__MAIN_TEXT__

Page 1

/HVLWHLQWHUFRPPXQDOGHO¶8QLRQ

&RQVWUXLUHXQS{OHG¶H[FHOOHQFH

/0&85RXEDL[7RXUFRLQJ:DWWUHORV'p¿QLWLRQGXSODQGLUHFWHXU0DL 5HLFKHQHW5REHUW $VVRFLpV$UFKLWHFWHV8UEDQLVWHV&RQVXOWDQWV$JHQFHV3{OHVSD\VDJLVWHV&RQÀXHQFHV%(7+\GUDXOLTXHV6&30LVVRQ0RUHO


LQWURGXFWLRQ

/HVHQMHX[GXSURMHWGHO¶8QLRQ

6LWXpVXUOHVWHUULWRLUHVGHVFRPPXQHVGH5RXEDL[7RXUFRLQJHW:DWWUHORVOHVLWHGHO¶8QLRQHVWLGHQWL¿p FRPPHO¶XQGHVVL[©S{OHVG¶H[FHOOHQFHPpWURSROLWDLQVª,OEpQp¿FLHG¶XQHVLWXDWLRQWUDQVIURQWDOLqUHXQLTXH G¶XQHGHVVHUWHGHTXDOLWpHWG¶XQHVXUIDFHLPSRUWDQWH KHFWDUHV DXWDQWG¶DWRXWVTXLFRQVWLWXHQWXQH UpHOOHRSSRUWXQLWpSRXUDFFXHLOOLUXQSURMHWGHGpYHORSSHPHQWGHGLPHQVLRQQDWLRQDOHHWHXURSpHQQH 'HX[LqPHVLWHG¶H[FHOOHQFHPpWURSROLWDLQDSUqV(XUDOLOOHLGHQWL¿pDXVFKpPDGLUHFWHXUOHVLWHGHO¶8QLRQHVW XQGHVS{OHVHWXQGHVPRWHXUVSULQFLSDX[GHUppTXLOLEUDJHGXVHFWHXU1RUG(VW /DGLPHQVLRQpFRQRPLTXHGXSURMHWHVWD[pHVXUOHGpYHORSSHPHQWDXQLYHDXHXURSpHQGHVVHFWHXUVGXWH[ WLOHGHO¶LPDJHHWGHODYHQWHSDUFRUUHVSRQGDQFHDYHFSRXUDPELWLRQODUHG\QDPLVDWLRQGXWLVVXpFRQRPLTXH ORFDO'HX[S{OHVVHURQWGpYHORSSpVVXUOHVLWHGHO¶8QLRQOHVQRXYHDX[WH[WLOHVHWO¶LPDJHFXOWXUHPpGLDV 8QTXDUWLHUQRXYHDXDFFHVVLEOHHWSDUIDLWHPHQWLQWpJUpjODYLOOHVHUDFUpp6DVWUXFWXUHXUEDLQHHVWGp¿QLH VHORQSOXVLHXUVSULQFLSHVG¶DPpQDJHPHQWVTXLWLHQQHQWjODIRLVFRPSWHGHO¶H[LVWDQWHWGHODGLPHQVLRQHP EOpPDWLTXHGXVLWH/HSURMHWYDORULVHOHWLVVXH[LVWDQWLQWqJUHOHSDWULPRLQHLQGXVWULHOHWFUpHGHQRXYHDX[ HQVHPEOHVEkWLV RX©SODTXHVEkWLHVª DX[W\SRORJLHVQRXYHOOHVTXLSURORQJHQWOHSULQFLSHKLVWRULTXHGH FRPSRVLWLRQGHVHQVHPEOHVLQGXVWULHOV/HQRXYHDXSD\VDJHXUEDLQHVWU\WKPpSDUGHVEkWLPHQWVHPEOp PDWLTXHVG¶XQHWUqVKDXWHTXDOLWpDUFKLWHFWXUDOH 8QHVSDFHSXEOLFRXYHUWGpFOLQDQWGLYHUVHVWKpPDWLTXHVYpJpWDOHVHVWFRPSRVpDYHFODULYH1RUGGXFDQDO GHSXLVOD7RXU0HUFXUHMXVTX¶DX3RQWGHV&RXWHDX[SpQqWUHGDQVOHTXDUWLHUQRUGHWPHWHQUHODWLRQOHV GLIIpUHQWHVIRQFWLRQVGXVLWHGHO¶8QLRQ /DUHFKHUFKHGHTXDOLWpGHO¶DPpQDJHPHQWHWGHKDXWHTXDOLWpHQYLURQQHPHQWDOHHQFRKpUHQFHDYHFOHV SROLWLTXHVPpWURSROLWDLQHVGHPDvWULVHGHVGpSODFHPHQWVFRQWULEXHURQWjFUpHUXQHLPDJHXUEDLQHIRUWHHW RULJLQDOHSRXUOHVLWHGHO¶8QLRQ

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO)pYULHU


VRPPDLUH

 /(3/$1*e1e5$/ 

 /(3/$1'(62/ /(3/$1'e3/$&(0(176  



 /(3/$19(57  



 /(3/$1%/(8   /(67<32/2*,(6 



 /(3/$1352*5$00(   /(%,/$1)21&,(5  /¶(67,0$7,21),1$1&,Ê5('(6,19(67,66(0(176 $11(;(6  

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL


3ODQJpQpUDO



 /$127,21'(3Ð/('¶(;&(//(1&( /(602'(6'¶,17(59(17,21',))e5(1&,e6 /$'(0$5&+('(+$87(48$/,7e(19,5211(0(17$/( /('e9(/233(0(17'8352-(7'$16/(7(036

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/$127,21'(3Ð/('¶(;&(//(1&( SODQJpQpUDOGXVLWHGHO¶8QLRQ



5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL









P


&RPPHQWFRQVWUXLUHXQH©DPELWLRQªXUEDLQHVXUO¶XQGHVVLWHVPDMHXUVGHO¶DJJORPpUDWLRQDYHFGHVPR\HQV KpWpURJqQHVHWGDQVGHVWHPSRUDOLWpVFRQWUDVWpHVPrODQWO¶XUJHQFHHWOHORQJWHUPH" 'LWG¶XQHDXWUHIDoRQFRPPHQWFRQFLOLHUOHVLPSpUDWLIVG¶XQWLVVXLQGXVWULHODQFLHQHQSURIRQGHPXWDWLRQ GHSXLVGHQRPEUHXVHVDQQpHVOHVVWDQGDUGVG¶XQH]RQHIUDQFKHHWOHVH[LJHQFHVG¶XQS{OHG¶H[FHOOHQFH FDSDEOHVGHSURMHWHUGDQVO¶DYHQLUFHFDUUHIRXUXUEDLQHVVHQWLHODXGpERXFKpGHODURXWHGHOD/DLQH" &¶HVWFHWWHpTXDWLRQFRPSOH[HTXHOHSURMHWGHO¶8QLRQDO¶DPELWLRQGHUpVRXGUHGDQVXQVRXFLRSpUDWLRQQHO HWHQFKHUFKDQWDXVVLOHVFRQGLWLRQVGHPLVHHQRHXYUHG¶XQHLPDJHIRUWHHWFRKpUHQWHDGDSWpHDX[UpDOLWpV GHODYLOOHFRQWHPSRUDLQH

/¶DPELWLRQG¶XQS{OHG¶H[FHOOHQFHSRXUO¶8QLRQGRLWVHWUDGXLUHGDQVOHSURMHWXUEDLQDXQLYHDXGHO¶LQYLVLEOH HWGXYLVLEOH SURJUDPPDWLRQHWIRUPHVXUEDLQHV DXQLYHDXGHO¶HQYLURQQHPHQWHWGHO¶pFRORJLHXUEDLQH PLVHHQ°XYUHVXUOHVLWHHWHQ¿QDXPR\HQG¶XQHJHVWLRQ¿QHGHVWHPSRUDOLWpVGDQVODPLVHHQ°XYUHGX SURMHWVXUXQVLWHFRQWUDVWp     

 $X QLYHDX GH O¶©LQYLVLEOHª RX GH OD SURJUDPPDWLRQ XUEDLQH OH SURMHW DPELWLRQQH GH FUpHU XQ TXDUWLHUPrODQWGHVDFWLYLWpVpFRQRPLTXHVDXWRXUG¶XQHORJLTXHGHS{OH WH[WLOHWHFKQLTXHLPDJH± FXOWXUH±PpGLD GHVpTXLSHPHQWVGHVORJHPHQWVGHVHVSDFHVYHUWVHWFHD¿QGHFUpHUXQHQRXYHOOH YLHXUEDLQHH[QLKLORWRXWHQUHQIRUoDQWOHVFHQWUDOLWpVHWOHVS{OHVGHYLHSUpH[LVWDQWVGDQVOHV TXDUWLHUVOLPLWURSKHV

       

 $X QLYHDX GX ©YLVLEOHª LO HQ GpFRXOH GHV IRUPHV XUEDLQHV RULJLQDOHV ORLQ GHV VWDQGDUGV GHV ]RQHVG¶DFWLYLWpVRXGHV]RQHVUpVLGHQWLHOOHV(OOHVYRQWGHSODTXHVEkWLHVPXOWLIRQFWLRQQHOOHVDX[ GHQVLWpVIRUWHVHWDX[SUHVFULSWLRQVWUqVFDGUpHV VHFWHXUDXWRXUGHODUXHGH1DQWHV jXQWUDYDLO PpWLFXOHX[GHFRXWXUHHQLQWHUVWLFHGXWLVVXH[LVWDQW TXDUWLHUV6DLQW-RVHSKHW6WHSKHQVRQ jGHV VHFWHXUVGHSODQPDVVHHQDWWHQWHG¶XQHSURJUDPPDWLRQRSSRUWXQH vORWV&XOGX)RXUHW&RXWHDX[  jODUHVWUXFWXUDWLRQG¶DQFLHQVvORWVLQGXVWULHOVHQFRQVHUYDQWOHXUVFDUDFWqUHFRPSOH[H OD7RVVpH HW9DQRXWU\YH jODPLVHHQVFqQHG¶REMHWVLVROpVTXLGHYURQWDYRLUODIRUPHG¶DUFKLWHFWXUHVHPEOp PDWLTXHV«

       

(QWHUPHG¶pFRORJLHXUEDLQHOHSURMHWDVVRFLHGHVHVSDFHVEkWLVGHQVHVjXQJUDQGSDUFXUEDLQ ,OSUHQGODIRUPHG¶XQ©SDSLOORQªFRPSRVpDYHFODULYHQRUGGXFDQDOGH5RXEDL[GHSXLVODWRXU  0HUFXUH MXVTX¶DX 3RQW GHV &RXWHDX[ GUDSp  HW SpQqWUH HQVXLWH SURIRQGpPHQW YHUV OH QRUG  SODLQH SUR¿WDQWDLQVLDX[TXDUWLHUVH[LVWDQWV,OFRQVWLWXHXQJUDQGHVSDFHSXEOLFRXYHUWHWXQOLHQ HQWUHOHVXQLWpVEkWLHVDQFLHQQHVRXQRXYHOOHV&¶HVWXQHVSDFHGHORLVLUHWGHUpFUpDWLRQHWXQ   GLVSRVLWLI SD\VDJHU GH JHVWLRQ GHV HDX[ SOXYLDOHV GDQV XQH RSWLTXH GH +DXWH 4XDOLWp (QYLURQ QHPHQWDOH&¶HVWDXVVLXQGLVSRVLWLIGHPLVHHQUHODWLRQGHVIRQFWLRQVGLYHUVL¿pHVGXVLWHG¶DPSOL ¿FDWLRQHWGHYDORULVDWLRQGHVSURJUDPPHVTXLYRQWRFFXSHUVHVIUDQJHV

    

/DPLVHHQ°XYUHGXSURMHWGDQVOHWHPSVVHIDLWHQPLVDQWVXUGHVWHPSRUDOLWpVHWGHVPRGHV G¶LQWHUYHQWLRQGLIIpUHQFLpHVHQPHWWDQWHQSODFHGHVORFRPRWLYHVTXLFUpHQWO¶DWWUDFWLYLWpjFRXUW WHUPHHQSHUPHWWDQWOHKDXWGHJDPPHFRPPHOHVWDQGDUGHWHQJpUDQWXQHSROLWLTXHGHUpVHUYH   IRQFLqUH VXU GHV VLWHV VWUDWpJLTXHV TXL PpULWHQW G¶DWWHQGUH TXH VRLW LQVWDOOpH FHWWH UpSXWDWLRQ G¶H[FHOOHQFH

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/(602'(6'¶,17(59(17,21',))e5(1&,e6 SODQJpQpUDOGHVGLIIpUHQWHVPRGHVGHSURFpGXUHVSDUVHFWHXU

OHV]RQHVGHFRXWXUHXUEDLQH OHV]RQHVGHFRXWXUHXUEDLQH OHVWqQHPHQWVLQGXVWULHOV OHVWqQHPHQWVLQGXVWULHOV OHVVHFWHXUVGHSODQPDVVH OHVVHFWHXUVGHSODQPDVVH ODSODTXH ODSODTXH OHVJUDQGVpTXLSHPHQWVSXEOLFV OHVJUDQGVpTXLSHPHQWVSXEOLFV OHVDUFKLWHFWXUHVHPEOpPDWLTXHV OHVDUFKLWHFWXUHVHPEOpPDWLTXHV 1 

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL











P


/¶DUWLFXODWLRQGXYLVLEOHHWGHO¶LQYLVLEOHGHVHVSDFHVEkWLV DQFLHQVHWQRXYHDX[ HWGHVHVSDFHVRXYHUWVGH O¶HVSDFHHWGXWHPSVHVWSRVVLEOHJUkFHjO¶LGHQWL¿FDWLRQGHVLWXDWLRQVXUEDLQHVGLIIpUHQWHVTXLQpFHVVLWHQW GHVPRGHVG¶LQWHUYHQWLRQVGLIIpUHQFLpV 'DQVXQSURMHWFRPSOH[HFRPPHFHOXLGHO¶8QLRQLOHVWLQGLVSHQVDEOHGHOHVLGHQWL¿HUGqVO¶RULJLQHGXSURMHW HWG¶\DVVRFLHUGHVDSSURFKHVRSpUDWLRQQHOOHVWUqVGLIIpUHQWHV

/D FRXWXUH XUEDLQH RX OD YDORULVDWLRQ GHV WLVVXV H[LVWDQWV LQWpJUpV GDQV OH SpULPqWUH GX VLWH GH O¶8QLRQ &¶HVWOHFDVGXTXDUWLHU6DLQW-RVHSKDXVXGGXVLWHHWGHO¶vORW6WHSKHQVRQDXQRUGGXVLWH&HWWHYDORUL VDWLRQVHIDLWDXQLYHDXGHVHVSDFHVSXEOLFV UpKDELOLWDWLRQRXFUpDWLRQGHYRLHVGHSODFHV HWDXQLYHDX GXEkWLSDUODFRQVWUXFWLRQGHQRXYHDX[ORJHPHQWVGDQVOHVGHQWVFUHXVHVODYDORULVDWLRQGHVORJHPHQWV H[LVWDQWVHQRIIUDQWGHQRXYHDX[MDUGLQVSULYDWLIVRXGHVHVSDFHVGHVWDWLRQQHPHQWODFUpDWLRQGHQRX YHDX[pTXLSHPHQWV/¶HQVHPEOHGHFHVDPpQDJHPHQWVVRQWGpWDLOOpVHWH[SOLTXpVGDQVOHFKDSLWUHGHV W\SRORJLHV

/HVpTXLSHPHQWVGp¿QLVVXUOHVLWHGHO¶8QLRQVRQWDXQRPEUHGHOHFROOqJHHWO¶pFROHDYHFVDKDOWH JDUGHULH 'H SOXV XQH HPSULVH IRQFLqUH HVW UpVHUYpH VXU OH VLWH GH7HUNHQ SRXU SRXYRLU DFFXHLOOLU XQ pTXLSHPHQW PpWURSROLWDLQ

/HV DUFKLWHFWXUHV HPEOpPDWLTXHV VRQW FRQoXHV VHORQ GHV SURFpGXUHV GH TXDOLWp GH WUqV KDXW QLYHDX G¶H[LJHQFH6XUFHWWHEDVHRQSRXUUDFRQMXJXHUXQFRQWU{OHULJRXUHX[GXSD\VDJHXUEDLQ©JOREDOªHWXQH JUDQGHOLEHUWpODLVVpHjODFUpDWLRQDUWLVWLTXH

/HVWqQHPHQWVLQGXVWULHOVRXODSRXUVXLWHGHO¶KLVWRLUHGHV©&LWpVLQWpJUpHVªVRQWSRO\YDOHQWVGXVLWH GHO¶8QLRQ /DPXWDWLRQGHFHV©FKkWHDX[GHO¶LQGXVWULHªHVWDQWLFLSpHD¿QGHOHVLQWpJUHUDXSURMHW'HVLQYDULDQWVGH SURMHWVVRQWSURSRVpVVXUFKDFXQGHVVLWHVODLVVDQWDLQVLOHFKDPSjGHVRSSRUWXQLWpVGHGpYHORSSHPHQW &HVLQYDULDQWVVRQW  OHV EkWLPHQWV TXL DX UHJDUG GH OHXU pWDW RX GH OHXU TXDOLWp DUFKLWHFWXUDOH VHUDLHQW VXVFHSWLEOHV G¶rWUH FRQVHUYpV OHVHVSDFHVSXEOLFV OHVYDOHXUVGHORFDOLVDWLRQGXVLWH &HX[FLVRQWGpYHORSSpVGDQVOHFKDSLWUHGHVW\SRORJLHV

/HVVHFWHXUVGHSODQPDVVHGXVLWHGHO¶8QLRQOHVTXDUWLHUVGHV©&RXWHDX[VXGªHWGX©&XOGH)RXUª /HXUVHPSULVHVGHjKHFWDUHVOHXUGRQQHQWXQU{OHGH©PLQLSURMHWVXUEDLQVª&HVPRUFHDX[GHYLOOH GRLYHQWrWUHFRQoXVDYHFOHXUORJLTXHLQWHUQH WKpPDWLTXHGHO¶vORW HWH[WHUQH GLDORJXHDYHFO¶HQYLURQQH PHQW  /HTXDUWLHUGHV&RXWHDX[VXGGRQWODWKpPDWLTXHHVW©O¶vORWGDQVO¶vORWªDXQHIRUPHLQWpULRULVpHWRXWHQGLD ORJXDQWDYHFOHWLVVXHQYLURQQDQWYLDGHVYXHVVXUOHVMDUGLQVIDPLOLDX[7HUNHQHWOHFDQDO /¶vORWGX&XOGH)RXUDFFXHLOOHGHVIRQFWLRQVPL[WHVGpWHUPLQpHVHQIRQFWLRQGHVHPSULVHVYRLVLQHV

/HVW\SRORJLHV©DOWHUQDWLYHVªGHODSODTXHRXO¶RUJDQLVDWLRQGHIRQFWLRQVYDULpHVVXLYDQWXQSULQFLSH XUEDLQpODERUp/DGpQRPLQDWLRQ©W\SRORJLHVDOWHUQDWLYHVªGpVLJQHGDQVO¶XUEDQLVPHDOOHPDQGGHVWLVVXV XUEDLQV©PL[WHVªDFFXHLOODQWVXUXQHPrPHEDVHSDUFHOODLUHGHVIRQFWLRQVHWGHVW\SRORJLHVGLYHUVHVPL VHVHQRHXYUHSDUHQVHPEOHVFRPSDWLEOHV&HWWHRUJDQLVDWLRQGHO¶HVSDFHIDYRULVHODPXOWLIRQFWLRQHWOD GLYHUVLWpSK\VLTXHPDLVDXVVLFHTXHO¶RQTXDOL¿HGH©YLOOHGHVSHWLWVLQYHVWLVVHPHQWVª

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/$'e0$5&+('(48$/,7e(19,5211(0(17$/( 3{OHG¶H[FHOOHQFHFRPPXQDXWDLUHOHVLWHGHO¶8QLRQDFFXHLOOHXQSURMHWGHDPELWLHX[DOOLDQWGpYHORSSHPHQW pFRQRPLTXHTXDOLWpXUEDLQHYDORULVDWLRQGXFDQDOHWFUpDWLRQG¶LPSRUWDQWVHVSDFHVYHUWV /HSURMHWSUpVHQWHXQHYRORQWpIRUWHGHPLQLPLVHUOHVLPSDFWVGHVDPpQDJHPHQWVIXWXUVVXUO¶HQYLURQQH PHQWHQLQWpJUDQWDXPD[LPXPWDQWGDQVOHEkWLTXHGDQVODFRQFHSWLRQXUEDLQHOHVSULQFLSHVG¶XQGpYH ORSSHPHQWGXUDEOH

/HVLWHUHQRXYHOOHPHQWXUEDLQ /HWHUULWRLUHGXVLWHGHO¶8QLRQHVWLVVXGXGpYHORSSHPHQWLQGXVWULHOGXqVLqFOHTXLDJpQpUpGHVTXDUWLHUV G¶KDELWDWRXYULHULQGLYLGXHOHWGHVLQGXVWULHV$XMRXUG¶KXLVXLWHDXGpFOLQGHVDFWLYLWpVLQGXVWULHOOHVOHWLVVX XUEDLQVHGpYDORULVH DSSDULWLRQGHIULFKHV«  /HUHQRXYHOOHPHQWXUEDLQO¶XQHGHVSULRULWpVGHODSROLWLTXHFRPPXQDXWDLUHFRQVWLWXHXQHIDoRQGHUHGRQ QHUDXVLWHGHO¶8QLRQXQHLPDJHIRUWHHWFRKpUHQWHDGDSWpHjODYLOOHFRQWHPSRUDLQH

'HQVLWpSODQ0DVVHPL[LWpXUEDLQH 8QHPL[LWpGHVIRQFWLRQVGRLWrWUHFUpHGqVOHFRPPHQFHPHQWGHVWUDYDX[pTXLSHPHQWVODUpDOLVDWLRQ G¶XQHSUHPLqUHWUDQFKHGHORJHPHQWVOHGpYHORSSHPHQWGHVORLVLUVOLpVjODUHPLVHHQQDYLJDWLRQGXFD QDO /HVpOpPHQWVGHVSURJUDPPHOLpVDXS{OHWH[WLOHGLVWULEXWLRQRXS{OHLPDJHVHURQWFRQFHQWUpVSRXUSHUPHW WUHOHVPXWXDOLVDWLRQVJpQpUHUXQHG\QDPLTXHHWIDYRULVHUODFUpDWLRQVHUYLFHVDX[HQWUHSULVHV /HVVHUYLFHVGpGLpVjWRXVOHVXVDJHUVGXVLWHVHURQWSRXUO¶HVVHQWLHOLQWpJUpVDXWLVVXXUEDLQD¿QG¶DVVX UHUXQXVDJHSDUWDJp /¶RIIUHGHORJHPHQWVFUppVUpSRQGjSOXVLHXUVREMHFWLIVFUpDWLRQGHOLHX[GHYLHHWG¶DQLPDWLRQRIIUHGH W\SRORJLHVGLIIpUHQWHVUpSRQGDQWDX[EHVRLQVGHODSRSXODWLRQG¶DFWLIV SHWLWVHWPR\HQVFROOHFWLIVPDLVRQV LQGLYLGXHOOHVHQEDQGH« UpLQWURGXLVDQWXQHPL[LWpGHSRSXODWLRQHWYDORULVDQWODSURGXFWLRQG¶XQHRIIUHGH TXDOLWpWLUDQWSDUWLGHVDWWUDLWVGXSDUFGXFDQDOHWGHO¶DFFHVVLELOLWp /HVJDEDULWVGHVEkWLPHQWVSUpVHQWVVXUOHVLWHQHVRQWJXqUHHQJpQpUDOWUqVpOHYpV 55 'HV DUFKLWHFWXUHVHPEOpPDWLTXHVGRQWODKDXWHXUHVWSOXVpOHYpHSRQFWXHQWO¶HVSDFHVHORQXQHRULHQWDWLRQ QRUGVXG'¶XQHDUFKLWHFWXUHHPEOpPDWLTXHLOVSDUWLFLSHQWDLQVLjXQHVFpQRJUDSKLHGXVLWH

3ROOXWLRQGHVVROV 'HVpWXGHVWHFKQLTXHVVXUO¶pWDWGHVVROVRQWpWpPHQpHVVXUOHVLWHGHO¶8QLRQD¿QGHGp¿QLUTXHOVSUR FpGpVGHGpSROOXWLRQVHUDLHQWHI¿FDFHVHWUHQWDEOHVVXUOHVLWH/HVVROVSROOXpVVHURQWGqVTXHFHODHVW SRVVLEOHLQWpJUpVjODJHVWLRQGXWHUUDVVHPHQWHQGpEODLVUHPEODLVD¿QG¶pYLWHUOHVFR€WVOLpVjO¶pYDFXDWLRQ HQVLWHGHWUDLWHPHQW 'HVpWXGHVFRPSOpPHQWDLUHVGHYURQWWRXWHIRLVrWUHPHQpHVSRXUFKDTXHQRXYHOOHRSpUDWLRQG¶DPpQDJH PHQWGRQWOHVROHVWFRQWDPLQp

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL

'pSODFHPHQWVFLUFXODWLRQVGRXFHV /HSURMHWYLVHjUpGXLUHOHVFLUFXODWLRQVDXWRPRELOHVVXUOHVLWHHQ SURSRVDQWO¶DSSOLFDWLRQGHUDWLRVGHVWDWLRQQHPHQWPD[LPXPVXUSDUFHOOHG¶XQHSDUW  SURSRVDQW XQ VHUYLFH GH WUDQVSRUW FROOHFWLI SHUIRUPDQW HW XQ UpVHDX GH SLVWHV F\FODEOHV LPSRUWDQW G¶DXWUHSDUW &HVUHFRPPDQGDWLRQVIDYRULVHQWOHVXVDJHUVjXWLOLVHUOHV7&HWSUDWLTXHUOHVWUDQVSRUWVQRQPRWRULVpV 3DUDLOOHXUVXQHKLpUDUFKLHGHODYRLULHHVWSUpVHQWpHD¿QGHGLPLQXHUODYLWHVVHGHVYRLWXUHVVXUOHVLWHHW GHPLQLPLVHUOHVLPSDFWVVXUO¶HQYLURQQHPHQW

*HVWLRQGHVHDX[GHUXLVVHOOHPHQW /DJHVWLRQGHVHDX[SOXYLDOHV FROOHFWHWUDLWHPHQWUpWHQWLRQHWpYDFXDWLRQ GXVLWHGHO¶8QLRQDpWpPHQpH GqVOHGpEXWGHVUpÀH[LRQVVXUO¶DPpQDJHPHQWGXVHFWHXUHQWDQWTXHGRQQpHSRXUO¶HQULFKLVVHPHQWGX SURMHWHWQRQHQWDQWTXH©FRQWUDLQWHWHFKQLTXHª/HSURMHWXUEDLQHWSD\VDJHUV¶HVWDLQVLVWUXFWXUpDXWRXU G¶XQHXWLOLVDWLRQHWXQHPLVHHQYDOHXUGHO¶HDXSOXYLDOHHWGHVPLOLHX[TXLOXLVRQWDVVRFLpV /HSULQFLSHGHFROOHFWHG¶XQHSDUWLHGHVHDX[SDUGHVpPLVVDLUHVjFLHORXYHUWSHUPHWXQHSUHPLqUHUpWHQ WLRQGHVHDX[jODVRXUFHFHTXLHVWIDYRUDEOHjO¶LQ¿OWUDWLRQHWSHUPHWGHUpGXLUHOHVSLFVGHUXLVVHOOHPHQW ÀX[K\GUDXOLTXHVHWSROOXDQWV /DFRQFHSWLRQpFRORJLTXHGHFHVpPLVVDLUHVDVVXUHO¶LQWURGXFWLRQGDQVOD YLOOHG¶HVSDFHVRULJLQDX[HW©LQVROLWHVªSRXYDQWVHUYLUGHVXSSRUWG¶LQIRUPDWLRQHWFRQWULEXDQWDXXQU{OH pGXFDWLIHWOXGLTXH $¿QGHOLPLWHUODVXUFKDUJHGHODVWDWLRQG¶pSXUDWLRQHQHDX[FODLUHVOHVUHMHWVGHV(3G¶XQHSDUWLHLPSRU WDQWHGXVLWHDXQRUGGXFDQDOVHURQWHIIHFWXpVGDQVOHFDQDOGH5RXEDL[DSUqVGpSROOXWLRQHWUpJXODWLRQ GHV GpELWV &HWWH GLVSRVLWLRQ FRQWULEXHUD j DPpOLRUHU OH IRQFWLRQQHPHQW GH OD 67(3 HQ OD GpEDUUDVVDQW G¶XQHSDUWGHODVXUFKDUJHK\GUDXOLTXHTXLOXLSDUYLHQWDXMRXUG¶KXLGHFHVWHUUDLQV /DUpWHQWLRQHWODUpJXODWLRQGHVHDX[SDUGHVEDVVLQVGHUHWHQXHFRXSOpVjGHV]RQHVLQRQGDEOHVSHUPHW WHQWO¶HQULFKLVVHPHQWpFRORJLTXHGXPLOLHXJUkFHjODELRGLYHUVLWpDVVRFLpHjFHW\SHG¶DPpQDJHPHQW /DPLVHHQSODFHGHGLVSRVLWLIVGHGpSROOXWLRQGHVHDX[SOXYLDOHVHQHQWUpHGHVEDVVLQVDXUDSRXUDYDQWDJH GHSUpOHYHUXQHSDUWLHGHODSROOXWLRQSDUOHVHDX[GHUXLVVHOOHPHQWGHSURWpJHUODTXDOLWpGHVEDVVLQVHW GHSpUHQQLVHUOHXUVXVDJHV/HVEDVVLQVMRXHURQWHQVXLWHOHU{OHG¶DI¿QDJHGXWUDLWHPHQWGHVSROOXWLRQVGH PDQLqUHjUHMHWHUGDQVOHFDQDOGHVHDX[GHERQQHTXDOLWp 3RXUOHVSODQWDWLRQVGHVEHUJHVGHVQRXHVGHVEHUJHVGHVEDVVLQVHWGHVPLOLHX[KXPLGHVG¶H[SDQVLRQ GHVFUXHVOHFKRL[V¶HVWSRUWpVXUGHVHVVHQFHVORFDOHVVDQVUHFRXUVjGHVHVVHQFHVRXYDULpWpVRUQH PHQWDOHV

3DWULPRLQHYLYDQWELRGLYHUVLWp /HSURMHWRIIUHXQHLPSRUWDQWHFRQWLQXLWpYpJpWDOHDYHFODJUDQGHHQWLWpFHQWUDOHTXHIRUPHOHSDUF ©OH SDSLOORQªFRPSRVpGXGUDSpHWGHODSODLQH VHVUDPL¿FDWLRQVDXVHLQGHVGLIIpUHQWVVHFWHXUVHWOHVERUGV GXFDQDO&HGLVSRVLWLIFRQWULEXHjODPLVHHQRHXYUHGHFRQWLQXXPVYpJpWDX[HWFRXORLUVELRORJLTXHVHQ PLOLHXXUEDLQ /HSURMHWGp¿QLWGHVVHFWHXUVHWDLUHVLGHQWL¿DEOHVDX[FDUDFWpULVWLTXHVSURSUHVTXLDSSHOOHQWQDWXUHOOHPHQW XQHJHVWLRQGLIIpUHQFLpH /HFKRL[GHVHVVHQFHVYpJpWDOHVHVWpJDOHPHQWJXLGpSDUODYRORQWpGHUpGXLUHOHVFRQWUDLQWHVGHJHVWLRQHW G¶H[SORLWDWLRQXOWpULHXUHV/HUHFRXUVDX[HVSqFHVORFDOHVHWODUHFKHUFKHGHODPHLOOHXUHFRPELQDLVRQHQWUH HOOHVSHUPHWWUDG¶DVVXUHUXQHFHUWDLQHDXWRQRPLHpFRORJLTXHHWGHUpGXLUHOHVLQWHUYHQWLRQVjXQU\WKPHDQ QXHOSRXUOHVYpJpWDX[DTXDWLTXHVHWjXQU\WKPHELDQQXHOSRXUOHVHVSDFHVLQRQGDEOHV JHVWLRQH[WHQVLYH HWGLIIpUpHIDXFKHVWDUGLYHV 


0DWLqUHVPDWpULDX[HWGpFKHWV 8QHGpPDUFKHKDXWHTXDOLWpHQYLURQQHPHQWDOHSRXUUDLWrWUHUpDOLVpHVXUO¶HQVHPEOHGHVUpDOLVDWLRQVEkWLHV SUpFRQLVDWLRQGHFLEOHV+4(GDQVOHVFDKLHUVGHVFKDUJHVSDUH[HPSOH D¿QGHSUpVHUYHUO¶HQYLURQQHPHQW HWO¶DPpOLRUDWLRQGHODTXDOLWpGHYLHGHVXVDJHUVGXVLWHUHODWLRQKDUPRQLHXVHGHVEkWLPHQWjOHXUHQYLURQ QHPHQWLPPpGLDWJHVWLRQGHVGpFKHWVHWRGHXUVFKDQWLHUVjIDLEOHVQXLVDQFHVFRQIRUWK\JURWKHUPLTHHW FRQIRUWDFRXVWLTXHSDUH[HPSOH 'HPrPHLOSRXUUDLWrWUHLPSRVpO¶XWLOLVDWLRQGHPDWpULDX[jIDLEOHLPSDFWVXUO¶HQYLURQQHPHQWSRXUO¶DPp QDJHPHQWGHVHVSDFHVSXEOLFV

$PELDQFHVFOLPDWLTXHDFRXVWLTXH /HVHVSDFHVYHUWVGXVLWHGHO¶8QLRQFRQVWLWXHQWXQSRXPRQYHUWG¶XQHpFKHOOHVXI¿VDQWHSRXUSHUPHWWUHXQ U{OHGHFOLPDWLVDWLRQXUEDLQHGHOXWWHUFRQWUHODSROOXWLRQGHO¶DLUHWOHEUXLW /DWUDPHYpJpWDOHTXLDFFRPSDJQHOHWLVVXEkWLSDUWLFLSHjODPDvWULVHGHO¶HQVROHLOOHPHQWGHVIDoDGHV

*HVWLRQGHO¶pQHUJLH /DFRQVRPPDWLRQGHO¶pQHUJLHGRLWrWUHODPLQLPXPSRVVLEOHGHVGLVSRVLWLIVpFRQRPHVHWRXIDLVDQWDSSHO DX[ pQHUJLHV UHQRXYHODEOHV GRLYHQW rWUH SULYLOpJLpV TX¶LO V¶DJLVVH GX PRELOLHU XUEDLQ GH OD VLJQDOLVDWLRQ URXWLqUHGXFKDXIIDJHXUEDLQ«

3DUWLFLSDWLRQGHVKDELWDQWV 8QHVpULHGHFRQFHUWDWLRQHVWRUJDQLVpHDXSUqVGHVKDELWDQWVGHVFRPPXQHVFRQFHUQpHVSDUOHSURMHWD¿Q GHSUHQGUHHQFRPSWHOHXUVEHVRLQVDYLVVXUOHSURMHWSURSRVpVXUOHVLWHGHO¶8QLRQ/DSDUWLFLSDWLRQDFWLYH GHVKDELWDQWVHVWHQHIIHWLQGLVSHQVDEOHGDQVODUpDOLVDWLRQG¶XQ©pFRTXDUWLHUª&HODVHWUDGXLWSDUXQHLP SOLFDWLRQGDQVODYLHVRFLDOHGXTXDUWLHUODPLVHHQSODFHGHV\VWqPHVGHFRRSpUDWLYHG¶DFKDWVXQHpWKLTXH GHFRQVRPPDWLRQOHFKRL[GHVPRGHVGHWUDQVSRUWSDUH[HPSOH

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/('e9(/233(0(17'8352-(7'$16/(7(036 /HGpYHORSSHPHQWGXSURMHWGDQVOHWHPSVVXLYDQWHVWLQGLFDWLI,OGpSHQGQRQVHXOHPHQWGHODPDvWULVH IRQFLqUHGHVWHUUDLQVVXUOHVLWH FIFDUWRJUDSKLHGHO¶pWDWGXIRQFLHUPDLVDXVVLGHVPRGHVG¶LQWHUYHQWLRQ  'HX[W\SHVG¶RSpUDWLRQVVRQWjHQYLVDJHU  OHVRSpUDWLRQVFKDvQpHVRXOLpHVjGHVORJLTXHVIRQFLqUHV  OHVRSpUDWLRQVDXWRQRPHVTXLRQWOHXUSURSUHORJLTXHLQWHUQHHWTXLVRQWOLpHVjGHVRSSRUWXQLWpV /DGLIIpUHQFLDWLRQHQWUHFHVRSpUDWLRQVHVWUpDOLVpHSRXUFKDTXHWHPSV

7HPSV±jSDUWLUGH

/HVRSpUDWLRQVFKDvQpHV jSDUWLUGH

/DSODTXHHVWOHSULQFLSDOHQMHXGHODSUHPLqUHSKDVHGHUpDOLVDWLRQHWRXWLOGHVWUXFWXUDWLRQGXTXDUWLHU/HV WUDYDX[GX&(7,FRPPHQFHURQW¿Q([LJHDQWXQHH[FHOOHQWHGHVVHUWHHQWUDQVSRUWVHQFRPPXQPDLV DXVVLDXWRPRELOHVRQLPSODQWDWLRQLQGXLWODUpDOLVDWLRQG¶XQWURQoRQGXQRXYHDXERXOHYDUGHWG¶XQHSDUWLH GHODUXHGH1DQWHV 3DUDOOqOHPHQWjFHVWUDYDX[GHYRLULHHQF°XUGHVLWHFHX[GX3RQWGHV&RXWHDX[FRPPHQFHURQWjO¶(VW GXVLWH,OVVRQWSUpYXVVXUDQVWUDYDX[UpVHDX[HQWUDYDX[JpQLHFLYLOHQPLVHHQPRELOLWp GHVWDEOLHUV¿QSDVVDJHGHVEDWHDX[pWpHWSDVVDJHVRXVFDQDO¿Q

/HVRSpUDWLRQVDXWRQRPHV 

'XIDLWG¶LQWHUYHQWLRQVGDQVXQWLVVXKDELWpVXUGHVHPSULVHVIRQFLqUHVUpGXLWHVHWODSOXSDUWGXWHPSVPDv WULVpHVSDUODFROOHFWLYLWpODYDORULVDWLRQGHVTXDUWLHUV6WHSKHQVRQHW6DLQW-RVHSKSHXWVHIDLUHGHIDoRQ GpWDFKpHHQGHKRUVG¶XQHORJLTXHGH=$&JOREDOHVXUOHVLWHGHO¶8QLRQ 3RXUOHTXDUWLHU6DLQW-RVHSKQRWDPPHQWRQSHXWGLUHTXHFHVHFWHXUHVWGLVVRFLDEOHGXUHVWHHQWHUPHGH WHPSRUDOLWpHWSHXWVHUpDOLVHUGqVjSUpVHQWDYHFXQpFKHORQQDJHGDQVOHWHPSVjFDOHUDYHFODFROOHFWL YLWp /HFDVGHO¶vORW6WHSKHQVRQHVWXQSHXGLIIpUHQWSXLVTX¶LODVVRFLHXQHSDUWLHQRUGTXLSHXWrWUHpJDOHPHQW GLVVRFLpHHWDPpQDJpHGqVjSUpVHQWG¶XQHSDUWLHVXGTXLV¶DUWLFXOHDYHFODSODTXHHWTXLHVWDVVXMHWWLHDX SHUFHPHQWGHODUXH1HXYHHWGRQFDXGpPpQDJHPHQWGHODUXFKH /RJLFLO SUpYXHHQ©WrWHªGHSODTXH

FDUWRJUDSKLHGHO¶pWDWGXIRQFLHUMDQYLHU

&RQFHUQDQWOHVWqQHPHQWVLQGXVWULHOV /¶vORW9DQRXWU\YHRXS{OHWH[WLOHpWDQWVRXVODPDvWULVHSXEOLTXHVHUDSULRULWDLUHGDQVOHSKDVDJHD¿QGH FRPSUHVVHUODGXUpHGHSRUWDJH/HVRSpUDWLRQVHQQHXIVHURQWDPRUFpHVGDQVOHPrPHWHPSVTXHODUHV WUXFWXUDWLRQGHVORFDX[FRQVHUYpV/HVORFDX[WHUWLDLUHVSRXUURQWrWUHGpYHORSSpVSOXVWDUG /HVWUDYDX[GHOD7RVVpHGHYURQWHX[rWUHUpDOLVpVSUpDODEOHPHQWRXFRQFRPLWDPPHQWjFHX[GHODSODTXH RXHVWSXLVTXHFHUWDLQVGHVORFDX[GpYHORSSpVVXUFHWDQFLHQVLWHLQGXVWULHOVHURQWHQUHODWLRQDYHFOHVHQ WUHSULVHVGHODSODTXH

/HVRFFXSDWLRQVSURYLVRLUHV 7HUNHQGRQWODSURJUDPPDWLRQQ¶HVWSDVGpWHUPLQpHSRXUUDLWGDQVXQSUHPLHUWHPSVDFFXHLOOLUGHVDFWL YLWpVGHORLVLUVHWVSRUWVGHSOHLQDLUPDLVDXVVLG¶LQWpULHXU DYHFODFRQVHUYDWLRQGHODKDOOH7HUNHQ HWFRQ VHUYHUODFXOWXUHGHVMDUGLQVIDPLOLDX[jO¶HVWGXVLWH EMPRISEMAÔTRISÏE PROPRIÏTAIRES,-#5 COMMUNE ##) AUTRESINSTITUTIONNELS EMPRISEFONCIÒREENCOURSDACQUISITION EMPRISEDONTLACQUISITIONESTDIFFICILE OUEMPRISESURLAQUELLEAUCUNEACTIONNESTENCOURS

/DVWUDWpJLHG¶DPpQDJHPHQWFRQVLVWHHQODFRQVWUXFWLRQHQSULRULWpGHVWHUUDLQVPDvWULVpVVDFKDQWTXHWRXVOHVWHU UDLQVQRQPDvWULVpVQHQpFHVVLWHQWSDVG¶rWUHDFTXLV SDUH[HPSOHHQSKDVH'3DHW'3D /DFDUWRJUDSKLHFL GHVVXVVRXOLJQHOHIDLWTX¶HQMDQYLHUSUHVTXHWRXVOHVWHUUDLQVGHVWHPSVHWVRQWVRXVPDvWULVHSXEOLTXHOHV SUHPLqUHVUpDOLVDWLRQVTXLSRXUURQWGRQFYRLUOHMRXUGpEXWEpQp¿FLHURQWGHO¶HIIHW]RQHIUDQFKH &HUWDLQHVDFTXLVLWLRQVQHVHURQWFRQVWUXLWHVTX¶DXJUpGHVRSSRUWXQLWpVG¶LPSODQWDWLRQ '3D7( HWSRXUURQWIDLUH O¶REMHWG¶XQHJHVWLRQWUDQVLWRLUH SUpYHUGLVVHPHQWSDUH[ 

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL

/D UXFKH G¶HQWUHSULVH /RJLFLO  SRXUUDvW GDQV O¶DWWHQWH GH OD FRQVWUXFWLRQV GHV EkWLPHQWV HQ IDoDGH GX QRXYHDXERXOHYDUGV¶LPSODQWHUSURYLVRLUHPHQWGDQVO¶XQGHVEkWLPHQWVGHOD7RVVpHSHUPHWWDQWDLQVLGH WHUPLQHUOHVWUDYDX[GHO¶vORW6WHSKHQVRQ /HVVLWHVGXGUDSpDXVXGGXFDQDO OHVWULDQJOHV HWGXJUDQGVXGVRQWYpJpWDOLVpVGDQVO¶DWWHQWHG¶XQH SURJUDPPDWLRQTXLYDORULVHUDFHVHPSODFHPHQWV


