBOUR $377,500

Web ID# 1128536 4

Large Six Bedroom Home With Rural Views

1

2

NAMBOUR $519,000

,OCATEDINAQUIET#OES#REEKCUL DE SAC THISSPACIOUSBRICKHOMEHASPLENTYOFROOMFORAYOUNG GROWINGFAMILY3ETONALOWMAINTENANCESQMBLOCKITCOMPRISESTHREEGENEROUSBEDROOMSWITH BUILT INS ACANDCEILINGFANS MODERNBATHROOMPLUSENSUITEOFFMASTERBEDROOM BIG BRIGHTKITCHEN WITHADJACENTDININGAREA LARGESUMPTUOUSLOUNGEROOM FANTASTICSUNROOMOFlCE!LLLIVINGAREASARE AIR CONDITIONEDSUN DRENCHEDYARDWITHIN GROUNDSALTWATERPOOL CARPORTPLUSSPACEFORBOAT VAN ORTRAILER7ITHANEWSHOPPINGCENTREANDTRANSPORTNEARBY THISHOMESHOULDPROVETOBEPOPULAR WITH&IRST(OME"UYERSAND)NVESTORS

3ETINACOMMANDINGPOSITIONWITHNORTHERLYRURALVIEWS THISSOLIDLYBUILTANDSPACIOUSYEAROLD HOMEHASEVERYTHINGTHATALARGEOREXTENDEDFAMILYCOULDPOSSIBLYWANT/NTWOSTYLISHLEVELS THE HOMEPROVIDESGENUINESEPARATEDLIVINGANDOFFERS'ROUNDLEVELGENEROUSBEDSWITHBUILT INS RUMPUSMEDIAROOM LOUNGE KITCHENETTE BATHROOM SEPARATEENTRANCEANDCARPORTFORATLEAST VEHICLES5PSTAIRS3TUNNINGFORMALLOUNGE AIR CON HUGEDECKWITHVIEWS LARGEMODERNKITCHENWITH GASCOOKING FORMALDINING BEDS INCLUDINGLARGEMASTERWITHENSUITEAND7)2 BATHROOMS4HE YARDISEASYCAREANDBOASTSASIZEABLEGARDENSHED

26 Burruma Court Open Saturday 1.45-2.15pm

22 Yvonne Street Open Saturday 1-1.30pm

Web ID# 1129252 3

2

1

Web ID# 1132361 6

3

5

Enchanting, Private, Perfect! NAMBOUR $355,000

Bargain Buying NAMBOUR $319,000

Large Modern Designer Home тАУ Views NAMBOUR $510,000

Affordable Brick Beauty NAMBOUR $365,000

s,ARGEBEDROOMS LOFTSTUDYOROFlCE s&ORMALLOUNGELEADINGTOOUTDOORENTAREA s3EPARATEDINING RUMPUSTVROOM s,ARGE@RETROSTYLEKITCHEN s#ARPORT CARSPACE s"EAUTIFULLYMAINTAINEDGARDENANDLAWN

s4HREEBEDROOMSWITHBUILT INS s-ODERNBATHROOM s4WOGENEROUSLIVINGAREAS s4IMBERmOORSTHROUGHOUT AIR CONDITIONED s,OCKABLEWORKSHOPSTORAGEAREA s%ASYCAREYARD WALKTOSCHOOLSANDSHOPS

sSTOREY BEDROOM BATHROOMHOME s3PACIOUSOPENPLANLIVING s#OVEREDENTERAININGDECKWITHVIEWS s3TYLISHKITCHEN MODERNAPPLIANCES s$OUBLEGARAGE FENCEDACCESSIBLEBLOCK s%ASYTOMAINTAINBLOCKnHANDYLOCATION

sBEDROOMSWITHBUILT INS MODERNBATHROOM s.EWKITCHENWITHGASCOOKING s/PENPLANLIVINGDINING s)NDOOROUTDOORENTERTAININGAREA s3INGLEGARAGE COURTYARD SHED s&ENCED LOWMAINTENANCE LANDSCAPEDYARD

22 Murray Crescent Open Sat 11-11.30am

11 MayямБeld Street Open Sat 11.45-12.15pm

9 Dunnart Court Open Sat 12.30-1pm

8 Titania Court Open Sat 2.30-3pm

Web ID# 1124339

Web ID# 1086265

Web ID# 1070756

Web ID# 1138633

Brilliant Acreage Value - Views + Space WOOMBYE $475,000

Solid, Quiet, Spacious - Offers! NAMBOUR Buyers From $385,000

Impressive Brick Home NAMBOUR $369,000

Best Value Townhouses NAMBOUR $329,000 - $354,900

sBEDROOM BATHROOMHOME GREATLOCATION sSQMACRE FENCEDBLOCK s3PECTACULARHINTERLANDVIEWS s,ARGEKITCHENANDDININGAREA s3UNROOMPLUSCOVEREDOUTDOORAREA s CARGARAGE CARPORT WORKSHOP

s"RICKANDTILEBED BATHHOMEWITHOFlCE s/PENPLANLIVINGANDDINING s2EARCOVEREDDECK INGROUNDPOOL s&ENCED LANDSCAPEDANDLAWNEDYARD s$OUBLECARPORT"ACKSONTORESERVEANDPARK s033344HISISGREATVALUE

s7ELL PRESENTEDLOWSETBRICKHOME s"EDROOMS  WAYBATHROOM s/PENPLANKITCHENDININGAREA s3UMPTUOUSFORMALLOUNGE AIR CON s#OVEREDOUTDOORENTERTAININGAREA s#ARPORT LARGESHEDANDWORKSHOP

s8BEDXBED sSQMSQMLIVINGSPACE s3INGLEDOUBLEGARAGES s0EACEFUL HANDYLOCATION s&HOG BYSEPTEMBER s/NLY PSQM#OMPARE3ELLINGFAST

37 Cobbs Road Open Sat 2-2.30pm

3 Casuarina Court Open Sat 12.15-12.45pm

16 Glenbrook Drive Open Sat 1.15-1.45pm

50 Aspland Street Saturday 10-11am & 1-2pm Web ID#991236

Web ID# 1103646

Web ID# 1081260

Web ID# 1063755

My Property Review | September 4, 2009 59

Page 59.indd 1

9/1/2009 3:06:29 PM


classifieds

property reviews

Houses for Sale

Houses for Sale

Terry Hinds

2/18 Blackall Street WOOMBYE

5442 1888

REAL ESTATE

OPEN HOMES NAMBOUR 44/70 Netherton St CALLING INVESTORS! Sat 11-11.45 Close to Private & Public Hospitals. Perfect 1st Home or Investment. 1yr, 2 storey, air con, priv. courtyard, bush back drop. Great Position $305,000 Sat 12-12.45 WOOMBYE 20 Pine Grove Rd “Do Not Miss This!” The Last Woombye Bargain .. Beautifully renovated town cottage, easy walk to everything & on a level block with magnificent views. $339,500 Sat 12-12.45 NAMBOUR HEIGHTS 4 Isabella Avenue Gorgeous homely Queenslander, appeal in & out. well presented, front verandah, 3brm, high ceilings,air con,f/fenced,SLUG,level yard $399,000

We have unsatisfied buyers ready to spend Don’t miss an opportunity – List with us now! Nambour Residential Block $165,000 991m² building block with cleared front and bush at rear, all town facilities in new estate surrounded by new homes. No covenants. Bargain price for today’s market. Price Slashed $419,000 $399,000 Nambour Heights- 2 storey block home in premier position! Three bedrooms up, rumpus and study down, Level 620m2 block with in-ground pool and 2 car lock up. Walk to shops, park & bowls club. Vendor purchased elsewhere and keen for early sale. A must to inspect. Open Sat & Sun 11.30-12.00noon 7 Isabella Avenue, Nambour Prime Position Maroochydore $429,000 Comfy Queensland style 3 bedroom timber home with detached livable studio, polished timber floors, T & G Interior, modern kitchen, separate shower & ,bath large covered rear patio. Only 150m to river and bus route. Close to CBD. Open Saturday 10.30- 11.00am 29 Broadsea Avenue, Maroochydore

FOR SALE LAND: Slashed by $10k Position! Walk town, quality estate $179,000 LAND: DUPLEX LAND. Golden Opportunity. 2 $229,000 1000m Cnr block HOUSE: ROLLING MEADOWS Estate. 3brm,ens,front & rear decks, 844m2 cul de sac block, Ideal First Home or Investment $359,000 HOUSE & LAND PACKAGES; 4 brms,ensuited,2 bath, decks & DLUG 4 homes to choose from … Starting at $425,000 Lee Andrews 0402 216 809 Gary De Paoli 0408 731 412 David Menck 0408 713 834 YOUR LOCAL GUYS www.riddellrealestate.com.au

19 Talara Street, Currimundi

Buy now & you too could live a 5 min drive from the beach & lake or a 5 min walk from the shops, school & parks. This recently renovated 4 bed, 2 bath house gives you these benefits plus more. Investors could achieve an approx rental return of $390-410p/wk or owner occupiers could enjoy having 2 living areas, back patio, side access & fenced yard. Price reduction - NOW $455,000 Open for inspection – Sat 5/9/09 10-11am or call for private inspection PRIVATE SALE - 0404 415 467 E: jane.baxter@uqconnect.edu.au W: www.domain.com.au/2007955811

Buderim on top Address: Features: Price: Agent: Contact:

9 Eckersley Avenue, Buderim 4 bed, 2 bath, 2 car Buyers in the $800,000s Ken Guy Maroochydore 5443 2222 Matt O’Grady 0414 317 375 and Richard Scrivener 0416 799 188

This family home boasts four bedrooms (master with ensuite and walk-in robe) plus a large study and multiple living zones. There’s a formal dining plus a large central kitchen with stainless steel appliances. Fully air-conditioned throughout, there’s also an entertaining area plus plenty of grass for the kids to play. This home is ideally located in the Meridan State College zone and close to beaches, shops and the CBD.

Little Mountain home

Terry 0407 135 423 John 0417 004 117

Address: Features: Price: Agent: Contact:

Terry Hinds Real Estate 73 Hillcrest Ave, Nambour. Ph: 5441 4616 Fax: 5441 7766 thinds@internode.on.net

3 Kingsview Court, Little Mountain 4 bed, 2 bath, 2 car $499,000 RE/MAX Property Associates Caloundra Donna Conrad 0401 502 078

s0ROPERTY3ALES

s!UCTIONEERS

s2ENTALS

s,AND3ALES

s(OUSES 5NITS

s,ISTINGSWANTED

This home is in a sought-after street on top of Buderim. Set behind security gates and surrounded by gardens, this residence is near-new and features four bedrooms plus two bathrooms. Boasting quality throughout and a neutral colour palette, everything here is contemporary, from the gourmet kitchen to the parent’s retreat. This is blue-chip real estate on Buderim – move in and enjoy capital growth.

Character Home Priced To Sell

Modern Home But It Has To Go!

Located within walking distance to Nambour Hospital this home features polished timber floors throughout. There are 3 bedrooms upstairs all with built-in robes, enclosed sunroom and big roomy kitchen. Downstairs there is an additional bathroom, living area and laundry ideal for dual living. The extra large double garage has remote control and the property is fully fenced.

Looking for a modern home and beautiful landscaped gardens and nothing to do but move in? Then look no further than this immaculate modern home located in Woombye Country Estate. Providing a little bit of country mixed with a little bit of town, only minutes from Nambour CBD and 20mins to the Coast. The home offers 3 bedrooms with ensuite, two separate living areas & well-appointed kitchen with stainless steel appliances & polished floors in the kitchen, dining & family room.

Address: 45 Nambour Mapleton Road, Nambour Inspect: Saturday 1-1.45pm Price: $319,000 Contact: Monica Smith 0414 322 243

Address: Inspect: Auction: Contact:

12 Countryview Street, Woombye Saturday 11-11.45am On site Saturday 3rd Oct at 11am Monica Smith 0414 322 243

Rare Acreage Find

Cottage Amongst The Trees

Good Starter Home In Woombye

Near New Townhouse In Nambour

Spacious homestead on 1.9 acres. The home has 4 big bedrooms, master ens. & w.i.r, main bathroom has large spa bath, spacious formal lounge with timber raked ceiling, open plan kitchen/dining/family area, big L-shaped patio/deck. DLUG plus 2nd garage/quarters with sauna room, toilet & shower at rear.

A comfortable 3 bedroom cottage in an elevated part of town with a beautiful northerly outlook. Most of the hard work has been done in renovating this home with new kitchen and both bathrooms. The home sits on a fenced 809m2 block. The property has a huge rear verandah overlooking Nambour.

