Issuu on Google+

HEALTHY LIVING HEALTHY PLANET feel good live simply laugh more

FREE

Special Edition:

NATURAL FOODS Eat Well, Live Well, Be Well

Mariel Hemingway’s

KITCHEN WISDOM

LOCAVORE

NATION

Savor Regional Foods

AMERICAN

Regional Foods

July 2010

Denver Mile High Edition | MileHighNaturalAwakenings.com


HEALTHY IS BEAUTIFUL WE TAKE TIME TO UNDERSTAND YOU. Dr. Cate Vieregger believes that dental health plays a SIGNIFICANT role in your overall health. A SPECIAL diagnostic appointment will help us UNDERSTAND your individual needs and desires. We will work with YOUR other holistic health partners to provide optimal care. Call our offices to find out what HEALTH-FOCUSED dentistry can do for you.

CATE VIEREGGER, D.D.S Your smile…the ultimate accessory

3OUTH5NIVERSITY"OULEVARD 3UITEs#ENTENNIAL #/   sWWW6IBRANCE$ENTISTRYCOM

MERCURY FREE * LATEX FREE * SEDATION DENTISTRY GENERAL AND COSMETIC DENTISTRY


contents 10

20

5 oped

6 newsbriefs

9 globalbriefs

12 healthbriefs

Natural Awakenings is your guide to a healthier, more balanced life. In each issue readers find cutting-edge information on natural health, nutrition, fitness, personal growth, green living, creative expression and the products and services that support a healthy lifestyle.

19 wisewords

5 CORN

20 localinsights

We Need

24 bookreview

CONSUMPTION Thoughtful Solutions

5

by Lauren Tatarsky

22

25 calendar

29 classifieds

30 communityresource guide

advertising & submissions how to advertise To advertise with Natural Awakenings or request a media kit, please contact us at 303-770-1981 or email info@MileHighNaturalAwakenings.com. Deadline for ads: the 10th of the month. Editorial submissions Email articles, news items and ideas to: editor@MileHighNaturalAwakenings.com. Deadline for editorial: the 10th of the month. calendar submissions Submit Calendar Events at milehighnaturalawakenings. com, Submit a Calendar Event. regional markets Advertise your products or services in multiple markets! Natural Awakenings Publishing Corp. is a growing franchised family of locally owned magazines serving communities since 1994. To place your ad in other markets call 239-449-8309. For franchising opportunities call 239-530-1377 or visit NaturalAwakeningsMag.com.

14 14 LOCAVORE NATION

Savor the Reign

of Regional Foods

by Judith Fertig

18 18 AMERICAN

REGIONAL FOODS

19

19 A

CONVERSATION WITH MARIEL HEMINGWAY

Her Kitchen Wisdom for Healthy Living

by Giovanna Aguilar

MileHighNaturalAwakenings.com July 2010

3


letterfrompublishers

H

appy 4th of July and Natural Foods issue!

Women, you can relate. Imagine a stressful, hormonal day. Parked in front of your home because you know the “cheesy poofs” won’t last the walk to the front door. So, shoveling away, you give yourself over to a private moment of craving surrender when suddenly, your new boyfriend pulls up alongside you!

contact us

Yikes! True story. Luckily the pot doesn’t often call the kettle black.

Publishers Doug Zerbarini Terry Chriswell

Assistant Editors Sharon Bruckman S. Alison Chabonais

Design & Production Judith J. Johnson Courtney Ayers Distribution KND Enterprises 303-845-9970 To contact Natural Awakenings Denver Mile High Edition:

Phone: 303-770-1981 Fax: 303-991-6892 publisher@MileHighNaturalAwakenings.com MileHighNaturalAwakenings.com

© 2010 by Natural Awakenings. All rights reserved.

Although some parts of this publication may be reproduced and reprinted, we require that prior permission be obtained in writing. Natural Awakenings is a free publication distributed locally and is supported by our advertisers. It is available in selected stores, health and education centers, healing centers, public libraries and wherever free publications are generally seen. Please call for a location near you or if you would like copies placed at your business. We do not necessarily endorse the views expressed in the articles and advertisements, nor are we responsible for the products and services advertised. We welcome your ideas, articles and feedback.

Since that time, Doug and I have explored detoxes and organic foods. We have crafted thousands of salads, chopped mountains of veggies. We have shunned high fructose corn syrup, MSG and processed foods. We’ve bought food from a co-op farm (with the best turkey I have ever eaten), tried in vain to grow our own tomatoes and he’s still trying to convince me that the next house we buy will have a backyard for goats and chickens. I have even given up diet cola. And, as I write this, we are diving into a 2 week, raw-food cleanse. Tea, lemon water and salads, oh my. Not a cheesy poof in sight. If you are like us, you strive to have a smaller “foodprint,” a smaller waistline and to eat healthier, choosing organics when possible, emphasizing vegetables, fruits and whole grains, and finding locally-produced food that travels fewer miles from field to market to kitchen. You will love the articles Locavore Nation (page 14) and American Regional Foods (page 18), which give a great history and education on our country’s resources. And who doesn’t admire Mariel Hemingway, who has become a poster child for living healthy? Her tips are on page 19. Here in the Denver area, we have so many ways to get or learn about fresh food, from Sunflower Markets (sfmarkets.com), High Plains Food Co-op (highplainsfood.org), localharvest.org, The GrowHaus (thegrowhaus.com) and all the wonderful Farmers Markets (denverfarmersmarket.com, coloradoproud.org, denverurbanhomesteading.com) this time of year. Even the Denver Botanic Gardens offers great programs on growing food – I might have to try those tomatoes again on August 7 with the class Going to Seed! Register at botanicgardens.com. What about trying a restaurant that cooks with locally-grown food? Organixx, Gaia Bistro, The Fort or Black Pearl? Chipotle began their locally-purchased food program two years ago and this year will serve about 5 million pounds of produce from local farms this year! I’m getting hungry writing this. We wish you all a happy, healthy, fresh summer!

SUBSCRIPTIONS Subscriptions are available for $24 (for 12 issues). Please call 303-770-1981 with credit card information.

4

MileHighNaturalAwakenings.com


oped

Corn Consumption

We Need Thoughtful Solutions by Lauren Tatarsky

A

ccording to the United States Department of Agriculture (USDA), from 2003-2004, the per capita conhsumption of corn in the U.S. surpassed 700 thousand metric tons, an equivalent of 1,400 pounds per person. The 400 percent increase since 1970 made the U.S. the world’s largest corn consumer, with more than 207 million metric tons consumed annually. Mexico, the birthplace of maize and a country that relies heavily on corn as a food staple, lags behind, with 25 million metric tons of corn consumed annually. The answer to why the U.S. consumes more corn per capita than a country where corn is essential to the food culture lies in xantham gum, natural flavoring, citric acid, dextrin, ascorbic acid, artificial flavorings, maltodextrin and sorbic acid. Representing some of the 150 products, ingredients or additives derived from corn, they are included in the majority of items on grocery store shelves. According to the Corn Allergy website (CornAllergens.com), which offers support for individuals with corn allergies, corn products can be found in everything from cereals to ketchup to frozen dinners. They are sometimes added to produce items, too; apples, for example, are often covered with a food-grade wax made from corn, to preserve their shelf life and add a fresh-looking sheen.

The Farm Bill and Farmer Subsidy Program The USDA, U.S. Food and Drug Administration (FDA), lobbyist groups, corporations and non-governmental organizations create our nation’s food policy. These agencies and groups work together to develop comprehensive and influential laws found in the Farm Bill; the laws regulate food production and consumption, including the farmer subsidy program, which underwent significant changes during the Nixon presidency. With the goal of lowering food prices, subsidy laws were changed so that farmers would no longer be subsidized according to the cost of production. Instead, they would be paid by the bushel.

Catch 22 and Genetically Modified Corn Corn farmers were suddenly faced with a Catch 22. To increased profits, they had to produce more bushels. As corn supplies increased, market prices went down, so farmers had to produce even more corn to keep up. At the same time, Monsanto, an agricultural biotechnology corporation, developed genetically modified (GM) corn seeds that are able to produce their own pesticide, allowing corn to grow faster and on a much larger scale.

The introduction of GM corn, combined with the need for farmers to step up production to survive financially, meant that more land was being used to farm corn. According to the United States Environmental Protection Agency, 72.7 million acres of U.S. land are currently used to grow corn. As farmers were fighting for a living wage, Monsanto was enjoying its financial success, and so the cycle continued. It wasn’t long before the U.S. faced an enormous corn surplus.

The Surplus Solution The solution to find a way to put corn in everything resulted in farmers feeding it to cows and pigs in extraordinary quantities, increasing our intake of corn as we consumed meat. Food scholars such as Michael Pollan, David Imhoff and Marion Nestle have investigated the phenomenon of corn derivatives, including high fructose corn syrup. Each has found convincing evidence that these products play a large part in the nation’s growing epidemic of obesity. These authors have also reported on how the corn surplus has damaged our nation’s farmland and its frightening effect on the health of our meat. With the growing interest in organic food, we have the opportunity to reclaim our land, our health and our food policy. The Farm Bill, with a few subsidy laws that didn’t work well, is up for renewal in 2012. It only took a few laws to get us where we are today. It will only take a few laws to fight back. For more information and updates about the Farm Bill, visit AgObservatory.org and click on Farm Bill Watch. Also visit FarmPolicy.com. Lauren Tatarsky, a graduate of American University in Washington, DC, holds a Bachelor of Arts degree in International Relations, with a concentration in Global Environmental Politics.

July 2010

5


Avatar Comes To Denver

newsbriefs Free Energy Balancing and Aura Healing

Y

oga of the Mind is now offering free energy balancing from 11 a.m. to 2 p.m. on Tuesdays, at Civic Center Eats, in Denver. Free healings are also offered from 6 to 7 p.m. every Tuesday at Yoga of the Mind, as a way of introducing people to energy balancing and aura healing and as an opportunity for trained healers to gain more experience. The 10- to 15-minute healing can help individuals gain mental clarity, relief from stress, and increased creativity. “We all have subtle, non-physical energy within us and around us,” says owner, David Stevens. “This energy profoundly influences how we feel, how healthy we are and how effective we are in our daily lives.” Energy balancing and aura healing are processes where a trained healer helps make positive shifts in this subtle energy. Stevens says anyone can benefit from this process of removing energy that is not their own or no longer serves them. After unwanted energies are removed, the healer helps bring in some of the individual’s own bright, original essence energy, which contains positive qualities. Location: 8 E. First Ave., Denver. Call 303-668-2358 or visit YogaOfTheMind.com. Mention Natural Awakenings and be entered to win a free 30-minute psychic reading. See ad page 30.

Green Forever By buying ecological you will make a difference in the life of someone you care about, and make our planet healthier! Solne researches the best quality and the purest green products in the market place. We do the work so you can enjoy giving and receiving.

No gift makes them feel more special than an Eco, Green and Natural gift. BIG SALE PRICES

Fashion Accessories Jewelry Bags & Back Packs Lingerie Cosmetics Bath & Body Healing and Wellness Baby Bedding Chrystals Media Eco-Gift Boxes Home Gifts

6

ocal Avatar Master, Linda Denmark Strachan, is excited to announce Colorado will host the Avatar® Course September 18 – 26, 2010. Avatar is a nine-day self-empowerment training delivered by a world-wide network of licensed Avatar Masters. According to the Avatar website, “Avatar® is the most powerful, purest self-development program available. It is a series of experiential exercises that enable you to rediscover your self and align your consciousness with what you want to achieve. You will experience your own unique insights and revelations. It’s you finding out about you.” In honor of this occasion and to allow the local public to “glimpse” the course, local Avatar Master, Linda Denmark Strachan is offering free introductions to Avatar on Tuesday nights throughout the Denver area and Wednesday nights in Boulder. These Intro Nights are filled with awakening to new possibilities and discovering the preciousness of life. It is a great opportunity to explore using the materials. “September’s event is especially exciting because we never really know what location will be chosen for the course. The courses are held throughout the United States and around the world in 71 countries. To have the course right here in Colorado is very special,” said Linda. The course will be offered September 18 – 26 in Westminster. To learn more about Avatar or to reserve a place at one of the intro nights, call Linda at 720-320-9681 or e-mail Lkdenmark@sysmatrix.net. Avatar® is a registered trademark of Star’s Edge Inc. All rights reserved. See ad page 10.

Isis Healing Café Opens

Green is here to stay to better the quality of your lives!

Something for every budget. Use code: LOVNAT

L

www.Solne.com 303-770-3337

I

sis Books, Amazing Origins Café and Dr. Robert Weissfeld have teamed up to create the Isis Healing Café, a new concept in healthcare delivery. Acupuncture and other healing modalities, along with coffee from Amazing Origins, will be offered from noon to 1:30 p.m., Monday, Wednesday and Friday, at Isis Books, Gifts and Healing Oasis. Envisioned years before by Dr. Weissfeld, a chiropractor and acupuncturist with offices at Isis, his idea met opportunity when the café opened last month. “Healing in a group setting offers several advantages,” he says. “Lower cost from efficiency is first on most people’s minds, but I am convinced that the addition of social factors and the group healing field increases the benefits.” In addition to treating pain issues, the central tableside treatment will be “The 21 Days.” Based on a well-established drug and alcohol addiction method, Dr. Weissfeld says the five-point treatment seems to satisfy the brain, “relaxing the addiction to our usual thoughts, feelings and perceptions, the box we are stuck in.” He says a single treatment can be relaxing, but three weeks can create permanent change. “It’s a great starting point for anxiety, depression, post traumatic stress or just getting out of a rut.” Area resident Elizabeth Morrison, who began the program to stop smoking, says, “I am seeing things from a new point of view, feeling much better about myself, taking better care of myself and meeting more people. I have more patience, and I am sleeping better too. I have a feeling of joy.” She also reported that cigarettes don’t taste good anymore. For information, call Dr. Weissfeld at 303-300-3993. See ad page 22.

MileHighNaturalAwakenings.com


Exploring the Next Level of Healing

A

newly emerging approach could change conventional understanding of health and healing. Focusing on experiments that quantify the effects of energy, light and information on human beings, scientists William Tiller, Ph.D., and Gary Schwartz, Ph.D., are studying “the reconnective healing frequencies” first discovered by Eric Pearl, a doctor of chiropractic. Tiller, professor emeritus at Stanford University, author of books and scientific papers and a lead character in the film, What the Bleep!?, has been conducting research on how the physical properties of a room change as a result of energy healing frequencies that enter it. Additional research by Schwartz and his colleagues at the Laboratory for Advances in Consciousness and Health at the University of Arizona has focused on monitoring attendees of two reconnective healing seminars hosted by members of the Reconnective Association. The researchers determined that the more than 90 people who participated in their study all walked out of the session with expanded and new electromagnetic abilities, even if they had never studied any of the various energy healing techniques known today. “This shift of energy is what allows normal human beings to enter a room and later to walk out with an ability to heal others and themselves, regardless of their background or education,” says Tiller. For more information or to register for a reconnective healing seminar, visit TheReconnection.com or call 323-960-0012. See ad page 21.

Deer Creek Counseling Opens in Littleton

T

herapist Kathy Higgins, MA, LPC, has opened Deer Creek Counseling, offering clients the chance to heal and transform their lives through interpersonal, dialectical and personcentered therapies. When the challenges of trauma, grief and pain become difficult to endure, a counselor’s care and assistance can often help one move forward to a more joyful and effective life. “We combine the effective, evidence-based therapies of mindfulness-based stress and anxiety reduction and Dialectical Behavior Therapy (DBT), with deep, soul-centered compassion, to provide a safe, validating space to assist you as you face your challenges, discover new choices and find solutions,” says Higgins. Higgins and her colleague, Anna Davis, offer individual counseling, therapy groups and workshops to people of all backgrounds and economic levels. Areas of specialization include depression and bipolar mood disorders; addiction recovery; healing trauma and PTSD; grief and bereavement; eating disorders and weight management; parenting skills and issues, phobias, anxiety and OCD; coping with disabilities; women’s issues; building self-esteem; healing from domestic abuse and violence; career counseling and coaching; and alternative spirituality. Location: 7345 S. Pierce Street, Ste. 110, Littleton. For information, contact 720-663-7702 or DeerCreekCounseling@ gmail.com. See ad page 30.