WHPSV

7(036











P

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


WHPSV

7HPSV±jSDUWLUGH

/HVRSpUDWLRQVFKDvQpHV 

/H QRXYHDX ERXOHYDUG HVW UpDOLVp MXVTX¶DX FDUUHIRXU GX ERXOHYDUG GHV &RXWHDX[ SHU PHWWDQWDLQVLO¶LQVHUWLRQG¶XQQRXYHDXWUDQV SRUWFROOHFWLIVXUOHVLWHGHO¶8QLRQ&HWUDQV SRUW SXEOLF GHVVHUYLUD OH F°XU GH O¶8QLRQ HW IDFLOLWHUDOHUDEDWWHPHQWHWOHVOLDLVRQVGHSXLV OHPpWUR (QOLHQDYHFOHQRXYHDXERXOHYDUGOHGUDSp DXQRUGGXFDQDOSUHQGIRUPHO¶HVSDFHDX VXGGHO¶HPSULVH0HUFXUHO¶HVSODQDGHHWO¶HV SDFH VXG GH OD SODLQH VRQW DPpQDJpV &HW HVSDFHSXEOLFRXYHUWYDORULVHO¶LPDJHGXVLWH HQERUGGHFDQDO /¶DFFqV QRUGVXG DX VLWH HVW IDFLOLWp SDU OD SRXUVXLWHGHODUXHGH1DQWHVMXVTX¶jODUXH GHOD)RQGHULH HWSDUOHVUXHVGH5RXEDL[ 7RXUFRLQJUHSULVHV/HGpYHORSSHPHQW1RUG GHODSODTXHVHUpDOLVHGDQVOHPrPHWHPSV TXHODUXHGH1DQWHV

/HVRSpUDWLRQVDXWRQRPHV 

/¶vORWGX&XOGH)RXUVHUDGpYHORSSpjPR\HQ WHUPHTXHOTXHVVRLHQWVHVIRQFWLRQVOHQRX YHOpTXLSHPHQWVSRUWLIGHYUDUHPSODFHUO¶DQ FLHQQH VDOOH 5RVVLQL OHV SDUFHOOHV DFWLYHV GHYURQW UpSRQGUH DX[ EHVRLQV GH OD ¿OLqUH LPDJHpODUJLHHWOHVSDUFHOOHVGHORJHPHQWV DX[EHVRLQVGXTXDUWLHU /H GpSDUWHPHQW VRXKDLWH LPSODQWHU XQ FRO OqJHVXUOHVLWHGH9DQGHUSHUUH6LO¶DEVHQFH GHSROOXWLRQGXVROHVWFRQ¿UPpHOHFROOqJH V¶\LPSODQWHUDHQSKDVH 

7(036



5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÃ&#x20AC;XHQFHV%(70LVVRQ0RUHO0DL









P


WHPSV

7HPSV±jSDUWLUGH

/HVRSpUDWLRQVFKDvQpHV 

/D YDORULVDWLRQ GX TXDUWLHU 6WHSKHQVRQ OH FRPPHQFHPHQWGHODSODLQHHWODUHSULVHGH ODUXHGH5RXEDL[LPSOLTXHODUpDOLVDWLRQGX F°XUGHODSDUWLHHVWGHODSODTXH /HGUDSpFRQWLQXHVDSURJUHVVLRQYHUVO¶HVW GXVLWHGHO¶8QLRQ /DVWDWLRQWUDPWUDLQFRPSOqWHUDOHPDLOODJH 7&GXVLWHGHO¶8QLRQ

/HVRSpUDWLRQVDXWRQRPHV 

7HUNHQ HVW DFWXHOOHPHQW XQH UpVHUYH IRQ FLqUHHQSHUVSHFWLYHG¶XQpTXLSHPHQWPp WURSROLWDLQ(QERUGXUHGHFDQDOOHVORFDX[ FRQVHUYpVSRXUURQWUHFHYRLUXQpTXLSHPHQW HWGHVORFDX[PL[WHVFRQQH[HVVXUOHWKqPH GHO¶HDX /H GHYHQLU GX VLWH GHV &RXWHDX[ VXG Gp SHQG GH VD SURJUDPPDWLRQ 6L OD SURSRVL WLRQGHUpDOLVHUXQ©SDUFKDELWpªHVWFRQ¿U PpHFHWWHRSpUDWLRQVHIHUDjORQJWHUPH /HVUpVHUYHVIRQFLqUHVGHVVLWHVGXGUDSp DXVXGGXFDQDO OHVWULDQJOHV HWGXJUDQG VXGVRQWXWLOLVpHVOHJUDQGVXGDFFXHLOOHUD GHV DFWLYLWpV DORUV TXH OHV DUFKLWHFWXUHV HPEOpPDWLTXHV GX GUDSp VXG VRQW SOXW{W GHVWLQpHV DX WHUWLDLUH RX ORJHPHQWV VXL YDQWO¶pYROXWLRQGXPDUFKp 

7(036











P

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL


/HSODQGHVRO



 /(6352%/e0$7,48(632//87,21 /(3/$1'(1,9(//(0(17  /(6'e%/$,65(0%/$,6 



 /(63/$16'(65e6($8; 

 



6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/(6352%/e0$7,48(632//87,21 SODQGHORFDOLVDWLRQGHVVSRWVGHSROOXWLRQLGHQWL¿pV

DQFLHQQH JDUH

'LVWULFKLPLH QRUG

9DQGHUSHUUH 'LVWULFKLPLH VXG

%ROORUp

SITESSURLESQUELSUNEÏTUDEBASÏESURLHISTORIQUEAÏTÏRÏALISÏE SITESSURLESQUELSUNEÏTUDEAPPROFONDIEBASÏESURDANCIENSRAPPORTSDÏTUDESAÏTÏMENÏE DÏLIMITATIONESTIMÏEDELACONTAMINATIONENMÏTAUXLOURDS ZONEESTIMÏEDELACONTAMINATIONENPLOMB ARSENICETBENZOPYRÒNE DÏLIMITATIONESTIMÏEDELACONTAMINATIONEN(#4 (!0 

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL









P


/D SUpVHQFH GH SROOXWLRQV LGHQWL¿pHV VXU OH VLWH GH O¶8QLRQ FRQVWLWXH XQH IRUWH FRQWUDLQWH SRXU OH SURMHW G¶DPpQDJHPHQW$¿QGHSUpFLVHUO¶pWDWGHSROOXWLRQGHVVROVHWGHVHDX[VRXWHUUDLQHVGHVpWXGHVWHFK QLTXHV RQWpWpPHQpHVSDU+DVNRQLQJ)UDQFHVXLYDQWGHX[RULHQWDWLRQV   OD PLVH HQ °XYUH G¶pWXGHV DSSURIRQGLHV HWRX GH PHVXUHV YLVDQW j UpVRUEHU HWRX j LVROHU OHV  VRXUFHVGHSROOXWLRQVLGHQWL¿pHVVXUVLWHV  ODUpDOLVDWLRQG¶XQHpWXGHKLVWRULTXHHWRXG¶XQGLDJQRVWLFGHSROOXWLRQVXUVLWHVUHFHQVpV 6XLWHjFHWWHDQDO\VHGHVPpWKRGHVGHUpKDELOLWDWLRQGHVVLWHVRQWpWpHVWLPpTXDQWLWDWLYHPHQWHW¿QDQFLq UHPHQW

/HVpWXGHVDSSURIRQGLHVEDVpHVVXUG¶DQFLHQVUDSSRUWVG¶pWXGHV VLWHVRQWIDLWO¶REMHWG¶XQH(WXGH6LPSOL¿pHGHV5LVTXHV %ROORUp 'LVWULFKLPLH6$ 9DQGHUSHUUH HWO¶DQFLHQQHJDUHGH5RXEDL[VLWHVXUOHTXHOXQH(WXGH'pWDLOOpHGHV5LVTXHVDpJDOHPHQWpWpUpDOLVpH /¶REMHFWLIGHFHVpWXGHVHVWODGp¿QLWLRQGHPpWKRGHVGHUpKDELOLWDWLRQHWO¶pYDOXDWLRQGHVFR€WVHQJHQGUpV HQWHQDQWFRPSWHGXSURMHWG¶DPpQDJHPHQW



OHVLWH%ROORUp /HSURMHWG¶DPpQDJHPHQWGHO¶8QLRQSURSRVHXQHVSDFHYHUWLQWpJUpDXGUDSpHWXQHDLUHGHVWDWLRQQHPHQW SRXUOHEkWLPHQWLPSODQWpjO¶RXHVWGHODGDUVHHWGHVWLQpjDFFXHLOOLUGHVVHUYLFHVVXUOHVLWHGH%ROORUp&H GHUQLHUHVWSROOXpSDUGHVPpWDX[ORXUGVHWGHVVROYDQWVFKORUpV ,OHVWUHFRPPDQGpGHUpDOLVHUXQHGpOLPLWDWLRQGHODFRQWDPLQDWLRQGXVROHQVROYDQWVFKORUpVHWG¶HQGpOL PLWHUO¶LPSDFWVXUODTXDOLWpGHVHDX[VRXWHUUDLQHV 'HX[W\SHVG¶LQWHUYHQWLRQVRQWSRVVLEOHVVXLYDQWODQDWXUHGHVSROOXDQWV OHVWHUUHVSROOXpHVHQVROYDQWVFKORUpVVHURQWHQSDUWLHH[FDYpHVSRXUO¶LQVWDOODWLRQGHVSDUNLQJV OHVWHUUHVFRQWHQDQWOHVPpWDX[ORXUGVVHURQWUpXWLOLVpHVVXUOHVLWHRXFRQ¿QpHVSDUDSSRUWGHPGH PDWpULDX[VDLQV



OHVLWH9DQGHUSHUUH /¶pWXGHWHFKQLTXHUHFRPPDQGHG¶HIIHFWXHUXQKLVWRULTXHGHODVRFLpWpORFDWDLUHGXVLWHGHSXLVVD FKDQWTXHOHVLWHpWDLWEDQDOLVDEOHDSUqVO¶DFWLYLWpSUpFpGHQWH  OHVLWHGHO¶DQFLHQQHJDUHGH5RXEDL[ /HSURMHWG¶DPpQDJHPHQWSUpYRLWXQHGLYLVLRQGXWHUUDLQGHO¶DQFLHQQHJDUHHQSDUFHOOHVG¶DFWLYLWpV /DVXUIDFHHQWRXUpHHQURXJHVXUOHSODQVLJQL¿HTXHOHVWHUUHVVRQWSROOXpHVHQPpWDX[ORXUGV/RUVTXH OHXUH[FDYDWLRQHVWQpFHVVDLUH VDFKDQWTXHOHVLWHHVWUHFRXYHUWSDUPGHWHUUHVVDLQHV FHVWHUUHV SROOXpHVSHXYHQWrWUHUpXWLOLVpHVVXUOHVLWHjFRQGLWLRQG¶rWUHFRQ¿QpHV 4XHOTXHV SRLQWV UHVWHQW FHSHQGDQW j pFODLUFLU  OHV FR€WV G¶H[FDYDWLRQ GHV SROOXWLRQV VLJQDOpHV SDU GHV FHUFOHVGHFRXOHXUYHUWHTXLQHSHXYHQWrWUHFDOFXOpVDXUHJDUGGXPDQTXHG¶LQIRUPDWLRQVXUO¶pWDWGHFHV VROV

/HVpWXGHVEDVpHVVXUO¶KLVWRULTXHHWOHSODQGHVLQIUDVWUXFWXUHV VLWHV UHFHQVpVSDU%$6,$6 RQWIDLWO¶REMHWG¶XQHSUHPLqUHpWDSHG¶(WXGH6LPSOL¿pHGHV5LVTXHVDYHF KLVWRULTXHVGHVVLWHV $XFXQHpWXGHGHVVROVQ¶D\DQWpWpUpDOLVpHVHXOHXQHDSSURFKHVXUOHVpOpPHQWVGHSROOXWLRQVVXSSRVpV HVWSULVHHQFRPSWHSDUO¶pWXGH+DVNRQLQJ)UDQFH 'HX[DSSURFKHVWHFKQLTXHHW¿QDQFLqUHRQWpWppWXGLpHVSRXUFKDFXQGHVVLWHVOHFRQ¿QHPHQWGHODWRWD OLWpGXVLWHHWGHX[HVWLPDWLRQV PR\HQQHHWKDXWH GHODSUpVHQFHGHSROOXDQWV

(QFRQFOXVLRQO¶pWXGHWHFKQLTXHDSSRUWHVXUVHFWHXUVGHVpOpPHQWVWHFKQLTXHVUHODWLIVjODQDWXUHGHV SROOXDQWVHWDX[LQWHUYHQWLRQVQpFHVVDLUHVjOHXUVDPpQDJHPHQWV'HVpWXGHVFRPSOpPHQWDLUHV GLDJQRV WLFV VHURQWjUpDOLVHUSRXUFKDTXHQRXYHOOHRSpUDWLRQG¶DPpQDJHPHQWGRQWOHVVROVVRQWFRQWDPLQpV

 OHVLWH'LVWULFKLPLH 'LVWULFKLPHQRUG /DORFDOLVDWLRQGXVLWHFRUUHVSRQGjGHVSDUFHOOHVDIIHFWpHVDXWHUWLDLUHHWDXORJHPHQW /DTXDOLWpGHVVROVVXUFHWWH]RQHGHPDQGHjrWUHYpUL¿pH8QHIDLEOHH[FDYDWLRQGHVWHUUHVHVWjHQYLVDJHU SXLVTXHOHVUHPEODLVQRXYHDX[VXUFHVLWHVRQWHVWLPpVHQWUHHWPHQYLURQHWTXHOHVSDUNLQJVVRXVOHV EkWLPHQWVWHUWLDLUHVVRQWHQWHUUpVDXPD[LPXPjP 'LVWULFKLPHVXG 6XUFHVLWHRFFXSpMDGLVSDUOHVHQWUHSULVHV'LVWULFKLPLH5HJHVROYHHW3URGLSODVWHVWSUpYXHO¶LPSODQWDWLRQ G¶XQHKDOWHÀXYLDOHG¶XQEDVVLQGHUpWHQWLRQGHVHDX[SOXYLDOHVHWG¶XQHSDUWLHGHO¶HVSODQDGH 'HVRSpUDWLRQVGHGpSROOXWLRQRQWpWpPHQpHVVDQVUpHOVXFFqV XQFRQ¿QHPHQWHWXQWUDLWHPHQWSDUYHQ WLQJ /HVLQIRUPDWLRQVVXUODSUpVHQFHRXQRQGHSROOXDQWVpWDQWWUqVPLQFHVLOQ¶HVWSRVVLEOHG¶HVWLPHUOH YROXPHGHVWHUUHVSROOXpHVQLOHXUFR€WGHWUDLWHPHQW'HVLQYHVWLJDWLRQVFRPSOpPHQWDLUHVDSSDUDLVVHQW GRQFLQGLVSHQVDEOHV

5DSSRUW(WXGHVGHVVLWHV%ROORUp'LVWULFKLPLH6$$QFLHQQHJDUGHGH5RXEDL[HW9DQGHUSHUUH 5DSSRUW(WXGHKLVWRULTXHGHVVLWHV 5DSSRUW(WXGHGpWDLOOpHGHVULVTXHVDQFLHQQHJDUHGH5RXEDL[ 5DSSRUW$SSURFKHWHFKQLTXHHWpFRQRPLTXHSRXUODUpKDELOLWDWLRQGXVLWHGHO¶8QLRQ

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/(3/$1'(1,9(//(0(17 SODQVFKpPDWLTXHGXQLYHOOHPHQWGXVLWHGHO¶8QLRQ

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL


/(6'e%/$,65(0%/$,6 VFKpPDWLVDWLRQGHVGpEODLVUHPEODLVLQGXLWVSDUOHQLYHOOHPHQWGXVLWH

/HQLYHOOHPHQWHWODVWUDWpJLHGHWHUUDVVHPHQW /HQLYHOOHPHQWGXSURMHWUHPRGqOHOHWHUUDLQVXUWRXWOHVHFWHXUSODTXH SODLQH HW GUDSp FRPSULV HQWUH OD YRLH GH FKHPLQ GH IHU HW OHV UXHV GH 5RXEDL[ HW GH 7RXUFRLQJ GX FDQDO MXVTX¶DX QLYHDX GH OD UXH 6WHSKHQVRQDXQRUG &HWWHPRGL¿FDWLRQGHO¶DOWLPpWULHHVWLVVXHGHODSUREOpPDWLTXHSRVpH G¶XQH SDUW SDU OD WRSRJUDSKLH SDUWLFXOLqUH OLpH j OD SODWHIRUPH HQ UHPEODLGHO¶DQFLHQQHJDUHTXLJpQqUHXQWDOXVGHPVXUODPDMHXUH SDUWLHGXOLQpDLUHGHODUXHGH1DQWHVSURORQJpHHWG¶DXWUHSDUWSDU OHSDVVDJHVRXVODYRLHIHUUpHGXQRXYHDXERXOHYDUGTXLLPSOLTXHXQ IRUWGpQLYHOp 3DU DLOOHXUV O¶HQVHPEOH GX VLWH SUpVHQWH GHV VROV SROOXpV DYpUpV RX HVWLPpV TXL VHORQ OHV SUpFRQLVDWLRQV GH OD GHUQLqUH pWXGH SHXYHQW rWUH LQWpJUpV j OD JHVWLRQ GHV WHUUDVVHPHQWV HQ GpEODLV UHPEODLVHQUHVSHFWDQWFRQGLWLRQVGHPLVHHQ°XYUHHWGLVSRVLWLIVGH FRQ¿QHPHQW&HWWHSRVVLELOLWpDSHUPLVGHUHYRLUODVWUDWpJLHJOREDOHGH QLYHOOHPHQWGqVORUVTXHO¶H[FDYDWLRQGHWHUUHVSROOXpHVQ¶HQJDJHDLW SDV QpFHVVDLUHPHQW O¶pYDFXDWLRQ HQ VLWH GH WUDLWHPHQW HW OHV FRÂ&#x20AC;WV DIIpUHQWV 'HIDLWODFRPELQDLVRQGHFHVWURLVGRQQpHVDPqQHjDGRXFLUOHSUR¿O HQORQJGXERXOHYDUGGHO¶8QLRQHWjLPSODQWHUODUXHGH1DQWHVjPL SHQWHGXGpQLYHOpGHIDoRQjFRQVHUYHUODSODWHIRUPHGHO¶DQFLHQQH JDUH WRXW HQ OLPLWDQW OHV WHUUDVVHPHQWV HQ UHPEODLV DX QLYHDX GH OD SODTXHWHUWLDLUHHWORJHPHQW

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/(65e6($8; FDUWHGHVUpVHDX[HQHDX[XVpHV

FDUWHGHVUpVHDX[HQGHVVHUWHG¶HDX

&,



 &$

&$ 

2



2



2



2 

6HUYLWXGHG DFFqVjO (VSLHUUHjSUpYRLU

2





3'

)7(

*6

)7(



 &$

2





)7(

7

3'

6

*6



7 



‘

‘



‘

*6

7

7



)7( 



3'



 7 7



)7( 



)7(

7

7 

7



7



 &,

 7







3'



&,  7



6



&,



7

2ÏSEAUXEXISTANTS %XUTOIRE 2ÏSEAUXSTRUCTURANTS 2ÏSEAUXSECONDAIRES  3ENSDÏCOULEMENT 7 $ÏCLASSEMENTOUDÏVOIEMENT 3IPHONSOUSCANAL

)7( )7( )7(

)7(

7

2ÏSEAUXPROJETÏS 3425#452!.4 



3'

)7(

)7(

2ÏSEAUXEXISTANTS %AUPOTABLE RÏSEAUPRIMAIRE %AUPOTABLE RÏSEAUSECONDAIRE %AUNONPOTABLE $ÏCLASSEMENTOUDÏVOIEMENT 2ÏSEAUXPROJETÏS 3425#452!.4 3ECONDAIRES

)7(

3RXUOHVHDX[XVpHVGHVFDQDOLVDWLRQVGHGLDPqWUHQRPLQDOpJDORXVXSpULHXUjPPVHURQWLQVWDOOpHVGDQV OHVHFWHXUGHO¶DQFLHQQHJDUHVRXVODQRXYHOOHDUWqUHQRUGVXGHWOHQRXYHDXERXOHYDUGHVWRXHVW(OOHVVHURQW UDFFRUGpHVVXUOHFROOHFWHXUGHODUXH'DUER /HVDXWUHVvORWVEpQp¿FLHQWGHODSUR[LPLWpGXUpVHDXG¶DVVDLQLVVHPHQWH[LVWDQW

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL

8QGpYRLHPHQWGHODFDQDOLVDWLRQSULQFLSDOHHVWjUpDOLVHUVXUODUXHGH0HQLQDXSUR¿WGX1RXYHDX%RXOHYDUGHW GHODUXHGH1DQWHVSHUPHWWDQWODGHVVHUWHGHODSODTXH /HVDXWUHVvORWVVHURQWUDFFRUGpVDX[UpVHDX[H[LVWDQWVjSUR[LPLWp


L’étude réalisée par le groupement Jacques Lefebvre et Aménagement Concept Ingénierie sur les réseaux existants propose un plan directeur de desserte et des recommandations pour le dévoiement et l’extension des différents réseaux. Ce plan directeur de desserte est décliné en plusieurs cartes thématiques cicontre et ci-après.

carte des réseaux d’eaux pluviales

La desserte du site de l’Union par les réseaux est liée :

rejet dans DN 1400 existant si h>PHEN

ND

- aux aménagements nouveaux du projet urbain du site de l’Union (le quartier de l’ancienne gare, le drapé, le nouveau boulevard) qui modifient la trame urbaine préexistante et entraînent soit un dévoiement des réseaux structurant existants, soit le maintien de leur accessibilité. Les implantations des nouveaux réseaux sont prévues, pour la plupart, sous les nouvelles voiries. Néanmoins, la conservation de la voie ferrée et la réalisation d’une halte fluviale, constituent deux contraintes majeures pour le passage de ces nouveaux réseaux. La traversée des réseaux sous voie ferrée ne pourra se faire à court ou moyen terme qu’au niveau des passages créés par le projet d’aménagement. L’implantation de la halte fluviale induit le dévoiement systématique de l’ensemble des réseaux.

stant 0 exi 140

rejet dans canal existant si h<PHEN

- les autres aménagements qui s’appuient sur la structure urbaine existante et réutilisent la plupart des réseaux existants.

2ÏSEAUXEXISTANTS CONSERVÏ SUPPRIMÏ 2ÏSEAUXPROJETÏS /UVRAGES DEPRÏTRAITEMENT DERÏGULATION

Site intercommunal de l’Union - Plan Directeur 23


FDUWHGHVUpVHDX[G¶pOHFWULFLWp

FDUWHGHVUpVHDX[GHJD]

2ÏSEAUXEXISTANTS 2ÏSEAU(4"K6 2ÏSEAU(4!K6 $ÏVOIEMENTDESCANALISATIONS 2ÏSEAUXPROJETÏS $ÏVOIEMENT %XTENSIONETDESSERTE

8QGpYRLHPHQWGHFkEOHV+7$ KDXWHWHQVLRQ HVWjHQYLVDJHUHQGHX[HQGURLWVVRXVOHTXDLGH&DODLV SURJUDP PDWLRQGHODKDOWHÀXYLDOH HWVRXVOHVUXHVGH0pQLQHWGH&KkORQV SURJUDPPDWLRQG¶HVSDFHVYHUWV  7URLVGpSDUWV+7$VRQWSURSRVpVjSDUWLUGXSRVWHVRXUFHSRXUGHVVHUYLUOHVVHFWHXUVGHODSODTXHGXS{OHLPDJH OHVDOHQWRXUVGXTXDUWLHUGX&XOGH)RXUOHVLWH7HUNHQHWOHV&RXWHDX[6XG

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL

2ÏSEAUXEXISTANTS $ISTRIBUTION"0ET-0" 4RANSPORT-0# 2ÏSEAUXPROJETÏS $ISTRIBUTION-0"STRUCTURANT $ISTRIBUTION-0"SECONDAIRE 4RANSPORT-0#

/HSURMHWG¶DPpQDJHPHQWQpFHVVLWHODGpULYDWLRQGHVUpVHDX[VWUXFWXUDQWVDXWRXUGHODKDOWHÀXYLDOH 'DQVXQSUHPLHUWHPSVXQHH[WHQVLRQGXUpVHDXVWUXFWXUDQW03% UpVHDXGRQWODSUHVVLRQHVWFRPSULVHHQWUH HWEDUV VHIHUDSRXUSHUPHWWUHGHGHVVHUYLUODSODTXHXQHDXWUHH[WHQVLRQGXUpVHDXVHUDUpDOLVpHHQVXLWH SRXUOHVHFWHXU7HUNHQ


FDUWHGHVUpVHDX[GHWpOpFRPPXQLFDWLRQV

9HUV7RXUFRLQJFHQWUH FDUWHGHVUpVHDX[GHFKDXIIDJHXUEDLQ



'pYRLHPHQWSUpDODEOH

 3URWHFWLRQRXGpYRLHPHQWpYHQWXHO

 ILEUHR SWLTXH

32 !.6%23 SWLTXH ILEUHR

32 '!-"%44!

&$1$/958 SWLTXH ILEUHR

752 

2ÏSEAUXEXISTANTS 3OUS RÏPARTITEUR

2ÏSEAUXEXISTANTS 3OURCEDECHALEUR 2ÏSEAUPRIMAIREANTENNE

2ÏSEAUXPROJETÏS $ISTRIBUTION $ÏVOIEMENTSDARSE

2ÏSEAUXPRIMAIRESPROJETÏS 3425#452!.4 ANTENNE

/HGpYRLHPHQWGXUpVHDXORQJXHGLVWDQFHVRXVOHTXDLGH&DODLVHVWLQGLVSHQVDEOHDORUVTXHFHOXLGXUpVHDX VLWXpjSUR[LPLWpGH0HUFXUHSHXWQHSDVO¶rWUHVLGHVSURWHFWLRQVVRXVFKDXVVpHVRQWSUpYXHV/HUpVHDXVHUD pWHQGXOHORQJGX1RXYHDX%RXOHYDUGHWGHODUXHGH1DQWHVSRXUGHVVHUYLUOHVLWH

,OVHUDLWLQWpUHVVDQWGHSUR¿WHUGXUpVHDXH[LVWDQWGHFKDXIIDJHXUEDLQPrPHVLOHVWUDYDX[HQJHQGUpVDSSDUDLV VHQWFRPSOH[HVDX[YXHVGHVLQIUDVWUXFWXUHVjIUDQFKLUFDULORIIUHXQHSRVVLELOLWpGHFKDXIIDJHVXSSOpPHQWDLUH SRXUOHVHQWUHSULVHVHWOHVKDELWDQWV

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL


/HSODQGpSODFHPHQWV



/$6<17+Ê6('(/¶e78'('e3/$&(0(17  /(5e6($8&<&/$%/((7/(675$1632576&2//(&7,)6  /(6,7,1e5$,5(635,9,/e*,e6'(63,e7216  /(0$,//$*(9,$,5(  /(6*$%$5,76'(692,(6  /(6(&7(85125'  /(6(&7(8568'  /(5e$0e1$*(0(17'(6&$55()2856  /$48(67,21'867$7,211(0(17 



6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/$6<17+Ê6('(/¶e78'('('e3/$&(0(17 /HVLWHGHO¶8QLRQJpQqUHXQHDXJPHQWDWLRQVLJQL¿FDWLYHGHVYROXPHVGHWUD¿FVVXUOHUpVHDXGHYRLULHTXLD IDLWO¶REMHWG¶XQHpWXGHFRQ¿pHDXFDELQHW,VLV3RXUpYLWHUWRXWHVFOpURVHGXVLWHHWDVVXUHUVRQDFFHVVLELOLWp FHWWHpWXGH©WUDQVSRUWVGpSODFHPHQWVHWVWDWLRQQHPHQWªFRQ¿UPHODQpFHVVLWpGHUHQIRUFHUOHUpVHDX GHWUDQVSRUWVFROOHFWLIVVXUOHVLWHGHO¶8QLRQGHKLpUDUFKLVHUOHVYRLULHVHWG¶DVVXUHUGHERQQHVFRQGLWLRQV GHFLUFXODWLRQDX[URXHVHWSLpWRQV

/HVWUDQVSRUWVFROOHFWLIV /DOLJQHHVWRXHVWGHEXVQDYHWWHHQVLWHSURSUH 3RXUDVVXUHUXQHRIIUHGHVHUYLFHHQWUDQVSRUWFROOHFWLI 7& FRPSOqWHHWHI¿FDFHLOHVWQpFHVVDLUHGHUHQ IRUFHUODGHVVHUWHHVWRXHVWGXVLWH8QHQRXYHOOHOLJQHGHEXVLQWpJUpHDX1RXYHDX%RXOHYDUGSHUPHWWUD QRQVHXOHPHQWGHGHVVHUYLUOHF°XUGHO¶8QLRQPDLVDXVVLGHIDFLOLWHUOHUDEDWWHPHQWHWOHVOLDLVRQVGHSXLV OHVUpVHDX[ORXUGV&HWWHOLJQHSRXUUDrWUHUHOLpHDYHFOHWUDPZD\HWG¶DXWUHVDUUrWVG¶D[HV7&HWSRXUUDLW rWUHSURORQJpHYHUVGHVTXDUWLHUVUpVLGHQWLHOVGH7RXUFRLQJ5RXEDL[HW:DWWUHORV /HVLWHSURSUHGHFH7&VHUDELODWpUDOSHUPHWWDQWjFRXUWHWPR\HQWHUPHODJHVWLRQG¶XQHUpGXFWLRQGX ERXOHYDUG YRLWXUHVHWEXVVXUODPrPHYRLH VXUOHWURQoRQHVW /¶pWXGHGpSODFHPHQWSUpFLVHTX¶LOVHUDLWLQWpUHVVDQWGHPRGL¿HUO¶LWLQpUDLUHGHODOLJQHGHEXV+16HQOH IDLVDQWWDQJHQWHUOHORQJGXVLWHDPpOLRUDQWDLQVLODGHVVHUWHHVWGXVHFWHXU /HVEXVFODVVLTXHV 3XLVTXHO¶XWLOLVDWLRQGHV7&LPSOLTXHXQUDEDWWHPHQWDLVpYHUVOHVPRGHVGH7&ORXUGVXQHPRGL¿FDWLRQGX WUDMHWGHODOLJQHQƒGHEXVVHUDLWjHQYLVDJHUHQSDVVDQWSDUODUXHGH1DQWHVMXVTX¶DXQRXYHDXERXOH YDUGV¶DUUrWDQWDLQVLDX[DUUrWVPpWURHWIXWXUWUDPWUDLQ /DGHVVHUWHHQPpWUR /DSUHPLqUHDFWLRQjPR\HQWHUPHVHUDOHUHQIRUFHPHQWGHODGHVVHUWHGXVLWHSDUOHPpWURWRXWHQVD FKDQWTX¶LOIDXWpJDOHPHQWPHWWUHHQSODFHOHVPHVXUHVQpFHVVDLUHVSRXUGHVVHUYLUHI¿FDFHPHQWOHF°XU GXVLWH /DIUpTXHQFHHWOHQRPEUHGHUDPHVGHPpWURDFWXHOVQHSHXYHQWUpSRQGUHDX[EHVRLQVIXWXUV8QHDFWLRQ ORXUGHWHFKQLTXHPHQWHW¿QDQFLqUHPHQWF¶HVWjGLUHXQHIUpTXHQFHVXSpULHXUHHWXQHUDPHVXSSOpPHQ WDLUHVHUDjHQYLVDJHU /HWUDPWUDLQ /¶LPSODQWDWLRQG¶XQHVWDWLRQWUDPWUDLQFRQVWLWXHXQHDOWHUQDWLYHjODYRLWXUHSRXUOHVOLDLVRQVDYHFO¶RXHVWGX VLWH&HWUDQVSRUWHQFRPPXQVHPEOHODPHVXUHODSOXVDSSURSULpHHQPDWLqUHGHWUDQVSRUWVFROOHFWLIVSRXU UpSRQGUHjODGHPDQGHjORQJWHUPH

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL

/HVDPpQDJHPHQWVURXHVHWSLpWRQV /HVSLpWRQV ,OFRQYLHQWG¶RIIULUDX[SLpWRQVGHERQQHVFRQGLWLRQVGHVpFXULWpGHFRPPRGLWpVHWGHFRQIRUWLQFLWDQWDLQVL OHVUpVLGHQWVDFWLIVGXVHFWHXUjUpDOLVHUOHXUVWUDMHWVGRPLFLOHWUDYDLOjSLHG /HVF\FOHV /¶pWXGHGpSODFHPHQWVQRWHTX¶XQPHLOOHXUPDLOODJHHVWQpFHVVDLUHVXUOHVLWHGHO¶8QLRQG¶ROHVSURSRVL WLRQVVXLYDQWHVGHJHVWLRQGHVGHX[URXHVVXUOHVD[HVVWUXFWXUDQWV '¶HVWHQRXHVWXQHSLVWHF\FODEOHH[LVWHOHORQJGXFDQDOGH5RXEDL[PDLVFHQ¶HVWSDVVXI¿VDQW,OHVWGRQF QpFHVVDLUHjFRXUWWHUPHG¶HQFUpHUXQHVHFRQGHOHORQJGXQRXYHDXERXOHYDUG&HWWHGHUQLqUHIHUDSDUWLH LQWpJUDQWHGXGUDSp 'XQRUGDXVXGGHVDPpQDJHPHQWVSHXYHQWrWUHDPpQDJpVVXLYDQWOHVWDWXWHWODYLWHVVHGHODYRLH(WDQW GRQQpODFLUFXODWLRQjIDLEOHYLWHVVHVXUODUXHGH1DQWHVOHVF\FOHVSRXUURQWHPSUXQWHUODPrPHYRLHTXH OHVDXWRPRELOHVDORUVTXHVXUODUXHGH5RXEDL[7RXUFRLQJGRQWOHWUD¿FHVWSOXVLPSRUWDQWXQHEDQGH F\FODEOH GDQVOHUpVHDXYRLWXUH VHUDSUpYXH6XUOHERXOHYDUGGHV&RXWHDX[DXUHJDUGGXWUD¿FDFWXHOHW HQYLVDJpLOVHUDLWLQWpUHVVDQWGHSURWpJHUOHVXWLOLVDWHXUVGHVURXHVHQDPpQDJHDQWXQHEDQGHF\FODEOH (Q¿QO¶LPSODQWDWLRQGHSDUFVjYpORVHVWjSUpYRLUO¶XQSUqVGHVVWDWLRQVWUDPWUDLQHWPpWURHWO¶DXWUHDX QRUGGHODSODLQH,OVSHUPHWWURQWXQDFFqVDLVpj©ODSODTXHªHWjOD7RVVpH

/HVDPpQDJHPHQWVDXWRPRELOHV /¶pWXGHGpSODFHPHQWVSURSRVHOHUpDPpQDJHPHQWGHFHUWDLQVFDUUHIRXUVSRXUIDFLOLWHUODJHVWLRQGHVÀX[ VXUOHVLWHGHO¶8QLRQ  O¶LQWHUVHFWLRQHQWUHOHERXOHYDUG*DPEHWWDHWOH1RXYHDX%RXOHYDUG  O¶LQWHUVHFWLRQGXTXDL'XQNHUTXHDYHFODUXHGH5RXEDL[UXHGH7RXUFRLQJ  DXFDUUHIRXUERXOHYDUGGHV&RXWHDX[HW1RXYHDX%RXOHYDUG /DPLVHHQSODFHGH7$*HW7$'VHPEOHrWUHODVROXWLRQODSOXVUpDOLVWH HQWHUPHGHFR€WHWGHUpVXOWDW  '¶DXWUHVDFWLRQVjORQJWHUPHSHUPHWWURQWpJDOHPHQWG¶pFRXOHUXQHSDUWGHWUD¿FWHOTXHOHERXFODJHFRP SOHWGXERXOHYDUGSpULSKpULTXH HQWUpHQRUGGXVLWH  /HPDLOODJHYLDLUHGHPDQGHXQHFODUL¿FDWLRQ&¶HVWSRXUTXRLQRXVSURSRVRQVXQHKLpUDUFKLHGHFHGHUQLHU 6XLYDQWODFODVVL¿FDWLRQGHODYRLHGHVDPpQDJHPHQWVGLIIpUHQWVVHURQWjSUpYRLU H[PLVHHQSODFHGH FRXVVLQVEHUOLQRLVSRXUUDOHQWLUOHÀX[DXWRPRELOHHWVpFXULVHUOHVSLpWRQV 


/(5e6($8&<&/$%/((7/(675$1632576&2//(&7,)6 SODQVFKpPDWLTXHGXUpVHDXF\FODEOHHWGHVWUDQVSRUWVFROOHFWLIV

/H SURMHW GX VLWH GH O¶8QLRQ YLVH OH GpYH ORSSHPHQWGHVPRELOLWpVSDUXQHRIIUHSHU IRUPDQWH GH WUDQVSRUWV SXEOLFV HW SDU XQH RIIUHLPSRUWDQWHGHSLVWHVF\FODEOHV

&$5/,(56

0(5&85(

VWDWLRQWUD

PWUDLQ

#!2,)%23

SpULPqWUHGHSURMHW

5pVHDXF\FODEOH H[LVWDQW SURMHWp

7UDQVSRUWVFROOHFWLIV PpWUR 7&63 EXVQDYHWWH

WUDPWUDLQ SRWHQWLHOOHVPRGLILFDWLRQVG¶LWLQpUDLUHVGHEXV+16 S{OHPXOWLPRGDO

$/6$&(











P

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/(6,7,1(5$,5(635,9,/(*,(6'(63,(7216 SODQVFKpPDWLTXHGHVLWLQpUDLUHVSULYLOpJLpVGHVSLpWRQVVXUOHVLWHGHO¶8QLRQ

8Q LPSRUWDQW UpVHDX G¶HVSDFHV SXEOLFV GLYHUVL¿pV OLpV DX SDUF HW DXGUDSpFRQVWLWXHOHVD[HVSULQFL SDX[HPSUXQWpVSDUOHVSLpWRQV /HV IUDQFKLVVHPHQWV GX FDQDO VRQWPXOWLSOLpVJUkFHjGHX[SDV VHUHOOHV SLpWRQQHV TXL SHUPHWWHQW OHV FRQWLQXLWpV QRUGVXG GHV PR GHVGRX[

SpULPqWUHGHSURMHW LWLQpUDLUHVSULYLOpJLpVSLpWRQV



5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL









P


/(0$,//$*(9,$,5( SODQVFKpPDWLTXHGHODKLpUDUFKLHGHVYRLULHV

UX

H

GH

7R

VV

pH

O GH

G

RQ

)

D

OD

/HSODQGLUHFWHXUGXVLWHGHO¶8QLRQ Gp¿QLW XQH KLpUDUFKLH GHV YRLHV SRXU PHWWUH HQ FRKpUHQFH OHXUV IRQFWLRQV  OH UpVHDX PDJLVWUDO FRUUHVSRQG   DX[ YRLHV UDSLGHV G¶pFKHOOH Gp SDUWHPHQWDOHRXQDWLRQDOH OHUpVHDXSULQFLSDOVXSSRUWGHWUD  ¿F GH WUDQVLW LQWpULHXU DX WHU ULWRLUHFRPPXQDXWDLUH OHUpVHDXVHFRQGDLUHTXLLQWqJUH OH1RXYHDX%RXOHYDUG  OHV YRLHV GH GHVVHUWH LQWHU TXDUWLHU OHVYRLHVGHGHVVHUWHORFDOH

H HUL

UXH



YD

HV

XOH

L 9R

T

ER

LQ

&

V

GH

H

UX GH

UG

XYH

ERXOHYDUG*

%R

DPEHWWD

XOH

YD

UG

QWHV

L[

XED

H1D

5R

UXHG

GH

UXH

X[

WHD

RX

V&

UXH1H

X

YHD

1RX

UX

H

8 95

GH

7 XU

W

XLQ

ERXOHYDUGGH

OD5pSXEOLT

XH

ER

XOH

YD

UG

G¶+

DOO

J

RLQ

XUF

7R

GH

UXH

JR

V

UH

WLq

HQ

¶$

UP

DU

HY

XO

ER

G G

SpULPqWUHGHSURMHW YRLHUDSLGHXUEDLQHUpVHDXPDJLVWUDO UpVHDXSULQFLSDO UpVHDXVHFRQGDLUHDYHF7&63 UpVHDXVHFRQGDLUH UpVHDXGHOLDLVRQLQWHUTXDUWLHU

SUpFRQLVDWLRQGHYRLULHVVXUSDUFHOOHVSULYpHV 









P

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/(6*$%$5,76'(692,(6

/(6(&7(85125'

OHERXOHYDUGGHO¶8QLRQFRQ¿JXUDWLRQFRXUDQWH /H1RXYHDX%RXOHYDUGHVWXQHYRLHOHQWHUHOLDQWOHVD[HVQRUGVXGTXLWDQJHQWHQWOHTXDUWLHU %RXOHYDUG*DPEHWWDHWGHV &RXWHDX[ &RQVDFUpDX[FLUFXODWLRQVGRXFHVLODFFXHLOOHUDXQWUDQVSRUWFROOHFWLIHQVLWHSURSUHGHW\SHEXVRXQDYHWWH

OHERXOHYDUGGHO¶8QLRQDXGURLWGHO¶LPPHXEOH/2*,&,/FRQ¿JXUDWLRQSURYLVRLUH 6XUODFRPPXQHGH:DWWUHORVDXGURLWGHO¶HQWUHSULVH/RJLFLOOHJDEDULWGXERXOHYDUGVHUDGDQVXQSUHPLHUWHPSVUpGXLW/H WUDQVSRUWFROOHFWLIVHUDGRQFLQWpJUpGDQVODFLUFXODWLRQDXWRPRELOHVXUFHWWHSRUWLRQ

OHIUDQFKLVVHPHQWGHODYRLHIHUUpHDXGURLWGX1RXYHDX%RXOHYDUG

OHERXOHYDUGGHO¶8QLRQDXGURLWGHO¶LPPHXEOH/2*,&,/FRQ¿JXUDWLRQjWHUPH $WHUPHO¶HPSLqWHPHQWGXSUHPLHUUDQJGHPDLVRQVDXQRUGGX1RXYHDX%RXOHYDUGSHUPHWWUDODFUpDWLRQGXVLWHSURSUHVXU WRXWHODORQJXHXUGHODYRLHHWDPpOLRUHUDDLQVLODSHUIRUPDQFHGXEXV

 SHQWH

WUDPWUDLQ FRXSHGpWDLOOpHHQDQQH[H

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÃ&#x20AC;XHQFHV%(70LVVRQ0RUHO0DL


SODQGpWDLOOpGXERXOHYDUGGHO¶8QLRQjORQJWHUPHpFKHOOHqPH

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


ODUXHGH1DQWHV /DUXHGH1DQWHVFRQQHFWpHDX1RXYHDX%RXOHYDUGHWjODUXHGHOD)RQGHULHLUULJXH OHTXDUWLHUPL[WHG¶DFWLYLWpVHWGHORJHPHQWVGHODSODTXH