Located in a cul-de-sac close to the Nambour Christian College with a fully fenced yard and a safe environment for the family. The home has 3 built in carpeted bedrooms, main with an ensuite, stylish bathroom with separate shower and bath, polished timber floors elswhere plus a covered deck.

This large townhouse is situated close to everything. The building has 9’ ceilings. There are 2 bedrooms, one with a walk in robe and ensuite. Large kitchen and open plan dining and lounge plus an office area for the computer. Downstairs there is a 3rd toilet, laundry and a one car lockup garage.

Address: Inspect: Price: Contact:

Address: Inspect: Price: Contact:

Address: Inspect: Price: Contact:

Address: Inspect: Price: Contact:

12 Ellora Court, Rosemount Saturday 11-11.45am $574,500 Ron Corelli 0412 728 954

www.woombyerealty.com.au

28 Bade Street, Nambour Saturday 12-12.45pm $365,000 Ron Corelli 0412 728 954

20 Holyn Close, Woombye Saturday 11-11.45am $369,000 Colin John 0418 750 227

Unit 18 Hidden Close, Nambour By appointment $320,000 neg. Norm Kolln 0410 059 843

12 Blackall Street, Woombye 5442 1855

60 My Property Review | September 4, 2009

Page 60.indd 1

2/09/2009 10:00:55 AM


rentals

classifieds Houses for Sale DTKPIKPIRGQRNGCPFRTQRGTV[VQIGVJGT

Houses for Sale

Houses for Sale

Rentals

1$0%285 +,17(5/$1' 23(1)25,163(&7,216$7WK6HSW

MAROOCHYDORE AND FOREST GLEN

BUDERIM - Reno 3 bed, new kitchen & bathroom, A/C, polished ďŹ&#x201A;oors, 1 car, shed, walk to village $295pw. Ph 0403 281 400.



7><4B5>AB0;4

ĎŽ

ĆľĆ&#x152;ĹśĆ?Ĺ?Ä&#x161;Ä&#x17E;ϲϏώž 

ΨϰϲϾÍ&#x2022;ĎŹĎŹĎŹ

dĹ&#x161;Ä&#x17E; ÄŽĹśĹ?Ć?Ĺ&#x161;Ĺ?ĹśĹ? Ć&#x161;ŽƾÄ?Ĺ&#x161;Ä&#x17E;Ć? Ä&#x201A;Ć&#x152;Ä&#x17E; ƾŜÄ&#x161;Ä&#x17E;Ć&#x152;Ç Ä&#x201A;Ç&#x2021; Ä&#x201A;ĹśÄ&#x161; Ć&#x161;Ĺ&#x161;Ĺ?Ć? Ć?ĆľĆ&#x2030;Ä&#x17E;Ć&#x152;Ä? Ĺ&#x161;ŽžÄ&#x17E;Ĺ?Ć?Ć&#x152;Ä&#x17E;Ä&#x201A;Ä&#x161;Ç&#x2021;ĨŽĆ&#x152;Ĺ?Ć&#x161;Ć?ĹśÄ&#x17E;Ç Ĺ˝Ç ĹśÄ&#x17E;Ć&#x152;Ć?Í&#x2DC;tĹ?Ć&#x161;Ĺ&#x161;Ď°Ä?Ä&#x161;Ć&#x152;ĹľĆ?Í&#x2022;ĎŽžŽÄ&#x161;Ͳ Ä&#x17E;Ć&#x152;ĹśÄ?Ć&#x161;Ĺ&#x161;Ć&#x152;ĹľĆ?Í&#x2022;>h'Î&#x2DC;Ĺ˝Ć&#x2030;Ä&#x17E;ĹśĆ&#x2030;ĹŻÄ&#x201A;ŜŏĹ?Ć&#x161;Ä?Ĺ&#x161;Ä&#x17E;ĹśĆ&#x161;Ĺ&#x161;Ä&#x201A;Ć&#x161;Ĺ˝Ć&#x2030;Ä&#x17E;ĹśĆ?ŽƾĆ&#x161; ŽŜĆ&#x161;Ĺ˝Ć&#x161;Ĺ&#x161;Ä&#x17E;Ć&#x152;Ä&#x17E;ĹŻÄ&#x201A;Ç&#x2020;Ĺ?ĹśĹ?Ä&#x161;Ä&#x17E;Ä?ĹŹÍ&#x2022;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ć&#x152;Ä&#x17E;Ć&#x152;Ä&#x17E;Ä&#x201A;ĹŻĹŻÇ&#x2021;Ĺ?Ć?ĹśÍ&#x203A;Ć&#x161;Ä&#x201A;ĹśÇ&#x2021;Ć&#x161;Ĺ&#x161;Ĺ?ĹśĹ?žŽĆ&#x152;Ä&#x17E; Ć&#x161;Ĺ˝Ä&#x201A;Ć?ĹŹĨŽĆ&#x152;Í&#x2DC;>Ĺ˝Ä?Ä&#x201A;Ć&#x161;Ä&#x17E;Ä&#x161;Ĺ?ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;'Ĺ˝Ć?ÄŽÄ&#x17E;ĹŻÄ&#x161;Ä&#x17E;Ć?Ć&#x161;Ä&#x201A;Ć&#x161;Ä&#x17E;Ç Ĺ?Ć&#x161;Ĺ&#x161;Ć&#x2030;Ä&#x201A;Ć&#x152;ĹŹĆ?Î&#x2DC; Ć?Ä?Ĺ&#x161;ŽŽůĆ?ĹľĹ?ŜƾĆ&#x161;Ä&#x17E;Ć?Ä&#x201A;Ç Ä&#x201A;Ç&#x2021;Í&#x2022;Ć&#x161;Ĺ&#x161;Ĺ?Ć?Ĺ&#x161;ŽžÄ&#x17E;Ĺ?Ć?Ä&#x201A;žƾĆ?Ć&#x161;Ć?Ä&#x17E;Ä&#x17E;Í&#x2DC; ^Ä&#x201A;Ć&#x152;Ä&#x201A;Ĺ&#x161;:Ĺ˝Ĺ&#x161;ĹśĆ?ŽŜĎŹĎ°Ď­ĎľϴϹϭώώϲ

zÄ&#x201A;ĹśÄ&#x161;Ĺ?ĹśÄ&#x201A;ϴϾϴžώ

Ä&#x17E;Ä&#x201A;Ä?Ĺ&#x161;ΨϯϳϹÍ&#x2022;ĎŹĎŹĎŹ

>Ĺ˝Ä?Ä&#x201A;Ć&#x161;Ä&#x17E;Ä&#x161;Ĺ?ĹśĆ&#x2030;Ĺ˝Ć&#x2030;ƾůÄ&#x201A;Ć&#x152;WÄ&#x201A;Ć&#x152;ĹŹĆ?Ĺ?Ä&#x161;Ä&#x17E;Ć?Ć&#x161;Ä&#x201A;Ć&#x161;Ä&#x17E;Ć&#x161;Ĺ&#x161;Ĺ?Ć?Ć?ŽŽŜĆ&#x161;Ĺ˝Ä?Ä&#x17E;Ä?ŽŜͲ Ć?Ć&#x161;Ć&#x152;ĆľÄ?Ć&#x161;Ä&#x17E;Ä&#x161;Ä&#x161;ĆľĆ&#x2030;ĹŻÄ&#x17E;Ç&#x2020;Ĺ?Ć?ĹśĹ˝Ç Ä&#x201A;Ç&#x20AC;Ä&#x201A;Ĺ?ĹŻÄ&#x201A;Ä?ĹŻÄ&#x17E;ĨŽĆ&#x152;Ć?Ä&#x201A;ĹŻÄ&#x17E;Í&#x2DC;Ä&#x201A;Ä?Ĺ&#x161;ƾŜĹ?Ć&#x161;ĨÄ&#x17E;Ä&#x201A;Ͳ Ć&#x161;ĆľĆ&#x152;Ä&#x17E;Ć?Ĺ˝Ć&#x2030;Ä&#x17E;ĹśĆ&#x2030;ĹŻÄ&#x201A;ŜŏĹ?Ć&#x161;Ä?Ĺ&#x161;Ä&#x17E;Ŝ͏Ä&#x161;Ĺ?ĹśĹ?ĹśĹ?ÍŹĹŻĹ?Ç&#x20AC;Ĺ?ĹśĹ?Ć&#x2030;ĹŻĆľĆ?ĎŻÄ?Ä&#x17E;Ä&#x161;Ć&#x152;ŽŽžĆ?Í&#x2022; ĎŽÄ?Ä&#x201A;Ć&#x161;Ĺ&#x161;Ć&#x152;ŽŽžĆ?Î&#x2DC;>h'Í&#x2DC;^Ä&#x17E;Ć&#x161;Ä&#x201A;Ä&#x161;ĹŠÄ&#x201A;Ä?Ä&#x17E;ĹśĆ&#x161;Ć&#x161;ŽϯÄ&#x201A;Ä?Ć&#x152;Ä&#x17E;Ć?ŽĨĆ&#x2030;Ä&#x201A;Ć&#x152;ŏͲ ĹŻÄ&#x201A;ĹśÄ&#x161;Í&#x2022;Ä&#x201A;Ć?Ĺ&#x161;Ĺ˝Ć&#x152;Ć&#x161;Ç Ä&#x201A;ĹŻĹŹĆ&#x161;Ĺ˝zÄ&#x201A;ĹśÄ&#x161;Ĺ?ĹśÄ&#x201A;sĹ?ĹŻĹŻÄ&#x201A;Ĺ?Ä&#x17E;Ä&#x201A;ĹśÄ&#x161;Ä&#x201A;ϭϹžĹ?ŜƾĆ&#x161;Ä&#x17E; Ä&#x161;Ć&#x152;Ĺ?Ç&#x20AC;Ä&#x17E;Ć&#x161;Ĺ˝ŽŽůƾžÄ&#x17E;Ä&#x201A;Ä?Ĺ&#x161;Í&#x2DC; Ć&#x152;Ä&#x201A;Ĺ?Ĺ?Î&#x2DC;ĹśĹ?Ć&#x161;Ä&#x201A;,Ä&#x201A;ĹśĹ?Ä?Ä&#x17E;ĹŹĎŹĎ°Ď°Ď´ϴϲϲĎ°ĎŹĎł ĎŽ

