Gallup Sun • Friday June 9, 2017 by Mike Kurov

E FRE

‘The Mummy’ back from the dead. Film Review Page 19 VOL 3 | ISSUE 114 | JUNE 9, 2017

QUILTS FOR VETERANS A poignant gift for those who served. Page 2

NEWS

Quilts of Valor COMFORTING SOLDIERS WITH HANDMADE QUILTS

By Dee Velasco For the Sun

“J

ust one star can comfort a soldier” A quilting club is making the difference in the lives of veterans. On a Saturday, women from near and far gathered at UNMGallup’s north campus with a goal of creating 10 quilts. Sewing machines hummed as blocks of fabric were slowly and methodically turned into colorful tapestries. The ladies talked and giggled as they worked, but they take their responsibility to heart as members of “The Loyal Order of the Quilt.” The Loyal Order of The Quilt designs and stiches together quilts for local veterans here in the Gallup area. Each year, 10 veterans are nominated by members of the

community and receive their quilts at the “Quilts of Valor” ceremony. In its fifth year, the ceremony will be held June 30, at the UNM-Gallup north campus. T he yea rly event wa s inspired by Gallup Service Mart’s quilt club, whose members made 80 “One Star Blocks” and sent them to the Moda Fabrics company, who in turn made 100 quilts in 100 days and sent them to veterans across the United States. Those members then decided to start making quilts for local veterans. The first ceremony was held December 2013 at the Winter Festival at UNM-Gallup, and two quilts were presented to local veterans attending the college. The event blossomed from there. Last year, Gallup Mayor Jackie McKinney proclaimed the last Friday in June as Quilts of Valor day.

The Loyal Order of The Quilt group has four QOV sew days to complete all 10 quilts. Coordinator Lynn Olinger says the quilts provide comfort to veterans. “The quilt blanket will comfort them when they have their

dark days of past war experiences that we may never understand,” Olinger said. “The blanket will act as hugs holding them for their service they have done for everyone.” The ladies of this group come from the surrounding area, and each has her own story on why she volunteers for this special project. From Continental Divide, Dorothy Slaughter found out about the club through her neighbor, and volunteering each year has left a lasting an impression on her.

“I came to a meeting one time and fell in love with it, it’s just amazing to me how wonderful it is that these people get together and do this for other people … they are just so unselfish,” she said. Linda Williams, of Church Rock, who is an ombudsmen volunteer in the local community said she loves to help, and enjoys the camaraderie she shares with the other women. “I thought that I would try it and I love doing this for the veterans,” she said. “I’m doing pretty good … slow … other-

Ten quilts will be given to local veterans. To see the honorees’ receive their quilts, attend the Quilts of Valor ceremony at UNM-Gallup’s north campus at 6 pm on June 30. Photo Credit: Knifewing Segura wise I love it.” C a r ol y n Fo r e m a n , of Grants, who is a member of the Mt. Taylor Quilt Guild, comes and lends a hand because she believes it’s a worthwhile project. She has three brothers that served during the Vietnam War era; a father who served in WWII; and her son is currently in the Air Force. “It’s a matter that is close to my heart,” she said. “We come to help out the Gallup ladies because the veterans are worth our time.” Nellie Kelsey, from Gallup, has been quilting since the idea of QOV was formed. “I’ve been doing this for the past three years,” she said. “I love it and visiting with these ladies for this worthwhile cause.” The community is invited to come out to the ceremony to honor all veterans for the service they have given. For more information contact Laura Jijon at the UNM-Gallup North Campus, (505) 726-6311, 425 N. 7th Shirley Hedge (left) and Linda Williams (right) holds up a quilt made for a veteran. Photo Credit: Knifewing Segura Street, Gallup, NM.

Friday June 9, 2017 • Gallup Sun

NEWS

New GPD badges reflect uniqueness of Gallup GPD: 30-YEAR CHANGE WELCOMED

Spencer said members of the greater McKinley County community have taken notice of the new patch designs and have made some very positive comments.

By Bernie Dotson Sun Correspondent

fficers at the Gallup Police Department recently began wearing new badges that are as unique as the community they serve. The badges set the Gallup officers apart from cops elsewhere. The new symbols of local law enforcement display a silver background with the new official city of Gallup Thunderbird design along with the flags of the United States and New Mexico. On the borders of the patch, are the words: “Strength, Honor and Courage.” The words Gallup Police are included on the patch, too. The entire patch is in the shape of an arrowhead. Personnel at the Gallup Police Department started wearing the newly designed patches on May 1. Gallup police who work patrol wear the new patches on their uniform shirts. There are 30 officers who routinely work patrol and five Community Service Aide’s. Gallup detectives and narcotics agents typically don’t wear the new patches. “Members of the department have tried to push for a change in the patch design,” Marinda Spencer, public information officer with GPD, said. “In the past, the majority vote has been not to change the design. But with the new administration, there was little resistance to the idea.” The old patch bore a white background with a black border. It had an embroidered

ATTENTION NEWS HOUNDS!

Have a news tip? Want to write up a guest submission for the paper? Email us at: gallupsun@gmail.com

Gallup Police Department’s new police badge patch. Thunderbird design with a turquoise color. The design of the old patch was first used back in the 1970s when Manuel Gonzalez was the city chief of police. Spencer noted that when new city police chief Phillip Hart came on board last year the idea for a patch change was brought up. Hart was in favor of a change. “He put out a call to all department staff for the submission of new designs for our sworn officers and community service aides,” Spencer said. “Seven designs were submitted for officers and three designs for the CSA’s and they were all posted for view. Capt. (Edwin) Yazzie’s design was selected. The design for the CSA’s is the same design that was selected for the sworn officers, but it does not identify them as officers, but as community service aides.”

Now considered the former badge of GPD.

ATTENTION!

VENDORS WANTED! Earn extra cash, set up a VENDING BOOTH at the ANNUAL 4TH OF JULY STARS & STRIPES CELEBRATION!

WE WAN

T YOU!

DO IT ALL RENOVATIONS ***NO JOB TOO SMALL***

505-814-9990

1632 S. Second St. in Cedar Hills Plaza (505) 863-9391

SPECIALIZING IN:

HOUSES – Complete Repair MOBILE HOMES – We gut it and rebuild it FURNITURE – Build/Repair/Refurbish compassion4u@hotmail.com

NEWS

ALLEGED HORSE THIEF He’s hiding out somewhere

GALLUP SUN BUSINESS DIRECTORY PAGE 11! AG SUES DOLLAR STORE Caught selling botched oil

MULTIPLE OFFENSES Two or more DWIs …

16 18 CONSTRUCTION LESSONS

UNM-G’s hands-on course

HEADED TO HASKELL Outstanding student, athlete signs on

Gallup Sun • Friday June 9, 2017

WANTED: Alleged horse thief at large By Babette Herrmann Sun Editor

little over a week ago socia l med ia buzzed with news of a quarter horse n ick n a me d “ Mont e” t h a t wa s repor ted stolen from TravelCenters of A mer ica t r u c k s t o p a t 3 4 0 4 W. Highway 66. Monte was found safe and sound June 1, one day after a thief rode off with him. And as of press time, the alleged suspect is still at large. TA v ide o s u r vei l l a nce helped pol ice t o ident i f y 18-year-old Wilbert Billy as t he a l leged hor se -napper. Ga llup Police Depa r tment i s sued a n a r re st wa r r a nt for Billy June 2. He’s wanted on one count of “larceny of l ivestock,” a t h i rd- deg ree felony. According to the criminal complaint, the unfortunate incident occurred when hor se t ra n spor ter Steven Dyess stopped at TA to get some rest during the early

Wilbert Billy afternoon of May 31. It was a long haul for the 11-yearold horse, from Arizona to Color a do, so D ye s s t ook Monte out of the trailer and tied him to it so he could stretch his legs. It was also a chance for Dyess to grab a few minutes of shut eye in the cab of the truck. Sometime during Dyess’s c a t n a p, B i l ly r e p or t e d ly approa ched t he a sh g rey q u a r t e r hor s e w it h fou r white socks and untied his rope, then walked away with

Friday June 9, 2017 • Gallup Sun

him. When he gained some d i s t a nce f rom D ye s s, he hopped on Monte and rode off. Dyess tried to catch up with Billy, but to no avail. Tim “TC” Show was desperate to find his Monte. His wife Mary Show immediately sta r ted posting photos of Monte on Facebook groups, asking for Gallup and Navajo Nation residents help in finding him. Monte’s full horsey name is “Yo Blue Doop.” Gallup Police Department Det. Lt. Rosanne Morrissette wasn’t content with letting the matter fall by the wayside. On June 1, with the assistance of Det. Philamena Chischilly, the two headed to NCI detox center to see if they had any information on Billy. A n NCI super v isor told the detectives that Billy’s fat her stole a hor se from him about four years earlier, a nd drew a map of where the suspect resided at, 908B Hunters Point Rd. It was the lead that police needed as it was the same direction that Billy was headed in when he

stole Monte. While driving in the area, det ec t ive s r a n i nt o New Mex ico L ive s t o ck Br a nd Inspector Byron Murphy. They asked him to follow them to Billy’s residence. When they arrived there, Billy’s mom, Nettie Billy, said her son was in possession of the horse, and had told her that he was watching it for someone. The night before, Nettie Billy said “they” put a pen together for Monte, some 500 yards from the residence. T he a r e a w a s h idden , a s det ec t ive s h a d t o c ut t h roug h “ t ree s a nd sa ge brush,” to find Monte, who’s valued at $15,000, according to the criminal complaint.

THANK YOU ADVERTISERS Amazing Grace Personal Care - 19 Best of the Best Timed Event Rodeo - 24 Bubany Insurance Agency - 5 Butler’s Office City - 8 Do It All Renovations - 3 El Morro Theatre - 19 Gallup Film Festival – 9 Gallup Housing Authority - 22 Gallup McKinley County Schools - 22 iHeart Media - 3 Law Office of Barry Klopfer - 10 McKinley County SNAPS / NMDH – 12/13 Pinnacle Bank - 16 Professional Truck & Auto Center - 6 Small Fry Dentistry - 15 Thunderbird Supply Co. - 4 TravelCenters of America - 7

Mur phy rode Monte out of the area, and Dyess met up with detectives and loaded the horse onto the trailer. Mar y Show took to the Gallup Sun Facebook page to express her gratitude to those who helped locate Monte. “Thank you Gallup police depa r tment a nd bra nd i n s p e c t o r s ,” s h e w r o t e . “Truly a miracle.”

Gallup Sun Publishing, LLC Publisher/Editor Babette Herrmann Advertising Raenona Harvey Correspondents Bernie Dotson Tom Hartsock Calendar Editor Lealia Nelson Photography Ana Hudgeons Ryan Hudgeons Knifewing Segura Design David Tsigelman On the Cover: Shirley Hedge (left) and Linda Williams (right) display quilts that ‘The Loyal Order of the Quilt’ have crafted; Carolyn Foreman on the sewing machine. Photos by Knifewing Segura. The Gallup Sun, published Fridays, is not responsible or liable for any claims or offerings, nor responsible for availability of products advertised. All rights reserved. Reproduction in whole or in part without permission is prohibited. The Gallup Sun distributes newspapers in McKinley, Cibola and Apache counties. Office (By Appointment): 102 S. Second St., Gallup, NM 87301 The Gallup Sun, pending USPS number 1, is mailed weekly. Application to mail at periodical rates is pending in Gallup NM. POSTMASTER: Send address changes to Gallup Sun, PO Box 1212, Gallup, NM. Mailing Address: PO Box 1212 Gallup, NM 87305 www.gallupsun.com Phone: (505) 728-1640 Fax: (505) 212-0391 gallupsun@gmail.com Letter to the editor/guest column ACCEPTED BY EMAIL ONLY. State full name and city/town. No pen names. ID required. All submissions subjected to editor’s approval. Guest columnists, email Sun for submission requirements.

NEWS

McKinley, Cibola unemployment rates edge downward SEASONAL CONSTRUCTION HIRING KICKING-IN

By Bernie Dotson Sun Correspondent

ew Mex ico’s season a l ly a d ju s t ed unemployment rate was 6.7 percent in April 2017, the same as it was in March, but up from a 6.6 percent rate a year ago. The national unemployment rate was 4.4 percent, down from 4.5 percent in March and down from 5.0 percent in April 2016, according to information put out by the state Department of Work Force Solutions. In McKinley County, the unemployment rate was 8.4 percent in April, which was lower than the 9.2 percent rate in March. In Cibola County, which is a 55-minute drive from McKinley County, the unemployment rate for April was 7.5 percent, compared to an 8.0 percent rate in March. The unemployment distinction is notable in McKinley County, which ranks in the Top 5 in New Mexico unemployment on a monthly basis. The rate differences in both McKinley and Cibola counties, which are considered rural, are attributed to warmweather hiring. The unemployment statistics are one month behind due to the amount of

time required to compile them. “In those two counties, what you see is a decreasing in the unemployment rates that is related to things like hiring within the construction industry,” Tracy Shaleen, an economist with the state Department of Work Force Solutions, said. “It’s a trend in small and rural counties. Those numbers will probably be different in a few months, particularly when it comes to the construction sector.” Shaleen noted that construction posted the largest percentage gain of jobs t h rou g hout t he s t a t e i n April, and the second largest numeric gain, relevant to state industries. B i l l L e e , t h e e xe c u tive director of the GallupMcKinley County Chamber of Commerce and a member of the McKinley County Board of Commissioners, said end-ofthe-school-year hiring figures into the unemployment rate in McKinley County. He said both continuing and graduating high school students, and some college students, have entered the overall county work force in one capacity or another and that’s a factor in the lowered unemployment rate. “I think you see this in

counties everywhere,” Lee said of the slight unemployment dip. “What we’re talking about is a relatively large number

of high school kids entering the work force, some in full time jobs such as retail jobs, and that impacts the slight

drop in county unemployment

UNEMPLOYMENT | SEE PAGE 8

Auto, Homeowner and Mobile Home policyholders from are now a part of the Bubany Insurance family Please call or come by and let us assist you with all your insurance needs! Make your payment and get service at one great location!

