Issuu on Google+

LTH | LUNDS TEKNISKA HÖGSKOLA | LUNDS UNIVERSITET

UTBILDNINGSKATALOG 2012

Framsidan av broschyren föreställer en QR-kod. Hur fungerar den? Ta ett foto på QR-koden med hjälp av din mobil eller surfplatta. Telefonen/plattan laddar då en webbsida, film eller text. För att det ska fungera så behöver du en QR-kodläsare. För iPhone eller iPad finns t ex programmet Scan och för Android finns bland annat QR Droid och Barcode Scanner.

LUNDS TEKNISKA HÖGSKOLA – LUNDS UNIVERSITET – UTBILDNINGSKATALOG 2012 Layout Robin Poulsen, LTH:s kansli Produktion Matilda Roijer, LTH:s kansli Bilder Anders Frick, Bertil Alm, Erik Hagman – Agent Molly, Gunnar Menander, Liv Andersson, Mats Nygren, SXC m.fl Illustration Anna Carlsson Innehållet i denna katalog är baserat på den fakta som fanns att tillgå vid trycktillfället Tryck Sörmlands Grafiska AB Tryckt på miljövänligt papper Tryckår 2011

Innehåll Vi öppnar dörrarna till framtiden  

6

HÖGSKOLEINGENJÖRSUTBILDNINGAR 

Världsledande forskning  

7

Byggteknik med arkitektur  

57

LTH i världen  

8

Byggteknik – Järnvägsteknik  

59

LTH – en högskola nära näringslivet  

8

Byggteknik – Väg & trafikteknik  

61

Det här kan du bli  

9

Datateknik  

63

Elektroteknik med automationsteknik  

65

CIVILINGENJÖRSUTBILDNINGAR  Bioteknik  

11

Tekniskt basår och Teknisk bastermin  67

Datateknik  

13

Livsmedelsteknisk högskoleutbildning  69

Ekosystemteknik  

15

Elektroteknik  

17

BRA ATT VETA 

Industriell ekonomi  

19

Campus Helsingborg – högskolan vid havet   55

Informations- och kommunikationsteknik  

21

Studera utomlands  

70

Kemiteknik  

23

Lund – studenternas stad 

72

Lantmäteri  

25

Prisade LTH-studenter

74

Maskinteknik  

27

Så här fungerar det på LTH  

76

Maskinteknik – teknisk design  

29

Moderna yrkesutbildningar  

78

Medicin och teknik  

31

Studenten i fokus  

79

Riskhantering  

33

Bostad  

80

Teknisk fysik  

35

Anmälan och behörighet  81

Teknisk matematik  

37

Kontaktinformation & viktiga datum  

Teknisk nanovetenskap  

39

Väg- och vattenbyggnad  

41

Kinainriktningen  

43

Technology Management  

45

Arkitekt  47 Brandingenjör  49 Industridesign – kandidatutbildning  51 Industridesign – masterutbildning  53

82

4

LTH – kunskapsarenan för tuffa utmaningar Dagens och morgondagens ingenjörer står inför stora utmaningar. Maten och hälsan är i fokus som aldrig förr. Utvecklingen av nya läkemedel och funktionella livsmedel kommer att sysselsätta civilingenjörer inom livsmedels- och bioteknik. Kraven på ett mera energisnålt boende blir en utmaning för arkitekter och väg- och vatteningenjörer.

Behovet av fordonsmotorer och många andra produkter som belastar miljön mindre

blir något för fysiker och produktutvecklare inom maskinteknik att ta sig an. Civilingenjörer inom bioteknik och kemi får chansen att utforska möjligheterna med biogas, etanol, vätgas och andra biodrivmedel. När städerna växer och förtätas behövs en genomtänkt infrastruktur, något som civilingenjörer i väg- och vattenbyggnad kan bidra med.

Medicinsk teknik är ett snabbt växande område. Här behövs civilingenjörer med god

förståelse för både teknik och människokroppen. Ingenjörer med kunskap inom IT och datavetenskap behövs när framtidens apparater och system byggs ihop till ett komplicerat samspel av olika sorters teknik.

Kemisterna har en viktig uppgift när det handlar om att utveckla gödningsmedel

och bekämpningsmedel som harmonierar med det ekologiska systemet. Avfallsfrågan kommer inte bara att sysselsätta civilingenjörer inom ekosystemteknik och industriell ekonomi utan även ingenjörer inom en rad andra områden. För nu räcker det inte med att vara bra på att återvinna material och energi ur avfallet. Om vi inte hittar fler jordklot måste vi hitta en väg för att minska avfallet även under perioder med god ekonomisk tillväxt. För att bara ta några få exempel.

Många som nu börjar sin bana på LTH kommer att spela en roll när vi ska förverkliga

visionen om att skapa tillväxt och välstånd på långsiktigt hållbar grund.

5

Vi öppnar dörrarna till framtiden LTH har funnits i 50 år. Det är både ungt och gammalt. LTH är tillräckligt gammal för att ha kunnat etablera en mycket framgångsrik forskningsmiljö med hjälp av en stark grundutbildning. Styrkan kommer från duktiga lärare och studenter. Samtidigt är LTH tillräckligt ungt för att vara organiserad på ett sätt som svarar mot samhällets behov. Vi kan och vill ta oss an dagens utmaningar som rör klimat, energi och en hållbar samhällsutveckling. LTH är en del av Lunds universitet. Det innebär att dörren är öppen för att ta del av hela universitetets utbud. Vi befinner oss i den mycket expansiva Öresundsregionen, vilket öppnar ännu fler dörrar. Öresundsbron har skapat en större närhet till Europa. Detta är bara några av de framgångsfaktorer som gjort att flera stora forskningsanläggningar kommer att etableras i Lund: ESS (European Spallation Source), MaxIV (synkrotronanläggning) och Ideon Medicon Village. ESS är ensam en av de största forskningssatsningar som gjorts i Sverige och i Europa. Den tekniska utvecklingen i samhället har gjort att vi har ett alltmer varierat utbud av utbildningsprogram för att täcka näringslivets behov. Varje utbildningsprogram har dessutom flera olika avslutande specialiseringar som är sprungna ur LTHs forskning. Forskningsanknytningen i dessa kurser är därför naturlig. Utbildningen vid LTH skapar ett mervärde genom att programmen ger både en akademisk examen i form av en Bachelor- eller en Masterexamen och en yrkesexamen som civilingenjör, högskoleingenjör, brandingenjör, arkitekt eller industridesigner. LTH har alla de viktigaste utbildningsprogrammen inom teknikområdet och vi är en teknisk högskola med en sällsynt stor bredd på kursutbudet. Studierna planeras och genomförs med stor omsorg.

6

LTH har mycket höga pedagogiska ambitioner med en egen pedagogisk utvecklingsgrupp, en pedagogisk akademi av lärare med stort engagemang för undervisning och ett gediget kvalitetssystem. Utöver detta finns en professionell studie- och karriärservice. Studier kräver rekreation vilket är lätt att finna i Lund med sitt unika studentliv. På nationer möts studenter från vitt skilda utbildningar och i teknologkårens olika sektioner byggs ett socialt nätverk redan från första dagen. Som student på LTH har du stora möjligheter att påverka utbildningen. Just nu satsar vi mycket på att skapa ännu bättre studiemiljöer för att underlätta studierna. Det görs i mycket nära samarbete med studenterna. Vi hälsar dig välkommen in i LTH. Dörren är öppen! Du kommer också snart att märka att du har många valmöjligheter både under utbildningen och när du är klar. Den breda utbildningen gör att du har många dörrar öppna när du väljer jobb i framtiden.

Välkommen och lycka till!

Anders Axelsson Rektor LTH

Världsledande forskning På LTH bedrivs forskning av hög internationell klass. Inom många vetenskapsområden är vi världsledande, bland annat inom nanoteknologi, energiomvandling, laserfysik, reglerteknik och aerosolteknologi. Lunds universitet har flera gånger fått mest anslag till grundläggande forskning jämfört med andra svenska universitet och högskolor. Den höga kvaliteten kommer dig som student till del på flera sätt. Du vet att utbildningen håller hög kvalitet, att dina lärare är kunniga inom sina ämnesområden och att du alltid har tillgång till den senaste kunskapen. Dessutom har du möjlighet att följa unika forskningsprojekt på nära håll. Exempel på ny teknik som utvecklats ur forskning på LTH är det medicinska ultraljudet, bläckstråletekniken, trådlös överföring via Bluetooth och hälsobefrämjande livsmedel som Proviva.

Ingen vet vad framtiden bär i sitt sköte men på LTH arbetar forskarna nu för att skapa sensorer som ur en droppe blod på ett ögonblick kan hitta alla dina sjukdomar, datalagring och processande i ännu mindre och snabbare och tillförlitliga format än hittills, handikapphjälpmedel som kan förenas med mänsklig värdighet, laserstrålar som både kan hitta och utplåna tumörer. En skara matematiker arbetar med bildanalys och deras forskning tillämpas inom trafiksäkerhet, medicin och mobiltelefoni. Framtidens klimat- och energifrågor är i fokus för många forskningsprojekt. Flera handlar om hur skogs- och växtavfall kan omvandlas till biodrivmedel, kemikalier och plaster. Andra forskare ser till att förbränningsmotorerna blir renare och effektivare. Vi arbetar också för att framtidens design ska bli människo- och naturvänlig, framtidens byggnader energisnåla, vackra och bekväma.

7

LTH i världen LTH och Lunds universitet rankas bland de 100 bästa universiteten i världen och bland de allra bästa i Europa. På vissa forskningsområden är vi i världstoppen. Våra forskare utbyter resultat med kollegor över hela världen och åtnjuter hög internationell status. Det leder också till att flera hundra utländska studenter årligen reser hit och deltar i våra utbildningar. Nästan lika många från LTH blir utbytesstudenter utomlands.

Även lärarna har internationella utbytesprogram där de hämtar hem nya fackkunskaper och pedagogiska erfarenheter. Några av LTHs tvååriga masterprogram vänder sig speciellt till internationella studenter, inte minst från utvecklingsländer. Dessutom erbjuder LTH studieprogram där delar av utbildningen är förlagd till Kina.

LTH – en högskola nära näringslivet Våra utbildningar förnyas ständigt för att möta de krav som ställs på oss av studenter, näringsliv och samhälle. Därför har kontakten med samhälle och näringsliv alltid varit en naturlig del av vår verksamhet. I Lund finns en mängd världsledande företag, till exempel Alfa Laval, Ericsson, Sony Ericsson, Gambro och Tetra Pak. Det är inte heller någon slump att forskningsbyn Ideon ligger bara ett stenkast från LTH. Här har nya företag baserade på forskningsidéer sedan länge haft möjlighet att växa sig starka och lönsamma.

8

Som student vid LTH hamnar du mitt i en värld av nytänkande, uppfinningsrikedom och entreprenörskap. I vårt närområde arbetar inte mindre än 10.000 personer inom vetenskapsområden som medicin, teknik, naturvetenskap och ekonomi! Nya stora forskningsanläggningar, MAX IV och ESS, ska byggas i anslutning till LTH. Forskare från hela världen kommer att arbeta här, bland annat med materialforskning. Detta sker i en expanderande Öresundsregion. LTHs framtid ser mycket spännande ut!

Det här kan du bli Vad du vill göra efter dina studier, det har du säkert redan en idé om. Våra utbildningar leder fram till ett antal examina. Oavsett vilken väg du väljer på LTH får du en så gedigen utbildning att du kan välja mellan ett flertal yrken. Här är några tips. Civilingenjör En civilingenjör utvecklar och använder ny kunskap och teknik. Som civilingenjör kan du arbeta med utveckling av nya produkter eller samhällsbyggnad, men även med forskning, projektledning, undervisning eller kommunikation. Oavsett inriktning har alla civilingenjörer förmågan att snabbt hämta in nya kunskaper och kreativt lösa problem – ofta på nya sätt. Som civilingenjör är det inte alls otroligt att du hamnar i en ledande position, antingen på ett privat företag eller inom stat och kommun. Svenska civilingenjörer är mycket eftertraktade utomlands. Högskoleingenjör

Civilingenjör i riskhantering Utbildningen i riskhantering vid LTH är ett avslutande program och är den första och enda i sitt slag i Sverige. Som civilingenjör i riskhantering blir din uppgift att identifiera och bedöma risker för att sedan föreslå åtgärder som minskar dem. Du får även arbeta med ledningssystem som är ett verktyg för att gå ”från ord till handling” så att verksamheten verkligen förändras så att olyckor kan undvikas. Forskare Att bli forskare passar dig som har ett specifikt intresseområde och en aldrig sinande vetgirighet. Forskare blir du genom att efter din grundexamen fortsätta på en forskarutbildning. När du är färdig är du teknologie doktor eller teknologie licentiat. Efter din doktorsexamen blir du efterfrågad för din specialistkunskap av såväl högskola och offentlig sektor som näringslivet.

En högskoleingenjör använder och utvecklar känd kunskap och teknik. Satsar du på att bli högskoleingenjör väljer du en utbildning som är efterfrågad. Dina kunskaper i bland annat ekonomi, arbetsmiljö, IT och projekthantering ger dig en bred arbetsmarknad. Högskoleingenjörer hittar du idag inte bara inom de traditionellt tekniska branscherna utan även inom till exempel design, miljö, vård, energi, medier, tillverkning, livsmedel och medicin. Prognoser visar att behovet av högskoleingenjörer kommer att växa än mer de närmaste åren. Arkitekt Om du väljer att bli arkitekt är det sannolikt att du får arbeta med att gestalta byggnader och miljöer som omger oss, såväl övergripande som i minsta detalj. Kanske startar du en egen arkitektbyrå. Numera är arkitektens arbetsfält även vidgat till forskning och utveckling, samhälls- och kretsloppsplanering, fastighetsförvaltning eller projektledning. Arkitekter anlitas också till utredningsarbete åt stat och kommun. Industridesigner Efter avslutade studier kan du arbeta med teknisk och konstnärlig utformning av nyttoprodukter, avsedda att tillverkas i serier. Din förmåga att visualisera idéer och kvaliteter kommer väl till pass. Din uppgift blir också att förena alla de professioner som är engagerade i framtagandet av dina produkter. Vilken sorts produkter du vill arbeta med är öppet. Några exempel är möbler, inredningsdetaljer, tjänster, förpackningar, transportmedel och verktyg. Brandingenjör Har du bestämt dig för att bli brandingenjör blir du del av en ännu ganska liten, men exklusiv, skara. Drygt hälften arbetar inom den kommunala räddningstjänsten. De andra har sökt sig till bland annat konsultföretag, statlig verksamhet och till försäkringsbranschen.

9

Johan Edfeldt – Asset Management Engineer, DONG Energy, Danmark

Helena Sjöström – student

För mig är LTH tre saker: kunskap, glädje och vänner. LTH är en unik plattform som erbjuder såväl bredd som djup och ger dig all världens möjligheter. Det finns så mycket roligt och intressant att syssla med och som civilingenjör får du verktygen att hantera det mesta. Jag valde att utbilda mig till civilingenjör på grund av två skäl: att utvecklas som människa och för att få spännande valmöjligheter på arbetsmarknaden. Jag är övertygad om att det alltid kommer att finnas behov av problemlösare. Oavsätt vad man gör så är det bra att vara förberedd och som civilingenjör är du just förberedd.

Redan första året på LTH får du ett smakprov, både på vad senare årskurser kommer att innehålla och vad arbetslivet kan handla om. Många civilingenjörer tycker det är svårt att få ett grepp om vilka jobbmöjligheter som finns efter examen, även långt in i utbildningen. Detta är något som programledningen för bioteknik arbetar mycket med genom att koppla kursinnehållet till verkligheten.