zÄ&#x201A;ĹśÄ&#x161;Ĺ?ĹśÄ&#x201A;ϴϯϹž 

ΨϰϹϰÍ&#x2022;ĎŹĎŹĎŹ

Ä?Ĺ&#x161;Ä&#x201A;Ć&#x152;ĹľĹ?ĹśĹ?ĎŻÄ?Ä&#x161;Ć&#x152;ĹľÍ&#x2022;Ä&#x17E;ĹśĆ?ĆľĹ?Ć&#x161;Ä&#x17E;Ä&#x161;Ĺ&#x161;ŽžÄ&#x17E;Ç Ĺ?Ć&#x161;Ĺ&#x161;ĹŻĹ˝Ä&#x201A;Ä&#x161;Ć?ŽĨÄ?Ĺ&#x161;Ä&#x201A;Ć&#x152;Ͳ Ä&#x201A;Ä?Ć&#x161;Ä&#x17E;Ć&#x152;Í&#x2DC; ,Ĺ?Ĺ?Ĺ&#x161; Ä?Ä&#x17E;Ĺ?ĹŻĹ?ĹśĹ?Ć? Î&#x2DC; Ć&#x2030;ŽůĹ?Ć?Ĺ&#x161;Ä&#x17E;Ä&#x161; Ĺ&#x161;Ä&#x201A;Ć&#x152;Ä&#x161;Ç Ĺ˝Ĺ˝Ä&#x161; Ĺ&#x2021;ŽŽĆ&#x152;Ć?Í&#x2DC; dĹ&#x161;Ä&#x17E; Ĺ?Ä&#x201A;Ć&#x152;Ä&#x161;Ä&#x17E;ĹśĹ?Ć?Ä&#x201A;Ä&#x161;Ä&#x17E;ĹŻĹ?Ĺ?Ĺ&#x161;Ć&#x161;Ç Ĺ?Ć&#x161;Ĺ&#x161;Ä&#x201A;ĹŻĆ&#x152;Ĺ?Ç&#x20AC;Ä&#x201A;Ć&#x152;Ĺ?Ä&#x17E;Ć&#x161;Ç&#x2021;ŽĨĨĆ&#x152;ĆľĹ?Ć&#x161;Ć&#x161;Ć&#x152;Ä&#x17E;Ä&#x17E;Ć?Í&#x2022;Ä&#x17E;Ä&#x201A;Ć?Ç&#x2021; Ä?Ä&#x201A;Ć&#x152;Ä&#x17E;Ç&#x20AC;Ä&#x17E;Ĺ?Ĺ?Ĺ?Ä&#x17E;Ĺ?Ä&#x201A;Ć&#x152;Ä&#x161;Ä&#x17E;ĹśÍ&#x2022;Ä&#x201A;ĹśÄ&#x161;ĹľÄ&#x201A;ĹśÇ&#x2021;Ĺ&#x2021;Ĺ˝Ç Ä&#x17E;Ć&#x152;Ĺ?ĹśĹ?ĹśÄ&#x201A;Ć&#x;Ç&#x20AC;Ä&#x17E;Ć?Í&#x2DC;ŽžͲ Ć&#x2030;ĹŻÄ&#x17E;Ć&#x161;Ä&#x17E;ĹŻÇ&#x2021;Ć&#x152;Ä&#x17E;ŜŽÇ&#x20AC;Ä&#x201A;Ć&#x161;Ä&#x17E;Ä&#x161;Í&#x2022;Ć&#x161;Ĺ&#x161;Ĺ?Ć?Ĺ&#x161;ŽžÄ&#x17E;Ĺ?Ć?ĹŠĆľĆ?Ć&#x161;ĹŻĹ?ĹŹÄ&#x17E;ĹśÄ&#x17E;Ç Í&#x2DC;&Ć&#x152;ŽžĆ&#x161;Ĺ&#x161;Ä&#x17E; Ç&#x20AC;Ä&#x17E;Ć&#x152;Ä&#x201A;ĹśÄ&#x161;Ä&#x201A;Ĺ&#x161;Ç&#x2021;ŽƾĹ&#x161;Ä&#x201A;Ç&#x20AC;Ä&#x17E;Ĺ?Ć&#x152;Ä&#x17E;Ä&#x201A;Ć&#x161;Ç&#x20AC;Ĺ?Ä&#x17E;Ç Ć?Ć&#x161;Ĺ˝Ç Ä&#x201A;Ć&#x152;Ä&#x161;Ć?DĆ&#x161;EĹ?ĹśÄ&#x161;Ä&#x17E;Ć&#x152;Ć&#x152;Ç&#x2021;Í&#x2DC; ^Ä&#x201A;Ć&#x152;Ä&#x201A;Ĺ&#x161;:Ĺ˝Ĺ&#x161;ĹśĆ?ŽŜĎŹĎ°Ď­ĎľϴϹϭώώϲ

Ĺ˝Ä&#x17E;Ć?Ć&#x152;Ä&#x17E;Ä&#x17E;ĹŹϲϲϏžώ

ΨϰϴϹÍ&#x2022;ĎŹĎŹĎŹ

tÄ&#x17E;ĹŻĹŻĆ&#x2030;Ĺ˝Ć?Ĺ?Ć&#x;ŽŜÄ&#x17E;Ä&#x161;Ĺ?ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;Ä&#x17E;ĹŻÄ&#x17E;Ç&#x20AC;Ä&#x201A;Ć&#x161;Ä&#x17E;Ä&#x161;EĹ˝Ć&#x152;Ć&#x161;Ĺ&#x161;Ć&#x152;Ĺ?Ä&#x161;Ĺ?Ä&#x17E;Ä&#x17E;Ć?Ć&#x161;Ä&#x201A;Ć&#x161;Ä&#x17E;Ć&#x161;Ĺ&#x161;Ĺ?Ć? Ä?Ä&#x17E;Ä&#x201A;ĆľĆ&#x;Ĩƾů ĹśÄ&#x17E;Ç  Ĺ&#x161;ŽžÄ&#x17E; Ĺ?Ć? Ć&#x152;Ä&#x17E;Ä&#x201A;Ä&#x161;Ç&#x2021; ĨŽĆ&#x152; Ç&#x2021;Žƾ Ć&#x161;Ĺ˝ žŽÇ&#x20AC;Ä&#x17E; Ĺ?Ĺś Ä&#x201A;ĹśÄ&#x161; Ä&#x17E;ŜŊŽÇ&#x2021;Í&#x2DC;dĹ&#x161;Ä&#x17E;Ć&#x152;Ä&#x17E;Ĺ?Ć?Ć&#x2030;ĹŻÄ&#x17E;ĹśĆ&#x161;Ç&#x2021;ŽĨĆ&#x152;ŽŽžĨŽĆ&#x152;Ä&#x201A;ĹŻĹŻĆ&#x161;Ĺ&#x161;Ä&#x17E;ĨÄ&#x201A;ĹľĹ?ĹŻÇ&#x2021;Ç Ĺ?Ć&#x161;Ĺ&#x161;Ď° Ä?Ä&#x17E;Ä&#x161;Ć&#x152;ŽŽžĆ?Í&#x2022;ĎŽÄ?Ä&#x201A;Ć&#x161;Ĺ&#x161;Ć&#x152;ŽŽžĆ?Í&#x2022;ĹľÄ&#x17E;Ä&#x161;Ĺ?Ä&#x201A;Ć&#x152;ŽŽžÍ&#x2022;>h'Ć&#x2030;ĹŻĆľĆ?Ä?Ĺ˝Ć&#x161;Ĺ&#x161; Ĺ?ĹśĆ&#x161;Ä&#x17E;Ć&#x152;ĹśÄ&#x201A;ĹŻ Ä&#x201A;ĹśÄ&#x161; Ä&#x17E;Ç&#x2020;Ć&#x161;Ä&#x17E;Ć&#x152;ĹśÄ&#x201A;ĹŻ Ä&#x17E;ĹśĆ&#x161;Ä&#x17E;Ć&#x152;Ć&#x161;Ä&#x201A;Ĺ?ĹśĹ?ĹśĹ? Ä&#x201A;Ć&#x152;Ä&#x17E;Ä&#x201A;Ć?Í&#x2DC; ^Ä&#x17E;Ä?ĆľĆ&#x152;Ä&#x17E; Ç&#x2021;ŽƾĆ&#x152; ĨƾĆ&#x161;ĆľĆ&#x152;Ä&#x17E;Ć&#x161;Ĺ˝Ä&#x161;Ä&#x201A;Ç&#x2021;Í&#x160; Ć&#x152;Ä&#x201A;Ĺ?Ĺ?Î&#x2DC;ĹśĹ?Ć&#x161;Ä&#x201A;,Ä&#x201A;ĹśĹ?Ä?Ä&#x17E;ĹŹĎŹĎ°Ď°Ď´ϴϲϲĎ°ĎŹĎł

WĆ&#x152;Ĺ?Ç&#x20AC;Ä&#x201A;Ć&#x161;Ä&#x17E;ĹŻÄ&#x17E;Ĺ?Ä&#x201A;ĹśÄ?Ä&#x17E;ϳϹϴžώ

ĹśĹ˝Ç ΨϰϾϾÍ&#x2022;ĎŹĎŹĎŹ

>Ĺ˝Ä?Ä&#x201A;Ć&#x161;Ä&#x17E;Ä&#x161; Ĺ?Ĺś ŽŜÄ&#x17E; ŽĨ Ć&#x161;Ĺ&#x161;Ä&#x17E; Ä?Ä&#x17E;Ć?Ć&#x161; Ć?Ć&#x161;Ć&#x152;Ä&#x17E;Ä&#x17E;Ć&#x161;Ć? Ĺ?Ĺś Ĺ˝Ä&#x17E;Ć? Ć&#x152;Ä&#x17E;Ä&#x17E;ĹŹÍ&#x2022; Ć&#x161;Ĺ&#x161;Ĺ?Ć? Ĺ&#x161;ŽžÄ&#x17E;Ĺ&#x161;Ä&#x201A;Ć?Ä&#x17E;ŜŽƾĹ?Ĺ&#x161;Ć&#x152;ŽŽžĨŽĆ&#x152;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ç Ĺ&#x161;ŽůÄ&#x17E;ĨÄ&#x201A;ĹľĹ?ĹŻÇ&#x2021;Í&#x2DC;tĹ?Ć&#x161;Ĺ&#x161;Ďą Ä?Ä&#x17E;Ä&#x161;Ć&#x152;ŽŽžĆ?Í&#x2022;ĎŻÄ?Ä&#x201A;Ć&#x161;Ĺ&#x161;Ć&#x152;ŽŽžĆ?Í&#x2022;Ä&#x201A;ĹśÄ&#x161;Ć&#x2030;ĹŻÄ&#x17E;ĹśĆ&#x161;Ç&#x2021;ŽĨÄ&#x17E;Ç&#x2020;Ć&#x161;Ć&#x152;Ä&#x201A;Ć?Ĺ˝Ç&#x20AC;Ä&#x17E;Ć&#x152;Ć&#x161;Ĺ&#x161;Ä&#x17E; Ć?Ć&#x2030;ĹŻĹ?Ć&#x161; ĹŻÄ&#x17E;Ç&#x20AC;Ä&#x17E;ĹŻ Ć&#x152;Ä&#x17E;Ć?Ĺ?Ä&#x161;Ä&#x17E;ĹśÄ?Ä&#x17E; Ĺ?ĹśÄ?ĹŻĆľÄ&#x161;Ĺ?ĹśĹ? ĎŻ Ä?Ä&#x201A;Ć&#x152; Ä&#x201A;Ä?Ä?ŽžžŽÄ&#x161;Ä&#x201A;Ć&#x;ŽŜ Ä&#x201A;ĹśÄ&#x161;Ä&#x201A;Ć?Ć&#x2030;Ä&#x201A;Ä?Ĺ?ŽƾĆ?ĹŻÄ&#x17E;Ç&#x20AC;Ä&#x17E;ĹŻÄ?Ä&#x201A;Ä?ĹŹÇ&#x2021;Ä&#x201A;Ć&#x152;Ä&#x161;Í&#x2022;Ć&#x161;Ĺ&#x161;Ĺ?Ć?Ć&#x2030;Ć&#x152;Ĺ?Ç&#x20AC;Ä&#x201A;Ć&#x161;Ä&#x17E;Ĺ˝Ä&#x201A;Ć?Ĺ?Ć?Ĺ?ĹśÄ&#x201A; Ć?ĆľĆ&#x2030;Ä&#x17E;Ć&#x152;Ä?ĹŻĹ˝Ä?Ä&#x201A;Ć&#x;ŽŜÇ Ĺ?ĹŻĹŻĆ?ĆľĆ&#x152;Ć&#x2030;Ć&#x152;Ĺ?Ć?Ä&#x17E;Ç&#x2021;ŽƾÍ&#x2DC;Í&#x2DC;Í&#x2DC;DĆľĆ?Ć&#x161;^Ä&#x17E;Ä&#x17E;Í&#x160;Í&#x160; ^Ä&#x201A;Ć&#x152;Ä&#x201A;Ĺ&#x161;:Ĺ˝Ĺ&#x161;ĹśĆ?ŽŜĎŹĎ°Ď­ĎľϴϹϭώώϲ ĎŽ

dĆ&#x152;Ä&#x17E;Ä&#x17E;Ć&#x161;Ĺ˝Ć&#x2030;^Ä&#x201A;ĹśÄ?Ć&#x161;ĆľÄ&#x201A;Ć&#x152;Ç&#x2021;ϳϲϏž 