Call for Research Participants

R

uth Rinehart, a candidate for her Master of Arts degree in transpersonal studies and president and founder of Three Trusts, Inc., a resource for conflict transformation, is seeking volunteers for an eight-week research study beginning in mid-July and ending in mid-September. Rinehart will study the relationship between trust and transcendence, specifically: “Can the experience of trust, the decision to trust, be a vehicle or container that can lead to transcendent experience?” Participants should be either divorced parents or women who resonate with the phrase, “scandalous women on a spiritual path.” According to Rinehart, participants will benefit from a cognitive study about trust, as well as experiential exercises designed to enhance the spiritual life and growth of each person involved. Group meditations, discussions, labyrinthwalking, authentic movement and dance, story sharing, mandalas, dreamscapes and guided reveries are among the methods that will be used to access the guiding principles of trust and transcendence. All participation can be done by phone, e-mail or online, as well as through personal experiential exercises and daily practices. Results of the study will be presented in Virginia Beach on November 20, 2010. Final results are written for Rinehart’s culminating project in her Master of Arts program. Location: 1010 Washington Ave., Ste. 200, Golden. For more information, call 303-278-8136 or visit ThreeTrusts.com.

The New Journey Books & Center For Self-Actualization & Enlightenment

A Non-Profit Educational Organization

Serving the spiritual community for over 30 years

View class & event listings at:

www.journeybooks.com * Classes * Events * Store *

*Monthly Psychic Fairs *Room Rental

*Books, Music, Tarot

*Holistic Practitioners *Readers

*Spiritual Gifts & Art

SUPER SUMMER CLEARANCE! On Selected Books, CD’s and Other Inventory

7735-D Wadsworth Blvd., Arvada, CO 80003 77th & Wadsworth in the Indian Tree Shopping Center

303-239-8773

New Hours: Mon-Fri Noon-7pm Saturday 10am-6pm

July 2010

7


newsbriefs Seven Cups Offers Free Tea Tastings

S

even Cups, Denver’s first and only Chinese tea house, is now offering free tea tastings at 3 p.m. every Friday afternoon. The tastings will usually offer two teas side by side, for sampling. Each tasting will last about one hour and include discussion about the teas’ history and special qualities, followed by the tasting. The tastings offer an interactive way to learn about the broad range of Chinese teas. According to owner Greg Fellman, Seven Cups offers more than 90 varieties of fine Chinese tea, sourced directly from Chinese tea masters. Nearly three months every year are spent in China, hand selecting the teas. To ensure that 100 percent of the teas’ quality is preserved from their Chinese tea garden sources, Seven Cups seals the teas in tough, resealable, foil-fresh pouches that block sunlight and moisture and protect the teas during shipping. Location: 1882 S. Pearl Street, Denver. For information, call 303-777-CUPS (2877) or visit SevenCupsDenver.com.

The Allergy Relief Stop Now Offers Body Balance

D

r. Steven Schwartz has successfully completed advanced training to offer a new service at The Allergy Relief Stop. The new process, called Body Balance, utilizes the same LZR7 biofeedback Laser device currently being used to treat

allergies. Body Balance focuses on treating those with chronic degenerative conditions, and, along with the LZR7 Laser device, has been used to aid in healing many conditions with acute and chronic pain, repetitive use disorders like carpal tunnel syndrome, soft tissue strains and sprains, inflammation, enhanced tissue healing, and cell regeneration. Contact The Allergy Relief Stop at 303-996-4663 or TheAllergyStop.net. See ad page 13.

Join the Climb to Fight Breast Cancer

O

n Saturday, August 7, join Boulder-based Women in Natural to climb Mt. Quandary, one of Colorado’s highest 14’ers, and help raise money to support the Breast Cancer Fund. Men, dogs, and teens are welcome to join the climb, too, which includes a goody bag and lunch—along with great company! The day will be dedicated to breast cancer survivors, supporters, and all others impacted by the disease. The crowning glory of this year’s climb will be the Toast at the Top—an opportunity to honor anyone with a toast. Sponsors contribute $14 per toast and receive a photo of the toast via e-mail. One hundred percent of the funds raised will benefit the Breast Cancer Fund, the leading national nonprofit focused solely on improving women’s health by identifying and eliminating the environmental links identified by scientists and environmental experts as potential and preventable causes of breast cancer. Space is limited to the first 50 people who register, and each participant is required to raise funds to support the Breast Cancer Fund. Registration fee is $50. For more information, e-mail womeninnatural_co@comcast.net or visit breastcancerfund.org/2010climbco.

Reiki Certification for Animal Practitioners

T

1VCMJD4FSWJDF$SFEJU6OJPOt#F-PDBM/P$Pt'PSU$PMMJOT'PPE$PPQt5SFFT8BUFS1FPQMFt(P8FTUt3F4PVSDFt-PUVT%FTJHO 3FFM.PUJPOt'$1VCMJD"DDFTT/FUXPSLt&MEPSBEP/BUVSBM4QSJOH8BUFSt(FO(SFFO-JGFDPNt4DFOF.BHB[JOF

8

he Misha May Foundation, a 501(c)(3) nonprofit dog rescue, is offering Reiki certification classes for animal practitioners, beginning in July. According to founder and Executive Director, Lorraine May, the class will teach humans how to experience the world from the animal’s perspective. Attendees will learn Reiki practices, as well as communication, handling strategies, physiology, psychology and more. May, a Reiki master teacher and creator of the certification, will teach the class. May says animal lovers, including rescue personnel, holistic practitioners and owners, will find this class particularly useful. The course demonstrates a variety of specific techniques, with hands-on application. Special attention is paid to trauma reduction and calming protocols. The result is often the alleviation of symptoms such as pain, fear and anxiety, as well as positive changes in behavior. May says Reiki does not replace other kinds of medicine but collaborates with them, to create a multi-level approach impacting not only the physical body, but the emotions and the mind. Other Misha May classes include Beginning Animal Communication, Finding Your Calling, Flower Essences for People and Animals, Spirit Animals and Understanding Dogs. To register, email MishaMayFoundation@gmail.com or call 303-239-0382. Cost is $350. For information visit MishaMayFoundation.org. See ad page 29.

MileHighNaturalAwakenings.com


globalbriefs News and resources to inspire concerned citizens to work together in building a healthier, stronger society that works for all.

Economic Security

Buying at Home Keeps America Strong Poll after poll points to Americans’ preference for locally produced goods, according to msn.com; the real question is if we are willing to look for them and pay more. A 21st-century grassroots website, StillMadeInUSA.com, provides a helping hand with an online shopping directory of American brands. Categories range from personal apparel, handcrafts and household goods to tools, sports and entertainment, and include special occasions and shop-by-geography menus. “I try to buy American products whenever possible, but as a working mother of three boys, I don’t have time to drive from store to store or search for hours online,” says founder Stephanie Sanzone, explaining her website’s genesis. The Made in USA label represents a heightened concern for guarding American manufacturing jobs, worker and environmental health, product quality, consumer safety, national competitiveness and security while defending against an increasing trade deficit.

Donate a Day Photo by Trace Ramsey

Crop Mobs Sustain Small Farms and Build Communities Across the country, crop mobs comprising dozens of mostly 20-something volunteers periodically gather at local sustainable small farms to donate their time to make immediate improvements. These landless farmers, apprentices, interns and the “agricurious” comprise a remarkably effective traveling Weeding blackberry beds at Spence’s Farm in Chapel Hill, NC. work party, often assisted by experienced farmers and gardeners eager to share their know-how with the next generation. Assigned tasks might be mulching, building a greenhouse, prepping garden beds or bringing in a harvest. “The more tedious the work we have, the better,” says Rob Jones, co-founder of the spreading movement, which originated in North Carolina’s Triangle in response to a regional surge in sustainable farming. “Because part of crop mob is about community and camaraderie, you find there’s nothing like picking rocks out of fields to bring people together.” It’s all about building the community necessary to practice this kind of laborintensive agriculture and to put the power to muster help into the hands of future local food producers. Any crop mobber can call a crop mob to do the kind of work it takes a community to do. Participants work together, share meals, play, talk and make music. No money is exchanged; it’s the stuff that communities are made of.

Supplementing your dog or cat with natural and herbal anti-inflammatories, pain killers, and/or glucosamine and chondroitin will help get your pets through the summer pain free. Stop by Hero’s Pets and we’ll coach you through the best supplement options for your furry friends.

8086 Bowles Ave N Littleton, CO 80123 303-972-1926 Herospets.com

For information and contacts in various states, visit CropMob.org.

Natural Spin

Shoppers Vote for Healthier Choices Attendees at this year’s mega Natural Products Expo West, in Anaheim, California, saw everything from organic burritos and glass baby bottles to bags that extend the life of produce. “The 30th anniversary of the event mirrors major business and consumer shifts to values of health and sustainability,” observed Fred Linder, president of New Hope Natural Media. Organic products and green packaging are in—genetically modified foods are out. Accordingly, The Fresh Ideas Group, which monitors new-product trends, has forecasted lower prices for private label organic food in 2010 and an increase in foods with fewer processed ingredients and more whole grains. While organic still accounts for less than 5 percent of national food sales, overall sales of organic foods and other products was up 5 percent in 2009, more than double the growth of conventional wares.

July 2010

9


What do 2 Osteopathic Physicians, an Acupuncturist, a Movement therapist, a PA and 2 Massage therapists have in common?

A commitment to your health. Integrative Medicine, in our office, skillfully blends traditional medical practices with alternative approaches. Our caring practitioners are dedicated to thoughtfully and compassionately listening to what our patients have to say. This is the key to truly helping you.

www.cointegrative.com

303-781-7862

It’s about Health.....isn’t it about Time! TM Colorado Osteopathic & Integrative Medicine Associates, PC 4901 W. 38th Avenue, Denver, CO 80212 Most Insurances Accepted

TM

Get Started With The Avatar® Course. The Avatar Course is about your beliefs and your perspectives. It is a series of experiential exercises that enables you to rediscover yourself and align your consciousness with what you want to achieve. You will experience your own unique insights and revelations.

“Avatar teaches the use of proven navigational tools that can be used, in harmony with your own integrity, to pass safely across the uncharted turbulence of the mind into the region of the soul.”

globalbriefs Lunch Box

Funding Debate Slows Upgrade of School Nutrition For the past year, Slow Food USA has led a consumer campaign now exceeding 100,000 emails asking Congress to improve school nutrition. “We cannot, in good conscience, continue to make our kids sick by feeding them cheap byproducts of an industrial food system,” states Josh Viertel, president of Slow Food USA. “It is time to give kids real food, food that tastes good, is good for them, is good for the people who grow and prepare it and is good for the planet.” President Obama has proposed investing an additional $1 billion a year to help schools serve healthier food, but Congress is hesitating to approve the full amount. This change to the five-year Child Nutrition Act, now up for renewal, would add 20 cents to the $1 allocated for ingredients in each school lunch. School nutrition directors say an additional $1 is needed to serve sufficient vegetables, fruits and whole grains, making the ultimate goal $4 billion a year. Meanwhile, the viable farm-to-school movement is seeking just $50 million of the total to link local farms with schools. Vending machines also must be subject to stronger nutrition standards. “Kids have the most at stake here,” remarks Emily Ventura, of Slow Food Los Angeles. “This is their future, their health, their quality of life. But it’s also America’s future.” Support the Time for Lunch campaign at SlowFoodUSA.org.

The frog does not drink up the pond in which he lives. ~ Buddhist Proverb

Call Linda Denmark for details or a free introduction to Avatar:

– Harry Palmer, author of the Avatar materials

720-320-9681

Lkdenmark@sysmatrix.net

Avatar® is a registered trademark of Star’s Edge, Inc. All rights reserved.

10

MileHighNaturalAwakenings.com

July 2010

10


July 2010

11


Mrs. Green Jeans .12:/('*(Â&#x2021;,17(*5,7<Â&#x2021;6(59,&(Â&#x2021;6(/(&7,21

Progressive Gardening Tips That Are Water Wise & Earth Friendly

W

hat is progressive gardening? Just what the title indicates. It is a method of gardening that is very earth-friendly and saves enormous amounts of water. So, lets explore why you would want to be conscious of and possibly use some of these methods - especially in todayâ&#x20AC;&#x2122;s environment of conservation and sustainability. 1. Hydroponic gardening uses about 1/10 of the water vs. conventional gardening methods. In a place like Colorado this is a very important factor. Hydroponic gardens allow you to recirculate the water for up to 2 weeks! 2. Vertical gardening is the best way to save space. This method can be practiced whether you are growing in soil, hydroponically, or in containers. Grow up â&#x20AC;&#x201C; not out. 3. When you are growing in soil grow organically. There are many products available that keep soil alive and that is important for our planet. And you know, your food will taste great and be the best for you and your family. 4. One of the best things about gardening hydroponically â&#x20AC;&#x201C; things just grow faster. 5. Maximize your space and produce more food. Hydroponic methods can grow up to 10 times the food in the same amount of space as their conventional counterparts.

Stop by one of our locations and let our knowledgeable and friendly staff help you start progressive gardening today!

%28/'(5+<'52321,&  25*$1,&&(17(5,1& 1630 N 63rd St. Â&#x2021; Boulder

303-415-0045 (67 _______________

Christine Hubbard General Manager

'(19(5+<'52321,&  25*$1,&&(17(5,1& 6810-D Broadway Â&#x2021; Denver

 (67

9LVLWRXUZHEVLWHZZZ%+2&HQWHUFRP 12

healthbriefs Why Mangos are Good for Us

I

ncluding mangos in summer fruit salads adds both delicious sweetness and health benefits. A new study by Texas AgriLife Research food scientists examined five mango varieties most common in the United States: Ataulfo, Francine, Haden, Kent and Tommy Atkins, and found that the tropical fruit has anticancer properties. When exposed to a variety of cancer cells in the laboratory, mango turned out to be especially effective against certain breast and colon cancers. The researchers attribute the cancer-fighting properties to the fruitâ&#x20AC;&#x2122;s polyphenolics, a class of bioactive compounds responsible for preventing or stopping cancer cells. As one might expect with an all natural anti-cancer agent, normal cells were not affected by the mango, which targeted only cells that had gone bad, by interrupting their mutated division cycles. Source: Texas A&M AgriLive Communications, 2010

Flaxseed Oil Strengthens Bones

A

ccording to a report in the International Journal of Food Safety, Nutrition and Public Health, numerous studies suggest that flaxseed oil benefits bone mineral density and reduces the risk of osteoporosis in post-menopausal women, as well as in women with diabetes. Source: Inderscience Publishers,

Exotic Superfruit

M

angosteen juice has anti-inflammatory properties that could prove to be valuable in preventing the development of heart disease and diabetes in obese patients. A study published in BioMed Centralâ&#x20AC;&#x2122;s open access Nutrition Journal states that the juice of the exotic superfruit lowers levels of C-reactive protein, a key factor associated with inflammation.

MileHighNaturalAwakenings.com


N

onstick cookware, popular because it’s convenient to use and clean, also emits toxic fumes when overheated. Tests commissioned by the Environmental Working Group (EWG) have shown that in just two to five minutes on a conventional stovetop, cookware coated with Teflon and other nonstick surfaces can exceed temperatures at which the coating breaks apart and emits toxic particles and gases. They posit that the same holds true for ovenware. At the same time, the researchers report that ingesting inert particles that have come off scratched cookware isn’t a hazard. EWG’s recommended alternatives are stainless steel and cast iron cookware. However, for families stuck with nonstick pots and pans, the group offers the following tips: Never preheat nonstick cookware empty or at high heat and make sure to cook food at the lowest possible temperature possible for safe cooking. Don’t put nonstick cookware in an oven hotter than 500 degrees and use an exhaust fan. Keep pet birds out of the kitchen, because they are particularly susceptible to the fumes.

Skip Nonstick Pans

Laser Allergy Relief Centers

The

Allergy Stop The latest technology for allergy relief without drugs, herbs, or needles. Safe and painless!