Nu arbetar jag som Asset Management Engineer på DONG Energy i Danmark. Mina arbetsuppgifter är mycket varierande och inkluderar för tillfället analys och optimering av logistiklösningar för underhåll av vindturbiner till havs där såväl teknik som ekonomi har stor betydelse. Resultaten kommer att användas som finansieringsunderlag till investerare där jag även är med i processen. Ingen dag är den andra lik och det är en synnerligen både utvecklande och utmanande tjänst.

Anledningen till att jag valde en civilingenjörsutbildning kommer möjligtvis att låta lite som en klyscha. Som civilingenjör har du framförallt tre fördelar jämfört med många andra utbildningar - valmöjlighet, arbetsmarknad och lön. Det är också dessa argument som var avg��rande för mig.

ÅRSKURS 1

ÅRSKURS 2

ÅRSKURS 3

Biokemi

Biokemi

Biokemi

Bioteknik

Bioteknik

Kemi

Specialiseringar inom: Molekylär bioteknik

Bioteknik Matematik

Matematik

ÅRSKURS 4 & 5

Bioprocess Livsmedel Läkemedel

Matematik

Projektarbete

Kemi

Kemiteknik

Ekonomi

Kemi Valbart

10

Kemiteknik

Valbart

Valfria kurser

Examensarbete

300 hp | 5 år

www.bioteknik.lth.se | 046-222 78 53 | bioteknik@kansli.lth.se Master of Science in Engineering  |  Biotechnology

Bioteknik 

11

–– Bioteknik i Lund ger dig en bred utbildning inom viktiga framtidsområden. –– Nya läkemedel, en bättre och säkrare miljö samt hälsosammare mat är några områden som behöver biotekniker. –– Bioteknik erbjuder ett brett urval av specialiseringar som bioprocess, molekylärbioteknik, livsmedel och läkemedel. Alla områden har en etablerad arbetsmarknad och goda forskningsmiljöer. –– Undervisningen på bioteknik i Lund ges i en miljö där det finns världsledande forskning inom många områden och engagerade lärare som satsar på pedagogisk utveckling av utbildningen.

Bioteknik är biologi, kemi och teknik i samverkan. Som biotekniker arbetar du med livets allra minsta byggstenar. Med kunskaper i såväl biokemi, mikrobiologi och genteknik som teknikrelaterade ämnen utvecklar du nya produkter och processer med naturens egna system som grund. En biotekniker ser till att brödet du åt av i morse håller sig färskt lite längre, att vitamintabletterna ger dig rätt mängd vitaminer – och att de verkligen tas upp av kroppen. Eller att bussen du brukar åka med kör på biogas istället för diesel.

Utbildningen är uppdelad i ett basblock på 3 år och en specialisering på 2 år. Basblocket omfattar obligatoriska kurser i matematik, kemi, mikrobiologi, genteknik och processteknik samt valbara kurser. Redan i början av utbildningen ingår industrianknutna projekt där kunskaper i biotekniska ämnen fördjupas. Det finns också stora inslag av laborativa övningar. I utbildningens senare del kan laborationerna bestå av att du får använda bioteknisk apparatur eller göra mätningar i biotekniska eller kemitekniska processer. Utbildningen har också flera projektkurser. Detta gör att vi erbjuder dig en undervisning som är mycket omväxlande. Specialiseringar På bioteknikprogrammat finns fyra olika specialiseringar: Bioprocessteknik Inom denna specialisering kombinerar vi kunskaper och färdigheter inom områdena biokemi och teknik för att bygga upp en specialisering mot bioprocessteknik. Denna processteknik handlar om att med biokatalysatorer omvandla råvaror till produkter. Kunskap om bioreaktorn och hur man ska mäta denna för att styra processen är viktig. Studier av biokemisk reaktionsteknik ingår liksom kurser i hur man renar fram de produkter som tillverkats. I projekteringskursen skissar man och kostnadsberäknar olika tekniska lösningar. Livsmedel Denna specialisering, unik för landet, baseras på mycket aktiv forskning vid LTH. Specialiseringen ger en bred introduktion till livsmedelsområdet från produktutveckling till livsmedelssäkerhet. Utbildningen innehåller också flera specialkurser inom ämnen som till exempel human nutrition och functional foods samt probiotika. Utbildningen har en nära anknytning till livsmedelsindustrin.

Läkemedel Denna specialisering ger en fördjupad kunskap om arbete med framställning och utveckling av läkemedel. Att utveckla ett nytt läkemedel är en komplicerad och tvärvetenskaplig process. Den vetenskapliga bredd som finns vid LTH gör att vi kan utbilda civilingenjörer med gedigna kunskaper i både design av nya molekyler, syntes och analys av aktiva substanser samt i utveckling av läkemedelsformuleringar och processutveckling. Utbildningen innehåller flera projektkurser där vi gör mycket studiebesök och arbetar med frågor som ligger nära läkemedelsindustrins forsknings- och utvecklingsproblem. Molekylär bioteknik Genom ett brett spektrum av kurser ger denna specialisering dig goda möjligheter till fördjupning inom det dynamiska gränsområdet mellan kemi, biologi och medicin. Kurserna behandlar såväl grundläggande teori som moderna analytiska, molekylärbiologiska och enzymologiska tekniker. Framtiden Bioteknikutbildningen är en bred utbildning som leder till många olika typer av arbeten. Du kan arbeta i små utvecklingsbolag med att ta fram framtidens läkemedel eller arbeta på stora företag som AlfaLaval och TetraPak. Du kan också arbeta med marknadsföring och försäljning av biotekniska produkter, livsmedel eller läkemedel men även hos myndigheter med frågor som förbättrar vår miljö eller säkerheten på våra livsmedel. Sist men inte minst kan du forska kring några av vår tids viktigaste frågor, t ex skapa nya drivmedel för att minska växthuseffekten eller utveckla nya läkemedel för HIV eller andra sjukdomar som det idag inte finns någon bot för.

Läs mer...

Utbildningen

Linda Gunnäng – Scrum Master, ST-Ericsson AB

Felix Aronsson – student

Jag har alltid varit teknisk intresserad och då jag efter gymnasiet inte var övertygad om vad jag ville jobba med i framtiden ville jag välja en bred utbildning. Någon form av ingenjörutbildning föll sig då naturligt, även om jag på gymnasiet läst natur-natur och inte teknisk inriktning. Att det blev datateknik var lite av en slump. Jag tyckte datorer var intressant men hade aldrig kommit i kontakt med programmering av något slag. Det var därför mest av nyfikenhet som jag valde att ge mig på en datateknikutbildning. Jag tänkte att ”detta skulle vara kul att kunna”!

Första åren på datateknikprogrammet lägger en väldigt god och stabil grund med matte, programmering och elektronik som man sedan kan stå på både i utbildningen och i arbetslivet efter examen. Det finns dessutom flera olika inriktningar man kan välja på sin utbildning så att den anpassas efter var och ens intressen och framtidsplaner.

Idag jobbar jag på ST-Ericsson i Lund och jag trivs jättebra, både med arbetskamrater och med arbetsuppgifter. Det finns bra möjlighet till varierande arbetsuppgifter och att avancera uppåt i organisationen, om detta är något som intresserar en. Själv sitter jag i dagsläget som scrum master/teamledare för en grupp programvaruutvecklare.

ÅRSKURS 1

Programvaruinriktade kurser

Elektronik & hårdvara

Matematik

ÅRSKURS 2

Programvaruinriktade kurser

Hårdvaruinriktade kurser

12

Jag har alltid varit intresserad av teknik och datorsystem så när det var dags att hitta ett universitet och en utbildning kändes det naturligt att med en civilingenjörsutbildning kunna fortsätta med mitt intresse på ett mer fokuserat sätt. Nu, fyra år senare, så vet jag att mitt val var helt rätt, både när det gäller mitt val av utbildning och mitt val av universitet.

ÅRSKURS 3

Programvaruinriktade kurser

Tillämpningsinriktade kurser

ÅRSKURS 4 & 5 Specialiseringar inom: Programvara Inbyggda system Specialiseringar Bilder och grafikinom: Kommunikationssystem Design av processorer och digitala system System, signaler och reglering

Matematik Matematik

Tillämpningsinriktade kurser Tillämpningsinriktade kurser

En civilingenjörsexamen från LTH öppnar många dörrar. Jag går mitt femte år nu och redan för något år sedan märkte jag hur företag började visa intresse för mig. Utbildningarna här håller hög kvalitet och det är något jag tror att industrin har märkt. De flesta jag känner som tagit examen har näst intill haft jobb väntandes på dem när de var klara.

Fysik

Valfria kurser

Examensarbete

300 hp | 5 år

www.data.lth.se | 046-222 47 83 | datateknik@kansli.lth.se Master of Science in Engineering  |  Computer Science and Engineering

Datateknik 

13

–– Du får vara med och utveckla de system av program och hårdvara som alla människor kommer att använda i framtiden. –– Du får en bredd i din utbildning på LTH som gör att du som civilingenjör i datateknik kan arbeta inom många områden och därmed har stor valfrihet i ditt yrkesval. –– På LTH får du kontakt med forskning på internationellt sett mycket hög nivå inom många områden som har med datateknik att göra som t ex programvaruutveckling, datasäkerhet, telekommunikation, reglerteknik och signalbehandling.

Under de tre första åren får du en kvalificerad teknisk utbildning med en hel del matematik och grundläggande tekniska ämnen, men tidigt ägnas även en stor del av utbildningen åt utveckling av datorprogram, datorteknik och tillämpningar. Datorn utnyttjas redan från början som ett naturligt arbetsredskap. Under de sista två åren skaffar du dig en egen profil på din utbildning genom att välja en specialisering och bestämma ett intressant ämne för ditt examensarbete. I din examen kan du även till viss del ta med kurser från hela Lunds universitet, så du har alltså möjlighet att komplettera din utbildning med icke-tekniska ämnen. Specialiseringar Datateknikutbildningen ger dig kunskaper som gör att du efter civilingenjörsexamen har mycket stor valfrihet i ditt yrkesval, oavsett vilken specialisering du väljer att fördjupa dig inom. För varje specialisering gäller att du får mycket goda möjligheter att arbeta med utvecklingsarbete inom industrin eller forskning inom högskolan. För närvarande finns följande specialiseringar: Programvara, där du lär dig avancerad programmering och hur industriella projekt utförs. Det ingår t ex nya programspråk och nya tillämpningar som språkbehandling och kompilatorteknik. Kurserna behandlar alla delar av utvecklingen, från hur man ställer krav på systemen till hur man testar dem. Inbyggda system, där du fokuserar på datorsystem som är inbygga i andra system som t ex mobiltelefoner och bilar och de ämnen som är viktiga i denna typ av projekt. Det kan t ex vara ämnen som realtidsprogrammering och kommunikation mellan programvara och hårdvara. Bilder och grafik, där du lär dig avancerade metoder för att analysera, konstruera samt behandla digitala bilder. Snabba algoritmer, speciell programvara samt implementeringsmetoder för bästa prestanda är exempel på innehåll. Tillämpningar finns inom vitt skilda områden, från underhållningsindustrin med spel och film till medicintillämpningar. Kommunikationssystem, där du lär dig hur avancerade kommunikationssystem är konstruerade. Dagens system med höga bithastigheter kräver spjutspetsteknik beträffande såväl programvara som hårdvara. Alla delsystem som bygger upp ett modernt kommunikationssystem förklaras. Kommunikation mellan datorer och datorsystem blir viktigare och viktigare med dagens Internet och mobiltelefonindustri.

Design av processorer och digitala system, där du lär dig konstruera hårdvaran i digitala datorsystem. Såväl programvaruaspekter som hårdvaruaspekter för bästa prestanda ingår, med fokus på hårdvaran. Det kan gälla allt från enskilda VLSI-kretsar till kompletta datorsystem. System, signaler och reglering, där du lär dig att konstruera system för avancerade tillämpningar där datorer och program utgör fundamentala komponenter. I kurserna använder du den senaste tekniken för ett flertal avancerade datatekniska lösningar, system och tillämpningar. Signalbehandling och reglerteknik är viktiga redskap inom denna specialisering. Kinainriktning Programmet erbjuder även, tillsammans med Elektroteknik och Informations- och kommunikationsteknik, en särskild Kinainriktning som du kan söka till på våren i årskurs ett. Inriktningen innebär att du under ditt andra år läser kinesiska och kinesisk kultur parallellt med dina teknikstudier. Höstterminen i årskurs 3 är förlagd till Kina. Dessutom har du möjlighet att söka ytterligare en utbytestermin senare under utbildningen samt praktikplats och examensarbete i Kina. Kurserna inom kinesiska och kinesisk kultur ligger inom den breddande delen av din utbildning. Se mer på sidan 43 eller www.lth.se/kinainriktningen. Framtiden I stort sett alla produkter som utvecklas av svensk industri innehåller datorer, eller är beroende av datorer i produktionen. Detta innebär att det finns ett stort behov av civilingenjörer i datateknik. Eftersom datorer används inom så många olika områden som t ex processindustrin, telekomindustrin, media- och underhållningsbranschen och medicinska tillämpningar så har du stor valfrihet i ditt yrkesval.

Läs mer...

Utbildningen

Helena Cordesius – Trainee, Tetra Pak/Sony Ericsson/Alfa Laval

Maria Olsson – student

Ekosystemteknikprogrammet var roligt, utmanande, omfattande och hade en tydlig röd tråd som gjorde att man som student för det mesta kände sig engagerad och intresserad av de ämnen och kurser man läste. Det är en väldig bredd på utbildningen, och under de sista åren kan man välja fritt det man verkligen är intresserad av. Som examensarbete åkte jag två månader till Bolivia för att utvärdera konstgjorda våtmarker som vattenreningsmetod.

Eftersom antalet antagna på Ekosystemteknik är relativt litet är varje student viktig. Vi har stort inflytande på hur utbildningen ska utformas. Kurserna har varit väldigt intressanta med engagerade professorer. Trots att det är svårt att välja specialisering efter trean underlättar det att man har fått ta del av minst en kurs från var och en av de fyra huvudinriktningarna. Miljö och teknik är två faktorer som alltid kommer att vara viktiga i samhället. Samspelet mellan dessa är grundstenarna i ekosystemteknikprogrammet.

Jag vann som nybakad civilingenjör 2009 Future Female Leader Award (FFLA) på LTH. Det är ett 18 månaders skräddarsytt trainee-program på tre globala företag, i mitt fall Tetra Pak, Sony Ericsson och Alfa Laval. Där jobbade jag med miljö och energieffektivisering på olika sätt, både i projekt och som en del av det löpande hållbarhetsarbetet. Det var fantastiskt att få en sådan bred erfarenhet direkt efter examen. Nu jobbar jag på E.ON Försäljning i Malmö, som ansvarig för miljöprodukter och miljö inom kommunikation och marknadsföring. Energibranschen var ny för mig och det är en jättekul utmaning att öka miljöengagemanget både hos oss och hos kunderna, och samtidigt erbjuda attraktiva produkter.

ÅRSKURS 1

Matematik

ÅRSKURS 2 Matematik

Teori har blandats med praktiska erfarenheter som exkursioner och studiebesök. Utbildningen kan leda till spännande jobb som att lösa vattenrelaterade problem i utvecklingsländer, dimensionera vindkraftverk, effektivisera processer inom industrin, forska inom förnyelsebara energikällor och mycket mer. Under fyran valde jag att studera utomlands och hamnade i Waterloo, Kanada. Det var en rolig tid med minnen för livet. Jag uppskattade verkligen att få insyn i det kanadensiska skolsystemet och att läsa kurser helt på engelska samtidigt som jag träffade folk från hela världen. Att studera utomlands är verkligen något jag kan rekommendera.