ΨϹϯϹÍ&#x2022;ĎŹĎŹĎŹ

dĹ&#x161;Ĺ?Ć?Ĺ˝Ć&#x2030;Ć&#x2030;Ĺ˝Ć&#x152;Ć&#x161;ƾŜĹ?Ć&#x161;Ç&#x2021;Ć&#x161;Ĺ˝Ć?Ä&#x17E;Ä?ĆľĆ&#x152;Ä&#x17E;Ä&#x201A;ƾŜĹ?Ć&#x2039;ĆľÄ&#x17E;Ĺ&#x161;ŽžÄ&#x17E;Ĺ?ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;Ä&#x17E;ĹśÇ&#x20AC;Ĺ?Ä&#x201A;Ͳ Ä?ĹŻÄ&#x17E;ZĹ˝Ć?Ä&#x17E;žŽƾŜĆ&#x161;ĹŻĹ˝Ä?Ä&#x201A;Ć&#x;ŽŜĹ?Ć?ŽŜÄ&#x17E;Ć&#x161;Ĺ˝Ĺ?Ć&#x152;Ä&#x201A;Ä?Ç Ĺ?Ć&#x161;Ĺ&#x161;Ä?Ĺ˝Ć&#x161;Ĺ&#x161;Ĺ&#x161;Ä&#x201A;ĹśÄ&#x161;Ć?Í&#x2DC; &Ä&#x17E;Ä&#x201A;Ć&#x161;ĆľĆ&#x152;Ä&#x17E;Ć? Ĺ?ĹśÄ?ĹŻĆľÄ&#x161;Ä&#x17E; Ď° ĹŻÄ&#x201A;Ć&#x152;Ĺ?Ä&#x17E; Ä?Ä&#x17E;Ä&#x161;Ć&#x152;ŽŽžĆ?Í&#x2022; Ä&#x17E;ĹŻÄ&#x17E;Ĺ?Ä&#x201A;ĹśĆ&#x161; ĹľÄ&#x201A;Ć&#x152;Ä?ĹŻÄ&#x17E; ĹŻĹ?ĹśÄ&#x17E;Ä&#x161;Ä?Ä&#x201A;Ć&#x161;Ĺ&#x161;Ć&#x152;ŽŽžĆ?Í&#x2022;Ć?Ć&#x2030;Ä&#x201A;Ä?Ĺ?ŽƾĆ?ĹŹĹ?Ć&#x161;Ä?Ĺ&#x161;Ä&#x17E;ĹśÇ Ĺ?Ć&#x161;Ĺ&#x161; Ĺ?Ć&#x152;Ä&#x201A;ĹśĹ?Ć&#x161;Ä&#x17E;Ä?Ä&#x17E;ĹśÄ?Ĺ&#x161; Ć&#x161;Ĺ˝Ć&#x2030;Ć?Í&#x2022;Ĺ˝Ć&#x2030;Ä&#x17E;ĹśĆ&#x2030;ĹŻÄ&#x201A;ŜůĹ?Ç&#x20AC;Ĺ?ĹśĹ?Í&#x2022;Ĺ&#x161;ĆľĹ?Ä&#x17E;Ç&#x20AC;Ä&#x17E;Ć&#x152;Ä&#x201A;ĹśÄ&#x161;Ä&#x201A;Ĺ&#x161;Ĺ˝Ç&#x20AC;Ä&#x17E;Ć&#x152;ůŽŽŏĹ?ĹśĹ?Ć&#x161;Ć&#x152;Ä&#x17E;Ä&#x17E; Ć&#x161;Ĺ˝Ć&#x2030;Ć?Í&#x2022;Ä?Ĺ˝Ç&#x152;Ç&#x2021;ÄŽĆ&#x152;Ä&#x17E;Ć&#x2030;ĹŻÄ&#x201A;Ä?Ä&#x17E;Í&#x2022;Ĺ?ĹŻĹ˝Ç Ĺ?ĹśĹ?Ç&#x2021;Ć&#x2030;Ć&#x152;ĆľĆ?Ć&#x2030;Ĺ?ĹśÄ&#x17E;Ĺ&#x2021;ŽŽĆ&#x152;Ć?Í&#x2022;>h'Í&#x2DC; ^Ä&#x201A;Ć&#x152;Ä&#x201A;Ĺ&#x161;:Ĺ˝Ĺ&#x161;ĹśĆ?ŽŜĎŹĎ°Ď­ĎľϴϹϭώώϲ

;0=35>AB0;4

tŽŽžÄ?Ç&#x2021;Ä&#x17E;ϭϯϰϏžώ

ΨώϴϹÍ&#x2022;ĎŹĎŹĎŹ

dĹ&#x161;Ĺ?Ć? Ä&#x161;Ä&#x17E;ĹŻĹ?Ĺ?Ĺ&#x161;Ć&#x17E;ƾů Ä?ĹŻĹ˝Ä?ĹŹ ŽĨ ĹŻÄ&#x201A;ĹśÄ&#x161; Ĺ&#x161;Ä&#x201A;Ć? Ć&#x161;Ĺ&#x161;Ä&#x17E; Ć&#x2030;Ć&#x152;Ĺ?Ç&#x20AC;Ä&#x201A;Ä?Ç&#x2021; Ć&#x2030;Ć&#x152;Ĺ˝Ç&#x20AC;Ĺ?Ä&#x161;Ä&#x17E;Ä&#x161; Ç Ĺ?Ć&#x161;Ĺ&#x161;Ä&#x201A;Ć&#x2030;Ć&#x2030;Ć&#x152;Ĺ˝Ç&#x2020;Ĺ?ĹľÄ&#x201A;Ć&#x161;Ä&#x17E;ĹŻÇ&#x2021;ϭϯϰϏžώĆ&#x161;Ĺ˝Ć&#x2030;ĹŻÄ&#x201A;Ç&#x2021;Ç Ĺ?Ć&#x161;Ĺ&#x161;Í&#x2DC;tĹ?Ć&#x161;Ĺ&#x161;Ĺ?ĹśÇ Ä&#x201A;ůŏͲ Ĺ?ĹśĹ? Ä&#x161;Ĺ?Ć?Ć&#x161;Ä&#x201A;ĹśÄ?Ä&#x17E; ŽĨ Ć&#x161;Ĺ&#x161;Ä&#x17E; tŽŽžÄ?Ç&#x2021;Ä&#x17E; Ć&#x161;Ĺ˝Ç ĹśĆ?Ĺ&#x161;Ĺ?Ć&#x2030; Ä&#x201A;ĹśÄ&#x161; Ç Ĺ?Ć&#x161;Ĺ&#x161; ŜŽ Ä?Ĺ˝Ç&#x20AC;Ä&#x17E;ĹśÄ&#x201A;ĹśĆ&#x161;Ć?Í&#x2022;Ć&#x161;Ĺ&#x161;Ä&#x17E;ŽŜůÇ&#x2021;ĹŻĹ?ĹľĹ?Ć&#x161;Ä&#x201A;Ć&#x;ŽŜĹ?Ć?Ç&#x2021;ŽƾĆ&#x152;Ĺ?ĹľÄ&#x201A;Ĺ?Ĺ?ĹśÄ&#x201A;Ć&#x;ŽŜÍ&#x2DC; ^Ä&#x201A;Ć&#x152;Ä&#x201A;Ĺ&#x161;:Ĺ˝Ĺ&#x161;ĹśĆ?ŽŜĎŹĎ°Ď­ĎľϴϹϭώώϲ

ĹŻĹ?ĹŻĹ?ϯϏϯϏžώ

ΨϭϾϾÍ&#x2022;ĎŹĎŹĎŹ

^Ä&#x17E;Ä?ĆľĆ&#x152;Ä&#x17E;ϯϏϯϏžώŽĨĹ��Ä&#x201A;ĹśÄ&#x161;Ĺ?ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;ĹŻĹ˝Ç&#x20AC;Ä&#x17E;ĹŻÇ&#x2021;ĹŻĹ?ĹŻĹ?Ä&#x201A;Ć&#x152;Ä&#x17E;Ä&#x201A;Ä&#x201A;ĹśÄ&#x161;Ä?ĆľĹ?ĹŻÄ&#x161; Ç&#x2021;ŽƾĆ&#x152;Ä&#x161;Ć&#x152;Ä&#x17E;Ä&#x201A;ĹľĹ&#x161;ŽžÄ&#x17E;Í&#x2DC;ĹŻÄ&#x17E;Ç&#x20AC;Ä&#x201A;Ć&#x161;Ä&#x17E;Ä&#x161;Ä&#x201A;ĹśÄ&#x161;Ĺ˝Ç&#x20AC;Ä&#x17E;Ć&#x152;ůŽŽŏĹ?ĹśĹ?Ć&#x161;Ĺ&#x161;Ä&#x17E;WÄ&#x201A;Ć&#x152;ŏͲ ĹŻÄ&#x201A;ĹŹÄ&#x17E;Ć?Ć?Ć&#x161;Ä&#x201A;Ć&#x161;Ä&#x17E;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ć&#x2030;Ć&#x152;Ĺ˝Ç&#x2020;Ĺ?ĹľĹ?Ć&#x161;Ç&#x2021;Ć&#x161;Ĺ˝Ä&#x201A;ĹŻĹŻĆ&#x161;Ĺ&#x161;Ä&#x17E;Ĺ?Ć&#x152;Ä&#x17E;Ä&#x201A;Ć&#x161;Ć&#x161;Ĺ&#x161;Ĺ?ĹśĹ?Ć?Ć&#x161;Ĺ&#x161;Ä&#x17E;^ƾŜͲ Ć?Ĺ&#x161;Ĺ?ĹśÄ&#x17E;Ĺ˝Ä&#x201A;Ć?Ć&#x161;Ĺ&#x161;Ä&#x201A;Ć?Ć&#x161;Ĺ˝ŽčÄ&#x17E;Ć&#x152;Ĺ?Ĺ?Ç&#x20AC;Ä&#x17E;Ć?Ć&#x161;Ĺ&#x161;Ĺ?Ć?Ä?ĹŻĹ˝Ä?ĹŹÄ&#x201A;ĹśÄ&#x201A;Ä&#x161;Ç&#x20AC;Ä&#x201A;ĹśĆ&#x161;Ä&#x201A;Ĺ?Ä&#x17E;Í&#x2DC; Ć&#x152;Ä&#x201A;Ĺ?Ĺ?Î&#x2DC;ĹśĹ?Ć&#x161;Ä&#x201A;,Ä&#x201A;ĹśĹ?Ä?Ä&#x17E;ĹŹĎŹĎ°Ď°Ď´ϴϲϲĎ°ĎŹĎł ĎŽ

Ĺ˝Ä&#x17E;Ć?Ć&#x152;Ä&#x17E;Ä&#x17E;ĹŹϾϹϯž 

ĹśĹ˝Ç ΨϭϳϾÍ&#x2022;ĎŹĎŹĎŹ

dĆľÄ?ĹŹÄ&#x17E;Ä&#x161;Ä&#x201A;Ć&#x161;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ä&#x17E;ĹśÄ&#x161;ŽĨÄ&#x201A;Ä?ƾůͲÄ&#x161;Ä&#x17E;ͲĆ?Ä&#x201A;Ä?Ć&#x161;Ĺ&#x161;Ĺ?Ć?ϾϹϯžώÄ?ĹŻĹ˝Ä?ĹŹŽĨ ĹŻÄ&#x201A;ĹśÄ&#x161;Ĺ?ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;Ä?ĹŻĆľÄ&#x17E;Ä?Ĺ&#x161;Ĺ?Ć&#x2030;Ä&#x17E;Ć?Ć&#x161;Ä&#x201A;Ć&#x161;Ä&#x17E;ŽĨEĹ˝Ć&#x152;Ć&#x161;Ĺ&#x161;Ć&#x152;Ĺ?Ä&#x161;Ĺ?Ä&#x17E;Ĺ&#x161;Ä&#x201A;Ć?Ĺ&#x161;Ä&#x201A;Ä&#x161;Ä&#x201A;Ć?ĆľÄ?Ͳ Ć?Ć&#x161;Ä&#x201A;ĹśĆ&#x;Ä&#x201A;ĹŻ Ć&#x2030;Ć&#x152;Ĺ?Ä?Ä&#x17E; Ä&#x161;Ć&#x152;Ĺ˝Ć&#x2030;Í&#x2DC;  tĹ?Ć&#x161;Ĺ&#x161; Ä&#x201A;Ĺś ŽƾĆ&#x161;ůŽŽŏ Ĺ˝Ç&#x20AC;Ä&#x17E;Ć&#x152; Ä&#x161;Ä&#x17E;Ć?Ĺ?Ĺ?ĹśÄ&#x201A;Ć&#x161;Ä&#x17E;Ä&#x161; Ć&#x2030;Ä&#x201A;Ć&#x152;ĹŹĹŻÄ&#x201A;ĹśÄ&#x161;Ä&#x201A;ĹśÄ&#x161;Ć&#x2030;ĹŻÄ&#x17E;ĹśĆ&#x161;Ç&#x2021;ŽĨĆ&#x152;ŽŽžĨŽĆ&#x152;Ć&#x161;Ĺ&#x161;Ä&#x17E;ĹŹĹ?Ä&#x161;Ć?Í&#x2022;Ć&#x161;Ĺ&#x161;Ĺ?Ć?Ĺ?Ć?Ä&#x201A;Ĺ?Ć&#x152;Ä&#x17E;Ä&#x201A;Ć&#x161; Ĺ˝Ć&#x2030;Ć&#x2030;Ĺ˝Ć&#x152;Ć&#x161;ƾŜĹ?Ć&#x161;Ç&#x2021;Ć&#x161;Ĺ˝Ä?ĆľĹ?ĹŻÄ&#x161;Ç&#x2021;ŽƾĆ&#x152;Ä&#x161;Ć&#x152;Ä&#x17E;Ä&#x201A;ĹľĹ&#x161;ŽžÄ&#x17E;Í&#x2DC; Ć&#x152;Ä&#x201A;Ĺ?Ĺ?Î&#x2DC;ĹśĹ?Ć&#x161;Ä&#x201A;,Ä&#x201A;ĹśĹ?Ä?Ä&#x17E;ĹŹĎŹĎ°Ď°Ď´ϴϲϲĎ°ĎŹĎł

"&7^fPaSBc=P\Q^da $#&%##'!0ePX[PQ[T&SPhb fffcWTX]ca^SdRTabR^\Pd

,163(&7$0²$0²5(3216,7( ³&RHV6HWWOHPHQW´&RHV&UHHN5RDG        

Private villas featuring two bedrooms, air-cond, decks, pool, tennis, low fees. Fantastic managers in place. From $168,000 â&#x20AC;&#x201C; interested?