CALL (505) 863-3836 311 South 3rd Street, Gallup, NM Fax: (505) 863-6310 •Auto • Home • Commercial • Mobile Home • Motorcycle • Boat • RV • Bonds NEWS

Gallup Sun • Friday June 9, 2017

AG files lawsuit against Dollar General store Staff Reports

L BUQU E RQU E – At tor ney Genera l He c t o r B a l d e r a s announced June 6 that the Office of the Attorney General filed a lawsuit last night against national discount retail chain Dollar General for false advertising, unfair trade practices, and environmental public nuisance for the sale of obsolete motor oil in New Mexico stores from 2010 until February of this year. Dollar General has 87 stores located across New Mexico, including in rural and suburban communities, many of which are lower income. “My office continues to aggressively protect hard working New Mexico families and vulnerable consumers by holding big corporations like Dollar General accountable for preying on them and lying about the quality of the products that they sell,” Balderas said. “Putting New Mexicans’ valuable property and safety at risk is unacceptable, and companies that harm our communities and profit by taking money

NM Attorney General Hector Balderas out of the pockets of our families will face consequences for their bad acts.” In its 35-page complaint, the OAG alleges that Dollar General knowingly marketed, distributed and sold its DG Auto brand obsolete motor oil (labeled “DG Auto” SAE 10W30, SAE 10W-40 and DG SAE30) in its stores in the State of New Mexico, utilizing false advertising and deceptive and misleading marketing and sales practices. Dollar General’s DG SAE 10W-30 and DG SAE 10W-40 motor oil products are manufactured to the API Service Category “SF” specification, which is obsolete and not suitable for motor vehicles built

after 1988. Dollar General’s DG SAE-30 motor oil product is manufactured to the API Service Category “SA” specification, which is not suitable for motor vehicles manufactured after 1930. Use of this obsolete motor oil in modern engines can cause engine damage. Dollar General misled and deceived consumers by (a) positioning its DG Auto obsolete motor oil immediately adjacent to the more expensive brand-name motor oil, wrongfully representing that its obsolete motor oil is lower-priced but comparable to the brand-name products; (b) failing to adequately warn its customers of the fact that its DG Auto obsolete motor oil is unsuitable for use by the vast majority of its customers; and (c) distributing advertisements and other marketing materials that contain materially misleading statements and other representations as to the appropriate use and quality of its obsolete motor oil products.

Dollar General has also done significant harm to New Mexico’s pristine air quality by selling obsolete motor oil that was unknowingly used by its customers in modern vehi-

cles, damaging engines and deactivating emission control

equipment that is required to reduce and control the emission of harmful pollutants. By doing so, Dollar General has caused an increase of ambient concentrations of carbon monoxide, hydrocarbons, nitrogen oxides, particulate matter, and other possible carcinogens, each of which has been linked to adverse human health and environmental impacts. In addition to penalties, the OAG is asking the court to order Dollar General to develop and fund a state-approved program that would notify New Mexico Dollar General customers of the damages caused by the use of obsolete motor oil; inspect the engine of any customer who used obsolete Dollar General motor oils in their car and repair or replace any damaged components or the entire automobile if necessary; and take any other steps necessary to fix the harm done to New Mexico’s clean air from cars that used Dollar General obsolete motor oil.

Shiprock woman sentenced to prison for assault conviction Staff Reports

LBUQUERQUE – C o r n e l i a To m Ta pa h a , 41, a n enrolled member of the Navajo Nation who resides in Shiprock, N.M., was sentenced June 7 in Santa Fe to 24 months in prison followed by two years of supervised release for her conviction on an assault charge. Tapaha was arrested in June 2016, on an indictment charging her with assault with a dangerous weapon, a vehicle, and assault resulting in serious bodily injury. The indictment alleged that Tapaha committed the crimes on July 8, 2015, on the Navajo Indian Reservation in San Juan County, N.M. A federal jury returned a verdict finding Tapaha guilty of assault and assault resulting in serious bodily injury on Dec. 12, 2016, after a five day. T he ev idence at t r ia l

Friday June 9, 2017 • Gallup Sun

established that on the evening of July 8, 2016, Tapaha, the victim and another individual consumed alcohol while driving on the Navajo Indian Reservation. While Tapaha was driving and the victim was in the front passenger seat, Tapaha and the victim began arguing. Eventually Tapaha pulled over, and the victim and the other individual got out of the vehicle and began walking away. Tapaha remained in the vehicle and proceeded to run over the victim. As a result of this assault, the victim’s ribs, collar bone and ankle were broken and required surgical repair. The victim also suffered multiple lacerations requiring stitches. This case was investigated by the Farmington office of the FBI and the Shiprock office of the Navajo Nation Department of Public Safety. Assistant U.S. Attorneys Joseph Spindle and Novaline D. Wilson prosecuted the case. NEWS

Roswell man sentenced to prison ABQ man prosecuted under for violating federal firearms laws FBI’s ‘Worst of the Worst’ AntViolence Initiative Staff Reports

L BUQU ERQU E – Isaac Joshua Salas, 25, of Roswell, N.M., was sentenced June 6 in Las Cruces to 41 months in prison followed by three years of supervised release for violating the federal firearms laws. Salas was arrested on Nov. 13, 2015, on a criminal complaint charging him with possession of a firearm silencer not registered to him in the National Firearms Registration and Transfer Record (NFRTR) on Nov. 12, 2015, in Chaves County. According to the complaint,

Staff Reports

L BUQU ERQU E – Oscar Anchondo, 40, of Albuquerque, was sentenced June 7 in federal court to 100 months in prison for his conviction on charges of being a felon in possession of a firearm and the armed robbery of two Albuquerque-area convenience stores that were engaged in interstate commerce. Anchondo will be on supervised release for three years after completing his prison sentence. Anchondo was arrested in Oct. 2015, on a criminal complaint charging him with being a felon in possession of a firearm and ammunition on Oct. 6, 2015, in Sandoval County, N.M. According to the criminal complaint, on Oct. 6, 2015, a resident of the Town of Bernalillo called the Bernalillo Police Department to report a stolen vehicle. The victim reported that A nchondo stole the vehicle after threatening to kill her, and that Anchondo was armed when he made the threat. Officers responded to the call and located the vehicle parked in the driveway of another residence in Bernalillo. In response to an inquiry from the officers, an occupant of the residence said that Anchondo was in the residence. A nchondo wa s subse quently indicted on the same cha rge on Dec. 17, 2015. According to court records, on Oct. 6, 2015, Anchondo was prohibited from possessing firearms or ammunition because he previously had been convicted of the following felony offenses in state court: armed robbery with a deadly weapon, attempted robbery with a deadly weapon, and being a felon in possession of a firearm. On Sept. 6, 2016, Anchondo entered a guilty plea to the indictment charging him with NEWS

Oscar Anchondo being a felon in possession of a firearm and to a felony information charging him with two counts of violating the Hobbs Act. In entering the guilty plea, Anchondo admitted the following criminal conduct: On Sept. 29, 2015, Anchondo entered the Giant convenience store located at 6100 San Mateo Blvd. NE in A lbuquerque, threatened the store employees with a firearm, demanded mo ney, a nd r o bb e d t he employee of cash. On Sept. 29, 2015, Anchondo entered the 7-Eleven convenience store located at 1801 San Pedro Dr. NE in Albuquerque, threatened the store employees with a firearm, demanded money, and robbed the employee of cash. On Oct. 6, 2015, Anchondo was in possession of a firearm during a standoff with police who were attempting to arrest him for the offense charged in the criminal complaint, and that he was prohibited from possessing firearms or ammunition because of his status as a convicted felon. This ca se wa s investigated by the ATF office in Albuquerque and the Bernalillo Police Department with assistance from the Albuquerque Police Department and the Rio Rancho Police Department. It is being prosecuted by Assistant U.S. Attorney Kimberly A. Brawley under a federal anti-violence initiative that targets “the worst of the worst” offenders for federal prosecution.

law enforcement officers found several firearms, ammunition, silencers, pre-cursors for homemade explosives, chemicals and books on how to make bombs while executing a search warrant at Salas’ residence. A subsequent search of the NFRTR determined that Salas did not have any weapons registered to him in the NFRTR. On April 20, 2016, Salas pled guilty to a felony information charging him with possession of an unregistered firearm or destructive device without the benefit of a plea agreement. In entering the guilty plea, Salas admitted possessing an

unregistered pipe bomb. Court documents indicate that several firearms, ammunition, magazines, pressure cookers, detonation cord, ammonium nitrate and numerous items that could be used to make explosive devices were found in Salas’ bedroom together with books on how to make weapons. This case was investigated by the Bureau of Alcohol, To b a c c o, F i r e a r m s a n d Explosives and the Roswell Police Department. Assistant U.S. Attorney Maria Y. Armijo of the U.S. Attorney’s Las Cruces Branch Office prosecuted the case.

GALLUP SUN ARCHIVES Effective June 24, 2016, ALL Gallup Sun *archives (past issues) will be mailed. Must provide exact release date and mailing address. Send info. and check or money order for $1.50 to: Gallup Sun PO Box 1212 Gallup, NM 87305 *Based on availability.

Gallup Sun • Friday June 9, 2017

Zuni Pueblo man sentenced for statutory rape conviction Staff Reports

L BUQU ERQU E – Kirk Simplicio, 24, a member and resident of Zuni Pueblo was sentenced June 6 in federal court in Santa Fe, N.M., to 16 months in prison followed by five years of supervised release for his conviction on a sexual abuse of a minor charge. Simplicio will be required to register as a sex offender after he completes his prison sentence. Simplicio was arrested on March 17, 2015, on an indictment charging him with sexually abusing a minor who was between 12 and 16 years of age. According to the indictment, Simplicio committed the crime on Jan. 1, 2014, on Zuni Pueblo in McKinley County, N.M. On May 26, 2016, Simplicio

UNEMPLOYMENT | FROM PAGE 5 numbers.” The highest unemployment rate in New Mexico during the month of April was in Luna County at 17.3 percent. The state’s lowest unemployment rates were 3.6 percent in Los Alamos County and Union County in the northeast sector of New Mexico had an

PED Secretary Hanna Skandera to resign Staff Reports

S Kirk Simplicio pled guilty to the indictment and admitted engaging in a sexual act with the victim, who was 14 years old and at least four years younger than Simplicio. This case was investigated by the Zuni Pueblo Tribal Police Department and was prosecuted by Assistant U.S. Attorney Kyle T. Nayback. unemployment rate of 3.7 percent. McK i n ley Cou nt y’s top unemployment sectors are health care, retail and education. The largest employer s i n Cibola Cou nt y a re tou r ism, gover n ment a nd health care. Cibola County includes parts of the Navajo a nd Zu n i I nd ia n reser va tions. There are 33 counties in New Mexico.

Friday June 9, 2017 • Gallup Sun

A N TA F E — G ov. Susana Mar tinez announced June 8 that New Mexico Public Education Secretary Hanna Skandera will step down effective June 20. “New Mexico’s students and schools are better off today because of Secretary Skandera’s leadership and dedication,” Martinez stated in a press release. “Since day one of my administration, she’s been relentlessly committed to helping us fight the status quo – like

PED Secretary Hanna Skandera teachers unions and other entrenched special interests – to reform education and give our students, teachers, parents and schools more of what they need to succeed. Now, more

New Mexico students are graduating from high school than ever before, more are at grade level in reading and math, and more New Mexico kids are college ready. I’m so grateful for all Hanna has done for New Mexico’s kids, and I wish her all the best.” It wa s r u mored some months back that Skandera was considering a job with the Trump administration, but her plans were not announced as of press time.