Laser Allergy Relief Center at Complete Wellness Chiropractic Denver, CO www.LaserAllergy.com

For a free downloadable Guide to PFCs (perfluorochemicals) and how to avoid them in a wide range of products, including cookware, visit ewg.org/EWGGuide-to-PFCs.

Another Strike Against Saturated Fats

S

aturated fat commonly found in ice cream, butter, cheese, milk and beef does not behave like fats in other foods, suggests a study from the UT Southwestern Medical Center, in Texas. The researchers found that when brain chemistry gets hit with such fatty acids, it fails to signal the body to stop eating, even when it’s had enough.

303-996-4663

Slow Down at Mealtime

T

he Endocrine Society’s Journal of Clinical Endocrinology & Metabolism reports that eating a meal too quickly reduces release of the hormones in the gut that induce feelings of being full, which can lead to overeating and weight gain.

Sizzling Summer SPECIAL $69 MASSAGE PLUS IONIC FOOTBATH With Bonnie Chipman & Julie Donlon

$69 HYDRATING FACIAL & MICRODERMABRASION Exfoliate, hydrate and promote healthy cellular renewal achieving a natural summer glow.

18425 Pony Express Drive t Suite 107 t Parker, CO 80134

303-805-2282 t www.cthealingcenter.com July 2010

13


LOCAVORE NATION SAVOR THE REIGN OF REGIONAL FOODS by Judith Fertig

C

onsider Boston cod, Georgia peach pie, Florida’s Indian River grapefruit, wheat from Kansas, heirloom tomatoes from Colorado, Michigan sour cherries, Texas pinto beans and California wines. While the definition of American cuisine is difficult to pinpoint, it definitely exists in regional form, say the Americans polled by the James Beard Foundation. It’s the particular tastes of the places we call home. There’s a delicious reason why regional foods remain popular; as The Leopold Center for Sustainable Agriculture found, the average “fresh” food item on American dinner tables now travels 1,500 miles to get there—and often tastes like it.

Taste is All About Terroir “Place-based foods have a unique taste, related to the soil, water, air and climate of a region, as well as the ethnic or regional heritage of their producers,” advises Rachelle H. Saltzman, folklife coordinator and director of the Iowa Place-Based Foods project. She notes that regional

14

food might be considered a result of the happy pairing of nature and nurture. Regional foods start with terroir, a French term that refers to a peculiar combination of microclimate and geography. If we draw a circle with its center in our own backyard, the area within the circumference of the circle that encloses the same climate and geography is the general terroir. Although terroir is in wide use in reference to wines, it also applies to any food. Terroir accounts for the differences in flavor between mild orange blossom honey from Arizona, aromatic and pear-like tupelo honey from Florida, amber-colored and medium-flavored clover honey from Iowa and dark and slightly sulfurous sunflower honey originating in South Dakota. “When you eat honey that local bees make, you’re eating an easily digestible, raw food full of enzymes, pollen, vitamins, proteins and minerals from the region,” says Tony Schwager of Anthony’s Beehive, in Lawrence,

MileHighNaturalAwakenings.com

Kansas. Bees forage for nectar in nearby blossoms and then do all the processing in the hive. The result is a regional food yielding more than 300 varieties across the United States. Even Vermont maple syrup can register the flavor changes from terroir, according to Amy Trubek, assistant professor of nutrition and food sciences at The University of Vermont and author of The Taste of Place: A Cultural Journey Into Terroir. Trubek is participating in an ongoing study of the character of small-batch maple syrups. “Like Burgundy wines or Savoie cheeses, the terroir of maple syrups matters,” she says. For example, maple syrup—a whole food made only from the sap that rises in the tree only after a long, cold winter—can taste different depending on whether the maple tree grows in areas rich in limestone (giving flavor notes of caramel, vanilla and bitter almond) or schist (where minerals yield a slightly moldy note), giving it a unique taste of place.


in their own kitchen gardens: boiled peanuts, sweet potato pie, boiled greens and black-eyed peas. Immigrants from Ireland who arrived in the New World during the potato famine of the 1840s and those Europeans promised free land under the Homestead Acts of the 1860s brought garden seeds, favorite plants and ethnic food traditions with them, further enlarging our country’s collective eating repertoire to include sauerkraut, coleslaw, cheesecake, cinnamon rolls and potato salad. Mennonite farmers who had emigrated from the Netherlands to Germany and then on to Russia, as their pacifist views clashed with the prevailing governments, finally left the steppes of the Ukraine for the similar terroir of the Kansas prairie in 1875. (This was around the same time that cowboys were herding longhorn cattle from Texas along the Chisholm Trail to

Wild Bounty Before European settlement here, Native American tribes were often identified—and strengthened physically and spiritually— by the regional foods they ate, whether gathered by hunting or fishing in the wild or raised themselves. Early visiting explorers and naturalists noted such delicacies as wild strawberries growing along the New Hampshire shoreline, native persimmons in Virginia and beach plums on Cape Cod. In Early American Gardens: For Meate or Medicine, gardener and author Ann Leighton chronicles which plants were native to New England and which ones the 17th-century colonists brought or had sent from England. The resulting cuisine evolved into a fusion of English recipes with New World ingredients. Through many generations, regional cuisines developed along the Eastern seaboard, often featuring maple syrup, cranberries, wild blackberries, corn, pumpkins, Carolina gold rice, cod, clams, blue crab, shad and shrimp. Grafting new and old world plants produced the happy accidents of the Bartlett pear, Concord grape and Newtown Pippin apple. What grew in these innovative gardens naturally began to grace American tables. “Native corn became a truly American food,” observes Lenore Greenstein, a food and nutrition journalist who has taught at several U.S. universities. “The corn of the settlers, however, was not the sweet corn we know today, but the field corn used to feed livestock and make corn meal, syrup and starches. Sweet corn was unknown until 1779, yet by 1850 it had replaced field corn on American tables.”

“In this wine, you can taste the magical place where our children, Hailey and Loren, grew up. Aromas of blackberries and bay leaves, like those that grow along the spring-fed creek with subtle notes of tobacco, smoke and earth, dance in the background, derived from the soil itself.” ~ Janet Trefethen, of Trefethen Family Vineyards, in Napa, California, about its HaLo cabernet sauvignon.

Ethnic Traditions Beyond the land itself, regional foods continue to be influenced by the transportation routes followed in early trading ventures; the ways of the English homeland were soon joined by those of African slaves. Greenstein relates that New Orleans’ famous gumbo comes from the African ngombo, for okra, its principal ingredient. The thick stew gets some of its distinctive flavor and smooth texture from gumbo file powder made of dried, wild sassafras leaves. In other parts of the South, a cuisine that became known as soul food grew up around dishes made from produce that slaves could grow

What’s Growing in Your Region? Slow Food, an international nonprofit organization dedicated to “good, clean and fair food,” has created an American Ark of Taste, its list of regional foods. Backyard entries include the granite beauty apple from New Hampshire, green striped cushaw [squash] from Tennessee, hand-harvested wild rice from Minnesota, Four Corners gold bean from Colorado, Padre plum from California and Alaskan birch syrup. (See SlowFoodUSA.org/ downloads/Ark_ FoodsByRegion_ 9.29_.09_.pdf)

“Were it not for Lake Michigan, you couldn’t grow fruit this far north on a commercial scale. The weather fronts come in from the west over the deep lake. The lake becomes a climate modifier, giving the fruit its character.” ~ Justin Rashid, of American Spoon Foods, a grower of sour cherries, apricots and peaches in Michigan’s Upper Peninsula

To find local farms and producers, visit: LocalHarvest.org SustainableTableorg/ issues/eatlocal  FoodRoutes.org

  July 2010

15


Good for Our Community

railyards in Abilene, Kansas.) The Mennonites brought bags of turkey red winter wheat seeds that helped transform the wild prairie into the cultivated â&#x20AC;&#x153;breadbasketâ&#x20AC;? it is today. In a similar fashion, Italian families coming to California brought their love of wine to a hilly region that benefited from moisture granted by the fog rolling in from the Pacific. They knew how to make the most of a climate with a spring rainy season followed by a dry summerâ&#x20AC;&#x201D;great conditions for growing wine grapes.

Good for Us Food Foods naturally suited to their environment grow better, taste better and are packed with more nutrients, reports Sustainable Table, an educational nonprofit working to build healthy communities through sustainable eating habits (SustainableTable.org). When grown and consumed locally, foods escape the degradation of being irradiated for longer shelf life. When they come from organic farms, theyâ&#x20AC;&#x2122;re also grown without pesticides and herbicides. Consider also that milk from dairy cattle raised in areas where they can eat grass for most of the year has a better flavor and contains more beneficial nutrients than milk from grain-fed cows. Jeni Britton Bauer uses regional Midwestern ingredientsâ&#x20AC;&#x201D; including organic milk from grass-fed cows, local goat cheese, foraged wild foods and organic berriesâ&#x20AC;&#x201D;for Jeniâ&#x20AC;&#x2122;s Splendid Ice Creams. â&#x20AC;&#x153;We couldnâ&#x20AC;&#x2122;t believe the difference in flavor in milk from grass-fed versus grainfed cows,â&#x20AC;? she says. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s because grass-fed cows produce milk with more conjugated linoleic acid, a cancer-fighting compound, as well as healthful omega-3 fatty acids.â&#x20AC;? Local examples such as hers illustrate the larger truth.

â&#x20AC;&#x153;Indian beliefs are the same and different [from one another]. For us, the sacred food is salmon; for the Plains Indians it was buffalo; in the Southwest it was corn. We all see food as part of our religion, but different foods give us our strengthsâ&#x20AC;Ś if we move about from place to place, we become separate from our sacred foods; we become weak.â&#x20AC;? ~ L o u i e H . D i c k , J r. o f O r e g o n â&#x20AC;&#x2122;s U m a t i l l a t r i b e in â&#x20AC;&#x153;Water is a Medicine that Can Touch Your Heartâ&#x20AC;? from Native Heritage: Personal Accounts by American Indians 1790 to the Present, edited by Arlene Hirschfelder

Assisting you in creating the life you desire and deserve! Sacred Spaces Center for Spiritual Growth, Conscious Creation & Psychic Development

ZZZ6DFUHG6SDFHV$QG3ODFHVFRPÂ&#x2021;$QJHO&KDQQHOHU#DROFRP 3V\FKLF +HDOLQJ)DLUODVW6DWXUGD\RI(DFK0RQWK²SP

5HY'HEUD5DH

30+ Years Experience / Clairvoyant Readings / Medium, Angel & Guide Communication Grief & Abuse Healing / Aura, Pet, House & Office Healings / Classes / Church Services Visit the website for monthly events, classes, articles and information â&#x20AC;&#x153;If you remembered who you are, you would have no fear because you would remember how powerful you are!â&#x20AC;? - Lazaris

16

MileHighNaturalAwakenings.com

Growing and eating regional foods is equally beneficial for our communities. According to Larry West, a writer for E/The Environmental Magazine, most farmers on average receive only 20 cents of each food dollar spent on what they produce. The remaining profit gets consumed by transportation, processing, packaging, refrigeration and marketing costs when their crops travel far and wide. Farmers who choose to sell their foods to local customers see a better return on their investment. When neighbors choose to eat locally, it supports local agriculture and encourages continued use of area land for farms, keeping development in check while preserving open space. There are even more benefits. Research by Duncan Hilchey, a senior extension associate at Cornell University, and his colleagues in upstate New York found that regional agriculture contributes to the local economy, provides fresh food and a secure food supply, and plays a role in preserving our rural heritage. In GoĂťt de Terroir: Exploring the Boundaries of Specialty Agricultural Landscapes, he concludes that â&#x20AC;&#x153;Agricultural landscapes, and the regional cuisine and foodways [culinary practices] to which they contribute, offer powerful expressions of place.â&#x20AC;? As Greenstein sums it up, â&#x20AC;&#x153;Regional food is better, however you look at it.â&#x20AC;? Judith Fertig is a freelance food writer in Overland Park, KS; for more information visit AlfrescoFoodAndLife style. blogspot.com. Primary sources: Tony Schwager at AnthonysBeehive.com; Lenore Greenstein at LenoreSue@Comcast.net; Rachelle H. Saltzman at Riki.Saltzman@Iowa.gov; Duncan Hilchey at Duncan@NewLeafNet.com; Justin Rashid at SpoonFoods. com; Amy Trubek at Amy.Trubek@uvm. edu; and Jeni Britton Bauer at JenisIceCreams.com Also, Culinaria: The United States, A Culinary Discovery, edited by Randi Danforth, Peter Feierabend and Gary Chassman; and Early American Gardens: For Meate or Medicine by Ann Leighton


Denverâ&#x20AC;&#x2122;s Local Resources

720-848-1090

Colorado Dept of Agriculture has a great booklet called Farm Fresh which lists Farmers Markets and roadside stands, and a booklet on local wineries. Email Markets@ag.state.co.us to find out where you can get them, or visit their website Comarketmaker.com. They list great restaurants that buy local as well.

We asked several different

You can always grow your own! Check out Denver Hydroponic & Organic Center; their staff is great and will help set you up! 6810-D Broadway, 303-650-0091 or Bhocenter.com.

health practitioners at the Center for Integrative Medicine, â&#x20AC;&#x153;What is your

Sunflower Markets has great events. Check Sfmarkets.com for the store nearest you and what events they have. Picking the Perfect Summer Berries or cooking classes. Fun! Darn - I missed the ice cream social in Littleton! The classes and info from Denver Botanic Gardens is great. How about Mushroom Propagation at Home or learning how to make your own pesto? They even have a certification program in Rocky Mtn gardening. Sign up at Botanicgardens. org. NOTE! They are looking for food vendors for a Local Foods Festival coming in September with the corn maize. Email Celia at CurtisC@botanicgardens.org. Contribute to a self-sufficient economy and biodiversity by trying a food co-op! Delicious, fresh food to put you on the right path â&#x20AC;&#x201C; thereâ&#x20AC;&#x2122;s so much in your fridge you just have to eat it. Highplainsfood.org.

www.uch.edu

advice to Natural Awakenings readers about healthy food?â&#x20AC;? BRIAN ENEBO D.C., PH.D. Chiropractor

Stay on the outside aisles of the grocery store which has less process foods with less additives. Choose complex carbs over simple. The more it looks like the actual grain, the better. If it looks like you could have picked it yourself, thatâ&#x20AC;&#x2122;s healthy food.

CARRIE PAYNE, PsyD

Licensed Clinical Psychologist Good nutrition impacts us physiologically and neurologically. Healthy food is part of an overall picture of having balance, healthy and more positivity in life. With healthier foods, one is better able to focus cognitively and feel more energetic and happy. Always be looking at balancing.

HEATHER GUNNERSON, CMT Toxins from processed food linger in the system longer. The healthier a person eats, Iâ&#x20AC;&#x2122;ve noticed the better their muscle tone and the better their hydration. I donâ&#x20AC;&#x2122;t know if unhealthy eating contributes to trigger point and neuromuscular pain, but there seems to be a correlation. The body seems to feel worse if someone is not eating well.

DAISY DONG, LAC, OMD Acupuncturist

If you have a colorful plate of food,that is a good balance, similar to a closet of clothes. Food must balance yin and yang, not too hot or cold, good balance of protein DQG ÂżEHU ,Q JHQHUDO QRW QHFHVVDULO\ HYHU\ meal. If you hesitate before eating something, your body probably wonâ&#x20AC;&#x2122;t accept it very well. If you crave warm or cold, follow your body.

SANDRA SCHWARTZ, RN Certifed Yoga Instructor

Portions are very important, as well as being aware of when you are hungry. Be careful to eat then, not just eating to eat. Eating breakfast is also very important. How ZHWUHDWRXUERGLHVLVDUHĂ&#x20AC;HFWLRQRIZKRZH are and our environment.

LISA CORBIN, MD FACP

Medical Director, The Center for Integrative Medicine A restrictive diet is not healthy. There are lots of great diets out there, but ones that tell you to take out an entire food group are not healthy. Even fruits have healthy sugars and we need that for quick energy. Make small changes toward goals; donâ&#x20AC;&#x2122;t make it rocket science.