TM 5445 5811 or 0416 725 336

MOOLOOLABA Canal front 3 brm unit, spacious tiled living, d/washer, courtyard, tandem garage, walk to shops/transport $350pw

2QO\EORFNVOHIWDOOIODW UHDG\WREXLOGRQ 7LWOHLVMXVWDIHZZHHNVDZD\&ORVHWRQHZ VKRSSLQJFHQWUHKRVSLWDOVFKRROV WRZQ7KH HVWDWHLVERXQGHGE\WUHHOLQHGFUHHNV RSHQ SDUNODQG0HHW*DU\RQVLWHLQ2OG'DYH\&RXUW *DU\/DQJIRUG 

,163(&71221 :DUDEL3O1DPERXU 9LHZV EUHH]HV6SDFLRXVHOHYDWHGEHG VHSDUDWHOLYLQJKXJHDOIUHVFRDUHD'/8*

:HQG\7D\ORU  ,163(&71221²30 5REHUWVRQ'U%XUQVLGH           9HU\ODUJH%HGURRPORZVHWEULFNZLWK DGGHGEHQHILWVRI /DUJHRSHQOLYLQJ 5XPSXV 5RRP 2IILFH )RUPDOGLQLQJ )RUPDOOLYLQJ &DVXDOGLQLQJ 8QGHUFRYHURXWGRRUDUHD  $FRQ7KHKRXVHKDVEDWKURRPVGRXEOH ORFNXS EDFNVRQWRFUHHN RSHQSDUNODQG  LVVLWXDWHGLQDFXOGHVDFLQQHZHVWDWH 7KLVKRPHSUHVHQWVDVQHZ *DU\/DQJIRUG 

³+HULWDJH+HLJKWV´PQHJ )DQWDVWLFRSSRUWXQLW\WREX\DFRUQHUEORFN ZLWKYLHZVLQQHZHVWDWHLQ%XUQVLGH%HTXLFN *DU\/DQJIRUG  +LJKODQG+LOO5RDG0DURRFK\5YU %HGURRP%DWKURRP/LYLQJ$UHDV SOXVJDPHVURRP'XDO/LYLQJ3RWHQWLDO 6HWRQòDFUHV$YHU\GHVLUDEOHKRPH /RXLVH*DUGLQHU  

:HQWZRUWK&W%XUQVLGHIURP QHZKRXVHVXQGHUFRQVWUXFWLRQVROG &ORVHWRWRZQKRVSLWDO VFKRROV &DOOIRUSODQV GHWDLOV²IXOO\IHDWXUHGKRPHV /HQ*HDU\

 6DYLOOHV5RDG+LJKZRUWK 6SDFLRXVEHGURRPHQVXLWHELJIRUPDO ORXQJHGLQLQJ6HSDUDWHIDPLO\URRPRII NLWFKHQFRQQHFWHGWRDP[PFRYHUHG WLPEHUGHFNRYHUORRNLQJWKHYLHZV'/8* ,DQ%ODFN

UNITS

Houses for Sale

MAROOCHYDORE Centrally located modern 2 brm unit with views overlooking golf course, huge exclusive use balcony, resort facilities, security parking $380pw

REALTY 5441 2511

MOOLOOLABA Spacious 3 bedroom, 2 level unit, balcony off living, large parents retreat upstairs with ensuite & balcony with views to Noosa, pool, sgl garage, walk to beaches & shops $400pw

We have been here nearly 30 years and have helped over 10,000 people buy and sell.

NAMBOUR

$269,000

Calling tradespeople and those who want space. Huge shade trees create magniďŹ cent setting for this Queensland workers cottage on a huge 1,138 m2 lot. This is a development site with great exposure within walking distance of shopping in Nambour.

NAMBOUR

Looking for an award winning Rental Manager who will maximise your investment & ease the worries?

$322,000

Strong hardwood mid-century home on high side of quiet street in prime Nambour development area. Great block roomy house, easy removal. All the options are yours!

NAMBOUR

Ă&#x160;UĂ&#x160; Ă?ÂŤiĂ&#x20AC;Â&#x2C6;iÂ&#x2DC;Vi`Ă&#x160;EĂ&#x160;vĂ&#x20AC;Â&#x2C6;iÂ&#x2DC;`Â?Ă&#x17E;Ă&#x160;Ă&#x192;Ă&#x152;>vv Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;UĂ&#x160; Â&#x153;Â&#x201C;ÂŤiĂ&#x152;Â&#x2C6;Ă&#x152;Â&#x2C6;Ă&#x203A;iĂ&#x160;Ă&#x20AC;>Ă&#x152;iĂ&#x192;

$345,000

Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;UĂ&#x160;/Â&#x2C6;Â&#x201C;iÂ?Ă&#x17E;Ă&#x160;`Â&#x2C6;Ă&#x192;LĂ&#x2022;Ă&#x20AC;Ă&#x192;>Â?Ă&#x192;

Lovingly restored cottage style home in peaceful elevated setting this 3 bedroom home oozes character. Polished ďŹ&#x201A;oors, outdoor partly covered deck and spacious yard. Spare shower and extra room plus storage underneath. Carport. Walk to shops.

NAMBOUR

Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;UĂ&#x160;,i}Ă&#x2022;Â?>Ă&#x20AC;Ă&#x160; Â&#x153;Â&#x201C;Â&#x201C;Ă&#x2022;Â&#x2DC;Â&#x2C6;V>Ă&#x152;Â&#x2C6;Â&#x153;Â&#x2DC; Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;UĂ&#x160;+Ă&#x2022;>Ă&#x20AC;Ă&#x152;iĂ&#x20AC;Â?Ă&#x17E;Ă&#x160;Â&#x2C6;Â&#x2DC;Ă&#x192;ÂŤiVĂ&#x152;Â&#x2C6;Â&#x153;Â&#x2DC;Ă&#x192; Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;UĂ&#x160;/Â&#x2026;Â&#x153;Ă&#x20AC;Â&#x153;Ă&#x2022;}Â&#x2026;Ă&#x160;Ă&#x152;iÂ&#x2DC;>Â&#x2DC;Ă&#x152;Ă&#x160;Ă&#x192;VĂ&#x20AC;iiÂ&#x2DC;Â&#x2C6;Â&#x2DC;}

$355,000

Three bedroom home with huge usable double frontage 1,543m2 yard. Encompassing picturesque creek. Bush outlook. Outdoor deck for entertaining. Single garage. Quiet location in town.

NAMBOUR

Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;UĂ&#x160;Ă&#x201C;{Ă&#x160;Â&#x2026;Â&#x153;Ă&#x2022;Ă&#x20AC;Ă&#x160;>VViĂ&#x192;Ă&#x192;Ă&#x160;Ă&#x152;Â&#x153;Ă&#x160;Ă&#x17E;Â&#x153;Ă&#x2022;Ă&#x20AC;Ă&#x160;>VVÂ&#x153;Ă&#x2022;Â&#x2DC;Ă&#x152;

5444 0800

$395,000

Huge Queenslander. Feel the Character here with potential plus. Four bedrooms, two lounge areas, huge kitchen, intimate verandah off the main bedroom. Back deck. Views to the ranges. Double block.

RURAL SPECIALS MAROOCHY RIVER

$449,000

Privacy assured and stunning ocean views. Three bedroom brick home with separate one bedroom cabin. Less than 10 minutes to coast and Maroochy River.

HUNCHY

$569,000

+286(6

Situated a short drive to town this home boasts 3 brm & study, 2 toilets, cathedral ceilings, open plan, polished ďŹ&#x201A;oors, rumpus, 4 bay garage shed, approx 10m pebble pool and dam. On over 2 private elevated acres.

HUNCHY

0DURRFK\GRUHEHGEDWKVLQJOHJDUDJH :XUWXOODEHGEDWK'/8*EHDFKVLGH

$750,000

Wind down the driveway past the expanse of lawn via the picturesque dam to the ranch style brick home. The kitchen has recently had a complete makeover with granite benches and quality appliances. Everything is strategically positioned to ďŹ&#x201A;ow to the double living areas and undercover outdoor entertaining area.

0DURRFK\GRUHEHGEDWKODUJH\DUG 0DURRFK\GRUHEHGEDWKGOXJSRRO %XGHULPEHGEDWKGXFWHGDLUFHQWUDO &XUULPXQGLEHGEDWKPHGLDGOXJ

:DUDQDEHGEDWKVHSDUDWHOLYLQJRSHQ SODQUHQRYDWHGGOXJRSSRVLWHEHDFK 

 

)DLUPHDGRZ5G1DPERXU1HJ ,QYHVWRUV7DNH1RWH0Ă°]RQHGPL[HG KRXVLQJEHGSROLVKHGIORRUV%(48,&. /RXLVH*DUGLQHU  

1DPERXU0ÂśWRQ5G.XUHHOSD 6XSHUEO\SULFHG4XHHQVODQGHU%ULQJWKH KRUVHVWUDQTXLODFUHVZLWKIRUHVWEDFNGURS /HQ*HDU\

%XGHULPEHGEDWKGOXJSRRO

REALTY 5441 2511 Properties on this page are just a sample! For the largest range of exclusively listed properties in Nambour and district check out www.keylinerealty.com

0LQ\DPDEHGEDWKZDWHUIURQWKRPH SRRODLUFRQGLWLRQHGOLYLQJ'/8*

81,76

Cnr Howard & Queen Sts, Nambour This business is independently owned and operated by Glamoren Pty Ltd A.B.N. 93 679 422 703

0DURRFK\GRUHEHGEDWKVLQJOHJDUDJH  %XGGLQDEHGEDWKVLQJOHJDUDJH



7XUQEHUU\&W1DPERXU )DPLO\IULHQGO\VSDFH FRPIRUWOLYLQJURRPV ZLWKDF+XJHFRYHUHGSDWLREHGURRPVHV ZDONLQUREHDF'EOHJDUDJHZLWKLQWHUQDO DFFHVV)XOO\IHQFHGZLWKHDV\FDUHJDUGHQ ,DQ%ODFN 

 

 

&XUULH6WUHHW1$0%2853K ZZZGD\DQGJULPHVFRP



Land



:XUWXOODEHGEDWKVLQJOHJDUDJHSRRO 0DURRFK\GRUHEHGWKRXVHEDWKVOXJ

7+(/$1'6+23FRPDX :RUNLQJZLWK\RXWRILQGWKD GUHDPEORFN&DOOXV /DQG6KRS

%XGHULPEHGEDWKFDUYLHZV



%XGHULPEHGEDWKFDUFHQWUDO



%XGHULPEHGEDWKFDUJUHDWYLHZV 



3KRQH ZZZNHQJX\PDURRFK\GRUHFRPDX

My Property Review | September 4, 2009 61

Page 61.indd 1

9/1/2009 3:24:57 PM


rentals NAMBOUR & HINTERLAND RENTALS

Our Knowledge is your Property BUDERIM $400 3 bedroom, 1 bathroom fully renovated home. Split level living. Open plan lounge/dining. Fans through-out. Double carport. Great location. AVAILABLE: NOW BUDERIM $350 Newly renovated 3 bedroom, 2 bathroom family home. Open plan lounge/dining with high ceilings. Walking distance to Buderim township. Fully fenced. Double carport. AVAILABLE: NOW WURTULLA $400 4 bedroom, 1 bathroom (2 way) family home. Master with walk in robe. Tiles through-out. Fully fenced back yard with spa and side access. Great location. AVAILABLE: NOW KULUIN $335 2 bedroom, 1 bathroom air-conditioned home. Modern kitchen & bathroom. Polished floors through-out. Large undercover deck, single garage plus undercover carport. Close to all amenities. AVAILABLE: NOW KULUIN $360 Neat and tidy. 3 generous size bedrooms. 1 bathroom. Balcony off lounge. Swimming pool. Close to Buderim and Maroochydore. AVAILABLE: 23/09/09

FOR RENT

Kawana Forest - This beauty features 4 bedrooms, 2 bathrooms including ensuite, quality fittings throughout home, single lock up garage with remote and a garden shed and is fully fenced. Close to shops, schools, parks and numerous family friendly walkways. What more can you ask for!!?? Pets on application. Avail 01/10/09 $365.