HANNA SKANDERA | SEE PAGE 10

Las Cruces man pleads guilty to federal meth trafficking charges PLEA AGREEMENT RECOMMENDS 140-MONTH PRISON SENTENCE Staff Reports

L BUQU ERQU E – Joshua Nestle, 26, of Las Cruces, N.M., pled guilty June 7 in federal court to methamphetamine trafficking charges. Under the terms of his plea agreement, Nestle will be sentenced to 140 months in prison followed by a term of supervised release to be determined by the court. Nestle and co-defendant Joclyn Telles, 35, also of Las Cruces, were arrested in Feb. 2017, and charged by criminal complaint with conspiracy and possession of a controlled substance with intent to distribute. The complaint also charged Nestle with being a felon in possession of a firearm and with using and carrying a firearm in relation to a drug trafficking crime. The criminal complaint alleged that the defendants committed the crimes on June 29, 2016, in Dona Ana County. According to the complaint, law enforcement officers arrested Nestle and Telles on outstanding arrest warrants following a traffic stop. During a search incident to the arrests, the officers found

Joshua Nestle approximately 2.6 ounces of methamphetamine and a firearm in Telles’ vehicle. During today’s proceedings, Nestle pled guilty to a felony information charging him with conspiracy and possession of methamphetamine with intent to distribute. In entering the guilty plea, Nestle admitted that on June 29, 2016, he conspired with others to violate the federal drug trafficking laws. He also admitted possessing the 2.6 ounces of methamphetamine found in his vehicle and acknowledged that he intended to distribute the drugs to others. Nestle further admitted that on March 9, 2017,

Joclyn Telles he possessed a controlled substance while he was incarcerated at the Dona Ana County Detent ion Center. Nest le remains in custody pending a sentencing hearing, which has yet to be scheduled. Telles remains in custody on the charges in the criminal complaint. Charges in criminal complaints are merely accusations and defendants are presumed innocent unless found guilty in a court of law. This case was investigated by the Las Cruces office of the FBI and is being prosecuted by Assistant U.S. Attorney Mark A. Saltman of the U.S. Attorney’s Las Cruces Branch Office. NEWS

MULTIPLE OFFENDER DWI REPORTS Staff Reports Mack Ramone 5.10.17, 10:19 pm 3rd DWI, Aggravated Ramone, 35, of Smith L a ke, N M , was arrested by Ga l lup P o l i c e Department O f f i c e r A n d r e w Thayer when he was dispatched to 1650 West Maloney. Thayer spotted the suspect pulling into 1020 W, Maloney and proceeded to do a welfare check on all of the occupants. Thayer asked Ramone if he had been drinking and he replied that about an hour previous he had consumed a lot of alcohol at Sports Page. Video and Audio was recorded during this interaction. Suspect refused to take a Standard Field Sobriety Test and was transported to WalMart where he was identified by two security officers as the person who was intoxicated at the store. They said Ramone attempted to return an item to the store that did not belong to them and was refused. The guards did not want to press charges against him for this attempted fraud. Ramone was then transported to the jail where he was booked for a 3rd DWI, Aggravated, as well as a violation of the Open Container ordinance and Driving on a Suspended License. Ramone’s vehicle was on private property and was left on site and secured. Vivian Jones 5.10.17, 7:08 pm 3rd DWI, Aggravated Jones, 39, of Gamerco, NM, was spot ted by GPD Officer Chaz Troncoso as she made a quick exit from a business at 800 W. Highway 66, crossing over into the Westbound lanes of traffic. Turning his patrol car around, Troncoso caught up with Jones at 6th and Hwy 66, where she ran into the curb at the corner. Troncoso then asked if NEWS

Jones would per for m the SFST and she agreed, but was unable to perform the tests asked of her. Jones claimed she had medical issues from being in a coma recently and Troncoso read her the NM Implied Consent Advisor y after she refused any chemical tests. She was taken to Gallup Indian Medical Center for medical clearance and then back to the McKinley County Adult Detention Center where she was also booked for Open Container, Duration of Evidence, and Vehicle Entering Highway. A passenger in the car was taken to Gallup Detox. H e r m a n W i l l i a m F. Livingston 5.5.17, 1:47 am 3rd DWI, Aggravated Livingston, 34, was questioned by GPD Officer DeWayne Holder while waiting his turn in the d r ive t h r u follow i ng a call by a McDonald’s E a s t employee. When asked for his license, Livingston said it was at his home but he did provide his name, date of birth, and social security number. When Holder ran an ID check on this information, it turned out that his license had been revoked because of a previous DWI. When asked to take the SFST, Livingston refused. He was read the NM Implied Consent Advisory but continued to refuse any testing. Liv ingston wa s then arrested on Aggravated DWI and Driving on a Suspended License. His vehicle was then moved from the drive thru and parked in the parking lot. Leopoldo P. Martinez 5.4.17, 4:39 pm 3rd DWI, Aggravated Sixtyfour year old Martinez of Gallup was arrested for his third DW I by GPD Officer Douglas Hoffman after he observed a vehicle stopped in the roadway of

South Second Street. The subject vehicle was taking up space in two different lanes causing other drivers to stop or slow. He then veered to the right, almost hitting the curb. Continuing north, the vehicle turned right at Apache and 2nd Street without using a turn signal and drove at a slow rate of speed to Puerco and Maple, stopping at this intersection though there was no stop sign. He turned right on Maple and did not stop when emergency lights were activated but instead crossed over Strong Ave before coming to a halt. When asked to exit his car, Martinez kept his face turned away from Hoffman, and staggered and weaved when he walked away from his car. When asked if he had consumed any alcohol, Martinez said no and did agree to take a field sobriety test, which he promptly failed. Again he was asked if he had been consuming alcohol and again he said no. When Officer T. Troncoso came to the scene with a

portable breath tester and Martinez blew a 0.26, admitting at this time that he had consumed two beers at the Sports Page. He was arrested and transported to GPD where he blew a 0.21 and a 0.22 and was transported to the Adult Detention Center. Sylvania Brown 3.2.17, 12:33 am 2nd DWI, Aggravated Brow n, 37, of Pinedale fou nd herself in more trouble than the singular account of DWI when it was discovered there were arrest orders from both the Municipal and Magistrate Courts asking for her. GPD Officer Andrew Thayer had been dispatched to the Sports Page, 1400 S. 2nd Street, in reference to an intoxicated driver driving away from the bar, stranding her boyfriend. While talking with the boyfriend, a car pulled into the parking lot and he identified it as belonging to his girlfriend Brown.

When she agreed to perform the Standard Field Sobriety Tests, Thayer found a level spot in the parking lot and moved his vehicle to where a video could be taken. After failing all aspects of the SFST, Brown agreed to a portable breath test and blew 0.184. When asked, Brown said she had consumed two shots about an hour before driving. Placed under arrest, it was discovered that Brown had three warrants outstanding and was transported to the GPD for more breath tests, blowing a 0.15 twice. Her vehicle was turned over at the scene by her sister and Brown was booked on other charges of Open Container and Suspended Driver’s License. Lionel Joe 2.26.17, 4:46 am 3rd DWI, Aggravated G P D Officer Justin Benally was d i spatched t o 310 S . Sixth St. in reference t o a f i g ht when Metro Dispatch

DWI | SEE PAGE 11

Mark Your Calendar! September 14 – 16, 2017 • Groundbreaking independent feature films • Compelling short films • Meet celebrities & filmmakers! • Live Music El Morro Theatre & Gallup Downtown Events Center

Attention Filmmakers June 16 is the Deadline for ALL Submissions

Gallup Film Festival (505) 722-8982

Gallup Sun • Friday June 9, 2017

DWI FIRST TIME OFFENDERS

WEEKLY CRIME BLOTTER Staff Reports

BRASS KNUCKLE BEATING 6/6, Thoreau A woman i nt er vened when she saw a man g e t t i n g punched out by a nother m a n , allegedly with brass knuckles near Thoreau Baptist Church, 87 State Highway 371. Dennalle Charley tackled suspect Joshua Jim, 23, and “tied him up on the ground,” according to McKinley County Sheriff’s Office Deputy Merlin Benally’s report. After Benally took an initial report from Charley, she left the scene. Benally traded out Jim’s tied hands with handcuffs and interviewed the victim, 50-year-old Jefferson Jim, who said that his nephew Joshua Jim’s behavior caught him off guard. The two were sipping on some beers near the church when Joshua Jim “sat on top of him, and began to punch him in the face with the brass knuckles in his right hand,” according to the report. Jef fer son Ji m sa id he couldn’t break free, but recalls Charley pulling Joshua Jim

HANNA SKANDERA | FROM PAGE 8 Deputy Secretary Christopher Ruszkowski will serve as acting cabinet secretary. Prior to his service in New Mexico, Ruszkowski worked as a middle school social studies teacher and served for nearly

away from him. Charley said that Joshua Jim threw the brass knuckles northward, but deputies were unable to find the weapon. Jefferson Jim sustained several half-inch lacerations to his forehead, and two one-inch lacerations to his left eyebrow. He was transported to Cibola General for treatment. Jefferson Jim was booked into McKinley County Adult Detention Center for aggravated battery with a deadly weapon and tampering with evidence.

NOT MY BEDFELLOW 5/20, Gallup A Gallup man was j a i l e d a nd later released after a theft a t a we s t side Chinese Massage business caught the attention of the Gallup Police Department. Tyler Sam, 20, broke into the business on May 20 and stole some Chinese cultural items, according to a police report taken by Gallup police officer Steven Peshlakai. Sam forced his way inside the front door and while at least three women were asleep, the police report reads. “I pat-searched Tyler for six years at the Delaware Depa r tment of Education under for mer Democratic Governor Jack Markell. Martinez claimed in the press release that under Skandera’s watch, since 2011, high school graduation rates in New Mexico have increased by 8 percentage points, to an all-time high of 71

Law Ofﬁce of Barry Klopfer P.C. Barry KIopfer Attorney at Law

Practice Areas: DWI Defense Semi-Truck Accidents Navajo Employment Law 224 W. Coal Ave. Gallup, NM 87301 Klopferlaw.com

Phone: (505) 722-9331 Fax: (505) 722-9335

Friday June 9, 2017 • Gallup Sun

weapons,” Peshlakai wrote. “I felt a big bulge in his inner left jacket sleeve.” Peshlakai recorded that Sam ended up returning a Chinese designer hanging item, a pair of rubber gloves, a pair of blue socks wrapped in bags and a CD case with a DVD that had some Chinese lettering on it. There was no value of the items listed in the police report. Peshlakai wrote that the women were asleep at the business and were awoken by someone banging on the door. “Linda woke up to a male standing over her bed,” the police report reads. “I reviewed the footage and it shows a male subject forcefully open the front door to the business. The male walks around the building and defecates in one of the rooms.” Sam got out of the McKinley County Adult Detention Center on May 25 on a $3,000 bond amount. Sam possesses a prior criminal record that consists of burglary. The break-in and theft are not uncommon at the location. Virgie’s restaurant, which is next door to the business, was robbed about a little more than a year ago. In that situation, robbers came into the business at around closing time and robbed the restaurant of an undisclosed amount of money, police said at the time. B.Dotson percent. Last year, 14.4 percent more students are now at grade level in math, and nearly 5 percent more students are at grade level in reading. Since 2011, the number of A and B schools has increased by 25 percent. 30,000 more students are now attending A and B schools. “It has been such a privilege to be part of Governor Martinez’s team in the fight to lift up our students and schools,” Skandera stated, in the press release. “The results we’re seeing in New Mexico show what can happen when we choose to embrace reform and put kids first. New Mexico should be very proud of our teachers and kids for their continuing hard work and achievement.”

NOTES: Agg. DWI

NAME: Courtney N. Billy AGE: 24 BOOKED: 5/15/17 NOTES: Agg. DWI; Cons./ Poss. Alcohol in Vehicle

NOTES: Open Container

NAME: Gabriel King AGE: 22 BOOKED: 2/10/17

NAME: Rupert Lee Billie AGE: 25 BOOKED: 5/6/17 NOTES: Agg. DWI; Cons./ Poss. Alcohol in Vehicle NAME: Julian Douglas Towne AGE: 40 BOOKED: 5/14/17 NOTES: Agg. DWI; Cons./ Poss. Alcohol in Vehicle NAME: Dennis Joe Brown AGE: 38 BOOKED: 5/11/17

NAME: Adrianne Yazzie AGE: 35 BOOKED: 2/10/17

NAME: Kyle R. Clah AGE: 30 BOOKED: 2/10/17

NAME: Richelle L. Shorty AGE: 28 BOOKED: 2/9/17 NOTES: Agg. DWI/ Open Container

the ADVERTISE inGALLUP SUN

- IT'S FREE! - IT'S FREE ONLINE! - LARGE DISTRIBUTION ZONE - CAPTIVATING COVERS

s want p! r e d a e R us u to pick at r

CALL

or EM

r gre today fo s u L I A

l deals!

specia ates and

(505) 728-1640

gallupsun@gmail.com | www.gallupsun.com

NEWS

GALLUP SUN BUSINESS DIRECTORY AUTOMOTIVE Rico Auto Complex GMC Buick Full Service Garage (505) 722-2271 220 S. 5th St. ricoautocomplex.com

FURNISHINGS

AUTOMOTIVE

PROFESSIONAL TRUCK & AUTO CENTER Auto Painting & Body ALL MAKES & MODELS FREE Estimates for Insurance Claims

AUTOMOTIVE

DINING OUT

Full Service Garage

Smoothies Coffee Wraps Salads Pizza Desserts

ED CORLEY NISSAN

500 E. HWY 66 Gallup, NM 87301 505-863-3953 protruck@qwestofﬁce.net

1000 W. Jefferson Ave. (505) 863-6163

(505) 722-5017 302 S. 2nd St.