ÅRSKURS 3

ÅRSKURS 4 & 5

Matematik och statistik Specialiseringar inom: Energisystem

Mekanik

Miljösystem Strömningslära, Masstransport och Systemteknik

Fysik och kemi

Processdesign Vattenresurshantering

Kemi

Miljösystem och ekonomi

Ekologi

Valfria kurser Molekylär cellbiologi Geovetenskap

14

Självständigt arbete för kandidatexamen/ alt. obligatoriska kurser

Examensarbete

300 hp | 5 år

www.eko.lth.se | 046-222 14 85 | ekosystemteknik@kansli.lth.se Master of Science in Engineering  |  Environmental Engineering

Ekosystemteknik 

15

–– En bred utbildning där samspelet mellan teknik, naturvetenskap och miljö är ett genomgående tema. –– Mångfald i kursupplägg och examinationsformer. –– Flera kurser ges med engelska som undervisningsspråk. –– Jämn fördelning bland kvinnor och män på utbildningen.

Utbildningen består av en grundläggande del på tre år och en fördjupande del om två år. I den grundläggande delen kombineras ämnen som kemi, ekologi, geologi, mikrobiologi, hydrologi och miljösystem med både teknikämnen och basämnen i civilingenjörsutbildningen, såsom matematik, statistik och fysik. Träningen i systematisk problemlösning blir alltmer avancerad för varje årskurs. Under den avslutande, fördjupande delen väljer studenten specialisering inom programmet. Därutöver kan kurser inom LTH och övriga delar av Lunds universitet läsas. Många studenter läser kurser eller gör sitt examensarbete utomlands. Specialiseringar För närvarande finns följande specialiseringar där du som student kan utforma din egen fördjupning: Energisystem För att skapa uthålliga energisystem krävs förutom kunskaper om miljöproblemen i sig även insikter i både energi- och miljöteknik och samhällsfrågor. Energisystem ger en bra bakgrund för att arbeta med energifrågor, och du har möjlighet att fördjupa dig både mot systemanalys och teknik. Miljösystem Kunskap och skicklighet i att hantera metoder inom miljömanagement – som Livscykelanalys, Miljöledning och Miljökonsekvensbeskrivning – efterfrågas inom offentlig förvaltning och i näringslivet. Specialiseringen bygger vidare på studenternas tidigare kunskaper om miljö- och hållbarhetsfrågor och ger teoretisk och praktisk kunskap om metoderna. Den ger även fördjupning inom några områden som avfallshantering och klimatfrågan.

Processdesign En effektiv tillverkningsprocess är en förutsättning för framställning av alla konkurrenskraftiga produkter, från färger och läkemedel till baskemikalier. Processdesign ger de kunskaper och färdigheter som krävs för arbete med processfrågor inom drift, produktutveckling och industriellt miljöskyddsarbete. Vattenresurshantering Människans vattenhantering är avgörande för många av de stora miljöfrågorna och samtidigt förutsättning för en bra samhällsutveckling. Vattenresurshantering ger kunskaper om grundvatten, ytvatten och VA-teknik och förbereder för arbete med både tekniska och naturliga vattensystem. All undervisning sker på engelska – inslaget av internationella studenter är stort. Framtiden Efter examen som civilingenjör i Ekosystemteknik/Environmental Engineering har du många intressanta möjligheter. Du kan välja att jobba för privata eller offentliga arbetsgivare, hos små konsultföretag eller på stora industriföretag, i kommuner eller forskningsinstitut. Forskarbanan står öppen och det finns stora möjligheter att arbeta internationellt. Förutom i Sverige finns det ekosystemtekniker i bl a Danmark, Norge, Tyskland och Australien. Miljöteknik och hållbar utveckling kommer under en lång framtid att vara viktiga områden och som civilingenjör i ekosystemteknik kommer du att kunna göra betydelsefulla insatser.

Läs mer...

Utbildningen

Vanja Samuelsson – Senior Research Engineer, Sony Ericsson Mobile Communications AB

Kristoffer Danielsson – student

Jag valde Elektroteknik på grund av mitt tekniska intresse och är otroligt nöjd med både den bredd och de specialiseringar som utbildningen gav. Själv valde jag att inrikta mig på Teoretisk elektroteknik men gavs också möjligheten att parallellt gå inriktningen Technology Management. På det sättet fick jag en gedigen ingenjörsbakgrund med en bred introduktion inom strategi, företags- och projektledning.

Bredden som finns på LTH, både inom forskning och utbildning samt kompetens och resurser, gjorde att LTH var ett självklart val för en karriär där jag får jobba med morgondagens teknik. Självklart också studentlivet som finns på LTH och i Lund ger mig ett fantastiskt kontaktnät som jag kommer ha nytta av i arbetslivet.

Idag jobbar jag som forskningsingenjör inom forskningsgruppen på Sony Ericsson som har som huvudsaklig uppgift att ta fram och utvärdera nya kommunikationsteknologier och tekniker för tillämpning i mobiltelefoner. Personligen jobbar jag med forskning och implementering av multipla antennsystem för nya kommunikationssystemet LTE. Karaktären på jobbet och företaget som jag jobbar för gav mig möjligheten att under de senaste fem åren fördjupa mig inom ämnet som industriell doktorand på LTH. Att forska på ett företag och universitet samtidigt har resulterat i en perfekt balans mellan teori och dess tillämpning i verkliga produkter och visar på ett bra samarbete mellan industrin och akademin.

ÅRSKURS 1

Jag ville inrikta mig inom teknik eftersom jag ville ha ett bra jobb. En säker väg till en bra karriär är att gå genom LTHs ganska tuffa men otroligt lärorika civilingenjörsutbildning och på så sätt vara bra rustad för en karriär där man får jobba med saker och produkter som inte finns idag.

ÅRSKURS 2

ÅRSKURS 3

ÅRSKURS 4 & 5

Analog elektronik

Elektromagnetisk fältteori

Specialiseringar inom: Bilder och grafik Design av processorer och digitala system Energi och miljö Kommunikationssystem Medicinsk teknik Produktionsekonomi och entreprenörskap Programvara Högfrekvens- och nanoelektronik Reglerteknik och automation System, signaler och reglering Fotonik

Elektronik

Mätteknik Digital och datorteknik

Komponentfysik Matematik

Elektroteknik är en traditionell tekniktung utbildning där jag får lära mig teorier och modeller som gör att jag förstår hur saker fungerar och hur man utvecklar varianter av dessa men även skapar nya innovationer. När man träffar företag så vet de vad en elektroingenjör är och det är en stark konkurrensfördel då man vet att utbildningen leder till ett bra jobb.

Fysik

Elenergiteknik Reglerteknik Digital signalbehandling Datorkommunikation

Matematik Programmering Fysik

16

Ekonomi Programmering

Elektronikprojekt och hållbar utveckling

Matematik

Valfria kurser

Examensarbete

300 hp | 5 år

www.elektro.lth.se | 046-222 14 85 | elektroteknik@kansli.lth.se Master of Science in Engineering  |  Electrical Engineering

Elektroteknik 

17

–– Elektroteknik är eftertraktad kunskap! Efter utbildningen kan du påverka framtidens teknik inom t ex miljö, energi, medicin, underhållning och kommunikation. –– Fantastisk arbetsmarknad! Det är stor brist på civilingenjörer i Elektroteknik. –– En teoretisk utbildning i kombination med många laborationer och projekt. –– Stor valfrihet inom utbildningen! Hela 11 olika specialiseringar, som är starkt knutna till forskargrupper som flera bedriver världsledande forskning inom t ex reglerteknik, nanoelektronik, medicinsk teknik och kommunikation.

Elektroteknik är den del av fysikämnet som i någon form handlar om elektricitet. Det kan röra sig om allt från de minsta elektroniska komponenterna i datorer och mobiltelefoner till generering och användning av elkraft. Du får en stark teoretisk grund av matematik och fysik och samtidigt en god träning i att konstruera, mäta och programmera. Specialiseringar Bilder och grafik där du lär dig avancerade metoder för att analysera, konstruera samt behandla digitala bilder. Snabba algoritmer, speciell programvara samt implementeringsmetoder för bästa prestanda är exempel på innehåll. Tillämpningar finns inom vitt skilda områden, från underhållningsindustrin med spel och film till medicintillämpningar. Design av processorer och digitala system - Här får du lära dig att konstruera både digitala och analoga system genom att använda avancerad kiselteknologi där miljarder transistorer tillsammans bygger upp system på ett enda chip. Energi och miljö - Arbetet för en hållbar utveckling innehåller många högteknologiska utmaningar och kräver ingenjörer med djupa kunskaper om energi, speciellt elenergi, med förståelse för energisystems miljöpåverkan. Kommunikationssystem - Här behandlas flera olika aspekter på fungerande kommunikation, allt från nätens arkitektur och uppbyggnad till de elektromagnetiska vågornas egenskaper inom systemen, t ex internet, datanät, mobil kommunikation och WLAN. Medicinsk teknik - Den här specialiseringen ger en stark kunskapsgrund för den som i framtiden vill arbeta på företag inom medicinsk teknik, som sjukhusingenjör eller med forskning inom medicinsk teknik. Produktionsekonomi och entreprenörskap - Omvärldens förändringstakt och komplexitet ökar vilket ställer höga krav på att civilingenjörer måste utveckla en förmåga att kombinera sitt djupa tekniska kunnande med den affärsmässiga utmaningen. Programvara - Nästan alla elektrotekniska system styrs av datorer med tillhörande programvara. En elektroingenjör med specialkompetens inom programmering och utveckling av stora programsystem är mycket eftertraktad på arbetsmarknaden.

Radio och nanoelektronik - För att överföra allt större datamängder så krävs mer bandbredd och effektivare utnyttjande av frekvensspektrat. Storleken på traditionella komponenter blir mindre och mindre, men hur små transistorer kan vi tillverka? Reglerteknik och automation - Återkoppling och framkoppling av system, har universell tillämpbarhet och har lett till att reglerteknik och automation är en viktig ingrediens i t ex mediaspelare, elektronik, kommunikationsnätverk, fordon samt inom tillverknings- och processindustrin. System, signaler och reglering - Denna specialisering handlar om att kunna mäta olika fysikaliska storheter på bästa sätt och hur den uppmätta signalen kan behandlas för att önskad information ska kunna utvinnas. Tillämpningar finns inom många olika områden som bl. a innefattar kommunikation, medicin och biologi. Fotonik - Fotonik spelar en stor och växande roll inom kommunikation, belysning, tillverkning, säkerhet, rymd- och försvarsteknik, medicinteknik och sjukvård. Fotonik kombinerar ljusets fysik och dess samverkan med materia. Kinainriktning Programmet erbjuder även en särskild Kinainriktning som du kan söka till på våren i årskurs ett. Inriktningen innebär att du under ditt andra år läser kinesiska och kinesisk kultur parallellt med dina teknikstudier. Höstterminen i årskurs 3 är förlagd till Kina. Dessutom har du möjlighet att söka ytterligare en utbytestermin senare under utbildningen samt praktikplats och examensarbete i Kina. Se mer på sidan 43 eller www.lth.se/kinainriktningen. Framtiden En civilingenjörsutbildning i elektroteknik ger dig nyckeln till det högteknologiska samhället. I arbetslivet kommer du att arbeta tillsammans med många andra yrkesgrupper, tjäna bra och få stora möjligheter att resa mycket eller arbeta utomlands. Vissa civilingenjörer inom elektroteknik blir tekniska specialister, andra gör chefskarriär och några stannar kvar inom universitetet för att forska. Många företagsledare är nu oroliga för att det inte utbildas tillräckligt många ingenjörer inom detta teknikområde. Det finns behov av både de som vill jobba väldigt tekniknära och de som är duktiga på att planera och se tekniken i ett vidare perspektiv. Läs mer...

Utbildningen

Mattias Tyrberg – VD och grundare av Saplo

Madelene Larsson – student

Lund är en fantastisk studentstad och för mig fanns det helt enkelt inga andra alternativ som var lika bra. Härlig skånska blandat med en massa galna studenter det kan inte gå fel!

Det bästa med LTH är att man möter massor med olika människor med olika intressen och bakgrund. Jag blir också väldigt inspirerad vid tanken på vilken expertis och kunskap LTHs byggnader rymmer.

Jag har alltid gillat kombination av matematik och ekonomi och därför passade Industriell ekonomi perfekt. Att redan från starten träffa andra som hade samma inställning har hjälpt till att ta mig dit där jag är idag. För fyra år sedan grundade jag Saplo tillsammans med Sverker Sikström, professor i kognitiv psykolog som jag gjorde mitt examensarbete hos. Företaget hjälper personer och företag att automatisk hitta värdefull information i texter. Ett exempel kan vara att ta fram vilken mobiltelefon som personer som använder social media tycker mest om. Vi fick tidigt intresse från internationellt håll och idag jobbar jag som VD och spenderar mycket tid i Silicon Valley.

Jag har alltid varit väldigt intresserad av de naturvetenskapliga ämnena, speciellt matematik, och tyckte bredden som ingenjörsutbildningen ger var tilltalade. Valet att utbilda mig till ingenjör var egentligen lätt, det var valet av vilken sorts ingenjör som var det svåra.

ÅRSKURS 1

ÅRSKURS 2

ÅRSKURS 3

ÅRSKURS 4 & 5

Ekonomi: Industriell ekonomi Företagsekonomi Entreprenörskap

Ekonomi: Mikroekonomi Marknadsföring Handel Globalisering Industriell ekonomi

Ekonomi: Finansiell ekonomi Optimering Simulering

Specialiseringar inom: Logistik och produktionsekonomi Supply Chain Management Finans och risk Affär och innovation Programvaruintensiva system Produktion Egen specialisering

Teknik: Mekanik Fysik Energi Miljöteknik

Matematik: Analys Algebra

18

Jag tvekade länge mellan att läsa kemiteknik eller industriell ekonomi men valde till sist industriell ekonomi på grund av bredden som utbildningen ger. Denna bredd gör att man efter examen kan arbeta inom en mängd olika branscher samtidigt som jag tror att man kommer få ett väldigt roligt jobb då man har en bas som ingenjör men en god förståelse för ekonomi.

Teknik: Logistik Programmeringsteknik Beräkningsteknik Matematik: Matematisk statistik Funktionsteori Systemteori Transformer

Teknik: Miljösystemanalys/management Hållbar utveckling Industriell produktion Reglerteknik Teknikprofil: Industriell produktframtagning Energi- och miljöteknik Matematisk modellering System- och programvaruutveckling Industriella tillverkningssystem

Valfria kurser

Examensarbete

www.i.lth.se | 046-222 08 53 | industriellekonomi@kansli.lth.se Master of Science in Engineering  |  Industrial Engineering and Management

300 hp | 5 år

Industriell ekonomi  –– –– –– ––

19

En god bas i matematik och en unik inriktning mot finans och risk. God nationell och internationell arbetsmarknad. Möjlighet till egen näringslivsmentor under studietiden. Utbytesavtal med många välrenommerade universitet i världen.

Industriell ekonomi är en bred, kvalificerad och internationellt konkurrenskraftig utbildning baserad på integrationen mellan matematik, teknik, ekonomi, management och ledarskap. Som civilingenjör i Industriell ekonomi är du attraktiv genom din mångfacetterade kompetens och förmåga att initiera och leda industriella projekt. Speciellt för utbildningen i Lund är möjligheten till samverkan inom Lunds universitet, utbytesstudier och avslutningar mot matematisk modellering, finansiell ekonomi eller affär och innovation. Utbildningen Av 300 hp är ca 150 hp obligatoriska baskurser, ca 30 hp inom valfri teknikprofil, ca 45 hp inom valfri specialisering samt 30 hp examensarbete. Parallellt läser du valfria fördjupnings- eller breddkurser samt helt valfria kurser, t ex juridik, språk och/eller miljöteknik. I årskurs 3 väljer du en av följande teknikprofiler: Industriell produktframtagning ger dig grundläggande kunskaper i materialteknik och tillverkningsmetoder. Energi- och miljöteknik ger dig grundläggande kunskaper i traditionell och förnyelsebar energi- och förbränningsteknik samt energi- och miljösystemanalys. Matematisk modellering ger dig inte bara kunskaper i modellering, optimering och statistik utan också verktyg att implementera kraftfulla modeller på verkliga system. System- och programvaruutveckling utvecklar dina kunskaper i programmerings-, dator- och digitalteknik samtidigt som du lär dig metoder för utveckling av mycket stora tekniska system.