/HVLPSDVVHVUpVLGHQWLHOOHV 3UDWLTXpHVHVVHQWLHOOHPHQWSDUOHVKDELWDQWVHOOHVGHVVHUYHQWOHVSDUFHOOHVGHORJHPHQWV 8QHQRXHFHQWUDOHSODQWpHSDUWLFLSHDXV\VWqPHG¶DVVDLQLVVHPHQWGXVHFWHXU

ODUXH1HXYHRXHVW /DUXH1HXYHSRVVqGHXQHYRLHSULQFLSDOHHWXQHFRQWUHDOOpHERUGpHGHVWDWLRQQHPHQWV/HWHUUHSOHLQHWOHVVWDWLRQQHPHQWV DWWHQDQWVFRUUHVSRQGHQWjO¶HPSULVHQpFHVVDLUHjODUpDOLVDWLRQG¶XQSDVVDJHDXWRPRELOHVRXVYRLHVIHUUpHVjORQJWHUPH

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÃ&#x20AC;XHQFHV%(70LVVRQ0RUHO0DL

/DUXH6WHSKHQVRQ (OOHUHOLHOHVUXHVGHOD7RVVpHHWGH1DQWHV5pVLGHQWLHOOHHOOHDFFXHLOOH GHVVWDWLRQQHPHQWVUpVHUYpVDX[UpVLGHQWVGHO¶vORW6WHSKHQVRQ

/DUXH1HXYHHVW $O¶HVWGHODUXHGH1DQWHVOHIRQFWLRQQHPHQWHVWLGHQWLTXHHWXQDOLJQHPHQWVXSSOpPHQWDLUHHVWDMRXWpVXUOHWHUUHSOHLQ FHQWUDOHQWUHODYRLHHWODFRQWUHDOOpH


ODUXHGHOD7RVVpHPRGL¿pH /HWUDFpVXGGHODUXHHVWPRGL¿pHWGpYLpSHUSHQGLFXODLUHPHQWjOD UXH1HXYH/¶DQFLHQWURQoRQGHYLHQWXQHYRLULHUpVLGHQWLHOOH

FRXUVGHO¶,QGXVWULH &HWHVSDFHSXEOLFSOXVRXPRLQVGLODWpDUWLFXOHOHVHFWHXUGHOD7RVVpHDXSDUFHWjODSODTXH6DFRQWLQLWpDYHFODUXH1HXYH HVWDVVXUpHYLVXHOOHPHQWSDUOHWUDLWHPHQWGHVVROVHWOHVDOLJQHPHQWVG¶DUEUHV

ODUXH5RXEDL[7RXUFRLQJ /DUXH5RXEDL[7RXUFRLQJRXYRLHGHOLDLVRQLQWHUTXDUWLHUFRQVWLWXHOHVHQWUpHVQRUGHWVXGGXTXDUWLHU /HVF\FOHVSRVVqGHQWOHXUSURSUHSLVWHLQWpJUpHjODYRLULHGpJDJHDQWDLQVLXQHYDVWHHVSODQDGHSLpWRQQHHQUDSSRUWDYHFODSODLQH

ODUXH&DGHDX /HVXGGHODUXH&DGHDXHVWFRQVHUYpHQWDQWTXHYRLHDXWRPRELOHOH QRUGGHYHQDQWHQWLqUHPHQWSLpWRQ(QOLDLVRQDYHFODYRLHLQWHUQHHVW RXHVWHOOHFRQVWLWXHO¶XQHGHVHQWUpHVSULQFLSDOHVGHOD7RVVpH

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/(6(&7(8568'

ODUXH-HDQ%DUWQRUG /HODUJHWURWWRLUF{WpHVWTXLSRXUUDDFFXHLOOLUOHVpWDOVGHVPDUFKDQGV GXPDUFKpGHO¶$OPD

ODUXH-HDQ%DUWVXG 'HX[EDQGHVGHVWDWLRQQHPHQWVSHUPHWWHQWXQDFFqVDLVpKRUVKHXUHVGXPDUFKpDX[ FRPPHUFHVHQUH]GHFKDXVVpHGHEkWLPHQW

/DUXHGHOD*XLQJXHWWHHVW /DUXHGHOD*XLQJXHWWHRIIUHXQHEDQGHGHVWDWLRQQHPHQWVDFFHVVLEOHV KRUVMRXUVGHPDUFKp

/DUXHGHOD*XLQJXHWWHRXHVW /¶DOLJQHPHQW GH OD YRLH DYHF OH WURQoRQ SUpFpGHQW HVW PDLQWHQX /¶pODUJLVVHPHQW GX JDEDULWGHODUXHSHUPHWXQHVHFRQGHEDQGHGHVWDWLRQQHPHQWV

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÃ&#x20AC;XHQFHV%(70LVVRQ0RUHO0DL


ODUXH5RVVLQLQRXYHOOH /HQRXYHDXWUDFpGHODUXH5RVVLQL¿OHGURLWHQWUHOHVUXHV7XUJRWHWGH)ODQGUHV(OOHGHVVHUW OHVORJHPHQWVGX&XOGH)RXUHWODVDOOHGHVSRUWGHOD9LOOHGH5RXEDL[

ODUXH:DJUDPQRXYHOOH /DUXH:DJUDPQRXYHOOHHVWGpYLpHHWpODUJLHD¿QG¶pORLJQHUOHVKDELWDWLRQVF{Wp RXHVWGHVDFWLYLWpVjO¶HVWGHODUXH

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/(5e$0e1$*(0(17'(6&$55()2856

&LDSUqVOHVSURSRVLWLRQVGHUpRUJDQLVDWLRQGHVFDUUHIRXUVG¶DSUqVO¶pWXGHWUDQVSRUWVGpSODFHPHQWVHWVWDWLRQQHPHQWUpDOLVpHSDUOHEXUHDXG¶pWXGHV,6,6 &HVFDUUHIRXUVVRQWUHSpUpVVXUOHSODQGLUHFWHXUSDUXQUHFWDQJOHYLROHW FDUUHIRXUERXOHYDUG*DPEHWWD1RXYHDX%RXOHYDUG /¶pWXGHGHGpSODFHPHQWV,6,6SURSRVHG¶DPpQDJHUXQH¿OHGH7RXQHj*DXFKHVXUOHERXOHYDUGGH*DPEHWWDjKDXWHXUGX QRXYHDXERXOHYDUG

 0'



 0'

       

FRXSH,6,6

 0'



 0'



       

FRXSH,6,6

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÃ&#x20AC;XHQFHV%(70LVVRQ0RUHO0DL

FDUUHIRXUERXOHYDUGGHV&RXWHDX[1RXYHDX%RXOHYDUG '¶DSUqVO¶pWXGH,6,6OD¿OHGH7RXUQH$*DXFKHGHYUDLWrWUHPDLQWHQXHVXUOHERXOHYDUGGHV&RXWHDX[F{Wp6XG ORUVTXH O¶RQYLHQWGXSRQWGHV&RXWHDX[ 8Q7RXUQH$'URLWHVXUO¶DYHQXH/pRQ-RXKDX[F{WpQRUG ORUVTXHO¶RQYLHQWGH7RXUFRLQJ  SRXUUDLWrWUHHQYLVDJpVXUO¶HPSULVHGLVSRQLEOHLOIDFLOLWHUDLWO¶DFFqVDXVLWHGHO¶8QLRQ


FDUUHIRXUGH958HWUXHVGH5RXEDL[7RXUFRLQJ

FDUUHIRXUGH958HWERXOHYDUGGH*DPEHWWD

/DUHFKHUFKHG¶XQHÃ&#x20AC;XwGLWpDXGURLWGXWUD¿FHQWUHOD958HWOHVUXHVGH5RXEDL[7RXUFRLQJLPSOLTXHO¶DPpQDJHPHQWGH GHX[¿OHVGHWRXUQHjJDXFKHVXUOHTXDLGH'XQNHUTXHHQGLUHFWLRQGHODUXHGH5RXEDL[ WURLV¿OHVGHFLUFXODWLRQVXUODUXHGH5RXEDL[ 7$*YDWRXWGURLWHW7$' GDQVOHVHQVYHUV5RXEDL[ GHX[¿OHVGHFLUFXODWLRQ GHX[¿OHVGHYDWRXWGURLW GDQVOHVHQV©YHUV7RXUFRLQJª $ORQJWHUPHODPLVHHQSODFHG¶XQGpQLYHOpVXUOHVTXDLVGH'XQNHUTXH*DQGHVWSURSRVp,OVHUDLWVRXKDLWDEOHTX¶XQHpWXGH DSSURIRQGLHVXUOHIRQFWLRQQHPHQWHWOHFRÂ&#x20AC;WHQJHQGUpSDUXQWHODPpQDJHPHQWVRLWUpDOLVpH

/¶pWXGH,6,6VXJJqUHO¶DPpQDJHPHQWG¶XQHJUDQGHSODFHIRQFWLRQQDQWHQJLUDWRLUH ,OVHUDLWQpFHVVDLUHDXSUpDODEOHGHUHFKHUFKHUXQHPHLOOHXUHUpJXODWLRQGHODFLUFXODWLRQSDUOHVIHX[WULFRORUHV

9XHDpULHQQH

S VFKpPD,6,6

VFKpPD,6,6

VFKpPD,6,6

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


/$48(67,21'867$7,211(0(17 VFKpPDGHVDLUHVG¶LQÀXHQFHGHVWUDQVSRUWVSXEOLFVH[LVWDQWVHWSURMHWpVVXUOHVLWHGHO¶8QLRQ

0

&$5/,(56

77 0

67$7,21 75$075$,1

0(5&85(

3pULPqWUHG LQIOXHQFHGXPpWUR 5 PVRLWPQjSLHG

0

3pULPqWUHG LQIOXHQFHGXWUDPWUDLQ 5 PVRLWPQjSLHG

$/6$&(

3pULPqWUHG LQIOXHQFHGXEXVQDYHWWH 5 PVRLWPQjSLHG 

5(,&+(1(752%(57 $VVRFLpV$JHQFH3{OHV%(7&RQÀXHQFHV%(70LVVRQ0RUHO0DL









P


$XMRXUG¶KXLOD]RQH8*GX3/8FRXYUHODPDMHXUHSDUWLHGXVLWHO¶HVWHWO¶RXHVWGXVLWHVRQWFODVVpVHQ ]RQHV8$EHW8%D'DQVFHV]RQHVVRQW¿[pVGHVPLQLPDVGHSODFHVGHVWDWLRQQHPHQWIRQFWLRQVGHO¶RF FXSDWLRQGHVSDUFHOOHV (WDQWGRQQpODYRORQWpGHFUpHUXQS{OHG¶H[FHOOHQFHLOVHUDLWLQWpUHVVDQWGHIDLUHpYROXHUOHVQRUPHVGH VWDWLRQQHPHQWHWGHSURSRVHUGHVUDWLRVPD[LPXP

5DSSHORQVOHVHQMHX[GHODSROLWLTXHGHVWDWLRQQHPHQWVXUOHVLWHLQWHUFRPPXQDOGHO¶8QLRQ   OH GpYHORSSHPHQW G¶XQH RIIUH GH VWDWLRQQHPHQW VXI¿VDPPHQW LPSRUWDQWH TXDQWLWDWLYHPHQW SRXU  PDLQWHQLUOHVSRSXODWLRQVHWGpYHORSSHUOHVDFWLYLWpVHWFRPPHUFHV  XQHJHVWLRQFRQWUDLJQDQWHGXVWDWLRQQHPHQWjO¶pJDUGGHVDFWLIVSDUDOOqOHPHQWDXUHQIRUFHPHQW  GHO¶RIIUHHQ7&  GpYHORSSHPHQWG¶XQHRIIUHGHVWDWLRQQHPHQWDGDSWpHDX[EHVRLQVGHVYpORV

3RXUPpPRLUHOD]RQH8$EGX3/8VRLWODSOXVUHVWULFWLYHSXLVTX¶HOOHV¶DSSOLTXHDX[©]RQHVXUEDLQHVLQWUDPXURVSULYLOpJLpHV G¶H[WHQVLRQGXFHQWUHDSSHOpHVjVHUpRUJDQLVHUªH[LJH SRXUOHVFRQVWUXFWLRQVjXVDJHUpVLGHQWLHODXPRLQVSODFHGHVWDWLRQQHPHQWSDUORJHPHQW  SRXU OHV EkWLPHQWV j XVDJH DUWLVDQDO GH FRPPHUFHV EXUHDX[ K{WHOV HW VHUYLFHV LO Q¶HVW SDV LPSRVp OD FUpDWLRQGHSODFHVGHVWDWLRQQHPHQW

'HSOXVOHVLWHHVWFRQFHUQpSDUOHVSpULPqWUHVGHYDORULVDWLRQGHVWUDQVSRUWVFROOHFWLIVH[LVWDQWVHW jYHQLU XQHOLJQHGHPpWURGHVVHUWGpMjOHVLWHXQEXVRXXQHQDYHWWHGHVVHUYLUDjFRXUWPR\HQWHUPHOH F°XUGXVLWHXQWUDPWUDLQHVWSURMHWpVXUOHVYRLHVIHUUpHVjORQJWHUPH 

(QDFFRUGDYHFOHVpWXGHVWHFKQLTXHVPHQpHVVXUOHVLWHGHO¶8QLRQQRXVSURSRVRQVO¶DSSOLFDWLRQGHUDWLRV GHVWDWLRQQHPHQWPD[LPXPHWODGLIIpUHQFLDWLRQGHFHX[FLGDQVHWKRUVSpULPqWUHGH7&GDQVOHV ]RQHVFRXYHUWHVSDUXQUD\RQGHPRXGHPQjSLHGDXWRXUGHVVWDWLRQVGHVUDWLRVSOXVFRQWUDLJQDQWV VRQWDSSOLTXpV&HVUDWLRVGHVWDWLRQQHPHQWVRQWIRQFWLRQGHODPLVHHQSODFHGHFHVWUDQVSRUWVFROOHFWLIV  

1RUPHVGHVWDWLRQQHPHQWGDQVOHSpULPqWUHGHYDORULVDWLRQGHV7&jFRXUWHWORQJWHUPH

ORJHPHQWV $FWLYLWpVPL[WH EXUHDX[ pTXLSHPHQW PpWURSROLWDLQ

UDWLRVjFRXUWWHUPH PLLOGTCOLLECTIFETINDIVIDUEL PLPARMÁDE3(/. PLPARMÁDE3(/.

UDWLRV55$jORQJWHUPH PLLOGTCOLLECTIFETINDIVIDUEL PLPARMÁDE3(/. PLPARMÁDE3(/.

PLPARMÁDE3(/. SOITPL

HORSLEP£RIMáTREDEVALORISATIONDES4#ÜCOURTMOYENLONGTERME .ORMESDESTATIONNEMENT 1RUPHVGHVWDWLRQQHPHQW KRUVOHSpULPqWUHGHYDORULVDWLRQGHV7&jFRXUWHWORQJWHUPH

ORJHPHQWV

DFWLYLWpVPL[WH EXUHDX[ pTXLSHPHQW PpWURSROLWDLQ

UDWLRV55$jFRXUWWHUPH  PLLOGTCOLLECTIFETPLLOGT INDIVIDUEL PLPARMÁDE3(/. PLPARMÁDE3(/.

UDWLRV55$jORQJWHUPH  PLLOGTCOLLECTIFETPLLOGT INDIVIDUEL PLPARMÁDE3(/. PLPARMÁDE3(/.

PLPARMÁDE3(/. SOITPL

3RXUFKDTXHFRQVWUXFWLRQjXVDJHG¶KDELWDWFROOHFWLISRXUOHVEXUHDX[FRPPHUFHVHWpTXLSHPHQWVLOHVW HVVHQWLHOGHSUpYRLUODUpDOLVDWLRQGHORFDX[H[FOXVLYHPHQWGHVWLQpVDXVWDWLRQQHPHQWGHVYpORVGLUHFWH PHQWDFFHVVLEOHVFORVSDUXQGLVSRVLWLIDMRXUQpHWpTXLSpVG¶DUFHDX[GHVWDWLRQQHPHQW

6LWHLQWHUFRPPXQDOGHO¶8QLRQ3ODQ'LUHFWHXU 


perspective de la plaine

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


Plan vert

4

1. LE PROJET PAYSAGER...............................................................................................44 2. LES STRUCTURES VÉGÉTALES ET LA GESTION DU PARC...................................................46 3. LES LIEUX ET LES USAGES.........................................................................................48 4. LE DRAPÉ...............................................................................................................50 5. LA PLAINE...............................................................................................................52

Site intercommunal de l’Union - Plan Directeur 43


1

LE PROJET PAYSAGER

éléments singuliers, places, dominante pierre espaces piétons majeurs, dominante béton espaces piétons dominante stabilisé équipements sportifs de loisirs franchissement piéton, surplombs, pontons, dominante bois trottoir, dominante asphalte stationnement, dominante enrobé grenaillé

la Plaine

desserte parkings, dominante enrobé espaces ouverts, plaine et drapé, dominante priairie jardins thématiques fossées, noues et berges chambres de verdure bassins

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

le Drapé


La démarche du projet

Les entités paysagères

La grande ouverture qui se dégage sur la rive nord du canal est la qualité première du site, à valoriser d’une part comme espace de «débordement» du canal, qui seul manque assurément d’ampleur, et d’autre part pour le recul et les profondeurs qu’elle permet sur le quartier.

Le parc urbain, composé des espaces publics du drapé et de la plaine, est l’élément de centralité du projet urbain, qui s’appuie sur les deux axes majeurs du site (le canal et les rues de Roubaix et de Tourcoing) et à partir duquel se déploient les frontalités bâties.

Les alignements récemment plantés de part et d’autre du canal constitueront à terme un élément structurant fort, mais accentueront la linéarité et l’effet de coupure que l’on ressent à l’heure actuelle.

Le plan paysage est conduit par l’équilibre à trouver entre des espaces publics majeurs d’échelle «territoriale» et la valeur de localisation que doit apporter l’échelle urbaine : il compose le rapport entre des «étendues» et des «stations».

Le projet prend le parti de développer cette ouverture comme identité première du site, fondée par le parc et orientée sur le canal, tout en la modulant et l’habitant. Il s’agit de la mise en scène d’un espace ouvert, mise en oeuvre par un jeu de «frontalités différées», autrement dit par des mesures de recul, de progression, de passage ou de filtre, conçues dans un travail de profondeur de champ, selon les rapports introduits par les plans successifs et les textures distinctes du proche et du lointain. Le canal de Roubaix est un élément central du site, physiquement et symboliquement. Par la présence de l’eau, il rattache le site au territoire naturel, par construction, il en est le cadre maîtrisé.

Au caractère extensif des unes répond le caractère intensif des autres, à l’homogénéité du drapé et de la plaine répond l’hétérogénéité, la diversité, ou la singularité avec un ensemble de lieux spécifiques : les places et les jardins publics qui seront conçus selon leurs propres thèmes et termes. L’aménagement des voies participe également à la composition de ce rapport en distinguant les axes nord / sud conçus comme éléments de continuité de la trame urbaine, des voies est / ouest éléments de transversalité à l’échelle des quartiers.

Le projet inscrit et déploie cette ambivalence dans le cadre d’une démarche Haute Qualité Environnementale (HQE) qui place la trame de gestion des eaux pluviales par l’hydraulique douce au cœur de l’armature urbaine et paysagère, offrant des qualités propres à valoriser et développer le site. Ce réseau innerve les espaces publics, structure un territoire plus large et permet aux dimensions urbaines et naturelles du paysage de s’exprimer dans un rapport très étroit.

Les espaces publics majeurs du plan vert en chiffres Le parc 11,2 ha dont 8,15 pour le drapé et 2,85 pour la plaine espces verts du drapé : le plissé 3,25 ha et les jardins thématiques 0,5 ha bassins du plissé : 1,35 ha dont 0,35 ha en eau permanente Le parc habité 0,65 ha bassins : 0,13 ha dont 0,65 ha en eau permanente Les jardins familiaux 2,45 ha conservés et 1,45 ha à déplacer à terme en secteur de proximité

les axes majeurs et l’ouverture au nord du canal

le parc urbain, centralité du projet

les «étendues» et les «stations» : échelle territoriale et échelle urbaine

le réseau viaire : éléments de transversalité est-ouest

la trame de gestion des eaux pluviales

le drapé et la plaine, les places et les jardins publics

Site intercommunal de l’Union - Plan Directeur 45


2

LES STRUCTURES VÉGÉTALES ET GESTION DU PARC

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


Les éléments de composition La trame verte est l’expression du jeu entre les dimensions urbaines et naturelles du paysage à l’oeuvre dans le projet. Elle distingue nettement le registre urbain du réseau viaire, accentue sa fonction d’accessibilité au site, sa lisibilité, par l’implantation systématique d’alignements dès que le gabarit de la voie le permet.

La prairie : - les groupements herbacés de type prairie sèche ou prairie fleurie : linum perenne / lin, anthemis, achillea, agrostema, papaver / pavot. - les tapis de graminées : pennisetum villosum, luzula nivea, agrostis et poa en mélange, gaura, festuca / fétuques.

Dans ce registre, les axes nord sud qui constituent les éléments de continuité, à l’échelle du projet, entre les secteurs nord et sud de part et d’autre du canal, sont des repères forts avec leurs alignements hauts de platanes. Les voies orientées est ouest, éléments de transversalité inscrits dans une échelle de proximité, sont caractérisées par des alignements d’érables de seconde et troisième grandeur.

La lisière : - arbres : Erable / acer campestre, Peuplier banc / populus alba nivea, Frêne / fraxinus angustifolia

Pour le reste, l’ensemble des espaces publics est marqué par le registre naturel à travers 3 thèmes principaux : le bois, associé sous la forme d’une frange aux ensembles bâtis, la ripisylve, associée aux berges des noues et des bassins, et la prairie, étendue par excellence. Un quatrième thème est proposé, la lisière, dans le cadre de préconisations sur les parcelles privées, en limite est du domaine RFF, qui contribue à la qualification du site à partir du parcours tram-train, autre accessibilité majeure.

Gestion d’entretien

La palette végétale Principalement adaptées au climat local, les essences choisies composent des paysages variés. La palette de la strate arborée décline un intérêt ornemental quant à la floraison (à dominante blanche) ou au feuillage (marcescence, impact visuel de la couleur selon les situations - gris et blanc en bord d’eau - ou les saisons).

Pour une gestion "durable" La conception globale du projet et ses formations végétales offrent des réponses concrètes pour favoriser la biodiversité locale de l’aménagement, et sa continuité biologique avec les rares «espaces à caractère naturel» existants sur le site - berges du canal à l’ouest du Boulevard Gambetta, espaces verts urbains telle la vaste emprise des jardins ouvriers. L’entretien nécessaire est limité au strict minimum, dans un souci de gestion cohérente et économe de la trame verte. Les strates végétales sont précisément définies selon la hauteur adulte des espèces et selon leur densité optimale à terme. Une gestion différenciée selon les strates végétales

Le registre urbain Les arbres d’alignement : - le boulevard de l’Union : Alisier blanc - les axes nord sud : Platane - les voies est ouest : Erables / acer rubrum «October Glory», acer rubrum "Schlesingeri"

Les alignements : Le choix d’un nombre réduit d’espèces vigoureuses facilite leur entretien ultérieur. Sauf interventions habituelles de nettoyage de houppier et de remontées progressives de couronne selon les gabarits de circulation, le futur gestionnaire n’aura pas de frais spécifiques liés aux alignements.

Le registre naturel La frange boisée : - arbres feuillus : Chêne blanc / quercus alba, et de Bourgogne / cerris, Frêne / fraxinus angustifolia, Hêtre commun / fagus sylvatica - résineux : Pin sylvestre / pinus sylvestris

Les boisements : L’entretien se limitera également à des opérations maintenant l’équilibre naturel des massifs boisés. Recépage et éclaircie peuvent être envisagés tous les huit à dix ans selon des techniques de taille douce, une priorité sera donnée au respect du port naturel de l’arbre. (d’après les préconisations du document Analyse Environnementale sur l’Urbanisme du 24 Octobre 2002 / Lille Métropole et Communauté Urbaine)

La ripisylve : - arbres : Peuplier banc / populus alba nivea, ou Grisard / canescens, Aulne glutineux / alnus glutinosa, ou de Corse / cordata, Frêne / fraxinus angustifolia, Saule blanc / salix alba , et Marsault / caprea, Chêne des marais / quercus palustris - arbustes : Cornouiller blanc / cornus alba, et Mâle / mas, Saule blanc / salix alba, Viminalis, et Romarin / rosmarinifolia - groupement herbacé de milieu humide : Renouée / polygonum, Massette / typha latifolia, Laîche pendante / carex pendula, Joncs des chaisiers / scirpus lacustris

Les prairies : Simplement enherbées, les prairies rustiques sèches et semi-humides (Plaine et Drapé) ne sont fauchées qu’une à deux fois par an, et chaque année à la même période. On bénéficie ainsi de la colonisation d’espèces sauvages pour favoriser la biodiversité. Les noues : Le projet nécessite une fauche tous les deux à trois ans en hiver afin de ralentir le phénomène d’affermissement. Dans la mesure où l’on voudra ralentir l’extension des plantes hygrophiles, il sera procédé en différents endroits à une opération de faucardage qui consistera à faucher les plantes sous le niveau de l’eau en août/septembre. (d’après les préconisations du document Analyse Environnementale sur l’Urbanisme du 24 Octobre 2002 / Lille Métropole et Communauté Urbaine)

Site intercommunal de l’Union - Plan Directeur 47


3

LES LIEUX ET LES USAGES localisation des usages sur le site de l'Union

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


JARDINS FAMILIAUX

PLACE DU MARCHE DE L'ALMA

PLACE DE TERKEN

PLACE HAUTE

PLACE DU MANEGE

PLACE DE LA TOSSEE

ESPLANADE

PLACE DE LA MAISON DU PARC

DRAPE

Les «étendues» et «stations» du drapé et de la plaine répondent pleinement à cette dominante, en combinant grands espaces ouverts et petites aires protégées et contrôlées.

PLAINE

L’organisation du parc est ici principalement orientée par les pratiques urbaines sportives, et les usages de loisirs liés au canal.

jeux

La place de la maison du parc, au nord de la plaine, est un espace public de centralité, à la jonction des anciens et nouveaux quartiers, et associée à la nouvelle école.

La place de la Tossée est un parvis de présentation et de valorisation du site historique.

marché

DE PROXIMITE

L’esplanade des rues de Roubaix et de Tourcoing est équipée de kiosques (presse, restauration rapide…) et accueille les activités ponctuelles de marchés et brocantes.

sport

La place du manège est un lieu d’articulation pour la plaine et le drapé, marquée par la vocation de loisir.

jardins publics

jardins familiaux

manège

La place haute est une porte belvédère. kiosques

L’ilôt du gymnase Rossini est traité comme un square / parvis, c’est une nouvelle centralité pour le secteur sud est du projet. Les jardins thématiques développent un aspect pédagogique et ludique, en correspondance avec la spécificité du pôle d’excellence, le textile et l’image, et les problématiques d’écologie urbaine à l’œuvre dans le projet. Les jardins familiaux conservés sont légèrement réorganisés de façon à améliorer leur accessibilité pour l’ensemble du quartier.

NAUTIQUES / TOURISME

La place du marché de l’Alma est une nouvelle centralité pour le secteur sud ouest du projet.

DE LOISIR / AIRE VILLE

La place de Terken est un parvis de présentation et de valorisation du site historique. restaurants

skatepark

tour d'escalade

quai d'amarrage

accueil fluvial

postes de pêche

Site intercommunal de l’Union - Plan Directeur 49


4

LE DRAPÉ coupe et plan sur les espaces du drapé - échelle : 1/200ème

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


L’échelle du Drapé est à la mesure du territoire du canal. Le modelé de cet espace de grande envergure décline un jeu de volumes «déliés» qui animent des prairies partiellement inondables. Ces «andains» enherbés, aux pentes souvent abruptes, dessinent le plissé, motif caractéristique du drapé. Ce dispositif offre des parcours inattendus et des lieux d’intimité.

ondulations du plissé

liserés fleuris des ondulations

les prairies inondables dans le plissé

La plasticité du modelé force par contraste la ligne construite du quai, mise en valeur par un surplomb. Le quai est le lieu des animations nautiques, culturelles, festives (halte nautique, quais d’amarrage, postes de pêche, restaurants, guinguettes) et propose un terrain d’évolution privilégié pour la glisse (roller, skate). Il accueille notamment un vaste «bowl», intégré aux aménagements du quai. Il constitue un véritable lien paysager actif et continu. Le drapé est un espace de promenade, de loisir et de détente, qui offre toute une palette d’ambiances, des parcours exposés du quai aux creux intimistes du plissé.

Les jardins thématiques cheminements dans le drapé

Ils sont à vocation pédagogique et ludique. Ce sont de petits lieux qui offrent une certaine densité physique, qui sollicitent les différents sens et multiplient les expériences. Ils développent le thème de la biotechnologie au service du développement durable, et spécifiquement les champs qui se rattachent à l’identité du site : dans le domaine du textile d’une part et de la maîtrise de la polllution d’autre part. Ils présentent des collections et donnent à voir des process actifs. En particulier, ils introduisent un degré d’évolutivité et de renouvellement, à confronter aux aspects «pérennes» du projet paysager du site de l’Union. Ce sont des jardoins éducatifs mis en oeuvre dans une démarche plasticienne, qui combinent jeu et savoir. Pêle-mêle : des toiles et des voiles, des cultures d’implants, des récoltes en compost, des fibres en capilotade, des serres laboratoires...

différentes valeurs des quais du drapé

le long du canal de Roubaix

aménagements du quai

jardin thématique Site intercommunal de l’Union - Plan Directeur 51


5

LA PLAINE coupe et plan sur les espaces de la plaine - échelle : 1/200è

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


La plaine étire l’espace ouvert du drapé au cœur du tissu urbain tout en trouvant sa propre dimension dans la médiation du privé au public. Une frange boisée compose avec la limite bâtie et ménage le passage à la grande étendue de la prairie fleurie, elle dessine de larges échancrures favorisant une certaine porosité. La prairie descend doucement jusqu’à la rue de Roubaix, contenue par une vaste esplanade plantée qui forme une sorte de retour du quai.

espaces ouverts de la plaine

La frange boisée abrite des clairières qui accueillent des chambres de verdure, des aires de jeux pour enfants et des terrains multi-sports, répondant à des usages de proximité.

jeux et espaces sportif dans les clairières

la place publique au nord de la plaine La place de la maison du parc introduit une modulation du vocabulaire de la plaine : la frange boisée côté ouest assure la continuité avec le nouveau front bâti, prolongeant l’identité du parc, et un filtre végétal côté est permet de requalifier la rive bâtie existante tout en ménageant une transition des usages entre desserte résidentiellle et place urbaine de quartier.

1

3 2

1

2

arrières des maisons, rue de la Tossée vue sur la chapelle

plan de situation et photos de l’existant

3

rues de la Tossée et Roubaix-Tourcoing

axonométrie de la place publique Site intercommunal de l’Union - Plan Directeur 53


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


Plan bleu

5

1. L’EAU DANS LE NOUVEAU QUARTIER DE L’UNION............................................................56 2. LES PRINCIPES D’ASSAINISSEMENT DES EAUX PLUVIALES.................................................57 LE SECTEUR NORD (TISSU NOUVEAU) LE SECTEUR SUD (TISSU EXISTANT) 3. LA HALTE FLUVIALE..................................................................................................64

Site intercommunal de l’Union - Plan Directeur 55


1

L’EAU DANS LE NOUVEAU QUARTIER DE L’UNION

La trame de gestion des eaux pluviales par l’hydraulique douce est une composante essentielle du projet. La présence de l’eau en site urbain est un élément de valorisation exceptionnel, par l’attractivité indéniable qu’elle provoque, d’autant plus forte qu’il s’agit ici d’un paysage d’eau soumis aux variations météorologiques. Cette temporalité crée de l’évènementiel. Cette présence introduit également le vocabulaire particulier des modes d’accessibilité qui lui sont attachés : passerelles, bevédères, pontons… La sécurisation des bassins est naturellement assurée par le profil doux des berges, qui ne présente pas de hauteur de chute critique. Les berges abruptes sont elles sécurisées par un garde-corps. Les milieux humides liés aux noues et bassins de rétention offrent un milieu riche, propice à développer l’observation.

les bassins : plan d’eau permanent

les noues : écoulement des eaux pluviales

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

les zones d’expansion occasionnelle des les zones d’expansion fréquentes des bassins bassins

les passerelles, belvédères, pontons...


2

LES PRINCIPES D’ASSAINISSEMENT DES EAUX PLUVIALES

schéma de localisation et de fonctionnement des bassins versants

BVD

BVE1 BVC

BVE2

BASSIN C2

BVB BASSIN C1

BASSIN B

BV9 BVA

BASSIN A

BV8

BV4

BV2

BV7 BV

bassin versant bassins de rétention des eaux

BV1

BV6

BV3

conduites conduites sur parcelles privées conduites hors périmètre noues

BV5

ouvrage de régulation ouvrage de prétraitement

Site intercommunal de l’Union - Plan Directeur 57


LE SECTEUR NORD 1. Contexte et principes Le périmètre du site de l’Union au nord du canal a été décomposé en 6 entités différentes caractérisées par leur homogénéité topographique et/ou par leur homogénéité liée au mode d’occupation des sols. Des infrastructures importantes (existantes ou projetées) ont également été utilisées pour délimiter ces zones. Entités

Situation

Exutoire des eaux pluviales

Commentaire

1- Ouest voie SNCF

Entre SNCF et Bd Gambetta

Régulation des débits dans les lots et rejet vers le bassin A : Exutoire du bassin A = Canal en aval de l’Ecluse de l’Union

Régulation à l’intérieur de chaque lot / gestion des EP par techniques alternatives – dispositif de régulation à définir à l’intérieur du lot : rejet 2l/s et par ha

2- BVA

Entre SNCF et rue de Nantes – Partie sud

Nouvelle canalisation sous rue de Nantes puis bassin de rétention A

Régulation des débits dans bassin A et complément dans bassin B

3- BVB

Entre SNCF et rue de Tourcoing – Partie médiane

Nouvelle canalisation sous rue de Nantes puis sous rue du Parc + noue le long de la rue du Parc – rejet dans le bassin de rétention B

Régulation des débits dans bassin B – évacuation du débit régulé vers le bassin C1

4- BVC

Périmètre nord entre SNCF et Rue de Tourcoing + périmètre sud entre le canal et la « Serpentine » Secteur du TERKEN

Nouvelle canalisation sous rue de Nantes puis sous rue du Parc puis sous la rue de Tourcoing + noue le long de la rue du Parc – rejet dans le bassin de rétention C1

Régulation des débits dans bassin (C1+C2) – évacuation du débit régulé vers le canal

5- BVD

Secteur de la Tossée

Régulation dans le lot Régulation à étudier à puis rejet dans le l’intérieur du lot : rejet 2l/s bassin C1 / Exutoire final et par ha = Canal

6- BVE

Pointe sud-est de la ZAC

Régulation dans les espaces publics, puis rejet dans le Canal

Conformément aux prescriptions du service assainissement de LMCU et aux dispositions du PLU, les aménagements urbains sur le territoire communautaire doivent être accompagnés d’une régulation des débits. Cette obligation porte aussi bien sur les nouvelles surfaces imperméabilisées que sur les espaces existants lorsqu’ils sont réaménagés. La règle imposée consiste à limiter les débits en aval de ces zones urbanisées à 2 l/s et par ha géographique, avec maintien d’un débit constant jusqu’à l’occurrence décennale. Ces règles sont applicables quel que soit l’exutoire pour les eaux pluviales. Pour la partie nord du site de l’Union, il s’agira du canal de la navigation.

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


2. Calcul des volumes de rétention Méthodes et hypothèses de calcul La méthode de calcul utilisée est la méthode «des pluies», exposée dans l’Instruction Technique relative aux réseaux d’assainissement des agglomérations. Cette méthode prend en compte : • la surface S de la zone à réguler, • le coefficient de ruissellement C de la surface, • le débit régulé pris en compte Qr, (Qr = S x 2) • la période de retour, T : ici T = 10 ans • les caractéristiques de la pluviométrie locale ou régionale. Nous considérons ici les données pluviométrie de la Région 1 telles qu’elles ont été considérées dans l’Instruction Technique. La définition des volumes à stocker pour l’occurrence décennale passe alors par le calcul successif : • des surfaces effectives de ruissellement Se = S x C, • des débits spécifiques de régulation q = Qr/Se en l/s par ha effectif, • des volumes spécifiques à stocker (v) en m3 par ha effectif en fonction du débit spécifique et de l’occurrence (voir abaque extrait de l’Instruction Technique ci-jointe), • et enfin des volumes à stocker pour la surface V = v x S x C, en m3. Les coefficients de ruissellement traduisent le taux de l’imperméabilisation du bassin versant. Pour le secteur de l’Union, compte tenu des intentions des urbanistes telles qu’elles sont traduites dans le plan masse, les coefficients de ruissellement ci-dessous ont été pris en compte : - secteur entre la voie SNCF et la rue de Nantes (La Plaque) : C10=0.85 : forte imperméabilisation en relation avec la vocation de cette zone pour l’activité, avec une grande surface dédiée aux stationnements, - secteur entre les rues de Nantes et du Parc : C10 = 0.55 : imperméabilisation modérée liée au programme de logements dans ce secteur, - La Tossée : C10=0.80 : occupation du sol dense, - secteurs à l’ouest de la SNCF : C10=0.80 : forte imperméabilisation de ces espaces urbains, - le Parc et le Drapé : C10=0.30 : imperméabilisation très faible de ces espaces verts. - secteurs au sud du canal : C10=0.60 : imperméabilisation relativement forte de ces secteurs denses.

Détermination des volumes de stockage pour chaque BV Le tableau ci-dessous récapitule, pour les bassins versants au nord du canal, les données hydrologiques et fournit les principales données hydrauliques à prendre en compte pour le dimensionnement des ouvrages de rétention. Bassin versant

Coef. de Surface du Bv Ruissellement (ha) (C10)

Débit total (quota 2l/s.ha)

Surf. effective (ha effectif)

Débit Spécifique (l/s.ha eff)

Volume spécifiques (m3/ha eff)

Volume à stocker V10 (m3) l

A

4.4

0.85

8.8

3.74

2.35

340.00

1 272.00

B

7

0.62

14

4.34

3.23

320.00

1 389.00

C

18.5

0.6

37

11.1

3.33

310.00

3 441.00

D

7

0.8

14

5.6

2.50

325.00

1 820.00

E

5

0.5

10

2.5

4.00

280.00

700.00

Ouest SNCF TOTAL

14.5 56.4

0.8

29 112.8

11.6 38.88

2.50 17.91

325.00

3 770.00 12 392.00

Caractéristiques hydrauliques du dispositif de régulation des EP au nord du Canal

Sur ces bases, le débit rejeté dans le Canal à l’aval de l’Ecluse de l’Union est de 112.80 l/s. LMCU devra donc établir une demande d’autorisation de rejet dans le canal pour un débit de l’ordre de 120 l/s. L’étude menée actuellement par VNF sur le fonctionnement hydraulique du canal devra intégrer cet apport constant au nord du canal dans les différentes simulations. Le rejet dans le canal présente l’avantage de réduire le rejet d’eaux claires dans le réseau unitaire et dans l’Espierre. Cette disposition est de nature à contribuer à optimiser le fonctionnement de la station d’épuration.

Le découpage des bassins versants concerne le plus souvent plusieurs de ces surfaces homogènes ; le coefficient de ruissellement global du bassin versant est le résultat d’une somme pondérée des surfaces partielles et des coefficients de ruissellement correspondant. Les coefficients de ruissellement retenus sont : BV

Coefficient de ruissellement retenu

A

0.85

B

0.62

C

0.60

D

0.80

E

0.50

Ouest SNCF

0.80

Site intercommunal de l’Union - Plan Directeur 59


plans et coupes techniques des bassins de rétention bassin A , échelle 1/5000ème

bassin B , échelle 1/5000ème

coupes techniques sur le bassin A (échelle 1/100ème) coupe nord-sud

coupe est-ouest

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

bassins C1 et C2 , échelle 1/5000ème


3. Présentation des dispositifs proposés pour la régulation des débits dans les espaces publics Caractéristiques géométriques Les dispositifs de régulation des débits des BV D et Ouest SNCF ne sont pas aujourd’hui déterminés car ils seront intégrés dans les lots privés. La collectivité veillera néanmoins à faire respecter les conditions de rejet (volume stocké, débit de rejet, qualité des eaux) dans le bassin A pour le secteur à l’ouest de la SNCF et dans le bassin C1 pour le bassin versant D. La collectivité vérifiera également les conditions de réalisation et d’exploitation de ces ouvrages pour assurer la pérennité de leur fonctionnement. Les eaux des BV A, B, C et E sont en revanches recueillies dans des retenues implantées en domaine public. En réponse au projet urbain et paysager, le projet d’assainissement des eaux pluviales a privilégié la réalisation de retenues à ciel ouvert. Ce concept s’inscrit dans une cohérence générale qui s’articule autour de l’utilisation des eaux pluviales pour apporter une diversité et une originalité à l’espace. Les eaux sont ainsi dirigées naturellement vers le «Drapé» qui se développe autour des points bas le long du canal. Les dispositifs de rétention des eaux pluviales sont constitués de petites retenues intégrées au Drapé, le long de la Serpentine. Il s’agit de structures mixtes constituées de : - un plan d’eau permanent qui borde la Serpentine, - une zone d’expansion qui s’inonde et s’exonde en fonction du marnage. L’étalement des eaux se faisant vers le sud, c’est à dire dans le Drapé. Le tableau suivant résume les caractéristiques hydrauliques des bassins de retenue créés dans l’espace public.