HIGHER EDUCATION

HOME HEALTH

INSURANCE

OIL CHANGES START AT $25.99 + tax

INSURANCE Bubany Insurance Agency

Electronics Appliances Carpet (505) 863-9559 1308 Metro Ave Gallup, NM

JEWELRY SUPPLY

Associates & Bachelor Degrees (505) 863-7500 705 Gurley Ave Gallup, NM

OFFICE SUPPLIES Butler's Ofﬁce City

(505) 722-4323 1907 W. Historic Hwy 66 thunderbirdsupply.com

DWI | FROM PAGE 9 adv ised him that a white pickup truck was leaving northbound on Sixth St., where the officer observed a white pickup turn onto Aztec and continue eastbound. Following closely, Benally caught up to the truck by Third and Aztec, making the final stop in the downtown Courtyard parking area, 200 W. Hill. Joe, 32, of Gallup said he was the designated driver, but while getting his papers together, Benally asked dispatch for more information and discovered that Joe’s license had been suspended/revoked for a previous DWI. Joe refuse to do a SFST and was arrested. A portable breathalyzer was brought to the scene where Joe blew a 0.217, but then refused further testing. Joe was booked into the Adult Detention Center. Eddie Tsosie 2.24.17, 7:14 pm 4th DWI, Aggravated Alerted by a passing civilian, McKinley County Sheriff’s Office Deputy Roxanne King traveled to the Family Dollar NEWS

Ofﬁce Printing Book Nook Teaching Supplies (505) 722-6661 1900 E. Hwy 66 Gallup, NM

Store on South State Road 602 wher e s he observed the subject vehicle in the store’s parking lot. When t he d r i ver started the small pickup, he pulled onto the highway heading south but went into oncoming traffic. King activated her emergency lights but the subject vehicle turned left onto Blue Jay Road before coming to a complete stop. Although initially claiming he lived in the area, a check of his I.D. card listed Bread Springs (about 9 miles north) as his current address, which he confirmed when asked. Tsosie, 61, agreed to a SFST but after the first part, which he failed, began claiming that he was disabled and unable to do the alphabet or finger dexterity test. At this point he was placed in handcuffs. The other three occupants in the vehicle were transported to Gallup Detox. Tsosie agreed to a breath test, where he blew a 0.27 and 0.26. He was taken

Personal Care Services, Inc & Enterprises (505) 863-5898 1613 S. 2nd St.

Life Auto Rentals Full Service Agency Se Habla Español (505) 863-8086 102 E. Aztec Ave

PHOTOGRAPHY

TRUCK STOPS

RAH Photography

Meeting All of Your Photography Needs! (505) 863-6084 Facebook.com/rahphotography RAHPhotography.com

TA Travel Center 3404 W. Hwy 66 Fuel Food Motel (505) 863-6801

first to Gallup Indian Medical Center for medical clearance and then to the Adult Detention Center to be booked. Valerie Baloo 2.18.17, 12:49 am 3rd DWI, Aggravated An alert McKinley C o u n t y Sher i f f ’s Deputy, A r nold J. Noriega, obser ved a vehicle without License Plate Illumination. He stopped the vehicle on S. 2nd Street just north of Astro Glass and talked to the driver Baloo, 45, of Houck, AZ. After noticing the strong odor of alcohol, Noriega asked Baloo if she had been drinking. She said that she had only had two beers at the Sports Page and agreed to a SFST. She failed the first part of the test because she couldn’t keep her head still. When Noriega saw that she was wearing high heels, he tried to substitute an alphabet test but Baloo said she couldn’t do it from N to Y because she had never started with an N before.

She also failed the number test and the finger dexterity test. This arrest constitutes her 2nd offense in New Mexico and she also had one prior arrest in

Home Auto Life All Types of Insurance! (505) 863-3836 311 S. Third St. Gallup, NM

Introducing Gallup Sun Biz Directory Get Noticed. And get more customers in the door for only $60 for six weeks! Call Ad Rep Raenona @ (505) 879-1941 or (505) 728-1640 today. Arizona. She was transported to the MCSO and submitted to a breath test where she blew 0.22 twice. She was booked into the Adult Detention Center.

Red Mesa man pleads guilty to involuntary manslaughter charge Staff Reports

L BUQU E R QU E – Lelander Mays, 31, an enrolled member of the Navajo Nation who resides in Red Mesa, Utah, pled guilty in federal court in Albuquerque to an involuntary manslaughter charge June 7. Mays was arrested in Dec. 2016, on a criminal complaint charging him with involuntary manslaughter. According to the complaint, Mays killed a man when Mays crashed his vehicle on Dec. 6, on the Navajo Indian Reser vation in San Juan County. At the time of the crash, Mays was driving under the influence of alcohol and the victim, who was a passenger in

Mays’ vehicle, was thrown from the vehicle. Mays was subsequently indicted on Dec. 20, a nd cha rged w ith involunta r y manslaughter. During today’s proceedings, Mays pled guilty to the indictment without the benefit of a plea agreement. At sentencing, Mays faces a maximum penalty of eight years in federal prison. A sentencing hearing has yet to be scheduled. This case was investigated by the Farmington office of the FBI, the Navajo Nation Division of Public Safety and the New Mexico State Police. Assistant U.S. Attor ney Nichola s J. Marshall is prosecuting the case.

Gallup Sun • Friday June 9, 2017

in McKinley County, New Mexico )\GIWWMZIEPGSLSPYWIMWEWIVMSYWTYFPMGLIEPXLMWWYIMR1G/MRPI]'SYRX]FYXXLIVIMW QYGL[IGERHS%WEGSQQYRMX][IGERSZIVGSQIQER]SJXLIWIRIKEXMZISYXGSQIWF] [SVOMRKXSKIXLIVXSTVSZMHITVIZIRXMSRIHYGEXMSRWYTTSVXPSGEPIJJSVXWERHKIXMRZSPZIHMR PSGEPGSEPMXMSRWERHTEVXMGMTEXIMRPSGEPEPGSLSPERHHVYKJVIIGSQQYRMX]IZIRXW

Excessive alcohol use led to approximately 92 deaths in McKinley County in 2015.

deaths among working age adults (20-64) in McKinley County is attributable to alcohol. (NMDOH BVRHS; CDC ARDI)

(NMDOH BVRHS; CDC ARDI)

MCKINLEY COUNTY

NEW MEXICO

In 2015, the McKinley County alcohol related death rate was the second highest alcohol related death rate in New Mexico. The most common cause being chronic liver disease. (NMDOH BVRHS; CDC ARDI)

Alcohol related deaths in McKinley County have increased 38% between 1999 and 2015.

(NMDOH BVRHS; CDC ARDI)

ALCOHOL-RELATED HARM IS 100% PREVENTABLE. PREVENTING EXCESSIVE DRINKING CAN PREVENT ALCOHOL-RELATED HARM.

HEAVY DRINKING WOMEN:

Consuming or more drinks per week

MEN: 12

Consuming or more drinks per week

Friday June 9, 2017 â€¢ Gallup Sun

BINGE DRINKING WOMEN:

Consuming or more drinks on an occasion

of adults in McKinley County are NOT drinking heavily (2015 BRFSS)

MEN:

Consuming or more drinks on an occasion

of adults in McKinley County are NOT binge drinking (2015NEWS BRFSS)

DRINKING DURING PREGNANCY 8LIVIMW 237%*) %13928SJEPGSLSP HYVMRKTVIKRERG]

of women in McKinley County DID NOT DRINK during third trimester of pregnancy. (2009-2013 McKinley County: NM PRAMS)

ALCOHOL & MCKINLEY’S YOUTH

of McKinley County youth are not currently using any alcohol.

(2015 YRRS, 2015 YRBSS)

McKinley County has a lower reported rate of youth binge drinking than New Mexico or the U.S.

MCKINLEY

(2015 YRRS, 2015 YRBSS)

4VSZMHMRKEPGSLSPXSER]SRIYRHIVMWE*3968,()+6)) *)032=ERHGERQIER YTXS1328,7&),-2(&%67 Contributing to the delinquency of a minor consists of any person committing any act or omitting the performance of any duty, which act or omission causes or tends to cause or encourage the delinquency of any person under the age of eighteen years. Youth who begin drinking before age 15 years are six times more likely to develop alcohol dependence/abuse later in life than those who begin drinking at 21 years. (CDC) (NMSA: 30-6-3 )

%PGSLSP7GVIIRMRKERH&VMIJ-RXIVZIRXMSR %7&- 4VIZIRXMZIWIVZMGIXLEXMRZSPZIWEWOMRKEZEPMHEXIHWIXSJ WGVIIRMRKUYIWXMSRWXSMHIRXMJ]ETEXMIRXvWEPGSLSPGSRWYQTXMSRERHEWLSVXGSRZIVWEXMSR[MXLTEXMIRXW [LSEVII\GIWWMZIP]HVMROMRK 6IHYGMRKEPGSLSPSYXPIXHIRWMX]0MQMXMRKXLIRYQFIVSJFYWMRIWWIWWIPPMRKERHHMWXVMFYXMRKEPGSLSPMR RIMKLFSVLSSHW )RLERGIHIRJSVGIQIRXSJPE[WTVSLMFMXMRKWEPIWXSQMRSVW ]IEVWSJEKI 1EWWQIHMEGEQTEMKRW 0MQMXXLIHE]WERHLSYVWEPGSLSPWEPIWSGGYV

*SVQSVIMRJSVQEXMSR

NEWS

8LI'SQQYRMX]+YMHIEX [[[XLIGSQQYRMX]KYMHISVKEPGSLSPMRHI\LXQP

JANUARY 2017 Gallup Sun • Friday June 9, 2017

OPINIONS Despite recent budget fix, higher education is still underfunded By Armelle Casau, PhD NM Voices for Children

nyone given a chance to make an investment that is guaranteed to give a positive return year after year would do it. Even when we’re not talking about the stock ma rket, investments w ith

a high rate of return make sense. Public higher education is one such investment because it improves the workforce and helps families get out of poverty, both of which grow the state’s economy. Economists say it again and again: investments in higher education pay off. Un for t u n a t ely, G over nor

Susana Martinez’s decision to veto all funding for higher education— ever y penny— sent the wrong message to current and future college students worried about college costs as well as to businesses reticent of investing in a state that does not value education. The vetoed funding has been restored, but there’s

MADAME G

still a per va sive problem: the state of New Mexico has slashed its investments in higher education since the recession. Between 2008 and 2016, New Mexico has cut state funding for public higher education by 30 percent on a

BUDGET | SEE PAGE 15

Dr. Armelle Casau

GUIDE TO THE STARS WEEK OF JUNE 9

Welcome to the Full Moon! The Gemini Sun opposes the Moon in Sagittarius. To quote a famous movie about dinosaurs: “hang onto your butts.” This will be an evolution of emotions. You’ll feel pressured to think logically (Gemini) and think it necessary to trust your gut (Sagittarius). Madame G says go with it. Love it! Live it! Experience everything and learn joy.

ARIES (March 21-April 19)

CANCER (June 21-July 22)

LIBRA (Sept. 23-Oct.22)

CAPRICORN (Dec. 22-Jan. 19)

New experiences are a challenge. They confront your basic fears: are you good enough? Why am I doing this? Though it may seem easier to stay in the status quo, remember: if you “aint” growing you’re stagnating. Don’t panic! That is rule number one. The second, is enjoy the journey. Get out of your head and start living in the moment. You’ll do just fine. You’re ready. Go!

You don’t owe anyone an explanation for how you live your life. After all, it’s your life. You may choose to set out on an unknown fool’s errand—maybe it is—maybe it’s your destiny. Maybe you’re the fool. Well, every kingdom needs one. Whatever your chasing, embrace it with both hands. You’ll never know until you try—and fail—and try again. Good luck!

This is it! Your hard work is culminating into this one big event. Don’t close your eyes or you may miss out. The thing is, everyone needs a little rest. Don’t get trapped into the bog and fog of: “work, work is never done.” Just let go. You can’t control the weather or other people. The only person you can control is yourself. So, let go of the struggle. Be free! Take a breath.

You have dreams. What are they? If not, why not. You only have yourself to blame. You can’t blame anyone else for making or not making the life of your dreams— the life you’ve always wanted. Do yourself a favor, think about your dream life. Picture, it in your head. Clean out the unnecessary bits. There you are. It’s probably closer than you think.

TAURUS (April 20-May 20)

LEO (July 23-Aug. 22)

SCORPIO (Oct. 23-Nov. 21)

AQUARIUS (Jan. 20-Feb. 18)

Life is full of unexpected joys and sorrows. Of course, it’s all in your perception. At one point losing a job you hate, but can’t afford to lose may seem like a disaster. On the other hand, maybe it forces you to look towards a brighter future. You may have to get crafty and find yourself. Whatever your challenge, get up! Dust yourself off and get cracking. Destiny awaits!

So, this is love! You’re experiencing life in the fullest sense. Pure freedom and enjoyment. Don’t forget to take a few breaks while you’re pursuing your bliss. Now is the best time for being fully and wholly yourself. Now is the time to live like you’ve never lived before. It’s never too late to be who you’ve always wanted to be. Have a blast and a nap! GO! Snore.