Supply Chain Management (Management av försörjningskedjor) Ett företags konkurrenskraft avgörs till stor del av dess försörjningskedja (supply chain), dvs leverantörer, distributörer och andra företag som man väljer att samarbeta med, både på hemmaplan och i ett internationellt perspektiv. Alla kurser inom specialiseringen ges på engelska. Finans och risk handlar om finansiella tillgångar i företag, t ex balansering av avkastning och risk, prissättning av finansiella tillgångar eller beskrivning av options- eller elmarknaden. Affär och innovation handlar om hur företag marknadsför, köper produkter och tjänster samt utvecklar teknologistrategier. Du ska kvantitativt och kvalitativt kunna analysera marknader, lägga upp strategier och skapa goda relationer till affärspartners. Programvaruintensiva system handlar om att leda och genomföra utveckling av stora programvarusystem som är integrerade i allt fler produkter, t ex inom telecom, automation, sjukvård och fordon. Produktion omfattar tillverkningsteknik, utformning av produk-

Industriella tillverkningssystem ger dig grunderna för att kunna vara med och forma framtidens system för tillverkning och produktion. Utbildningen sker vid University of Connecticut genom ett särskilt avtal för Industriell ekonomi i Lund.

tionssystem, automation, materialteknik, ekonomisk styrning och produktionsledning. Du kommer lära dig att utveckla ett företags konkurrenskraft och leda produktionen i företaget såväl nationellt som internationellt.

Du har också möjlighet att påverka utformningen av din egen teknikprofil genom att kombinera LTHs breda kursutbud från andra universitet runt om i världen som Lunds universitet har avtal med.

Framtiden

Under de avslutande två åren utvecklar du djupa kunskaper inom ett vetenskapsområde med god forskningsbas vid LTH. Logistik och produktionsekonomi handlar om att leda, styra och planera produktionsprocesser och materialflöden med goda resultat, med avseende på resursutnyttjande, kvalitet, effektivitet och försäljningspris.

Läs mer...

Specialiseringar

Efter utbildningen kan du arbeta både i Sverige och utomlands. Du kan tillämpa hela kedjan från idéformulering, modellering, konstruktion, tillverkning, kvalitetssäkring, drift och underhåll till produktion och distribution av produkter och tjänster. Du arbetar t ex som affärsutvecklare, produktionsledare, systemutvecklare, kvalitetsingenjör, marknadsförare, managementkonsult, investment banking, riskanalytiker, logistikchef eller företagsledare. Det är stor efterfrågan såväl nationellt som internationellt på civilingenjörer med goda ledaregenskaper som kan verka i gränsområdet mellan teknik och ekonomi.

Jelena Mirosavljevic – student

Markus Solälv – utvecklare , Lundalogik AB

Det bästa med LTH är utbudet och kvalitén på utbildningarna samt närheten till företag. LTH erbjuder studenten även en mängd aktiviteter och nöjen att välja mellan - det är full fart hela läsåret!

Jag valde att läsa på LTH för att kursutbudet som InfoCom erbjuder bara kan hittas här. Utbildningens bredd bidrog till att det var lätt att hitta vad jag själv ville satsa på när jag skulle specialisera mig. Under mina första år på programmet gick mitt intresse mer och mer mot hur användaren upplever de tekniska produkter och hjälpmedel som människor använder sig av dagligen. Det fanns då en fördjupning som passade mig perfekt. För att komplettera det jag lärt mig på Infocom läste jag även kognitionsvetenskap under det sista året. Detta gjorde så att jag under mitt examensarbete kunde fördjupa mig ännu mer.

InfoCom är en civilingenjörsutbildning som innehåller både klassiska matematik- och programmeringsblock men även nya och spännande kurser inom informationsöverföring mellan datorer, mobiltelefoner och människor. Telekom blir ju allt viktigare för samhället och är ett teknikområde med stora utvecklingsmöjligheter som jag vill vara en del av. Väljer man Kinainriktningen, som jag har gjort, har man möjligheten att läsa en termin på ett kinesiskt universitet och sedan praktisera på ett internationellt företag i Kina. Efter ett halvårs studier av det kinesiska språket och kulturen ser jag fram emot att studera på Zhejiang-universitetet i Hangzhou under hösten. Som civilingenjör får man en bred utbildning vilket ger stora valmöjligheter när man kommer ut på arbetsmarknaden. Dessutom får man arbeta med tekniska lösningar och innovationer vilket jag tycker är väldigt intressant.

ÅRSKURS 1

ÅRSKURS 2

Data- och telekom Data- och telekom

Jag gjorde mitt examensarbete på Lundalogik och därefter började jag arbeta där som utvecklare. Sedan dess har jag varit inblandad i flera olika projekt där jag haft stor möjlighet att använda mig av både mina programmeringskunskaper och användbarhetskunskaper. Vid sidan om mitt heltidsarbete på Lundalogik har jag startat ett företag som importerar varor och säljer dem vidare via internet. Här har jag haft nytta av både mina kurser i ekonomi som jag läste som breddkurser samt mina programmeringskunskaper.

ÅRSKURS 3

ÅRSKURS 4 & 5

Data- och telekom

Specialiseringar inom: Användbarhet och design Kommunikationssystem System, signaler och reglering

Människa-teknik Människa-teknik Matematik

Människa-teknik

Matematik

Fysik och matematisk statistik

Programmering

Programvaruutveckling

20

Valfria kurser Programmering

Datorteknik och reglerteknik

Examensarbete

www.infocom.lth.se | 046-222 47 83 | infocom@kansli.lth.se Master of Science in Engineering  |  Information and Communication Engineering Technologies

300 hp | 5 år

Informations- och kommunikationsteknik  21 –– Utbildningen ger dig förmågan att vara med och utveckla och anpassa framtidens tekniska lösningar av kommunikationssystem, tjänster och tillämpningar med hänsyn till människans förutsättningar, möjligheter och behov. –– Du får en bred kunskap om hela kommunikationskedjan i moderna data- och telekommunikationssystem, från hur informationen överförs, till hur människan tar till sig informationen. –– Utbildningen ger en djup förståelse över hur de ingående delarna i ett data- och telekommunikationssystem fungerar och påverkar varandra.

Informations- och kommunikationsteknik används inom allt fler områden. Data- och telekommunikation har blivit en absolut nödvändighet i en uppsjö av produkter, tjänster och tillämpningar inom de mest skiftande områden såsom sjukvården, industrisektorn, media- och underhållningsbranschen och mobila tjänster. Några välkända exempel på vad teknikutvecklingen hittills gett oss är Internet, bredband och mobiltelefoner med tillhörande tillämpningar. Användarperspektivet är en viktig del i utbildningen. Som civilingenjör i Informations- och kommunikationsteknik är du särskilt lämpad att arbeta med och deltaga i teknikutvecklingen av framtidens produkter, system och applikationer. Du får en god helhetsförståelse av hela kommunikationskedjan, hur informationen bearbetas och skickas, hur olika kommunikationsnät är uppbyggda för att hantera informationsflöden samt hur användaren interagerar med tekniken för att tillgodogöra sig informationen på bästa sätt. Utbildningen inleds med ett block av obligatoriska kurser om 180 högskolepoäng. Dessa ger en bred grundläggande förståelse för hur moderna kommunikationssystem fungerar, samt ger de baskunskaper, i t ex matematik och programmering, som behövs för att tillgodogöra sig utbildningen. Därefter följer en av tre specialiseringar, valfria kurser, samt slutligen examensarbetet. Specialiseringar Som färdig civilingenjör i Informations- och kommunikationsteknik har du en gedigen utbildning som gör att du har mycket stor flexibilitet i ditt yrkesval, oavsett vilken av de tre specialiseringarna du väljer att fördjupa dig inom. För varje specialisering kan du exempelvis arbeta som teknisk expert, projektledare, utvecklingsansvarig, chef på olika nivåer eller påbörja forskarstudier. Användbarhet och design ger insikter i hur användaren möter informationen. Du får förståelse för hur information uppfattas beroende på hur den presenteras. Du lär dig hur ett gränssnitt byggs upp till exempel på en skärm, både designmässigt och praktiskt, för att det skall bli naturligt att använda.

Kommunikationssystem ger djup förståelse för hur avancerade data- och telekommunikationssystem är uppbyggda samt hur dess ingående delsystem fungerar och samverkar. Du får mycket goda kunskaper om hur t ex Internet och mobila system fungerar samt en inblick i framtida kommunikationssystem. System, signaler och reglering ger förståelse för hur många avancerade tillämpningar kan beskrivas och analyseras. Du lär dig exempelvis hur ett digitalt filter kan konstrueras samt reglertekniska tillämpningar. Du får också kunskap i hur olika system i verkligheten kan modelleras, övervakas, styras och simuleras. Kinainriktning Programmet erbjuder även, tillsammans med Elektroteknik och Datateknik, en särskild Kinainriktning som du kan söka till på våren i årskurs ett. Inriktningen innebär att du under ditt andra år läser kinesiska och kinesisk kultur parallellt med dina teknikstudier. Höstterminen i årskurs 3 är förlagd till Kina. Dessutom har du möjlighet att söka ytterligare en utbytestermin senare under utbildningen samt praktikplats och examensarbete i Kina. Kurserna inom kinesiska och kinesisk kultur ligger inom den breddande delen av din utbildning. Se mer på sidan 43 eller www.lth.se/kinainriktningen. Framtiden Som civilingenjör inom Informations- och kommunikationsteknik har du en gedigen kunskap om olika aspekter av data- och telekommunikation. Du vet hur systemet byggs upp av de olika delarna och hur de påverkar varandra. Data- och telekommunikation är idag en grundpelare inom de mest skiftande områden med en uppsjö av avancerade tillämpningar som ställer hårda krav på exempelvis användbarhet, nätuppbyggnad och kvalitet i överföringen. Att studenterna som tagit examen på Informations- och kommunikationsteknik på LTH är mycket attraktiva på arbetsmarknaden framgår tydligt i en undersökning från våren 2010 som visar att de nyblivna civilingenjörerna snabbt fick relevanta jobb på en mångfald av företag.

Läs mer...

Utbildningen

Mia Wärjerstam – miljökonsult, NIRAS

Peter Kongstad Rasmussen – student

Jag arbetar som konsult på ett företag som heter NIRAS. Företaget tillhandahåller tjänster bland annat inom miljöområdet. Mina arbetsuppgifter består främst i utredningar av förorenade områden och verksamheters uppföljning av villkor enligt miljöbalken. Mitt jobb är spännande, varierande och jag får resa en hel del. Exempel på projekt jag har utfört under våren är bland annat miljökontroll i samband med sanering av nedlagda bensinstationer och utredning av föroreningar på ett skjutfält. Jag har med min utbildning fått en mycket bra grund till det arbete jag utför idag.

Det bästa med LTH är helt klart LTH-andan! Alla studenter på LTH är vänliga och öppna för varandra. Man får en nära vänskap med sina studiekamrater på ett par veckor som normalt tar år att nå.

Den främsta anledningen till att jag valde att studera på LTH var möjligheten till att studera en termin som utbytesstudent på universitet utomlands vilket jag också gjorde. Jag är överlag nöjd med min utbildning som civilingenjör i kemiteknik på LTH. Utbildningen håller väldigt hög standard.

ÅRSKURS 1

ÅRSKURS 2

Som kemitekniker lär man sig mycket som man kan använda både i sin egen vardag, t ex när man handlar mat eller andra kemiska substanser, och i arbetet. Man får också en djupare teknisk förståelse för processer i världen, både i små och i stora skalor. Jag valde att utbilda mig till civilingenjör för att utveckla mina kunskaper och kunna använda min kompetens till att göra samhället bättre för gemene man och för framtida generationer.

ÅRSKURS 3

ÅRSKURS 4 & 5

Kemi

Specialiseringar inom: Processdesign Material Läkemedel

Bioteknik Kemiteknik

Mekanik Matematik

Matematik

Matamatik

Projektarbete

Kemi Kemiteknik

Valfria kurser Kemi

Kemiteknik

Ekonomi Valbart

22

Examensarbete

300 hp | 5 år

www.kemiteknik.lth.se | 046-222 71 38 | kemiteknik@kansli.lth.se Master of Science in Engineering  |  Chemical Engineering

Kemiteknik 

23

–– Kemiteknik i Lund ger dig en bred utbildning för många viktiga framtidsområden. –– Nya läkemedel, en bättre och säkrare miljö samt framtidens nya nanomaterial är områden där kemiteknikers kunskap behövs. –– En miljö där det finns goda kontakter med industrin. –– En utbildning som är välkänd inom den svenska industrin. –– Möjlighet att specialisera sig mot läkemedel, processdesign och material. Alla är områden med både stark arbetsmarknad och goda forskningsmiljöer. –– En miljö där det finns världsledande forskning inom många områden.

Utbildningen Kemiteknikprogrammet vid LTH är ett brett program som ger dig möjlighet att välja många olika typer av jobb i framtiden. En kemitekniker har hela världen som arbetsfält. Eftersom kemiingenjörens arbetsområde är mycket skiftande, från forskning och utveckling till marknadsföring och produktion, erbjuder utbildningen många möjligheter för dig att skräddarsy din egen utbildning. Under de första åren får du dina baskunskaper. Inför årskurs 4 väljer du sedan en specialisering. Här får du både möjligheter till fördjupning och till fria val ur ett stort kursutbud. Utbildningen i kemiteknik innehåller laborationerna där du själv får utforska och testa kemiska teorier. I utbildningens senare del kan laborationerna bestå av att du får använda kemiteknisk apparatur eller göra mätningar i kemiska processer inom industrin. Utbildningen har också flera projektkurser. Detta gör att vi erbjuder dig en undervisning som är mycket omväxlande. Specialiseringar Material Denna inriktning ger dig kunskap om hur du kan utveckla morgondagens material, allt från pappret som kan vara en datorskärm till konstgjorda hjärtan. Inom denna specialisering fördjupar du dig i material- och polymerkemi. Vi behandlar polymera material, elektronikmaterial och konstruktionsmaterial från en kemisk synvinkel. Du får lära dig både om framställning och karaktärisering av material i allmänhet samt om nya avancerade funktionella material som t ex nanomaterial.

Läkemedel Denna specialisering ger en fördjupad kunskap om arbete med framställning och utveckling av läkemedel. Att utveckla ett nytt läkemedel kräver många olika typer av kunskap inom områden som biologi, kemi, kemiteknik och bioteknik. Den vetenskapliga bredd som finns vid LTH gör att vi kan utbilda civilingenjörer med gedigna kunskaper i både design av nya molekyler, syntes och analys av aktiva substanser samt i utveckling av läkemedelsformuleringar och processutveckling. Utbildningen innehåller flera projektkurser där vi gör mycket studiebesök och arbetar med frågor som ligger nära läkemedelsindustrins forsknings och utvecklingsproblem. Framtiden Kemiteknik är en bred utbildning som leder till många olika typer av arbeten. Man kan arbeta i läkemedelsindustrin med att ta fram framtidens läkemedel eller på små utvecklingsbolag med morgondagens nya material. Man kan också arbeta mer med marknadsföring och försäljning eller hos myndigheter med frågor som förbättrar vår miljö. Många kemitekniker arbetar som chefer eller projektledare i den kemiska industrin. Det finns också möjligheter att forska kring några av vår tids viktigaste frågor, t ex hur utvecklar vi nya drivmedel för att minska växthuseffekten eller nya läkemedel för HIV eller andra sjukdomar som det idag inte finns någon bot för.