July 2010

17


AMERICAN REGIONAL FOODS From sea to shining sea, America’s eight large geographic regions—each with its own unique foods—give us a taste of our country. Atlantic Coast ~ from Maine south to Florida ~ Lobster, clams, cod, scallops, bluefish in cold sea waters; cranberries in natural marshland; wild Maine blueberries; tomatoes in mineral-rich New Jersey soil; oysters, blue crab, shrimp, grouper and mackerel in warmer southern Atlantic waters; Concord grapes, Bartlett pears and Newton Pippin apples in New England and upstate New York; peanuts, pecans and peaches in the Piedmont region of Virginia, North Carolina and Georgia; Indian River grapefruit and oranges in the sunshine state of Florida. Appalachian Forest ~ Vermont, New Hampshire, upstate New York, Pennsylvania, West Virginia, North Carolina, Tennessee and Georgia ~ From the hardscrabble, forested hills of the Appalachians: maple syrup in the north; hominy corn (turned into grits) in the south; and wild foods like ramps and cress, scuppernong grapes, sourwood and tupelo honey. Southern Lowlands ~ from Kentucky south to Louisiana ~ Farm-raised, sustainable catfish along the Mississippi River delta; crawfish in bayous; rice and sugar cane in tropical lowlands; shell beans and peas, leafy greens, traditional sorghum syrup, limestone lettuce and gallberry honey; and wild foods like spicebush, sassafras, cress, paw paw and native persimmon. Eastern Plains ~ from Pennsylvania west to Illinois, north of the Ohio River, including Pennsylvania, Ohio, Michigan, Indiana, Illinois and Wisconsin ~ Mushrooms in Pennsylvania; sour cherries and orchard fruits in Michigan’s Upper Peninsula; Wisconsin and Ohio butter, milk, cheese; Ohio sweet corn; Indiana corn and melon; Great Lakes whitefish and lake perch; and wild foods like native persim-

18

mons, paw paws, hickory nuts, black walnuts and morel mushrooms, as well as clover and wildflower honeys. Western Plains ~ mid-section between the Mississippi River and Rocky Mountains, including Minnesota, the Dakotas, Iowa, Missouri, Kansas, Nebraska, Oklahoma and Texas ~ Beef and bison; wheat and sorghum, both for syrup and gluten-free flour; wines; honeycrisp apple and walleye pike in Minnesota; dried beans of all kinds in the Dakotas; red grapefruit, sweet onions, and wild-caught Gulf of Mexico shrimp in Texas; and wild foods like handharvested wild rice, native persimmons, paw paws, hickory nuts, black walnuts, northern pecans and morels, as well as clover, wildflower, sunflower and yaupon honeys. Rocky Mountains ~ Colorado, Montana, Wyoming, Idaho, Nevada and Utah ~ Rocky Mountain rainbow trout; quinoa, at higher altitudes; Idaho baking potato; lamb, elk and green chiles; and wild chokecherries and huckleberries. Desert Southwest ~ New Mexico, Arizona, parts of Colorado and Utah ~ Hatch and Chimayo chiles from New Mexico; blue corn, squash, avocados, prickly pear cactus; pepita and pine nuts; and gaujillo and orange blossom honeys. Pacific Coast ~ California, Oregon, Washington, Alaska and Hawaii ~ Oranges, dates, artichokes and wine and table grapes in California; stone fruits (sweet cherries, plums, nectarines and apricots), pears and apples in Oregon and Washington; pineapples, coffee, macadamia nuts and Wilelaiki blossom honey in Hawaii; shellfish such as oysters, clams, mussels; Dungeness and king crab off the coasts of Oregon, Washington and Alaska; wild-caught abalone, salmon, petrale sole and halibut from California north to Alaska; wild mint honey in Oregon; and wild salmonberries, thimbleberries and beach strawberries in Oregon, Washington and Alaska.

MileHighNaturalAwakenings.com


wisewords A Conversation with

MARIEL HEMINGWAY Her Kitchen Wisdom for Healthy Living by Giovanna Aguilar

T

his month Natural Awakenings speaks with Mariel Hemingway about her personal journey to achieving a healthy and happy life. The veteran actress has practiced and taught yoga for 20 years and avidly pursues avenues of sustainable living and holistic health. Her most recent books include Mariel’s Kitchen: Simple Ingredients for a Delicious and Satisfying Life and Mariel Hemingway’s Healthy Living From the Inside Out.

You are a big advocate of organic food, which can be pricey for families on tight budgets. How can healthy eating be accessible to all? It’s about choices. When people want to eat healthier and believe organic is too expensive, I ask them to consider how many times they buy café coffee or order out. When you start to look at food and how you live your life as a method of preventive medicine, it becomes obvious

My mother went to Le Cordon Bleu in Paris to learn how to cook. My family was crazy about food; growing up, I was obsessive about food and used it to fill a hole and replace love. I fasted and tried all kinds of diets, which eventually shut down my thyroid. I wound up needing to go to such extremes in order to find my center; now I’m privileged to be able to help other people find theirs. What I have realized is that instead of serving as a substitute for love, food should come from love as an expression of sharing and giving. You juggle many responsibilities and roles in your personal and professional life. What advice can you offer readers for achieving balance in their lives? You must make time for what’s most important to you. Ask yourself questions so that you can find places where you can pull back and reset your priorities. How much television do you watch? Are you taking time to exercise? Do you take five minutes to close your eyes, breathe and listen to internal whispers? It’s often the everyday places, people and things of value that work to keep you connected and balanced.

In Mariel’s Kitchen, you stress the importance of local seasonal eating. What do you consider an ideal meal? It’s important to connect nature with food—knowing where foods come from, knowing about local farms and farmers’ markets. My perfect meal is something that is very simple, fresh and seasonal. The key is to use the right ingredients, a little olive oil and herbs. One of my favorites is searing fish so that it is raw on the inside and serving it with a wonderful aioli or fruit salsa and a lightly steamed, seasonal vegetable.

How has food influenced your life?

that getting sick [due to poor nutrition and a weak immune system] is a lot more expensive. How did you come up with the concept for your health snack, Blisscuits? My mother had cancer when I was a child, and I was her primary caregiver, so I saw what chemotherapy and radiation did to her. When my ex-husband was diagnosed with cancer, I created the cookies as part of a healthy, holistic lifestyle that could help heal him. They are gluten- and sugar-free and healthful. He is now 11 years in remission and well because he made many good choices. Another reason I developed Blisscuits was to feed my daughters as they were growing up in a world of unhealthy snacks.

What projects are you working on that you’d like to share? I’m currently producing a film based on my grandfather’s book [referring to Ernest Hemingway], A Moveable Feast, and an environment-focused television show with my boyfriend and business partner, Bobby Williams, shot in amazingly beautiful places. It will start filming in the United States, but we plan to shoot internationally, starting with Costa Rica. Bobby and I are also writing a book, Be You Now. Connect on the Internet by visiting MarielHemingway.com and Twitter. com/MarielHemingway. Giovanna Aguilar is a freelance writer based in New York City. Reach her at LifestyleTargeting.com.

July 2010

19


localinsights with Katia I. Meier, MD and The Clear Sky Medical Team

I N F L A M M AT I O N If you feel tired all the time, and have unexplainable body aches, you may suffer from chronic inflammation. Inflammation acts like a slow burning fire, which tears down our bodies from the inside and makes us more susceptible to disease. Having a cumulative effect, it can be the precursor to more serious health problems. Common causes are dietary imbalances, which promote inflammation when too many pre-packaged and refined foods, which contain sugar and excess omega 6 fatty acids, are consumed, as well as the lack of consuming flavonoid and antioxidant-rich fresh vegetables and fruits which have potent anti-inflammatory benefits. Dietary imbalances can lead to obesity, which is a risk factor for multiple diseases, as well as a cause of inflammation. Fat cells are biologically active, secreting inflammatory substances (cytokines) which in turn promote insulin resistance and diabetes. Diabetes in itself is also an inflammatory disease, which untreated, leads to more complications. The key is to rev up your body’s anti-inflammatory defenses with powerful nutrients. The latest research shows that the plant extract reservatrol optimizes blood sugars in diabetes and activates Sirt 1, a gene that promotes longevity. Additionally, Omega 3 fatty acids are the building blocks for defending inflammatory cytokines. Boswellia serrata, an Ayurvedic herb used for centuries, inhibits inflammatory enzymes and counteracts over-activation of the inflammatory response. An additional key is having a healthy hormone balance, especially of insulin, cortisol, and sex hormones, since this will reduce inflammation and aid in tissue repair. Integrative medicine combines natural medicine and sound, cutting-edge research to address the root cause of inflammation, so you can live free of it without harm-causing drugs.

INTEGRATING CONVENTIONAL AND NATURAL MEDICINE FOR OPTIMAL HEALTH

Clear Sky Medical

Healthy Aging & Wellness Center 20

303.790.7860

10103 Ridge Gate Pkwy Aspen, Suite 221 Lone Tree, CO 80124

Summer: Balance the Element of Fire by Lori Perez

A

ccording to Traditional Chinese Medicine, as we enter summer we should align ourselves with nature’s expression of growth and maturation. This is an important time to enjoy plenty of exercise and outdoor activity, as our body, like nature, is at the height of its outward energy expression. Connecting with the earth and water elements is essential at this time of the year, to balance the fire energy of summer. The Element of Fire: In the Traditional Chinese health system, our relationship to our bodies and the fire elements of nature create within us a natural awareness to stay in motion and develop our connections in body, mind and spirit, as well as to develop acceptance to change, grow and be nourished. According to Chinese folk medicine, “The condition of the heart may be read in a person’s complexion. The heart fills the blood vessels and feeds the pulse.” A Heart in Balance: The heart rules our expression of joy, with imbalances showing up as sadness, an inability to create, or inappropriate laughter. A heart in balance results in true joyous expression of love, rather than an emotional need for fulfillment. In union, we are able to give freely to our self and to others with unconditional love. Achieving Balance: Schedule body treatments that focus on the complexion and use cooling and stimulating essential oils. A summer diet should be packed full of organic fruits and vegetables—raw, steamed or baked. Eat variety, in the colors of the rainbow. Consume small quantities of nuts, seeds and grains and decrease dairy and meats. For weak digestion, add foods such as red peppers, bell peppers, cayenne pepper, curry and tomatoes. Drink more herbal teas with cooling properties, such as raspberry, peppermint and lemongrass, orange hibiscus and jasmine. Add fresh fruit wedges to water to stay well hydrated and incorporate the cooling effects of the natural fruit juices. “Solarize” water and teas by placing them in a clear jar in the outdoor sunlight for one or two days. Seek out treatments to release old energy patterns of thought that are holding back the change our body desires this time of year. A nutritionist or herbalist can assist in customizing a physical and emotional “heart-healthy” diet. Hypnotherapy and traditional Chinese acupuncture are also useful. Throughout these warm summer months, remember to keep your mind open and clear, and listen to your heart. Lori Perez holds a master’s degree in Traditional Chinese Medicine and is the co-owner of Crowning Touch Healing Arts Center, in Parker. She has been in private practice for 16 years. Call 303-805-2282 or visit CTHealingCenter.com. See ad on page 13.

MileHighNaturalAwakenings.com


Exploring the Next Level of Healing By M. Darren Gregor

A

new science is emerging that is changing our traditional understanding of healing. The latest scientific research is focused on experiments quantifying the effects of new form of energy healing. Leading the way are two world-renowned scientists, William Tiller, Ph.D., and Gary Schwartz, Ph.D., and specifically their studies of Reconnective HealingÂŽ, first discovered by Eric Pearl, D.C. Tiller, Professor Emeritus at Stanford University, author of eight books and 250 scientific papers and star of the recent film, What The Bleep!?, has been conducting research on how the physical properties of a room or space change as a result of energy healing frequencies entering that room. When Tiller conducted his experiments on the Reconnective Healing frequencies in 2006, he found the results extraordinary enough to repeat the study in 2007. According to Tiller, this new, more comprehensive bandwidth of healing frequencies brings healing, â&#x20AC;&#x153;beyond just what has been classically known as energy healing, into a broader spectrum of energy, light and information.â&#x20AC;? Tiller found that these intelligent frequencies begin changing the quantum field effects of the room, or â&#x20AC;&#x153;conditioning the space,â&#x20AC;? days before the seminars began, increasing the â&#x20AC;&#x153;excess

free thermodynamic energyâ&#x20AC;? in the room that, if this were simply the energy of energy healing, the temperature of the room would had to have increased by 300 degrees centigrade! The initial findings are highly significant. Dr. Tiller continues, â&#x20AC;&#x153;This shift of energy is what allows human beings to enter a room and later to walk out with an ability to heal others and themselves.â&#x20AC;? In another research study, Dr. Schwartz, along with Dr. Melinda Connor at the University of Arizona, focused their research on Reconnective Healing Seminar attendees. In 2006 and 2007, Schwartz and his colleagues conducted their baseline energy healing studies measuring peopleâ&#x20AC;&#x2122;s abilities to work with, feel, transmit and receive light and other electromagnetic frequencies, before and after they attended a Reconnective Healing seminar. Of the more than 90 people who participated in the study, all walked out with permanently expanded and new electromagnetic abilities following the seminar, whether or not they had ever studied healing, or were masters/teachers of the various energy healing techniques known today, old or new. These studies show that traditional science and medicine can no longer approach health and healing the same way as before. New scientific exploration is validating the powerful effects that energy, light and information can have on people. Information about Dr. Eric Pearl and The Reconnection, or to register for a Reconnective Healing Seminar, Reconnective Yoga, Reconnective Kids!, or Mastery Conference event in Los Angeles, visit TheReconnection.com, call The Reconnection at 323-960-0012 or read Eric Pearlâ&#x20AC;&#x2122;s book, The Reconnection: Heal Others, Heal Yourself. See ad below.

ÂŽ Thein Boulder, Reconnection CO with Christine Upchurch These seminars and events will teach you about healing beyond anything youâ&#x20AC;&#x2122;ve read about, thought about, dreamed about! Find out whatâ&#x20AC;&#x2122;s baffling the medical community. Discover why hospitals and universities around the world are investing time and money to understand these unprecedented healings... and how you, too, can master this extraordinary work!

Christine Upchurch

Learn how to completely transcend â&#x20AC;&#x153;energy healingâ&#x20AC;? and â&#x20AC;&#x153;techniqueâ&#x20AC;? and access a level of healing beyond anything anyone has been able to access prior to now!

This is NEW! This is DIFFERENT! This is REAL!

+VMZr#PVMEFS $0 Beyond Energy Healing

taught by Christine Upchurch

Metaphyiscal Research Society of Denver

+VMZr#PVMEFS $0

The Reconnection: Heal Others, Heal Yourself presented by Christine Upchurch Boulder Center for Conscious Living

+VMZr#PVMEFS $0

Level I/II Seminar: Reconnective Healing taught by Christine Upchurch

The Westin Westminster

+VMZr#PVMEFS $0

Level III Seminar: The Reconnection

taught by The Reconnection Teaching Team

The Westin Westminster

For More Information and to Register: ^^^;OL9LJVUULJ[PVUJVTrPUMV';OL9LJVUULJ[PVUJVT Inside the US 1 888 ERIC PEARL (1 888 374 2732) Outside the US +1 323 960 0012

Local Contacts: Sabrina Fritts ZHIYPUH'ZHIYPUHMYP[[ZJVTr+1 720 935 6316 Mary Beth Kennedy THY`IRLUULK`'NTHPSJVTr+1 720 320 4669 or +1 303 589 8006

+VMZr%FOWFS $0

Reconnective Kids! Workshop

for children 4-7 yrs old (with parent) for children 8-14 yrs old (children only)

taught by Sabrina Fritts Eli Ashby Healing Arts Center Eric Pearl and The Reconnection, LLC, in connection with The ReconnectionŽ and Reconnective HealingŽ, including but not limited to seminars, teachings, any information or people, including but not limited to practitioners, instructors, assistants, representatives, associates, employees, agents and assignees related thereto, make no promises, guarantees, representations and or warranties regarding medical diagnosis and or medical treatment, and are neither diagnosing nor treating specific health challenges. You are solely responsible for your own medical care. Registration fees are non-refundable, but are transferable to another Reconnection Seminar up to one year from seminar date. Should you need to cancel, please contact our office at +1 323 960 0012. The Reconnection, LLC reserves the right to change the seminar instructor for each seminar without notice. Š 2010 The Reconnection, LLC

July 2010

21


localinsights Train Your Brain By Lisa Grunden

T

oday, the airwaves are bombarded with promotions for heart health, skin care products to make us look younger, exercise programs, diet and weight loss programs, healthy living and more. Rarely does a consumer ad suggest that healthy living has anything to do with taking care of the brain, which is responsible for speech, memory, balance, emotion, love and consciousness. This thinking organ learns and grows by interacting with the world through perception and action. Mental stimulation improves brain function and actually protects against cognitive decline, as does physical exercise. A study done by the National Council on Aging (NCOA) determined that human mental decline typically begins before the age of 40. Thanks to scientific research, we now know that the human brain is able to continually adapt and rewire itself. Even in old age, it can grow new neurons. Severe mental decline is generally caused by disease, whereas most age-related losses involving memory or mo-

Tools for your soulâ&#x20AC;&#x2122;s journey Huge selection of books in all spiritual philosophies, Music for meditation, yoga and relaxation, comprehensive wellness center. Large selection of herbs and essential oils.