Creativity has a way of sneaking up on you. Don’t rush it. Instead of rushing a project to death, just wait. Allow time to heal all wounds and clear away the sediment. You’ll notice that the mud falls right down to the bottom. Focus on one project at a time and put first things first. You’ll get nowhere fast, if you bounce from one to the other. Instead focus on completing just one.

You’re probably thinking—is this it? When you get to the end of a journey it can be disappointing. Was the buildup worth it? Are you ready to walk a thousand miles back? Remember what you learned on the journey, it’s the journey that matters not the number of steps or where you’re going. Enjoy watching the cherry blossoms and children laughing. Good!

GEMINI (May 21-June 20)

VIRGO (Aug. 23-Sept. 22)

SAGITTARIUS (Nov. 22-Dec. 21)

Your logic is warring with your intuition. In cases like these, it’s actually logical to listen to both sides. But, the body has its own wisdom and scientists have proved that there are brain tissues in your heart and gut. So, listen to your head, heart, and gut. If something seems dangerous it probably is. If you feel it’s time to leave—do it! Don’t wait! Don’t hesitate. Do it.

What are you waiting for? You never know until you try, if you can do something or not. And even if you fail—you should try again. You don’t need to keep failing in the same way. Just look for a new way of living. Life is not about perfection. It’s about enjoying perfect little moments while taking a break from the really big ones. It’s up to you and greatness.

PISCES (Feb. 19-March 20)

Do the right thing, at the right moment, and in the right way—that’s timing. Timing is everything. The best time to tell someone you have issues is not when they’re crying over a loss. You may feel like yelling at the new clerk behind the counter, but your new boss is just walking around the corner. Remember, life is not a sprint—it’s a marathon. Thaw out a little.

You’re learning. You may feel the way to someone’s heart is through your wallet, but you’re wrong. That’s just the consumerism talking. In fact, they way to any heart (worth having) is through honesty and sincerity. Help someone when they need. Reach out when you notice a job well done. Show gratitude at the best and worst of times. You’ll get it.

Friday June 9, 2017 • Gallup Sun

OPINIONS

Gallup Sun Editorial: The Angels of Mercy at GMCS

ur hats are off to Ga llupMcK inley Cou nt y S c ho ol s I nt e r i m Superintendent Mike Hyatt a nd t he mem b er s of t he ent i re Ga l lup -McK i n ley County Board of Education. The school district pulled off a ma jor logistical feat with the recent announcement t hat k id s at tend i ng McK i n ley Cou nt y schools won’t be required to pay for school supplies starting the fall of 2017.

The school supplies decision is final and won’t change in the near or distant future. That means free pens, pencils, notebooks and lab fees forever! “ It ’s a c o s t - s a v i n g s mea sure a nd there a re no strings attached to it,” Hyatt told the Gallup Sun. “This takes the cost-factor of parents hav ing to buy school supplies and basically puts the cost-factor in the hands of the district.” McKinley County

students now don’t have to pay for school supplies and the lab fees – a big deal considering the cost of school supplies for one student can go as high as $70 per pupil per in a given school year. And we won’t dare get into Gallup’s high gross receipts tax rate, which at 8.3125 percent is one of the highest in New Mexico. F r om ou r s t a nd p oi nt , Hyatt and crew hit a home run with this move, which didn’t require a formal board

vote. The move to not charge students was a perfect example of what people in power can do when they care and get together and support the community. As we’ve noted

BUDGET | FROM PAGE 14

government invested nearly $400 million in our state’s colleges and universities in 2014 -2015 t h roug h g ra nt s a nd cont ra ct s, a ccord i ng to the National Center for Education Statistics. These federa l fu nds, a long w ith tuition, hospital services, and other payments, all added up to more than $3.6 billion in overall revenue generated through New Mexico’s public higher education institutions. Of that total, $790 m i l l ion c a me f rom s t a t e appropr iations. W hen the state cuts funding for higher education, the universities and colleges have to make up the difference with cuts in classes offered and staffing and increases in tuition. All of which makes it more difficult for students to complete their education. While the state was cutting funding between 2008 and 2016, colleges and universities were increasing tuition by 31 percent. Given the most recent cuts, many of our higher education institutions have no choice but to raise tuition, again. And g ue s s who s u f fer s mo s t when tuition goes up? Lowand middle-income students, who are less likely to enroll in college or to complete the credentials we need to grow our economy. Another problem with our state higher education priorities is that only 24 percent of New Mexico’s state financial aid is based on student financial need. The national average is 76 percent and

n e i g h b o r i n g s t a t e s l i ke Arizona, Colorado, and Texas are all at or near 100 percent. When need-based financial aid is insufficient, particularly in our state which has the second worst rate of poverty nationwide, college is out of reach for a large portion of our current and future workforce. And then

our businesses and industries suffer as well when they can’t find qualified workers. Given that not enoug h of our work force ha s the education and credentials necessary for a 21 st century economy, it should come as no surprise that New Mexico has the worst unemployment rate in the nation and little job

per-student inflation-adjusted basis. And the Legislature made additional cuts for 2017 and 2018. Research clearly shows t h a t it pay s t o i nve s t i n the work force. States ca n bu i ld a s t ron g e conom ic foundation with high pro ductivity when they invest in education. Median wa ges i ncrea se w it h better- educated workers. States can then better support the needs of the state t h roug h h ig her t a x reve nues. Universities and colleges fuel the economy in the communities where they are located. College education reduces public a ssistance and health care costs. On and on… State Representative Bill McCamley outlined the numerous ways that higher e d u c a t i o n i m p a c t s Ne w Mexico in an op ed before the special session. Our New Mexico universities and community colleges educate college students and strengthen our workforce, but they also conduct scientific research and treat cancer patients, work with farmers through extension offices, train military cadets, and help students with special needs access crucial education services. All of these increase our state’s human capital. Ou r publ ic u n iver sit ie s a nd col lege s h ave a high dolla r impact on the state, as well. The federal OPINIONS

on this page numerous times before, the volunteer spirit in McKinley County is alive and well and surfaces when one least expects. But the school d istr ict sincerity is something that’s not always found in communities. There are caring people ever ywhere, of course, but a community that is able to give and not expect anything back, particularly in a poor and rural county, is commendable.

Gallup Sun Classifieds Getting ready to have a garage sale or shed some unwanted items? Perhaps you want to sell your home or car. Place your classified ad today. See page 22 for rates and details!

growth. That, along with our high rate of poverty, makes New Mexico the last state that should be skimping on investments in higher education—including need-based financial aid—let alone making deep cuts. Ar mel le Ca sau is a research and policy analyst with NM Voices for Children.

Let that Summer SMILE Shine! Schedule your dental check up today! Eduardo Valda, DDS

Birth to 21 – Hospital Dentistry – Emergency Service Physically & Developmentally Challenged Children and Adults

We Accept NM Medicaid – Hablamos Espanol

107 W. Green Ave. Gallup, NM 87301

505-721-0040 • www.smallfrydentistry.com Gallup Sun • Friday June 9, 2017

COMMUNITY

Transportation Construction Career Readiness Program: FROM THE CLASSROOM TO THE CONSTRUCTION FIELD By Dee Velasco For the Sun

unique program has come to the UNMGallup branch that of fer s more t ha n just classroom instruction for a career in construction. The Tra nspor tation Construction Career Readiness Program, which began June 5, is a hands-on class that introduces students to the construction trade. And a core group of students have donned hardhats and rolled up their sleeves to get busy with some construction projects. A collaboration of T he A s s o c i a t e d G ener a l Cont r a c t or s of A mer ic a , New Mexico Department of Transportation, and National Cent er for Con s t r uc t ion Educat ion Re sea rch, t he program is free of charge to students. And the program has its benefits as well as rewards. Once completing the entire course, students receive a NCCER Core Complet ion C e r t i f i c a t i o n , O S H A 10 Construction Card, NCCER Site Safety Credential, Up to one-year advanced placement in all 5 of AGC New Mexico Apprenticeship programs. Rebecca Johnson,

U N M - G a l l u p Wo r k f o r c e Development Business liaison, said NMDOT utilized grant money so they could provide training to fill positions in transportation and construction. “This collaboration between New Mex ico Department of Transportation, AGC, and NCCER makes it possible for students to learn a new trade,” Johnson said. “We were lucky to make this available to 14 students, they will learn all types of safety. They will even build a project here too, which is going to exciting … we hope to do this a couple times a year.” Donov a n Wi l l i a m s, of Gallup, says the program was a welcome change in his deciding upon a different career path. “I wanted a career change from what I was doing,” he said. “It’s very informing and it really teaches us everything.” Getting the students prepared so they can go out to the job force is all a matter of confidence says Robert E n c i n i o, a U N M - G a l l u p Con st r uct ion Tech nolog y instructor. Encinio who was a general contractor for more than 30 years, and has been teaching for five years at the UNM-Gallup branch.

Instructor Robert Encinio provides hands on training to students enrolled in the “Transportation, Construction and Career-Readiness Program” at UNM-Gallup. Photo Credit: Knifewing Segura “This is the first class that I have taught like this; to have the student realize what they are doing and then going out and doing it for themselves is a big part,” Encinio adds, “We’re giving them basic safety, we’re giving them basic tool safety, tool usage, and teaching them basic blue print reading, layout and framing.” There is a great interest among young people in the constr uction f ield with 11

We’re here to help manage the financial things in life. So you can focus on the finer things. Life itself, is rich. And at Pinnacle Bank, we want all of our customers to have a chance to experience it fully. We’ll work hard to satisfy your banking needs. Because banking here is just a means to getting back to living here. GALLUP 107 E. Aztec Ave., 505.722.4411 Walmart: Maloney Ave., 505.863.3442 • 1804 E. Aztec Ave., 505.722.0300 0416_NM_HOTAIRBALLOON_4C_5925x2.4894_AD.indd 1 16 Friday June 9, 2017 • Gallup Sun

nmpinnbank.com 3/23/17 1:45 PM

men a nd t h ree women i n this program. UNM graduates who have prev iou sly taken classes in constr uction have come back for this program. “There are so many people who need people with construction skills right now, (and) we just don’t have them and this program fits that’s that gap.” Encinio said. Student K ia ra Cha rley, who hopes it will enhance her degree, and, Cheyenne Livingston, wanted to take the class to gain some new experience. “I want to use this program to help me reach my civil engineering degree,” Charley said “It’s also teaching us the basics like using tools like the skill saw and it’s really fun.” Charley said. “I took a class like this in high school in Thoreau, and if I don’t find a job it’s nice to have these qualities.” Livingston said.

Requirements to enter the program include: GED, high school diploma, 18 years or older, and other requirements. Once accepted students are immersed right into the program with Basic Hands-on Construction Skills. The three-week Tra nspor tation Ca reer Readiness Program includes topics such a s creating a trades resume, math and measuring skills, construction culture, what it’s like to work in the construction trade, basic safety, and tools training. It includes 46 hours of core construction principles, 40 hours of heavy/highway construction principles, 10 hours of OSHA training, and 24 hours of hands on training. For more details about the Construction Career Readiness program cont a c t th e U N M G a l l u p Community Based Ed & Workforce Development office at (505) 863-7743. COMMUNITY

‘Run For The Wall’ T-Shirt Fundraiser

Cibola Arts Council sponsors golden hour ‘photo safari’

EVERYBODY WELCOME TO SHOOT THE ‘MOTHER ROAD’ By Helen Davis Sun Correspondent

G V

etera ns Helping Vet er a n s i s hold ing a fundraiser to help raise money to

raise a giant flagpole, and a very large American flag, at the home of the future national veterans’ cemetery in Gallup.

To purchase or make a donation, contact Dave Cuellar of Veterans Helping Veterans: (505) 879-3333

Bob Dylan’s ‘Hometown’ Hopes singer to play local fest Staff Reports

ulitzer prize winner and legendar y folk si n ger B ob D yl a n has famously claimed that he grew up in Gallup, NM. Now, Gallup, a small desert town in northwestern New Mexico, is hoping to bring the musicia n back to h is roots with a brand-new music festival. “Doin’ Dylan: Gallup’s Bob Dylan Tribute Concert” will feature regional folk artists and bands for the first of an annual music festival. The lineup includes McManus & Juda, the Cliff Dwellers, and Joe West & Friends: The Dylan Project. But the pie-in-thesky, ultimate hope of Gallup is for their long-lost native son to make an appearance. GallupARTS, a nonprofit arts council and sponsor of the event, has reached out to Dylan. In a letter to the singer, they write: “We in Gallup love knowing that we may have captured your imagination and that you wanted to own COMMUNITY

our hardscrabble town if only in your heart.” Even if the famously reclusive Dylan doesn’t attend, gallupARTS invites all folk music lovers and Dylan aficionados to attend “Doin’

Dylan”, which is free and open to the public. The concert is June 10, from 6:30 – 9 pm at Gallup Downtown Conference Center. For more i n for mat ion, please visit galluparts.org.