Läs mer...

Processdesign En effektiv tillverkningsprocess är en förutsättning för framställning av alla konkurrenskraftiga produkter, från färger och läkemedel till baskemikalier. En effektiv process skall vara ekonomiskt optimal samtidigt som den ger minimal miljöbelastning. Den här specialiseringen ger de kunskaper och färdigheter som krävs för arbete med processfrågor inom drift, produktutveckling och industriellt miljöskyddsarbete.

Jesper Nordlund – trafikkonsult, Trivector AB

Moa Chley Tegnelund – student

När jag först läste om lantmäteriutbildningen hade jag egentligen ingen tydlig bild av vad den kunde leda till för yrke. Utbildningen i sig lät väldigt intressant då den var en civilingenjörsutbildning som behandlade såväl teknik, som juridik och ekonomi; tre ämnen som jag varit inne och nosat på bland mina val. Passande nog lyckades jag hitta inriktningen mot samhällsplanering, där jag i mitt fjärde år läste arkitektur och samhällsplanering med arkitektstudenterna och trafikplanering och miljö med Vägoch vattenstudenterna. Med min lantmäteribakgrund hade jag en god allmänorientering inom samhällsfrågor och juridiska frågor, och ett lite annorlunda perspektiv än flertalet andra som läste denna inriktning.

Lantmäteri kändes som den rätta utbildningen för mig då jag fastnade för den tvärvetenskapliga kombinationen av ämnen. Eftersom jag är från Norrbotten blev valet att läsa i Lund, som är en fantastisk studentstad, lite annorlunda. Det valet är jag väldigt nöjd med nu. Jag trivs mycket bra med utbildningen på LTH och har praktiserat på arbetsplatser som visat vilket varierande område Lantmäteri kan vara. Civilingenjörer i Lantmäteri är eftertraktade på arbetsmarknaden så framtiden ser mycket ljus ut. Att läsa i Lund ger goda möjligheter till kontakter med arbetslivet och att läsa något år utomlands. En civilingenjörsexamen inom Lantmäteri ger dig många möjligheter till ett spännande yrkesliv.

Idag jobbar jag som trafikkonsult på konsultbolaget Trivector AB. Främst arbetar jag med kollektivtrafik och linjenätsöversyner för stadsbusstrafik, spårvägsutredningar, trafikanalyser och prognosberäkningar, trafikmodellering och trafikstrategier. Våra kunder är ofta kommuner och myndigheter, men även företag hör av sig som vill ha hjälp med bl.a logistikfrågor. En del av våra uppdrag är forskningsuppdrag, såväl nationella som internationella EU-finansierade forskningsuppdrag. Arbetet innebär en del resor eftersom vi jobbar över hela landet med trafik- och samhällsplaneringsfrågor.

ÅRSKURS 1

ÅRSKURS 2

ÅRSKURS 3

ÅRSKURS 4 & 5

Matamatisk statistik National- & företagsekonomi Matematik

Geografiska informationssystem

Mät- & kartteknik

Fastighetsekonomi

Specialiseringar inom: Fastighetsrätt Fastighetsekonomi Geografisk informationsteknik Landinspektør

Juridik Programmering & databaser Fastighetsbildning

Miljö, bygg- & anläggningsteknik

Fastighetsteknik och fysisk planering

Matematik

24

Valbara kurser inom: Miljörätt Byggprocess/-ledning Stadsplanering Programmering

Valfria kurser

Examensarbete

300 hp | 5 år

www.l.lth.se | 046-222 70 31 | lantmateri@kansli.lth.se Master of Science in Engineering  |  Surveying and Land Management

Lantmäteri  –– –– –– –– ––

25

En blandning av teknik, ekonomi och juridik. Det enda renodlade civilingenjörsprogrammet i lantmäteri i Sverige. Mycket god arbetsmarknad. Konkreta ämnen ger ett verklighetsnära perspektiv. Jämn fördelning mellan killar och tjejer.

Utbildningen Lantmäteri är ett bra val för dig som vill läsa såväl teknik, juridik som ekonomi. I utbildningen kombineras fastighetsekonomi och fastighetsrätt med geografisk informationsteknik, samhällsplanering och byggämnen, samt grundläggande civilingenjör sämnen som matematik , s tatis tik och programmering. Vi utvecklar förståelsen av fastigheten som en juridisk enhet. Du gör ekonomiska analyser, lär dig om rättigheter i fastigheter, samhällets regler för byggande och

Det finns också krav på miljötänkande, samtidigt som din lösning måste vara ekonomiskt försvarbar, med krav på bra förräntning av fastighetskapitalet. Du kan också läsa mer inom nationalekonomi och statistik för att lära dig göra analyser av fastighetsmarknadens svängningar och tendenser. Finns det en bubbla för priserna på bostadsmarknaden? Hur bra kan experterna bedöma detta?

markanvändning. Vidare studerar du tekniska förutsättningar för byggande och förvaltning av byggnader. Du lär dig utföra geodetiska mätningar, programmera, utveckla och använda databaser, samt att arbeta med geografiska informationssystem (GIS).

Inom Geografisk informationsteknik fokuserar du på hur man bygger upp och använder geografiska databaser som exempelvis digitala kartor, fastighetsregister, satellitbilder och miljöinformation. Exempel på tekniker som studeras är satellitpositionering (t ex GPS), geografiska informationssystem (GIS) och satellitbaserad fjärranalys (d v s fotografier tagna från satelliter). Geografisk informationsteknik är idag vanlig inom samhällsplanering, miljöanalys och olika kommersiella tillämpningar. GPS-teknik används i allt fler vardagsprylar, t ex iPhone och träningsklockor.

Specialiseringar I den fastighetsrättsliga specialiseringen får du lära dig lagar och praxis om markanvändning, fastighetsbildning och utbyggnad av tätorter. Du lär dig att förstå och upprätta fastighetsrättsliga avtal, t ex för kommersiella lokaler, bostadsrätter och jordbruksarrenden. Det kan handla om stadsutveckling och stadsförnyelse, utifrån kommunernas detaljplaner som ofta tas fram i samarbete med byggföretag. Praktiska frågor kommer in, t ex om långsiktig klimatanpassning, trafik, bredband och annan infrastruktur. Du lär dig både om krav vid enstaka bygglov och hur man jobbar med större områden. Västra hamnen med Turning Torso i Malmö är ett spännande exempel. Det krävs fastighetsrättslig kunskap även när nya vägar eller järnvägar ska anläggas, t ex Citytunneln i Malmö. En del kurser kan du läsa tillsammans med arkitekt- och väg- och vattenstudenter. Fastighetsekonomi attraherar studenter med intresse för arbete inom fastighetsmarknaden. Du lär dig grundläggande nationaloch företagsekonomi, och använder det sedan för tillämpningar inom fastighetsekonomi. Värdering av fastigheter och förvaltning är viktiga områden. Du lär dig ta ställning till frågor såsom att riva och bygga nytt, renovera, ändrad användning av lokaler, nya hyresgäster?

En särskild specialisering är att efter årskurs 3 läsa kurser i Danmark under 1,5 år till Landinspektør. Du läser då tillsammans med de danska landinspektørstudenterna i Aalborg eller i Köpenhamn för att även få en dansk examen, dvs en dubbelexamen, som civilingenjör i lantmäteri och landinspektør. Framtiden Arbetsmarknaden är ljus, med låg arbetslöshet idag. Statistik från fackförbundet Sveriges Ingenjörer har under många år visat att civilingenjörer i lantmäteri har den lägsta arbetslösheten bland alla civilingenjörer. Även långsiktigt antas bristen kvarstå. Utbildningen är mångsidig och färdigutbildade är attraktiva inom många arbetsområden. Arbete inom den privata sektorn, t ex byggbranschen, i fastighetsbolag, tekniska konsulter, banker och fastighetsvärderingsföretag är lika vanligt som arbete i kommuner (t ex på fastighetskontor eller mark- och exploateringsavdelning) och flera olika statliga myndigheter (t ex Lantmäteriet, Trafikverket, Naturvårdsverket, Regeringskansliet, Mark- och miljösdomstol). En del arbetar utomlands under kortare eller längre perioder.

Läs mer...

Forskning sker i de olika ämnena du läser, t ex hur geografisk information hanteras på Internet, digitala koordinater som grund för fastighetsgränser, säkerställda obligationer på fastighetsmarknaden, om oro på fastighetsmarknaden med stora prisändringar, effektiv fastighetsförvaltning, attraktiva stadsmiljöer och trafiksäkerhet.

Sofia Sjöberg – Manager Supplier Quality Assurance, Tetra Pak, Italien

Emil Pennsäter – student

Det bästa med Maskinteknikprogrammet var inte den faktiska tekniska kunskapen som jag naturligtvis fick mycket av, utan flera andra delar såsom nära vänner, självinsikt samt förmåga att analysera och lösa problem. Efter 2,5 år valde jag att söka Technology Management-avslutningen som kombinerar teknik med mjukare delar som företagsstrategi och ledarskap. Avslutningen gav mig en stabil grund till den chefsroll som jag idag har i en stor organisation.

En civilingenjörsexamen från LTH är attraktiv bland arbetsgivare. Redan under utbildningen har man goda möjligheter att sommarjobba och praktisera på företag. Jag har haft lärorika sommarjobb både på Alfa Laval AB och Kockums AB tack vare att jag pluggat på LTH. Möjligheterna till jobb är alltså stora, så passa på att utnyttja dessa redan under utbildningen.

Idag arbetar jag som Manager, Supplier Quality Assurance på Tetra Pak. I denna roll är jag stationerad i Modena, Italien och kommer att vara kvar här i ytterligare knappt ett år. Mitt team har till uppgift att analysera inkommande kundreklamationer, lösa kvalitetsproblem tillsammans med leverantörerna samt implementera och följa upp lösningarna. Jag ansvarar för att vi på ett effektivt sätt löser de problem som våra kunder möter samt att vi proaktivt förhindrar att nya problem uppstår. En stor del av mitt arbete innebär också utveckling av det arbete vi utför tillsammans med andra funktioner inom Tetra Pak samt vidareutveckling av individerna i teamet.

ÅRSKURS 1

Matematik

Det bästa med att gå på Maskinteknik är den goda stämningen och sammanhållningen. Studiekompisarna på M är inspirerande och uppmuntrar en till att göra sitt bästa. Oftast pluggar vi i grupper även utanför lektionstid, vilket gör det lättare att klara tentorna.

ÅRSKURS 2

ÅRSKURS 3

ÅRSKURS 4 & 5

Mekanik - statik

Transmissioner

Specialiseringar inom: Energiteknik Logistik och produktionsekonomi Produktion Produktutveckling Mekatronik Beräkningsmekanik Fordon

Mekanik - dynamik

Elektroteknikens grunder

Termodynamik Strömningslära Introduktion till maskinteknik

Logistik

Energi och miljö i hållbar utveckling Reglerteknik

Ritteknik/Datorstödd ritning Hållfasthetslära

Utvecklingsmetodik

Programmering

Industriell ekonomi Fysik

26

Tribologi

Valfria kurser Konstruktionsmaterial

Matematisk statistik

Tillverkningsmetoder

Alternativobligatoriska kurser

Examensarbete

www.m.lth.se | 046-222 84 93 | maskinteknik@kansli.lth.se Master of Science in Engineering  |  Mechanical Engineering

300 hp | 5 år

Maskinteknik 

27

–– Här förenas klassiska ingenjörsämnen med bland annat teknisk design, ekonomi och miljö. –– Du får en efterfrågad kompetens inom en mängd branscher som t ex design, produktutveckling, dimensionering, tillverkning, energiomvandling och energianvändning samt distribution och återvinning. –– Utbildningen i Maskinteknik fokuserar på ett ansvarsfullt lärande. De olika ämnena följer och kompletterar varandra på ett logiskt sätt för att ge både bredd och djup.

Utbildningen Utbildningen erbjuder en bred bas som ger dig möjlighet att välja mellan ett antal specialiseringar inom olika områden. Som civilingenjör i Maskinteknik kan du bli både specialist och problemlösare och kan därmed påverka hur vårt framtida samhälle kommer att se ut. Maskiningenjörens breda kompetens gör att du blir attraktiv på arbetsmarknaden. Drygt första halvan av utbildningstiden ägnas åt grundläggande naturvetenskapliga och tekniska ämnen. Den specialisering du sedan väljer ger dig en suverän utbildning med djupa kunskaper och färdigheter inom något av nedanstående maskintekniska specialområden, kompletterade med valfria kurser. Specialiseringar

Logistik och produktionsekonomi är en specialisering som ger dig verktygen för att effektivisera processer för material-, informations- och betalningsflöden inom och mellan företag. Som logistiker kan du arbeta med allt från inköp till distribution inom företag eller som konsult, nationellt och internationellt. Beräkningsmekanik är specialiseringen där du ska studera fysikaliska begrepp och numeriska metoder som är väsentliga för modellering och analys av mekaniska problem. Du får möjlighet att använda avancerade datorbaserade simuleringsverktyg baserade på modern teori inom fluidmekanik, hållfasthetslära, mekanik och värmeöverföring. Du får träning i problemformulering och analys av tillhörande numeriska lösningar – en god balans mellan djup och bredd inom beräkningsmekanik.

Energiteknik är specialiseringen som ger dig kunskap om energiomvandlingsanläggningar med komponenter, som t ex kraftverk och ång- och gasturbiner samt färdigheter att använda avancerade beräkningsverktyg. Studier av energiförsörjning och -användning, ända ner till enskilda användare, ger dig möjlighet att utveckla effektiva energilösningar. Miljöaspekter är givetvis integrerade i specialiseringen, från kunskaper om förbränning med låga emissioner till hållbar energiförsörjning och energianvändning.

Mekatronik är specialiseringen som kombinerar ämnen som maskinkonstruktion, elektronik och avancerad datorstyrning. Hur konstrueras motorstyrningen i en modern kamera eller en robot till hjälp för handikappade? Hur konstruerar man en automatisk gräsklippare eller elektrisk styrning av en bil? Specialisering ger en maskinteknolog en breddad kunskap mot angränsande discipliner. Mekatronikingenjören utnyttjar flera kompetenser och kan därför skapa nya och smarta produkter.

Produktutveckling är specialiseringen för dig som vill bli konstruktör, en roll som är både dynamisk och spännande. En produktutvecklare arbetar både med utformning och dimensionering och tar utifrån ett kundbehov fram helt nya produkter eller utvecklar redan existerande produktkoncept till bättre prestanda. Arbetet utförs oftast i team av experter från olika ämnesområden.

Fordon är specialiseringen som ger dig fördjupade kunskaper att utveckla morgondagens person- och lastfordon för att uppnå samhällets mål avseende hållbar utveckling. Du får gedigna kunskaper inom dimensionering och formgivning av de komponenter och system som bygger upp ett fordon. Självklart är förståelse för fordons miljöpåverkan och hur den kan reduceras ett mål med specialiseringen.

Läs mer...

Produktion omfattar tillverkningsteknik, utformning av produktionssystem och automation, materialteknik, ekonomisk styrning och produktionsledning. Specialiseringen ger dig de kunskaper som krävs för att kunna utveckla ett företags konkurrenskraft och framgångsrikt leda produktionen i företag på såväl nationell som internationell nivå.