20% OFF YOUR FIRST PURCHASE - MENTION THIS AD

5$TQCFYC[Ĺ&#x2013;'PINGYQQF%1

Ĺ&#x2013;YYYKUKUDQQMUEQO WALK-IN APPOINTMENTS WELCOME IN THE ISIS HEALING OASIS!

*[RPQUKU2CKP4GNKGH%QWPUGNKPI Massage and more! Psychic Readings available 7 days a week. 22

tor skills result from inactivity and lack of mental exercise and stimulation. Follow these BRAIN training tips to nurture the bodyâ&#x20AC;&#x2122;s most vital, mysterious organ. Be consciousâ&#x20AC;&#x201D;play and laugh more. Learn new things. Do crossword puzzles or take a class. Restful sleep is replenishing. Relax, unwind and sleep well to recharge your energy. Lack of sleep leads to fatigue, a suppressed immune system, and memory, concentration and mood disorders. Move. Take dance lessons, go for a walk and ride your bike. Exercise will help prevent nearly every age-related disease. Inner â&#x20AC;&#x153;house cleaningâ&#x20AC;? keeps the mind clear and alert. Negative thoughts and beliefs, much like toxins, have a negative impact on the body. Author Wayne Dyer says, â&#x20AC;&#x153;If you realized how powerful your thoughts are, you would never think a negative thought.â&#x20AC;? Nourish the brain. Reduce your consumption of white sugar and flour. Eat delicious, in-season foods from all of the colors of the rainbow. Good nutrition for the body is good for the brain. Changing lifelong patterns may seem difficult at first, but follow these empowering brain training tips and see how quickly things can shift. The Fast Focusing Center offers innovative, non-drug approaches to working with memory, concentrated focus and releasing negative thoughts and emotions to significantly improve healthier minds. 303-708-8817 or FastFocusingCenter.com. See ad on page 13.

What is Ai Chi? By Willow Saunders

L

i t t l e Iknown but highly beneficial to health and overall wellbeing, Ai Chi is a simple yet disciplined 16-part sequence of movements performed while standing in chest- to neck-deep warm water. Ai Chi stems from Watsu, an aquatic form of bodywork developed by Harold Dull in 1980. Ai Chiâ&#x20AC;&#x2122;s warm water supports every move, offering a unique form of meditative exercise that breathes flexibility into all systems of the self. The breath, the most important aspect of Ai Chi and the key to balancing the autonomic nervous system, is the first thing taught, but the last thing learned. Breathing is synchronized with active stretches, at an individualâ&#x20AC;&#x2122;s pace and range of motion, which helps to integrate a soothing breath, connecting body and mind. Regular practice facilitates access to deeper breathing and helps individuals change their everyday breathing patterns.

MileHighNaturalAwakenings.com


Ai Chi works well for a variety of abilities. The water provides support for individuals with limited mobility and those with a healthy range of motion; it facilitates the opening of closed, tight or painful areas and encourages the flow of chi, the vital life force, through the bodyâ&#x20AC;&#x2122;s energy channels, or meridians. Meridians can become stagnant or closed, blocking a healthy flow of chi, which can manifest as pain or disease. During supported active stretches, participants benefit from the meditation or contemplation aspect of Ai Chi. â&#x20AC;&#x153;Directing the focus inward and feeling the movement inside the body helps an individual recognize the breath throughout the entire body, not just in the lungs and chest,â&#x20AC;? notes Petri. The water facilitates motion through buoyancy, allowing a gentle stretch, and provides resistance that can help build strength. â&#x20AC;&#x153;I can move in water in ways that I cannot even come close to moving on land,â&#x20AC;? advises Petri. â&#x20AC;&#x153;In my opinion, my ability to increase my range of motion in the water stimulates and revives my damaged nervous system.â&#x20AC;? â&#x20AC;&#x153;One of my students, who has been in the Ai Chi class for the last three months, said the experience was not only invigorating but also helped his range of motion and gave him the strength to play sports better than he has for many years,â&#x20AC;? advises Petri. According to Petri, Ai Chi improves overall posture, core flexibility, stabilization and strength, thus improving balance. It also relieves upper back and neck stress, reduces anxiety, improves sleep, relaxes muscles, relieves pain and reduces symptoms of chronic disorders. Petri says regular practice can have neurobiological, cardiorespiratory, metabolic, musculoskeletal, endocrine and cognitive benefits. Visit AiChiWithPetri.web.com or email AquaFreeFlow@gmail.com. Ai Chi classes are held from 7 to 8 p.m., Thursday, at the Sheraton Denver West-Aura Wellness Center. Call 720-963-2043 or visit SheratonDenverWest.com/fitnessstudio-classes. Free one-hour Watsu with each 10 punch card by appointment with Petri ($60 value), if you saw this in Natural Awakenings. See ad on pg x for class prices. For a video demonstration, visit YouTube.com/user/aichiitalia#p/a/u/0/ anplxTKNIHI. See ad on page 27.

4501USZJOHUPEJBHOPTFZPVSTFMG *UTUJNFUP45"35EPJOHTPNFUIJOHUIBUXPSLT t"DVQVODUVSF t)FBMUIBOEOVUSJUJPODPOTVMUBUJPO t$IJSPQSBDUJDDBSF t)FSCBMTVQQMFNFOUTNBEFPOTJUF t%BSLĂśFMENJDSPTDPQZ t5IFSBQFVUJDNBTTBHF t5IPVTBOETPGIBQQZDMJFOUT

1SBDUJDBM"EWJDF

$BSJOH&YQFSUT (VBSBOUFFE3FTVMUT PS XXX5IF(SFFO)FSCDPN

NEED A GOOD RECIPE?

FoodieView.com, a recipe search engine, makes it easy for readers to tap into a million recipes organized by category from many of the Internetâ&#x20AC;&#x2122;s most popular cooking sites. July 2010

23


bookreview

WILD AND WEEDY APOTHECARY By Karen Charboneau-Harrison

J Readings Find out the angels' messages for your life.

Catherine Morgan 720-290-4902 Sign up online for free weekly angel messages at www.theangelscircle.com.

ust outside your doorstep or kitchen window, hidden beneath a tall pine tree or twining through porch latticework, a wild and weedy apothecary waits to be discovered. Herbalist Doreen Shababy shares her deep, abiding love for the earth and its gifts in this collection of herbal wisdom that represents a lifetime of work in the forest, field, and kitchen. This herbalism guidebook is jam-packed with dozens of tasty recipes and natural remedies, including Glorious Garlic and Artichoke Dip, Sunny Oatmeal Crepes, Candied Catnip Leaves, Lavender Lemonade, Roseberry Tea, Garlic Tonic, Parsnip Hair Conditioner, and Dream Charms made with Mugwort. Most people think of healing herbs as those used in salves, tonics,

Natural Treatment for Your

Learning Challenges Â&#x2021;&ORVHG+HDG,QMXULHV Â&#x2021;$''$'+' Â&#x2021;$Q[LHW\'LVRUGHUV

Fast Focusing Center ,QYHUQHVV&LUFOH(DVWÂ&#x2021;$Â&#x2021;&HQWHQQLDO&2

Â&#x2021;)DVW)RFXVLQJ&HQWHUFRP 24

MileHighNaturalAwakenings.com

and teas. They can also be part of entertaining entrees, satisfying side dishes, and even delectable deserts! This encyclopedic book Doreen Shababy begins with ISBN 0738719072 complete information on how to set up your kitchen so you can become a master of herbal and culinary arts. Then youâ&#x20AC;&#x2122;ll take a fun, A-to-Z walk through Shababyâ&#x20AC;&#x2122;s favorite â&#x20AC;&#x153;cures,â&#x20AC;? including teas and tonics, baths and salves, and delicious foods. Filled with the authorâ&#x20AC;&#x2122;s extensive knowledge of herbalism (she was the publisher of a journal on herbs for six years) and presented with her pleasant wit and wisdom, youâ&#x20AC;&#x2122;ll be amazed to discover that the answers for your sneezes and itches, your stresses and aches, can be found right in your garden. The value of organic, local, and homegrown foods is also revealed in this rich book full of information, fun and delightful recipes. Karen Charboneau-Harrison is the owner of Isis Books, Gifts and Healing Oasis. A Master Herbalist since 1980, she finds this book very useful and lots of fun!

Parentsâ&#x20AC;&#x2122; Day on July 25 honors responsible parenting and uplifts ideal parental role models for our nationâ&#x20AC;&#x2122;s children. ~ ParentsDay.com


calendarofevents

FRIDAY, JULY 9

NOTE: All Calendar events must be received by July 10 (for August issue) and adhere to our guidelines. Visit www.MileHighNaturalAwakenings.com for guidelines and to submit entries. th

THURSDAY, JULY 1 Summer Concert Series at Denver Botanic Gardens â&#x20AC;&#x201C; Natalie Cole. 7 pm; gates open at 6pm. Unrivaled ambience of thousands of blooming plants and the crystal clear music of some of the worldâ&#x20AC;&#x2122;s most sought-after artists. $65 members, $70 non-members. 888-440-9568. Concerts.Denverbotanicgardens.org Energetic Boundries/Student Space â&#x20AC;&#x201C; 7-8:30 (9) pm. Want tools? Learn EB in the first six classes for $25/class. Got tools (completed EB class)? Guided by Rev. DebraRae, youâ&#x20AC;&#x2122;ll create â&#x20AC;&#x153;your space,â&#x20AC;? run â&#x20AC;&#x153;your energy,â&#x20AC;? work energetic dynamics, create mock-ups and trade healings ($10). Sacred Spaces Center, 223 Titan St, Aurora. 303-365-0200, www.SacredPlacesAndSpaces.com.

SATURDAY, JULY 3 Cherry Creek Arts Festival â&#x20AC;&#x201C; July 3-5. Coloradoâ&#x20AC;&#x2122;s signature cultural celebration of the visual, culinary and performing arts. Free. Cherry Creek. Colorado. com/Events. Animals Welcome at Heath Fair â&#x20AC;&#x201C; 12-5pm. Sessions available with Lorraine May of Misha May Foundation can include any combination of animal communication, Custom Flower Essence Remedy, behavior Advice or Reiki. Bring oneâ&#x20AC;&#x2122;s animal. $30/30 min or $60/60 min. The New Journey Books and Center, Indian Tree Center, Wadsworth Blvd and 77th Dr. RSVP: 303-239-0382 or MishaMayFoundation@gmail.com. An Evening at Lumonics â&#x20AC;&#x201C; 9pm. It looks like a warehouse on the outside, but it is truly another world once entered. Magical light sculptures and fountains help create the cool vibes and sense of community that prevails. A multi-sensory experience like no other. $12. Lumonics, 800 E 73rd Ave, Unit 11, Denver. 303-568-9406.

SUNDAY, JULY 4 Evergreen Music Festival â&#x20AC;&#x201C; All-day music festival featuring National Repertory Orchestra, Denver Brass and more. $10/adults; $5/5-15yrs; free/under 5yrs. 29614 Upper Bear Creek Rd, Evergreen. 303-679-6869. Spiritual Gathering & Aura Healing Clinic â&#x20AC;&#x201C; 11 am-12:30 pm. A spiritual gathering of blessings, love, healing, empowerment and community. Church is followed by an aura healing clinic and lunch at Mimiâ&#x20AC;&#x2122;s CafĂŠ. Rev DebraRae, Officiating Minister. Donations accepted. 223 Titan St, Aurora. Sacred Spaces House of Light, 223 Titan St., Aurora, 303-365-0200, www.SacredSpacesAndPlaces.com.

TUESDAY, JULY 6 Meditation for Living â&#x20AC;&#x201C; 7-9pm. A 5-wk program to

bring the benefits of meditation into oneâ&#x20AC;&#x2122;s life. Release stress, worry and anxiety. Move into greater peace and joy. Heal pain and discomfort. Move into greater health to clear blocks to growth. Move into greater creativity. $150. 2730 S Wadsworth Blvd, Lakewood. 720-413-7303. The Center of Well-Being Pranic Healing Clinic â&#x20AC;&#x201C; 7-9pm. Pranic Healing is a non-touch, painless, healing art and science that acts as a powerful catalyst to spark the bodyâ&#x20AC;&#x2122;s inborn ability to repair itself. It utilizes prana to balance, harmonize and transform the bodyâ&#x20AC;&#x2122;s energy processes. Free. 1385 Carr St, Ste 6, Lakewood. 303-667-2223.

WEDNESDAY, JULY 7 EFT: Boost Health, Eliminate Fears, Forget Phobias â&#x20AC;&#x201C; 6:15-8:45pm. Done rearranging oneâ&#x20AC;&#x2122;s life around phobias, fears and health issues? Others are freeing themselves from issues that have limited and frustrated them for decades. One can, too. Class includes a second session on July 14. $59. Arapahoe Community College, Community Education, Littleton. Register: 303-797-5608.

THURSDAY, JULY 8 Denver Metro Holistic Moms Network Monthly Meeting â&#x20AC;&#x201C; 6:30pm. With Lori Roop, clinical herbalist. She will share information on how to create oneâ&#x20AC;&#x2122;s own natural and herbal first aid kits for oneâ&#x20AC;&#x2122;s kids. Learn about how to take care of sore muscles and bruises, open-skin abrasions, splinters and other invasions, plus more. Free. Denver Waldorf School, 940 Fillmore St, Denver. 720-810-5593. HolisticMoms.org. First Steps-Healing from Recent Loss â&#x20AC;&#x201C; July 8-10 7-9pm, Thur and Fri; 8am-12pm, Sun. First Steps is a facilitated support workshop for individuals in the painful stages of recent loss due to physical death. In three meetings, the process of mourning and the depths and manifestations of grief are explored. $10. Vogt Center, Classroom 2, 9077 W Alameda Ave, Lakewood. MileHiChurch.org. Map & Compass Basics â&#x20AC;&#x201C; 7pm. This class is aimed at the newcomer to map and compass. No experience necessary. Free. Denver REI, 1416 S Platte, Denver. REI.com. Nutritional Cleansing 101 â&#x20AC;&#x201C; 7-8:30pm. A revolutionary new cleansing/fat burning system. A totally natural, safe and effective program to rid oneâ&#x20AC;&#x2122;s body of the harmful toxins built-up over oneâ&#x20AC;&#x2122;s lifetime. Limited seating. Free. 65 S Wadsworth Blvd, Lakewood. 303-934-3600. Open Door Reading Space â&#x20AC;&#x201C; 7-8:30 pm. In a group setting, Rev. DebraRae will channel your guides & angels. (July: Medium Communication) $20. Sacred Spaces Center, 223 Titan St, Aurora. 303-365-0200. www.SacredPlacesAndSpaces.com.