Cotton Tree - 2 bed, 2 bath unit with spectacular ocean views, located on 3rd floor with 3 balconies, very nicely renovated, reverse cycle air con, heated pool & spa, tennis court & Pay TV. Avail NOW $350.

ALEXANDRA HEADLAND $400 Fully furnished 3 brm ensuite ground floor unit DLU secure complex DLU BOKARINA $350 3 brm home, 1 bath, single l/up, fans, sec screens, entertainment area, shed, nice outlook avail now BUDERIM $320 2 bedroom U/F unit SLU partly renovated new kitchen stunning coastal views BUDERIM $520 Stunning 4 brm ensuite home DLU 2 living areas fantastic deck with ocean views COTTON TREE $340 2 brm partly renovated unit air cond in living facing north with views of Maroochy River & Mt Coolum avail now MOOLOOLABA $750 Executive modern beautifully furnished unit DLU and separate locked storage, with views of the marina, complex has pool, gym and sauna. Walk to beach, shops & restaurants. MOOLOOLABA $400 4 bedroom U/F home end DLU large fenced yard located in Mountain Creek school zone MOOLOOLABA $390 Recently reno home, private 3 bed, 1 bath, dbl carport, timber deck fenced yard, close to all amenities avail now MOOLOOLABA $330 Tidy 3 level townhouse, 2 bed, 1 bath, single l/up, new carpet & paint MOOLOOLABA $255 2 bedroom U/F unit with balcony central Mooloolaba close to beach shops & school quiet complex WARANA $360 3 bedroom U/F recently renovated home SLU 1 bath close to shops transport & beach

Tel: 07 5445 2777

Mountain Creek $365p/w As new townhouse in gated complex. 3 bedrooms, 2 bathrooms + powder room. Air conditioned, double remote garage. Inspect now. Mooloolaba $300p/w Canal front 2 bedroom units. Within walking distance of the beach. Available now. Minyama $495p/w 3 bedroom, 2 bathroom deep waterfront home with pontoon. Open plan living, undercover entertaining plus waterfront deck.

What are you looking for in a Property Manager? Experience  Maturity Professionalism  Communication If you would like to know more about what we can offer you, please contact Rachel & Annette on 5478 3788 or 0407 006 748 to discuss your management options.

 

Warana - Centrally located and close to shops beach and school this home will rent quickly. Includes, new kitchen, bathroom, air conditioning and freshly painted. Just move in and enjoy. It has side access, great yard, and single lock up garage with auto door. fully fenced Avail NOW $360.

BURNSIDE $410 per week 3 bedroom home, open plan lounge and dining, modern kitchen with dishwasher, ceiling fans, security screens, ensuite, entertainers deck. COTTON TREE $550 per week Immaculate 2 bedroom plus media room unit, separate office, ensuite, 2 large balconies, pool spa & gym in complex, two cars secure parking. MAROOCHY RIVER $400 per week 3 bedrooms + rumpus, on the canal, modern kitchen, dishwasher, entertaining patio, open plan lounge and dining area, lovely backyard with timber deck. NAMBOUR $320 per week 3 bedroom home, open plan lounge and dining area, air conditioner, security screens, carport, and great yard for the kids to play. NAMBOUR $340 per week First weeks rent free! New 3 bedrooms, 2 bathroom townhouse, walking distance to Nambour CBD, ensuite, open plan lounge, dining & kitchen area, dishwasher, air conditioner, remote lock up garage. NAMBOUR $355 per week Modern townhouse, 2 bedrooms plus study and ensuite, private courtyard, air conditioner, dishwasher, dryer, security and ceiling fans.

NAMBOUR $400 per week Brand new large family home. 4 bedrooms, ensuite, large kitchen, dining and living area, separate media/lounge room, DLUG and ceiling fans.

Carolans

waterfront & coastal property Cnr Parkyn Pde & River Esp. Mooloolaba Ph (07) 5444 6400 www.waterfrontcoastal.com.au

www.colliers.com/sunshinecoast

FIRST NATIONAL REAL ESTATE

Ph: 5441 1344 www.carolans.net

Jump the rent queue

rentals

rentals

Maroochydore

CALOUNDRA

FIRST NATIONAL REAL ESTATE Buderim - Very neat & tidy 4 brm, 2 bath family home, multiple living areas + separate study, large kitchen, outside entertaining area, DLUG Avail NOW $420.

Open For Inspections Sat, 5th Sept

MAROOCHYDORE Two brm ground floor unit, 1 bath, large lounge area, carport, close to Maroochydore CBD ......................... $260pw

SIPPY DOWNS - Lots of charm! 3 bdrms, ensuite, open plan, carport, fully fenced. $350 p/w SIPPY DOWNS - Great price! 3 bdrms, ensuite, 2 living areas, good sized family yard, fans, under cover area, DLUG. $350 p/w SIPPY DOWNS - 3 bdrms. Furnished/unfurnished. $360 p/w SIPPY DOWNS - 4 bdrm home, 2 living areas, outdoor entertaining, fully fenced backyard. Fresh paint! DLUG. $370 p/w SIPPY DOWNS - New! 4 bdrms, open plan, modern kitchen, undercover area, DLUG, quite cul-de-sac location. $390 p/w SIPPY DOWNS - 4 good sized bdrms w fans, ensuite, separate living areas one w air con, centrally located kitchen w lots of space & dishwasher. $420 p/w SIPPY DOWNS - Just gorgeous!! Beautiful Queenslander! Polished timber floors, 4 bdrms, gorgeous kitchen, 2 very large living areas, views of the Glasshouse Mountains. $460 p/w BUDERIM - Fresh! New! 2 & 3 bdrm modern executive units. Air-con, d/washer, SLUG & outdoor area + extra storage available. Great location! 2 WEEKS RENT FREE! From $360 p/w BUDERIM - Neat & tidy, large living area, great sized rooms, air con, d/washer, fans. Covered outdoor area, DLUG. $360 p/w BUDERIM - Modern 3 bdrm home, intercom, electric gate, air con, covered courtyard. Close to heart of Buderim. $390 p/w

MAROOCHYDORE Two bedroom newly renovated first floor unit, combined lounge/ dining, single lock up, walking distance to Plaza ............................................... $285pw

Buderim - 4 bed, 2 bath, family home, 2 stories with amazing ocean views , large living areas, light & bright, very quite street DLUG, close to Buderim CBD Avail NOW $480.

MAROOCHYDORE Private triplex townhouse, 3 bedrooms, 1 bathroom + extra W.C d/stairs, courtyard, single lock up ................. $320pw MAROOCHYDORE Luxury 3 bedroom townhouse, ensuite, open plan living, courtyard, double lock up with remote, close to Maroochydore CBD .................... $350pw MAROOCHYDORE Modern 3 bedroom townhouse, 2 baths, courtyard, double lock up garage with remote ................... $370pw

Buddina - Positioned across from the Buddina Surf Club, walking distance to Shops, Tennis Courts & beach, this prestigious modern styled Penthouse has it all! 2 bed, 1 bath, onsite pool, secure underground parking. Unit had security screens , also new pergola on roof top &new carpet. Open living with ocean breezes, polished floors, designer kitchen, stainless steel appliances & dishwasher, balcony & private access to the roof top area which is for the exclusive use of the penthouse. Avail NOW $350 Buderim - 4 bedroom, 2 bath, family home in a quite bushland setting, open living double carport, potential dual living, pets on application. Avail NOW $350

MAROOCHYDORE Two bedroom apartment close to beach, one bath, spacious lounge/ dining, balcony, d/w, single lock up, pool in complex. Furn or Unfurn ................. $300pw MAROOCHYDORE Three bedroom townhouse, ensuite, single lock up + extra car space, walking distance to Maroochydore CBD ................................................ $360pw

Reader’s index

ĂůůϬϳϱϰϳϲϱϱϴϴƚŽĚĂLJ͘͘͘

Phone 5409 9900 For a full rental list visit www.mfnre.com.au

SLUG – single lock up garage

DLUG – double lock up garage

3/14 Warne Tce, Kings Beach – F/F 2 bed, 1 bath unit w SLUG. $270 p/w. Viewing Time: 1.05pm 3/13 Merrima Ave, Kings Beach – 3 bed, 1 bath unit w SLUG. $300 p/w. FIRST WEEKS RENT FREE! Viewing Time: 1.25pm Please contact our office on the day of the viewings, before 11.00am in order to check properties availability.

Other Available Rental Properties: 1/41 Albert St, Kings Beach – F/F 2 bed, 1 bath unit w SLUG. $260 p/w. 17/35 Maltman St, Kings Beach – F/F 2 bed, 2 bath unit w tandem garage. $360 p/w. 13 Saffron Dr, Currimundi – 3 bed, 2 bath home w DLUG. TNT to pay excess water. $370 p/w – Includes monthly garden maintenance. 13 Nothling St, Moffat Beach – 3 bed + study, 2 bath home w off street parking. $420 p/w. 904/38 Mahogany Dr, Pelican Waters – F/F 2 bed, 2 bath unit w SLUG. $435 p/w. 5 Grace Crt, Pelican Waters – 3 bed + study, 2 bath home w DLUG. TNT to pay excess water. $480 p/w. 12 Heath Crt, Little Mountain – 4 bed + study, 2 bath home w DLUG & pool. $500 p/w – Includes garden/pool maintenance.

   

BUDERIM Three bedroom A frame house, separate lounge & dining, one bath, large yard, carport ................................... $300pw

5452 4545

www.remaxproperty.com.au

    

2/10 Bombala Tce, Caloundra – 2 storey, 2 bed, 2 ½ bath duplex w SLUG. TNT to pay excess water. $315 p/w. Viewing Time: 12.45pm

9 Annabelle St, Pelican Waters – 5 bed + study, 2 bath home w DLUG. POA. $560 p/w.

Buderim Chancellor Park Sippy Downs Mountain Creek

U/C – undercover parking

brm – bedroom

Please contact Henzells Permanent Rentals Department 5491 2000 or rentals@henzells.com.au for more information regarding all of our available rental properties.

d/w - dishwasher

f/f – fully furnished

u/f - unfurnished

62 My Property Review | September 4, 2009

Page 62.indd 1

2/09/2009 12:01:07 PM


Beautiful barriers How to choose the best fence for your home

Compact & functional Morcraft Mo orcraft Homes’’ newest display for s small blocks

Country style Inject yo your our int interiors teriors w with some charming pieces

“œÀiÊ̅>˜Ê

meets

̅iÊeye...

Homes from $139,500 House/Land Packages starting at $356,200 New display now open in Sippy Downs

Since 1985 1800 806 473 Display homes at: UÊ-**9Ê "7 -ÊUÊ* ,  Ê-*, -ÊUÊ*   Ê7/ ,-ÊUÊ ,   Ê "7 -ÊUÊ9*

www.dqh.com.au My Property Review | September 4, 2009 63

Page 63.indd 1

2/09/2009 11:25:09 AM


DIY m.au

home@mypropertyreview.co

Q

Hi Todd, Dave and Jade. We want to do something with our land – we’re on a few acres and there’s a dam close to our house – and I was wondering how we could use it as an outdoor entertaining kind of space or for something for the kids. Do you have any ideas of what we could do to link it with the house? Ben, Palmwoods

Ja ade

Todd

Dave

From DIY blunders to hints and advice, let Jade, Todd and Dave solve your home project queries before things go horribly wrong. Jade: Depending on the distance between the house and the dam (and your budget), you could easily link it with a series of boardwalks. If you’re a green thumb you could plant some natives alongside, throw in some solar garden lights to light the way and then extend the boardwalk to create a deck out over the dam’s edge. This would be an ideal place for th the kids to fish, and would be a serene location to entertain guests. gues You could go one step ste further and create ah halfway point between the th house and the dam where wh the boardwalk veers veer off to a freestanding Balinese-style Balin pavilion. Install Insta a wood-fire pizza oven o or barbecue and you have the ultimate waterside entertaining pad come hail, entertain rain or shine. s

photo: greg gardner

Dave: Hey Benny Boy, my brother in the hood. The house that sings in Palmwoods has three P

dams along its fence line, which belong to our neighbours, and it scares the bejesus out of me to think that if two-and-a-half-year-old Summer ever works her way out of her leg irons she may go wandering into one. It’s hard to work out where some of them start with all the reeds and muck on top, so fencing it will give you, and me, some peace of mind. Now back to your question of how do you link it with the house. With a bloody great big cable, Benny, that’s how. Erect a flying fox. They’re sexier than Megan Fox. Nothing gets a kid outdoors quicker than the flying fox into water combo. Then start practising your father of the year acceptance speech, because you’ve earned it.

and an intricate recycled watering system for the essential ‘water’ part of the slide and boom, Robert’s ya mother’s brother, Benny, you’ve got a MEGASLIDE for the yard. Now I suggest you position the entry right up on the patio so when you open the glass sliding door you can either go right to the barbecue, left for a bit of table tennis action or straight on for the ride of your life! It’ll be on for young and old at your joint, Ben, as your kids and your mates whirl round and tog up for a thrill ride through your backyard, finishing off with a megadrop into the middle of the dam. Genius! All we need now, Benny, is a plan to get the old Wild Mouse rollercoaster from Aussie World and put that up in your yard and we’re laughing! Bewdy Newk.