Bassin de rétention

Niveau eau nominal (NN.NGF)

Niveau d'eau décennal (N10.NGF)

Niveau du fond mini (NGF)

Débit de rejet (l/s)

Exutoire

Surf. Plan Eau permanent (m2)

Surf au N10 (m2)

Capacité à N10 (m3)

A

33.00

34.00

31.80

37.80 (dont 29 l/s provenant du BV ouest SNCF)

Bassin B

385.00

1 510.00

885.00

B

31.20

32.20

30.00

(37.8+14)=51.80

Bassin C1

710.00

3 225.00

1 810.00

Le bassin A permet le stockage de ses besoins (1389 m3) et le stockage du déficit du bassin A (387 m3)

C=C1+C2

30.10

31.10

28.90

(51.8+14+37)=102.8 l/s (14.0 l/s issus du Bassin versant D)

Canal

550+560

3700+6200

4 775.00

Le bassin C permet de couvrir largement ses besoins (3440 m3)

10 l/s

Canal

E1+E2

Commentaire

Déficit = 387 m3 stocké dans le bassin B

Description et fonctionnement La création de ces bassins et des aires d’expansion nécessitera des travaux de déblais pour atteindre les profondeurs nécessairesau bon fonctionnement du réseau de collecte et garantissant le marnage. La création de bassins mixtes (partie en eau et partie inondable plus ou moins fréquemment) permet de tenir compte des contraintes hydrauliques tout en répondant au problème des pollutions par les eaux pluviales (effet de décantation et de dilution dans le plan d’eau). Par une conception écologique adaptée, ce type de bassins assure de bonnes conditions pour l’installation de milieux écologiques riches et diversifiés. On peut ainsi s’attendre à l’apparition d’une flore et d’une faune originales dans cette partie de la ville. La création de bassins mixtes (partie en eau et partie inondable plus ou moins fréquemment) permet de tenir compte des contraintes hydrauliques tout en répondant au problème des pollutions par les eaux pluviales (effet de décantation et de dilution dans le plan d’eau). Par une conception écologique adaptée, ce type de bassins assure de bonnes conditions pour l’installation de milieux écologiques riches et diversifiés. On peut ainsi s’attendre à l’apparition d’une flore et d’une faune « originales » dans cette partie de la ville. En fonction des conditions pédologiques et édaphiques des sols (berges sous eaux, berges imbibées, berges plus ou moins inondées, étendues soumises à l’alternance inondation-exondation, talus secs,…) la végétation s’installera suivant une zonation naturelle en relation avec ses exigences écologiques. Dans le choix des végétaux introduits pour amorcer la dynamique floristique, on veillera à l’équilibre des peuplements et on privilégiera les espèces rencontrées à l’état naturel au bords des ruisseaux, dans les étangs ou dans les zones humides de l’agglomération lilloise. Les dispositifs de régulation ainsi retenus sont donc constitués de bassins en eaux prolongés vers le sud par des aires inondables. En fonction de l’importance des pluies et donc de la rareté du phénomène pluviométrique, l’élévation du niveau d’eau dans les bassins concernera d’abord les plans d’eau : leur niveau augmentera au-dessus du niveau nominal d’équilibre. Cette augmentation se traduira ensuite par l’inondation progressive des terrains du Drapé. Pour l’occurrence décennale, le niveau d’eau dans les bassins augmentera de 1m par rapport au niveau d’équilibre. Les talus des plans d’eau présentent des configurations différentes en fonction de leur contexte urbain : - côté Serpentine, les talus sont réguliers (talus 1 vertical pour 3 horizontal), - côté est et ouest, les talus des bassins sont construits en gradines ou soutenus par des structures verti cales donnant à ces parties un caractère plus urbain. - côté sud, les talus «se perdent» dans le Drapé, ouvrant ainsi les bassins sur cet espace vert. Sous eaux, les talus sont d’abord très faibles pour permettre l’aménagement de risbermes de sécurité. Celles-ci présenteront à 3 m de la berge une hauteur d’eau de 0.50m. Sur une largeur minimale de 2 m hors eaux et de 4 m sous eaux (soit 6 m au total), les berges seront plantées d’une végétation hélophytes suffisamment dense ( 12 à 15 plants au m²) pour assurer : - un rôle d’anti érosion (effet du clapot), - un rôle écologique (flore, refuge pour la faune…), - une dépollution des eaux par prélèvement des nutriments contenus dans les eaux pluviales, - un effet dissuasif pour contrôler l’approche de l’eau.

Site intercommunal de l’Union - Plan Directeur 61


4. Les exutoires

5. Les ouvrages hydrauliques

Le canal de Roubaix constitue l’exutoire final des bassins réalisés au nord du Canal (Ouest SNCF, A, B, C, D et E). Le rejet régulé cumulé est ainsi de 112.80 l/s. Les bassins Ouest SNCF, A, B, C et D étant en série, les rejets se cumulent d’un bassin à l’autre. Le débit régulé du bassin ouest SNCF transitera par le bassin A via une canalisation à poser sous la SNCF. Le rejet du bassin A transitera par une canalisation DN800 mm posée le long de la Serpentine avant de rejoindre le bassin B. Cette canalisation véhiculera également le débit de la surverse qui permettra le transfert du déficit du bassin A vers le bassin B. Le rejet du bassin B rejoindra le bassin C1. Celui-ci étant en communication avec le bassin C2 par une canalisation DN1000. Ce grand diamètre de la liaison entre les bassins C1 et C2 est justifié par la nécessité d’assurer un transfert quasi instantané entre les deux parties du bassin C. Une autre branche provenant du nord alimentera le bassin C2 par le rejet régulé du bassin versant D (La Tossée). Le rejet final se fera à partir du bassin C2 par une canalisation DN800 posée parallèlement au cheminement piéton qui traverse le Drapé. Le rejet se fera dans le canal en aval de l’écluse de l’Union. Les conditions de rejets (niveau, orientation,..) se feront dans le respect des exigences formulées par les services de la Navigation. L’accès pour entretien de la conduite DN800 se fera par le chemin piéton qu’elle longe. Le gabarit et la structure de ce chemin seront adaptés à cet usage. Suite à la demande des Services de la Navigation le rejet dans le canal pourra être interrompu si le niveau d’eau dans le canal est trop important. Les principes suivants ont ainsi été arrêtés : - rejet dans le canal si le niveau d’eau dans celui-ci est inférieur au niveau des (Plus Hautes Eaux Navigables) PHEN, soit NNN + 30 cm, (30.32 + 0.30 = 30.62), - arrêt du rejet dans le canal et rejet dans le réseau public lorsque le niveau est supérieur aux PHEN

Les ouvrages de décharge Chaque bassin de régulation (aussi bien à l’intérieur des lots privés que dans les espaces publics) sera équipé à sa sortie, d’un ouvrage de régulation du débit qui sera calibré en fonction du débit de rejet nominal du bassin versant, à savoir 2 l/s et par ha L’appareillage de régulation est choisi pour maintenir le débit à une valeur égale au débit nominal jusqu’à l’occurrence décennale et donc faire face à un marnage de 1,0 m. L’appareillage qui permet ces performances est un orifice de section variable muni d’un diaphragme mobile assujetti à la montée de l’eau dans le bassin par l’intermédiaire d’un flotteur disposé à l’extrémité d’un bras qui actionne le diaphragme. Ses performances devront être fiables et pérennes. A cet effet, le dispositif de contrôle de débit est choisi parmi les appareillages non sensibles au colmatage. Il sera installé dans un ouvrage en béton armé implanté à l’aval d’un seuil calé au niveau nominal du plan d’eau. L’ouvrage de régulation est complété par un seuil de sécurité intégré à l’ouvrage et calé au niveau décennal. Il permet l’évacuation des débits générés par les phénomènes exceptionnels et d’éviter ainsi toute submersion incontrôlée. Les ouvrages de prétraitement Aux débouchés des réseaux de collecte dans les bassins de rétention, on prévoira la mise en place d’un dispositif de prétraitement pour assurer la maîtrise des pollutions (chroniques et accidentelles) et protéger ainsi les plans d’eau et les zones humides attenantes. Ces dispositifs seront implantés en sortie des réseaux qui assainissent les zones « à risque » (parkings, zones fortement imperméabilisées, voiries à fort trafic,…). Les autres émissaires de collecte des eaux pluviales (notamment les noues) ne seront pas équipés d’ouvrage de prétraitement ; leurs rejets se feront à l’aval de ces ouvrages pour éviter la dilution des flux traités.

PS : NNN : Niveau Normal de Navigation

Pour respecter ces principes on procédera de la manière suivante : - Mise en place d’un jeu de deux vannes automatiques, l’une sur la canalisation DN800 débouchant dans le canal, l’autre sur un tronçon de canalisation raccordé au DN1400 mm existant le long du canal et débouchant dans l’Espierre, - Asservissement des vannes par un signal envoyé par le capteur du niveau d’eau du canal. Ce signal pouvant être doublé par un signal émis par un agent, - Sécurisation du dispositif automatique par une commande manuelle. Le rejet du sous bassin versant E sera fait directement dans le canal, indépendamment du rejet du bassin C2.

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

Les objectifs associés à ces ouvrages sont : - de retenir une part de la pollution chronique (matières en suspension et pollution associée, hydrocarbures, métaux, flottants) et protéger ainsi la qualité visuelle et écologique des bassins, - de traiter la pollution saisonnière issue des premiers flots d’orage et protéger les bassins de régulation contre la pollution concentrée en période sèche principalement, - de faire obstacle à une pollution accidentelle éventuelle grâce, à leur capacité de rétention des hydrocarbures. La possibilité d’isoler les ouvrages de traitement permet également de confiner une pollution miscible. Les ouvrages seront dimensionnés pour assurer le traitement au fil de l’eau des débits de période de retour de 4 mois. Ils seront équipés de by-pass amont qui permettent, aux gros débits, de contourner l’ouvrage sans entraîner ni mettre en suspension ou en émulsion les pollutions déjà piégées.


LE SECTEUR SUD 5. Fonctionnement en cas de crue exceptionnelle Les bassins de rétention du secteur de l’Union sont dimensionnés pour réguler les débits jusqu’à l’occurrence décennale de manière optimale. La régulation est obtenue par stockage des volumes ruisselés dans les bassins et leur restitution sous forme de faibles débits pendant de longues durées. L’élévation des niveaux d’eau par rapport aux niveaux d’équilibre (niveau nominal) est appelée marnage. Pour l’occurrence décennale, ce marnage est fixé de manière à ne pas perturber le fonctionnement des réseaux amont. Pour les 3 bassins du site de l’Union les niveaux s’établissent comme suit : Bassin A

Bass i n B

Bassin C ( C 1 + C2 )

Ni veau mo y e n du te rrai n n at urel (TN) en NGF

35.00

33.50

32.50

Niveau nomi nal du bassin en NGF

33.00

31.20

30.10

Niveau décennal en NGF

34.00

32.20

31.10

R e va n ch e e n t r e TN e t N 1 0 (m )

1.00

1.30

1.40

Le tableau montre que la rétention du volume décennal est faite avec des revanches importantes. Cette revanche permettra le stockage des volumes excédentaires en cas d’événements pluviaux plus rares que l’occurrence décennale. Le tableau ci-après donne les volumes à retenir dans les bassins pour les crues exceptionnelles : Bassin A Périodes de retour Su rface BV (ha) Coeff de ruissellement

1/10

1/20

1/50

Bas sin B 1/100

1/10

1/20

1/50

Les programmes d’urbanisation au sud du canal constituent des interventions sur le tissu existant par création ou adaptation de programmes existants. Conformément à la demande du service assainissement de la Communauté Urbaine, ces interventions devront s’accompagner d’une régulation des débits des différents lots, par application du quota de 2 l/s et par ha. Le réseau d’eaux pluviales existant au sud du canal constitue l’exutoire direct pour ces programmes. Ce réseau rejoint l’Espierre au nord du canal après la traversée de celui-ci par un siphon situé au niveau du rond point des Coteaux. Les dispositifs de régulation des débits de ces lots ne sont pas aujourd’hui déterminés car ils seront intégrés dans les lots privés. La collectivité veillera néanmoins à faire respecter les conditions de rejet (volume stocké, débit de rejet, qualité des eaux). La collectivité vérifiera également les conditions de réalisation et d’exploitation de ces ouvrages pour assurer la pérennité de leur fonctionnement. Nous identifions 9 lots qui correspondent à autant de BV partiels et qui devront être équipés de dispositifs de régulation spécifiques. Le tableau ci-dessous présente leurs principales caractéristiques ; le plan au 1/2000 en annexe situe ces BV. Le rejet de la partie sud dans le canal n’est pas envisagé aujourd’hui car les débits régulés des BV 1 à 9 sont repris dans des réseaux existants collectant des surfaces existantes non régulées. Cette éventualité doit pouvoir être envisagée à terme, lorsque la totalité du BV sud canal sera contrôlée par des ouvrages de régulation des débits. Dans ses études sur le fonctionnement hydraulique du canal à terme, VNF devra vérifier par simulation, la possibilité d’un rejet provenant du sud du canal pour permettre à terme, de décharger le réseau unitaire des apports EP de cette partie de l’Union.

Bassin versant

Bassin C (C1+C 2) 1/100

4.4

4.4

4.4

4.4

7

7

7

7

0.85

0.90

0.95

1.00

0.62

0.66

0.72

0.80

1/10

1/20

1/50

1/100

18.50 18.50 18.50 18.50 0.60

0.65

0.71

0.76

Volum es d e 1 270 1 660 2 010 2 600 1 389 1 700 2 200 2 700 3 441 4 450 5 800 6 180 rétention (m3) Surface au N10 1 510 3 225 3700 + 6200 = 9 900 (m2) Volume stocké ava nt d ébo rdement 1 510 4 192 13 860 (m3)

Le tableau ci-dessus justifie les conclusions suivantes : - le bassin A assurera le stockage d’un volume proche du volume vicennal (1/20), sa surverse devra être prise en compte par le bassin B situé en aval, - le bassin B (avec 4 190 m3 de capacité avant débordement) pourra faire face au phénomène centennal de son bassin versant tout en absorbant le déficit centennal du bassin A (soit 2600 – 1510 = 1090 m3), - la capacité maxi du bassin C (13 860 m3) est très largement excédentaire par rapport aux besoins aussi rares que centennaux (6 180 m3).

Coef. de Surface du Bv Ruissellement (ha) (C10)

Débit total (quota 2l/s.ha)

Surf. effective (ha effectif)

Débit Spécifique (l/s.ha eff)

Volume spécifiques (m3/ha eff)

Volume à stocker V10 (m3) l

1

1.84

0.65

3.68

1.196

3.08

315.00

377

2

0.69

0.65

1.38

0.4485

3.08

315.00

141

3

0.1

0.65

0.2

0.065

3.08

315.00

20

4

0.78

0.65

1.56

0.507

3.08

315.00

160

5

0.24

0.65

0.48

0.156

3.08

315.00

49

6

0.28

0.65

0.56

0.182

3.08

315.00

57

7

0.69

0.65

1.38

0.4485

3.08

315.00

141

8

1.91

0.65

3.82

1.2415

3.08

315.00

391

9

1.1

0.65

2.2

0.715

3.08

315.00

TOTAL

7.63

15.26

4.96

27.69

225 1 561.00

Il est précisé que le stockage de ces volumes exceptionnels dans les bassins créera des mises en charge des réseaux d’assainissement amont sans aucune inondation des surfaces assainies. Cependant, ces niveaux hauts pourraient occasionner l’inondation de points bas ou de niveaux inférieurs qu’il conviendra de prendre en compte au moment du calage des déférentes plate-formes. Site intercommunal de l’Union - Plan Directeur 63


3

LA HALTE FLUVIALE plan sur la halte fluviale (échelle : 1/2000ème)

La halte fluviale constitue un des éléments majeurs du drapé. Véritable intrusion d’un plan d’eau dans un espace de verdure, elle fait le lien entre les façades sur le nouveau boulevard du CETI, de la ruche d’entreprise et le canal. De plus, d’une superficie de 3 800 m² et d’une profondeur de 2 mètres, elle permet d’accueillir environs 25 pénichettes. Un bâtiment intégrant divers programmes d’accueil du public, des commerces, des restaurants et un hôtel vient la border à l’est . La darse constitue donc une véritable centralité tournée vers la détente et les loisirs avec ses quais aménagés à cet effet.

résèrve foncière pour la halte fluviale

images de références

coupe sur la halte fluviale (échelle 1/500ème)

35.00 NGF

35.65 NGF 33.87 NGF

BOULEVARD

DRAPE

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

DARSE

PASSERELLE PIETONS

CANAL

QUAI


phasage de la halte fluviale (échelle : 1/2000ème)

temps 0 et 1

temps 2

Dans l’attente des travaux de la halte fluviale, l’emplacement réservé à cet équipement pourrait être planté, permettant ainsi la continuité du drapé.

alternative à la localisation de la halte fluviale (échelle : 1/2000ème)

Une alternative à l’emplacement prévu pour la halte fluviale peut être envisagée. Localisée en front du bâtiment du C.E.T.I., elle jouerait un «effet miroir» et mettrait en scène l’esplanade d’autre façon autre. La plaque pourrait alors se poursuivre jusqu’au canal. L’îlot ouvert réalisé au sud constituerait un lieu de vie lié au canal.

Site intercommunal de l’Union - Plan Directeur 65


perspective de la «plaque»

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


Typologies

6

1. LES ZONES DE COUTURES URBAINES...........................................................................68 2. LES TÈNEMENTS INDUSTRIELS....................................................................................76 3. LES SECTEURS DE PLAN MASSE..................................................................................82 4. LES TYPOLOGIES ALTERNATIVES..................................................................................86 5. LES ÉQUIPEMENTS...................................................................................................92 6. LES EMBLÈMES........................................................................................................95

Site intercommunal de l’Union - Plan Directeur 67


1

LES COUTURES URBAINES : L’ÎLOT STEPHENSON projet en filaire sur photo aérienne (échelle : 1/1000ème)

Le secteur Stephenson est un ensemble de parcelles d’habitation qui constituent l’entrée Nord du site de l’Union. Desservi par les rues de la Tossée, de Nantes et Stephenson, cet îlot nécessite, dans le cadre du projet de renouvellent urbain du quartier de l’Union, une valorisation de l’existant. Le confortement et la restructuration de ce quartier se déclinent en 4 points : - l’ouverture de la rue Stephenson vers la rue de Nantes réaménagée, - la création d’une offre de logement adaptée en conservant et réhabilitant les maisons au droit des rues Stephenson, de la Tossée et de la Fonderie, et en construisant de nouveaux logements individuels et collectifs en alignement des voies existantes et nouvelles, - l’agrandissement des jardins au sud de la rue de Stephenson et à l’ouest de la rue de la Tossée, - la gestion des problématiques de stationnement et de pollution au sein de l’îlot.

E

ERI

A

EL

D UE

D FON

R

E

U

R E

D LA EE

SS TO

nature des propriétaires cadastraux sur l’îlot Stephenson

RUE

E

ED

E

DE

TO SS E

IX

LA

A UB RO

RU

ES ANT DE N

RU

N

O NS

E

H EP

E

E

ST

RU

RUE

DE TES

NAN 0

100

200

légende Etat foncier et avancement des négociations phasage des négociations contact acte signé

propriété foncière LMCU / Communes / CCI / autres institutionnels

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

0

10

20

30

40

50


VALORISER L’EXISTANT plan masse (échelle : 1/1000ème)

vue de la rue Stephenson

Le prolongement de la rue Stephenson

aujourd’hui...

La rue Stephenson est ouverte vers la rue de Nantes, permettant une meilleure desserte du secteur et une mise en valeur des maisons implantées de part et d’autre de la voie. Le gabarit de cette voie correspond à celui des voies urbaines de proximité, supports de desserte locale : la chaussée est réduite à 5,5 m, le stationnement est unilatéral, les trottoirs sont larges (de 2 m à 2,3 m) afin d’assurer le confort et la sécurité des piétons et des personnes à mobilité réduite.

...demain

les maisons individuelles

Le quartier Stephenson : un îlot de logements Les typologies de logement développées sur ce quartier -maisons individuelles et petits collectifs- sont fonction du contexte urbain.

Les maisons individuelles : réhabilitations et constructions neuves L’essentiel des maisons individuelles de cet îlot sont des maisons existantes qui seront réhabilitées. Quelques maisons nouvelles qui reprennent la volumétrie des maisons réhabilitées seront construites en continuité du tissu existant. La largeur des parcelles varie de 6 à 9 m selon leur localisation (limite séparative construite ou non). les logements collectifs

0

10

20

30

40

50

Les nouveaux logements collectifs Au droit des rues de la Tossée, Neuve et de Nantes, face à une école, aux bâtiments nouveaux d’activités et à une place minérale, est privilégiée l’implantation de petits collectifs. Ces collectifs ferment les angles de ce secteur. Le bâti est implanté à l’alignement au domaine public et en limite séparative. Site intercommunal de l’Union - Plan Directeur 69


plan des hauteurs

la de rue

Les alignements et hauteurs Les maisons sont implantées à l’alignement au domaine public et en limite séparative pour assurer une cohérence avec le tissu existant. Leur hauteur est comprise entre 6 m (type R+1) et 8 m (R+1+attique). Ces maisons peuvent accueillir plusieurs types de logements avec des surfaces variant de 100 m² à 160 m².

ie der Fon ru

e

de

la

To ss

ée

R+2 +att

au

h ép +

+ at 1 t

R +a +1 tt

R+2 +att

la

To ss

ée

Une nouvelle division du parcellaire et le changement d’affectation des espaces de garages permettent de redistribuer des espaces verts en fond de parcelle (18 jardins privatifs sont créés sur l’îlot).

1640 m²

e ru

St

h ép

so en

n

Tossée

R+2 +att

de

ée la Toss

r

St

Actuellement, les parcelles individuelles du secteur sont organisées de la façon suivante : le bâti en alignement sur rue, le jardin en fond de parcelle. Autant que cela est possible, nous avons souhaité retrouver ce principe.

rue de

ue

e

la rue de

R+1 +att

n so en R

ru

es Nant

es Nant

R+2 +att

Les bâtiments collectifs sont de type R+2 mais peuvent accepter un étage d’attique pour animer la ligne de ciel.

la de rue

Les espaces verts

ie der Fon

e rue d

e rue d

1

ve ni

plan des jardins

2200 m² R+2 +att

R+2 +att

uve rue Ne

Deux grands espaces verts collectifs (de 1640 à 2200 m²), sur lesquels chaque logement a une vue, sont réalisés en cœur d’îlot. De part et d’autre de la rue Stephenson, un passage vers cet espace vert privé est créé : il permet une ouverture visuelle du cœur d’îlot depuis l’espace public. La clôture de cet espace privatif peut être symbolisée par un système de haies en baïonnette formant des écrans décalés qui maîtrisent les vues.

uve rue Ne

coupe sur la rue Stephenson

aujourd’hui...

...après réaménagement

2,70

2,70

36.25

croisement rue Stephenson rue de Nantes

36.00

logements nouveaux

ouverture vers coeur d’îlot vert

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

35.50

logements individuels raccordés à l’existant

maisons existantes réhabilitées

35.00

jardin de poche

rue de la Tossée


plan des stationnements ie der Fon a l de rue

Le stationnement Etant donné que ce quartier est actuellement dans l’aire d’influence du métro et pourrait être desservi par la déviation du bus 21 (cf. chapitre viaire), le nombre de places de stationnement est d’une par logement qu’il soit collectif ou individuel.

20 pa

rk in gs

aé r

ie

ns

ru

e

de

la

To ss

ée

e rue d

52

27

parkings aériens

es Nant

places de stationnement en semi-enterré

16

ns

on ns

Tossée

S

rie aé

la rue de

e ru

e ph té

gs in rk pa

118

La nouvelle organisation de l’îlot induit une mutualisation des places de stationnement. Actuellement, le nombre de places de parking est insuffisant et, de plus, certaines de ces places sont transformées en jardins (environ 25 places). Au droit de la rue de la Tossée, une parcelle occupée jadis par la société Craye et Cie et, à priori, polluée (site nécessitant une EDR pour confirmation ou non du risque de pollution) peut accueillir le stationnement nécessaire à l’îlot nord. Les places de stationnement sur la rue Stephenson peuvent alors servir aux particuliers de l’îlot sud.

places de stationnement en semi-enterré

uve rue Ne

Les habitants des immeubles collectifs possèdent une place de stationnement dans un parking semi-enterré sous le bâtiment accessible depuis les rues de Nantes, Stephenson, la Tossée.

BILAN ILOT STEPHENSON Emprise au sol

:17

Logements Maisons réhabilitées

: 47 : 144 (140 appartements et 4 maisons) : 11 250 m² : parkings semi-enterrés (collectifs) mutualisation en cœur d’îlot aérien sur voie

Logements neufs SHON Stationnement

Espace public Voies existantes reprises Voie créée Espaces verts

630 m²

: 230 ml (rues Stephenson et la Tossée) : 95 ml (déviation rue de la Tossée) : 175 m² d’espaces verts extérieurs : 3 825 m² de jardins collectifs : 900 m² redistribués en 15 jardins privés

Site intercommunal de l’Union - Plan Directeur 71


1

LES COUTURES URBAINES : LE QUARTIER SAINT-JOSEPH

Le secteur Saint-Joseph, situé au bord du canal, est un quartier mixte avec son église, ses maisons, son école maternelle et son marché qui constitue l’entrée sud du quartier. La mixité de ses fonctions demande à être affirmée favorisant ainsi la proximité entre l’habitat, le commerce et l’emploi. Les espaces publics (voirie, espaces verts) assurant la cohérence des aménagements, doivent être restructurés de façon à lier les équipements du quartier. Le confort et la restructuration de cet ensemble d’îlots fera du quartier Saint-Joseph un véritable lieu de vie.

photo aérienne du quartier Saint-Joseph (échelle : 1/2000ème)

i de qua

que ker n u D r

ru e

Ch ris t

op he

ru

Co lo m

e

b

an Je rt Ba

ette

d’H all uin

u ing Gu de

Bo ule va rd

rue

la

e

de

Fr

ru

ru

ed

es

An

ge

s

groupe scolaire Blaise Pascal

an

ce

ru

e Va ll

on

Ja cq ua rd

église St-Joseph

ru

ed

el

aC

us

ru e

ha

e

0

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

50

100


plan masse du quartier Saint-Joseph (échelle : 1/2000ème)

plan des espaces publics et privés

Un nouveau maillage Les rues de la Guinguette et Jean Bart, axes structurants du quartier, sont reprises. La rue de la Guinguette, articulant l’église St-Joseph, le groupe scolaire Blaise Pascal, le futur terrain de sport de la Ville de Roubaix et la future place du marché de l’Alma, garde son statut de voie de desserte locale. L’espace public de voirie est valorisé par des plantations le long des voies. La rue Jean Bart est également reprise dans son tronçon nord et prolongée au sud pour rejoindre la rue Jacquard. Plantée sur toute sa longueur, elle sert d’appui au marché de l’Alma.

ru e

ZONES D’INTERVENTION

Je

PÏRIMÒTREDEPROJET

an

RÏSERVESFONCIÒRES

rt

Ba

rue

de

la

ng Gui

te

ESPACEBÊTI ESPACEDEVOIRIE ESPACEMINÏRAL ESPACEVERT

Privée : ESPACEBÊTI ESPACEVERT

ru

groupe scolaire

uet

Publique :

e

Je

an

Ba rt

église Saint-Joseph

0

50

100 Site intercommunal de l’Union - Plan Directeur 73


plan des hauteurs des maisons en bande

Une offre de logements adaptée Les typologies de logement développées sur ce quartier sont des maisons individuelles en bande en continuité du tissu existant (construction de dents creuses) et du tissu nouveau (nouveau front bâti sur la rue Bart prolongée) mais aussi de petits collectifs au droit de la rue Jacquard et sur les îlots nouveaux.

R+2

Les maisons en bande Les logements en continuité avec le tissu existant sont essentiellement des maisons en bande dont la trame parcellaire est d’environ 9 m. Les constructions s’alignent en 3 endroits : aux voies, en limite séparative et au nu de la façade de jardin. Les décrochés sont possibles au rez-de-chaussée pour l’intégration d’un garage au logement. Ces maisons peuvent accueillir plusieurs types de logements : du 3 au 5 pièces. La hauteur du bâti n’est pas supérieure à 2 étages (R+1 et R+2) et le couronnement devra être traité comme une ligne interrompue de pleins et de vides. En fond de parcelle, les jardins sont souhaités arborés, plantés, fleuris. Les clôtures sont traitées autant que possible par des dispositifs végétaux, arbres, arbustes, haies…

R+2 R+2

RdC

R+2

RdC R+2

R+1 àR+2

R+1 àR+2

R+1 à R+3

R+2

R+2

R+1 àR+2 R+1 àR+2

R+1 àR+2 R+1 àR+2 R+2

images de référence de maisons en bande

Les petits collectifs Le retournement et la fermeture de ces îlots de logements au droit de la rue Jacquard sont réalisés par des petits collectifs R+1 à R+2. Alignés sur la rue Jean Bart, d’autres collectifs accueillent des activités, commerces de proximité en rez-de-chaussée et deux étages de logements. A l’angle des rues de la Guinguette et Jean Bart, quelques collectifs R+2 avec jardin collectif intériorise l’îlot et répondent à l’opération de logements de la ville de Roubaix actuellement en cours. Maisons en bande, Trofaiac, Autriche, 2002, arch.H.Riess

30 maisons en bande, Amsterdam, Pays-Bas, 2000, arch.Claus en Kaan

principe d’organisation : rue/ bâti/ jardin

coupe sur une maison en bande

plan schématique de l’implantation des maisons en bande

jardin

alignement bâti R+2

jardin privé

maison

R+1 alignement sur rue

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


linéaire actuel du marché de l’Alma

linéaire projeté du marché de l’Alma

Une nouvelle organisation du marché de l’Alma Afin de redynamiser le quartier, une micro centralité, localisation privilégiée d’équipements et de petits commerces de proximité, sera créée. Une place constitue cette centralité autour de laquelle s’organise le linéaire du marché de l’Alma. Actuellement, le linéaire du marché de l’Alma est sur : - la rue de la Guinguette, - le parking au droit des rues de la Guinguette et Jean Bart, - la rue Jean Bart, - l’angle de la rue Jean Bart et du boulevard d’Halluin, - une partie de la rue de France.

coupe sur la place du marché

La réalisation d’un espace public accueillant une partie des commerçants du marché permettra de réorganiser son linéaire sur : - la rues de la Guinguette, - la rue Jean Bart, tout en répondant aux besoins des commerçants (leur besoin est estimé à 10 mètres linéaire par commerçant sachant que leur nombre est d’environ 170 en période estivale). Cette place d’environ 4 000 m² peut accueillir une halle de 1 400 m² permettant de recevoir d’autres activités en dehors des périodes du marché.

image de référence

BILAN ILOT ST-JOSEPH Emprise au sol

: 37

390 m²

Les logements SHON totale

: 13 265 m²

Logements neufs

: 110 (83 appartements et 27 maisons)

Stationnement

: parkings semi-enterrés sous bâtiment, en aérien sur voie, sur parcelle (garage dans construction)

vue de la halle de marché, Lyon, 2001, F.Jourda archi.

Espace public Voies existantes reprises Voies créés Place du marché

: 435 ml (rue de la Guinguette et rue Jean Bart) : 175 ml (rue Jean Bart sud) : 3 460 m²

Equipement Terrain de sport Halle

: 16 000 m² d’emprise au sol : 1 400 m² Site intercommunal de l’Union - Plan Directeur 75


2

LES TÈNEMENTS INDUSTRIELS :

LA TOSSÉE

La valorisation et la reconversion du site au regard du projet global ne peuvent se réaliser sans poursuivre l’histoire de cette « Cité intégrée » et polyvalente. Pour conserver cette identité, le site doit rester relativement compact et peu perméable, et doit accueillir une mixité de fonction. Son intégration au sein du projet d’aménagement se réalise en valorisant son environnement : mise en valeur des bâtiments de premier rang, intégration paysagère et création d’un espace public continu avec le tissu environnant.

Nous proposons d’établir une liste d’invariants de projets qui laissent le champ à des opportunités de développement aujourd’hui non déterminées. Ces invariants de projet sont les bâtiments conservés sur le site, l’armature des espaces publics et les valeurs de localisation. Les capacités du site peuvent être données à titre indicatif.

repérage des bâtiments conservés sur le site de la Tossée (échelle : 1/2000ème)

photos de l’existant conservé Logicil

1

N

4

2 chaufferie et pompe

2

Les bâtiments conservés Un diagnostic des bâtiments à conserver sur le site de la Tossée a été mené par l’équipe P. Bernard. Cette étude conduit à une proposition d’éclaircissement du site visant à rendre opérante l’organisation interne du site et à participer au paysage urbain. Les bâtiments conservés sont non seulement emblématiques pour la ville mais aussi structurants pour le site. Il s’agit : - des magasins et triages, - du nouveau peignage et de l’ancien lavage, - du magasin et des bureaux accolés, de la chaufferie et des pompes. L’emprise au sol de ces bâtiments est de 12 830 m² et sa SHON de 19 100 m².

4 1

5 3 magasin, bureau, hall d’arrivage

3

4 nouveau peignage et magasin - lavage

0

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

50

100

5 magasin 2


POURSUIVRE L’HISTOIRE DES «CITÉS INTÉGRÉES» ET POLYVALENTES plan masse (échelle : 1/2000ème)

détermination des espaces publics et privés

ZONES D’INTERVENTION PÏRIMÒTREDEPROJET RÏSERVESFONCIÒRES

Publique : ESPACEBÊTI ESPACEDEVOIRIE ESPACEMINÏRAL ESPACEVERT

Privée : ESPACEBÊTI ESPACEVERT

la Tossée

plan des valeurs de localisation

L’armature des espaces publics de voirie Le nouveau boulevard, axe structurant du site de l’Union tangente le site de la Tossée. Il donne ainsi une valeur de premier rang et une adresse aux bâtiments sud. Un second axe structurant est crée suivant le tracé de la rue correspondante à l’accès actuel des bureaux et passant au pied des pompes et de la chaufferie. Il permet non seulement de mettre en relation la Tossée avec l’école/crèche prévue sur l’ouest de la plaque et avec les jardins familiaux à l’est de la rue des Cinq voies, mais aussi de diviser l’îlot en 2 ensembles (à dominante résidentielle au nord et d’activités au sud). L’espace minéral au nord de la plaine a un rôle important d’articulation des deux entités que sont la plaque et la Tossée. Il participe à la mise en valeur de la maison de maître et des grands arbres qui constituent aujourd’hui le site Logicil. Un maillage de voies de desserte interne est envisagé dans l’îlot : - une rue nord-sud qui relie l’espace public et le nouveau boulevard en passant entre la chaufferie et les pompes, - une voie nord-sud qui passe entre les magasins et triage, - une voie est-ouest depuis la rue de Cinq Voies qui rejoint la rue Cadeau pour atteindre le nouveau boulevard ; la rue Cadeau s’efface alors au nord pour devenir un espace piéton articulé avec la place minérale de la plaine, L’armature des espaces publics de voirie assure la cohérence du développement urbain, la réversibilité des interventions, les continuités.

BILAN ILOT LA TOSSÉE : 66

Emprise au sol

110 m²

Réaffectation des bâtiments existants Emprise foncière : 16 980 m² SHON : 19 100 m² dont 35 logements (type lofts)

Programmes neufs Emprise foncière SHON

: 27 700 m² : 15 800 m²

dont 94 appartements et 9 maisons

Espaces publics de voirie Voies existantes reprises : 535 ml (rue Cadeau, voies internes) Voie créée : 220 ml (axe majeur est-ouest) : 1 820 m² (nord rue Cadeau) : 1 510 m² (placette) Programmes divers (SHON) Activités : 17 425 m² Tertiaire : 2 000 m² Recherche&Développement : 10 250 m² : 10 620 m² Services : 129 appartements et 9 maisons Logements : 1 160 m² (accueil du site) Equipement Espace minéral

Les valeurs de localisation

0

50

100

Certaines façades de bâtiments devront avoir un traitement particulier du fait de leur localisation, de leur lisibilité depuis l’espace public. C’est le cas des bâtiments au droit du nouveau boulevard et de la rue de Tourcoing , et ceux implantés le long de l’espace public magistral de l’îlot.

Site intercommunal de l’Union - Plan Directeur 77


2

LES TÈNEMENTS INDUSTRIELS :

TERKEN

Le site Terken a une position stratégique en bordure de canal. Son rayonnement est à l’échelle du site de l’Union. Il est aujourd’hui difficile de déterminer le devenir de Terken à long terme. Cependant, dans une première phase, cet espace peut être dédié aux sports et aux loisirs.

Nous proposons également d’établir une liste d’invariants de projets, au même titre que la Tossée, qui laissent le champ à des opportunités de développement. Ces invariants de projet sont les bâtiments conservés sur le site, l’armature des espaces publics et les valeurs de localisation. Les capacités du site seront données à titre indicatif puisque l’affectation du site n’est pas déterminée.

repérage des bâtiments conservés sur le site de la Terken (échelle : 1/2000ème)

photos de l’existant conservé halle Terken (vues extérieures et intérieures)

1

N

2 vue de la tour Terken

3 brasserie

1

Les bâtiments conservés Le diagnostic réalisé par l’équipe P. Bernard propose de conserver des bâtiments qui ont certes une valeur emblématique au sein du site mais «c’est surtout leur agglomération qui est remarquable». Ces bâtiments sont : - la tour Terken, - le bâtiment de stockage/embouteillage, - la malterie, - la brasserie, - une partie de la halle de stockage à court terme (une partie nord devra être démolie pour la réalisation du nouveau boulevard). L’emprise au sol de ces bâtiments est de 26 250 m² et la somme de leurs SHON de 11 700 m².

2 4

4 bâtiment des silos, nef et canneterie

3 0

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

50

100


plan de masse du secteur Terken (échelle : 1/2000ème)

emprise foncière constructible

détermination des espaces publics et privés

jardins familiaux

ZONES D’INTERVENTION PÏRIMÒTREDEPROJET RÏSERVESFONCIÒRES

Publique :

résèrve foncière de 5ha pour un équipement métropolitain

ESPACEBÊTI ESPACEDEVOIRIE ESPACEMINÏRAL ESPACEVERT

Privée : ESPACEBÊTI ESPACEVERT

plan des valeurs de localisation

halle conservée à court terme pour activités de loisir-sport

L’armature des espaces publics La servitude qui met en relation l’est et l’ouest du site, passe sous la Tour et sépare le site en 2 parties : - la partie nord divisée en une réserve foncière de plus de 5 ha qui peut recevoir un équipement métropolitain à long terme et offrir un usage temporaire à court terme : jardins familiaux, sports, loisirs… et une emprise constructible de 6 500 m² en front de boulevard qui peut accueillir des bureaux en relation ou non avec la fonction future de Terken. - la partie sud, plus bâtie, peut être réhabilitée et réaffectée à court terme ; son usage dépend des capacités techniques des bâtiments et des opportunités. Cette servitude est piétonnière sur l’essentiel de son parcours. Elle peut néanmoins recevoir un trafic automobile sur le tronçon est et permettre ainsi la desserte du site Terken et des Couteaux sud. Sur le secteur Terken, ce cheminement met en scène différents espaces publics : l’espace planté au nord de la malterie, le jardin thématique au sud de la halle Terken, le drapé et ses paysages. L’accessibilité nord au site se fait depuis le nouveau boulevard sur l’espace minéral du drapé ou en prolongement la rue des Cinq Voies. Le site est desservi au sud depuis le quai d’Anvers par deux voies : l’une entre la brasserie et la malterie et l’autre à l’est du bâtiment embouteillage.

usage temporaire : jardins familiaux, sport, loisir...

BILAN ILOT TERKEN

Les valeurs de localisation 0

50

100

Les abords du canal, la jonction avec l’espace minéral du drapé et la façade sur le nouveau boulevard devront être traités différemment.

Emprise au sol

: 73

300 m²

Réaffectation des bâtiments existants Emprise foncière SHON

: 26 150 m² : 11 700 m²

Espace public Usage temporaire de la réserve foncière Axe est-ouest piétonnier Axe est-ouest automobile

: 5 ha : 210 ml : 263 ml

Espaces verts proche ancien bâtiment embouteillage jardin thématique au sud de la halle

: 2 700 m² : 1 930 m²

Site intercommunal de l’Union - Plan Directeur 79


2

LES TÈNEMENTS INDUSTRIELS : VANOUTRYVE

Le site Vanoutryve regroupe un ensemble de bâtiments appartenant à la LMCU qui est destiné, pour la majeure partie, au pôle image. L’étude réalisée par l’équipe P. Bernard identifie dans un premier temps les bâtiments qui pourraient être conservés et établit un programme plus défini sur la totalité du site. repérage des bâtiments conservés sur le site de Vanoutryve (échelle : 1/2000ème)

photos de l’existant conservé teinturerie

Les bâtiments conservés

1

N

rue

Afin de rendre opérante l’organisation interne du site et de garantir une bonne contribution au paysage urbain, les bâtiments à conserver sont : - la teinturerie, - la retorderie, - la chaufferie, - le bâtiment des cartons, - le grand magasin et bureaux.

du Ca ain eA ub

1

bo

ul

ev

ar

d

De s

ca

t

ert

4

L’emprise au sol de ces bâtiments est de 51 580 m² et la somme de leurs SHON de 75 530 m².

2 retorderie

pit

3

2

3 chaufferie

4 bâtiment Jacquard

bo

ul

ev

ar

ru

d

e

d’

du

Ar

C

a

m en

ta pi

i

tiè

re

ne

s

A

e ub

rt

5

0

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

50

100

5

grands magasins


plan masse (échelle : 1/2000ème)

Processus d’évolution dans le temps étude Pierre Bernard architecte

L’armature des espaces publics

io

s

Un débouché sur les quatre faces de l’îlot lui garantit une excellente accessibilité. L’allée des studios permet un accès au site depuis les rues Corneille et du capitaine Aubert et le boulevard Descat et, connectée avec les espaces publics de voiries internes et traversants, constitue une bonne desserte interne. Cette ouverture de l’îlot cherche aussi à établir des liaisons vers le boulevard de la République et la station Alsace du métro.

e

de

s

St

ud

BILAN ILOT VANOUTRYVE

al

Emprise au sol

: 51

580 m²

Réaffectation des bâtiments existants Emprise foncière : 8 970 m² SHON : 21 990 m²

le pôle image

0

50

100

Programmes neufs Emprise foncière SHON

: 18 640 m² : 16 910 m²

Espaces publics Voies principales Voies secondaires

: 535 ml : 950 ml

Espaces verts

: 5 980 m²

Programmes divers (SHON) Activités : 3 000 m² Tertiaire : 12 120 m² Recherche&Développement : 10 250 m² : 9 260 m² Services : 50 (type lofts) Logements :1 Hôtel Site intercommunal de l’Union - Plan Directeur 81


3

LES SECTEURS DE PLAN MASSE : LE QUARTIER «COUTEAUX SUD»

Les «couteaux sud» est un secteur de développement d’une surface au sol de 2,7 ha qui prendra place à long terme dans un environnement requalifié. Il accueillera du logement qualitatif (environ 200 logements) autour de tapis verts : jardins familiaux, espaces verts de proximité. vue aérienne du site des «Couteaux Sud» (échelle : 1/2000ème)

plan masse du site des «Couteaux Sud» (échelle : 1/2000ème)

rd va ule Bo

le parc habité ux tea ou

sC

de

quai d’Anv ers

0

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

50

100

0

50

100


CONCEVOIR UN MORCEAU DE VILLE perception visuelle depuis le canal

plan des espaces publics ZONES D’INTERVENTION

Le parc habité est desservi par une voie connectée au boulevard des Couteaux (seul tronçon de l’axe est-ouest accessible aux voitures) qui contourne la parcelle et se branche sur le quai d’Anvers. Deux voies perpendiculaires desservent le cœur de l’îlot. L’organisation est-ouest des constructions sur la parcelle permet au piéton, selon sa position par rapport au canal, une lecture des façades en anamorphose et une lecture en profondeur. De plus, elle offre une vue partagée sur le canal depuis le cœur d’îlot.

PÏRIMÒTREDEPROJET RÏSERVESFONCIÒRES

Publique : ESPACEBÊTI ESPACEDEVOIRIE ESPACEMINÏRAL ESPACEVERT

Privée : ESPACEBÊTI ESPACEVERT

Accès et organisation

en anamorphose

Espaces verts La part paysagée de ce site est importante puisque l’emprise pour la végétation représente au moins 50% de la surface globale. En cœur d’îlot, de part et d’autre de l’Espierre, un bassin de rétention est programmé pour récolter les eaux pluviales. Ce bassin, exigeant un entretien, est un espace public piéton accessible depuis la voie nord-sud qui traverse l’îlot et depuis Terken. en profondeur

plan des hauteurs

Le bâti : implantation, volume, enveloppe Le parc habité offre une grande diversité de logements : des petits collectifs, des villas urbaines et un bâtiment emblème.

R+3

Les petits collectifs Ces bâtiments de type R+3 font front aux dessertes résidentielles. Ils peuvent être implantés en retrait (maximum 6 m) par rapport à la voie.

R+3

R+8max R+3 R+4 R+3

axonométrie des volumes du parc habité

R+8max

Les villas urbaines Ces bâtiments de type R+3 ou R+4 sont dispersés de façon aléatoire dans le cœur d’îlot. Ils sont conçus comme accueillant du «collectif familial» et imbriquent 4-5 grands logements (suivant l’organisation des logements en duplex ou non). La distance minimale entre deux villas ne peut être inférieure à 2/3 de la hauteur maximale de la façade, soit 9 m, les vues sur l’espace vert privé et l’entrée de lumière se prenant sur les 4 façades. Le bâtiment emblème Alignée sur le boulevard des Couteaux, la hauteur de cette construction peut varier de 4 à 9 niveaux. Bâtiment emblème orienté nord-est, il participe à la lecture rythmée du paysage urbain du site de l’Union.