EFT Practice Group (Emotional Freedom Technique) â&#x20AC;&#x201C; 6-7:30pm. A practice group for people with a basic understanding of Emotional Freedom Technique. If donâ&#x20AC;&#x2122;t know EFT, take the July 7 class or call for other ways to learn. Free. Location and info: 303-955-7532. Summer Concert Series at Denver Botanic Gardens â&#x20AC;&#x201C; Glen Campbell. 7 pm; gates open at 6pm. Unrivaled ambience of thousands of blooming plants and the crystal clear music of some of the worldâ&#x20AC;&#x2122;s most sought-after artists. $62 members, $67 non-members. 888-440-9568. Concerts.Denverbotanicgardens.org.

SATURDAY, JULY 10 EFT Q&A Radio Call-in Show â&#x20AC;&#x201C; 8am-8:30pm. Emotional Freedom Technique is an easy skill that people are using to free themselves from trauma, phobias, fears, even health issues. Personal EFT question? Call 917-889-7601. ClearSourceCoaching.com. Improv with Erica â&#x20AC;&#x201C; 9am-4:30pm. Experience with Erica Teel the art of improvisation in a safe, friendly atmosphere. The workshop is designed for casting out preconceived notions, being spontaneous and living in the moment. $125. Mile Hi Church, 9077 W Alameda Ave, Lakewood. Register: 303-246-9882 or IlluminedPath.com. The Prosperity Shift â&#x20AC;&#x201C; 9:30am-4pm. Karen Sherwood, founder of Womenâ&#x20AC;&#x2122;s Small Biz Network gives an interactive workshop exploring how to make those subtle, yet powerful, shifts to open the flow of abundance in our lives. $97. 8747 N Sheridan Blvd, Arvada. TheCreativeLivingCenter.com. Brown Dog School Adoptathon â&#x20AC;&#x201C; 11am-3pm. Adoptathon/Fundraiser for many rescue groups. Adopt, foster or volunteer. Misha Mayâ&#x20AC;&#x2122;s adoptable animals will be present and will have a table with merchandise and info. Volunteer hrs: 9am-5pm. 9900 W 44th Ave, Wheatridge. MishaMayFoundation@gmail.com. Tagawa Gardens Grey Kittyâ&#x20AC;&#x2122;s Birthday â&#x20AC;&#x201C; July 10-11. 11am-3pm. Adoptathon/Fundraiser for many rescue groups. Adopt, foster or volunteer. Misha Mayâ&#x20AC;&#x2122;s adoptable animals will be present, and sheâ&#x20AC;&#x2122;ll have a table with merchandise, and info. Volunteer hrs: 9am-5pm. 7711 S Parker Rd, Centennial. MishaMayFoundation@gmail. com. TagawaGardens.com.

SUNDAY, JULY 11 A Seth Material/Abraham-Hicks Comparative Class â&#x20AC;&#x201C; 12-2pm. This class will give an overview of both of these brilliant, channeled materials as well as compare their core teachings. Discover how complementary these two bodies of work are and how if studied together can truly enhance oneâ&#x20AC;&#x2122;s life. $15. Isis Books, 2775 S Broadway, Denver. 303-918-1204. Summer Concert Series at Denver Botanic Gardens â&#x20AC;&#x201C; Serj Tankian and the Colorado Symphony Orchestra. 7 pm; gates open at 6pm. Unrivaled ambience of thousands of blooming plants and the crystal clear music of some of the worldâ&#x20AC;&#x2122;s most sought-after artists. $49 members, $54 non-members. 888-440-9568. Concerts. Denverbotanicgardens.org

Have You Heard of Arginine Yet? Â&#x2021;1REHO3UL]HZLQQLQJUHVHDUFKLQDVDIHQDWXUDOVXSSOHPHQW Â&#x2021;3URYHQWRLQFUHDVHQLWULFR[LGHSURGXFWLRQLQWKHERG\ Â&#x2021;6LJQLILFDQWEHQHILWVLQWKHWUHDWPHQWUHYHUVDORIFRURQDU\ DUWHU\GLVHDVHGLDEHWHVHUHFWLOHG\VIXQFWLRQDQGPRUH Â&#x2021;3UHYHQWLYHKHDOWKFDUHLQDSURSULHWDU\IRUPXOD For medical studies and more information contactâ&#x20AC;Ś

PHASE 2 Technologies

www.MiracleOfHealth.com

303-693-9391

Mail@phase2online.net

Synergy Independent Distributor ID# 821627

July 2010

25


Improv with Erica – 1:45-5pm. Experience with Erica Teel the art of improvisation in a safe, friendly atmosphere. The workshop is designed for casting out preconceived notions, being spontaneous and living in the moment. $125. Mile Hi Church, 9077 W Alameda Ave, Lakewood. Register: 303-246-9882 or IlluminedPath.com. Understanding Dogs – 2-4pm, Sundays July 11-August 15. Integrative, holistic approach to training, behavior, health and healing, including obedience, reiki, flower essences, calming techniques and communication. Includes a behavior consultation / coaching session / treatment plan for each participating dog. One Human/one Dog $150; Additional human $45; Fee for Human without dog $90. RSVP req’d 303-239-0382 or email mishamayfoundation@gmail.com. Sage Valley Pet Center, 16400 West 54th Avenue, Golden.

MONDAY, JULY 12 Regain Freedom & Strength with Somatics – 5:30pm. Somatics movement therapy is gentle movements that release tight muscles. Contracted muscles often can’t relax. Somatics, aka Modern Man’s Yoga, relaxes these muscles, often quickly. Regain freedom, strength and control. 5 wks. $40-45. 4005 Kipling St, Wheatridge. 303-231-1300. Discover Your Inner Pharmacy – 7pm. This workshop awakens one to a powerful tool within “Your Inner Pharmacy” for creating health, growth and well being. Learn how to improve health, extend life, make good chemicals and reduce production of bad chemicals in one’s body. $30. Vogt Center, 9077 W Alameda Ave, Lakewood. 303-237-8851. Flower Essences for People and Animals – 7-9pm. Immediately begin to choose remedies for oneself, family, friends, plants and animals, when one feels out of balance, to create a custom remedy to address deeper problems, and to respond confidently in certain emergency situations. Fee includes an information packet and all supplies necessary for a custom remedy. $35; $25 if paid by July 5. Center for Wholistic Health, 8600 W 14th Ave, Lakewood. 303-239-0382. The Hike Club – 7pm. The Hike Club is a free club, open to anyone of any skill level. Features weekday hikes and weekend hikes. There are 1-2 weekday hikes within 30 minutes from downtown Denver, and 1-3 weekend hikes per month within about 3 hours of Denver. Free. Denver REI, 1416 S Platte, Denver. REI.com.

TUESDAY, JULY 13 EFT-Miracle Tool for Your Parenting Toll Box – 6:15-8:30pm. Replace force and blame with this easy, do-it-yourself tool to dissolve tantrums, nightmares, shyness, phobias, migraines, etc. Kids can grow up free of emotional baggage. Use it for you, too. Includes a session on July 27. $59. Arapahoe Community College, Community Education, Littleton. Register: 303-797-5608.

WEDNESDAY, JULY 14 Seth Material Discussion Group – 7:30-9:30pm. Familiar with the Seth Books or Abraham-Hicks? Believe that one can create own reality and that thoughts manifest the world around us? Have fun and meet fellow Seth Readers and discuss the main

concepts in Seth/Jane Roberts books. Free. 1140 Elm St, Denver. 303-918-1204. Beyond Energy Healing – 7pm. By Christine Upchurch. Metaphysical Research Society. mrsdenver.org.

THURSDAY, JULY 15 Oneness Blessing – 5:30pm. This non-denominational benediction can accelerate spiritual growth and deepening. It assists the recipient in a more heartfelt experience of Oneness and the Divine. Love offering. Mile Hi Church, 9077 W Alameda Ave, Lakewood. MileHiChurch.org/Events/Calendar.asp. Summer Concert Series at Denver Botanic Gardens – Jamie Cullum with Special Guest. 7 pm; gates open at 6pm. Unrivaled ambience of thousands of blooming plants and the crystal clear music of some of the world’s most sought-after artists. $52 members, $57 non-members. 888-440-9568. Concerts. Denverbotanicgardens.org The Reconnection: Heal Others, Heal Yourself – 7pm. By Christine Upchurch. Boulder Center for Conscious Living. consciousboulder.com. Parent Event – 6:30pm. Brain Balance Achievement Centers are for families with children struggling with ADHD, dyslexia, autism, aspergers, PDD and OCD. We will be talking about what is happening in the brains of our children, why it is happening and how the Brain Balance Program works to make corrections in the brain. 1211 Avery St, Golden. 303-278-1780. Outdoor Film Series – Movies begin at dusk. Gates open at 7pm. Adults, Seniors and Children: $5. Members: $4. Children 3 and younger: Free. Tickets can be purchased online beginning May 10 and at each event. botanicgardens.org/content/outdoor-movies for schedule. Botanic Gardens at Chatfield. 303-278-1780. Energetic Boundries/Student Spaces – 7-8:30 (9) pm. Want tools? Learn EB in the first six classes for $25/ class. Got tools (completed EB class)? Guided by Rev. DebraRae, you’ll create “your space,” run “your energy,” work energetic dynamics, create mock-ups and trade healings ($10). 223 Titan St, Aurora. Sacred Spaces House of Light, 223 Titan St., Aurora, 303-365-0200, www.SacredSpacesAndPlaces.com.

FRIDAY, JULY 16 The Self-Love Tool Kit: Great Workshop – 9am-1pm. How is your relationship with You? This workshop will provide one with a replenished sense of self-esteem, self-confidence, and self-love. Learn 7 important tools to strengthen one’s relationship with the most important person in one’s life: You. $79. 7900 E Union Ave, Ste 1100, Denver. 303-921-1473. EFT Clinic for Stress/Anxiety Relief – 6:45-8:30pm. EFT is acupuncture without the needles, and often works where nothing else will. Tap on specific stress relief points on one’s body. It is amazingly fast, and easy to learn and use. Bring some anxious thoughts with you, and leave without them. $20. 1385 Carr St, Ste 6, Lakewood. 303-667-2223. Enhancing Healthy and Wholesome Relationships – July 16 and 17. 7-9:30pm, Fri; 9am-4:30pm, Sat. Learn and grow into a clear understanding of the love one

deserves. Gift oneself and share it with one’s partner. Discover one’s spiritual right to a successful and loving relationship. Learn healthy key ingredients of effective communication. $60/one; $90/two. Community Center, 9077 W Alameda Ave, Lakewood. 303-237-8851.

SATURDAY, JULY 17 Moonlight Classic – There’s something wild about cruising on one’s bike in the middle of the night. Imagine the exhilaration of pedaling through the deserted streets of Denver with the magnificent light of the moon defining the course for you and thousands of other cyclists. Register by July 14. $35/adults; $20/under 12; $30/seniors. After July 15 prices go up $5. Info: Moonlight-Classic.com/Reg.html. Divine Feminine Workshop – 9am-7pm. An opportunity to get in touch with one’s feminine side. Fantastic speakers; organic lunches and snacks. Showcase one’s business by being a sponsor or exhibitor. $35. 1820 E Colfax, Denver. Info and Registration: WisdomByNature.org. Reconnective Healing Seminar – The Westin Westminster. TheReconnection.com. Awakening to the Secret Code of Your Mind – 10am5pm. One- day workshop based on Dr Darren Weissman’s book, Awakening to the Secret Code of Your Mind. Learn the 1-2-3 Plan of The LifeLine Technique, a quantum healing technology that incorporates the blueprint of the subconscious mind. $125 + book. Full Moon Books & Event Center, 9106 W 6th Ave, Lakewood. 303-956-2382.

SUNDAY, JULY 18 Urgent Messages from Mother Earth – 1pm. New Dawn Center for Spiritual Living is proud to host “Earth Monk” Adam Chapuis, author of the book Voices of the Earth: Life Lessons from a Blue Planet for a talk and Q&A. Fee includes light lunch. $8. New Dawn CSL, 1680 S Chambers Rd, Aurora. 303-369-8222. ScienceOfMind.org. Reconnective Healing Seminar – The Westin Westminster. TheReconnection.com. Spiritual Gathering & Aura Healing Clinic – 11 am-12:30 pm. A spiritual gathering of blessings, love, healing, empowerment and community. Church is followed by an aura healing clinic, refreshments and community. Rev DebraRae, Officiating Minister. Donations accepted. 223Titan St, Aurora, 303-365-0200, SacredSpacesAndPlaces.com.

MONDAY, JULY 19 The Reconnection Seminar – The Westin Westminster. TheReconnection.com

TUESDAY, JULY 20 New Cleansing Seminar – 7-8:30pm. A revolutionary new cleansing/fat-burning system. A totally natural, safe and effective program to rid one’s body of the harmful toxins built-up over one’s lifetime. Limited Seating. Free. 65 S Wadsworth Blvd, Lakewood. 303-934-3600. Prosperity Circle – 7pm. Rumor has it the Jesuit Order of the Catholic Church came by its great wealth through doing “Prosperity Circles.” Each person speaks their

LOSE 30 POUNDS IN 30 DAYS FREE CONSULTATION $OOHYLDWH&RQVWLSDWLRQ‡,QFUHDVH0HWDEROLVP ,PSURYH7K\URLG)XQFWLRQ‡1RKHDY\H[HUFLVH 1RIUR]HQRUSUHSDUHGIRRGVWREX\

massage therapy nia classes transformation breath coaching

Jodi Winter, N.D. 'HQYHU7HFK&HQWHU

,QWHJUDWLYH+HDOWK,QFFRP‡ 26

MileHighNaturalAwakenings.com


heart’s desire which is prayed for by the others in the group. Donation. The New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773. The Reconnection Seminar – The Westin Westminster. TheReconnection.com

WEDNESDAY, JULY 21 Feng Shui 101: An Introductory Talk – 7pm. With feng shui practitioner Kathie Seedoff. An introductory talk on the ancient Chinese practice of interior design. Learn simple steps one can do to enhance the flow of Qi in one’s home or office. Free. 1882 S Pearl St, Denver. 303-777-2877. Reconnective Healing with Animals – 10am-6pm. Reneé Coltson, Practitioner Mentor and Associate Instructor of The Reconnection® is offering a jam-packed workshop. Achieve a greater depth of understanding of the science, art and philosophy of Reconnective Healing® while advancing your level of expertise. Designed to be a fun-filled experience working and playing with the frequencies in a classroom environment as well as hands on with a variety of animals at the facility. Crestone Farms – Old MacDonald Barnyard Rescue. 480-595-0888. crestonefarm.com/Barnyard.html.

THURSDAY, JULY 22 Denver Botanic Garden Free Day – Colorado residents can enjoy a special free day at the Gardens, thanks to funding from the SCFD. Free Days occur during regular Gardens hours only, and do not include ticketed events. York Street location only.

SATURDAY, JULY 24 World Service Meditation – 7:15-8:30pm. Each month Denver Meditation Service Group meets to link with groups throughout the world to contact and direct divine energies toward the world’s need for universally expressed goodwill. Join us in working with the energies available in Leo. Free. Denver. DenverMeditationService.org. An Evening at Lumonics – 9pm. See July 3 listing. Lumonics, 800 E 73rd Ave, Unit 11, Denver. 303-568-9406.

SUNDAY, JULY 25 Labyrinth – 4-8pm. A quiet, self-guided meditative walk that has taken place in all religious traditions in various forms around the world. Free. Community Center, 9077 W Alameda Ave, Lakewood. 303-237-8851.

MONDAY, JULY 26 Beginning Animal Communication – 7-9 pm. Learn the fundamentals of communication. Includes intuitive techniques and handouts, and will outline follow-up practice. $25 if paid by July 19, $30 thereafter. Center for Wholistic Health, 8600 W 14th Ave, Lakewood. RSVP 303-239-0382 or MishaMayFoundation@gmail.com.