Todd: Righto, Ben, this is probably the easiest nail bag ever buddy. Long story short, you need a MEGASLIDE. Yep, first up we’ll sort a few parts from the old Thrill Hill Slide of Death at Woombye. Sure it’s old, rusty and unpredictable, but so’s Dawn Fraser and she still kicks butt. We’ll also need a dozen bags of Readymix, some metal poles and stuff

DIY questions solved! Email us your DIY query and if you are chosen you will receive handy (or not-so handy) advice straight from Jade, Dave and Todd. Listen to HOT FM on Friday mornings and have your advice published in MPR. Simply email your entry to: home@ mypropertyreview.com.au to enter. Disclaimer: This information is offered as advice only. Licensed tradesmen should always be consulted. Editor’s note: Dave and Todd’s responses should be considered as entertainment only.

The Best Value For Money Builder in Queensland DISPLAY HOMES

A fence that looks this good... and NEVER needs painting!

Brightwater, 15 Ponytail Circuit 5493 4800 Caboolture, Cnr Branch & Morrow Street 5495 4105 Peregian Springs, 82 Sandhurst Crescent 5448 3022 Gympie, 24 Premier Circuit 5482 5155 Beerwah, 32 Woodgrove Blvd 5494 6988 Hervey Bay, Cnr Boat Habour Dr & Tee Way 4191 4771 Bundaberg, 7 Lomandra Drive 4151 0520 Pialba , 53 Magellan Circuit 4194 0415 MUDJIMBA HEAD OFFICE 679 David Low Way Wide Bay Regional Office, 3 Tee Way

5448 9900 4124 7333 Building and Designing Award Winning Homes Winner:

QMBA Sunshine Coast President’s Award for Design, Innovation and Affordability (Brightwater Display Home)

Winner:

Best Display Home $251,000 - $400,000

Winner:

Best Display Home up to $250,000

(Brightwater Display Home) (Beerwah Display Home)

www.pjburns.com 07 5448 9900 Proudly licensed under the Queensland Building Services Authority Act 1991 Licence No: 1042321

64 My Property Review | September 4, 2009

Page 64.indd 1

2/09/2009 10:47:38 AM


cover story

Fenced in by Jessica Ainscough

Sitting on the fence about choosing an enclosure for your home? We’re here to help. t’s the great Australian dream – your own patch of dirt, with your palace on it, enclosed by a white picket fence. The dream has stayed the same, but fences have moved on. White pickets are now usually seen only around quaint country cottages, and many newer home are framed by much more contemporary fences. Among them, timber, rendered brick, steel, aluminium and glass materials are leading the pack. Here is the lowdown on the latest in fencing.

I

Timber Timber is one of the most popular choices in fencing products. Simon Brady at Ironbark Timber Products says this is because timber is a renewable resource. “It’s grown in plantations and takes much less energy to produce than aluminium or steel-based products,” he says. “Timber gives a very natural look and it’s an inexpensive option for most situations. A treated pine fence with 1.8-metre palings can usually be built for around $65 a metre including materials and labour.” The most common timbers used for fencing are treated pine or treated hardwood, but Simon says many people are also starting to use kiln-dried, decking-quality timber and installing it horizontally rather than vertically.

Steel If you like the look of corrugated iron, Colorbond steel fencing is an aesthetically similar and economical option.

Mac Lamond, managing director of Fencepac at Kunda Park, says Colorbond fencing is his company’s most popular domestic fence. “Colorbond is great because it is guaranteed not to rot, twist, warp, chip or peel,” he says. “Frost [white] river sand [light brown], terrace [beige] and neutral tones are very popular.”

Aluminium Aluminium fencing is great because it’s long-lasting, resistant to corrosion, durable and low maintenance. It’s also easy to install, making it perfect for the DIYer. Grant Symes from Protector Aluminium Fencing says the most popular choice of aluminium fencing is the flat or loop style. “Other common designs include spear and picket top. Rings, crosses and diamonds are available in a range of variations. The four most requested colours are black, primrose, deep ocean and heritage green.” Grant says there are a few things questions you should ask when looking to purchase as aluminium fence. How many welds do your panels have? There should be minimum of six. Is a pool-compliant certificate available on request? What warranty is available by the manufacture? If the block of land is an unusual shape, how difficult, and costly, is it to manufacture a fence to fit?

Render Rendered fences are a great way to carry the style of your home out to your fence, says Mick Alcock from ASM Render. “Render is more durable, more modern

than the standard brick or wooden fence and it can be painted to suit the colour of the existing house.” Opt for rendered brick or, if you’re looking for a cheaper option, check out some contemporary ideas like polystyrene, which provides the street appeal of a rendered fence without having to employ bricklayers.

Glass Glass fencing is a great choice for pool surrounds. Jane Rentoul from The Glass Depot in Kunda Park says glass is great for Sunshine Coast homes because we spend so much time outside. “All new homes are built with entertaining areas and so that you can see the beautiful garden or pool it is better to have glass rather than aluminium or wood,” Jane says. When building your glass fence, you can choose between frameless and semi-frameless styles. Semi-frameless features glass panels in aluminium powder coated posts and frameless is all glass with no posts, just clamps holding the glass at the bottom. “Different styles can be achieved when you have semi-frameless by having different colour posts,” Jane says. “We can get the posts powder coated to whatever colour you want to mix in with the colour scheme you have chosen for your house.”

Combination Get creative and use a variety of materials to achieve a stylish fence. You can mix things up by combining timber with Colorbond panels, timber with rendered brick pillars, timber with stone features, aluminium with timber slats or aluminium with glass. An expert can give you advice on what suits your home and your lifestyle.

ALL OUR LATEST IDEAS FROM THE COAST’S LEADING BUILDERS The new Living Display Centre at Woodgrove is full of ideas to suit any budget. Experience the beauty of the Glasshouse Mountains and the setting for this community. See your ideal home come to life. - Unique home designs with landscaped gardens - Choose from the best builders in the business - Latest ideas and innovations in interiors - Friendly staff to answer all your questions

Ph: 07 5494 0765

BSTO5322_MPR

Visit us Sat - Wed 10am – 4pm, Woodgrove off Roberts Rd Beerwah.

My Property Review | September 4, 2009 65

Page 65.indd 1

2/09/2009 11:13:23 AM


display home

Straight and narrow This Morcraft Homes property proves that good things come in small packages. he Rhode Island 175 is the latest display offering from Morcraft Homes and was designed to occupy smaller residential allotments. This cleverly crafted design uses the space well to create a very functional and spacious residence. Catering well to the growing family, there are three spacious bedrooms plus two bathrooms and an oversized single garage to cater for narrower blocks. There hasnâ&#x20AC;&#x2122;t been any compromise on quality, with a large gourmet kitchen, raked ceilings and open living zones all featuring in the design. There is plenty of glass throughout to allow for control of light and breeze and the shape of the home takes into consideration the size and dimensions of the block. The Rhode Island 175 oozes street appeal, with an aesthetically pleasing design, decor and roof line.

T

Design: Rhode Island 175 Crafted by: Morcraft Homes 5437 6333 Take a tour: 5 Ponytail Circuit, Brightwater Price: From $195,139 (house only)

Ivadale Lakes CALOUNDRA

66 My Property Review | September 4, 2009

Page 66.indd 1

2/09/2009 9:31:36 AM


display home

Considering Property Investment? At National Rental Solutions we specialise in high grade investment property solutions for savvy investors. RIGHT Now we have brand new properties and packages available that meet the key requirements for successful property investment. Location: Within minutes of Anchor infrastructure, and our beautiful beaches, shops, schools and transport. From the ground up, these are designed to achieve maximum rent, without over capitalising or wasting equity. We can show you how you can save $$$$$ by not paying someone elseâ&#x20AC;&#x2122;s proďŹ t. We have properties available that take advantage of these key features, priced between $389,000 and $449,000. We will even secure your tenant before completion.

Call us for an info pack on 1300 884 379

1300 884 379 nationalbuildingsolutions.com.au My Property Review | September 4, 2009 67

Page 67.indd 1

2/09/2009 9:32:53 AM


trend

Plastic fantastic Live on a rural property? This new fencing material aims to cut back your maintenance duties. iving on a rural property means space, quiet, and the frustration of maintenance. And fences in particular require a lot of upkeep, especially on larger acreages and farms. Traditional rural fences are generally

made from timber, iron or steel, which require constant maintenance and can be harmful to livestock if they run into it or the fence is damaged. As a result, many rural residences are opting for PVC vinyl, a new solution for fencing.

L

OWN YOUR OWN BRICK & TILE MONEY TREE

Les Hanslo from Polvin Fencing Systems says there are many benefits to choosing PVC. “It’s safer for animals, horses in particular,” he says. “It will never need maintenance, termites won’t eat it, there are no sharp edges so cattle and horses won’t be hurt, and it’s flexible so if a horse leans on it, it won’t break. PVC is also guaranteed for 50 years.” Then there are the environmental advantages. No trees are harmed in the making of PVC, and while toxic wood treatments and paints leak chemicals into the ground, environmentallyfriendly PVC won’t affect the land. If you’re thinking about using PVC vinyl fencing, Les advises you check out the quality of it first. “Normally PVC is attacked by UV rays, which makes it brittle,” he says. “You do get cheap imitations, which are made without correct formulation and they can go yellow. Our PVC is made in Australia with a special formula designed to cope with our harsh UV environment.”

Cheap LandOcean Views!

Hinley Apartments: The Best Investment Property Return on the Coast These near new apartments have been purpose designed to be a high returning, low maintence investment property. Architecturally designed to cater for a growing demand in the rental market, it is the future of share living-private, secure and flexible. • 4 Fully Self Contained Rooms, Includes Built in wardrobes, ensuite and coffee bar. • Fully Tenanted. • Quality Finishes and Fittings throughout. • Sunshine Coast growth Hotspot • Walking Distance to Sunshine Plaza and Maroochy river • Fully Furnished

Alex Veal

PRDnationwide Maroochydore M: 0402 808 569 P: 5443 34 99 www.prdnationwide.com.au/maroochydore

4

5

4

VIEW: By Appointment PRICE: $599,000 With NET RETURNS OF $36,083P.A P - 07 5443 3499

No More at this Price!

$139,950 07 5476 7244

68 My Property Review | September 4, 2009

Page 68.indd 1

1/09/2009 2:38:35 PM


design

A good Image Oliver Hume’s Claremont 2765 is available at Nambour. esigned for Nambour’s only master-planned community, The Image estate, this home from Oliver Hume features four bedrooms and two bathrooms. The master bedroom features a walk-in robe and ensuite while the three remaining bedrooms gravitate around the children’s activity room.

D

There is an open-plan living/dining/ kitchen area that leads to an alfresco area and a formal living room at the front of the home. Design: Claremont 2765 Crafted by: Oliver Hume 5441 4100 Price: $218,000

Artist’s impression

Limited Offer

Secure your preferred block now and pay in 2010

Here’s your chance to secure land at Forest Pines and not have to settle until January 2010. Located at the foothills of Buderim, this is a limited offer for you to own your slice of this wonderful location. Features...  Large level homesites from 600m2 to 1,320m2.  10 minutes to the beach from your doorstep.  8 hectares of parkland and landscaped reserve.  Close to cafes, restaurants and shopping.  Close to the university, tafe, public and private schools.