BILAN ILOT COUTEAUX SUD Emprise au sol

: 27

300 m²

SHON

: 23 660 m²

Voiries Voies publiques créées Voies privées créées

: 196 ml : 162 ml

Espaces verts publics

: 6 730 m²

liés à deux bassins de rétention

Le stationnement Le stationnement devra être géré au maximum sur parcelle en parking semi enterré ou aérien. Une part des places de stationnement peut cependant être prise en compte dans le parking silo du futur «équipement métropolitain».

Logements (SHON) 3 Collectifs (100 appartements) 16 plots (64 logements) Bâtiment emblème (47 Logements)

: 9 040 m² : 10 370 m² : 4 250 m²

soit un total de 210 logements

Site intercommunal de l’Union - Plan Directeur 83


3

LES SECTEURS DE PLAN MASSE : LE QUARTIER «CUL DU FOUR» projet en filaire sur photo aérienne (échelle : 1/2000ème)

e e

ru

ru

Tu rg

m gra Wa rue

ot

lle uve no

Le maillage viaire est actuellement très serré. Afin d’améliorer la desserte et la lisibilité de l’îlot, les tracés des rues Rossini, Milton et Marengo seront modifiés au profit de 2 voies qui traversent l’îlot du nord au sud. La rue Rossini nouvelle permet, grâce à son alignement d’arbres et les aménagements paysagers, une meilleure lisibilité des espaces publics depuis les bords du canal vers le quartier résidentiel. Cette rue sépare une parcelle pouvant recevoir la salle de sport de la ville de Roubaix et une autre parcelle résidentielle. Le tracé de la rue Wagram est également modifié. cette rue se branche désormais entre les rues Meyerbeer et Rollin. D’un gabarit de 15 m, elle permet une séparation entre la fonction résidentielle de la parcelle ouest et la fonction d’activités à l’est. L’accès aux cours intérieures des parcelles d’activités se fait préférentiellement depuis la rue d’Iéna.

a

M

én

ey e

Accès et organisation sur l’îlot

d’I

rb

e

ee

ru

r

L’îlot du Cul de Four a une situation particulière sur le site de l’Union puisqu’il assure la jonction entre la bande d’activités/commerces qui borde le canal et le quartier sud résidentiel de la Ville de Roubaix. Son emprise au sol d’environ de 2 ha de ce secteur lui confère un statut de «mini-projets urbains» ayant à la fois une thématique et une logique interne et dialoguant avec son environnement. Ce morceau de ville doit donc être conçu avec sa logique de desserte, ses fonctions et ses typologies variées (équipement/logements/activités).

ru

e

Ro ss

in

in

ou

ve

ot rue Turg

lle

llin Ro e ru

0

50

100

coupe - élévation sur les différentes fonctions du Cul de Four (échelle : 1/500ème)

R+2 PONCTUEL

R+2 PONCTUEL

SALLE DE SPORT

rue Rossini nouvelle

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

LOGEMENT

45°

rue Wagram nouvelle

LOCAUX MIXTES

rue d'Iéna


CONCEVOIR UN MORCEAU DE VILLE plan masse du site du «Cul du Four» (échelle : 1/2000ème)

plan des hauteurs

La salle de sport

RdC

R+2 R+2

rue g Wa

R+1 à R+2

activités

ram

logements

uve

e

ss

in

R+1

in

ou

R+1 à R+2

R+2

lle

Ro

RdC

R+1 à R+2

no

ru

R+1 à R+2

+1

ve

R+2

RdC

La pratique des sports de combat et le fort taux d’occupation des salles et complexes sportifs du quartier nécessite la réalisation d’un nouvel équipement en remplacement de la salle Rossini. Les besoins sont : - un plateau omnisport qui pourrait être utilisé par les écoles environnantes, - une salle de sports de combat. Les surfaces nécessaires sont de 1800 à 2050 m². L’emprise de la parcelle ouest, de 18 850 m², permet ce programme. Un accès piéton à la salle peut se faire via la rue Rossini nouvelle plantée. Les automobiles pourront stationner sur les voies ceinturant la parcelle. Les activités

R+2

La parcelle Est est dédiée aux activités (filière image élargie). Avec une assiette foncière de 5100 m², le site est divisé en 2 parcelles d’activités mixtes de 1750 et 2500 m² de SHON proposant des locaux et des bureaux modulables. Les bureaux de type R+2 sont implantés à l’alignement de la rue Wagram nouvelle et offrent une façade «noble» aux maisons en bande. Les halles industrielles sont tournées vers les îlots d’activités qui jouxtent la parcelle. Leurs cours sont accessibles par la rue d’Iéna pour éviter des nuisances aux habitants du quartier.

lle

salle de sport

BILAN ILOT CUL DU FOUR 0

50

100

Les logements 13 700 m² sont dédiées à l’habitat sous forme de maisons individuelles et petits collectifs. Des venelles est-ouest permettent une perméabilité de l’îlot. Des maisons en bande sont implantées à l’alignement des voies Rossini et Wagram reprises. Une trame parcellaire de 9 m est souhaitée pour offrir la possibilité de construire des maisons R+1 et R+2 partiel, soit d’environ 200 m² de SHON. Les jardins en fond de parcelles sont jardinés de préférence et perceptibles depuis les quelques venelles qui traversent l’îlot. La séparation entre les parcelles privées sera traitéeau maximum avec des dispositifs végétaux. Des petits collectifs sont construits au nord et au sud de l’îlot. Implantés à l’alignement de la voie, ils ferment l’îlot et permettent une certaine intimité de son cœur vert. De type R+3, ils proposent 36 logements collectifs. Ces parcelles n’étant pas dans l’aire d’influence des transports en commun desservant le site, les places de stationnement doivent être au nombre de 1,5 par logement collectif et 2 par logement individuel. Concernant les maisons en bande, une place est au moins est intégrée à la parcelle (garage géré dans la construction), l’autre est disponible sur voirie. Le bâtiment collectif nord peut intégrer un parking enterré alors que les places de stationnement du bâtiment sud sont sur voirie.

Emprise au sol

: 18

560 m²

SHON

: 15 550 m²

Voiries Voies existantes reprises (rue Rossini nouvelle) (rue Wagram nouvelle)

: 112 ml : 143 ml

Voie créée

: 40 ml

Espaces verts

: 380 m²

Programmes divers (SHON) Activités : 2 300 m² et 4 290 m² Logements 36 logements collectifs : 3 300 m² 16 maisons : 3 670 m² Equipement Salle de sport : 1 800 à 2 000 m² Site intercommunal de l’Union - Plan Directeur 85


4

LES TYPOLOGIES ALTERNATIVES :

LA PLAQUE vue aérienne du site de la plaque (échelle : 1/3000ème)

LES GÉNÉRALITÉS SUR L’ENSEMBLE DE LA PLAQUE La plaque constitue le principal enjeu de la première phase de réalisation et l’outil de structuration du quartier. Cet espace central du site de l’Union bénéficie d’une excellente desserte : proche du métro, tram-train et TCSP. Il est composé de «typologies alternatives» qui intègrent des programmes variés –activités / tertiaire / logements / équipement- qui doivent pouvoir cohabiter par un principe urbain élaboré. Cette multifonctionnalité qu’offre la plaque doit également s’intégrer au tissu complexe environnant : - les voies ferrées et la plaine, 2 entités contrastées qui tiennent la plaque, - le Nouveau Boulevard qui donne une valeur de localisation aux bâtiments qui s’y adossent, - les quartiers d’habitat existants (quartier Stephenson).

ru e

de

la

Fo nd er ie

e rue d es Nant

s be r e sh e l a

eM ru rue

Me nin

0

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

50

100


INTÉGRATION DE PROGRAMMES VARIÉS DANS UN PRINCIPE URBAIN ÉLABORÉ plan de la trame urbaine

plan masse de la plaque (échelle : 1/3000ème)

La trame parcellaire

38.00

La plaque est découpée en îlots qui correspondent à la fois à des contraintes foncières et à des contraintes programmatiques. Le découpage des îlots est crée en suivant une trame parcellaire. Le respect de cette trame directrice est une prescription pour tout projet de la plaque car elle s’adapte à des principes de desserte qui permettent de rationaliser les emprises destinées à l’immobilier d’activités, de tertiaire et au logement. Cette trame est une succession de bandes qui correspondent à des parcelles de 48 mètres divisibles en 2*24 et séparées par 15 mètres de voies. Cas particulier : la première «bande», de part sa situation (vue depuis l’esplanade, la halte fluviale et le canal) diffère (35 mètres).

15 m 48 m 38.30

15 m

48 m

38.45

15 m 48 m

38.50

38.80

48 m 38.70

15 m 48 m

38.75

15 m

le quartier de l’ancienne gare

24 m 48 m 24 m

38.75

15 m 48 m 38.80

15 m 48 m

D’un point de vue de la maîtrise foncière, le dimensionnement des parcelles et le système de desserte rationnel permettent de débloquer des unités foncières cohérentes en terme de desserte et de capacité, au rythme des acquisitions foncières côté tertiaire / logements. D’un point de vue programmatique, le dimensionnement des parcelles permet une flexibilité de la taille des programmes à implanter. Par exemple : - pour les parcelles d’activités : un tènement constructible d’environ 17 000m² desservi par les rues transversales, ou 5 tènements d’environ 3 400m², ou 10 tènements d’environ 1 700 m²… - pour les parcelles de bureaux, 1 ou deux tènements desservis par la rue de Nantes et les rues résidentielles, avec des plateaux divisibles... - pour les parcelles de logements, la profondeur des parcelles permet d’implanter des logements individuels en bande avec jardinets en cœur d’îlots, ou des petits collectifs.

39.10

35 m 34.50

39.40 35.70 32.50

le C.E.T.I.

la ruche d’entreprise

le collège de Tourcoing 0

50

100

Site intercommunal de l’Union - Plan Directeur 87


plan des espaces publics et privés

Les espaces privés et publics

organisation de la plaque

Organisation sur l’îlot

ZONES D’INTERVENTION PÏRIMÒTREDEPROJET RÏSERVESFONCIÒRES

Publique : ESPACEBÊTI ESPACEDEVOIRIE ESPACEMINÏRAL ESPACEVERT

Privée : ESPACEBÊTI ESPACEVERT

La rue de Nantes, les voies résidentielles et la rue Neuve sont les espaces publics de voirie de la plaque qui desservent les parcelles de tertiaires et de logements. Les autres voies desservant les parcelles d’activités sont privées et donc à la charge des acquéreurs des lots. Les noues, le coeur des parcelles de logements qui demandent un entretien, sont à la charge de la collectivité.

délimitation de la plaque

L’organisation des fonctions de la plaque se fait suivant les espaces qui la bordent :

activités équipements publics

- Au sud, le nouveau boulevard Sur cette face, la plaque offre sa façade la plus emblématique et valorisante, ouvrant ses RDC aux espaces d’accueil accessibles aux piétons. Les programmes implantés sur cette façade participent à l’animation de l’esplanade, qui à terme recevra des programmes de service liés à la vie du quartier et aux entreprises, des programmes touristiques et hôteliers autour de la darse (restauration…).

tertiaire

PL17

recherche et développement logements

PL16

- Du nord au sud, la rue de Nantes, Prolongée jusqu’au Nouveau Boulevard, la rue de Nantes est l’axe de desserte majeur de la «plaque». La rue de Nantes marque la séparation entre les parcelles d’activités et les programmes mixtes tertiaire/logement.

PL14 PL15

PL12

uve rue Ne

PL10

PL9

p PL5

es Nant PL1+3

PL11

PL 8

e rue d

PL7

- A l’est des voies ferrées Les programmes d’activités occupent les parcelles comprises entre les voies ferrées et la rue de Nantes. Ils sont desservis par un système de voies privées connectées à la rue de Nantes.

PL13

PL6

PL4

RUCHE D’ENTREPRISES PL2

GB1

d oulevar

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

station

DP2

- A l’est de la rue de Nantes, les programmes tertiaire/habitat et l’équipement Les bâtiments tertiaires sont implantés le long de la rue de Nantes et forment un espace tampon entre les activités et les logements. Ils sont desservis par des voies résidentielles perpendiculaires à la rue de Nantes. Un équipement scolaire est envisagé sur la plaque. Cette école/halte garderie est destinée aux habitants du secteur. Son implantation est privilégiée à proximité des parcelles de logements et au sud de la rue Neuve afin de faciliter son accessibilité. - A l’est, le parc Les logements desservis par les impasses résidentielles s’ouvrent sur le parc. - Au nord, la rue Neuve marque l’articulation avec le quartier Stephenson.


La plaque multi-fonctionnelle est constituée d’une succession de bandes types constituées d’une parcelle d’activités, d’une parcelle de tertiaire et d’une parcelle de logements.

Cas particulier de la nouvelle ruche d’entreprise

vue axonométrique de la plaque multifonctionnelle

2

r+1

1

bureaux + ruche = 9 600 m² SHON

r+2

4

r+3

3

r+2 découpage de la plaque en bandes-types

Front bâ

ti sur b

+ align oulevard

ement

Plan de la ruche, 1/1000è stationnement bande active rue de Nantes

Implantation d’une nouvelle ruche d’entreprise «en tête» de plaque en bordure du Nouveau Boulevard avec une opération de bureaux.

bande mixte tertiaire logements

16 m

15 m 48 m 15 m voie de desserte

48 m

Intentions à respecter : - front bâti sur Nouveau Boulevard (R+2) avec bâtiment emblématique émergent (supérieur ou égal à R+3) - continuïté du gabarit tertiaire sur rue de Nantes (R+2) - possibilité de mutualisation des parkings

voie de desserte

15 m

stationnement

24 m

bande active

Localisation/accessibilité : - proximité du C.E.T.I. - tête de plaque - accessible via le Nouveau Boulevard et la rue de Nantes - en partie dans l’aire d’influence du métro, dans l’aire d’influence des futurs TCSP et tram-train - accès des véhicules sur rue de Nantes - accès piéton possible boulevard de l’Union

48 m

rue de Nantes

24 m

bande mixte tertiaire logements

24 m voie de desserte sserte serte

48 m 24 m

Parcelle et constructibilité : - emprise = 6 250m² - SHON = 9 600 m² - ratio de stationnement applicables : 1/70 Site intercommunal de l’Union - Plan Directeur 89


DÉTAILS PAR FONCTION

Chaque fonction -activité/tertiaire/logement- est traitée ci-après. NB : Le cas de l’école est traité plus particulièrement dans le chapitre équipement. Implantation du bâti

schéma d’implantation du bâti sur une bande type

Les parcelles dédiées à l’immobilier d’activités Les constructions seront implantées à l’alignement du domaine public, et à l’alignement en limite séparative. Cas particulier de la limite du domaine RFF : les constructions seront implantées avec un retrait de 16m minimum permettant l’implantation d’une bande de stationnement. L’implantation d’une lisière plantée entre les voies ferrées et les places de stationnement est à la charge de l’acquéreur des lots d’activités.

LAPLA

ESSERTE

D VOIEDE

DOMAIN

48 m

E2&&

Les parcelles dédiées à l’immobilier tertiaire L’implantation du bâti sera à l’alignement en limite séparative et à l’alignement de la rue de Nantes. Cas particulier de la parcelle dédiée à la ruche d’entreprise : les bâtiments de cette parcelle un peu singulière sont implantés sur deux limites séparatives au moins.

INE

15 m 16 m

15 m

Les parcelles dédiées aux logements Alors que les maisons en bande sont alignées au sud de l’espace public des voies résidentielles, l’implantation des petits collectifs nécessite un retrait de 2 m pour accueillir des places de stationnement en pied de bâtiment. La distance entre les collectifs ne doit pas être inférieure à la hauteur maximale de la façade. Les maisons en bande, construites sur une trame parcellaire de 9 m s’alignent également sur les limites séparatives.

implantation continue implantation discontinue

voirie publique et privée limite d’emprise limite de parcelle

Hauteurs La hauteur n’est pas limitée dans une bande de 35 m le long du nouveau boulevard, ni sur une bande de 48 m à l’angle de ce boulevard et de la la Plaine (bâtiments emblèmatiques). Les angles des rue de Nantes/Nouveau Boulevard, très visibles depuis le quai de Calais et le quai de Dunkerque (Voie Rapide Urbaine), la darse et le «drapé», recevront particulièrement un traitement valorisant et représentatif de l’ambition «pôle d’excellence» de la métropole lilloise.

schéma des hauteurs du bâti sur une bande type

Les parcelles dédiées à l’immobilier d’activités Ces parcelles accueillent des halles industrielles d’une hauteur d’environ 8 m et des bâtiments de type R+2 qui émergent et animent la ligne de ciel.

R+2 R

R R+2

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

références de maisons individuelles sur la communauté urbaine de Lille métropole

R

R+2

R+3

R+3

48 m

Les parcelles dédiées aux logements Les hauteurs des logements peuvent varier du R+1 à R+3 suivant la typologie du bâtiment : - les maisons en bande peuvent être construites avec 2 niveaux et un attique. Les toitures et les terrasses créent ainsi des variations dans la ligne de ciel, - les hauteurs des collectifs atteignent environ 11 m avec leurs 4 niveaux.

références d’immeubles collectifs

INE

E2&&

DOMAIN

Les parcelles dédiées à l’immobilier tertiaire Le nombre de niveaux des bureaux n’excède pas 3 au-dessus de la dalle du parking semi-enterré. Cas particulier de la parcelle dédiée à la ruche d’entreprise La hauteur du bâti qui fait front au nouveau boulevard s’aligne à celle du CETI. Le bâtiment qui ferme l’îlot au nord de cette parcelle accueille 2 niveaux, comme les bureaux de tertiaire. La situation et l’orientation du bâtiment emblème dont les vues s’ouvrent sur le parc admettent une hauteur plus importante d’environ 18 m, soit 5 niveaux.

16 m

R R+2

R+2 R+1 à

LAPLA

ESSERTE

D VOIEDE

15 m

R+2

R+3

R

15 m

bâti voirie publique et privée limite d’emprise limite de parcelle


Espaces verts

schéma des espaces verts sur une bande type

Aussi souvent que possible, le toit terrasse est végétalisé, assurant ainsi des fonctions thermiques et acoustiques. LAPLA

ESSERTE

D VOIEDE

Les parcelles dédiées à l’immobilier d’activités L’implantation d’une lisière plantée entre les voies ferrées et les places de stationnement crée un écran bas sur cette face qui offre une vision emblématique depuis le train et contribue au traitement des façades ouest.

INE

15 m 16 m

DOMAIN E2&&

Les parcelles dédiées à l’immobilier tertiaire En fond de parcelle, une bande de 5 m est plantée. Cette distance avec les premiers logements permet de limiter les vues directes depuis les bureaux et donc de créer une certaine intimité.

48 m

15 m

bande plantée alignement d’arbres coeur d’îlot vert

Les parcelles dédiées aux logements L’implantation des constructions permet de créer un cœur d’îlot vert important (environ 60% de l’emprise totale de la parcelle). Les maisons en bande possèdent des jardins souhaités arborés, plantés et fleuris orientés plein sud qui sont séparés les uns des autres par des dispositifs végétaux. Les collectifs profitent d’un grand espace vert privatif qui représente plus de 50% de la parcelle. Accès et stationnement

voirie publique et privée limite d’emprise limite de parcelle

plan des accès et stationnements sur une bande type ESSERTE

Les accès sur les parcelles quelque soit la fonction de la parcelle se font par des voies privés ou publiques (les rues résidentielles) perpendiculaires à la rue de Nantes.

LAPLA

D VOIEDE

INE

15 m 16 m

E2&&

DOMAIN

Le nombre de places de stationnement dépend de la proximité des transports publics existants et à venir. Etant donné que la plaque est située dans l’aire de stationnement de ce TC, les ratios des stationnements suivants peuvent être appliqués : - 1 place par 100 m² pour les activités, - 1 place par 70 m² pour les bureaux, - 1 place par logement (collectif et individuel).

48 m

15 m

accès stationnement accès bâtiment

Les parcelles dédiées à l’immobilier d’activités Une bande de stationnement sur parcelle privée est localisée à l’ouest des parcelles à l’alignement de la limite avec le terrain RFF, d’autres places de stationnement sont disponibles sur voirie et dans les cours de retournement.

stationnements extérieurs ou dans maison stationnements enterrés ou semi-enterrés

voirie publique et privée

Les parcelles dédiées à l’immobilier tertiaire Un parking semi enterré sous les bâtiments offre 25 places de stationnement, les autres places sont situées sur un parking planté aérien sur la parcelle. L’accès au parking se fait via une rampe d’environ 12% au sud du bâtiment Les parcelles dédiées aux logements La place de stationnement de chaque maison en bande est gérée sur la parcelle sous la forme d’un garage intégré au bâti. Des places supplémentaires sont localisées sur la voie résidentielle. Les places de stationnement des collectifs forment une «barrette» localisée au rez-de-chaussée des bâtiments. Cette barrette est en retrait de 2 m par rapport à la rue résidentielle pour permettre le recul des automobiles. coupe transversale sur un îlot résidentiel (1/500ème)

limite d’emprise limite de parcelle

BILAN LA PLAQUE Emprise au sol SHON Parcelles d’activités Emprise au sol SHON

: 110 260 m² : 15 550 m²

: 143 m² : 26 320 m²

45° R+2 PONCTUEL 11 mètres environ

Parcelles de tertiaire Emprise au sol SHON

: 7 725 m² : 9 000 m²

Parcelles de R&D Emprise au sol SHON

: 23 960 m² : 21 000 m²

11 mètres minimum

LOGEMENT

: 19 250 m² : 21 230 m²

soit 22 maison et 37 appartements (3 collectifs)

R+3 PONCTUEL

35.60 NGF

Parcelles de logements Emprise au sol SHON

35.50 NGF

rue résidentielle

GARAGE

35.40 NGF

LOGEMENT

Parcelles d’équipements Emprise au sol SHON

: 3 300 m² : 2 720 m²

Site intercommunal de l’Union - Plan Directeur 91


5

LES GRANDS ÉQUIPEMENTS :

LE COLLÈGE

L’implantation d’un collège est envisagée sur le site de l’Union. Cet équipement de quartier est prévu sur l’ancienne parcelle de l’entreprise Vanderperre.

plan masse du collège (échelle : 1/2000ème)

vue aérienne du site du collège (échelle : 1/2000ème)

La constructibilité La superficie de l’emprise est de 21 100 m². Le collège est composé de : - un bâtiment destiné aux salles de classe et annexes, - un réfectoire, - une salle de sport - une cour de récréation - 4 logements de fonction. L’ensemble atteint une SHON de 8 900 m².

600 m2 logements de fonction

Le site et le nivellement

36.50 37.00 37.50 38.00 38.5

Le site Vanderperre, qui a fait l’objet d’investigations des sols et de la nappe d’eau souterraine, est, à priori, banalisable. Cependant, il est recommandé d’effectuer un historique de la société locataire du site afin de déterminer la présence ou non d’infrastructures ou de produits qui auraient pu provoquer une contamination ultérieure à l’activité de Mory Combustible.

0 39.0

0

720 m2 0 .0 377.50 3

demi-pension

1 500 m2 terrain de sport 0 .5 41 50 0 0. .0 4 1 50 4 0 39. 0 0 . .5 40 38 00 . 39 0 .0 38

2

730 m 37.50 37.00 36.50 36.00

vestiaire - stockage

970 m2

37 .5 0

Le nivellement global du terrain, d’environ 38.50 NGF, implique une gestion du dénivelé par rapport au nouveau boulevard dont le niveau varie entre 32.50 NGF au niveau du passage sous voie et 37.10 NGF à l’intersection avec le boulevard Gambetta. Un tel dénivelé est déjà traité dans le projet du CETI par le bâtiment emblèmatique situé le long du boulevard ; la différence de niveau du terrain du collège peut l’être de la même façon.

gymnase

970 m2 gymnase

41.00 4 401.50 40 .50 .0 0 39.5

0 9. 00 3 0 38.50 8.0 3 0 37.50 7.0 3

0

50

0

100

50

100

Coupe-élévation sur le nouveau boulevard (échelle : 1/1000ème) 53.20 NGF 50.90 NGF

R+3

R+3

50.90 NGF

R+3 47.70 NGF

R+2

38.80 NGF 37.10 NGF

37.10 NGF existant

parvis- entrée piéton

38.80 NGF

pente piétons collège 3.9%

pente 3.6% 34.60 NGF

entrée-sortie PARKING

32.50 NGF

Bd. Gambetta

TERTIAIRE

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

COLLEGE

entrée-sortie PARKING

35.60 NGF

35.60 NGF

TRAM-TRAIN

32.50 NGF

pente 2.94%


Organisation sur parcelle

axonométrie sur le collège

Le bâtiment recevant les salles de classe est projeté à l’alignement du nouveau boulevard. Sa localisation nécessite une façade emblématique et valorisante, offrant un RdC accessible aux piétons. Ce bâtiment R+2 est le «pendant» du CETI : les voies ferrées forment un «axe de symétrie» entre ces 2 structures. Il serai souhaitable d’obtenir un vélum constant des hauteurs sur ces parcelles. L’espace sport -le gymnase, le vestaire-stockage et les terrains de sportest accessible à l’ouest de la parcelle en limite séparative. La demi-pension et sa terrasse, nécessitant des livraisons sont implantées à l’est de la parcelle le long de la voie 35t. La cour de récréation, d’une surface de 3000 m², est un grand espace libre entourée par ces bâtiments dont les hauteurs moyennes permettent un grand ensoleillement. Les 4 logements de fonction sont excentrés sur la parcelle du collège. Leur implantation au nord entre les voies ferrées et leur accessibilité par la voie 35t leur offre une certaine tranquillité et la possibilité de devenir indépendant à terme. Ces logements de fonction sont 4 maisons en bande de 150 m² environ (R+1/R+2 partiel) avec un jardinet de 60 m².

Accès au collège et stationnement Cet équipement profite d’une excellente desserte en transport en commun : à moins de 5 mn à pied de l’actuelle station de métro, du futur TCSP qui empruntera le nouveau boulevard et de la future station tram-train. Ses deux entrées piétons sont sur le Nouveau Boulevard : par un parvis mènant sur la cour ou dans le bâtiment (grâce à une rampe) et par un escalier donnant directement dans le bâtiment. Un accès réservé aux 35 t, aux pompiers et au personnel qui habite les logements de fonction est prévu au droit des voies sncf. Un parking semi-enterré accueillant environ 60 places de stationnement est construit sous le bâtiment en front du Nouveau Boulevard. Son accès se fait directement depuis ce boulevard de la même façon que l’accès au parking visiteur du bâtiment du CETI. Les logements de fonction intégreront leur place de stationnement (garage) au sein de la construction.

BILAN ILOT COLLÈGE Emprise au sol

: 21

100 m²

Programme neuf SHON

: 8 900 m²

Site intercommunal de l’Union - Plan Directeur 93


5

LES GRANDS ÉQUIPEMENTS : L’ÉCOLE

La réalisation du secteur «plaque» engendre la construction d’environ 60 logements. Pour satisfaire aux besoins de ce quartier et des quartiers de logements environnants, l’implantation d’un équipement scolaire – école/haltegarderie- est envisagé. plan masse de l’école (échelle : 1/1000ème)

vue axonométrique de l’école

0

50

100

Accès

Hauteurs

Deux accès à cet équipement sont envisagés : - l’un au nord piéton et voiture depuis la rue Neuve (cf. chapitre voirie). Un système de contre-allée offre la possibilité de créer un dépose- minute et quelques places de stationnement pour le personnel. - l’autre au sud piéton seulement depuis une rue résidentielle.

Les bâtiments est peuvent recevoir les salles de classe et les annexes sur 3 niveaux, le bâtiment sud, une halte garderie en rez-de-chaussée.

Principes d’implantation Le choix de son implantation, au nord-est de la plaque, est dû pour partie à l’existence de beaux arbres sur la parcelle Logicil. Leur conservation participe à la qualité de l’espace commun de l’école. L’implantation des bâtiments est privilégiée à l’ouest avec un retrait par rapport à la limite séparative et au sud en alignement avec la limite parcellaire pour offrir des façades calmes et permettre des vues sur le cœur vert de la parcelle et la «clairière» de la plaine.

BILAN ILOT ÉCOLE

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

Emprise au sol

:3

300 m²

Programme neuf SHON

: 2 720 m²


6

LES EMBLÈMES

Les architectures emblématiques sont des bâtiments aux volumétries qui viennent rythmer le drapé. Ils créent une lecture en mouvement du site et donne une «signature» architecturale à la notion de pôle d’excellence. Ces bâtiments sont des points focaux qui captent le regard dans un tissu globalement assez bas. repérage des bâtiments emblèmes sur l’ensemble du site (échelle : 1/3000ème)

Site intercommunal de l’Union - Plan Directeur 95


6

LES EMBLÈMES : LES «TRIANGLES» DU DRAPÉ SUD ET LA D.T.P.A.S axonométrie du site

plan de masse du site du drapé sud (échelle : 1/2000ème)

DTPAS

Implantation de la DTPAS Parcelle : - emprise totale : 1 500 m² SHON constructible : - Emprise bâtie : 670 m² - Hauteur : R+2 - SHON : 2 000 m² Intentions urbaines : - Alignement obligatoire sur rue Racine - Hauteur obligatoire R+2 respectant la hauteur à l’égoût des façades existantes Accessibilité : - Accès piétons rue Racine, proche métro et futur tram-train - Accès voitures par rue intérieure

0

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

50

100

Stationnements: - Stationnements enterrés pour personnel :30 places (ratio supérieur à 1 / 70m² SHON) - Parkings aériens pour public : 15 places


6

LES EMBLÈMES : L’ÎLOT MERCURE

Implantation d’un tribunal de commerce et d’une parcelle de bureaux sur le site de la tour Mercure Parcelle : - emprise totale : 30 000 m²

Implantation du bâti Alignement obligatoire avec retrait possible sur avenue Gambetta

Accessibilité : - excellente accessibilité par les transports collectifs -(métro, futurs tramway et tram-train) et 2 roues - accès monumental piéton dans l’axe de l’entrée de la tour Mercure : avenue de Gambetta, largeur libre 30 mètres - accès véhicules : boulevard de l’Union

Stationnements : (voir schémas)

Accessibilité : - accès véhicules et piétons dans l’axe de l’entrée de la tour Mercure : avenue de Gambetta, largeur libre 30 mètres. - 70 stationnements possibles en aérien au nord de l’îlot.

Bâtiment 2 : Tribunal de commerce - parcelle = 4 000 m² - emprise bâtie = 1 500 m² - hauteur : R+1, R+2 - SHON = 4 100 m²

Parcelle au nord : - réalisation d’une place Bâtiment 2 : Tribunal de commerce - parcelle = 4 000 m² - emprise bâtie = 1 500 m² - hauteur : R+1, R+2 - SHON = 4 100 m²

Réalisation place verte au nord + tribunal de commerces avec implantation d’une nappe de parkings aériens (350)

Constructibilité (voir schémas)

Bâtiment 1 : immeuble de bureaux - parcelle = 1 800 m² - emprise bâtie = 1200 m² - hauteur : R+3 - SHON = 4 800 m² env. Bâtiment 2 : Tribunal de commerce - parcelle = 4 000 m² - emprise bâtie = 1 500 m² - hauteur : R+1, R+2 - SHON = 4 100 m² Réalisation immeuble de bureaux au nord + tribunal de commerces avec implantation d’une nappe de parkings aériens (350) voir souterraines (650) Site intercommunal de l’Union - Plan Directeur 97


plan programmatique

U ITES O ACTIV T EMEN EQUIP

TS

LOGEMEN

CTIVITES ACTIVITES A

RESERVE FONCIERE POUR EQUIPEMENT METROPOLITAIN

ITES ACTIV élargie image

TERRAIN DE SPORT

AIRE TERTI age m lié à l’i

TER liés à TIAIRE/A l’ima CTIV ge ITES

IRE TERTIA

AIRE

ACTIVITES SERVICES

L HOTE E EPRIS ENTR

IN TRAM-TRA STATION

AIRE TERTI age l’im TERTI AIRE G lié à ENER ALIST E

I TERT

RE

EGE COLL RCOING U DE TO

CENTRE MERCURE

TS LOGEMEN

CETI IRE TERTIA

E ECOL

AI

I RT

TE

RESERVE FONCIERE

ACTIVITES LOGEMENTS FORMATION

LOGEMENTS

LOGEMENTS OU RESERVE FONCIERE POUR EQUIPEMENT

ACTIVITES

ACTIVITES LOGEMENTS EQUIPEMENT

MARCHE DE L'ALMA

LO

ACTIVITES G LOGEMENTS EM EN TS

POLE IMAGE projet Bernard et Debarge architectes

0

100

200

N

0 REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

300

400

500 m


Le plan programme Les évolutions du site depuis juin 2004 ainsi que la réalisation d’une étude de marché sur le site de l’Union par l’équipe Katalyse-Stratis induisent un réajustement du programme par des adaptations du projet urbain.

1. La recherche et le développement du site Les programmes de l’îlot Vanoutryve sont actuellement détaillés dans l’étude réalisée par l’équipe P. Bernard. Ceci a pour conséquences une répartition de la SHON vers d’autres thèmes. De plus, le parcellaire destiné à l’hôtel d’entreprise ou ruche est réduit pour introduire une parcelle de tertiaire.

7

5. Les services Les îlots de la Tossée et de Vanoutryve accueillent des services liés à leur fonctionnement (parking silo, lieu d’accueil...).

6. Les équipements S’agissant des équipements, on peut noter les variations de programmes suivants : la possibilité d’implanter une salle de sport sur l’îlot du Cul de Four et l’attribution de l’ancienne parcelle du lycée transfrontalier à l’activité image élargie.

2. Le tertiaire Certains îlots ou certaines parcelles d’îlot ont changé de destinations : le quartier Stephenson n’accueillera désormais que du logement, la parcelle accueillant le marché de l’Alma est dédiée aux activités en rdc et logement en étage (au lieu des services seulement). De nouvelles emprises ont été prises en compte, telles que celle de Mercure, celle localisée à proximité du collège et Nouveau Boulevard et celle comprise entre le Nouveau Boulevard à l’Est et Terken. Aussi, davantage de surfaces tertiaire sont affectées à Vanoutryve et à la Tossée. La fonction tertiaire généraliste apparaissait au regard du marché actuel, trop importante, alors que le tertiaire lié à l’image et au textile ne suffisait pas à asseoir l’identité tertiaire de l’Union, d’où les changements suivants : - en arrière du site «drapé sud» sera implanté du tertiaire généraliste en continuité avec l’existant offrant une typologie de petit tertiaire en couture urbaine, - les parcelles du drapé sud en bordure du canal constituent aujourd’hui une réserve foncière qui pourra accueillir du tertiaire lié à l’image (ou suivant les besoins à long terme, du logement haut de gamme) tout en conservant cette typologie de «bâtiment emblème». Seuls les fonciers de la plaque au sud de la rue Neuve gardent leur vocation tertiaire généraliste.

3. Les activités Deux emprises repérées lors de l’étude de juin 2004 - celles de l’entreprise Lepoutre Ternynck et de la miroiterie Trousson- ne sont plus comptées (elles font l’objet d’un projet privé) alors que la Tossée est introduite dans le périmètre d’étude et que le programme de la parcelle anciennement réservée au lycée transfrontalier devient de l’activité. Ces deux sites comblent les besoins en surface des filières textile au nord du canal (Tossée) et image élargie au sud (en bord de canal). De plus, le quartier Cul de Four accueille une ou deux parcelles d’activités mixtes.

4. Les logements Les Couteaux nord ne sont plus comptabilisés dans cette adaptation. Par contre d’autres logements seront disponibles sur l’îlot de la Tossée et sur Stephenson. Le nombre de logement reste donc quasi identique.

Site intercommunal de l’Union - Plan Directeur 99


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


Bilan foncier

8

1. PLAN DE REPERAGE ET DES EMPRISES FONCIERES.......................................................102 2. BILAN RECHERCHE ET DEVELOPPEMENT......................................................................103 3. BILAN TERTIAIRE....................................................................................................103 4. BILAN ACTIVITE......................................................................................................104 5. BILAN SERVICE......................................................................................................104 6. BILAN LOGEMENT...................................................................................................105 7. BILAN EQUIPEMENT.................................................................................................106

Site intercommunal de l’Union - Plan Directeur 101


1 PLAN DE REPERAGE ET DES EMPRISES FONCIERES

PL17 TO2 PL16 TO7a

TO1 TO6 TO5 PL15

TO0

TO4

TO10

PL13

TO3

TO12

TE1

TO11

PL11

TO15

PL9

CS1

plaine PL5

es Nant

PL8

e rue d

no uv ea u

PL10

GB2

TE2

TO13

TO9

PL12

PL7

TO14

TO8

uve

rue Ne

TO7b

bo ul ev ar d

PL14

drapé

TE3

PL6

PL1+3

GB1

PL4

PL2

CETI

drapé GS1

GB3

levard au bou

nouve

DP2

station tram train

DP1

DP3a

DP3b

SJ2 DP4

Mercure

GS2

terrain de sport SJ1

SJ4a

SJ3

marché de l'Alma

DP5

GS3

SJ4b DP4a SJ8 SJ5

DP4b

activités

SJ7 SJ6

équipements publics tertiaire

VV1b

VV1e

VV1a

Pole télévisuel

services

VV1 VV1d

recherche et développement VV1f

logements VV1c

N 0

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

100

200

300

400

500 m


BILANS Programme

2

Phases

Localisation N° îlot

Capacités

Conditions de desserte

COS prévisionnel

SHON (m²)

Nbre de niveaux

Transports en Commun

Poids Lourds (dispositif)

Stationnement

RECHERCHE ET DEVELOPPEMENT DU SITE (dont équipements mutualisables)

CETI (tertiaire + halles indust.)