RANTS – Amateur a nd profe s sion a l photographers will have a chance to “safari” down the Grants and Milan stretch of Highway 66 June 10 during the early morning “golden hour.” The “golden hour” for photographers is that time when the light adds mood and texture to photographs, early morning or late afternoon. Shooting in the field is from 6 am to 9 am or so. The event begins and ends the Cibola A r ts Council’s Double 66 Gallery in Grants and is open to everyone. “I’ll have cinnamon rolls and coffee at 6 am,” Executive Director Rober t Ga llegos said, adding that there will be refreshment for the return to the gallery at 9 am, as well. Photographers will be able to download and copy their work

to a flash drive and discuss photos at the gallery after the shoot.  Old Route 66 throughout the area still has original art on some buildings; many buildings and signs from the hey-day of the “Mother Road” are still standing. The United States highway, known as “Route 66” contributed greatly to the Cibola County economy in its time, but is falling into memory in the 21st century. “We can capture it so it becomes new again,” Gallegos said. Photographers should provide their own flash drives, but co-founder of the event, local photographer Joe Chavez, will provide assistance and computers Gallegos said. Gallegos said the community photography event began to form when Chavez one day said, “Let’s have a photo

CIBOLA ARTS | SEE PAGE 21

Old Rt. 66 in Grants and Milan is now part of the business bypass for Interstate 40. Photo Credit: Helen Davis Gallup Sun • Friday June 9, 2017

Wingate’s Keziah Pine to attend Haskell Indian Nations University in Kansas

FORMER GALLUP SECURITY GUARD, THEATRE WORKER NOW A ‘FIGHTING INDIAN’ By Bernie Dotson Sun Correspondent

f ter ex per ienci ng a year in the work world to contemplate life and “to just think about what I wanted to do,” Wingate High School graduate Keziah Pine is now poised to attend college come fall of 2017. Pine, a for mer student

council president at Wingate and standout volleyball player for the Lady Bears, signed a letter-of intent-June 5 to attend Haskell University in Lawrence, Kan. Pine, 19, signed the letter in the presence of her parents, Donald and Mary Pine, Wingate volleyball coach Karen Malone and Wingate assistant volleyball coach Melody West. The signing took place at Wingate

From left, Melody West, Karen Malone, Kaziah Pine, Donald Pine and Mary Pine. Photo Credit: Knifewing Segura

Keziah Pine gets ready to sign her letter of intent with Haskell University June 5. Photo Credit: Knifewing Segura

COACH’S KORNER … By Greg McNeil

ast year I addressed a diet question from a California gentleman who wanted know if it were possible to get into really good shape without a restrictive diet or training like an Olympian. My answer to the question was yes, and the answer remains yes. But there’s got to be a catch somewhere, right? No, there is no catch but there is a requirement to have a fundamental understanding of natural law to fully appreciate how food works in our bodies. The late Dr. Sebi said, “If you want a great example of how you should be eating all you have to do is take a look at the zoo.” Animals in the natural world eat according to their DNA (your body’s instruction for living) and for this reason they never need a vet. It is easy to overlook, but there are deeper reasons why the polar bear will never be a grain eater,

obviously, there are some former Wingate players there already.” As a senior at Wingate High, Pine said she got looks

from Lewis and Clark College in Portland, Ore., and from

KEZIAH PINE | SEE PAGE 21

It’s Not Meant For You?

the eagle won’t dine on strawberries, humming birds avoid dairy products and the zebra will never ask for a steak well done. A n i m a l s t h a t a re not domesticated naturally avoid anything not meant for them to eat. This is fundamental to natural law and the first step to improving health as human beings. Health does not begin with exercise health begins with proper nutrition. In addition there is the understanding that nutrition and food is not the same thing. Food will fill your belly but it will not nourish the body. In order for a substance to provide nutrition it must be recognized and assimilated by the body. This is called chemical affinity. If we return to the zoo example and the natural world we share with all things there is insight to be gained that supports our understanding of food, DNA

Friday June 9, 2017 • Gallup Sun

High School. “I’m very happy with my decision,” Pine said. “I’m very familiar with the school. I’m familiar with the coaches and,

and what we should be eating. Here in New Mexico, the high desert and surrounding reservations there is a critical problem with diabetes. I told my wife (Dine’) that the cure for diabetes lies in understanding the effect that fo o d h a s

on our health. The cure is in the food? Yes, the cure is always in the food. Let me explain. A gorilla will never eat meat because

meat it is not the gorilla’s source of food. Furthermore, the DNA of the gorilla is not designed to eat meat, but nuts, leaves and berries. For example, if you are Native American, Dine’ and your doctor tells you that you are lactose intolerant, what is the message? At one level your doctor is telling you that your body’s DNA cannot process any dairy products from the cow, including the meat as well. Second, and perhaps the most important message is continued use of this product (dairy) will lead to medical symptoms and disease. Why? The cow was created through genetic engineering (see Gregor Mendel) and is not natural to your ancestral environment in North America. This does not make the cow a bad animal as a source of food if your ancestors are European, however, if your

ancestors are not European and in this case Dine’, then the vitamin D claims attributed to milk will not apply to you because genetically your body cannot metabolize cow milk. My first trip through the Window Rock museum yielded interesting facts as I followed the historical timeline. The first thing I noticed was that there was no obesity or other indicators of poor health such as kidney, heart, liver, autoimmune or any other disease associated with 21st century living. If I consume any product not meant for me, regardless of how tasty it is my body will manifest medical symptoms leading to disease over time. As we improve our knowledge of health and nutrition we begin to understand that the health problems we experience in the form of obesity, heart, kidney, or liver disease are really symptoms created

COACH’S KORNER | SEE PAGE 21 COMMUNITY

Unraveling the suffocating wrap of stilted dialogue in ‘The Mummy’ RATING: «« OUT OF 4 RUNNING TIME: 110 MIN. By Glenn Kay For the Sun

ver thought that the only problem with the classic Universal Monsters series was that they needed to team up and form an underground league to fight greater evil? I didn’t think so, but that is the tack that has officially been taken. T he Mummy is an attempt to start a new “Dark Universe” series of films that will eventually combine characters like Frankenstein’s Monster, The Invisible Man and The Creature from the Black Lagoon. While I’ll admit to being amused by the idea of these monsters coming together (personally, I think they should fight crime while tackling their various psychological issues), based on their first attempt the studio hasn’t yet found the right approach. T he stor y beg i ns w ith greedy soldier/treasure-hunter Nick Morton (Tom Cruise) and his pal Chris (Jake Johnson) accidentally uncovering the tomb of Egyptian princess A hmanet (Sofia Boutella).

They enter with archeologist Jenny Halsey (Annabelle Wallis) and get more than they bargained for. Ahmanet was mummified while alive as punishment for making a deal with the Devil for revenge against humanity. Now, she wants to complete a ritual that will bring the evil force back, and she needs Nick to supply the body. Stepping in to offer assistance to the group is a mysterious London-based organization headed by Dr. Henry Jekyll (Russell Crowe). There are some entertaining moments. A sequence with an out of control plane feat u r i ng t he ch a r a ct er s being bounced around looks impressive as does a scene that involves swimming mummies. A couple of quips and reactions from Morton also raise a chuckle. The movie’s emphasis on action (with the occasional hints of creepiness thrown in) may impress youngsters unfamiliar with the characters. However, those familiar with the creature features will note the many bits and pieces sewn together from other horror films. Obviously, The Avengers has inspired this new monster team-up universe, but the movie also bor r ow s element s (f r om threatening bugs to a treasure

Want a hug? Ahmanet (Sofia Boutella) gives hugs that kill in ‘The Mummy.’ Now playing. Photo Credit: Universal Pictures hunting protagonist) from the 1999 remake as well. Even the mummies featured share characteristics more in common with vampires and fast-moving zombies. Hor ror fa n s w i l l a l so notice scenes that bear close similarity to pictures like An American Werewolf in London and Lifeforce, yet lacking the same kind of witty, crazed panache. There are also some serious pacing issues that ultimately make it seem as though the sum is less than the whole of the pa r ts. The editing feels muddled, choppy and at times clumsily executed. People jump around a lot from

INSURANCE & PRIVATE PAY ACCEPTED

Services Include:

Mobility Assistance Meal Preparation & Eating Household Services Hygiene/ Grooming/ Bathing

Be cared for by GRACE with a staff that Cares 505-863-5898 Fax 505-722-9165 1613 S. 2nd Street • Gallup COMMUNITY

location to location, and while there’s sometimes a justification for it, on numerous occasions the strange cutting takes one out of the story. The movie is in a big rush, but it comes at the expense of story and character and feels exhausting at times. T r ut h f u l ly, t here’s not a whole lot of chem istr y between the stars, either. A lot of the interplay falls flat and that leaves viewers less involved with the primary relationship within the film. None of the cast members are particularly helped by some stiff and at time corny dialogue that includes (paraphrased) lines like, “Maybe it takes a monster to defeat a monster.”

The entire enterprise is a bit too stiff and serious for its own good, needing a sharper sense of humor. Would I want to see these characters team up and get involved in more adventures? Not really, and this is coming from a Universal Monsters fan. In the end, The Mummy has a few interesting moments but doesn’t quite come together, eventually unraveling thanks to a problematic screenplay. One can only hope that future chapters in the “Dark Universe” get a better handle on some of these classic characters and deliver a bigger punch. For more awesome movie and DVD reviews, visit: cinemastance.com 207 WEST COAL GALLUP 505.863.1250 www.elmorrotheatre.com Facebook @elmorrogallup

MOVIE TICKETS $5 AT ALL TIMES CHILDREN 12 AND UNDER FREE WITH ADULT FOR FILMS

JUNE 2JUNE 15

Weeknights @ 7pm Saturday & Sunday @ 2pm, 5:30pm, 9:00pm Gallup Sun • Friday June 9, 2017

DVD/Blu-ray Roundup for June 9, 2017 By Glenn Kay For the Sun

oly cow. W hen it comes to Blu-rays a nd DV Ds, some we ek s a r e q u iet while others are filled with a seemingly endless supply of films. This happens to be one of the latter examples, with a massive supply of new releases that include the most popular film of the year (so far). So, if you can’t make it out to the movies this week, be sure to give one of these titles a try!

BIG NEW RELEASES Aftermath - An air traffic controller’s mistake results in a tragic plane crash. Suffer ing from tremendous g u i lt, t h i n g s ge t even worse when the man must confront the enraged widower husband of one of the passengers, who is seeking revenge for the death of his wife and daughter. This heavy independent drama earned split notices from reviewers, with a few more negative responses than positive. Most were impressed with the first half of the film and admired the performances, but many felt the story became too rushed and melodramatic a s it progressed. It sta rs Arnold Schwarzenegger, Scott McNairy and Maggie Grace. All Nighter - In this oddball indie comedy, a musician is forced to endure an awkward dinner with his girlfriend’s father, who is an uptight workaholic businessman. Some time later after the pair have broken up, the woman disappears and the dad attempts to secure the help of the musician to locate her. Together, these very different people begin to open up to one another and start to find common ground. Notices were quite poor, with many critiquing the screenplay for veering into formula and slapstick, leaving its talented cast with little to salvage. It features Analeigh Tipton, Emile Hirsch, J. K. Simmons and Kristen Schaal. T h e A ssi g nm e nt - A n assassin is double-crossed in

this action-thriller. He ends up under the care of a surgeon who performs gender reassignment surgery. Now a female, the hitwoman attempts to find the parties responsible and figure out exactly why all of this happened. This low-budget effort comes from director Walter Hill (The Warriors, 48 Hrs., Streets of Fire). Unfortunately, the press didn’t think it was as effective as some of the filmmaker’s previous works. As few called it amusingly pulpy and polished enough to recommend, but the majority didn’t think that it allowed its characters and situations to get outrageous enough and found the film a bit of a slog. The cast includes Sigourney Weaver, Michelle Rodriguez, Tony Shalhoub and Anthony LaPaglia. T h e A x e Mu r d e r s of Villisca - In this scare flick, a group of teenagers are compelled to break into a house where a series of unsolved axe murders took place in 1912. Guess what happens? Yep, the kids are terrorized by some sort of malevolent force looking to add them to the victim list. Critics weren’t particularly impressed with this independent feature. A couple felt that some of scares worked, but most called it a very middle-of-the-road effort that does little new or inventive with the teens-in-peril horror formula. Rober t Ada mson, Ja r ret t Sleeper and Alex Frnka headline the feature. Beauty and the Beast Here’s one some of you may have heard of. The highest grossing movie of the year to date is this live-action update of the 1991 animated Disney flick. Belle is a young girl who ends up in the castle of a prince cursed to live as an ill-tempered beast. As a relationship blooms, villagers learn of the creature and venture out to kill it. Reviews were decent for this effort. Several did feel that it didn’t add much to the original, but others admired the lavish, elaborate production and commented that the entertaining cast made this new take on the material enjoyable enough to recommend. It stars Emma Watson, Dan Stevens, Luke Evans, Josh Gad, Kevin Kline and plenty of other familiar faces. A Cure For Wellness Looking for a future cult film