Erica Backe – student

Axel Nordin – doktorand, LTH

Det bästa med LTH är välkomnandet man får när man börjar. Den första tiden var riktigt rolig och man träffar många nya människor. De personer jag lärt känna under min studietid kommer att vara mina vänner för livet. Och så självklart det att LTH ligger i Lund som har så mycket att erbjuda till studenter, både genom nationer och kårer.

Första åren på Teknisk design bestod av Maskinteknikprogrammet, vilket jag tyckte gav en bra grund till att förstå hur produkter konstrueras, tillverkas, och fungerar i teorin, och övade kanske framför allt upp ens förmåga till att sätta sig in i nya problem och lösa dem. De sista åren fick vi större inblick i hur industridesignarbetet går till, och fick själva ta oss an produktutvecklingsprojekt, där allt vi tidigare lärt oss kom till användning. På det hela taget fick vi en helhetsbild av produktutvecklingsarbetet som är svår att få i andra mer specialiserade utbildningar.

Det bästa med utbildningen är mixen av teknik och design. Man blir stimulerad på både det tekniska och estetiska planet. Det är väldigt skönt efter en tung föreläsning att få sätta sig och skissa eller gå till verkstaden och vara kreativ. Eftersom jag inte var säker på vad jag ville arbeta med, så valde jag civilingenjörsutbildningen för att den öppnar upp många dörrar. Jag tänkte att det var ett bra val för framtiden som kommer att ge mig många roliga jobbmöjligheter.

ÅRSKURS 1

ÅRSKURS 2

Just nu står jag med ena foten i industrin och andra i akademin. Jag har arbetat med två forskningsprojekt, och ska börja doktorera till hösten kring hur konsumentprodukter kan skräddarsys utifrån kundens behov, och hur former från naturen och matematiken kan inkorporeras inom industridesign. På sidan av detta jobbar jag tillsammans med en industridesigner och ett nystartat designföretag med att kommersialisera resultaten från forskningen. Jag arbetar med att ta fram koncept i olika datorbaserade designverktyg, med att utvärdera olika lösningars funktion, t ex deras hållfasthet och värmeledningsförmåga, och med att förbereda produkterna för produktion.

ÅRSKURS 3

ÅRSKURS 4 & 5

Reglerteknik

Estetik och ergonomi

Elektroteknik

Kontruktion och CAD

Energi och miljö

Företagande

Maskinelement

Designprojekt

Hållfasthetslära Matematik Mekanik, statik och dynamik Ritteknik Industriell ekonomi Verkstadsintroduktion Introduktion till maskinteknik Estetik

28

Designerns verktyg

Termodynamik

Designmetodik

Strömningslära

Ergonomi

Valfria kurser inom: Medicin/Rehab Energi/Miljö Teknik Struktur Management Material PU/Design

Designprojekt

Examensarbete

Konstruktionsmaterial

Utvecklingsmetodik

Estetik Tillverkningsmetoder

www.mtd.lth.se | 046-222 84 93 | tekniskdesign@kansli.lth.se Master of Science in Engineering  |  Mechanical Engineering with Industrial Design

300 hp | 5 år

Maskinteknik - Teknisk design 

29

–– M askinteknik med teknisk design är en utbildning som kombinerar klassisk maskinteknik med industridesign. –– Som student får du kunskap om produktutvecklingsprocessen där design, som uttrycksmedel och utvecklingsprocess, är ett väsentligt inslag. Inslaget av teknik är fortfarande stort och du får en stabil ingenjörsgrund att stå på. –– Teknisk design börjar bli ett etablerat begrepp inom industrin, och examinerade från utbildningen är mycket uppskattade av arbetsgivarna.

Vår tillvaro blir alltmer komplex och globaliserad. Vi förutsätter därför att produkter och redskap ska vara lättillgängligt begripliga och ergonomiska, men även framtagna utifrån ett hållbarhetsperspektiv. Konsekvenser och påverkan under hela produktlivscykeln måste beaktas. Design ses idag som ett självklart konkurrensmedel och det är avgörande att en produkt, utöver att fungera väl, även har estetiska kvaliteter.

Teknisk design är en civilingenjörsutbildning som blandar naturvetenskap och teknik med ett stort utbud av designrelaterade kurser av olika slag. En utbildning för dig som är både kreativ och nyfiken men samtidigt intresserad av teknik, matematik och design. Tanken är att mer teoretiska kurser varvas med färdighetskurser såsom skissning och handfast prototypbygge i våra verkstäder. Detta för att både kunna frambringa, och inte minst visualisera, nya idéer samt reflektera över dem. I början av utbildningen läser du grundläggande ämnen inom naturvetenskap och maskinteknik tillsammans med övriga maskinteknikstudenter. Successivt från våren i årskurs 1 ökar inslaget av designrelaterade kurser. Under utbildningen genomför du flera projekt. I projekten får du tillfälle att tillämpa och fördjupa dina kunskaper och färdigheter och träna upp din förmåga att arbeta kreativt och systematiskt med att utveckla och utforma produkter.

Under de två avslutande åren finns möjlighet till fördjupning inom olika områden. För dig som är intresserad av medicinteknik och produkter för funktionshindrade finns fördjupningen medicin/rehab. Du kan fördjupa dig inom energi/miljö med fokusering på ett uthålligt samhälle eller kurser i PU/design som ytterligare stärker ditt kunnande inom produktutveckling. Framtiden Som färdig civilingenjör inom Maskinteknik med teknisk design kommer du att kunna välja mellan en rad olika spännande arbeten inom olika branscher, i Sverige och utomlands. Du kan arbeta som bl a produktchef, projektledare, produktutvecklare, designer eller varför inte starta ditt eget företag runt en produktidé.

Läs mer...

Utbildningen

Caroline Ehrenborg – forskningsingenjör, Bone Support AB

Kristian Solem – forskningsingenjör, Gambro AB

Medicin och teknik, en riktigt spännande kombination.

Jätteroligt att det nu ska starta ett program i Medicin och

Jag själv gick en liknande utbildning, men hade den här utbildningen funnits i Lund vid den tidpunkten hade jag gärna valt den istället.

Teknik, synd bara att det inte fanns när jag läste på LTH. Under min uppväxt har jag alltid varit intresserad av medicin, matematik och teknik. Efter studenten på naturvetenskapliga linjen, var det dags att välja utbildning på universitetet men frågan var ska man söka läkarutbildningen eller någon civilingenjörsutbildning? Insåg att mitt matematiska och tekniska intresse var störst så jag sökte till LTH. Under mitt sista år kunde jag äntligen återförena mina två intressen, då jag valde en inriktning inom medicinsk signalbehandling. Efter civilingenjörsexamen ville jag lära mig mer om medicin och teknik så jag började doktorera inom detta område på LTH.

Idag jobbar jag på Bone Support AB:s forskningsavdelning i Lund. Vi utvecklar ett keramiskt injicerbart bensubstitut som används för behandling av benskörhetsfrakturer. Mitt arbete är mycket omväxlande, ibland fördjupar jag mig i människokroppens fysiologi för att nästa dag skriva ett datorprogram, blanda till en kemisk lösning eller studera reologin hos våra keramiska pastor. Som de flesta civilingenjörsjobb innebär mitt jobb att lösa problem, såsom produktförbättringar. Vissa dagar går jag in så mycket för själva problemlösningen att jag glömmer bort vad produkten egentligen används till. När jag sedan blir påmind om hur mycket våra produkter betyder för patienterna blir jag glad och lycklig. Det känns oerhört tillfredsställande att jobba med produkter som gör att människor med svår smärta slipper ha ont och kan få tillbaka sin livskvalité.

ÅRSKURS 1

Medicin och teknik

ÅRSKURS 2

ÅRSKURS 3

Matematik

Statistik och matematisk modellering

Cellbiologi Människans fysiologi

Matematik

Jag är nu anställd på forskningsavdelningen på Gambro AB i Lund som är ett av de större medicintekniska företagen i Medicon Valley, dvs. Öresundsregionen. Mitt jobb är tvärvetenskapligt och jag får tilllämpa mina kunskaper från både medicin och teknik för att lösa problem. Arbetet är inte bara roligt utan det känns även väldigt tillfredställande att veta att det man gör om dagarna bidrar till att rädda liv.

Ingenjörsvetenskapliga verktyg

Medicinsk informationsbehandling Klinisk kemisk diagnostik

ÅRSKURS 4 & 5

Specialiseringar inom: Medicinsk informationsbehandling Biomekanik och Biomedicinsk analys Medicinsk fysik

Biomaterial E-hälsa

Fysik

Medicinsk fysik

Valfria kurser

Organisk kemi Programmering Sjukvården i praktiken

30

Projekt i klinnovation MedTek-design

Examensarbete

www.medicinochteknik.lth.se | 046-222 14 85  | medicinochteknik@kansli.lth.se Master of Science in Engineering  |  Biomedical Engineering

300 hp | 5 år

Medicin och teknik 

31

–– Utbildningen, som är ny sedan 2011 och unik i Sverige, är tvärvetenskaplig i grunden för att ge dig de kunskaper som krävs för att utveckla framtidens teknologier inom medicin. –– Utbildningen har utvecklats i samarbete med den medicintekniska industrin och ger dig därför goda insikter i design- och innovationsprocessen där höga krav bl a ställs på patientsäkerhet. –– Vissa kurser ges på medicinska fakulteten för att ge en insyn i hur vården fungerar och skapa en levande kommunikation mellan ingenjörer och läkare/vårdpersonal. –– Som civilingenjör i Medicin och teknik kommer din kompetens att vara starkt efterfrågad inom såväl medicinteknisk industri och forskning som hälso- och sjukvård.

Programmet i Medicin och teknik är skräddarsytt för dig som har ett tvärvetenskapligt intresse och vill jobba med teknik för bättre hälsa och livskvalitet och som kan rädda liv. Redan från första årets början läser du kurser som kombinerar ingenjörens tekniska kunskaper med en grundläggande förståelse för olika medicinska problemställningar. Ett flertal kurser är specialutvecklade och baseras på den unika kompetens som finns på LTH där ett flertal framgångsrika forskningsgrupper är verksamma inom medicin och teknik. Utbildningen har tonvikt på projektarbete och innehåller bl.a. en projektkurs i MedTek-design (år 2), ett projektarbete i klinnovation (år 3) och ett avslutande examensarbete. De tre första åren ger breda, grundläggande kunskaper där medicin och teknik varvas med med biovetenskap, fysik, kemi och matematik – kunskaper som etablerar det gränsöverskridande systemtänkande som har central betydelse för en civilingenjör i medicin och teknik. Därefter väljer du en av nedanstående specialiseringar som, kompletterad med ett flertal valfria kurser, fördjupar dina kunskaper och skapar din yrkesprofil. Specialiseringar Utbildningen erbjuder tre breda specialiseringar som har det gemensamt att de bygger på den vetenskapliga mångfald som finns vid Lunds universitet. Biomekanik och biomedicinsk analys ger kunskaper om hur människokroppen påverkas av bl a mekanisk belastning och kopplar samman dessa kunskaper med modern protesteknik och rehabilitering. Denna specialisering behandlar även modern klinisk kemisk analys och diagnostik som är ett expansivt område. Medicinsk informationsteknik beskriver principer och metoder för behandling och tolkning av signaler och bilder för diagnostik och terapi.

Avancerad informationsteknik kommer att ha en mycket central betydelse i framtidens sjukvård genom att den erbjuder patienten bättre förutsättningar att fortsätta leva i sin hemmiljö. Medicinsk fysik ger fördjupade kunskaper om den fysik som ligger bakom många av de medicintekniska metoder som används inom sjukvården. I denna specialisering får du bl a lära dig de principer som ligger till grund för medicinska bildgivande system, laserbehandling och kliniskt ultraljud. Framtiden Sverige har en internationellt framträdande position inom medicinsk teknik tack vare många framgångsrika företag som ofta byggt upp sin verksamhet kring svenska innovationer. Företagens verksamhet spänner över många olika områden däribland medicinska bilder, bioteknologi, informationsteknik, rehabilitering och terapeutisk teknik. Som civilingenjör i medicin och teknik har du etablerat ett tvärvetenskapligt synsätt som gör dig speciellt attraktiv på arbetsmarknaden. Att jobba i framtidens medicintekniska industri kan betyda en anställning på ett nystartat innovationsföretag likafullt som på ett etablerat storföretag. I båda fallen kan produktutveckling, klinisk prövning eller frågor kring säkerhet och riskanalys vara utmaningen. Du kan jobba som sjukhusingenjör med ett övergripande ansvar för medicinteknisk utrustning där aspekter som inköp, användning och infrastruktur ingår. Du kan också välja att fördjupa dina kunskaper genom att forska och med tanke på att din utbildning sedan länge är internationellt väletablerad under benämningen ”biomedical engineering” kan detta ske vid ett utländskt universitet likaväl som vid ett svenskt.

Läs mer...

Utbildningen

Cecilia Sandström – konsult, Tyréns

Marcus Åberg– student

Jag valde att läsa på LTH eftersom det var ett av få ställen som erbjöd en civilingenjörsutbildning inom miljöteknik. Det var först flera år senare som jag upptäckte att det gick att läsa en avslutning inom Riskhanteringsområdet. Jag är oerhört nöjd med kombinationen av de två programmen Ekosystemteknik och Riskhantering. Det är två program som skiljer sig mycket åt men jag tycker att jag har plockat det bästa ur de två.

Det bästa med riskhanteringsutbildningen är att det är en bred utbildning. Utbildningen är anpassad för alla studenter då det är många valfria kurser så man kan anpassa inriktningen efter eget intresse. Att sedan föreläsarna sitter med stora mängder kunskap som de är ivriga att dela med sig av gör inte det hela mindre motiverande!

Jag arbetar som konsult på ett företag i Malmö, Tyréns, som sysslar med riskhantering. Det är främst riskanalyser inom samhällsplanering, transport av farligt gods och miljörisker som jag arbetar med. Jag trivs verkligen jättebra och använder kunskaper från båda programmen. Att hantera risker blir allt viktigare och då även inom miljöområdet. Jag tror att behovet inom detta område kommer att växa i Sverige, liksom det har gjort i andra länder, och då kommer det att skapas fortsatta intressanta utvecklingsmöjligheter för oss med denna utbildning.

ÅRSKURS 1-3

Det bästa med LTH är att det finns så många engagerade studenter som är med och utvecklar samarbetet med lärarna och försöker förbättra kursuppläggen så att det är aktuella. De kursansvariga lärarna tar hänsyn till våra åsikter och vi får på så sätt vara med och anpassa kursupplägget till viss del. Jag vill även lyfta fram att sammanhållningen mellan klasserna och de olika sektionerna är riktigt bra, man trivs och det har aldrig varit tråkigt att gå till undervisningen på dagarna.

ÅRSKURS 4

ÅRSKURS 5

Riskanalysmetoder

Statistiska metoder för säkerhetsanalys

Valfria kurser

Juridik inom säkerhet, hälsa och miljö Tidigare utbildningsprogram (Brandingenjör eller civilingenjör)

Människa- teknik- organisation och hantering av risker Olycks- och miljörisker i ett samhällsekonomiskt perspektiv Valfria kurser

32

Examensarbete

www.riskhantering.lth.se | 046-222 08 79 | riskhantering@kansli.lth.se Master of Science in Engineering  |  Risk Management and Safety Engineering

120 hp | 2 år (examen på 300 hp)

Riskhantering 

33

–– Alla företag och myndigheter har behov av riskhantering, vilket gör arbetsmarknaden mycket bred och det är lätt att få jobb. –– Stora möjligheter att inrikta sin egen utbildning mot allt ifrån ekonomiska risker till miljörisker. –– Kontakt med företag i arbetslivet - programmet är anpassat till marknadens behov. –– Studenterna kommer från många olika civilingenjörsprogram vilket gör att man lär sig mycket inom en stor mängd olika områden bara genom att umgås med sina studiekamrater.