Land now selling from $ 255,000*

Visit or call the sales and Information Centre to secure your homesite today.

CALL NOW

1800 667 668

Corner of Old Maroochydore Road and Vise Road, Forest Glen UBD Map 67 - M17 OLD MAROOCHYDORE RD

FOREST GLEN

N

Noosa

hy d

Maroochydore

ar oo

c

d

d re R ydo ch

Sunshine

M ot

Alexandra Headlands

y wa or

oo Mar

eR or

ns t

e Rd Vis

75 mi

rson s Rd y wa igh e H ane Bruc o Brisb

Pa

M Old

Mooloolaba

Buderim

Mo ns Rd

Caloundra

Sales & Information Centre: OPEN Monday to Thursday 12pm - 5pm, Saturday & Sunday 10am - 5pm sales@forestpines.com.au • www.forestpines.com.au • 1800 667 668 Whilst all details have been carefully prepared and are believed to be correct, we do not guarantee the accuracy of the information. Intending purchasers must rely on their own enquiries. Illustrations are conceptual only and subject to regulatory approval and change without notice. *Average land price $288,668. Average land size approx 757m2. FOR6013

My Property Review | September 4, 2009 69 FOR6013 264x167.indd 1

Page 69.indd 1

4/8/09 11:37:04 AM

2/09/2009 10:45:39 AM


style

home directory

A little bit country

Pergolas

PERGOLAS $1275.00 inc GST

Add rustic charm to any room with these pieces.

6m x 3m top quality treated pine

All sizes - All areas Decks, Carports, Renovations

3

1

s BSA 51514

Pool Construction

Swimming Pool Construction & Renovations

2

30 years experience building and renovating swimming pools on the Sunshine Coast.

For advice and quotation Mobile 0415 498 869 Ph 5438 9839 Pre Purchase Inspections

4 6

Suncoast Building Inspections - Fully Insured - Building Contractor BSA 114 1065 - Independent owner and operator Call Chris Fahey P. 07 5351 1669 M. 0438 886 948 E. suncoastinspections@bigpond.com

5

Property Maintenance

7

8

HOME and PROPERTY MAINTENANCE SERVICES For all work bookings call our customer service hotline

13 11 98 Window Restoration

SPECIALISTS IN WINDOW REFURBISING

1/ Tennyson splay-arm three-seater sofa, $1599, Oz Design Furniture 5479 1377 2/ Launceston rectangle coffee table, $989, and side table, $659, Oz Design Furniture 5479 1377 3/ Ballet chandelier, $149.95, Beacon Lighting 1300 BEACON 4/ Lucerne three-seater sofa, $1299, Early Settler 1300 653 969 5/ Amalfi orchid jar, $49.95, bowl, $69.95, and vase, $64.95, Albi Imports www.albi.com.au (03) 9474 1300 6/ Amalfi Dupont & Allardet fob clock, $69.95, Albi Imports www.albi.com.au (03) 9474 1300 7/ Meadows dining table, $1299, Early Settler 1300 653 969 8/ Madeleine 2.5-seater sofa, $1699, Oz Design Furniture 5479 1377

s2ECOLOURINGTOEXISTINGWINDOWFRAMESINSITU sFULL REPAIR SERVICE s3%#52)49$//23!.$'2),,3 CLEARSHIELD STAINLESSSCREENSUPPLIERS

Covering the Sunshine Coast p. Brad: 54455822 m.0427444 022

Want a pool fence that looks like this? FACTORY DIRECT PRICES - FREE MEASURE AND QUOTE or DO IT YOURSELF We offer Frameless or Semi Frameless. We are a one stop glass pool fencing shop. So for personalized and friendly service come and see the local family owned business that specialises in glass pool fencing. 8mm, 10mm, & 12mm glass panels from $51.90 inc GST Complete gate kit. All fittings included $275 inc GST THE ONLY THING WE SMASH IS THE PRICE

Ph: 07 5476 6611 THE GLASS DEPOT Unit 3 / 50 Hoopers Road, Kunda Park

www.theglassdepot.com.au

70 My Property Review | September 4, 2009

Page 70.indd 1

1/09/2009 1:44:09 PM


home directory Business proďŹ le â&#x20AC;&#x201C; Kim Is My Carpet Cleaner

Business proďŹ le â&#x20AC;&#x201C; Drain Surgeon

Looking to get your carpets, upholstery or rugs cleaned? The system we use is a favourable alternative to steam or dry cleaning because it requires a minimal amount of water (up to 95 per cent less than standard wet cleaning methods) and effectively eliminates shampoo and chemical residues.

Drain Surgeon is a specialised plumbing business specifically established to clear blocked drains fast. We offer a quick response service to clear all drains from stormwater and sewage to tree roots in clay pipes. Because we are qualified plumbers we not only clear the drains but we can fix them too. Repairs and maintenance

We use an eco-friendly system recommended by the Australian Carpet Cleaning Institute. Our value-for-money system uses a two-in-one process that includes soil inhibitors that will leave your carpets drier quicker, feeling softer and looking brighter and cleaner for longer than any other carpet cleaning method. We are Government accredited, insured and registered.

jobs can be quoted on the spot. Drain Surgeon offers fixed prices on our drain-clearing services, Drain Surgeon is a franchise business with a central control office, with an emergency 24-hour seven-day service. For more details on our services and franchise opportunities visit www.drainsurgeon.net.au or phone Paul on 1300 729 919.

Antenna & Home Theatre Services

Cleaning

Excavations & Demolition

Insulation

SUNSHINE

D & A Cleaning Services

Phone: 5479 1999

Specialising In â&#x20AC;˘ High Pressure Cleaning - Roofs - Driveways - Fences - External Walls - Eves and Gutters - Garage Floors â&#x20AC;˘ Move Out Cleans â&#x20AC;˘ House Washing - Windows - Internal/External Walls â&#x20AC;˘ Any job required â&#x20AC;˘ Free quote

AFP EXCAVATIONS & DEMOLITION

Insulate your home today!

!SBESTOS2EMOVALs$EMOLITIONs3TRIP/UTS  TON%XCAVATORSs2ECYCLED4IMBERS Servicing the Coast since 1981

Take advantage of the $1600 Federal Government Rebate

ANTENNA SERVICE & HOME THEATRE INSTALLATIONS

Shop 9, 25 Fishermans Rd, Maroochydore

Mob: 0411 206 541

Email: info@sunshineantenna.com.au www.sunshineantenna.com.au

Ph. 0408 956 739

Ian Michael 0412 711 116 07 5444 3301

MICHAEL BLAKE CONCRETING

New homes and renovations Local builder available for immediate start. All insurances, all areas.

Installation from $0 upwards depending on size and product

Concrete Services

Building

MJH

Builder

Footings, slabs, driveways, paths, pool surrounds, epoxy ďŹ&#x201A;ooring, and concrete rejuvenation and colouring. Plain and exposed. Phone for a free quote and advice.

0418 726 900

New Homes, Renovations

QBSA 1111333

Wool, polyester and earth-wool available

Sunray Solar Solutions 1800 177 837

afpdemo@bigpond.com

Finance

Mowing & Lawn Care

Curtains & Blinds

Building/Renovation

New or Redo Constructions ď Žď&#x20AC; New homes ď Žď&#x20AC; Extensions ď Žď&#x20AC; Renovations ď Žď&#x20AC; Bathrooms ď Žď&#x20AC; Decks and pergolas 20 years experience

with great rates Lawn Mowing & General Yard Maintenance s,AWNMOWINGs4RIMMINGs7EEDING s0RUNINGs7ASTE2EMOVAL

Save up to 50%

Custom made curtains, roman, sunscreen and roller blinds direct from our overseas & local workrooms. â&#x20AC;˘ Local business â&#x20AC;˘ 25 years experience Call us today for a free measure & quote

Call Tim & Guy 0431 140 421

5438 9989 â&#x20AC;˘ decordirect.com.au Drain Cleaning

Shacks Gardening & Lawn Services

Lawn mowing, rubbish removal, mulching and planting, full yard cleanups, roof gutters cleaned, trimming of trees and shrubs. Pensioner Discounts

New or Redo Constructions BSA 1072866

Call 5448 4412 or 0420 633 315

Mobile: 0405 452 284 Fax: 5493 4082 Email: new_or_redo@live.com.au

Email: steveshackell@yahoo.com.au

Painter/Decorator

Carpet Cleaning

No Sweat

 

Gardening & Property Maintenance

  RQVLWHFRORXUFRQVXOWDWLRQ

Domestic, Commercial & Acreage Mowing â&#x20AC;˘ General Gardening â&#x20AC;˘ Weed Control â&#x20AC;˘ Rubbish Removal â&#x20AC;˘ Gutter Cleaning â&#x20AC;˘ Interior House Painting â&#x20AC;˘ AND MUCH MORE

                 

WINNER 2009

At last, your carpet & upholstery will stay clean longer than ever before...GUARANTEED!

Australian Carpet Cleaning Institute

When you mention this advertisement receive FREE protection for your carpet valued at over $200

National Quality Award for Excellence

Government Certified Carpet Cleaning Technicians Member of the Australian Carpet Cleaning Institute

(minimum 3 rooms)

Phone 0407 712 111 Carpenter

0ATIOSs0ERGOLASs$ECKS AND!LL#ARPENTRY s#HEAPESTPRICESONTHE#OAST s&ULLYINSUREDLICENSED s1UALITYWORKMANSHIP

&ORAFREEQUOTECALL-ATT

Landscaping & Garden Services

East Coast Landscaping&Property Maintenance We provide the following services UĂ&#x160;>Ă&#x153;Â&#x2DC;Ă&#x160;V>Ă&#x20AC;iĂ&#x160;EĂ&#x160;Â&#x153;Ă&#x153;Â&#x2C6;Â&#x2DC;} UĂ&#x160;7ii`Ă&#x160; Â&#x153;Â&#x2DC;Ă&#x152;Ă&#x20AC;Â&#x153;Â? UĂ&#x160;>Ă&#x20AC;`iÂ&#x2DC;Â&#x2C6;Â&#x2DC;} UĂ&#x160;iÂ&#x2DC;VÂ&#x2C6;Â&#x2DC;}Ă&#x160;EĂ&#x160;Ă&#x160; UĂ&#x160;/Ă&#x20AC;iiĂ&#x160;ÂŤÂ?>Â&#x2DC;Ă&#x152;Â&#x2C6;Â&#x2DC;}]Ă&#x160;Ă&#x160; Ă&#x160;Ă&#x160;Ă&#x160;,iĂ&#x152;>Â&#x2C6;Â&#x2DC;iĂ&#x20AC;Ă&#x160;7>Â?Â?Ă&#x192; Ă&#x160;Ă&#x160;Ă&#x160;ÂŤĂ&#x20AC;Ă&#x2022;Â&#x2DC;Â&#x2C6;Â&#x2DC;}Ă&#x160;EĂ&#x160;Ă&#x20AC;iÂ&#x201C;Â&#x153;Ă&#x203A;>Â? UĂ&#x160;*Â?Ă&#x2022;Ă&#x192;Ă&#x160;Â&#x201C;Ă&#x2022;VÂ&#x2026;Ă&#x160;Â&#x201C;Â&#x153;Ă&#x20AC;i UĂ&#x160;Ă&#x2022;Â?VÂ&#x2026;Â&#x2C6;Â&#x2DC;} Call 0411 us for172 an 965 obligation free quote Bill Burow /Paul Kerle 0406 967 515 Daniel Kerle 0405 978 483

Free quotes: Damien 0411 283 065

5HVLGHQWLDOÂ&#x2021;&RPPHUFLDOÂ&#x2021;,QGXVWULDO

ABN 33808726939 Fully Insured

Property Advisors

Peace of mind for your property decisions Investing? Buying? How do you know where to buy? Is the asking price fair market value? Our market research can get you started; our qualiďŹ ed valuers can inspect the property and give you reassurance about the price.

We advise. You decide. Sunshine Coast: 07 5444 7277 www.htw.com.au My Property Review | September 4, 2009 71

Page 71.indd 1

1/09/2009 1:43:38 PM


WE HAVE TRIPLED OUR INVESTMENT.

As the major sponsor of the USC Barbarians Rugby Union Team INVESTA congratulates the players, coaches, committee and supporters on their recent grand final win. Winning three consecutive grand finals is an outstanding achievement. INVESTA is committed to building a strong and vibrant Sunshine Coast by supporting a range of local sporting, educational, cultural and community events and programs.

Call 1800 550 240

Page 72.indd 1

www.bellflower.com.au

2/09/2009 9:16:51 AM


My Property Review 55