20 Friday June 9, 2017 • Gallup Sun

to rent? This horror/thriller involves a young executive who is sent to a strange retreat in the Swiss Alps to find a corporate executive. Once he arrives at a bizarre “wellness center” that is housing his boss, the youngster finds leaving much harder than anticipated. This is one of those love-it-or-hate-it experiences. It split the press, with slightly more opponents than advocates. Those who hated it described the film as pretentious and overlong. It’s supporters called it gorgeously shot and completely unhinged, tackling some taboo elements in outrageous fashion. It features Dane DeHaan, Jason Isaacs and Mia Goth. A Good American N S A (National Security Agency) Cryptologist Bill Binney is the sub ject of this documentary from Executive Producer Oliver Stone. It details his work on a simple yet sophisticated program he developed in the late 90s to counter terrorism threats. Unfortunately, business contracts between the NSA and other developers led to the project’s dismissal weeks before the 9/11 attacks; this film purports the software would have easily stopped the event from occurring. Reviews were very good, suggesting that while it sometimes gets bogged down in technical details, the film was stunning in its exposé of government ills. Land of Mine - Based on real events, this wartime drama is set after the close of WWII and involves a group of captured teenage German POWs. As part of their sentence, they are tasked with clearing thousands of mines from Danish beaches. The story follows the relationship that develops between a tough Sergeant and the prisoners. This one was nominated for Best Foreign Language Film at the Academy Awards and earned strong reviews. There were a few who critiqued it as being overly sentimental, but the vast majority found it a unique and incredibly tense feature. The cast includes Roland Moller, Louis Hofmann and Joel Basman. The Last Word - A successful

but controlling businesswoman e m ploy s a young writer to help write her life story. After recou nt i ng her experiences and being less-than-impressed with the final product, she forces her employee to massage and reshape the biography, causing a bit of conflict between the pair. This comedy/ drama didn’t earn much love from critics. A few enjoyed the performances of the leads, but the greater part complained that it became more and more sappy and tiring as it progressed. It features Shirley MacLaine, Amanda Seyfried. AnnJewel Lee Dixon, Philip Baker Hall and Anne Heche. Political Animals - This docu ment a r y det a i l s t he st r ug g les of fou r fema le Californian legislators fighting for LGBT rights. Among their noted accomplishments are a partnership registry and an anti-bullying bill enacted to protect gay students. The distributor who picked up the film are debuting it on disc so there aren’t any reviews available as of yet. However, it did make the rounds at various festivals and earned plenty of significant accolades, including wins for Best Documentary at the 2016 Los Angeles and San Diego Film Festivals as well as awards from several LGBT events. The Sense of an Ending An older man reminisces about the decisions he made as a youngster in this UK drama based on the popular book of the same name. Unfortunately, they weren’t all great choices. This leads to various revelations about the character and the pain he caused others. Notices were quite good for the feature. While there were a few who felt it didn’t do its source material justice, significantly more complimented the low-key performances and weighty characterizations. It comes from the director of The Lunchbox and stars Jim Broadbent, Cha rlotte Rampling, Harriet Walter, Michelle Dockery, Matthew Goode and Emily Mortimer. The Ticket - In this independent drama, a blind man has his sight restored. Yet, as the

bright colors of the world open up to him, it changes his personality. A synopsis states that he becomes obsessed with superf icia l a nd p r e t t y things, contrasting his previous life ph i losophy and experiences. Reviews were evenly mixed for the production. Compliments went to the lead performance and visuals on display although some found that while well-intentioned, the themes were handled in too blunt and obvious a manner. Dan Stevens, Malin Ackerman, Kerry Bishe and Oliver Platt headline the feature. A United Kingdom - Based on a true story, this biopic tells of how King Seretse Khama of Botswana fell for a British white woman. Their relationship caused scandal and uproar in 1940s society and the film tells how the pair dealt with the opposition to their union. While there were some comments about the story being predictable, reaction was very positive towards this recreation of real events. The cast were praised for being warm and likable without events being played in too sugary or unrealistic a manner. This one is from the director of Belle and stars David Oyelowo, Rosamund Pike, Tom Felton and Jack Davenport. Voice from the Stone - A sculptor hires a nurse to come to his estate and help care for his inwardly drawn son in this thriller. Soon after arriving and falling for the artist, she begins to hear stories of voices in the walls and wonder if the man’s late wife is really deceased. Set in Tuscany during the 1950s, this period effort was complimented for its photography, but little else. Most wrote that it was poorly paced, lacking in suspense or thrills that resulted in an effort more silly than chilling. The cast includes Emilia Clarke, Marton Csokas and Caterina Murino.

BLASTS FROM THE PAST! Shout! Factor y have a

DVD REVIEW | SEE PAGE 21 COMMUNITY

KEZIAH PINE | FROM PAGE 18 Haskell. She said she’s known Ha skel l vol leyba l l coa ch Nanabah Allison-Brewer since she was 14 years old, noting that taking some general education classes at the University of New Mexico-Gallup helped her keep an academic edge. “I didn’t just keep away from school,” Pine said. “I was at UNM-Gallup.” P i ne wa s a relent les s leader and first team All-State volleyball player at Wingate for three straight years and teamed with Ashanti Antonio and Nizhoni Young in helping the Lady Bears get to state for four years. Pine and Antonio were middle hitters and two of the top players in the Four Corners during their senior years. Wingate’s signature play was to keep Pine and the incredibly athletic Antonio at the net so that a setter (Young) could “hit” one of the two for a kill shot. Antonio and Young are members of Haskell’s volleyball squad. Malone was excited about Pine’s signing. “She was a varsity starter and she went to state for three years,” Malone said. “She was one of my more stronger players. I think she will do well at the college level because she’s very smart, very athletic and very confident.” During the past years, Pine,

COACH’S KORNER | FROM PAGE 18 through our body’s response to foods or substances we cannot assimilate in our bodies. It might be easier to make Navajo tacos with Bluebird flower instead of the natural pine nuts used by the ancestors, but the patience of the old ways stored in your DNA lead to health. We can completely turn our health around

CIBOLA ARTS | FROM PAGE 17 safari,” and the gallery started developed the idea. Gallegos said he doesn’t know what to expect. He hopes this will be the first of a series of themed photo safaris. “We will try to do four a year,” he said. Pa r ticipa nts in the Saturday’s event can provide ideas and comments for future themes and locations. COMMUNITY

who thought about joining the U.S. Marines, said she worked full-time as a security guard in Gallup, and also worked at an area movie theatre. She said she utilized the open gym dates at Wingate to stay in game shape. Pine played basketball and ran track at Wingate. She said she’ll play only volleyball at Haskell. “I knew I was going to go to college,” Pine said. “Now I’m going and I’m very eager to get there.” A straight A student at Wingate, Pine said she visited Haskell over the past few months and ran into Antonio and Young while there. She said the two invited her to play in a tournament volleyball match. As for the three recapturing the outright dominance they displayed at Wingate? “We can do it. Ashanti and Nizhoni are good players. We all felt very comfortable with each other when I was there,” Pine said. “I leave in August and the first game is not too long after that.” Haskell is a federally-operated tribal university that offers associate and baccalaureate degree programs in a variety of disciplines. The school’s athletic teams play in the National Association of Intercollegiate Athletics. Haskell’s team colors are purple, gold and white. Pine hails from the Standing Rock Sioux Tribe in North Dakota.

c u lt mov ie com i n g you r way on Blu-ray. W here the Buffalo Roam (1980) tells the drug-addled adventures of author Hunter S. Thompson (who was also the subject of the 1998 feature Fear and Loathing in Las Vegas). Bill Murray takes on the lead role in this adaptation, depicting the reporter as he attempts to cover the Superbowl and Presidential election while on various narcotics. The “Collector’s Edition” includes all of the original background music from Bob Dylan and Jimmy Hendrix used in the film which hasn’t been present on previously released versions due to licensing issues. There’s also an interview with the screenwriter and a theatrical trailer. Ugetsu (1953) is a venerated Japanese film arriving on Blu-ray from Criterion. Set during the country’s 16th century civil war, the plot involves two villagers doing their best to survive the chaos occurring around them and falling prey to temptation - apparently, ghosts are also involved in the proceedings. The release includes a 4K digital restoration of the film, a movie scholar audio commentary, a documentary on the director, an interview with the cinematographer as well as the first assistant director and many other extras.

without ever picking up a weight or jogging a few miles, we simply need to remember to eat the foods that are meant for us. G reg McNeil is a S t r o n g F i r s t In s t r u c t o r, P rofe ssion a l Stre n gth & Conditioning coach, Licensed Clinical Counselor (LPCC), Life Coa ch, Auth or, an d the owner of Gallup School of Strength (www.gallupschoolofstrength.com)

Calling Local Actors

“There are no rules. Just get out and shoot,” Gallegos said. No reservations are needed, show up at the Gallery at 6 am with a camera or a mobile phone. No one will scoff at people using non-digital cameras, but they will not be able to download images. Beginners are welcome. Cibola Arts Council Double Six Gallery, 1001 W. Santa Fe Ave, Grants. Phone: (505) 285-7311. 505.287.7311 100 Mexico 87020

Pa ra mou nt is celebrating the 25th anniversary of Juice (1992) with a new Bluray. This film involves four Harlem teens who decide to make a name for themselves by robbing a corner store. Things don’t go as planned, leading to turmoil and backstabbing within the group. T upa c Sh a k u r a nd O m a r Epps star. Currently, there aren’t any bonuses listed so we’ll have to wait and see if any new material comes with this release. Also, cele br a t i n g a big birthday is Universal Pictures’ Fahre nh eit 451 (1967). It ’s a b o u t a n oppre s sive society where books and information is outlawed by the government and set ablaze by firemen. Directed by Francois Truffaut and based on the Ray Bradbury novel, the 50th Anniversary Edition Blu-ray includes documentaries on the film’s production, publicity material and an interview with Bradbury himself.

YOU KNOW, FOR KIDS! Looks like there’s some primate entertainment arriving for kids on disc.

Curious George: Fun With Friends

ON THE TUBE! And here are some of the TV-themed releases. Amer ican Masters: Jacques Pepin: The Art of Craft (PBS) American Masters: James Beard - America’s First Foodie (PBS) B e c k e r : T he Complete Series CHiPs: The Complete Series CHiPs: Season 6 The Convenient Groom (Hallmark TV-movie) Fair y Ta l e: Collection 8 (Japa nese A nimated T V series) Father Dowling Mysteries: The Complete Series Ge n d e r Re volution: A Journey With Katie Couric (National Geographic) Last of the Summer Wine: Vintage 2007 (BBC) Numbers: The Complete Series NOVA : Building Chernobyl’s Megatomb (PBS) Soun d of th e S ky (12 Episode Japanese Animated TV series) Van Helsing: Season 1 Wentworth: Season 3 W hen Calls the Heart: The Heart of the Community (Hallmark) The Young Pope: Season 1 (HBO)

Director Shaandiin Tome and Producer Aroonsri Khamsamran set up their casting call for the film “Mud” at Gallup Downtown Conference Center June 4. Photo Credit: Knifewing Segura Gallup Sun • Friday June 9, 2017

CLASSIFIEDS CLASSIFIEDS WEEKLY RATES

FIRST 25 WORDS: FREE!

GALLUP MCKINLEY COUNTY SCHOOLS Now Hiring K-12 Teachers GMCS Signing Incentives 2017-2018 School Year Special Education Teachers (K-12) - $7,500* Special Education Teachers (GATE) - $5,000* Speech Pathologists, Occupational Therapists, Physical Therapists, Diagnosticians, Social Workers, School Psychologists - $7,500* Math Teachers (6-12) - $5,000* Science Teachers (6-12) - $3,000 School Counselors (K-12) - $5,000* Elementary (PreK - 5 core teacher only) - $2,000 *Signing incentives at or above $5,000 will be paid over the course of two school years.

Free Rent in Rural Areas

All new teachers who work in the county and are choosing to live in district-owned housing will be offered free rent until October 31, 2017.

Apply online at www.gmcs.k12.nm.us

ADVERTISEMENT FOR BIDS FOUNDATION BRACING and MISCELLANOUS WORK (2 Buildings) GALLUP HOUSING AUTHORITY GALLUP, NEW MEXICO

Sealed bids will be received for the FOUNDATION BRACING and MISCELLANOUS WORK (2 Buildings) project at the Gallup Housing Authority main office, located at 203 Debra Drive, Gallup, NM 87302, until 1:30 p.m. local time on Tuesday, June 20, 2017. All interested parties are invited to attend. Proposals will be opened publicly and read aloud. Proposals received after that time will not be accepted. Contact Lowry Consultants, Inc., Project Engineer at (505) 259-5915 for questions concerning this project. Documents pertaining to this project may be viewed at the Gallup Housing Authority main office, phone number: (505) 722-4388, or secured at the following locations: Albuquerque Reprographics 4716 McLeod NE Albuquerque, NM 87109 (505) 884-0862 www.ariplans.com Construction Reporter 1607 2nd Street NW Albuquerque, NM (505) 243-9793 www.constructionreporter.com General Contractors, Subcontractors, Suppliers, and Manufacturers: One (1) set of

22 Friday June 9, 2017 • Gallup Sun

Contract Documents may be obtained upon deposit of $50.00 per set, is refundable and paid by check to the plan room. The deposit will be refunded to those who return the Contract Documents in good condition within seven days of the bid opening. Bidders are advised that the specifications of the Project Manual require that Davis-Bacon federal wage rates be paid for labor. Any state labor wage rates that exceed the corresponding federal rate is inapplicable and shall not be enforced. (Federal Register August 10, 1988, 24 CFR Part 905, 941, 965 & 968). The state procurement code, sections 13-1-28 NMSA 1978, imposes civil and misdemeanor criminal penalties for its violation. In addition, the New Mexico criminal statutes impose felony penalties for bribes, gratuities, and kick-backs. Bidders are advised that a liquidated damages clause is included in the Contract, as called for in the General Conditions of the Contract for Construction. No bidder may withdraw their bid within thirty (30) days after the actual date of the opening thereof. The Gallup Housing Authority reserve the right to reject any or all bids and waive any or all informalities.