Utbildningen

Utbildningens innehåll

Riskhantering handlar om att minska riskerna för stora olyckor och katastrofer, samt dess konsekvenser. Det finns riskfaktorer i all verksamhet. Men hur stora är de? Och vad består de av? Hur kan de minskas? Idag arbetar riskhanteringsingenjörer som utbildats vid LTH inom industrin, på försäkringsbolag, inom räddningstjänsten, vid kommunal och statlig förvaltning samt

I alla verksamheter som kan medföra skador på människor, miljö och egendom måste riskerna hanteras på ett riktigt sätt. Detta kräver utbildning i riskhantering. Utbildningen i riskhantering vid LTH lägger stor vikt vid att förmedla kunskap om de hot och risker som finns i samhället både vid normal verksamhet och när det förekommer olyckor. Denna utbildning är den första

som konsulter. Arbetsmarknaden är mycket god för riskhanteringsingenjörer.

av sitt slag i Sverige. Här utbildas studenterna i att identifiera och bedöma risker, föreslå åtgärder som minskar riskerna och att arbeta med ledningssystem som gör att risknivån blir låg. Utbildningen innebär också att man lär sig samarbeta med andra personalkategorier, både tekniker och icke-tekniker.

Jordbävningen i Japan våren 2011 med den efterföljande tsunamin och det havererade kärnkraftverket, svältkatastrofen på Afrikas horn samt den enorma oljeläckan från oljeplattformen Deepwater Horizon i Mexikanska Golfen är exempel på händelser som fått tragiska konsekvenser. Visst borde vi kunna undvika att sådana händelser inträffar eller i varje fall se till att de inte får enorma konsekvenser. Men hur kan man i förväg, innan sådana olyckor och katastrofer inträffar, påverka händelseförloppen? Det finns risker som behöver hanteras inom alla sektorer i samhället, både inom den offentliga och privata sektorn. Men riskhantering handlar inte bara om stora olyckor. Också vid helt vardaglig och odramatisk verksamhet kan det uppstå skador på miljön, på människors fysiska och psykiska hälsa samt på egendom. Kraven på ökad tillväxt, effektivitet och konkurrenskraft leder till stora förändringar i samhället. Utvecklingen går svindlande snabbt. Produkter utvecklas på nya sätt, produktionstakten ökar, distributionen moderniseras, kommunikationsmönster och infrastruktur förändras. Dessa förändringar medför också risker. Det gäller därför att vid planeringen tillgodose en god livskvalitet genom att i förväg fundera på vad som skulle kunna hända om något går snett.

Målet med utbildningen Studenterna erbjuds särskilt goda förutsättningar att använda riskanalys som ett systematiskt arbetsverktyg när det gäller att: • identifiera och bedöma risker • föreslå åtgärder som minskar eller förhindrar risker för att det uppstår skador på människa, miljö och egendom • utforma och arbeta med ledningssystem inom området säkerhet, miljö och hälsa. Målet är att risknivån blir låg med hänsyn till ekonomi och resurshushållning, både inom organisationen och i förhållande till samhällets krav. Antagning Anvisningar samt behörighetskrav för den som söker till programmet anges på hemsidan (se ovan). Börjar du dina studier på Brandingenjörsprogrammet vid LTH hösten år 2012 kan du, med platsgaranti efter sex terminer, välja att studera till civilingenjör i riskhantering. För dig blir det aktuellt att påbörja programmet höstterminen 2015.

Läs mer...

Behov

Sara Christiansson – student

Tomasz Wysocki – Improvement & Business Consultant, Vestas Northern Europe

På LTH har jag upplevt en stor gemenskap och funnit många vänner för livet. Det finns ett stort utbud av kurser med hög standard och många mycket kompetenta lärare och föreläsare. Miljön gör att man får chansen att utmana sig själv och utvecklas i den riktning man vill och så mycket man orkar. Teknisk fysik ger en stor bredd och öppnar därmed upp för varierande möjligheter. För mig har det passat mycket bra att läsa en stabil grund de första åren för att sedan välja bland vitt skilda inriktningar. Nu när jag är på sluttampen av utbildningen har jag också upptäckt de stora fördelarna med att läsa en känd utbildning som är mycket respekterad ute bland företagen. Jag ville läsa till civilingenjör för att jag tror detta kommer ge mig ett spännande och motiverande arbetsliv. Med en ingenjörsutbildning upplever jag att otroligt många dörrar öppnas.

ÅRSKURS 1

ÅRSKURS 2

Fysik: Vågor och kvantfenomen

Fysik: Statistisk fysik och termodynamik, vektoranalys

Mitt första jobb var som International Management Trainee på danska FOSS, som utvecklar analysinstrument för livsmedelsindustrin. Jag anställdes pga jag hade kombinerat en krävande teknisk utbildning med internationella studier och språk. Jag fick jobba inom IT och verksamhetsutveckling i bl a Danmark, Spanien, USA och Australien. Tack vare min utbildning kunde jag komma med idéer för utveckling av ITverktyg som har hjälpt företaget. Nu arbetar jag med det interna affärssystemet på danska Vestas. Företaget är världsledande på vindkraftverk – en tekniskt avancerad produkt pga sin storlek, krav på säkerhet och kvalitet. Med Teknisk fysik i bagaget går det snabbt att förstå hur produkten och processen kring dess produktion fungerar. Mitt ansvar på Vestas är att lösa problem som uppstår med våra affärssystem, så att vi snabbt och effektivt kan sälja och bygga våra vindkraftverk- lite som att vara en James Bond- man måste agera snabbt i en komplex miljö för att rädda sitt företag när det är i nöd. Jag trivs riktigt bra med den rollen, får mycket uppskattning i organisationen och går till jobbet med ett stort leende på läpparna!

ÅRSKURS 3

Fysik: Kvantteori, atom- och kärnfysik, fasta tillståndets fysik

Matematik: Komplex analys, systemteori, partiella differentialekvationer Matematik: Grundläggande analys och linjär algebra

Teknik: Mekanik och programmering

34

ÅRSKURS 4 & 5

Specialiseringar inom bl.a: Fotonik Medicinsk teknik Finansiell matematik Nanofysik Miljöteknik Teoretisk fysik

Matematik: Sannolikhetslära och statistik, vetenskapliga beräkningar Teknik: Mekanik, elektronik och mätteknik, reglerteknik, hållfasthetslära, hållbar utveckling

Teknik: Ingenjörskunskap, elektromagnetiska fält, beräkningsteknik, ekonomi, hållbar utveckling

Valfria kurser

Examensarbete

300 hp | 5 år

www.tekniskfysik.lth.se | 046-222 08 54 | tekniskfysik@kansli.lth.se Master of Science in Engineering  |  Engineering Physics

Teknisk fysik 

35

–– T eknisk fysik är programmet för dig som tycker att matematik och fysik är intressant och roligt och som vill veta mer om hur ämnena används i samhället och näringslivet. –– Du kan arbeta med forskning och utveckling vid universitet eller inom näringslivet. –– Många civilingenjörer i Teknisk fysik är innovatörer och entreprenörer med egna företag. –– Du blir inte en förvaltare av känd kunskap utan någon som formar framtiden. Ingen vet hur världen ser ut eller vad ingenjörsyrket innebär om 10 eller 20 år, men som civilingenjör i Teknisk fysik kan du anpassa dig till nästan vad som helst.

Som civilingenjör i Teknisk fysik har du god insikt i de fysikaliska lagar som styr världen och du har vad som krävs för att förverkliga ny teknik och nya uppfinningar. Du är bra på att hantera och sortera stora mängder information och du är specialist samtidigt som du har den bredd som krävs för att samarbeta med människor med andra kompetenser. Förutom de djupa kunskaper i matematik och fysik som behövs för utveckling i vårt samhälle har du insikt i teknikområden som t ex hållfasthetslära, energi- och miljöteknik och programmering. Tekniska fysiker fungerar ofta som projektledare eller spindel i nätet när projekt ska startas och drivas. Utbildning Under de tre första åren av totalt fem läser du obligatoriska kurser som lägger grunden för hela utbildningen. Ämnena kan delas upp i fysik, matematik och teknikämnen. Den sista kategorin innehåller till exempel mekanik, reglerteknik, elektronik, elektromagnetiska fält och hållbar utveckling. Efter de tre första åren har du gedigna kunskaper i matematik och modern fysik och har fått nya perspektiv på hur de tillämpas inom olika teknikområden - t ex hur numeriska beräkningar kan användas för att modellera värmeledning eller kvantmekaniska fenomen. Du har också fått insikt i vad teknik är och vilken betydelse den har nationellt och globalt, för enskilda människor såväl som för mänskligheten. Under de två sista åren väljer du fritt fördjupningskurser i de ämnen som du är intresserad av, dessutom kan du bredda dig med kurser i till exempel språk och ekonomi. Lunds universitet är ett komplett universitet och du kan välja att läsa kurser motsvarande 15 högskolepoäng inom andra delar av universitetet. Efter ditt tredje år kan du söka en praktikkurs och tillbringa 8 veckor på ett företag och där prova på ingenjörsrollen i verkligheten. Det är vanligt att studenter på programmet tillbringar en eller två terminer utomlands genom ett av universitetets många utbytesprogram. Specialiseringar 

Några specialiseringar är fokuserade på matematik, t ex finansiell modellering, några på olika delar av fysiken, som exempelvis fotonik eller teoretisk fysik och några är mer teknikorienterade, som medicinsk teknik, programvara eller energisystem. Samtliga specialiseringar ger dig kontakt med ledande forskningsmiljöer. I Lund finns världsledande forskning inom många områden, som exempelvis nano- och materialvetenskap, matematisk bildanalys, laserfysik och medicinsk teknik. Utbildningen avslutas med ett examensarbete som kan utföras vid LTH, vid någon annan högskola eller vid ett företag. Examensarbetet är en av dina viktigaste meriter när du söker jobb. Framtiden Efter examen har civilingenjörer i teknisk fysik en oerhört bred arbetsmarknad. En gemensam nämnare är den allmänna förmågan att snabbt skaffa sig god överblick över och sätta sig in i nya, ofta tvärvetenskapliga, problemställningar vars lösning kräver kunskaper och metoder från flera olika områden. Tekniska fysiker arbetar ofta i ledande roller i forsknings- och utvecklingsarbete, både inom företag och inom universitet, eller som entreprenörer i egna företag. Tekniska fysiker från Lund jobbar t ex vid ABB Robotics, Analytic Investors, Anoto, Astra Zeneca, AWA Patent, Bofors, EON, Ericsson, Exportrådet, Gambro, Handelsbanken, Hewlett Packard, IBM, IKEA, Karolinska institutet, Kockums, McKinsey, Procter&Gamble, Saab, Scania, Skånes universitetssjukhus, Softhouse Consulting AB, Tetra Pak, Totalförsvarets forskningsinstitut, Vattenfall och såklart vid många fler arbetsplatser.

Läs mer...

Du skaffar dig fördjupade kunskaper i något av programmets ämnesområden genom att du läser hälften av dina valfria poäng inom en specialisering. Programmet har väldigt många specialiseringar – titta på www.tekniskfysik.lth.se för mer information.

Martin Appelgren – Consultant, Accenture, Köpenhamn

Hilda Lindvall – student

Jag tyckte det var en väldigt utvecklande, utmanade och intressant utbildning som verkligen har utvecklat min problemslösningsförmåga och analytiska sida. Matematiken har fungerat som en röd tråd genom alla olika ämnesområden vilket har gjort att vi snabbare kunnat se mönster och sammanhang i för oss nya områden. Detta har varit enormt värdefullt för mig i mitt vardagliga arbete. Dessutom är Lund en fantastisk studentstad att tillbringa sina studieår i.

Det bästa med LTH är stämningen! Under mina hittills tre år vid LTH har jag nästan bara mött trevliga personer och det gäller både lärare och studenter. Sammanhållningen bland studenterna är mycket bra, vi gör allt vi kan för att hjälpa och underlätta för varandra.

Sedan februari 2008 så jobbar jag hos Accenture i Köpenhamn vilket är ett globalt företag med verksamhet inom management, IT och outsourcing med cirka 220 000 medarbetare och kontor i över 120 länder. Min inriktning har blivit mot försäkringsbolag och de IT-system som deras medarbetare använder i sina dagliga arbeten. Min huvudsakliga roll har varit att vara funktionell arkitekt för systemets försäkrings- och kundmoduler där jag tillsammans med vår klient designar/anpassar dessa moduler till klientens krav. Jag fungerar också som länk mellan klienten och programmerarna.

ÅRSKURS 1

Matematik

ÅRSKURS 2

Matematik

Det bästa med utbildningen är utmaningen. Varje dag lär jag mig något nytt och det som kändes omöjligt för ett halvår sedan känns självklart nu. Jag hoppas att jag i slutet av utbildningen kommer kunna knyta ihop all kunskap under mina år vid LTH och sen använda dem för att få mitt drömjobb och för att uppnå mina mål. En kompis övertalade mig att söka teknisk matematik. Jag har en bit kvar till examen men han kommer vara en av de första som får inbjudan till min examensfest. Jag är så glad över att han talade varmt om LTH och utbildningarna och det är jag honom evigt tacksam för. Att jag fortfarande inte riktigt vet vad en typisk civilingenjör har för arbetsuppgifter spelar ingen roll. Detta eftersom man som ingenjör har oändligt många möjligheter och det ena jobbet är inte det andra likt.

ÅRSKURS 3

Matematik

Matematisk modellering Matematisk statistik Matematisk modellering

ÅRSKURS 4 & 5 Specialiseringar inom: Beräkning och simulering Biologisk och medicinsk modellering Finansiell modellering Miljö, risk och klimat Signaler, system och reglering Programvara

Numerisk analys Ekonomi Elektroteknik

Programmering Programmering Fysik och mekanik

36

Reglerteknik

Signalbehandling Biologi och hållbar utveckling

Valfria kurser

Examensarbete

www.tekniskmatematik.lth.se  |  046-222 37 36 |  tekniskmatematik@kansli.lth.se Master of Science in Engineering  |  Engineering Mathematics

300 hp | 5 år

Teknisk matematik 

37

–– Programmet där du läser mer matematik än på andra civilingenjörsprogram. –– Du får en bred bas av tillämpningsämnen som du kan använda matematik inom, vilket ger stora valmöjligheter i arbetslivet. –– Du får en specialistkompetens som matematiker inom något teknikområde. –– Du utvecklar din problemlösningsförmåga och din förmåga att arbeta matematiskt med många olika typer av problem, även sådana som från början inte är formulerade i matematiska termer.

Utbildningen Matematik är teknikens och vetenskapens språk och har alltid varit ett kärnämne för en civilingenjör. Den snabba datorutvecklingen gör att matematiken i dag blivit än viktigare, t ex för att effektivt analysera information och göra simuleringar. Matematik genomsyrar vardagslivet, ofta utan att man tänker på det, med allt från Google och väderprognoser till prissättning av optioner på börsen. Det finns idag många nya områden, t ex inom bioinformatik, IT, medicin och ekonomi, där det behövs avancerad matematik som ofta ännu inte är färdigutvecklad. Specialiseringar Specialiseringarna inom Teknisk matematik är var för sig mycket breda och tillsammans täcker de nästan all sorts ingenjörskonst där analys och simuleringar har betydelse. Varje specialisering hålls samman av stora stycken gemensam matematik. Detta hjälper till att skapa bra överblick över breda fält, vilket också är en viktig specialistkompetens för en teknisk matematiker. Beräkning och simulering Här byggs en bred bas av generella verktyg för modellering och beräkning för komplexa system och fenomen i naturen och industrin. Specialiseringen skapar möjlighet att från den matematisk- beräkningstekniska sidan profilera sig inom ett brett fält av teknikområden t ex elektroteknik, maskinteknik, mekanik, kemi, strömningslära, fysik, byggnadsteknik. Biologisk och medicinsk modellering Inom denna specialisering sysslar man med matematisk modellering, simulering och beräkning inom biovetenskaperna, av intresse för bl a läkemedels- och medicinsk industri samt sjukvård. Ett aktuellt område är bioinformatik, där det idag finns ett stort behov av nya matematiska metoder för att söka och känna igen mönster i stora informationsmängder, t ex databaser av gener.