TUESDAY, JULY 27 Secrets to Longevity: Mind Tools and Brain Games – 7-8:30pm. Just as one’s muscles need to be exercised in order to avoid atrophy, so does one’s brain. Human mental decline typically begins before age 40. Learn secrets to sharpen one’s memory, focus concentration, heighten awareness and age youthfully. $30; $21/2+. 88 Inverness Circle E, Ste H107, Centennial. 303-708-8817.

Hi Church, 9077 W Alameda Ave, Lakewood. MileHiChurch.org/Events/Calendar.asp. Sex, Lies and Rattlesnakes – 7pm. With Mary Ann Bonnell, a biologist who tracked Colorado’s prairie rattlesnakes for over two years. Her presentation will explore the fascinating sex life of rattlesnakes, examine common myths, and foster appreciation for a creature many people fear. Free. Denver REI, 1416 Platte St, Denver. REI.com. The Kitchen Ecosystem Lecture with Eugenia Bone, Food Writer – 7pm. For Eugenia Bone, the kitchen is an ecosystem with dishes in all stages of life: a bounty of mushrooms or artichokes might, simultaneously, be going into preserves, the freezer, soup stock and dinner. An avid canner, Bone writes not only about how to preserve foods but also how to merge food preservation into a daily kitchen routine. 5:15pm:Tour of seasonal edible plants in the Gardens ($5 additional, limited to 25 people); 6pm: Social hour and tasting, hosted by Slow Food Denver (Mitchell Hall); 7pm: Program and book signing (Mitchell Hall). Pre-registration for individual Bonfils-Stanton programs: $20 member, $25 non-member. Entire series: $110 member, $140 non-member. Day of the event: $30, if space available.To register, and for a complete schedule of the Bonfils-Stanton Lecture Series, botanicgardens.org, “programs” link, e-mail registrar@ botanicgardens.org or 720-865-3580.

SATURDAY, JULY 31 Wilderness First Aid Course – July 31 and Aug 1. 9am. REI is collaborating with the Wilderness Medicine Institute of NOLS to offer a comprehensive two-day course that will teach one the wilderness medicine skills need to recreate with confidence in the backcountry. $200/member; $220/nonmember. Denver REI, 1416 Platte St, Denver. REI.com. Speaking of Seth – 10:30am-12:30pm. Want answers to life’s most important questions? Discover who is Seth? Seth on: One creates one’s own reality, illness and suffering; the purpose of existence and more. Learn how to use the incredible source of power and wisdom that lies within. $15. Isis Books, 2775 S Broadway, Denver. 303-918-1204. Psychic & Healing Fair – Noon – 5 pm. Rev. DebraRae available for readings at fair rates of $20/20 min.; healing modalities offered may include Aura Healings, Egyptian Rod Healings, Tuning Fork Balancing, Chair Massage, Chi Machine, Reiki, Ionizer Detox Foot Bath; plus vendors’ merchandise. Come for an hour or come for the day!

LOOKING AHEAD TO AUGUST SATURDAY, AUGUST 7 The Art of Thriving 2-day Workshop – Aug 7 and 14. 3:30-5:30pm. 2 Saturdays. Based on the Abraham Material. Just survive in life? Or thrive? This fun-filled 2-day workshop will be filled with lots of hands-on activities, discussions, games and thriving tools to help one learn how to become the “Ultimate Thriver.” $35. Isis Books, 2775 S Broadway, Denver. 303-918-1204.

Summer Concert Series at Denver Botanic Gardens – Mary Chapin Carpenter with Dar Williams. 7 pm; gates open at 6pm. Unrivaled ambience of thousands of blooming plants and the crystal clear music of some of the world’s most sought-after artists. $55 members, $60 non-members. 888-440-9568. Concerts.Denverbotanicgardens.org

Ah, summer, what power you have to make us suffer and like it.

THURSDAY, JULY 29

~Russell Baker

WEDNESDAY, JULY 28

Oneness Blessing – 5:30pm. See July 15 listing. Mile

\

THURSDAY, AUGUST 12 Nutritional Cleansing 101 – This lecture introduces a revolutionary new cleansing/fat burning system. A totally natural, safe and effective program to rid one’s body of the harmful toxins built up over one’s lifetime. Free. Limited seating. 65 S Wadsworth Blvd, Lakewood. 303-934-3600. Denver Metro Holistic Moms Network Monthly Meeting – 6:30pm. Bring own picnic dinner with a blanket and meet at the playground in the back of Denver Waldorf School. This is not a potluck, so bring own dinner, plates, drinks, etc. Free. Denver Waldorf School, 940 Fillmore St, Denver. 720-810-5593.

SATURDAY, AUGUST 14 The Art of Thriving 2-day Workshop – 3:30-5:30pm. See Aug 7 listing. Isis Books, 2775 S Broadway, Denver. 303-918-1204.

SUNDAY, AUGUST 22 Outdoor Divas Sprint Triathlon – 8am. 3rd annual all-women’s event. Limited to 400 competitors, please register early. Distances feature a half-mile swim; flat and fast 12-mile bike course; and finishes with a 3.1-mile run. Details: WithoutLimits.com.

MONDAY, AUGUST 23 Bio-Identical Hormone Therapy Seminar – 6-7pm. BodyLogicMD provides targeted and comprehensive seminars focused on natural bio-identical hormone therapy and customized fitness and nutrition programs. Q&A format. Free. 1805 S Bellaire St, Ste 201, Denver. 866-972-5306.

SUNDAY, AUGUST 29 Venus de Miles – 6am. All-women bike ride. Courses for every skill level. Select 65-, 48- or 32-mile course. Hosted by Greenhouse Scholars and proceeds help to provide high-performing, under-resourced college students with financial support and mentorship. $90 before 8/17. Prospect New Town, 700 Tenacity Dr, Longmont. 303-459-5473.

LOOKING AHEAD TO SEPTEMBER Quantum Breath Meditation & Yoga with Yogi Amrit Desai – September 3-5. Yogi Amrit Desai will teach ancient secrets that take you into the deepest levels of meditation like a seasoned master. Experience a paradigm shift that effortlessly silences your mind and draws you into the innermost core of your Being. The Quantum Breath Meditation helps decrease stressrelated health problems such as anxiety, depression, fatigue and insomnia. Starting at $385. Shambhala Mountain Center, Red Feather Lake. 888-788-7221. shambhalamountain.org/programs/1423.

A warm water exercise that soothes and stretches the body and mind, all levels.

Every Thursday 7pm, Aura Wellness Center, Sheraton Denver West 360 Union, Lakewood, CO. RSVP to 720-963-2043 or aquafreeflow@gmail.com. Visit www.aichiwithpetri.webs.com

MileHighNaturalAwakenings.com

July 2010

27


ongoingevents sunday Planetary Healing, World Harmony Meditations – 8-9am. A brief discourse and guided meditations which assist us to hold unconditional resonance for ourselves, others and the planet. Free. Teleconference. Info: 720-301-3993. Spiritual Gathering & Aura Healing Clinic – 11am12:30pm. First and third Sun each month. A spiritual gathering of blessings, love, healing, empowerment and community. Church is followed by an aura healing clinic, refreshments and community. Rev DebraRae, Officiating Minister. Donations accepted. 223Titan St, Aurora. SacredSpacesAndPlaces.com. Understanding Dogs – July 11-Aug 15. 2-4pm. Integrative, holistic approach to training, behavior, health and healing, including obedience, Reiki, flower essences, calming techniques and communication. Includes a behavior consultation, coaching session, treatment plan for each participating dog. $150/one human, one dog; $45/additional human; $90/human without dog. Sage Valley Pet Center, 16400 W 54th Ave, Golden. RSVP: 303-239-0382 or MishaMayFoundation@gmail.com. HypnoBirthing® Childbirth Education Classes – 6:30-9pm. Learn everything need to know to achieve a safer, easier and more comfortable birth. HypnoBirthing® is a natural childbirth education series that runs for 5 wks. Includes books and relaxation CDs. $295/couple. 821 Park St, Castle Rock. 720-939-9654. Healing with the Masters – 7-8pm. Enjoy a renewed sense of who one truly is. This Healing Circle is designated to allow one to directly experience the energy of the Masters, to expand one’s awareness of truth and restore balance to one’s mental, emotional and physical bodies. $8. Samadhi Center for Yoga, 639 E 19th Ave, Denver. 303-638-1225.

monday Ashtanga Vinyasa Free Flow Yoga – 7pm. Simple and easy. No experience required. An exhilarating and complete yoga practice. The free-flow series uses the

Ujjayi breath to flow from one asana (pose) to another allowing to energize the metabolic rate to burn fat and build a firm toned healthy body. The class ends with savasana (deep relaxation) and short meditation for a simple blissful experience. $79.99/mo (2 classes/wk) or $44/mo (one class/wk). The New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773. Finding Peace Within – 7-8pm. A free weekly meditation group for all levels of experience. Free oneself from limiting beliefs; discover one’s true self through Kriya Yoga Meditation. Led by Kathryn Solie and Alec Story. Donation. The New Journey Books & Center, 7735-D Wadsworth, Arvada. Journeybooks.com. Kundalini Yoga – 5:30-6:45 pm. Through December. The ancient and sacred practice of Kundalini yoga is the oldest form of yoga. Find relief from back pain, stress, addiction, depression and insomnia, and weight control. Kundalini yoga promises peace of mind. Elevate and experience yourself through this ancient science! All levels welcome; no experience required. Please bring water and a yoga mat. Single session: $8 member, $10 non-member/drop-in rate. Full series: $100/$120. Denver Botanic Gardens at York Street. RSVP req’d botanicgardens.org or call 720-865-3580.

tuesday Free Energy Balancing – 6-7pm. Relieve stress, gain clarity, increase creativity during a 15-minute rebalance.Free. Yoga of the Mind, 8 E. 1st Ave., Ste. 103, Denver. 303-668-2358. yogaofthemind.com. Discover Real Happiness with the Avatar® Course – 6-9pm. Explore how one’s beliefs are affecting one’s reality and how one can use the Avatar tools to change the blueprint one operates from. These intros are filled with awakening to new possibilities and discovering the preciousness of life. If interested in creating the rest of one’s life more deliberately or if one has found oneself in a repeating pattern that would like to change, the Avatar Course will be very inspiring and empowering. Free. RSVP Linda: 720-320-9681. Avatar® is a registered trademark of Star’s Edge, Inc. All rights reserved. Learn About Your Credit – 7pm. Learn how to get the good credit one deserves. It’s more important than ever to learn about one’s FICO, how to improve one’s score, how to get a lower interest rate and save money. Get one’s credit questions answered. Free. Lucero Real Estate, 3480 W 38th, Denver. 303-433-4357.

See our special August edition of

VIBRANT CHILDREN For more information about advertising and how you can participate, call

303-770-1981

28

MileHighNaturalAwakenings.com

Modern-Day Meditation – 7-8:30pm. This meditation guides people to a more open and calm state, to think clearly about solutions for daily life changes and find a deeper spiritual connection within. $10 donation. First class free. Miracle of Love Center, 4277 W 43rd Ave, Denver. 800-338-3788. Strategic Health System Webinar – 7pm. Dr. Prendergast and other special guests explain the science behind ProArgi-9 Plus, the mechanics of the Strategic Health System, the income aspects of this business system, and how healthcare professionals can implement this system into their wellness practices. Register: 303-693-9391. Miracle of Health Webinar – 8pm. Dianne Leavitt and very special guests Sue Ramson and Ted Wilson explain the science behind ProArgi-9 Plus as well as the virtues of this incredible business system. Register: 303-693-9391.

wednesday Free Aura Clearing and Chakra Balancing – 6-7pm. A healing is an energy clearing, like a psychic shower. During a healing, energy one doesn’t need to be carrying is cleared out of one’s space, including energies that block growth and flow. Donation. 2730 S Wadsworth Blvd, Lakewood. 720-413-7303. HypnoBirthing ® Childbirth Prep Classes – 6:30-9pm. A complete childbirth education series teaching everything need to know. The series runs for 5 wks. Learn how to have a safe, satisfying birth. Pre-registration required. $295/cpl. 18425 Pony Express Dr, Ste 107, Parker. 720-939-9654. Ashtanga Vinyasa Free Flow Yoga – 7pm. See Mon listing. The New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773. Recovered Living – 7-8:15pm. A holistic approach to reclaiming one’s power. Ken Ludwig facilitates, taking an alternative look at self-defeating habits. He uses original principles based on the mental, spiritual, emotional and physical. $10. Center for Spiritual Living Denver, 1420 Ogden St, Denver. MakingItOutAlive.com. Understanding Dogs – Thru July 21. 7-8:30pm. A holistic approach to training, behavior, health and healing, including obedience, Reiki, flower essences, calming techniques and communication. Includes a behavior consultation/coaching session/ treatment plan for each participating dog, and a Weekly Myth Buster about dog behavior. Preregistration required. $195/one human/one dog pair; $60/additional human. $120/human w/o dog. The


New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773. Arginine ProArgi-9 Plus: Synergy’s Cardio Call w/Dr. Prendergast – 7pm. Synergy’s Executive Team interviews Dr. Prednergast about the science behind ProArgi-9 Plus. Register: 303-693-9391.

thursday Ai Chi – 7-8pm. A warm water contemplative or meditative exercise that helps gain awareness of Self. Aura Wellness Center, 360 Union Blvd, 2nd floor. Free 1 hr Watsu with each 10 punch card purchase, $60 value, if you saw this in Natural Awakenings. 720-963-2043. AquaFreeFlow@gmail.com, aichiwithpetri.webs.com , SheratonDenverWest.com/Fitness-Studio-Classes. Beyond Loss Grief Support Workshop – July 8-Sept 9. 7pm. When grieving, emotional support is important in adjusting to loss, but the real grieving begins when the condolence calls stop. Beyond Loss is for those at least 4 months past the death of a friend or family member. $30. Vogt Center, Classroom 3, 9077 W Alameda Ave, Lakewood. MileHiChurch.org. Meditation Mastery – 7-8:30pm. Build a practice starting with 5 minutes at a time. Support each other to take baby steps toward self-discipline. Facilitated by Ken Ludwig. Meditating for over 30 years, Ken believes this is the alpha and omega of creating a daily practice. $10. A Holistic Wellness Center, 10200 W 44th Ave, Ste 400, Wheat Ridge. 303-278-7013. Oneness Deekshas & Sacred Sound with Ann & Donna – 7-9pm. Third Thurs each month. A Oneness Deeksha experience with live Sacred Sound from crystal bowls and Native American flute. Deeksha is a Divine intelligent energy transfer that causes a neurobiological transformation within the brain of each receiving individual. It is not a teaching or concept, but rather an experience or process that supports all paths or beliefs. $20 donation. The New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773.

friday Meditation Mastery – 12-1:30pm. See Thurs listing. Center for Spiritual Living Denver, 1420 Ogden St, Denver. Info 303-278-7013. Ashtanga Vinyasa Free Flow Yoga – 1pm. See Mon listing. The New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773. HypnoBirthing® Childbirth Education Classes – 6:30-9pm. See Sun listing. $295/couple. 821 Park St, Castle Rock. 720-939-9654. Metaphysical Book Club & Meanderings – 6:30-8:30pm. First Fri each month. Open to anyone who would like to discuss and share their thoughts and ideas relating to metaphysics, new age, paganism, or similar subjects. Feel free to bring questions and answers for a quick community chat. Free. The New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773. Modern-Day Meditation – 7:30-9pm. See Tues listing. Miracle of Love Center, 4277 W 43rd Ave, Denver. 800-338-3788.

saturday LaughterYoga-SmileHi – 9:15am. Learn how to enrich one’s life with Laughter. Laughter exercises combined with gentle stretching and breathing at the beautiful Mercury Café and its roses. $5. Mercury Café, 2199 California, Denver. 303-237-4432.