(4 consecutive weeks max.)

26-50 WORDS: $10 51-75: WORDS: $20 76-100 WORDS: $30

EXTRAS – $5 PER WEEK, PER ITEM: TEXT BOX, HIGHLIGHT, ALL CAPS, BOLD, AND/OR PIC/LOGO Free classified: Limit one free ad per customer only. Second ad starts at $10, per 25 words.

EMAIL: GALLUPSUN@GMAIL.COM DUE: TUESDAYS 5 PM ESTATE SALE ESTATE SALE featuring a significant collection of fine and vintage Navajo rugs as well as pottery, baskets, furniture and art from the Estate of Kathy Foutz. June 16th through June 19th, 9:00 AM to 5:00 PM. 307 West Main, Farmington, NM GALLUP SUN ARCHIVES Need a past issue? $1.50 per copy. Note issue date and send check or M.O. to: Gallup Sun, PO Box 1212, Gallup, NM 87305. Subject to availability. HOMES FOR SALE Want a getaway! Cabin for sale in the Zuni mountains 20 minutes from Grants, NM 1.5 acres, $78k 505-240-2112 Newly renovated, 5 BR, 2 BA Huge fenced backyard. 1412 S. Cliff, $178,900 Call 505-870-7754 PLACE YOUR REAL ESTATE AD HERE! FIRST 25 WORDS FREE. LOGO and/or PHOTO $5 EACH. APPEARS ON GAL-

LUPSUN.COM FOR FREE! EMAIL: gallupsun@gmail.com CALL: 505-728-1640 MOBILE HOMES 3 BR MH’s with washer/dryer for rent. $670 plus deposit. Credit Check and Police Check. Quiet and safe. White Cliffs, 4 miles east of Gallup; Call Carmelita 505-870-4095. MOBILE HOME SPACES Mobile Home Spaces – Single wide – any size $205/mo. Double Wide $260/mo. Call Mike 505-870-3430 or Carmelita 505870-4095. SERVICES Cleaning Made Easy! Affordable & Professional Cleaning services for your residential or commercial cleaning needs Call Fantastic Cleaning services @ 505-713-6628

MAIL DELIVERY 1 year subscription. Send check for $59.95 to:

Gallup Sun Publishing PO Box 1212 Gallup, NM 87305

Place an tribute in the Gallup Sun It will last the whole week and forever on GallupSun.com Easy form to fill out. Starting under $10.* Artistic, customized tributes available. Phone: (505) 728-1640

Email: gallupsun@gmail.com

*Prepayment Required. Cash. M.O. Credit Card.

CLASSIFIEDS

COMMUNITY CALENDAR JUNE 9-15, 2017 FRIDAY June 9 COMMUNITY BLOOD DRIVE The RMCHCS Auxiliary is hosting a community blood drive with United Blood Services from 8:30 am-12:30 pm. Eligible donors will be entered into a drawing for a grill/BBQ valued at $250 and a BBQ goodie basket valued at $50. Walk-ins are welcome. For more information call (505) 863-6959 or (505) 863-3098. Location: RMCH 3rd Floor Solarium, 1901 Red Rock Dr. INFORMATION TECHNOLOGY TRAINING The library is offering free computer training throughout the month. Class size is limited to 10 participants per session. Registration is required, (505) 863-1291 or email: libtrain@gallupnm.gov or visit the front desk of the library. Basic Tablet Skills: 10:30 am – 12:30 pm. Octavia Fellin Public Library, 115 W. Hill Ave. GET UP AND GAME (ALL AGES) Join us for family-friendly video games every Friday afternoon. 4 pm at the Children’s Branch, 200 W. Aztec Ave. SATURDAY June 10 SUMMER READING PROGRAM: PINTSIZE POLKAS Kick-off event for the Summer Reading Program. Nationally known accordion player and children’s polka musician Mike Schneider (a.k.a. Uncle Mike) from Milwaukee, WI will be performing his “Pint Size Polkas” program from 2:30-3:30 pm. Octavia Fellin Library, Children’s Branch, 200 W. Aztec Ave. Free. SUNDAY June 11 TAIZE’ WORSHIP Westminster Presbyterian Church hosts the non-denominational monthly Taize’ service at 4pm. Take this opportunity to calm and quiet the soul before a new week begins. Location: 151 State Highway564. Call Kathy Mezoff (505) 870-6136. MONDAY June 12 FOOD DRIVE The Jim Harlin Community Food pantry will have a food drive from 6:30-8:30 am. They’re accepting non-perishable food items. This event is well suited for those individuals who live and work around the Nizhoni/Red Rock area. Call Melinda Russel (505) 790-0618 INTRODUCTION TO 3D PRINTING CLASS CALENDAR

The library is offering free computer training throughout the month. Class size is limited to 10 participants per session. Registration is required, to register call (505)863-1291 or email libtrain@gallupnm.gov or visit the front desk of the library. Location: 115 W. Hill Ave. TUESDAY June 13 MAKER’S CLUB (AGES 6 AND UP) A club for kids interested in science, math, building, and inventing. Each week features a different challenge, project, or experiment. Starts: 4 pm. Children’s Branch, 200 W. Aztec Ave. This week: 3D Printing WEDNESDAY June 14 DISTRICT 2 NEIGHBORHOOD ASSOCIATION MEETING Councilor Allan Landavazo will host a District 2 Neighborhood Association meeting from 6:30-7:30 pm. Gallup Fire Department prevention specialists will speak about fire prevention. The presentation will be followed by a Q&A session. Everyone is welcome to attend: Location: Eastside Fire Station, 3700 Church Rock St. TODDLER TIME (AGES 2 TO 4) An active and energetic program for toddlers, featuring music, movement, rhymes, and stories. Starts: 10:30 am. Children’s Branch, 200 W. Aztec Ave. WEDNESDAY NIGHT FILMS Wednesdays at 5:30 pm, popcorn provided. Film: La La Land. Octavia Fellin Public Library, 115 W. Hill Ave. THURSDAY June 15 CRAFTY KIDS (ALL AGES) Fun crafts for the whole family. Starts at 4 pm. Children’s Branch, 200 W. Aztec Ave. This week: Create Your Own Painting ONGOING ARTSCRAWL ArtsCrawl is held the second Saturday of every month from 7 to 9 pm, downtown Gallup. CITY OF GALLUP’S SUSTAINABLE GALLUP BOARD Meets on the first Monday from 3:00 to 5 pm at the Octavia Fellin Library (management room). Community members

CALENDAR

concerned about conservation, energy, water, recycling and other environmental issues are welcome. Call (505) 722-0039 for information. COMMUNITY PANTRY The Hope Garden offers organic produce for sale from 10 am - noon, Tue – Fri., 1130 E. Hassler Valley Road. All funds go to helping feed local folks. Call (505) 726-8068 or when visiting, ask for Vernon Garcia. FRIDAY NIGHT HOOTENANNY Gallup’s longest-running live show! Every Friday night from 7 - 9 pm. Camille’s Sidewalk Cafe, 306 S. Second St. GALLUP-MCKINLEY COUNTY HUMANE SOCIETY Wednesdays are low-cost Spay and Neuter Days, at the Gallup-McKinley County Humane Society. For more information, please call (505) 863-2616, or email: gmchumanesociety@gmail.com. Location: 1315 Hamilton Rd. GALLUP SOLAR The nonprofit, Gallup Solar, is hosting free Solar 101 classes about all things related to off-grid solar systems on the first three Wednesdays of each month, 6 - 8 pm, at 113 E. Logan Ave. All welcome any week. No registration required. For info call: (505) 728-9246. GREEN REVOLUTION Through September 9, enjoy: Green Revolution. This Smithsonian Institution “Traveling Exhibition Service” uses recycled and repurposed materials to teach creative ways to reduce waste and conserve energy. Don’t miss this free exhibit full of hands-on fun for everyone at the Farmington Museum, 3041 E Main Street, during regular museum hours. For more information visit www.fmtn.org/FarmingtonMuseum or call (505) 599-1174. HABITAT FOR HUMANITY Habitat for Humanity yard sales are held every Saturday, 9 am - noon on Warehouse Lane, weather permitting. Volunteers wishing to serve on construction projects may sign up there or call (505) 722-4226. K-3 PLUS: A SUPER START TO SCHOOL Give your kids a “Jump Start” this summer. Program is available at all GMCS Elementary Schools. For students who will enter Kinder-

garten and 1st-3rd Grades next school year. Contact your local Elementary School for enrollment information. OVEREATERS ANONYMOUS Overeaters Anonymous 12step meetings. Held every Saturday at 10 am. The First Methodist Church, 1800 Red Rock Drive. Open to anybody who has a desire to stop compulsive eating. Contact info. (505) 307-5999, (505) 721-9208, or (505) 870-1483. PHOTOGRAPHY BY KEN HOFFMAN Through July 22, experience the photography of Ken Hoffman. New Mexico: A Meditative State features 25 photographs Hoffman has taken throughout the state. All of his photography is film based utilizing a Chamonix large format camera. Working exclusively in black and white, he develops and prints in his own darkroom. Nothing is manipulated digitally. This exhibition is free to the public with a SUGGESTED DONATION of $3 per person. For more information contact the Farmington Museum at (505) 599-1174 or online at www.fmtn.org/FarmingtonMuseum. RECYCLING COUNCIL McKinley Citizens Recycling Council is a local nonprofit working to increase recycling through education, community outreach, and partnership with local government agencies. MCRC meets the first Saturday of the month at 2 pm, at Red Mesa on Hill St. For more information, please call (505) 722-5142 or visit Recylegallup.org. SUPPORT EARLY LANGUAGE AND LITERACY FOR SCHOOL SUCCESS! Gallup McKinley County Schools is currently recruiting pregnant women and teens in McKinley County with children from birth to 5 years of age. There are no income guidelines and services are free to ALL community members. Learn more about this opportunity by contacting BeBe Sarmiento at (505) 721-1055. SAVE THE DATE 5K RUN/WALK SCHOLARSHIP FUND On Saturday, June 17, smile like Jesse for a 5K run/walk scholarship fund. Entry fee: $20 in advance at Rehoboth Christian School Business Office; Day of Event: $25. Free T-shirt for the first 100 registrants. Upload registration form on Facebook fit: #smilelikejesse 5k/walk, online: admission@rcsnm. org, mail: PO Box 41 Rehoboth NM, 87322. Call Verlena Livingston (505) 726-9692. Make all money order or

checks payable to: Rehoboth Christian/ smielikejesse. Registration starts 8am; Run/ walk starts 9am. For more information contact Esther Sanchez (505) 862-1459. ODY ON WHEELS TO WIDE RUINS CHAPTER On June 22, ODY on Wheels will be visiting Wide Ruins, Arizona from 1-4 pm. Come out and join JaNelle and have some fun! Open to the youth and community. Call (928) 729-4336. GOSPEL HYMN SING On June 25, a time for great old hymns, with a twist of Jazz and Blues mixed in. Snacks are provided. Call Melinda Russel (505) 7900618. First United Methodist Church, 1800 Red Rock Drive. NORTHSIDE NEIGHBORHOOD MEETING On June 29, join Councilor Linda Garcia for the Northside Neighborhood Association meeting: 6:30 - 8 pm. Northside Senior Center. For more information, call (505) 879-4176. Address: 607 N. 4th St. E Pluribus Unum: Dinetah In September 2016, artists Matthew Chase-Daniel and Jerry Wellman traveled to the Navajo Nation and surrounding areas to create the third project in the ongoing series E Pluribus Unum. These projects use their Axle Contemporary mobile art gallery as a photographic portrait studio. The Navajo Nation Museum will exhibit all of the black and white portraits, images of the artists at work, and a life-size photograph of the mobile portrait studio. Exhibition Dates: July 12, 2017- January 31, 2018.Opening Reception: July 12 (5:30-7pm). The Navajo Nation Museum, Hwy 264 and Post Office Loop, Window Rock, AZ 86515. GALLUP INTERFAITH GATHERING On June 20, celebrate the Summer Solstice at the Gallup Interfaith Gathering. Bring food for a shared meal. Location: 151 State Highway 564 (Boardman Drive). Call Reverend Kay for more information (505) 290-5357 or (505) 905-3247. To post a nonprofit or civic event in the calendar section, please email: gallupsunevents@gmail.com or fax: (505) 212-0391. Deadline: Monday at 5 pm.

Gallup Sun • Friday June 9, 2017

24 Friday June 9, 2017 â€¢ Gallup Sun

CLASSIFIEDS

Gallup Sun • Friday June 9, 2017

Published on Jun 12, 2017

makf

Similar to

Popular now

Just for you

Go explore