Hôtel d'entreprises ou ruche Pôle image-culture-média Vanoutryve Réserve foncière développement ultérieur Pôle image-culture-média Vanoutryve (studios + incubateur d'entreprise + formation )

métro 500m + CSP + tram-train à Accès poids lourds par cour de service avec 100 places sur la bande de stationnement + places sur terme docks de chargement pour activités en rdc parcelle

0

PL1 et PL3

23 960

0,9

21 000

R à R+3

0

PL2

6 250

1,2

7 350

R+2 à R+3

2

GB2

32 000

PM

PM

PM

11 000

0,9

10 250

RdC à R+3

métro 500m + réseau bus

métro 500m + TCSP + tram-train

Total R echerche et développement du site

métro 500m + TCSP + tram-train

VV1a + 0

VV1b + VV1d

73 210

Total R echerche et développement du site

3

Superficie terrain (m²)

110 places de stationnement sur parcelle (aérien + semienterré)

Accès par rue de Nantes

depuis bd Descat et d'Armentières (desserte 43 places de stationnement aérien et 99 places dans le des studios et des locaux d'activités par rues parking silo du Capitaine Aubert et Corneille)

38 600

TERTIAIRE Locaux tertiaire "quartier de l'ancienne gare" petites à moyennes implantations

Locaux tertiaire "quartier de l'ancienne gare" Locaux tertiaires "drapé" centre Mercure bâtiments emblématiques Locaux tertiaires "drapé"

Terken

0 1 1 1 1

PL4 PL5 PL8 PL10 PL12

PM 1 545 1 545 1 545 1 545

PM 1,2 1,2 1,2 1,2

2 250 1 800 1 800 1 800 1 800

R+2 R+2 R+2 R+2 R+2

1 2

DP1 DP3b

PM 5 800

1,5

8 000 8 800

R+4 R+4

0 2 0 2

DP3a DP4a DP4b DP5

24 800 11 830 2 650 6 850

2,1 1,5 2,2

PM 25 000 4 000 15 000

R+8 max R+2 R+8 max

métro 500m + tram-train

2

TE2

6 500

PM

PM

TCSP

depuis Nouveau Boulevard

stationnement sur parcelle

2

GB3

4 700

3 800

R+3

métro 500m + TCSP + tram-train

depuis bd. Gambetta

stationnement sur parcelle

12 120

RdC à R+2

métro 500m + réseau bus

depuis bd Descat et d'Armentières

0,8

métro 500m + TCSP + tram-train

accès livraisons à l'arrière du bâtiment

sur chaque parcelle : 26 places de stationnement en semi-enterré + parking aérien planté

depuis nouveau boulevard Stationnement sur parcelle depuis VRU et bd Gambetta depuis VRU et bd Gambetta depuis VRU et quartier Saint-Joseph

VV1a + VV1e +

PM

Vanoutryve

0

VV1c +

Tossée

0

TO3

3 870

0,5

2 000

R+2

TCSP

depuis nouveau boulevard

parking silo

Saint Joseph - bord de canal

0

SJ1

5 500

1,2

6 500

R+1 à R+2

métro + tram-train

depuis VRU et quartier saint-Joseph

stationnement sur parcelle

Total Tertiaire

78 680

94 670

Légende foncier maîtrisé emprise maîtrisée

Saint Joseph - bord deemprise canal avec forte probabilité d'acquisition acquisition improbable ou difficile aucune action en cours (privé)

Site intercommunal de l’Union - Plan Directeur 103


Programme Ateliers PME "quartier de l'ancienne gare"

4

Phases

Localisation

Conditions de desserte

N° îlot

COS prévisionnel

SHON (m²)

Nbre de niveaux

Transports en Commun

Poids Lourds (dispositif)

dans zone d'influence métro + TCSP + tram-train

Accès Poids lourds par cour de service avec docks de chargement en rdc

ACTIVITES Ateliers PME "quartier de l'ancienne gare"

1 1 1

PL7 PL14 PL17

17 000 17 600 3 840

0,7 0,7 0,6

12 500 11 600 2 220

R et R+2 R et R+2 R+2

Tossée neuf et réaffectation de l'existant

0 0 0 0 0 0 0

TO4 TO7a TO8 TO9 TO10 TO13 TO14

1 290 3 930 2 140 2 180 2 740 2 050 3 340

0,6 0,6 PM 0,5 0,5 2,0 2,2

820 2 500 PM 1 150 1 355 4 200 7 400

R+1 RdC PM RdC haut RdC haut R+2 R+2

2

GS1

10 150

0,9

9 000

R à R+4

1

GS3

2 300

0,7

1 500

R+1

1 0

GS2 VV1d + VV1f

5 680 PM

1,2 PM

6 550 3 000

R à R+2 RdC

métro 500m + réseau bus

depuis bd Descat et d'Armentières

stationnement sur parcelle

1

SJ4b

3 030

0,6

1 740

R

hors zone d'influence TC

depuis VRU et quartier Saint-Joseph

stationnement sur parcelle et voirie

Station multimodale métro/TCSP et tram-train

Accès livraison depuis nouveau boulevard

Autres activités

Saint Joseph - bord de canal

Saint Joseph - bord de canal activités - commerces de proximité

77 270

Total Activités

e a

5

Capacités

Superficie terrain (m²)

(

250 places de stationnement le long de la ligne de chemin de fer, le reste sur parcelle

places de stationnement sur parcelle parking silo en partie dans zone d'influence TCSP

depuis nouveau boulevard

stationnement sur parcelle

parking silo

depuis VRU Accès Poids lourds par cour de service (sur rue Iéna) avec docks de chargement en rdc

hors zone d'influence TC

stationnement sur parcelle

depuis rue de Turgot

65 535

)

SERVICES Espace d'accueil central zone de l'Union Espace évènementiel et d'affaires centre de remise en forme suivant besoins Espace d'accueil, d'évènementiel et d'affaires

0 0 0 0

DP1

PM

Parking silo 260 places Parking silo 260 places

0 0

TO12 VV1 c

PM PM

Hôtel restauration commerces

1

DP2

6 800

0,4

2 500

R+5

autres services

0 0 0

TO5+TO6 TO7b

0,3 2,2

VV1 b et VV1f

2 470 550 PM

700 1 200 1 240

RdC R+2 R

2

TE3

15 850

PM

R+1 à R+6

25 670

8 040

Terken - bord de canal

Total Services REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

1

2 400

R+3 4 niveaux 4 niveaux

stationnement sur parcelle (aérien et enterré)

dans zone d'influence TCSP dans zone d'influence métro dans zone d'influence métro + TCSP + tram-train

dans zone d'influence TCSP

accès depuis nouveau boulevard

stationnement sur parcelle (aérien )

25 places disponibles sur parcelle et places visiteurs le long de la rue de l'Industrie stationnement dans parking silo

métro 500m + réseau bus

stationnement sur parcelle à définir en fonction du projet développé à terme : possibilité de mutualiser le stationnement avec le parc du palais omnisports


Programme

Phases

Localisation N° îlot

6

Superficie terrain (m²)

Capacités

Conditions de desserte

COS prévisionnel

SHON (m²)

Nbre de niveaux

Transports en Commun

1,0

4 000 6 000

R+1 à R+2 R+2

dans zone d'influence TCSP

Poids Lourds (dispositif)

LOGEMENTS Logements spécifiques TO3

lofts (magasins et bureaux de la Tosseé) lofts (grand magasin de Vanoutryve)

1 0

VV1f + VV1c

3 870 3 200

Logements "quartier de l'ancienne gare" Petits collectifs/individuels

2 2 2

PL6 PL9 PL11

2 670 2 700 3 240

1,0 1,0 0,8

2 660 2 660 2 660

Logements "quartier Stephenson" couture urbaine, petits collectifs et individuels

1 1

PL15 PL16

6 040 4 600

1,4 1,0

Tossée

0

TO1

2 330

0

TO2

0 Saint Joseph - couture urbaine couture urbaine, individuels et collectifs

métro 500m + réseau bus

PM

parking silo

R+1 à R+3 R+1 à R+3 R+1 à R+3

dans zone d'influence métro + TCSP + tram-train

PM

Stationnement sur parcelle (sur voirie, dans logement, sur parcelle)

8 600 4 650

R+1 à R+3 R+1 à R+3

dans zone d'influence métro

PM

0,7

1 400

R à R+1

hors zone d'influence TC

5 650

0,6

3 430

R+1

hors zone d'influence TC

TO15

3 230

1,2

5 240

R+3

dans zone d'influence TCSP

0 0 0 0 0

SJ3 SJ4b SJ5 SJ6 SJ7

2 410 3 030 2 860 1 050 1 350

1,4 0,6 1,4 1,7 0,9

3 300 1 800 4 040 1 800 1 225

R+2 R+1 à R+3 R+1 et R+2 R+1 à R+2 R+1 à R+2

dans zone d'influence tram-train

0

SJ8

930

1,2

1 100

R+1 à R+2

dans zone d'influence métro + tram train

2

GS2

5 550

1,3

7 000

R+1 et R+2 partiel et R+2

2

CS1

27 300

0,9

23 660

R+3,5 à R+8 maximum

quartier Cul de Four Petits collectifs et individuels quartier Couteaux Sud Petits collectifs Total Logements

places de parking sur parcelle

82 010

PM

Stationnement sur parcelle (aérien et semi-enterré )

Stationnement sur parcelle (garage) et sur voirie pour les individuels 56 places de stationnement sur parking aérien pour les collectifs stationnement sur parcelle (parking semi-enterré)

PM

Stationnement sur parcelle (sur voirie, dans logement, sur parcelle)

hors zone d'influence TC

PM

Stationnement sur parcelle

hors zone d'influence TC

PM

Stationnement sur parcelle

85 225

Site intercommunal de l’Union - Plan Directeur 105


7

Programme

Phases

Localisation

Capacités

Conditions de desserte

N° îlot

Superficie terrain (m²)

COS prévisionnel

SHON (m²)

Nbre de niveaux

Transports en Commun

Poids Lourds (dispositif)

EQUIPEMENTS Terrain de sport de Roubaix

0

SJ2

16 000

PM

PM

PM

tram-train à terme

depuis VRU et quartier St-Joseph

stationnement sur parcelle

Collège

2

GB1

21 100

0,4

8 900

R à R+2

métro 500m + TCSP + tram-train

depuis Nouveau Boulevard

stationnement sur parcelle (parking semi-enterré)

DTPAS

0

DP4b

1 500

métro 500m + réseau bus

depuis bd d'Aremntières

stationnement sur parcelle

Marché de l'Alma

0

SJ4a

4 260

PM

1 500

R

tram-train à terme

depuis VRU et quartier Saint-Joseph

stationnement sur voirie

Ecole crèche halte garderie

2

PL13

3 300

0,8

2 720

R et R+2

métro 500m + tram-train

depuis rue Neuve, rue de Nantes

dépose-minute + places de stationnement

Accueil fluvial - darse

2

DP2

PM

PM

PM

PM

métro 500m + TCSP + tram-train

PM

parking visiteur sur parcelle

Centre de gestion technique du canal

0

PM

PM

PM

métro 500m + TCSP + tram-train

Equipement métropolitain

2

TE1

51 350

Salle de sport

2

GS2

3 250

0,6

2000

Accueil de la Tossée

0

TO0

230

2

0

TO11

5 960 PM

Formation Maison du parc

0

Centre de loisirs Centre de gestion du parc Autre programme

2 1 2

maison éclusière

2 000

dans zone d'influence du TCSP

depuis Nouveau Boulevard

places de stationnement en aérien complétées par un parking silo

RdC haut

hors zone d'influence TC

PM

stationnement sur parcelle (aérien)

460

R+1

hors zone d'influence TC

PM

stationnement sur parcelle (aérien)

0,4

2400

RdC / R+1 ponctuel

PM

700

suivant programme

500 500 600

106 950

Total Equipements

PM

hors zone d'influence TC

R à R+3 R

22 280

Tableau récapitulatif des superficies, SHON et COS sur trois secteurs secteurs

superficie de l'îlot (m²)

superficie terrains (en m²)

COS prévisionnel

SHON (m²)

dont pôle R&D

Plaque Tossée Vanoutryve

101700 49000 49000

97 380 38 090 33 830

0,9 1,0 1,0

88 070 38 255 32 610

28350

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

10 250

dont tertiaire/laboratoires

dont activités

dont services

9 450 2000 12 120

26 320 17 425 3 000

1900 1 240

dont dont équipements logements publics 21 230 14 070 6000

2 720 2860


Tableau récapitulatif des emprises foncières par typologie de programme et phase Synthèse des emprises foncières

Dont Tertiaire

Dont Activités

Dont services

Dont logements

Dont équipements publics

17 670 49 450 10 150

3 020 6800 15 850

26 040 14 510 41 460

27 950

32000

36 820 6 180 35 680

79 000

73 210

78 680

77 270

25 670

82 010

106 950

Dont Activités 20425 + PM de 2140m² 36 110 9 000

Dont services

Dont logements

Dont équipements publics

5 540 2500 PM de 15850m² (terken)

40 360 17 250 38 640

10 450

PM de 32000m² (réserve foncière)

Dont Tertiaire 26 870 15 200 52600+PM de 6500m² (terken)

79 000

38 600

94 670

65 535

8 040

85 225

89 450

PHASES Développement total du site, en m² Synthèse des emprises foncières

Dont pôle R&D

0 1 2

41 210

TOTAL

443 790

Synthèse des SHON

Tableau récapitulatif des SHON par typologie de programme et phase Synthèse des SHON

PHASES

Développement total du site, en m²

0 1 2 TOTAL

Dont pôle R&D 38 600

381 520

Le réajustement du programme suite aux diverses études techniques menées sur le site de l’union ainsi que l’intégration de certaines parcelles et le retrait d’autres, expliquent en grande partie les évolutions de superficie et de SHON depuis juin 2004.

Ci-après un tableau récapitulatif de ces évolutions : PROGRAMMES

étude de définition

définition plan directeur

emprise (m²)

SHON (m²)

emprise (m²)

SHON (m²)

RECHERCHE ET DEVELOPPEMENT

95 920

67 300

73 210

38 600

TERTIAIRE

69 070

110 900

78 680

94 670

ACTIVITES

79 090

60 095

77 270

65 535

SERVICES

18 205

8 200

25 670

8 040

LOGEMENTS

88 145

85 398

82 010

85 225

EQUIPEMENTS

79 070

suivant programme

90 950

suivant programme

Site intercommunal de l’Union - Plan Directeur 107


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


Estimation financière des investissements

9

1. PLAN DE REPÉRAGE DES ESPACES PUBLICS ET PRIVÉS..................................................110 2. ESTIMATION FINANCIERE..........................................................................................112

Site intercommunal de l’Union - Plan Directeur 109


1

PLAN DE REPĂ&#x2030;RAGE DES ESPACES PUBLICS ET PRIVĂ&#x2030;S Plan de repĂŠrage des espaces publics et privĂŠs

ZONES Dâ&#x20AC;&#x2122;INTERVENTION PĂ?RIMĂ&#x2019;TREDEPROJET RĂ?SERVESFONCIĂ&#x2019;RES

Publique : ESPACEBĂ&#x160;TI ESPACEDEVOIRIE ESPACEMINĂ?RAL ESPACEVERT

PrivĂŠe : ESPACEBĂ&#x160;TI ESPACEVERTMINĂ?RAL 0

REICHEN ET ROBERT & AssociĂŠs - Agence PĂ´les - BET ConďŹ&#x201A;uences - BET Misson Morel // Mai 2006

100

200

300

400

500 m


Hypothèses Approche Budgétaire Niveau de prix sept 2005

Compris : • terrassements généraux nécessaires aux ouvrages à construire (environ 190.000m3 de déblais). • incidence* pollution d’après rapport et estimation fournis par LMCU (rapport définitif de Royal Haskoning, janvier 2006) et selon nivellement des espaces publics projetés (fichier 2006-02-17 nivellement revu.dwg) – évacuation totale en temps 0 et confinement total en temps 1 et 2• démolition de surface et structure et reconstruction pour les voiries à réaménager • terrassement, nivellement et apport de terre végétale pour l’ensemble des espaces verts • desserte réseaux eaux usées • réseaux eaux pluviales et ouvrages de rétention zone Nord • remplacement des réseaux d’assainissement principaux si nécessaire en rénovation d’espace existant (remplacement systématique pour tous les ouvrages type maçonnerie, ovoïde…). • dévoiement de l’Espierre dans le ‘parc habité’ • eau et défense incendie (hypothèse mélange tertiaire / habitat / artisanat) • eau industrielle dans nouveau boulevard, rue de Nantes et voie de desserte quartier ancienne gare Ouest. • électricité moyenne et basse tension compris poste transformateur (hypothèse mélange tertiaire/habitat/ /artisanat) et nouvelle ligne HTA à partir du poste source dès la phase 1 (préfinancement). • gaz – dévoiement pour la darse – desserte pour mémoire (non chiffré – préfinancement) • génie civil de réseaux de télécommunication (2 réseaux) • ensemble des voiries (structure selon usage, lourd ou léger), piétonniers et ouvrage selon descriptif plaquette compris carrefour de raccordement sur voie existante (carrefour giratoire ou réaménagement de carrefour existant). • passage inférieur SNCF (2 créations, 1 réhabilitation) et passage inférieur pont des Couteaux. • réalisation de la darse compris dévoiement de réseaux divers, terrassement évacuation en décharge traditionnelle (sauf incidence pollution), berges, quais, passerelle. • une passerelle au dessus du canal. • parking de surface en structure réservoir. • aménagement d’un stade (terrain, parking, tout réseaux, bâtiment vestiaire…). • réaménagement des abords de la tour Mercure (démolition de surface, parking, espace vert…). • ensemble des plantations, parc, lisière, jardin et équipement spécifiques (skate parc…) selon descriptif plaquette • mobilier urbain (banc – poubelle – borne – garde corps…) • signalétique (muret signalétique en béton hors inscription) • signalisation (horizontale et verticale – compris carrefours à feux sur grands boulevards)

Niveau de prestation : • borduration type 20 x 30cm béton haute gamme sur l’ensemble • éclairage moyenne gamme dans voirie et haute gamme dans place, spot occasionnellement (place, quai…) • mobilier urbain (moyenne gamme dans voirie, haute gamme dans parc et jardin) • voirie, piétonnier, plantation selon descriptif plaquette (voirie enrobé, trottoir asphalte, béton ou pierre, piétonnier stabilisé…)

Non compris : • dépollution des sols et purge des futurs espaces privés • démolition des bâtiments et fondations • branchements réseaux divers et branchements assainissement • accès parcelles ou lots • rénovation des ponts et passerelles existants sur canal. • aménagement des espaces SNCF de la gare tram-train • rétention eaux de ruissellement et reprise exutoire final quartier Sud (rétention à la parcelle si nécessaire)

Site intercommunal de l’Union - Plan Directeur 111


2

ESTIMATIONS FINANCIÈRE

Temps 0 QUARTIER NORD

temps 0

1 - BOULEVARDS ET RUES ( 1.1 ) NOUVEAU BOULEVARD (675 ml sur 21 ou 28 m) ( 1.2 ) PASSAGE INFERIEUR SOUS VOIE FERREE ( 1.3 ) RUE DE NANTES : réaménagement (575 ml sur 17 m) ( 1.3bis) PLACE DE LA MAISON DU PARC (2365 m²) ( 1.5 ) RUES RESIDENTIELLES (95 ml sur 15 m) ( 1.6 ) RUE NEUVE : hors structure sous voie ferrée (190 ml sur 28,50 ou 11m) ( 1.8 ) RUE STEPHENSON (115 ml sur 11,86 m) ( 1.9 ) RUE DE LA TOSSEE SUD (105 ml sur 12,75 m) (1.10) RUE CADEAU (110 ml sur 12 m) ( 1.11 ) COURS DE L'INDUSTRIE (190 ml sur 20 m) (1.12) COURS DE L'INDUSTRIE (90 ml sur 36 m) Total :

3 859 821,00 € 4 861 080,00 € 2 152 648,00 € 462 720,00 € 293 395,00 € 833 721,00 € 230 981,00 € 224 911,00 € 250 856,00 € 501 260,00 € 668 115,00 € 14 339 508,00 €

Total :

101 760,00 € 101 760,00 €

Total :

6 999 750,00 € 6 999 750,00 €

TOTAL Quartier Nord :

21 441 018,00 €

2 - ESPACES PAYSAGERS ( 2.1 ) PREVERDISSEMENT PLAINE ( 11200 m² ) 4 - ALEAS ( 4.1 )

INCIDENCE* POLLUTION selon étude fournie par LMCU

QUARTIER Temps 0SUD : QUARTIER

1.8 1.9

1.11 1.3bis 1.12

1.6

1.3 1.10 2.1 1.5 2.1

SUD

1.1

5 - BOULEVARDS ET RUES ( 5.1 ) RUE JEAN BART 1 (102 ml sur 10 m) ( 5.1 bis ) RUE JEAN BART 2 (175 ml sur 18 m) ( 5.2 ) LA RUE GUINGUETTE 1 et 2 (331 ml sur 14,5 m) ( 5.3 ) LA RUE DES ANGES (164 ml sur 10 m)

1.1

Total :

1.2

229 249,00 € 549 593,00 € 849 722,00 € 283 000,00 € 1 911 564,00 €

7.1 5.1 6.3

6 - ESPACES PAYSAGERS ( 6.1 ) LA PLACE DU MARCHE DE L'ALMA (1986 m²) ( 6.3 ) TRAITEMENT PROVISOIRE DES PARCELLES DP4 et DP5 (19000 m²) ( 6.4 ) LA LISIERE (150 ml sur 14 m) Total :

534 068,00 € 175 200,00 € 125 260,00 € 834 528,00 €

Total :

1 568 010,00 € 1 568 010,00 €

7 - OUVRAGES - BATIMENTS ( 7.1 ) STADE

8 - VANOUTRYVE (d'après l'étude de P. Bernard, prise en compte des voiries, réseaux et éclairage communs + aménagement extérieur du pôle télévisuel Total : 663 862,00 € TOTAL Quartier Sud :

4 977 964,00 €

TOTAL Temps 0 :

26 418 982,00 €

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

6.3

6.4

5.2 6.1

5.2 5.3

5.1bis


Temps 1 QUARTIER NORD

temps 1

1 - BOULEVARDS ET RUES ( 1.1 ) PROMENADE DU PARC (102ml sur 18,50 m) ( 1.2 ) RUE DE ROUBAIX/TOURCOING : réaménagement (100 ml sur 28,20 m) ( 1.3 ) RUE DE ROUBAIX/TOURCOING: réaménagement (336 ml sur 28 m) 1.3 bis PLACE DE L'UNION (1480 m²) ( 1.4 ) RUE NEUVE (115 ml sur 28,50 m) ( 1.5 ) PARVIS DE LA TOSSEE (1930 m²) ( 1.6 ) NOUVEAU BOULEVARD (658 ml sur 28 m) Total : 2 - ESPACES PAYSAGERS ( 2.1 ) LE QUAI (12539 m²) ( 2.2 ) LA DARSE et PARKING (3520 m²) ( 2.3 ) LE DRAPE (22800 m²) (2.3 bis) LE JARDIN (980 m²) Total :

1 975 578,00 € 1 632 720,00 € 1 462 200,00 € 137 840,00 € 5 208 338,00 €

Total :

284 000,00 € PM 284 000,00 €

3 - PASSERELLES ( 3.1 ) LA PASSERELLE AU DESSUS DE LA DARSE ( 3.2 ) LA PASSERELLE VERS QUAI SUD 4 - ALEAS ( 4.1 )

398 437,00 € 788 986,00 € 1 603 811,00 € 310 580,00 € 753 314,00 € 383 840,00 € 3 505 960,00 € 7 744 928,00 €

O.1 O.1 O.1bis O.1

1.6

1.4

1.5 O.1 1.3

O.1bis O.1

O.1

1.1 1.2

INCIDENCE* POLLUTION selon étude fournie par LMCU Total :

714 500,00 € 714 500,00 €

2.3 2.2

O.3 2.3

OPTIONS ( O.1 ) ( O.1bis ) ( O.3 )

1.3 bis

O.1

VOIE DE DESSERTE QUARTIER ANCIENNE GARE OUEST (650 ml sur 15 m) VOIE DE DESSERTE QUARTIER ANCIENNE GARE OUEST PARKING (600 ml sur 15 m) PARVIS DU COLLEGE

Temps 1SUD : QUARTIER QUARTIER

Total :

1 872 696,00 € 1 267 880,00 € PM 3 140 576,00 €

TOTAL Quartier Nord :

17 092 342,00 €

Total :

654 390,00 € 280 671,00 € 372 355,00 € 1 307 416,00 €

Total :

226 836,00 € 226 836,00 €

TOTAL Quartier Sud :

1 534 252,00 €

TOTAL Temps 1 :

18 626 594,00 €

2.1 2.1 2.3

3.1

2.1

2.3 bis 5.1

3.2 6.1 5.2 5.3

2.3

SUD

5 - BOULEVARDS ET RUES (5.1) LA RUE TURGOT (210 ml sur 19,50 m) (5.2) RUE DE WAGRAM (143 ml sur 15 m) (5.3) RUE ROSSINI (120 ml sur 19.50 m)

6 - ESPACES PAYSAGERS ( 6.1 ) PASSAGE PIETON (175 ml sur 6 m)

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Février 2006

Site intercommunal de l’Union - Plan Directeur 113


Temps 2 QUARTIER NORD temps 2 1 - BOULEVARDS ET RUES ( 1.1 ) PROMENADE DU PARC (231 ml sur 17,4 m) ( 1.2 ) DESSERTE GRAND EQUIPEMENT - TERKEN - LOGEMENTS (280 ml sur 9 m) ( 1.3 ) EXTENSION RUE NEUVE : vers Bd Gambetta (202 ml sur 10 m) ( 1.4 ) RUES RESIDENTIELLES (286 ml sur 15 m) ( 1.5 ) PASSAGE INFERIEUR SOUS VOIE FERREE ( 1.6 ) PLACETTE PARC (2935 m²)

463 797,00 € 586 984,00 € 441 718,00 € 815 000,00 € 833 420,00 € 590 070,00 € 3 730 989,00 €

Total : 2 - ESPACES PAYSAGERS ( 2.1 ) LE QUAI (21000 m²) ( 2.2 ) LE SKATE PARK (2950 m²) ( 2.3 ) LE DRAPE (21627 m²) ( 2.3bis ) LE DRAPE GRAND EQUIPEMENT (14500 m²) ( 2.4 ) LE JARDIN THEMATIQUE 1 (4410 m²) ( 2.5 ) LE JARDIN DE TERKEN (2810 m²) ( 2.9 ) LA PLACE HAUTE (3500 m²) ( 2.10 ) LA PLAINE (22530 m²) ( 2.11 ) LE CŒUR D'ILOT LOGEMENTS (5500 m²)

2 945 070,00 € 529 850,00 € 1 101 265,00 €

1.5

O.5

1.4

1.2

1.1

419 610,00 € 365 010,00 € 1 081 695,00 € 1 215 008,00 € 1 680 620,00 € 9 338 128,00 €

2.3 bis

1.4 1.4

2.10

Total :

284 000,00 € 284 000,00 €

Total :

241 700,00 € 241 700,00 €

Total :

2 228 650,00 € 17 000 000,00 € 254 650,00 € 543 250,00 € 20 026 550,00 €

TOTAL Quartier Nord :

33 621 367,00 €

TOTAL Temps 2 :

33 621 367,00 €

INCIDENCE* POLLUTION selon étude fournie par LMCU

ESPACES EXTERIEURS DE LA TOUR MERCURE (31000 m²) PASSAGE INFERIEUR PONT DES COUTEAUX LE PARKING (150 ml sur 15 m) LES JARDINS FAMILIAUX (5000 m²)

Récapitulatif général TOTAL TEMPS 0 TOTAL TEMPS 1 TOTAL TEMPS 2

: : :

26 418 982,00 € 18 626 594,00 € 33 621 367,00 €

TOTAL GENERAL

:

78 666 943,00 €

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

2.5

2.1

2.3

2.11

2.4 2.2

2.4

3 - PASSERELLES ( 3.1 ) LA PASSERELLE VERS QUAI SUD

OPTIONS ( O.2 ) ( O.4 ) ( O.5 ) ( O.6 )

O.6

1.6

P.M

Total :

4 - ALEAS ( 4.1 )

1.3

2.9 O.2

3.1

O.4


Site intercommunal de lâ&#x20AC;&#x2122;Union - Plan Directeur 115


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


Annexes

1. PLAN DIRECTEUR ET PLAN DIRECTEUR AVEC LE PARCELLAIRE EXISTANT.............................119 2. COUPES SUR NOUVEAU BOULEVARD ET RUE DE NANTES.................................................123 3. COUPES TYPOLOGIQUES..........................................................................................125 4. PLAN DE RÉGULATION ET ÉVACUATION DES EAUX PLUVIALES............................................127 5. DÉBITS DES EAUX PLUVIALES ET DIMENSIONNEMENT DES RÉSEAUX...................................129 6. DÉTAILS DE L’ESTIMATION.........................................................................................131 7. RÉCAPITULATIF PAR TYPE D’ESPACE...........................................................................141 8. RATIOS.................................................................................................................144

Site intercommunal de l’Union - Plan Directeur 117


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


plan directeur

Site intercommunal de lâ&#x20AC;&#x2122;Union - Plan Directeur 119


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


plan directeur plus parcellaire existant

Site intercommunal de lâ&#x20AC;&#x2122;Union - Plan Directeur 121


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


coupes sur nouveau boulevard

Site intercommunal de lâ&#x20AC;&#x2122;Union - Plan Directeur 123


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


coupes typologiques

Site intercommunal de lâ&#x20AC;&#x2122;Union - Plan Directeur 125


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


plan regulation et evacutation des ep

Site intercommunal de lâ&#x20AC;&#x2122;Union - Plan Directeur 127


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


5

DÉBITS DES EAUX PLUVIALES ET DIMENSIONNEMENT DES RÉSEAUX

schéma de collecte des eaux pluviales

définition des paramètres relatifs à la pluviométrie période de retour 10ans 5ans 2ans 1an

Région 1 a(F) 5,9 5,0 3,7 3,1

b(F) -0,59 -0,61 -0,62 -0,64

période a(F) b(F)

REGION 1

Région 2 a(F) 6,7 5,5 4,6 3,5

10 ans erreur erreur

Région 3 a(F) 6,1 5,9 5,0 3,8

b(F) -0,55 -0,57 -0,62 -0,62

5 ans erreur erreur

b(F) -0,44 -0,51 -0,54 -0,53

2 ans erreur erreur

1 an erreur erreur

DEFINITION DU COEFFICIENT DE BAZIN 1 2

Coefficient de BAZIN = 0,46 : Dimensionnement classique avec écoulement sur parois semi rugueuses (dépôts). Coefficient de BAZIN = 0,30 : Dimensionnement réduit, réseau bien entretenu, matériaux appropriés.

BAZIN 1

PENTES LIMITES (Validité des formules) 0 1

Pas de limite de pente Pentes maxi limitée à 0,05 m/m selon Instruction du 22 Juin 1977

PENTES 1

caractéristiques des noues de collecte des eaux pluviales Coupe type n°

Localisation

Base ( B en m)

Hauteur normale (Hn m)

Côté talus1/1 Côté talus1/3 Section (m2)

Périmètre mouillé (m)

Rayon hydraulique Rh (m)

Pente (m/m) Coefficient K

Débit (m3/s)

1

Rue du Parc - section amont

0,6

0,25

0,25

0,75

0,275

1,6

0,17

0,003

22

0,102

2

Rue du Parc - section médiane

0,6

0,3

0,3

0,9

0,36

1,8

0,20

0,003

22

0,148

3

Rue du Parc - section aval

0,6

0,35

0,35

1,05

0,455

2

0,23

0,003

22

0,204

4

Rue de Roubaix

0,6

0,15

0,15

0,45

0,135

1,2

0,11

0,003

22

0,038

Emprise au sol : 4.40 à 5.20 m H total : 0.95 m à 1.15 m

talus 1/1 talus 1/3 Hn : 0.15 à 0.35 m

Base (B)

Site intercommunal de l’Union - Plan Directeur 129


calculs de dimensionnement du réseau de collecte des eaux pluviales du bassin versant B D O N N E E S BASSIN

B B B B B B B B

Sous Bassin

1 2 3 4 5 6 7 8

TOTAL

surface totale St (ha)

surface revêtue Sr (ha)

Coef ruiss. C

chemin hydr. L (m)

cote amont ZH (m)

cote aval ZB (m)

Chutes DH (m)

Pente I m/m

1,772 0,332 0,258 0,586 1,774 1,758 0,380 FICTIF

1,506 0,282 0,219 0,381 0,532 0,527 0,209 0,000

0,85 0,85 0,85 0,65 0,30 0,30 0,55 1,00

200 110 55 85 230 180 150 0

*** *** *** *** *** *** *** ***

*** *** *** *** *** *** *** ***

*** *** *** *** *** *** *** ***

0,0040 0,0040 0,0067 0,0033 0,0032 0,0032 0,0055 0,0040

6,860

3,657

assemblage séries

parall.

1 2 3 5 6 7

4

Période retour (année) 10 10 10 10 10 10 10 10

DEBIT AMONT (l/s)

437 405 425 108 604 575

DEBIT AVAL (l/s)

437 405 425 444 108 161 575 575

DIMENSIONNEMENT DU RESEAU BASSIN

Sous Bassin

Pente I (m/m)

B B B B B B B B

1 2 3 4 5 6 7 8

0,0040 0,0040 0,0067 0,0033 0,0032 0,0032 0,0055 0,0040

Débit Qamont (m3/s)

0,437 0,405 0,425 0,108 0,604 0,575

Débit Qaval (m3/s)

coeff de Bazin

Ø brut (m)

0,437 0,405 0,425 0,444 0,108 0,161 0,575 0,575

0,46 0,46 0,46 0,46 0,46 0,46 0,46 0,46

0,709 0,709 0,640 0,738 0,445 0,514 0,753 0,783

coefficient de Bazin=0,46 : dimensionnement classique avec écoulement sur parois semi-rugueuses (dépôts)

0,53

calculs de dimensionnement du réseau de collecte des eaux pluviales du bassin versant C D O N N E E S BASSIN

C C C C C C C C C C C C C C

Sous Bassin

1 2 3 4 5 6 7 8 9 10 11 12 13 14

surface totale St (ha)

surface revêtue Sr (ha)

Coef ruiss. C

0,780 1,044 0,834 0,302 1,260 0,056 1,130 0,482 0,420 FICTIF 0,150 0,855 0,330 FICTIF

0,663 0,887 0,709 0,196 0,693 0,036 0,961 0,265 0,231

0,85 0,85 0,85 0,65 0,55 0,65 0,85 0,55 0,55 1,00 0,65 0,30 0,55 1,00

0,000 0,098 0,257 0,182

0,000

chemin cote cote Chutes hydr. amont aval DH L (m) ZH (m) ZB (m) (m) 125 65 85 120 120 65 160 115 135 115 125 335 125 0

*** *** *** *** *** *** *** *** *** *** *** *** *** ***

*** *** *** *** *** *** *** *** *** *** *** *** *** ***

*** *** *** *** *** *** *** *** *** *** *** *** *** ***

Pente I m/m 0,0050 0,0050 0,0050 0,0180 0,0110 0,0030 0,0190 0,0090 0,0030 0,0030 0,0040 0,0030 0,0050 0,0040

assemblage séries

parall.

1 2 3 4 5 7 8 9 10

6

11 12 13

Période retour (année) 10 10 10 10 10 10 10 10 10 10 10 10 10 10

DEBIT AMONT (l/s)

254 496 696 722 483 1045 794 698 674 651

DEBIT AVAL (l/s)

254 496 598 98 722 645 483 406 794 698 645 38 651 651

DIMENSIONNEMENT DU RESEAU BASSIN

Sous Bassin

Pente I (m/m)

C C C C C C C C C C C C C C

1 2 3 4 5 6 7 8 9 10 11 12 13 14

0,0050 0,0050 0,0050 0,0180 0,0110 0,0030 0,0190 0,0090 0,0030 0,0030 0,0040 0,0030 0,0050 0,0040

Débit Qamont (m3/s)

0,254 0,496 0,696 0,722 0,483 1,045 0,794 0,698 0,674 0,651

Débit Qaval (m3/s)

coeff de Bazin

Ø brut (m)

0,254 0,496 0,598 0,098 0,722 0,645 0,483 0,406 0,794 0,698 0,645 0,038 0,651 0,651

0,46 0,46 0,46 0,46 0,46 0,46 0,46 0,46 0,46 0,46 0,46 0,46 0,46 0,46

0,561 0,713 0,763 0,316 0,708 0,896 0,555 0,635 1,025 0,928 0,840 0,313 0,797 0,819

coefficient de Bazin=0,46 : dimensionnement classique avec écoulement sur parois semi-rugueuses (dépôts)

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


6

DÉTAILS DE L’ESTIMATION

Temps 0 : QUARTIER NORD 1 - BOULEVARDS ET RUES ( 1.1 ) NOUVEAU BOULEVARD (675 ml sur 21 ou 28 m) Préparation (Terrassement - démolition de surface...) Démolition surface Apport de terre végétale 0,30cm Terrassements Plantations et noue Bandes herbacées de 4m00 (2 fois 2m00) Bande petits arbuste couvre sol noue (compris plantations) de 7m00 (pro 1m20) arbre d'alignement 1u/12m Voirie Chaussée en enrobés de 6m50 Transport commun site propre (6m50) Piste cyclable en béton de 3m00 Stationnement longitudinal de 2m00 Carrefour à feux Gambetta Passerelle piéton sur noue Quai de 4m00 Trottoir en asphalte de 2m00 Assainissement Traversée EP Bouche d'égout - caniveaux Tuyau "ø 500" E.P Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau "Eau" industrielle "ø 200" Réseau Télécom Réseau "Electricité" "HTA" Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Arrêt site propre (mobilier et quai) Mobilier Signalisation Signalétique Dévoiement de réseaux Eau diamètre 400 Réseaux divers (borne incendie et poste transfo) Appareil incendie Raccordement extérieur HTA poste source Poste électrique

( 1.2 ) PASSAGE INFERIEUR SOUS VOIE FERREE Ouvrage d'art Passage inférieur Voirie Chaussée en enrobés de 6m00 Transport commun site propre (7m00) Bande minérale (2 fois 2m00) Stationnement longitudinal de 2m00 Trottoir en asphalte de 2m00 Assainissement Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau "Eau" industrielle Réseau Télécom Réseau "Electricité" "HTA" Réseau "Electricité" "BT"

453 680,00 € 7000 m² 2227,5 m³ 24730 m³

8,00 € 12,00 € 15,00 €

m² 2700 m² ml 57 u

5,00 € 20,00 €

54 000,00 €

1 250,00 €

71 250,00 €

675 675 400 675 1

ml ml ml ml for ml 400 ml 675 ml

56 000,00 € 26 730,00 € 370 950,00 € 125 250,00 €

370,00 € 640,00 € 713,00 € 295,00 € 344,00 € 250 000,00 €

3 000,00 €

1 758 100,00 € 432 000,00 € 481 275,00 € 118 000,00 € 232 200,00 € 250 000,00 €

377,00 € 139,00 € Sous-total :

150 800,00 € 93 825,00 € 2 337 030,00 €

ml ml ml ml

181,00 € 53,00 € 265,00 € 320,00 €

39 277,00 € 35 775,00 € 178 875,00 € 216 000,00 €

1350 ml

170,00 €

229 500,00 €

1350 744 675 400 675 400 1600

46,00 € 23,00 € 77,00 € 80,00 € 75,00 € 54,00 € 39,00 €

62 100,00 € 17 112,00 € 51 975,00 € 32 000,00 € 50 625,00 € 21 600,00 € 62 400,00 €

15 000,00 €

30 000,00 € 125 000,00 € 48 000,00 €

60 000,00 € 30 000,00 € 125 000,00 € 48 000,00 €

250 ml

300,00 € Sous-total :

75 000,00 € 1 335 239,00 €

6 u 800 ml 4 u

2 592,00 € 140,00 € Sous-total :

15 552,00 € 112 000,00 € 60 000,00 € 187 552,00 €

187 552,00 €

TOTAL :

3 859 821,00 €

3 859 821,00 €

217 675 675 675

2 337 030,00 € 469 927,00 €

229 500,00 € 297 812,00 € ml ml ml ml ml ml ml

338 000,00 € 4 1 1 1

u for for for

15 000,00 €

1 335 239,00 € 187 552,00 F

4 800 000,00 € 600 m²

8 000,00 €

4 800 000,00 €

640,00 € 713,00 € 295,00 € 344,00 € 139,00 € Sous-total :

12 800,00 € 14 260,00 € 5 900,00 € 6 880,00 € 2 780,00 € 4 842 620,00 €

320,00 €

6 400,00 €

42 620,00 € 20 20 20 20 20

ml ml ml ml ml

20 ml

4 842 620,00 € 6 400,00 €

170,00 €

3 400,00 €

46,00 € 23,00 € 77,00 € 80,00 € 75,00 € 54,00 € 39,00 € Sous-total :

920,00 € 460,00 € 1 540,00 € 1 600,00 € 1 500,00 € 1 080,00 € 1 560,00 € 18 460,00 €

18 460,00 €

TOTAL :

4 861 080,00 €

4 861 080,00 €

8 660,00 € 20 20 20 20 20 20 40

ml ml ml ml ml ml ml

Assainissement Traversée EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau "Eau" industrielle Réseau Télécom Réseau "Electricité" "HTA" Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique Dévoiement de réseaux Eau diamètre 400 Réseaux divers (borne incendie et poste transfo) Appareil incendie Poste électrique

( 1.3 bis ) PLACE DE LA MAISON DU PARC (2365 m²) Plantations et noue petit arbre d'alignement 1u/7m Voirie Emmarchement pierre Revêtement en pierre

4250 m² 2025 m³ m³

8,00 € 15,00 € 12,00 €

m² 83 u ml

20,00 € 925,00 € 100,00 €

1 for 34 ml 34 ml

25 000,00 €

Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Signalétique

64 375,00 € 34 000,00 € 30 375,00 € 76 775,00 €

600,00 €

350,00 €

76 775,00 € 57 300,00 € 25 000,00 € 20 400,00 € 11 900,00 € 872 275,00 €

ml ml ml ml ml ml

139,00 € 224,00 € 640,00 € 344,00 € 309,00 € 139,00 €

575 ml

296,00 €

575 575 575 575

128 800,00 € 368 000,00 € 197 800,00 € 177 675,00 € 170 200,00 €

Sous-total :

170 200,00 € 1 240 925,00 €

102 ml 575 ml 575 ml

181,00 € 53,00 € 320,00 €

18 462,00 € 30 475,00 € 184 000,00 €

575 ml

170,00 €

97 750,00 €

1 240 925,00 € 232 937,00 €

97 750,00 € 289 984,00 € 575 408 575 575 575 575 2300

ml ml ml ml ml ml ml

46,00 € 23,00 € 77,00 € 80,00 € 75,00 € 54,00 € 39,00 €

26 450,00 € 9 384,00 € 44 275,00 € 46 000,00 € 43 125,00 € 31 050,00 € 89 700,00 €

30 000,00 € 62 500,00 € 48 000,00 €

30 000,00 € 62 500,00 € 48 000,00 €

300,00 € Sous-total :

75 000,00 € 836 171,00 €

2 592,00 €

Sous-total :

15 552,00 € 60 000,00 € 75 552,00 €

75 552,00 €

TOTAL :

2 152 648,00 €

2 152 648,00 €

700,00 €

10 500,00 €

215 500,00 € 1 for 1 for 1 for 250 ml 6 u 4 u

15 u 75 ml 2365 m²

15 000,00 €

300,00 € 150,00 € Sous-total :

3 400,00 € 20 ml

( 1.3 ) RUE DE NANTES : réaménagement (575 ml sur 17 m) Préparation (Terrassement - démolition de surface...) Démolition surface Terrassements Apport de terre végétale 0,30cm Plantations et noue Bande petits arbustres couvre sol de 5m00 arbre d'alignement 1u/7m Structure mixte arbuste arboré Réhabilitation passage inférieur Ravalement Garde corps Rive Voirie Trottoir en asphalte de 2m00 Trottoir en asphalte de 3m50 Chaussée en enrobés de 6m00 Stationnement longitudinal de 2m00 Trottoir en asphalte de 5m00 Trottoir en asphalte de 2m00 Assainissement Canalisation enterrée "E.P" : "ø 600" mini

836 171,00 € 75 552,00 F

10 500,00 € 377 250,00 € 22 500,00 € 354 750,00 € 387 750,00 €

387 750,00 € 15 120,00 €

4 u 40 ml

1 500,00 € 228,00 €

6 000,00 € 9 120,00 €

150 ml

242,00 €

36 300,00 €

150 ml 50 ml

46,00 € 23,00 €

6 900,00 € 1 150,00 €

13 500,00 € 2 000,00 € Sous-total :

13 500,00 € 2 000,00 € 74 970,00 €

74 970,00 €

TOTAL :

462 720,00 €

462 720,00 €

36 300,00 € 8 050,00 € 15 500,00 € 1 for 1 for

Site intercommunal de l’Union - Plan Directeur 131


( 1.5 ) RUES RESIDENTIELLES (95 ml sur 15 m) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm Terrassements Plantations et noue Bandes herbacées de 3m00 noue (compris plantations) de 6m00 (pro 0m80) noue (compris plantations) de 3m00 (pro 0m60) Voirie Trottoir en asphalte de 2m00 Chaussée en enrobés de 3m50 Chaussée en enrobés de 5m00 Chaussée mixte en enrobés de 3m50 Trottoir en asphalte de 2m00 Assainissement Traversée EP Exutoire E.P "ø 600" de la rue de Nantes Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

12,00 € 15,00 €

m² 95 ml ml

330,00 € 230,00 €

31 350,00 €

139,00 € 455,00 € 566,00 € 509,00 € 139,00 € Sous-total :

13 205,00 € 43 225,00 €

Réseaux divers (borne incendie et poste transfo) Appareil incendie

2 052,00 € 12 375,00 € 31 350,00 €

5,00 €

104 785,00 € 95 ml 95 ml ml 95 ml ml 30 95 143 143

48 355,00 € 150 562,00 €

150 562,00 € 64 009,00 €

ml ml ml ml

181,00 € 296,00 € 53,00 € 160,00 €

5 430,00 € 28 120,00 € 7 579,00 € 22 880,00 €

143 ml

170,00 €

24 310,00 €

143 60 143 143 380

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

6 578,00 € 1 380,00 € 11 011,00 € 10 725,00 € 14 820,00 €

5 000,00 € 1 000,00 € 4 000,00 € Sous-total :

5 000,00 € 1 000,00 € 4 000,00 € 142 833,00 €

142 833,00 €

TOTAL :

293 395,00 €

293 395,00 €

24 310,00 € 44 514,00 € ml ml ml ml ml

10 000,00 € 1 for 1 for 1 for

( 1.6 ) RUE NEUVE : hors passage sous voie ferrée (190 ml sur 28m50 ou 11m) Préparation (Terrassement - démolition de surface...) Démolition surface m² Apport de terre végétale 0,30cm 169,0 m³ Terrassements 1400 m³ Plantations et noues Bandes herbacées de 3m00 561 m² arbre d'alignement 1u/3m 16,00 u Voirie Trottoir en asphalte de 6m00 ml Trottoir en béton de 7m00 120 ml Stationnement longitudinal de 2m00 120 ml Trottoir en asphalte de 5m00 ml Trottoir en asphalte de 2m00 ml Contre allée de 3m50 240 ml Contre allée de 5m00 ml Stationnement longitudinal de 2m00 120 ml Chaussée en enrobés de 6m00 70 ml Stationnement longitudinal de 2m00 240 ml Terre plein pierre de 3m50 120 ml Contre allée de 5m00 ml Trottoir en asphalte de 2m00 ml Trottoir en béton de 3m00 120 ml Trottoir en asphalte de 5m00 ml Trottoir en asphalte de 6m00 ml Assainissement Réseau EP "ø 600" Traversée EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

14 427,00 €

171 m³ 825 m³

190 114 190 190

ml ml ml ml

Assainissement Traversée EP Tuyau "ø 500" unitaire Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

885 m² m³

8,00 € 12,00 €

m² 9 u ml

5,00 € 925,00 €

7 080,00 € 7 080,00 € 8 325,00 € 8 325,00 €

230,00 € 112 700,00 €

115 ml 115 ml 115 ml ml 115 ml ml

139,00 € 338,00 € 344,00 € 640,00 € 159,00 € 309,00 € Sous-total :

15 985,00 € 38 870,00 € 39 560,00 €

128 105,00 €

36 ml 115 ml 115 ml ml

181,00 € 265,00 € 53,00 € 160,00 €

6 516,00 € 30 475,00 € 6 095,00 € 0,00 €

115 ml

170,00 €

19 550,00 €

18 285,00 € 128 105,00 € 43 086,00 €

19 550,00 € 31 740,00 € 115 ml ml 115 ml 115 ml 230 ml

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

5 290,00 € 0,00 € 8 855,00 € 8 625,00 € 8 970,00 €

5 000,00 € 1 500,00 € 2 000,00 € Sous-total :

5 000,00 € 1 500,00 € 2 000,00 € 102 876,00 €

102 876,00 €

TOTAL :