Monthly Alternative Health Fair – 12-5pm. First Sat each month. Various healing arts, consultation of disease, massage and introduction to new thoughts around illness. $l/min; 20/30/45-min. The New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773. JourneyBooks.com.

classifieds FOR RENT LOOKING TO EXPAND YOUR PRACTICE? Isis Healing Oasis has fully furnished private counseling and massage offices available on a part-time/ shared basis and at very reasonable rates!  Great opportunity for practitioners who are building their practice, practitioners working out of their home who want to meet new clients in a professional, secure environment and those practicing out of the Denver metro area who wish to meet with Denver clientele.  Services and Appointment website hosted by Isis Books, Gifts and Healing Oasis. Check them out at www.isishealingoasis.com  Centrally located at Broadway and Yale.  Contact: Karen Harrison at karenharrison@isisbooks.com.

FOR SALE COMMERCIAL CLEANROOM & WAREHOUSE – 25 mins West of Minneapolis would convert beautifully to a food prep commercial kitchen or be awesome for someone who compounds vitamins, neutraceuticals, etc., in bulk. Heavily discounted price. For more info, email Info@NaturalAwakeningsSA.com or visit Cleanroom10k.info. CURRENTLY PUBLISHING NATURAL AWAKENINGS MAGAZINES – For sale in Birmingham/Huntsville, AL; Boulder, CO; Morris

Monthly Intuitive/Psychic Fair – 12-5pm. Third Sat each month. Animal communication, astrological readings, aura cleansing and chakra balancing, aura photos, gem readings and palmistry, past life readings, tarot, soul path readings, and more. $20/20 mins. The New Journey Books & Center, 7735-D Wadsworth, Arvada. 303-239-8773.

County, NJ, and Southwest VA. Call for details, 239-530-1377. LIVING DELIBERATELY – Do you desire to be an explorer, discoverer, enlightened being, independent, discerning, wise, awake, fully alive? If you want to start developing these qualities in your life, buy and read Living Deliberately. Contact Linda for a copy: 720-320-9681 or LKDenmark@sysmatrix.net.

FOSTER/ADOPTION LOOKING FOR A CAT OR DOG TO OWN OR MAYBE TRIAL WITHIN YOUR FAMILY? – Misha May Foundation has many cats and dogs available for foster or adoption― different breeds, personalities, all looking for you. If your home is not available, we are always in need of volunteers and donations. Contact: 303-239-0382 or MishaMayFoundation@ gmail.com. Click on Make A Donation at MishaMayFoundation.org or send a check to Misha May, P.O. Box 151166, Lakewood, CO 80215-1166.

WANTED HOUSEMATE WANTED ASAP – Share multilevel home (I-225S & Alameda) near Hi-Line Canal. Upstairs bedroom w/closet; shared kitchen, family room, washer/dryer; utilities paid. Must either know how to ground/manage energy or be willing to learn. $650 monthly rent + 10 hrs/mo; yard/misc. work + $250 deposit. Front part of house is a spiritual center and used for clients and events. Call DebraRae, 303-365-0200.

communityresourceguide Connecting you to the leaders in natural healthcare and green living in our community. To find out how to be included in the Community Resource Guide email advertising@MileHighNaturalAwakenings. com to request our media kit.

BOARD CERTIFIED HOLISTIC MD CLEAR SKY MEDICAL

Katia I. Meier, M.D. 10103 Ridge Gate Parkway Aspen Building, Suite 221 Lone Tree, CO 80124 303-790-7860 ClearSkyMedical.com Family practice physician specializing in Bio-Identical Hormone Replacement therapy, Neurotransmitter balancing, comprehensive Nutritional analysis and therapy, Homeopathy, Herbalogy, Naturopathic Medicine, Personalized Detoxification Programs, Medical Weight Loss and Cosmetic procedures. Treating all ages and most insurance welcomed. Call for more information today. See more info, page 20.

DOG TRAINING MISHA MAY FOUNDATION Lorraine May, Executive Director 303-239-0382 MishaMayFoundation.org Understanding Dogs - Not your typical “sit, stay, lay down” class. Holistic approach to training, behavior, health and healing, including obedience, Reiki, flower essences, calming techniques and communication. Includes a behavior consultation, coaching session and treatment plan for each participating dog. Listen and learn, engage in handling, and be guided in follow-up practice. May holds masters degrees in both education and psychology. She teaches classes, and consults on behavior, for the general public, as well as various shelters and rescue groups. Registration required. Email for dates and info: MishaMayFoundation@gmail.com.

July 2010

29


ENERGY BALANCING YOGA OF THE MIND

VIBRANCE DENTISTRY

8 E. 1st Ave., Suite 103 Denver, CO 80204 303-668-2358 YogaOfTheMind.com Free Energy Balancing. Relieve stress, gain clarity, increase creativity during a 15-minute rebalance. You will leave feeling better and more open to creating the opportunities that life offers. We offer these healings for free every Tuesday, from 6-7pm, as a way of introducing people to what we teach and as an opportunity for our trained healers to gain more experience. New! Free Energy Balancing now offered at Civic Center Eats in Denver from 11am-2pm on Tuesdays.

ENTERTAINMENT MINERS ALLEY PLAYHOUSE 1224 Washington Ave, Ste 200, Golden, CO 80401 303-935-3044 MinersAlley.com Back by popular demand, Miners Alley presents the hilarious, frothy, naughty comedy The Underpants by Steve Martin July 9-August 29. Side-splitting reinvention by the incomparable Martin about Carl Sternheim’s turn-of-the-century satire on sex, in which he focuses his zany eye on the relationship between a prudish government clerk and his delectably voluptuous young wife, Louise.

GREEN CLEANING GREEN CLEANING PRODUCTS LLC Rae Ann Dougherty 720-746-0803 GreenCleaningProductsLLC.com Green Cleaning Products LLC provides safe, green household cleaners manufactured by wowgreen. The company’s mission is to free the world of toxic chemicals, one household and business at a time. These products are manufactured from a proprietary blend of enzymes that provide a safe, effective and all-natural cleaning solution for every household need. Products are packaged in reusable containers and shipped in recyclable paper containers.

Don’t dig your grave with your own knife and fork. ~English Proverb

30

HEALTH-FOCUSED DENTIST Cate Vieregger, DDS 7960 S. University Blvd., Suite 200 Centennial, CO 80122 303-770-1116 VibranceDentistry.com H e a l t h - f o c u s e d d e n t a l o ffi c e providing mercury-free and latexfree dentistry, digital X-rays, sedation dentistry and more. We will work with your holistic health partners to help you reach optimal levels of wellness. See ad, page 2.

HYDROPONICS DENVER HYDROPONIC & ORGANIC CENTER

6810 N. Broadway, Unit D Denver, CO 80221 303-650-0091 BHOCenter.com Grow your garden now – we’ll show you how. Have fresh produce, an herb garden or flowers all year round. Grow almost anything faster, in less space with less water. See more info, page 12.

INTEGRATIVE HEALTH CLEAR SKY MEDICAL

Katia I. Meier, M.D. 10103 Ridge Gate Parkway Aspen Building, Suite 221 Lone Tree, CO 80124 303-790-7860 ClearSkyMedical.com Family practice physician specializing in Bio-Identical Hormone Replacement therapy, Neurotransmitter balancing, comprehensive Nutritional analysis and therapy, Homeopathy, Herbalogy, Naturopathic Medicine, Personalized Detoxification Programs, Medical Weight Loss and Cosmetic procedures. Treating all ages and most insurance welcomed. Call for more information today. See more info, page 20.

CROWNING TOUCH HEALING ARTS MEDICAL CENTER 18425 Pony Express Dr.,Suite 107 Parker, CO 80134 303-805-2282 CTHealingCenter.com Reform, rejuvenate and restore your body, mind and spirit with complete integrated affordable health care and wellness services. Monthly specials, insurance accepted. Services include acupuncture, biomeridian, hypnotherapy, nutrition, classical homeopathy, massage, fertility specialists including maya abdominal massage, Tai chi, meditation, yoga, Pilates, medical weight loss, complete skin and body therapies and self-development coaching and workshops. See ad, page 13.

MileHighNaturalAwakenings.com

MASSAGE AND MORE HEALING SPACE Natalie Gentry, CMT 121 S Madison St, Ste D, Denver, CO 80209303-325-4150 HealingSpaceDenver.com Nurture your body, mind and spirit and rediscover your self through the healing power of touch, movement and breath. Healing Space offers relaxing and deep tissue massage, Maya Abdominal/Uterine Massage, Prenatal/Post Partum Massage, Spiritual Plant Healing, Nia classes, and Transformational Breath facilitation. Schedule your appointment today. See ad, page 26.

NO SURGERY/NO DRUGS ACCREDITED JOURNEY PRACTITIONERS PO Box 10, Louisville, CO 80027 973-680-0271 TheJourneyUSA.com Experience for yourself the deep and profound healing potential of The Journey. Be guided to access your own infinite body wisdom to then uncover and clear out the driving force behind physical disease or emotional blocks or anything else holding you back from your fullest potential. Work with highly skilled and expertly trained Journey Practitioners to reach personal freedom, without surgery or medication

PSYCHOLOGY AND GROWTH KATHY HIGGINS, MA, LPC

Deer Creek Counseling 7345 South Pierce Street, Suite 110 Littleton, Colorado 80128 720-663-7702 0.0625 inKathy Higgins, MA, LPC, helps individuals bring about change in order to live more effective and joyful lives, using Interpersonal, Dialectical and Person-Centered therapies. Kathy specializes in treating Depression and Bipolar Mood Disorder; Trauma and PTSD; Phobias, Anxiety, and OCD; Eating Disorders; Recovery from Addictions; Career Counseling; and Alternative Spirituality.

TRAUMA HEALING WITH TRAGER ELIZABETH HASELWOOD Certified Trager Practitioner

303-547-2221

Trager is a form of gentle, physical movement performed with great sensitivity that enables a strengthening in the mind-body connection. Clients can learn to feel and love their bodies again, as Trager deepens awareness of the body so clients can learn to shift emotions by shifting one’s body’s response to the mind first. Trager helps clients to learn to receive appropriate healthy touch without triggering a posttraumatic stress response. Haselwood has spent the last three years pioneering Trager application for anorexia and bulimia, and has been certified since 2004. ®


Join us for a FREE Cooking Class

6JWTUFC[,WN[VJ

Visit SFMarkets.com for more details.

Buffalo Corn Ears

Servings: 4 Prep Time: 15 Min. 5GTXG9KVJ)TKNNGFEJKEMGPQTÅ¿UJ

Cook Time: 15 Min.

9JCV[QWPGGF

Find these recipe ingredients CPFOQTGCVCNN5WPÆ&#x20AC;QYGT Farmers Market locations. 2880 S Colorado Blvd &GPXGTÅ&#x2013; ___________________ 9VJ#XG &GPXGTÅ&#x2013; ___________________ 1980 E County Line Rd Highlands Ranch  ___________________ 9%TQUU&TKXG .KVVNGVQPÅ&#x2013; ___________________ '$TKCTYQQF%KTENG #WTQTCÅ&#x2013; ___________________ 9CFUYQTVJ$NXF #TXCFCÅ&#x2013;

Å&#x2013;UVCNMUEGNGT[UNKEGFVJKPN[NGPIVJYKUG Å&#x2013;DWNDHGPPGN UVCNMUCPFNGCXGUTGOQXGF  VJKPN[UNKEGF Å&#x2013;6DURDWVVGT Å&#x2013;ELCNCRGPQJQVUCWEG Å&#x2013;6DURJQVTGFRGRRGTUCWEG

UWEJCU6CDCUEQ Å&#x2013;VURHTGUJNGOQPLWKEG Å&#x2013;GCTUHTGUJ5WRGTUYGGVEQTP

$NWG%JGGUG5NCVJGT

E$NGWEJGGUGETWODNGU EETGCOEJGGUGUQHVGPGF 6DURJCNHJCNH VUREGNGT[UCNV

9JCVVQFQ 2TGJGCVITKNNQTDTQKNGT2NCEGEGNGT[CPFHGPPGNKPCDQYNQHKEGYCVGTVQETKUR +PCUOCNNUCWEGRCPOGNVDWVVGTYKVJJQVUCWEGU4GOQXGHTQOJGCVCPFCFF NGOQPLWKEG$TWUJEQTPYKVJUGCUQPGFDWVVGTOKZVWTG 1PCTCEMCTTCPIGEQTPITKNNQTDTQKNWPVKNUNKIJVN[EJCTTGFVQOKP VWTPKPIGCTUCPFDCUVKPIYKVJTGOCKPKPIDWVVGTOKZVWTG 6QUGTXG&TCKPEGNGT[CPFHGPPGN1PFKPPGTRNCVGURNCEGEGNGT[HGPPGN CPF$WHHCNQ%QTP'CTUFKXKFKPIGSWCNN[6QREQTPYKVJ$NWG%JGGUG5NCVJGT

TGEKRGHQNNQYU 7UGTGOCKPKPI5NCVJGTCUCFKRHQTVJGEGNGT[CPFHGPPGN5GTXG YKVJITKNNGFQTHTKGFEJKEMGPQTÅ¿UJKHFGUKTGF

$NWG%JGGUG5NCVJGT +PCUOCNNDQYNEQODKPGDNWGEJGGUGETGCOEJGGUGJCNHCPFJCNHCPF EGNGT[UCNV/CUJYKVJCHQTMWPVKNHCKTN[UOQQVJ;KGNFUCDQWVEWR

_________________________________________________________ %QWTVGU[QH(TGUJ5WRGTUYGGV%QTP


Join Our Family of Publishers...

be your own boss and make a difference in your community

Little Rock/ Birmingham, AL Hot Springs, AR Mobile/Baldwin, AL & Huntsville, AL

New Haven/ Middlesex, CT

Emerald Coast, FL

Sarasota, FL Peace River, FL & Portland, OR

Tallahassee, FL

Grand Rapids, MI

Ann Arbor, MI

Santa Fe/ Morris County, NJ Albuquerque, NM

Phoenix, AZ

Daytona/ Volusia/Flagler, FL

Atlanta, GA

Greater Oakland/ Wayne County, MI Macomb, MI & Greater Genesee, MI

New York City, NY

Rockland/ Orange, NY

Charleston, SC

Lehigh Valley, PA

Austin, TX

Augusta, GA

Miami & Florida Keys

Indianapolis, IN

Westchester/ Putnam, NY

Columbia, SC & Grand Strand, SC

Naples/ Ft. Myers, FL

Lexington, KY

Hartford County, CT Fairfield County, CT

North Central FL

Louisville/ Metro, KY

Orlando, FL

New Orleans, LA

Southern Coast, NC Somerset Raleigh/Durham/ Middlesex, NJ Chapel Hill, NC

Cincinnati, OH

Upstate, SC

Denver, CO

Boulder, CO

Central Missouri Asheville, NC Charlotte, NC

Rhode Island Bucks County, PA

Ventura, CA

Melbourne/ Jacksonville/ Vero Beach, FL Ft. Lauderdale, FL St. Augustine, FL

Floridaâ&#x20AC;&#x2122;s Tampa/ St. Petersburg, FL Treasure Coast

Long Island, NY

San Diego, CA

Tucson, AZ

Oklahoma City, OK

Chattanooga, TN & Knoxville, TN

Tulsa, OK

Nashville, TN

Palm Beach, FL

Lafayette, LA

Monmouth & Ocean, NJ

Portland, OR

Memphis, TN

Northeast, PA

Dallas, Texas

East Texas

Houston, TX

Richmond, VA San Antonio, TX

Madison, WI Southwestern VA

Toronto, Canada Puerto Rico

Our Family Tree Is Growing Strong As a Natural Awakenings publisher, your magazine will help thousands of readers to make positive changes in their lives, while promoting local practitioners and providers of natural, earth-friendly lifestyles. You will be creating a healthier community while building your own financial security in the franchise market of your choice. Youâ&#x20AC;&#x2122;ll work for yourself but not by yourself. We offer a complete training and support system designed to help you successfully publish your own magazine. Become a new Natural Awakenings franchise publisher in the market of your choice, or purchase one of the existing magazines currently for sale: Birmingham/Huntsville, AL; Boulder, CO; Morris County, NJ; and Southwestern, VA.

Phenomenal Monthly Circulation Growth Since 1994

For more information contact John R. Voell, Co-Founder 239-530-1377 or visit us online at NaturalAwakeningsMag.com


July 2010 Denver Natural Awakenings