230 981,00 €

230 981,00 €

1339 m² m³

8,00 € 12,00 €

10 710,00 €

m² ml

230,00 €

8 500,00 € 1 for 1 for 1 for

40 633,00 €

8,00 € 12,00 € 15,00 €

0,00 € 2 028,00 € 21 000,00 €

5,00 € 925,00 €

2 805,00 € 14 800,00 € 480 520,00 €

618,00 € 574,00 € 344,00 € 312,00 € 139,00 € 455,00 € 566,00 € 344,00 € 640,00 € 344,00 € 525,00 € 566,00 € 139,00 € 246,00 € 312,00 € 618,00 € Sous-total :

521 153,00 €

296,00 € 181,00 € 53,00 € 160,00 €

56 240,00 € 20 634,00 € 10 070,00 € 30 400,00 €

68 880,00 € 41 280,00 € 109 200,00 € 41 280,00 € 44 800,00 € 82 560,00 € 63 000,00 € 29 520,00 € 521 153,00 € 117 344,00 €

64 600,00 € 380 ml

170,00 €

64 600,00 €

380 228 380 380 760

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

17 480,00 € 5 244,00 € 29 260,00 € 28 500,00 € 29 640,00 €

10 000,00 € 2 500,00 € 8 000,00 € Sous-total :

10 000,00 € 2 500,00 € 8 000,00 € 312 568,00 €

2 592,00 € Sous-total :

0,00 € 0,00 €

0,00 €

TOTAL :

833 721,00 €

833 721,00 €

110 124,00 € ml ml ml ml ml

( 1.8 ) RUE STEPHENSON ( 115 ml sur 11,86 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Apport de terre végétale 0,30cm Plantations et noue Bandes herbacées de 3m00 Petis arbres d'alignement (1u/13m) noue (compris plantations) de 3m00 (pro 0m60) Voirie Trottoir en asphalte de 2m00 Chaussée en enrobés de 5m50 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Trottoir en asphalte de 2m36 Trottoir en asphalte de 3m00

( 1.9 ) RUE de la TOSSEE SUD (105 ml sur 12,75 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Apport de terre végétale 0,30cm Plantations et noue Bandes herbacées de 3m00 noue (compris plantations) de 3m00 (pro 0m60) Voirie Trottoir en asphalte de 2m50 Chaussée en enrobés de 6m00 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Trottoir en asphalte de 4m25 Trottoir en asphalte de 3m00 Assainissement Traversée EP Tuyau "ø 500" unitaire Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

10 710,00 € 0,00 €

5,00 €

118 965,00 € 105 ml 105 ml ml ml 105 ml ml

184,00 € 640,00 € 344,00 € 640,00 € 309,00 € 309,00 € Sous-total :

19 320,00 € 67 200,00 € 0,00 €

129 675,00 €

36 ml 105 ml 105 ml ml

181,00 € 265,00 € 53,00 € 160,00 €

6 516,00 € 27 825,00 € 5 565,00 € 0,00 €

105 ml

170,00 €

17 850,00 €

32 445,00 € 129 675,00 € 39 906,00 €

17 850,00 € 28 980,00 € 105 ml ml 105 ml 105 ml 210 ml

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

4 830,00 € 0,00 € 8 085,00 € 7 875,00 € 8 190,00 €

5 000,00 € 1 500,00 € 2 000,00 € Sous-total :

5 000,00 € 1 500,00 € 2 000,00 € 95 236,00 €

95 236,00 €

TOTAL :

224 911,00 €

224 911,00 €

1320 m² 360 m³

8,00 € 12,00 €

10 560,00 € 4 320,00 €

330 m² 110 ml

5,00 € 230,00 €

1 650,00 € 25 300,00 €

110 ml 110 ml 110 ml

139,00 € 640,00 € 309,00 € Sous-total :

15 290,00 € 70 400,00 € 33 990,00 € 161 510,00 €

110 ml 110 ml

53,00 € 296,00 €

5 830,00 € 32 560,00 €

110 ml

170,00 €

18 700,00 €

110 72 110 110

46,00 € 23,00 € 75,00 € 39,00 €

5 060,00 € 1 656,00 € 8 250,00 € 4 290,00 €

7 500,00 € 1 500,00 € 4 000,00 € Sous-total :

7 500,00 € 1 500,00 € 4 000,00 € 89 346,00 €

89 346,00 €

TOTAL :

250 856,00 €

250 856,00 €

8 500,00 € 1 for 1 for 1 for

20 500,00 € 1 for 1 for 1 for u

312 568,00 € 0,00 F

( 1.10 ) RUE CADEAU (110 ml sur 12 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Apport de terre végétale 0,30cm Plantations et noue Bandes herbacées de 3m00 noue (compris plantations) de 3m00 (pro 0m60) Voirie Trottoir en asphalte de 2m00 Chaussée en enrobés de 6m00 Trottoir en asphalte de 3m00 Assainissement Bouche d'égout - caniveaux Tuyau "ø 600" E.P Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

14 880,00 € 26 950,00 € 119 680,00 €

ml ml ml ml

161 510,00 € 38 390,00 € 18 700,00 € 19 256,00 €

13 000,00 € 1 for 1 for 1 for


Temps 0 : QUARTIER SUD ( 1.11 ) COURS DE L'INDUSTRIE (190 ml sur 20 m) Préparation (Terrassement - démolition de surface...) Démolition surface Terrassements Plantations et noue Petis arbres d'alignement Voirie Parvis béton largeur 5 m moyen Chaussée en enrobés de 5m50 Stationnement longitudinal de 2m00 Parvis béton largeur 7,5 m moyen

3800 m² 3420 m³ 63 u

8,00 € 15,00 € 925,00 €

81 700,00 € 30 400,00 € 51 300,00 € 58 275,00 € 58 275,00 € 347 010,00 €

190 190 130 190

Assainissement Réseau EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

ml ml ml ml

410,00 € 566,00 € 344,00 € 615,00 € Sous-total :

77 900,00 € 107 540,00 € 44 720,00 € 116 850,00 € 486 985,00 €

190 ml 190 ml 190 ml

296,00 € 53,00 € 160,00 €

56 240,00 € 10 070,00 € 30 400,00 €

190 ml

170,00 €

32 300,00 €

486 985,00 € 96 710,00 €

32 300,00 € 46 870,00 € 190 80 190 190 190

ml ml ml ml ml

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

8 740,00 € 1 840,00 € 14 630,00 € 14 250,00 € 7 410,00 € 5 250,00 €

1 for 1 for 1 for

4 000,00 € 750,00 € 500,00 € Sous-total :

4 000,00 € 750,00 € 500,00 € 181 130,00 €

181 130,00 €

TOTAL :

668 115,00 €

668 115,00 €

5 - BOULEVARDS ET RUES ( 5.1 ) RUE JEAN BART 1 (102 ml sur 10 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue arbre d'alignement 1u/7m Voirie Trottoir en asphalte de 2m00 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Stationnement longitudinal de 2m00 Trottoir en asphalte de 2m00 Assainissement Canalisation enterrée "E.P" Assainissement Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique Réseaux divers (borne incendie et poste transfo) Appareil incendie

( 1.12 ) COURS DE L'INDUSTRIE avec contre allée (90 ml sur 36 m) Préparation (Terrassement - démolition de surface...) Démolition surface 1620 m² Terrassements 1458 m³ Plantations et noue Petis arbres d'alignement 30 u Voirie Parvis béton largeur 8 m moyen 90 ml Stationnement longitudinal de 2m00 90 ml Chaussée en enrobés de 5m50 90 ml Stationnement longitudinal de 2m00 90 ml Chaussée contre allée en enrobés de 3m50 90 ml Stationnement longitudinal de 2m00 90 ml Parvis béton largeur 13 m moyen 90 ml

12 960,00 € 21 870,00 €

925,00 €

27 750,00 €

296,00 € 53,00 € 160,00 €

26 640,00 € 4 770,00 € 14 400,00 €

90 ml

170,00 €

15 300,00 €

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

8 280,00 € 1 840,00 € 6 930,00 € 6 750,00 € 7 020,00 €

4 000,00 € 1 000,00 € 2 000,00 € Sous-total :

4 000,00 € 1 000,00 € 2 000,00 € 98 930,00 €

98 930,00 €

TOTAL :

501 260,00 €

501 260,00 €

TOTAL "Quartier Nord - Boulevards et rues" - Temps 0 :

14 339 508,00 €

14 339 508,00 €

402 330,00 € 45 810,00 €

15 300,00 € 30 820,00 €

7 000,00 € 1 for 1 for 1 for

( 5.1 bis ) RUE JEAN BART 2 (175 ml sur 18 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue arbre d'alignement 1u/7m Voirie Trottoir en asphalte de 2m00 Trottoir en asphalte de 2m80 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Stationnement longitudinal de 2m00 Trottoir en asphalte de 5m20 Trottoir en asphalte de 2m00 Assainissement Canalisation enterrée "E.P" Assainissement Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique Réseaux divers (borne incendie et poste transfo) Appareil incendie

2 - ESPACES PAYSAGERS (2.1) Préverdissement des 2 triangles PLAINE ( 11200 m² ) Préparation (Terrassement - démolition de surface...) Démolition de surface Apport de terre végétale 0,15cm Modelé de terrain (sommaire) Plantations et noue Enherbement prairie Divers (mobilier, signalétique, signalisation...) Signalétique

13 875,00 €

925,00 €

13 875,00 €

102 ml ml 102 ml ml 102 ml

139,00 € 344,00 € 640,00 € 344,00 € 139,00 €

14 178,00 €

102 ml

296,00 €

93 636,00 € 65 280,00 € 14 178,00 € 30 192,00 €

Sous-total :

30 192,00 € 145 863,00 €

102 ml 102 ml

53,00 € 160,00 €

5 406,00 € 16 320,00 €

102 ml

170,00 €

17 340,00 €

102 112 102 102 204

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

4 692,00 € 2 576,00 € 7 854,00 € 7 650,00 € 7 956,00 €

1 for 1 for 1 for

5 000,00 € 2 000,00 € 4 000,00 € Sous-total :

5 000,00 € 2 000,00 € 4 000,00 € 80 794,00 €

1 u

2 592,00 € Sous-total :

2 592,00 € 2 592,00 €

2 592,00 €

TOTAL :

229 249,00 €

229 249,00 €

8,00 €

22 400,00 €

925,00 €

23 125,00 €

145 863,00 € 21 726,00 € 17 340,00 € 30 728,00 €

ml ml ml ml ml

11 000,00 €

80 794,00 € 2 592,00 €

27 750,00 €

90 ml 90 ml 90 ml

ml ml ml ml ml

8 160,00 € 8 160,00 €

339 750,00 € 59 040,00 € 30 960,00 € 50 940,00 € 30 960,00 € 40 950,00 € 30 960,00 € 95 940,00 € 402 330,00 €

180 80 90 90 180

8,00 €

15,0 u

34 830,00 €

8,00 € 15,00 €

656,00 € 344,00 € 566,00 € 344,00 € 455,00 € 344,00 € 1 066,00 € Sous-total :

Assainissement Réseau EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

1020 m²

2800 m² 25,0 u

22 400,00 € 23 125,00 € 320 775,00 €

ml ml ml ml ml ml ml

139,00 € 184,00 € 344,00 € 640,00 € 344,00 € 321,00 € 139,00 €

175 ml

296,00 €

175 175 175 175 175

32 200,00 € 60 200,00 € 112 000,00 € 60 200,00 € 56 175,00 € 51 800,00 €

Sous-total :

51 800,00 € 418 100,00 €

175 ml 175 ml

53,00 € 160,00 €

9 275,00 € 28 000,00 €

175 ml

170,00 €

29 750,00 €

175 112 175 175 350

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

8 050,00 € 2 576,00 € 13 475,00 € 13 125,00 € 13 650,00 €

1 for 1 for 1 for

5 000,00 € 2 000,00 € 4 000,00 € Sous-total :

5 000,00 € 2 000,00 € 4 000,00 € 128 901,00 €

1 u

2 592,00 € Sous-total :

2 592,00 € 2 592,00 €

2 592,00 €

TOTAL :

549 593,00 €

549 593,00 €

418 100,00 € 37 275,00 € 29 750,00 € 50 876,00 €

ml ml ml ml ml

11 000,00 €

128 901,00 € 2 592,00 €

75 360,00 € 5500 m² 1680 m³ 11200 m²

12,00 €

8,00 €

11200 m²

2,00 €

1,00 €

44 000,00 € 20 160,00 € 11 200,00 € 22 400,00 €

Sous-total :

22 400,00 € 97 760,00 €

4 000,00 € Sous-total :

4 000,00 € 4 000,00 €

4 000,00 €

TOTAL :

101 760,00 €

101 760,00 €

TOTAL "Quartier Nord - Espaces paysagers" - Temps 0 :

101 760,00 €

101 760,00 €

1 for

97 760,00 € 4 000,00 €

4 - ALEAS (4.1) Incidence* pollution selon LMCU Espace public Evacuation surplus de déblais Evacuation déblais assainissement Evacuation déblais tranchée commune

6 999 750,00 € 23068 m³ 1797 m³ 1060 m³

270,00 € 270,00 € 270,00 € Sous-total :

6 228 360,00 € 485 190,00 € 286 200,00 € 6 999 750,00 €

6 999 750,00 €

TOTAL :

6 999 750,00 €

6 999 750,00 €

Site intercommunal de l’Union - Plan Directeur 133


( 5.2 ) LA RUE GUINGUETTE 1 et 2 (331 ml sur 14,5 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue arbre d'alignement 1u/10m Voirie Trottoir en asphalte de 2m00 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Trottoir en asphalte de 2m00 Trottoir en asphalte de 4m80 Assainissement Reprise déplacement de Be Remplacement assainissement D800 Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom (enfouissement - création) Réseau "Electricité" "BT" (enfouissemen - création) Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

( 5.3 ) LA RUE DES ANGES (164 ml sur 10 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue arbre d'alignement 1u/7m Voirie Trottoir en asphalte de 1m50 Chaussée en enrobés de 6m00 Trottoir en asphalte de 2m50 Assainissement Reprise déplacement de Be Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau Télécom (enfouissement - création) Réseau "Electricité" "BT" (enfouissement - création) Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

4799,50 m²

8,00 €

38 396,00 € 38 396,00 € 30 525,00 €

925,00 €

30 525,00 €

139,00 € 344,00 € 640,00 € 139,00 € 309,00 € Sous-total :

46 009,00 € 113 864,00 € 211 840,00 € 46 009,00 € 57 474,00 € 544 117,00 €

331 ml 200 ml 331 ml

53,00 € 343,00 € 160,00 €

17 543,00 € 68 600,00 € 52 960,00 €

331 ml

170,00 €

56 270,00 €

33,0 u

475 196,00 € 331 331 331 331 186

ml ml ml ml ml

( 6.3 ) TRAITEMENT PROVISOIRE DES PARCELLES DP4 et DP5 (19000 m²) Préparation (Terrassement - démolition de surface...) Démolition de surface 10000 m² Apport de terre végétale 0,15cm 2850 m³ Modelé de terrain (sommaire) 19000 m² Plantations et noue Enherbement prairie 19000 m² Divers (mobilier, signalétique, signalisation...) Signalétique

38 000,00 €

2,00 € Sous-total : 4 000,00 € Sous-total :

4 000,00 € 4 000,00 €

4 000,00 €

TOTAL :

175 200,00 €

175 200,00 €

12,00 € 3,00 €

7 560,00 € 6 300,00 €

1 250,00 € Sous-total :

87 500,00 € 101 360,00 €

150 ml

100,00 €

15 000,00 €

150 ml

46,00 €

6 900,00 €

2 000,00 € Sous-total :

2 000,00 € 23 900,00 €

1 for

171 200,00 € 4 000,00 €

56 270,00 € 95 732,00 € 331 168 170 331 993

ml ml ml ml ml

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

15 226,00 € 3 864,00 € 13 090,00 € 24 825,00 € 38 727,00 €

7 500,00 € 3 000,00 € 4 000,00 € Sous-total :

7 500,00 € 3 000,00 € 4 000,00 € 305 605,00 €

305 605,00 €

TOTAL :

849 722,00 €

849 722,00 €

14 500,00 € 1 for 1 for 1 for

1640 m²

8,00 €

( 6.4 ) LA LISIERE (150 ml sur 14 m) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm Modelé de terrain Plantations et noue Arbre 1u/30 m²) Eclairage public Spot + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Signalétique

13 120,00 €

630 m³ 2100 m² 70 u

13 860,00 € 87 500,00 € 101 360,00 € 15 000,00 € 6 900,00 € 2 000,00 €

1 for

23 900,00 €

TOTAL :

125 260,00 €

125 260,00 €

TOTAL "Quartier Sud - Espaces paysagers" - Temps 0 :

834 528,00 €

834 528,00 €

3,00 € 12,00 € 8,00 €

1 800,00 € 2 160,00 € 60 000,00 €

550 000,00 € 458,00 € 500 000,00 € 145,00 € 10 000,00 €

550 000,00 € 91 600,00 € 500 000,00 € 47 850,00 € 10 000,00 € 62 500,00 €

5 u 50 ml

1 500,00 € 228,00 €

7 500,00 € 11 400,00 €

4 u 125 ml

25 000,00 € 170,00 €

100 000,00 € 21 250,00 €

400 ml 50 ml

46,00 € 23,00 €

18 400,00 € 1 150,00 €

10 000,00 € 160,00 € 2 000,00 € Sous-total :

10 000,00 € 70 400,00 € 2 000,00 € 1 568 010,00 €

1 568 010,00 €

TOTAL :

1 568 010,00 €

1 568 010,00 €

TOTAL "Quartier Sud - Ouvrages - Bâtiments" - Temps 0 :

1 568 010,00 €

1 568 010,00 €

663 862,00 €

663 862,00 €

TOTAL "Quartier Sud" - Temps 0 :

4 977 964,00 €

4 977 964,00 €

TOTAL Temps 0 :

26 418 982,00 €

26 418 982,00 €

13 120,00 € 22 200,00 €

925,00 €

22 200,00 €

111,00 € 640,00 € 156,00 € Sous-total :

18 204,00 € 104 960,00 € 25 584,00 € 184 068,00 €

164 ml 164 ml

53,00 € 160,00 €

8 692,00 € 26 240,00 €

164 ml

170,00 €

27 880,00 €

164 60 164 164

46,00 € 23,00 € 75,00 € 39,00 €

7 544,00 € 1 380,00 € 12 300,00 € 6 396,00 €

24 u

7 - OUVRAGES - BATIMENTS

148 748,00 € 164 ml 164 ml 164 ml

184 068,00 € 34 932,00 € 27 880,00 € 27 620,00 €

ml ml ml ml

8 500,00 € 1 for 1 for 1 for

5 000,00 € 1 500,00 € 2 000,00 € Sous-total :

5 000,00 € 1 500,00 € 2 000,00 € 98 932,00 €

98 932,00 €

TOTAL :

283 000,00 €

283 000,00 €

TOTAL "Quartier Sud - Boulevards et rues" - Temps 0 :

1 911 564,00 €

1 911 564,00 €

1986 m²

15 888,00 €

8,00 €

15 888,00 €

700,00 €

4 900,00 €

300,00 € 150,00 €

45 000,00 € 297 900,00 € 363 688,00 €

4 900,00 € 7 u 150 ml 1986 m²

Sous-total : Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Borne "nomade" rétractable Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier - borne Signalétique

1,00 €

80 000,00 € 34 200,00 € 19 000,00 € 38 000,00 € 171 200,00 €

544 117,00 € 139 103,00 €

( 7.1 ) STADE Préparation (Terrassement - démolition de surface...) Modelé de terrain Apport de terre végétale 0m30 Démolition de surface Plantations et noue Terrain multisport Piste d'entrainement 5m00 Vestiaires - club Cheminement stabilisé 3m00 Accès raccordement Parking réservoir 50 places Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Eclairage du terrain Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Clôture - portail Signalétique

6 - ESPACES PAYSAGERS

( 6.1 ) LA PLACE DU MARCHE DE L'ALMA (1986 m²) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue petit arbre d'alignement 1u/7m Voirie Emmarchement pierre Revêtement en pierre

133 200,00 € 8,00 €

12,00 €

342 900,00 €

6 u 120 ml

1 500,00 € 228,00 €

9 000,00 € 27 360,00 €

200 ml

242,00 €

48 400,00 €

363 688,00 € 36 360,00 € 48 400,00 € 44 720,00 €

200 ml 5 u 240 ml

46,00 € 6 000,00 € 23,00 €

9 200,00 € 30 000,00 € 5 520,00 €

38 900,00 € 2 000,00 € Sous-total :

38 900,00 € 2 000,00 € 170 380,00 €

170 380,00 €

TOTAL :

534 068,00 €

534 068,00 €

40 900,00 € 1 for 1 for

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

600 m² 180 m³ 7500 m²

63 960,00 €

1 261 950,00 € 1 200 1 330 1 50

for ml for ml for u

1 250,00 €

18 900,00 € 121 250,00 € 19 550,00 € 82 400,00 €

1 for 440 ml 1 for

8 - VANOUTRYVE (d'après l'étude P. Bernard)


Temps 1 : QUARTIER NORD 1 - BOULEVARDS ET RUES

( 1.1 ) PROMENADE DU PARC (102 ml sur 18,5 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Apport de terre végétale 0,30cm Terrassements Plantations et noue noue (compris plantations) de 6m00 (pro 0m80) Voirie Trottoir en asphalte de 2m00 Allée en stabilisé 15m00 (variable) Stationnement longitudinal de 2m00 Passerelle piéton sur noue Gradine Chaussée en enrobés de 5m00 Assainissement Tuyau "ø 800" E.P Traversée du Parc Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "HTA" Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique Réseaux divers (borne incendie et poste transfo) Appareil incendie Poste électrique

12 240,00 € 2 208,00 € 22 500,00 €

102 ml

330,00 €

33 660,00 €

ml 102 ml ml 24 ml 100 ml ml

139,00 € 523,00 € 344,00 €

33 660,00 €

102 ml ml ml

175 346,00 € 175 346,00 € 53 346,00 €

3 000,00 € 500,00 €

72 000,00 € 50 000,00 €

566,00 € Sous-total :

245 954,00 €

343,00 € 343,00 € 160,00 €

245 954,00 € 34 986,00 €

34 986,00 € 0,00 € 17 340,00 €

102 ml

170,00 €

17 340,00 € 16 157,00 €

102 ml 259,0 ml ml ml 102 ml ml

46,00 € 23,00 € 77,00 € 75,00 € 54,00 € 39,00 €

4 692,00 € 5 957,00 € 5 508,00 € 24 000,00 €

1 for for 1 for 3 u 4 u

( 1.2 ) RUE DE ROUBAIX/TG : réaménagement (100 ml sur 28,20 m) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm 350 m³ Démolition surface 2900 m² Plantations et noue Bande herbacée/arbustive de 2m00 m² arbre d'alignement 2u/10m 20 u Plage mixte herbacée/arbustive de 5m00 m² arbre d'alignement 1u/7m u noue (compris plantations) de 7m10 (pro 1m20) 100 ml Allée en pierre 8m80 800 m² Allée en pierre 9m00 m² Voirie Trottoir en asphalte de 2m00 ml Trottoir en asphalte de 2m30 100 ml Stationnement longitudinal de 2m00 100 ml Chaussée en enrobés de 6m00 100 ml Carrefour à niveau 1 for Stationnement longitudinal de 2m00 100 ml Piste cyclable en béton de 3m00 ml Trottoir en asphalte de 2m00 ml Assainissement Bouche d'égout - caniveaux - reprise Tuyau "ø 800" E.P Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune en trottoir Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

36 948,00 €

8,00 € 12,00 € 15,00 €

1530,0 m² 184 m³ 1500 m³

18 000,00 € 3 500,00 € 6 000,00 € Sous-total :

6 000,00 € 92 483,00 €

2 592 00 € 15 000,00 € Sous-total :

60 000,00 € 60 000,00 €

60 000,00 €

TOTAL :

398 437,00 €

398 437,00 €

12,00 € 8,00 €

18 000,00 €

370,00 €

150,00 € 150,00 €

27 400,00 € 4 200,00 € 23 200,00 € 18 500,00 € 37 000,00 € 120 000,00 € 498 400,00 €

139,00 € 156,00 € 344,00 € 640,00 € 350 000,00 € 344,00 € 295,00 € 139,00 € Sous-total :

701 300,00 €

100 ml 100 ml

53,00 € 343,00 €

5 300,00 € 34 300,00 €

100 ml

170,00 €

17 000,00 €

0,00 € 15 600,00 € 34 400,00 € 64 000,00 € 350 000,00 € 34 400,00 € 701 300,00 € 39 600,00 € 17 000,00 € 12 586,00 €

100 ml 282,0 ml

61,00 € 23,00 €

6 100,00 € 6 486,00 € 18 500,00 €

1 for 1 for 1 for

Assainissement Traversée EP Bouche d'égout - caniveaux - reprise Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

1217 m³ 5040 m²

12,00 € 8,00 €

618 m² 67,4 u 336 ml ml 2719 m² m²

8,00 € 925,00 €

336 336 336 336

370,00 € 400,00 €

150,00 € 150,00 €

ml ml ml ml ml ml ml ml

139,00 € 156,00 € 344,00 € 640,00 € 344,00 € 295,00 €

7 500,00 € 5 000,00 € 6 000,00 € Sous-total :

7 500,00 € 5 000,00 € 6 000,00 € 87 686,00 €

87 686,00 €

TOTAL :

788 986,00 €

788 986,00 €

( 1.3 bis ) PLACE de L'UNION (1480 m²) Plantations et noue petit arbre d'alignement 1u/7m Voirie Emmarchement pierre Revêtement en pierre

( 1.4 ) RUE NEUVE (115 ml sur 28m50) Préparation (Terrassement - démolition de surface...) Démolition surface Apport de terre végétale 0,30cm Terrassements Plantations et noue noue (compris plantations) de 5m00 (pro 0m80) noue (compris plantations) de 5m00 (pro 0m80) Bandes herbacées de 3m00 arbre d'alignement 1u/7m Petits arbres alignement 4u/7ml Voirie Parvis de 9m00 Trottoir en asphalte de 2m00 Trottoir en béton de 7m00 Stationnement longitudinal de 2m00 Contre allée de 3m50 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Stationnement longitudinal de 2m00 Terre plein pierre de 3m50 Trottoir en béton de 3m00 Parvis de 9m00 Assainissement Traversée EP Bouche d'égout - caniveaux Tuyau "ø 600" E.P Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique Réseaux divers (borne incendie et poste transfo) Appareil incendie

594 515,00 € 62 345,00 € 124 320,00 € 407 850,00 € 663 624,00 € 52 416,00 € 115 584,00 € 215 040,00 € 115 584,00 €

3 000,00 €

165 000,00 € 1 313 063,00 €

112 ml 336 ml

181,00 € 53,00 €

20 272,00 € 17 808,00 €

672 ml

170,00 €

114 240,00 €

672 ml 392 ml

46,00 € 23,00 €

30 912,00 € 9 016,00 €

17 500,00 € 75 000,00 € 6 000,00 € Sous-total :

17 500,00 € 75 000,00 € 6 000,00 € 290 748,00 €

290 748,00 €

TOTAL :

1 603 811,00 €

1 603 811,00 €

0,00 €

0,00 € 0,00 € 24 000,00 € 222 000,00 € 246 000,00 €

1 313 063,00 € 38 080,00 € 114 240,00 € 39 928,00 € 98 500,00 €

1 for 1 for 1 for

15 u

300,00 € 150,00 €

80 ml 1480 m²

Sous-total : Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Signalétique

54 924,00 € 14 604,00 € 40 320,00 €

139,00 € Sous-total :

55

92 483,00 € 60 000,00 €

175 500,00 €

8,00 € 925,00 € 8,00 € 925,00 €

( 1.3 ) RUE DE ROUBAIX/TOURCOING (336 ml sur 28 m) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm Démolition surface Plantations et noue Bande herbacée/arbustive de 2m00 arbre d'alignement 2u/10m noue (compris plantations) de 7m10 (pro 1m20) noue (compris plantations) de 9m00 (pro 1m20) Allée en pierre de 8m80 Allée en pierre 4m00 Voirie Trottoir en asphalte de 2m00 Trottoir en asphalte de 2m30 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Stationnement longitudinal de 2m00 Piste cyclable en béton de 3m00 Passerelle piéton sur noue Trottoir en asphalte de 2m00

0,00 € 246 000,00 € 246 000,00 € 18 900,00 €

5 u 50 ml

1 500,00 € 228,00 €

7 500,00 € 11 400,00 €

100 ml

242,00 €

24 200,00 €

100 ml 60 ml

46,00 € 23,00 €

4 600,00 € 1 380,00 €

13 500,00 € 2 000,00 € Sous-total :

13 500,00 € 2 000,00 € 64 580,00 €

64 580,00 €

TOTAL :

310 580,00 €

310 580,00 €

2100 m² 104 m³ 2250 m³

8,00 € 12,00 € 15,00 €

16 800,00 € 1 248,00 € 33 750,00 €

ml ml 345,0 m² 39 u u

330,00 € 330,00 €

24 200,00 € 5 980,00 € 15 500,00 € 1 for 1 for

51 798,00 €

37 800,00 €

5,00 € 925,00 €

1 725,00 € 36 075,00 €

700,00 € 417 565,00 € 125,00 € 139,00 € 574,00 € 344,00 € 455,00 € 344,00 € 640,00 € 344,00 € 525,00 € 246,00 € 125,00 € Sous-total :

507 163,00 €

ml 115 ml 115 ml 230 ml

181,00 € 53,00 € 296,00 € 320,00 €

0,00 € 6 095,00 € 34 040,00 € 73 600,00 €

230 ml

170,00 €

39 100,00 €

230 228 230 230 460

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

10 580,00 € 5 244,00 € 17 710,00 € 17 250,00 € 17 940,00 €

10 000,00 € 4 000,00 € 8 000,00 € Sous-total :

10 000,00 € 4 000,00 € 8 000,00 € 243 559,00 €

2 592,00 €

2 592,00 € 2 592,00 €

2 592,00 €

TOTAL :

753 314,00 €

753 314,00 €

115 115 230 115 230 115 115

m² ml ml ml ml ml ml ml ml ml m²

66 010,00 € 39 560,00 € 104 650,00 € 39 560,00 € 0,00 € 79 120,00 € 60 375,00 € 28 290,00 € 507 163,00 € 113 735,00 €

39 100,00 € 68 724,00 € ml ml ml ml ml

22 000,00 € 1 for 1 for 1 for 1 u Sous-total :

243 559,00 €

Site intercommunal de l’Union - Plan Directeur 135


( 1.5 ) PARVIS DE LA TOSSEE (1930 m²) Plantations et noue petit arbre d'alignement 1u/7m Voirie Emmarchement pierre Revêtement en pierre

17 u 80 ml 1930 m²

0,00 € 300,00 € 150,00 € Sous-total :

Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Signalétique

0,00 € 0,00 € 0,00 € 24 000,00 € 289 500,00 € 313 500,00 €

5 u 50 ml

1 500,00 € 228,00 €

7 500,00 € 11 400,00 €

120 ml

242,00 €

29 040,00 €

120 ml 60 ml

46,00 € 23,00 €

5 520,00 € 1 380,00 €

313 500,00 € 313 500,00 € 18 900,00 € 29 040,00 € 6 900,00 € 15 500,00 €

1 for 1 for

( 1.6 ) NOUVEAU BOULEVARD (658 ml sur 28 m) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm Terrassements Plantations et noue Bandes herbacées de 4m00 (2 fois 2m00) noue (compris plantations) de 7m00 (pro 1m20) arbre d'alignement 1u/12m Voirie Chaussée en enrobés de 6m50 Transport commun site propre (6m50) Piste cyclable en béton de 3m00 Stationnement longitudinal de 2m00 Carrefour Passerelle piéton sur noue Quai de 4m00 Trottoir en asphalte de 2m00

13 500,00 € 2 000,00 € Sous-total :

13 500,00 € 2 000,00 € 70 340,00 €

70 340,00 €

TOTAL :

383 840,00 €

383 840,00 €

296 460,00 €

1580,00 m³ 18500 m³

12,00 € 15,00 €

18 960,00 € 277 500,00 €

2632 m² ml 54 u

5,00 €

13 160,00 €

370,00 €

80 660,00 €

1 250,00 €

67 500,00 €

640,00 € 713,00 € 295,00 € 344,00 € 200 000,00 €

421 120,00 € 469 154,00 € 194 110,00 € 226 352,00 € 200 000,00 €

377,00 € 139,00 € Sous-total :

248 066,00 € 91 462,00 € 2 227 384,00 €

181,00 € 53,00 € 550,00 € 343,00 € 320,00 €

33 666,00 € 69 748,00 € 165 000,00 € 120 050,00 € 210 560,00 €

1 850 264,00 € 658 658 658 658 1

ml ml ml ml for ml 658 ml 658 ml

Assainissement Traversée EP Bouche d'égout - caniveaux Restructuration réseau existant "ø 1200" Tuyau "ø 800" E.P Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "HTA" Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Arrêt site propre (quai et mobilier) Signalisation Signalétique

186 1316 300 350 658

ml ml ml ml ml

3 000,00 €

2 227 384,00 € 599 024,00 €

( 2.2 ) LA DARSE et PARKING (3520m²) Préparation (terrassement - génie civil...) Terrassement darse Equipement - ponton largeur 1m50 Soutènement - étanchéité - berge Zone minérale Revêtement pierre Assainissement Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Dévoiement de réseaux Gaz diamètre 300 Gaz diamètre 200 HTA Mobilier Signalisation Signalétique

( 2.3 ) LE DRAPE (22800 m²) Préparation (Terrassement - démolition de surface...) Terrassements déblais remblais Soutènnement végétal Apport de terre végétale 0,30cm Modelé de terrain Plantations et noue Plantations mixtes herbacées graminées Voirie - passerelle Passerelle longue sur bassin Cheminement piéton en béton 2m50 Assainissement Bassin de rétention Exutoire EP diamètre 315 Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Signalétique

770 100,00 € 16000 m³ 110 ml 2160 m²

14,00 € 350,00 € 235,00 €

224 000,00 € 38 500,00 € 507 600,00 €

150,00 € Sous-total :

528 000,00 € 1 298 100,00 €

200 ml 80 ml

53,00 € 160,00 €

10 600,00 € 12 800,00 €

240 ml

170,00 €

40 800,00 €

240 ml

46,00 €

11 040,00 €

3520 m²

528 000,00 € 1 298 100,00 € 23 400,00 € 40 800,00 € 11 040,00 € 259 380,00 €

240 240 480 1 1 1

ml ml ml for for for

450,00 € 350,00 € 81,00 € 22 500,00 € 2 000,00 € 4 000,00 € Sous-total :

108 000,00 € 84 000,00 € 38 880,00 € 22 500,00 € 2 000,00 € 4 000,00 € 334 620,00 €

334 620,00 €

TOTAL :

1 632 720,00 €

1 632 720,00 €

m³ ml m³ m²

8,00 € 150,00 € 12,00 € 3,00 €

182 400,00 € 33 000,00 € 82 080,00 € 68 400,00 €

12500 m²

6,00 €

75 000,00 €

150 m² 220 ml

1 150,00 € 254,00 €

172 500,00 € 55 880,00 €

4570 m³ 150 ml

146,00 € 228,00 € Sous-total :

667 220,00 € 34 200,00 € 1 370 680,00 €

220 ml

170,00 €

37 400,00 €

220 ml

46,00 €

10 120,00 €

365 880,00 € 22800 220 6840 22800

75 000,00 € 228 380,00 € 701 420,00 € 1 370 680,00 € 37 400,00 € 10 120,00 € 44 000,00 €

1 for 1 for

36 000,00 € 8 000,00 € Sous-total :

36 000,00 € 8 000,00 € 91 520,00 €

91 520,00 €

TOTAL :

1 462 200,00 €

1 462 200,00 €

8,00 € 3,00 €

7 840,00 € 2 940,00 €

100,00 € Sous-total :

98 000,00 € 108 780,00 €

35 ml

170,00 €

5 950,00 €

35 ml

46,00 €

1 610,00 €

223 720,00 € 1316 ml

170,00 €

223 720,00 €

1316 372 658 658 658 1316

46,00 € 23,00 € 77,00 € 75,00 € 54,00 € 39,00 €

60 536,00 € 8 556,00 € 50 666,00 € 49 350,00 € 35 532,00 € 51 324,00 €

255 964,00 € ml ml ml ml ml ml

174 500,00 € 1 4 1 1

Réseaux divers (borne incendie et poste transfo) Appareil incendie Poste électrique

for u for for

4 u 1 u

22 500,00 €

15 000,00 €

80 000,00 € 12 000,00 € Sous-total : 2 592,00 €

22 500,00 € 60 000,00 € 80 000,00 € 12 000,00 € 1 253 208,00 €

1 253 208,00 € 25 368,00 F

Sous-total :

10 368,00 € 15 000,00 € 25 368,00 €

25 368,00 €

TOTAL :

3 505 960,00 €

3 505 960,00 €

TOTAL "Quartier Nord - Boulevards et rues" - Temps 1 :

7 744 928,00 €

7 744 928,00 €

15 000,00 €

Assainissement Traversée EP Bouche d'égout - caniveaux Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation, traitement berge...) Renforcement berge - tête de palplanche - buttée - garde corps Mobilier Signalétique

Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Clôture basse Signalétique

980 m³ 980 m² 980 m²

10 780,00 € 98 000,00 € 108 780,00 € 5 950,00 € 1 610,00 € 21 500,00 €

1 for 150 ml 1 for

4 500,00 € 2 000,00 € Sous-total :

4 500,00 € 15 000,00 € 2 000,00 € 29 060,00 €

29 060,00 €

TOTAL :

137 840,00 €

137 840,00 €

TOTAL "Quartier Nord - Espaces paysagers" - Temps 1 :

5 208 338,00 €

5 208 338,00 €

100,00 €

3 - PASSERELLES

2 - ESPACES PAYSAGERS ( 2.1 ) LE QUAI (12539 m²) Préparation (Terrassement - démolition de surface...) Démolition surface Plantations et noue Revêtement béton

( 2.3 bis ) LE JARDIN (980 m²) Préparation (Terrassement - démolition de surface...) Terrassements déblais remblais Modelé de terrain Plantations et noue Aménagement des jardins et terre

56 000,00 €

7000 m²

8,00 €

56 000,00 €

12539 m²

82,00 € Sous-total :

1 028 198,00 € 1 084 198,00 €

181,00 € 53,00 €

50 680,00 € 37 100,00 €

1 028 198,00 €

280 ml 700 ml

1 084 198,00 € 87 780,00 €

( 3.1 ) LA PASSERELLE AU DESSUS DE LA DARSE Ouvrage Culée sur pieux Garde corps Passerelle Eclairage par spot

284 000,00 € 2 40 20 10

u ml ml u

60 000,00 € 6 350,00 € 1 300,00 € Sous-total :

120 000,00 € 24 000,00 € 127 000,00 € 13 000,00 € 284 000,00 €

284 000,00 €

TOTAL :

284 000,00 €

284 000,00 €

600,00 €

169 400,00 € 700 ml

242,00 €

169 400,00 €

700 ml

46,00 €

32 200,00 €

750,00 € 63 000,00 € 14 000,00 € Sous-total :

525 000,00 € 63 000,00 € 14 000,00 € 891 380,00 €

891 380,00 €

TOTAL :

1 975 578,00 €

1 975 578,00 €

32 200,00 € 602 000,00 € 700 ml 1 for 1 for

( 3.2 ) LA PASSERELLE VERS QUAI SUD Ouvrage TOTAL : PM

TOTAL "Quartier Nord - Passerelles" - Temps 1 :

284 000,00 €

284 000,00 €

4 - ALEAS (4.1) Incidence* pollution selon LMCU Espace public Déplacement déblais

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

PM

714 500,00 € 8159 m³

50,00 €

407 950,00 €


Temps 1 : QUARTIER SUD 5 - BOULEVARDS ET RUES

OPTIONS ( O.1 ) VOIE DE DESSERTE QUARTIER ANCIENNE GARE OUEST (650 ml Voirie Trottoir en asphalte de 2m50 650 Stationnement longitudinal de 2m00 650 Chaussée en enrobés de 6m00 650 Stationnement longitudinal de 2m00 650 Trottoir en asphalte de 2m50 650 Assainissement Réseau EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau "Eau" industrielle Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique Réseaux divers (borne incendie et poste transfo) Appareil incendie

sur 15 m) 1 066 000,00 € ml ml ml ml ml

650 ml 650 ml 650 ml

( O.3 ) PARVIS DU COLLEGE Préparation (Terrassement - démolition de surface...) Démolition surface Plantations et noue arbre d'alignement Voirie Revêtement en pierre

101 400,00 € 223 600,00 € 416 000,00 € 223 600,00 € 101 400,00 € 1 066 000,00 €

296,00 € 53,00 € 160,00 €

192 400,00 € 34 450,00 € 104 000,00 €

650 ml

170,00 €

110 500,00 €

46,00 € 23,00 € 77,00 € 80,00 € 75,00 € 39,00 €

29 900,00 € 8 970,00 € 50 050,00 € 52 000,00 € 48 750,00 € 101 400,00 €

1 for 1 for 1 for

32 500,00 € 8 000,00 € 26 000,00 € Sous-total :

32 500,00 € 8 000,00 € 26 000,00 € 798 920,00 €

3

2 592,00 € Sous-total :

7 776,00 € 7 776,00 €

7 776,00 €

TOTAL :

1 872 696,00 €

1 872 696,00 €

291 070,00 € 650 390 650 650 650 2600

ml ml ml ml ml ml

66 500,00 €

798 920,00 € 7 776,00 €

1 003 200,00 € 156,00 € 344,00 € 672,00 € 344,00 € 156,00 € Sous-total :

93 600,00 € 206 400,00 € 403 200,00 € 206 400,00 € 93 600,00 € 1 003 200,00 €

228,00 €

1 003 200,00 € 57 300,00 €

100 ml 23 u

1 500,00 €

22 800,00 € 34 500,00 €

600 ml

170,00 €

102 000,00 €

600 ml 360 ml 600 ml

46,00 € 23,00 € 75,00 €

27 600,00 € 8 280,00 € 45 000,00 €

15 000,00 € 3 500,00 € 6 000,00 € Sous-total :

15 000,00 € 3 500,00 € 6 000,00 € 264 680,00 €

264 680,00 €

TOTAL :

1 267 880,00 €

1 267 880,00 €

102 000,00 € 80 880,00 €

24 500,00 € 1 for 1 for 1 for

m² u m² u ml

0,00 €

1 250,00 €

0,00 €

150,00 €

0,00 € 0,00 €

1 500,00 € 228,00 €

( 5.2 ) RUE DE WAGRAM (143 ml sur 15 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue arbre d'alignement 1u/7m Voirie Trottoir en asphalte de 2m00 Chaussée en enrobés de 6m00 Trottoir en asphalte de 2m00 Assainissement Reprise déplacement de Be Remplacement assainissement D600 Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau Télécom (enfouissement - création) Réseau "Electricité" "BT" (enfouissement - création) Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

32 760,00 €

925,00 €

27 750,00 €

184,00 € 344,00 € 640,00 € 344,00 € 423,00 € Sous-total :

38 640,00 € 72 240,00 € 134 400,00 € 72 240,00 € 88 830,00 € 466 860,00 €

210 ml 210 ml 210 ml

53,00 € 296,00 € 160,00 €

11 130,00 € 62 160,00 € 33 600,00 €

210 ml

170,00 €

35 700,00 €

210 80 210 210

46,00 € 23,00 € 75,00 € 39,00 €

9 660,00 € 1 840,00 € 15 750,00 € 8 190,00 €

5 000,00 € 2 500,00 € 2 000,00 € Sous-total :

5 000,00 € 2 500,00 € 2 000,00 € 187 530,00 €

187 530,00 €

TOTAL :

654 390,00 €

654 390,00 €

8,00 €

17 160,00 €

0,00 €

0,00 €

30 u

27 750,00 € 406 350,00 €

210 210 210 210 210

ml ml ml ml ml

466 860,00 € 106 890,00 €

35 700,00 € 35 440,00 € ml ml ml ml

9 500,00 € 1 for 1 for 1 for

2145 m² u

17 160,00 € 0,00 € 131 274,00 €

143 ml 143 ml 143 ml

139,00 € 640,00 € 139,00 € Sous-total :

19 877,00 € 91 520,00 € 19 877,00 € 148 434,00 €

143 ml 143 ml 143 ml

53,00 € 296,00 € 160,00 €

7 579,00 € 42 328,00 € 22 880,00 €

143 ml

170,00 €

24 310,00 €

143 120 143 143

46,00 € 23,00 € 75,00 € 39,00 €

6 578,00 € 2 760,00 € 10 725,00 € 5 577,00 €

5 000,00 € 2 500,00 € 2 000,00 € Sous-total :

5 000,00 € 2 500,00 € 2 000,00 € 132 237,00 €

132 237,00 €

TOTAL :

280 671,00 €

280 671,00 €

8,00 €

18 720,00 €

148 434,00 € 72 787,00 €

24 310,00 € 25 640,00 € ml ml ml ml

9 500,00 € 1 for 1 for 1 for

0,00 € 0,00 € 0,00 € 0,00 €

0,00 € 0,00 € 0,00 €

ml

242,00 €

0,00 €

ml

46,00 €

0,00 €

9 000,00 € 1 000,00 € 2 000,00 € Sous-total :

0,00 € 0,00 € 0,00 € 0,00 €

0,00 €

TOTAL :

0,00 €

0,00 €

0,00 € 0,00 € for for for

Assainissement Reprise déplacement de Be Remplacement assainissement D600 Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau Télécom (enfouissement - création) Réseau "Electricité" "BT" (enfouissement - création) Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

32 760,00 €

8,00 €

4095 m²

0,00 €

8,00 €

Sous-total : Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

1 066 000,00 € 330 850,00 €

110 500,00 €

( O.1bis ) VOIE DE DESSERTE QUARTIER ANCIENNE GARE OUEST PARKING (600 ml sur 15 m) Voirie Trottoir en asphalte de 2m50 600 ml Stationnement longitudinal de 2m00 600 ml Chaussée drainante en enrobés de 6m00 600 ml Stationnement longitudinal de 2m00 600 ml Trottoir en asphalte de 2m50 600 ml Assainissement Exutoire EP Bouche d'injection et filtre Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau Télécom Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

156,00 € 344,00 € 640,00 € 344,00 € 156,00 € Sous-total :

( 5.1 ) RUE TURGOT (210 ml sur 19,5 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue arbre d'alignement 1u/7m Voirie Trottoir en asphalte de 2m50 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Stationnement longitudinal de 2m00 Trottoir en asphalte de 7m00

TOTAL "Quartier Nord - Optione" - Temps 1 :

3 140 576,00 €

3 140 576,00 €

TOTAL "Quartier Nord" - Temps 1 :

17 092 342,00 €

17 092 342,00 €

( 5.3 ) RUE ROSSINI (120 ml sur 19,5 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue arbre d'alignement 1u/7m Voirie Trottoir en asphalte de 2m50 Stationnement longitudinal de 2m00 Chaussée en enrobés de 6m00 Stationnement longitudinal de 2m00 Trottoir en asphalte de 7m00 Assainissement Reprise déplacement de Be Remplacement assainissement D600 Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau Télécom (enfouissement - création) Réseau "Electricité" "BT" (enfouissement - création) Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

2340 m²

18 720,00 € 13 875,00 €

925,00 €

13 875,00 €

ml ml ml ml ml

184,00 € 344,00 € 640,00 € 344,00 € 423,00 € Sous-total :

22 080,00 € 41 280,00 € 76 800,00 € 41 280,00 € 50 760,00 € 264 795,00 €

120 ml 120 ml 120 ml

53,00 € 296,00 € 160,00 €

6 360,00 € 35 520,00 € 19 200,00 €

120 ml

170,00 €

20 400,00 €

120 60 120 120

46,00 € 23,00 € 75,00 € 39,00 €

5 520,00 € 1 380,00 € 9 000,00 € 4 680,00 €

2 500,00 € 2 000,00 € 1 000,00 € Sous-total :

2 500,00 € 2 000,00 € 1 000,00 € 107 560,00 €

107 560,00 €

TOTAL :

372 355,00 €

372 355,00 €

15 u

232 200,00 € 120 120 120 120 120

264 795,00 € 61 080,00 €

20 400,00 € 20 580,00 € ml ml ml ml

5 500,00 € 1 for 1 for 1 for

Site intercommunal de l’Union - Plan Directeur 137


6 - ESPACES PAYSAGERS ( 6.1 ) PASSAGE PIETON (175 m par 6m) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm Démolition de surface Plantations et noue 2 Bandes herbacées de 3m00 petit arbre d'alignement 1u/7m Voirie Revêtement béton 4m00 Revêtement en pierre 4m00 Assainissement Création de Be Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

10 992,00 €

216 m³ 1050 m²

12,00 € 8,00 €

2 592,00 € 8 400,00 €

720 m² 10 u

5,00 € 700,00 €

3 600,00 € 7 000,00 €

240 ml 480 m²

150,00 €

377,00 €

Sous-total :

90 480,00 € 72 000,00 € 184 072,00 €

120 ml

53,00 €

6 360,00 €

120 ml

170,00 €

20 400,00 €

10 600,00 € 162 480,00 € 184 072,00 € 6 360,00 € 20 400,00 € 8 004,00 €

120 ml 108 ml

46,00 € 23,00 €

5 520,00 € 2 484,00 €

5 000,00 € 1 000,00 € 2 000,00 € Sous-total :

5 000,00 € 1 000,00 € 2 000,00 € 42 764,00 €

42 764,00 €

TOTAL :

226 836,00 €

226 836,00 €

TOTAL "Quartier Sud" - Temps 1 :

1 534 252,00 €

1 534 252,00 €

TOTAL Temps 1 :

18 626 594,00 €

18 626 594,00 €

8 000,00 € 1 for 1 for 1 for

Temps 2 : QUARTIER NORD 1 - BOULEVARDS ET RUES

( 1.1 ) PROMENADE DU PARC (231 ml sur 17,4 m) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm Terrassements Plantations et noue noue (compris plantations) de 6m00 (pro 0m80) Bande petits arbustres couvre sol de 5m00 Voirie Trottoir en asphalte de 2m00 Allée en stabilisé 15m00 (variable) Chaussée en enrobés de 5m00 Passerelle piéton sur noue Gradine Stationnement longitudinal de 2m00 Assainissement Traversée EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

763 m³ 400 m³

12,00 € 15,00 €

9 156,00 € 6 000,00 €

231 ml m²

330,00 €

76 230,00 €

76 230,00 €

ml 231 ml ml 16 ml 231 ml ml

20,00 € 139,00 € 523,00 € 566,00 €

284 313,00 € 120 813,00 €

3 000,00 € 500,00 €

48 000,00 € 115 500,00 €

344,00 € Sous-total :

375 699,00 €

ml ml ml

181,00 € 53,00 € 160,00 €

231 ml

242,00 €

375 699,00 € 0,00 €

55 902,00 € 55 902,00 € 12 696,00 € 231 ml 90 ml ml ml ml

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

10 626,00 € 2 070,00 €

Assainissement Réseau EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

( 1.4 ) RUES RESIDENTIELLES (286 ml sur 15m) Préparation (Terrassement - démolition de surface...) Démolition de surface Apport de terre végétale 0,30cm Plantations et noue Bandes herbacées de 3m00 noue (compris plantations) de 6m00 (pro 0m80) noue (compris plantations) de 3m00 (pro 0m80) Voirie Trottoir en asphalte de 2m00 Chaussée en enrobés de 3m50 Chaussée en enrobés de 5m00 Chaussée mixte en enrobés de 3m50 Trottoir en asphalte de 2m00 Assainissement Traversée EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "HTA" Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

49 910,00 €

8,00 € 15,00 €

16 160,00 € 33 750,00 €

139,00 € 640,00 € 139,00 € Sous-total :

28 078,00 € 129 280,00 € 28 078,00 € 235 346,00 €

202 ml 202 ml 202 ml

296,00 € 53,00 € 160,00 €

59 792,00 € 10 706,00 € 32 320,00 €

202 ml

170,00 €

34 340,00 €

202 80 202 202 202

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

9 292,00 € 1 840,00 € 15 554,00 € 15 150,00 € 7 878,00 €

10 000,00 € 1 500,00 € 8 000,00 € Sous-total :

10 000,00 € 1 500,00 € 8 000,00 € 206 372,00 €

206 372,00 €

TOTAL :

441 718,00 €

441 718,00 €

4290 m² 516 m³

8,00 € 12,00 €

34 320,00 € 6 192,00 €

m² 286 ml ml

330,00 € 240,00 €

94 380,00 €

302 ml 302 ml ml 302 ml 302 ml

139,00 € 455,00 € 566,00 € 509,00 € 139,00 € Sous-total :

41 978,00 € 137 410,00 €

467 998,00 €

135 ml 429 ml 429 ml

181,00 € 53,00 € 160,00 €

24 435,00 € 22 737,00 € 68 640,00 €

429 ml

170,00 €

72 930,00 €

185 436,00 €

235 346,00 € 102 818,00 €

34 340,00 € 49 714,00 € ml ml ml ml ml

19 500,00 € 1 for 1 for 1 for

40 512,00 € 94 380,00 €

5,00 €

333 106,00 €

153 718,00 € 467 998,00 € 115 812,00 €

72 930,00 € 124 260,00 € 429 270 429 429 200 572

ml ml ml ml ml ml

46,00 € 23,00 € 77,00 € 75,00 € 54,00 € 39,00 €

19 734,00 € 6 210,00 € 33 033,00 € 32 175,00 € 10 800,00 € 22 308,00 €

12 500,00 € 3 500,00 € 18 000,00 € Sous-total :

12 500,00 € 3 500,00 € 18 000,00 € 347 002,00 €

347 002,00 €

TOTAL :

815 000,00 €

815 000,00 €

300 m²

2 500,00 €

750 000,00 €

20 ml 20 ml 20 ml

139,00 € 640,00 € 139,00 € Sous-total :

2 780,00 € 12 800,00 € 2 780,00 € 768 360,00 €

50 000,00 € 296,00 €

50 000,00 € 5 920,00 €

20 ml

170,00 €

3 400,00 €

20 ml ml 20 ml 20 ml 20 ml

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

920,00 € 0,00 € 1 540,00 € 1 500,00 € 780,00 €

1 000,00 € Sous-total :

1 000,00 € 65 060,00 €

65 060,00 €

TOTAL :

833 420,00 €

833 420,00 €

34 000,00 € 1 for 1 for 1 for

19 500,00 € 1 for for 1 for

Réseaux divers (borne incendie et poste transfo) Appareil incendie

u

( 1.2 ) DESSERTE GD EQUIPEMENT-TERKEN-LOGEMENTS (280 ml sur 9 m) Préparation (Terrassement - démolition de surface...) Démolition surface 2520 m² Terrassements 3000 m³ Voirie Trottoir en asphalte de 1m50 280 ml Chaussée en enrobés de 6m00 280 ml Trottoir en asphalte de 1m50 280 ml Assainissement Réseau EP Bouche d'égout - caniveaux Tuyau "ø 200" E.U Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

15 156,00 €

( 1.3 ) EXTENSION RUE NEUVE : vers Bd Gambetta (202 ml sur 10 m) Préparation (Terrassement - démolition de surface...) Démolition surface 2020 m² Terrassements 2250 m³ Voirie Trottoir en asphalte de 2m00 202 ml Chaussée en enrobés de 6m00 202 ml Trottoir en asphalte de 2m00 202 ml

13 500,00 € 1 500,00 € 6 000,00 € Sous-total :

13 500,00 € 6 000,00 € 88 098,00 €

88 098,00 € 0,00 F

2 592,00 € Sous-total :

0,00 €

0,00 €

TOTAL :

463 797,00 €

463 797,00 €

8,00 € 15,00 €

65 160,00 € 20 160,00 € 45 000,00 € 241 360,00 €

111,00 € 640,00 € 111,00 € Sous-total :

31 080,00 € 179 200,00 € 31 080,00 € 306 520,00 €

280 ml 280 ml 280 ml

296,00 € 53,00 € 160,00 €

82 880,00 € 14 840,00 € 44 800,00 €

280 ml

170,00 €

47 600,00 €

280 108 280 280 280

46,00 € 23,00 € 77,00 € 75,00 € 39,00 €

12 880,00 € 2 484,00 € 21 560,00 € 21 000,00 € 10 920,00 €

12 500,00 € 3 000,00 € 6 000,00 € Sous-total :

12 500,00 € 3 000,00 € 6 000,00 € 280 464,00 €

280 464,00 €

TOTAL :

586 984,00 €

586 984,00 €

306 520,00 € 142 520,00 €

47 600,00 € 68 844,00 € ml ml ml ml ml

21 500,00 € 1 for 1 for 1 for

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

( 1.5 ) PASSAGE INFERIEUR SOUS VOIE FERREE Ouvrage d'art Passage inférieur Voirie Trottoir en asphalte de 2m00 Chaussée en enrobés de 6m00 Trottoir en asphalte de 2m00 Assainissement Poste de pompage Réseau EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Réseau "Eau" potable "ø 200" Réseau Télécom Réseau "Electricité" "BT" Divers (mobilier, signalétique, signalisation...) Signalisation

750 000,00 € 18 360,00 €

1 for 20 ml

768 360,00 € 55 920,00 € 3 400,00 € 4 740,00 €

1 000,00 € 1 for


( 1.6 ) PLACETTE du PARC (2935 m²) Plantations et noue petit arbre d'alignement 1u/7m Voirie Emmarchement pierre Revêtement en pierre

30 u 100 ml 2935 m²

700,00 € 300,00 € 150,00 € Sous-total :

Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Signalétique

10 u 50 ml

1 500,00 € 228,00 €

21 000,00 € 21 000,00 € 0,00 € 30 000,00 € 440 250,00 € 491 250,00 €

470 250,00 € 491 250,00 € 26 400,00 €

15 000,00 € 11 400,00 € 38 720,00 €

160 ml

242,00 €

38 720,00 €

160 ml 80 ml

46,00 € 23,00 €

7 360,00 € 1 840,00 €

22 500,00 € 2 000,00 € Sous-total :

22 500,00 € 2 000,00 € 98 820,00 €

98 820,00 €

TOTAL :

590 070,00 €

590 070,00 €

9 200,00 €

3 730 989,00 €

3 730 989,00 €

2 - ESPACES PAYSAGERS ( 2.1 ) LE QUAI (21000 m²) Préparation (Terrassement - démolition de surface...) Démolition de surface Voirie Revêtement en béton Assainissement Traversée EP Bouche d'égout - caniveaux Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation, traitement berge...) Renforcement berge - tête de palplanche - buttée - garde corps Mobilier Signalétique

( 2.3 ) LE DRAPE (21627 m²) Préparation (Terrassement - démolition de surface...) Terrassements déblais remblais Soutènement végétal Apport de terre végétale 0,30cm Modelé de terrain Plantations et noue Plantations mixtes herbacées graminées Voirie Cheminement piéton en béton 2m50 Assainissement Bassin de rétention Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Signalétique

168 000,00 €

21000 m²

8,00 €

168 000,00 €

21000 m²

82,00 €

35 280,00 € 13 230,00 €

100,00 € Sous-total :

310 000,00 € 358 510,00 €

100 ml

170,00 €

17 000,00 €

100 ml

46,00 €

4 600,00 €

13 500,00 € 2 000,00 € Sous-total :

13 500,00 € 24 000,00 € 2 000,00 € 61 100,00 €

61 100,00 €

TOTAL :

419 610,00 €

419 610,00 €

2810 m³ 2810 m²

8,00 € 3,00 €

22 480,00 € 8 430,00 €

2810 m²

100,00 €

310 000,00 € 3100 m²

Sous-total : 260 ml 650 ml

181,00 € 53,00 €

47 060,00 € 34 450,00 €

870 ml

242,00 €

210 540,00 €

39 500,00 € 1 for 240 ml 1 for

Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Clôture basse Signalétique

870 ml

46,00 €

40 020,00 €

750,00 € 58 500,00 € 12 000,00 € Sous-total :

652 500,00 € 58 500,00 € 12 000,00 € 1 055 070,00 €

40 020,00 € 723 000,00 €

2 945 070,00 €

1 055 070,00 € 2 945 070,00 €

53 600,00 €

2950 m² 2000 m³

8,00 € 15,00 €

23 600,00 € 30 000,00 €

2950 m²

135,00 € Sous-total :

398 250,00 € 451 850,00 €

150 ml

228,00 €

34 200,00 €

100 ml

242,00 €

24 200,00 €

100 ml

46,00 €

4 600,00 €

100,00 €

30 910,00 € 281 000,00 €

Sous-total :

281 000,00 € 311 910,00 €

100 ml

170,00 €

17 000,00 €

100 ml

46,00 €

4 600,00 €

311 910,00 € 17 000,00 € 4 600,00 € 31 500,00 €

1 for 250 ml 1 for

4 500,00 € 2 000,00 € Sous-total :

4 500,00 € 25 000,00 € 2 000,00 € 53 100,00 €

53 100,00 €

TOTAL :

365 010,00 €

365 010,00 €

8,00 € 24,00 €

12 000,00 € 378 000,00 €

925,00 €

32 375,00 €

100,00 €

1 890 000,00 € 81 510,00 € 210 540,00 €

870 ml 1 for 1 for

( 2.5 ) LE JARDIN DE TERKEN (2810 m²) Préparation (Terrassement - démolition de surface...) Terrassements déblais remblais Modelé de terrain Plantations et noue Aménagement des jardins et terre

358 510,00 € 17 000,00 € 4 600,00 €

1 722 000,00 € 1 722 000,00 € 1 890 000,00 €

TOTAL :

Assainissement Tuyau "ø 315" E.P Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier (banc - poubelle) Signalétique

Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Clôture basse Signalétique

48 510,00 €

8,00 € 3,00 €

4410 m³ 4410 m²

24 500,00 € 1 for 1 for

TOTAL "Quartier Nord - Boulevards et rues" - Temps 2 :

( 2.2 ) LE SKATE PARK (2950 m²) Préparation (Terrassement - démolition de surface...) Démolition de surface Terrassements Voirie Revêtement + élément coulé béton

( 2.4 ) LE JARDIN THEMATIQUE 1 (4410 m²) Préparation (Terrassement - démolition de surface...) Terrassements déblais remblais Modelé de terrain Plantations et noue Aménagement des jardins et terre

398 250,00 €

( 2.9 ) LA PLACE HAUTE (3500 m²) Préparation (Terrassement - démolition de surface...) Démolition surface Terrassements - remblais technique Plantations et noue arbre d'alignement 1u/7m Voirie Revêtement en pierre Assainissement Réseau EP Bouche d'égout - caniveaux Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Signalétique

1500 m² 15750 m³ 35 u 3500 m²

150,00 €

390 000,00 € 32 375,00 € 525 000,00 €

Sous-total :

525 000,00 € 947 375,00 €

120 ml 240 ml

254,00 € 53,00 €

30 480,00 € 12 720,00 €

240 ml

242,00 €

58 080,00 €

240 ml

46,00 €

11 040,00 €

947 375,00 € 43 200,00 € 58 080,00 € 11 040,00 € 22 000,00 €

1 for 1 for

451 850,00 € 34 200,00 €

18 000,00 € 4 000,00 € Sous-total :

18 000,00 € 4 000,00 € 134 320,00 €

134 320,00 €

TOTAL :

1 081 695,00 €

1 081 695,00 €

12,00 € 3,00 € 15,00 €

81 108,00 € 67 590,00 € 90 000,00 € 24 000,00 € 10 500,00 € 45 060,00 € 215 000,00 €

24 200,00 € 4 600,00 € 15 000,00 € 1 for 1 for

10 000,00 € 5 000,00 € Sous-total :

10 000,00 € 5 000,00 € 78 000,00 €

78 000,00 €

TOTAL :

529 850,00 €

529 850,00 €

381 765,00 €

m³ ml m³ m²

8,00 € 150,00 € 12,00 € 3,00 €

173 016,00 € 66 000,00 € 77 868,00 € 64 881,00 €

18000 m²

6,00 €

108 000,00 €

254,00 €

114 300,00 €

21627 440 6489,00 21627

108 000,00 € 114 300,00 €

450 ml

365 000,00 € 2500 m³

146,00 € Sous-total :

365 000,00 € 969 065,00 €

450 ml

170,00 €

76 500,00 €

450 ml

46,00 €

20 700,00 €

27 000,00 € 8 000,00 € Sous-total :

27 000,00 € 8 000,00 € 132 200,00 €

132 200,00 €

TOTAL :

1 101 265,00 €

1 101 265,00 €

969 065,00 € 76 500,00 € 20 700,00 €

( 2.10 ) LA PLAINE (22530 m²) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm Modelé de terrain Terrassements Plantations et noue Bosquets feuillus arbres isolés Bosquets résineux Prairie rustique noue (compris plantations) de 10m00 (pro 1m20) Voirie Cheminement piéton en béton 2m50 Passerelle piéton sur noue Aire de jeux enfant Aire de jeux en béton poreux Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Clôture haute aire de jeux Clôture basse aire de jeux enfant Mobilier Signalétique

6759 m³ 22530 m² 6000 m³ 80 15 22530 500

u u m² ml

300,00 € 700,00 € 2,00 €

290 40 680 1350

ml ml m² m²

254,00 €

430,00 €

238 698,00 €

294 560,00 €

494 910,00 € 175,00 € 135,00 € Sous-total :

73 660,00 € 120 000,00 € 119 000,00 € 182 250,00 € 1 028 168,00 €

290 ml

170,00 €

49 300,00 €

290 ml

46,00 €

13 340,00 €

160,00 € 100,00 €

54 000,00 € 12 000,00 € Sous-total :

43 200,00 € 15 000,00 € 54 000,00 € 12 000,00 € 186 840,00 €

186 840,00 €

TOTAL :

1 215 008,00 €

1 215 008,00 €

3 000,00 €

1 028 168,00 € 49 300,00 € 13 340,00 € 124 200,00 €

270 150 1 1

ml ml for for

35 000,00 € 1 for 1 for

Site intercommunal de l’Union - Plan Directeur 139


OPTIONS ( 2.11 ) LE CŒUR D'ILOT LOGEMENTS (5500 m²) Préparation (Terrassement - démolition de surface...) Démolition de surface Apport de terre végétale 0,30cm Modelé de terrain Plantations et noue Plantations mixtes herbacées graminées Voirie Cheminement piéton en béton 2m50 Assainissement Dévoiement reconstruction espierre Bassin de rétention Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Signalétique

5500 m² 1410 m³ 5500 m² 4700 m²

8,00 € 12,00 € 3,00 €

77 420,00 € 44 000,00 € 16 920,00 € 16 500,00 € 28 200,00 €

6,00 €

28 200,00 €

254,00 €

101 600,00 €

4 000,00 € 250,00 € Sous-total :

1 200 000,00 € 175 000,00 € 1 582 220,00 €

170,00 €

68 000,00 €

101 600,00 € 400 ml

1 375 000,00 € 300 ml 700 m³ 400 ml 400 ml

1 582 220,00 € 68 000,00 € 18 400,00 €

46,00 €

18 400,00 €

10 000,00 € 2 000,00 € Sous-total :

10 000,00 € 2 000,00 € 98 400,00 €

98 400,00 €

TOTAL :

1 680 620,00 €

1 680 620,00 €

12 000,00 € 1 for 1 for

TOTAL "Quartier Nord - Espaces paysagers" - Temps 2 :

9 338 128,00 €

10 136 028,00 €

( O.2 ) ESPACES EXTERIEURS DE LA TOUR MERCURE (31000 m²) Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm 2500 m³ Démolition surface 15000 m² Voirie - paysagers Accès 1 for Parvis 12000 m² Parking paysager réservoir 300pla 300 u Arbres isolés 80 u Aménagement paysager (mixte herbacée arbustif) 12000 m² Allée piétonne asphalte 3m00 400 ml Piste cyclable béton de 5m00 300 ml Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Fourreaux Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

150 000,00 €

12,00 € 8,00 €

30 000,00 € 120 000,00 €

25 000,00 € 82,00 €

25 000,00 € 984 000,00 € 375 000,00 € 100 000,00 € 96 000,00 € 123 600,00 € 137 400,00 € 1 991 000,00 €

1 841 000,00 €

1 250,00 € 1 250,00 € 8,00 € 309,00 € 458,00 € Sous-total :

1 991 000,00 € 45 300,00 €

15 u 100 ml

1 500,00 € 228,00 €

22 500,00 € 22 800,00 €

750 ml

170,00 €

127 500,00 €

750 ml 450 ml

46,00 € 23,00 €

34 500,00 € 10 350,00 €

12 500,00 € 3 500,00 € 4 000,00 € Sous-total :

12 500,00 € 3 500,00 € 4 000,00 € 237 650,00 €

237 650,00 €

TOTAL :

2 228 650,00 €

2 228 650,00 €

17 000 000,00 € Sous-total :

17 000 000,00 € 17 000 000,00 €

17 000 000,00 €

TOTAL :

17 000 000,00 €

17 000 000,00 €

8,00 €

20 800,00 €

127 500,00 € 44 850,00 € 20 000,00 € 1 for 1 for 1 for

3 - PASSERELLES ( 3.1 ) LA PASSERELLE VERS QUAI SUD Réhabilitation Culée sur pieux Garde corps Passerelle Eclairage par spot

284 000,00 € 2 40 20 10

u ml ml u

60 000,00 € 6 350,00 € 1 300,00 € Sous-total :

120 000,00 € 24 000,00 € 127 000,00 € 13 000,00 € 284 000,00 €

284 000,00 €

TOTAL :

284 000,00 €

284 000,00 €

TOTAL "Quartier Nord - Passerelles" - Temps 2 :

284 000,00 €

284 000,00 €

600,00 €

4 - ALEAS (4.1) Incidence* pollution selon LMCU Espace public Déplacement de déblais Déplacement déblais assainissement Déplacement déblais tranchée commune

( O.4 ) PASSAGE INFERIEUR PONT DES COUTEAUX Ouvrage sous canal et pont des couteaux

17 000 000,00 € 1 for

( O.5 ) LE PARKING (150 ml sur 15 m) Préparation (Terrassement - démolition de surface...) Démolition de surface Plantations et noue Arbres d'alignement Voirie Parking réservoir 125 places

2600 m² 20 u

1 250,00 €

25 000,00 €

125 u

1 250,00 €

156 250,00 € 202 050,00 €

Sous-total : 241 700,00 € 2874 m³ 1233 m³ 727 m³

50,00 € 50,00 € 50,00 € Sous-total :

143 700,00 € 61 650,00 € 36 350,00 € 241 700,00 €

241 700,00 €

TOTAL :

241 700,00 €

241 700,00 €

TOTAL "Quartier Nord - Aleas" - Temps 2 :

241 700,00 €

241 700,00 €

Assainissement Bouche d'injection et filtre Exutoire EP Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Tranchée commune Divers (mobilier, signalétique, signalisation...) Mobilier Signalisation Signalétique

( O.6 ) LES JARDINS FAMILIAUX Préparation (Terrassement - démolition de surface...) Apport de terre végétale 0,30cm Modelé de terrain Démolition de surface Divers Clôtures Cabanons Cheminements piéton stabilisé 1m00 Cheminement piéton béton 2m00 Eclairage public Candélabre + câbles + chambres Réseaux divers (tranchée - fourreaux - réseaux) Réseau "Eau" potable "ø 60" Tranchée commune Divers (mobilier, signalétique, signalisation...) Signalétique

20 800,00 € 25 000,00 € 156 250,00 €

1 500,00 € 228,00 €

9 000,00 € 5 700,00 €

150 ml

170,00 €

25 500,00 €

150 ml

46,00 €

6 900,00 €

2 500,00 € 1 000,00 € 2 000,00 € Sous-total :

2 500,00 € 1 000,00 € 2 000,00 € 52 600,00 €

52 600,00 €

TOTAL :

254 650,00 €

254 650,00 €

12,00 € 3,00 € 8,00 €

18 000,00 € 15 000,00 € 40 000,00 €

65,00 € 750,00 € 82,00 € 214,00 € Sous-total :

76 050,00 € 141 000,00 € 53 300,00 € 64 200,00 € 407 550,00 €

450 ml

170,00 €

76 500,00 €

650 ml 450 ml

50,00 € 46,00 €

32 500,00 € 20 700,00 €

2 000,00 € Sous-total :

6 000,00 € 135 700,00 €

135 700,00 €

TOTAL :

543 250,00 €

543 250,00 €

TOTAL "Quartier Nord - Optione" - Temps 2 :

20 026 550,00 €

19 228 650,00 €

TOTAL Temps 2 :

33 621 367,00 €

33 621 367,00 €

25 500,00 € 6 900,00 € 5 500,00 € 1 for 1 for 1 for

1500 m³ 5000 m² 5000 m²

73 000,00 €

334 550,00 € 1170 188 650 300

ml u ml ml

407 550,00 € 76 500,00 € 53 200,00 € 6 000,00 €

3 for

TOTAL GENERAL

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

202 050,00 € 14 700,00 €

6 u 25 ml

:

78 003 081,00 €


6

RÉCAPITULATIF PAR TYPE D’ESPACE* voirie neuve

1 - BOULEVARDS ET RUES ( 1.1 ) NOUVEAU BOULEVARD (675 ml sur 21 ou 28 m) ( 1.2 ) PASSAGE INFERIEUR SOUS VOIE FERREE ( 1.3 ) RUE DE NANTES : réaménagement (575 ml sur 17 m) ( 1.3bis) PLACE DE LA MAISON DU PARC (2365 m²) ( 1.5 ) RUES RESIDENTIELLES (95 ml sur 15 m) ( 1.6 ) RUE NEUVE : hors structure sous voie ferrée (190 ml sur 28,50 ou 11m) ( 1.8 ) RUE STEPHENSON (115 ml sur 11,86 m) ( 1.9 ) RUE DE LA TOSSEE SUD (105 ml sur 12,75 m) (1.10) RUE CADEAU (110 ml sur 12 m) ( 1.11 ) COURS DE L'INDUSTRIE (190 ml sur 20 m) (1.12) COURS DE L'INDUSTRIE (90 ml sur 36 m) Total :

3 859 821,00 € 4 861 080,00 € 2 152 648,00 € 462 720,00 € 293 395,00 € 833 721,00 € 230 981,00 € 224 911,00 € 250 856,00 € 501 260,00 € 668 115,00 € 14 339 508,00 €

Total :

101 760,00 € 101 760,00 €

Total :

6 999 750,00 € 6 999 750,00 €

TOTAL Quartier Nord :

21 441 018,00 €

Total :

229 249,00 € 549 593,00 € 849 722,00 € 283 000,00 € 1 911 564,00 €

Total :

534 068,00 € 175 200,00 € 125 260,00 € 834 528,00 €

Total :

1 568 010,00 € 1 568 010,00 €

TOTAL Quartier Sud :

4 314 102,00 €

TOTAL Temps 0 :

25 755 120,00 €

2 - ESPACES PAYSAGERS ( 2.1 ) PREVERDISSEMENT PLAINE ( 11200 m² ) 4 - ALEAS ( 4.1 )

INCIDENCE* POLLUTION selon étude fournie par LMCU

Réhabilitation

Espaces verts

Place

parcelle

Ouvrages d’art et divers

3 859 821,00 € 4 861 080,00 € 2 152 648,00 € 462 720,00 € 293 395,00 € 833 721,00 € 230 981,00 € 224 911,00 € 250 856,00 € 501 260,00 € 668 115,00 € 101 760,00 € 6 861 780,00 €

Surface aménagée 18 900 m² 9 775 m² 2 365 m² 1 425 m² 3 278 m² 1 364 m² 1 339 m² 1 320 m² 3 800 m² 3 240 m² 46 805 m² 11 200 m² 11 200 m²

137 970,00 € 58 005 m²

Temps 0 : QUARTIER SUD 5 - BOULEVARDS ET RUES ( 5.1 ) RUE JEAN BART 1 (102 ml sur 10 m) ( 5.1 bis ) RUE JEAN BART 2 (175 ml sur 18 m) ( 5.2 ) LA RUE GUINGUETTE 1 et 2 (331 ml sur 14,5 m) ( 5.3 ) LA RUE DES ANGES (164 ml sur 10 m) 6 - ESPACES PAYSAGERS ( 6.1 ) LA PLACE DU MARCHE DE L'ALMA (1986 m²) ( 6.3 ) TRAITEMENT PROVISOIRE DES PARCELLES DP4 et DP5 (19000 m²) ( 6.4 ) LA LISIERE (150 ml sur 14 m) 7 - OUVRAGES - BATIMENTS ( 7.1 ) STADE

229 249,00 € 549 593,00 € 849 722,00 € 283 000,00 €

1 020 m² 3 150 m² 4 800 m² 1 640 m² 10 610 m² 534 068,00 €

1 986 m² 19 000 m² 2 100 m² 23 086 m²

175 200,00 € 125 260,00 €

1 568 010,00 €

11 500 m² 11 500 m² 45 196 m²

12 184 371,00 €

5 604 681,00 €

364 990,00 €

996 788,00 €

1 743 210,00 €

4 861 080,00 €

103 201 m²

* hors îlot Vanoutryve

Site intercommunal de l’Union - Plan Directeur 141


Temps 1 : QUARTIER NORD

voirie neuve

1 - BOULEVARDS ET RUES ( 1.1 ) PROMENADE DU PARC (102ml sur 18,50 m) ( 1.2 ) RUE DE ROUBAIX/TOURCOING : réaménagement (100 ml sur 28,20 m) ( 1.3 ) RUE DE ROUBAIX/TOURCOING: réaménagement (336 ml sur 28 m) 1.3 bis PLACE DE L'UNION (1480 m²) ( 1.4 ) RUE NEUVE (115 ml sur 28,50 m) ( 1.5 ) PARVIS DE LA TOSSEE (1930 m²) ( 1.6 ) NOUVEAU BOULEVARD (658 ml sur 28 m) Total :

398 437,00 € 788 986,00 € 1 603 811,00 € 310 580,00 € 753 314,00 € 383 840,00 € 3 505 960,00 € 7 744 928,00 €

Total :

1 975 578,00 € 1 632 720,00 € 1 462 200,00 € 137 840,00 € 5 208 338,00 €

Total :

284 000,00 € PM 284 000,00 € 714 500,00 € 714 500,00 €

600 560,00 €

Total :

1 872 696,00 € 1 267 880,00 €

Total :

1 872 696,00 € 1 267 880,00 € PM 3 140 576,00 €

TOTAL Quartier Nord :

17 092 342,00 €

Total :

654 390,00 € 280 671,00 € 372 355,00 € 1 307 416,00 €

Total :

226 836,00 € 226 836,00 €

TOTAL Quartier Sud :

1 534 252,00 €

TOTAL Temps 1 :

18 626 594,00 €

2 - ESPACES PAYSAGERS ( 2.1 ) LE QUAI (12539 m²) ( 2.2 ) LA DARSE et PARKING (3520 m²) ( 2.3 ) LE DRAPE (22800 m²) (2.3 bis) LE JARDIN (980 m²) 3 - PASSERELLES ( 3.1 ) LA PASSERELLE AU DESSUS DE LA DARSE ( 3.2 ) LA PASSERELLE VERS QUAI SUD 4 - ALEAS ( 4.1 ) OPTIONS ( O.1 ) ( O.1bis ) ( O.3 )

INCIDENCE* POLLUTION selon étude fournie par LMCU

VOIE DE DESSERTE QUARTIER ANCIENNE GARE OUEST (650 ml sur 15 m) VOIE DE DESSERTE QUARTIER ANCIENNE GARE OUEST PARKING (600 ml sur 15 m) PARVIS DU COLLEGE

Réhabilitation

Espaces verts

Place

parcelle

Ouvrages d’art et divers

398 437,00 €

1 887 m² 2 820 m² 9 408 m² 1 480 m² 5 415 m² 1 930 m² 18 424 m² 41 364 m²

788 986,00 € 1 603 811,00 € 310 580,00 € 753 314,00 € 383 840,00 € 3 505 960,00 €

1 975 578,00 € 1 632 720,00 € 1 462 200,00 € 137 840,00 €

12 539 m² 3 520 m² 22 800 m² 980 m² 39 839 m²

284 000,00 € PM

113 940,00 €

9 750 m² 9 000 m² PM 18 750 m² 99 953 m²

Temps 1 : QUARTIER SUD 5 - BOULEVARDS ET RUES (5.1) LA RUE TURGOT (210 ml sur 19,50 m) (5.2) RUE DE WAGRAM (143 ml sur 15 m) (5.3) RUE ROSSINI (120 ml sur 19.50 m)

6 - ESPACES PAYSAGERS ( 6.1 ) PASSAGE PIETON (175 ml sur 6 m)

* hors îlot Vanoutryve

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

654 390,00 € 280 671,00 € 372 355,00 €

4 095 m² 2 145 m² 2 340 m² 8 580 m²

226 836,00 €

1 050 m² 1 050 m² 9 630 m²

8 310 990,00 €

3 700 213,00 €

2 339 253,00 €

2 359 418,00 €

0,00 €

1 916 720,00 €

109 583 m²


Temps 2 : QUARTIER NORD

voirie neuve

Réhabilitation

Espaces verts

Place

parcelle

QUARTIER NORD 1 - BOULEVARDS ET RUES ( 1.1 ) PROMENADE DU PARC (231 ml sur 17,4 m) ( 1.2 ) DESSERTE GRAND EQUIPEMENT - TERKEN - LOGEMENTS (280 ml sur 9 m) ( 1.3 ) EXTENSION RUE NEUVE : vers Bd Gambetta (202 ml sur 10 m) ( 1.4 ) RUES RESIDENTIELLES (286 ml sur 15 m) ( 1.5 ) PASSAGE INFERIEUR SOUS VOIE FERREE ( 1.6 ) PLACETTE PARC (2935 m²)

463 797,00 € 586 984,00 € 441 718,00 € 815 000,00 € 833 420,00 € 590 070,00 € 3 730 989,00 €

Total : 2 - ESPACES PAYSAGERS ( 2.1 ) LE QUAI (21000 m²) ( 2.2 ) LE SKATE PARK (2950 m²) ( 2.3 ) LE DRAPE (21627 m²) ( 2.3bis ) LE DRAPE GRAND EQUIPEMENT (14500 m²) ( 2.4 ) LE JARDIN THEMATIQUE 1 (4410 m²) ( 2.5 ) LE JARDIN DE TERKEN (2810 m²) ( 2.9 ) LA PLACE HAUTE (3500 m²) ( 2.10 ) LA PLAINE (22530 m²) ( 2.11 ) LE CŒUR D'ILOT LOGEMENTS (5500 m²)

4 - ALEAS ( 4.1 ) OPTIONS ( O.2 ) ( O.4 ) ( O.5 ) ( O.6 )

463 797,00 € 586 984,00 € 441 718,00 € 815 000,00 € 833 420,00 € 590 070,00 €

2 945 070,00 € 529 850,00 € 1 101 265,00 €

2 945 070,00 € P.M

Total :

419 610,00 € 365 010,00 € 1 081 695,00 € 1 215 008,00 € 1 680 620,00 € 9 338 128,00 €

Total :

284 000,00 € 284 000,00 €

Total :

241 700,00 € 241 700,00 €

Total :

2 228 650,00 € 17 000 000,00 € 254 650,00 € 543 250,00 € 20 026 550,00 €

TOTAL Quartier Nord :

33 621 367,00 €

TOTAL Temps 2 :

33 621 367,00 €

TOTAL GENERAL :

78 003 081,00 €

INCIDENCE* POLLUTION selon étude fournie par LMCU

ESPACES EXTERIEURS DE LA TOUR MERCURE (31000 m²) PASSAGE INFERIEUR PONT DES COUTEAUX LE PARKING (150 ml sur 15 m) LES JARDINS FAMILIAUX (5000 m²)

4 020 m² 2 520 m² 2 020 m² 4 290 m² 2 935 m² 15 785 m² 21 000 m² 2 950 m² 21 627 m² 14 500 m² 4 410 m² 2 810 m² 3 500 m² 22 530 m² 5 500 m² 98 827 m²

529 850,00 € 1 101 265,00 €

P.M

3 - PASSERELLES ( 3.1 ) LA PASSERELLE VERS QUAI SUD

Ouvrages d’art et divers

419 610,00 € 365 010,00 € 1 081 695,00 € 1 215 008,00 € 1 680 620,00 €

284 000,00 €

167 450,00 €

74 250,00 €

2 228 650,00 € 17 000 000,00 € 254 650,00 € 543 250,00 €

33 000 m² 2 250 m² 5 000 m² 33 000 m² 147 612 m²

3 104 788,00 € 23 600 149,00 €

0,00 € 9 304 894,00 €

4 966 690,00 € 7 670 933,00 €

4 616 835,00 € 7 973 041,00 €

2 815 634,00 € 4 558 844,00 €

18 117 420,00 € 24 895 220,00 €

147 612 m² 360 396 m²

* hors îlot Vanoutryve

Site intercommunal de l’Union - Plan Directeur 143


6

RATIOS

Hypothèses : • ‘surface ZAC’ selon périmètre approximatif des zones desservies par les aménagements projetés • ‘surface espace aménagé’ selon emprises des zones traitées dans le cadre de travaux • surface hors îlot Vanoutryve Voirie (ml)

Coût global Temps 0

Nord

21 441 018,0 €

2070

Surface ZAC (ha)

10 358 €/ml

14,7 ha

145,56 €/m²

Surface espace aménagé (ha) 5,8 ha

369,64 €/m²

Temps 0

Sud

4 314 102,0 €

752

5 737 €/ml

8,3 ha

51,98 €/m²

4,5 ha

95,45 €/m²

Temps 1

Nord

17 092 342,0 €

2852

5 993 €/ml

11,0 ha

155,38 €/m²

10,0 ha

171,00 €/m²

Temps 1

Sud

1 534 252,0 €

473

3 244 €/ml

3,1 ha

49,81 €/m²

1,0 ha

159,32 €/m²

Temps 2

Nord

33 621 367,0 €

-

-

22,3 ha

150,50 €/m²

14,8 ha

227,77 €/m²

78 003 081,0 €

6147

12 690 €/ml

59,5 ha

131,21 €/m²

36,0 ha

216,44 €/m²

53 740 571,0 €

6147

8 743 €/ml

59,5 ha

90,40 €/m²

34,9 ha

154,03 €/m²

47 573 445,0 €

6147

7 739 €/ml

59,5 ha

80,02 €/m²

29,7 ha

160,10 €/m²

Total Général

Total hors ouvrages (1.2, 1.5 Temps 2, O.4) et stade (7.1)

Total hors ouvrages et options

Prix H.T.

REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006


Site intercommunal de lâ&#x20AC;&#x2122;Union - Plan Directeur 145


REICHEN ET ROBERT & Associés - Agence Pôles - BET Confluences - BET Misson Morel // Mai 2006

Profile for SEM Ville renouvelée

Plan directeur Reichen et Robert 2006  

En 2006, l'équipe Reichen et Robert présente le plan directeur d'aménagement de l'Union.

Plan directeur Reichen et Robert 2006  

En 2006, l'équipe Reichen et Robert présente le plan directeur d'aménagement de l'Union.

Profile for lunion
Advertisement