Miljö, risk och klimat Risker i tekniska system har sedan lång tid varit ett fält där matematik och statistik kommit till stor användning. Specialiseringen mot risk, miljö och klimat breddar verksamhetsfältet till några andra områden där matematisk modellering och analys blivit viktiga verktyg. Bildtolkning i fjärranalys, extremvärden i klimatmodeller och simulering av biologiska system är några exempel. System, signaler och reglering I denna specialisering byggs en bred bas av matematiskt-systemvetenskapliga verktyg och teori. Dessa har breda användningsområden inom system uppträdande inom industri och forskning, och har kontaktytor även mot de andra specialiseringarna inom Teknisk matematik. Programvara I denna specialisering lär du dig hur man utvecklar stora programvarusystem. Kurserna behandlar alla delar av utvecklingen; från hur man ställer krav på systemen till hur man utvecklar dem med avancerade programmeringstekniker, samt hur man testar dem. Framtiden Som civilingenjör i Teknisk matematik är du eftertraktad på arbetsmarknaden och kan få intressanta jobb över ett brett fält av arbetsgivare och branscher. Du kan se fram emot ett omväxlande arbete där du utvecklar eller forskar kring avancerade tekniska produkter, system och teori. De tekniska problemområdena kommer att skifta under din yrkeskarriär, men den breda träning i matematiska arbetssätt som utbildningen ger dig kommer att göra dig varaktigt attraktiv på arbetsmarknaden. Många kommer att arbeta i team där de bidrar med matematisk specialistkunskap bland specialister inom andra områden. För detta är du väl förberedd genom utbildningens bredd och den träning i kommunikation och modellering som du fått.

Läs mer...

Finansiell modellering Matematiska och statistiska modeller och metoder spelar en allt viktigare roll inom ekonomisk verksamhet vid t ex banker och försäkringsbolag. Inom denna specialisering byggs en bred bas inom ekonomiska områden åtkomliga för kvantitativ modellering och analys.

Chi-Manh Tran – Research Technician, Haldor Topsoe, Danmark

Malin Sohlmér – student

Det som var bra med utbildningen var att man fick en bred bas inom kemi, elektronik, biologi och fysik. I slutet av utbildningen inriktar man sig mot det som man är intresserad av, vilket för min del blev materialinriktningen.

Det bästa med LTH är att det finns mycket roligt att engagera sig i även utanför studierna. Man får en chans att skaffa vänner och knyta kontakter både från universitetet och olika företag. Det är en investering för livet. LTH är en bra skola med mycket kunnande också.

Efter min utbildning har jag jobbat på Haldor Topsoe som producerar katalysatorer. Jag har fått huvudansvaret för ett elektronmikroskop av avancerad karaktär. Värt att nämna är dess egenskap att kunna leda in gaser för att studera strukturförändringar och kemiska förlopp i realtid. Det vardagliga arbetet är varierat men handlar till stor del om att karakterisera och analysera olika typer av prover. Dessa kan vara allt från metaller till keramer. Jag jobbar väldigt mycket utåt med tanke på att det både är interna och externa kunder som skickar in proverna för analys. Arbetet är inte alls introvert som många skulle tro. Varvat med det dagliga arbetet deltar jag även i olika projekt, där samarbete är en viktig beståndsdel. Det ges tillfälle för experter inom olika fält såsom kemister, fysiker, tekniker och materialvetare att träffas för att komma fram till lösningar på olika problemställningar. Detta tycker jag är både stimulerande och utvecklande då man får vara med och påverka.

ÅRSKURS 1

ÅRSKURS 2

Introduktion till nanovetenskapen

Cellens biologi

Ternodynamik, våglära, optik och atomfysik

Kvantfenomen och nanoteknologi Människans fysiologi

På teknisk nanovetenskap har vi möjlighet att läsa kurser från många olika institutioner och träffa människor från många olika yrkesområden. Det är kul att se hur olika t ex en tekniker och en biolog tänker. Sen är det väldigt roligt att vara del av allt det nya som nanoteknik står för. Det känns som att man är del av framtiden. Jag valde att utbilda mig till civilingenjör eftersom det verkade som en rolig utbildning som ger möjlighet att jobba med lite allt möjligt. Jag hade ganska svårt att bestämma mig så det var nog bredden som lockade.

ÅRSKURS 3

ÅRSKURS 4 & 5

Analys på nanoskalan Komponentteknologi Projekt nanoingenjör

Specialiseringar inom: Nanobiomedicin Material Nanofysik Högfrekvens- och nanoelektronik

Allmän och oorganisk kemi Organisk kemi Programmering

Elektroniska material Funktionella material

Ellära och elektronik Endimensionell analys Linjär algebra

38

Flerdimensionell analys Tillämpad matematik

Reglerteknik Sensorer Hållbar utveckling med nanoperspektiv Matematisk statistik

Valfria kurser

Examensarbete

www.teknisknanovetenskap.lth.se | 046-222 08 54 | teknisknanovetenskap@kansli.lth.se Master of Science in Engineering  |  Engineering Nanoscience

300 hp | 5 år

Teknisk nanovetenskap 

39

–– D en enda utbildningen i Sverige inom Teknisk nanovetenskap som ger både en civilingenjörsoch en masterexamen. –– En utbildning för dig som är intresserad av biomedicin, fysik och kemi och vill tillämpa nanoteknik för att skapa framtidens material, läkemedel eller elektronik. –– En tvärvetenskaplig utbildning som med hjälp av specialkomponerade kurser ger ett helhetsperspektiv på nanoteknik.

Utbildningen Som enda tekniska högskola i landet startade LTH 2003 ett utbildningsprogram som idag ger både en civilingenjörs- och en mastersexamen i Teknisk nanovetenskap. Genom tvärvetenskapligt samarbete inom Lunds universitet erbjuder vi ett helhetsperspektiv på nanoteknik, där specialkomponerade kurser t ex i kemi och biomedicin bidrar till att bredda den grund som fysik och matematik ger. Under de fem åren får du både studera teori och lära dig använda tekniker inom nanoteknologin. Efter tre år får du skapa dig en egen profil mot yrkesrollen som nanovetare inom en av fyra specialiseringar. Målet med utbildningen är att utbilda civilingenjörer som känner sig tilltalade av att sudda ut gränserna mellan traditionella kunskapsområden som biologi, fysik, kemi, materialvetenskap och elektronik. Redan från dag ett återspeglas denna tvärvetenskapliga karaktär i utbildningen. Det betyder att utbildningen i teknisk nanovetenskap attraherar motiverade studenter med en mycket bred intressesfär. Många nanostudenter utnyttjar också möjligheten att läsa kurser eller göra examensarbete i utlandet. En vistelse utomlands spetsar utbildningsprofilen men ger också erfarenheter för livet. Specialiseringar På Teknisk nanovetenskap kan du välja att specialisera dig inom någon av våra fyra specialiseringar: Nanobiomedicin, material, höghastighets- och nanoelektronik eller nanofysik. Specialiseringarna ger spetsen i utbildningen efter de inledande tre årens breda grundblock. Oavsett vilken av specialiseringarna du väljer kan din framtida arbetsmarknad komma att vara både industrin och akademin.

Nanofysikspecialiseringen är bred och kan leda till arbete inom allt från grundläggande halvledarfysik till mer teoretisk modellering av nanostrukturer. Men om du vill kan du kombinera fysiken med biologin även i din specialisering och på så sätt komma att arbeta med något så spännande som experimentell eller teoretisk biofysik! Framtiden Nanotekniken har identifierats som ett nyckelområde för svensk industris framtid. Det finns redan åtskilliga exempel på nanoteknik inom dagens industri, och i vissa fall är det först på senare tid företagen uppmärksammat att det som de sysslat med i många år faktiskt är nanoteknik. Till exempel används nanopartiklar i slitstarka däck, i målarfärg och cement, som UV-filter i solkräm och, vilket är det äldsta exemplet av alla, för att färga glas. Nanostrukturerade ytor som inte repas har börjat dyka upp i stekpannor, liksom nanodesignade trådar i byxor på vilka inte ens ketchup fastnar. Efter examen kan du se fram emot ett omväxlande arbete där du, ofta i en internationell miljö, arbetar med att utveckla forskningsnära, avancerade tekniska produkter, system och metoder inom biologi, fysik, kemi, elektronik eller materialvetenskap. Du kan t ex komma att arbeta som specialist eller forskare i ett företag inom biomedicin, informationsteknik eller materialteknik. Du kan, som Chi-Manh här intill, välja att arbeta som ingenjör vid ett multinationellt företag eller att arbeta med forskning och undervisning vid ett svenskt eller utländskt universitet. Kanske väljer du istället att bedriva konsultverksamhet eller, varför inte, starta ditt eget innovationsföretag. Du kommer med din tvärvetenskapliga utbildning att vara attraktiv på arbetsmarknaden!

Läs mer...

Med en specialisering i nanobiomedicin kan du välja att förbereda dig för jobb inom t ex läkemedelsindustrin. Du kan också komma att arbeta med utveckling av andra typer av medicinska produkter eller material för medicinska ändamål. Nanobiomedicin gränsar alltså till specialiseringen inom material. Har du valt denna, är det möjligt att du t ex hamnar inom industri som utvecklar starkare och lättare material för allt från tennisracket till flygplan. En specialisering inom höghastighets- och nanoelektronik kan leda till att du får arbeta med utveckling av elektronik för nästa generations datorer; komponenter designade för hög hastighet och låg energikonsumtion.

Maria Malm – verksamhetsansvarig för investeringar i lokalnätet, E.ON Elnät Sverige

Björn Andersson – student

Jag ansvarar för att det finns kort- och långsiktiga ombyggnadsplaner i vårt mellan- och lågspänningsnät. Investeringsplanerna baserar sig på analyser av befintliga och framtida kapacitetsbehov och risker. Den avdelning jag driver arbetar med projekten från att ett behov definierats till dess att beslut tas och projektet kan lämnas över till utförande. I uppdraget ingår projektering, budgetansvar med ekonomisk uppföljning och prognosarbete.

Det bästa med LTH är att det är många olika civilingenjörsutbildningar samlade i en studentstad där det alltid är något nytt på gång. Traditionerna och gemenskapen på LTH är något man inte ska behöva missa.

Vår organisation är nationell från Skåne i söder till mellersta Sverige vilket medför att jag reser mycket i tjänsten. Det är ett utmanande och omväxlande arbete. Detta är min andra tjänst inom E.ON. Tidigare jobbade jag som projektingenjör på den avdelning som utför investeringsprojekten. Dessförinnan hade jag en traineetjänst på NCC Construction Sverige AB, där jag var arbetsledare på ett Citytunnel-projekt i Malmö.

Väg och vatten är en bred utbildning med bred arbetssektor som gör att man kan variera sig i arbetslivet. Programmet har bra kontakt med företag ur näringslivet vilka kommer och föreläser eller på annat sätt medverkar i utbildningen. Många av föreläsarna forskar parallellt med undervisningen vilket gör att man kan få en inblick i vad som är på väg ut i branschen. Jag gillar problemlösning, vilket gjorde civilingenjörsutbildning till ett naturligt val. Som civilingenjör är man inte bara attraktiv inom Sverige utan även internationellt.

Som civilingenjör öppnas många dörrar och valmöjligheter!

ÅRSKURS 1

ÅRSKURS 2

ÅRSKURS 3

Byggnadskonstruktion

Anläggningsteknik

Mekanik Fysik Trafik Vatten och miljö Byggnadsteknik

Statistik

ÅRSKURS 4 & 5 Specialiseringar inom: Anläggningsteknik Byggproduktion och förvaltning Husbyggnadsteknik Konstruktion Väg- och trafikteknik Vattenresurshantering

Byggprocessen och ekonomi Fördjupande kursval Matematik Matematik

40

Valfria kurser

Examens arbete

300 hp | 5 år

www.v.lth.se  |  046-222 92 48 |  vagochvattenbyggnad@kansli.lth.se Master of Science in Engineering  |  Civil Engineering

Väg- och vattenbyggnad 

41

–– L eder till en examen som ger dig möjlighet att påverka hur vårt framtida samhälle ska se ut och fungera, från stadsplanering och byggande till naturresursplanering och praktisk miljövård. –– Du får under studietiden kontakt med företrädare för din framtida arbetsmarknad liksom en inblick i denna genom olika inslag i kurserna. –– Vid LTH finns landets bästa kompetens inom husbyggnadsteknik, vattenresurshantering och trafikplanering.

Utbildningen De första tre åren innehåller ämnen som ger dig en bas inom största delen av en Väg- och vattenbyggares arbetsområde. Under de avslutande två åren av utbildningen skaffar du dig en kunskapsprofil genom ditt val av specialiserade kurser och examensarbete. Du kommer under hela studietiden att bygga upp din problemlösningsförmåga och förmåga att kommunicera dina idéer och slutsatser till omgivande samhälle. Specialiseringar Anläggningsteknik Denna specialisering innehåller främst kurser inom konstruktion, vägbyggnad och grundläggningsteknik, för att ge dig förståelse för och kunskap om planering och utformning av infrastruktur, främst större anläggningskonstruktioner. Som anläggningsprojektör arbetar du med att planera och konstruera olika typer av anläggningar, som vägar, järnvägar, tunnlar, broar och andra konstruktioner med krav på design, hållfasthet, beständighet, miljö, hållbar utveckling och alla övriga anspråk som finns på dagens infrastruktur. Byggproduktion och förvaltning En specialisering riktad mot byggproduktion och förvaltning innehåller ett spektrum av ämnesområden som byggproduktion, fastighetsföretagande, fastighetsekonomi, bygg- och anläggningsteknik och hållbar utveckling. Efter genomgången specialisering kan du leda och medverka i byggprojekt både som beställare och entreprenör, samt genom god förvaltnings och fastighetsekonomisk kompetens leda ett fastighetsföretag. En stor variation av yrkesmöjligheter finns: fastighetsförvaltare, fastighetsutvecklare, byggentreprenör, facility manager, byggledare, projektledare mm. Husbyggnadsteknik Inom denna specialisering finns det främst kurser som ger fördjupade kunskaper om byggnadsrelaterade energi- och fuktfrågor, inomhusmiljö, materialteknik och konstruktion. Du får en helhetssyn på byggnadens olika funktioner som gör att du kan välja den totalt sett bästa tekniska lösningen. Vid LTH finns landets bästa kompetens inom husbyggnadsteknik. Denna specialisering leder till arbete där du är med och utformar olika typer av hus med de krav som finns på dagens byggnader när det gäller

Konstruktion Specialiseringen inom konstruktion ger en fördjupning inom de beräkningsmetoder och praktiska kunskaper som krävs för att förstå och kunna utföra hållfasthetsberäkningar och dimensionering för byggnader och anläggningar. Kurserna är främst inriktade mot mekanik, konstruktion och materialteknik och ger en god grund för att i framtiden arbeta med utformning av konstruktioner. Arbetsuppgifterna är av problemlösande karaktär och nytänkande och förmåga att skapa praktiskt fungerande byggnadsverk i samarbete med arkitekter och andra specialister är centralt. Väg- och trafikteknik Specialiseringen är upplagd med två sammankopplade spår inom trafikteknik respektive vägbyggnad. Du får de kunskaper som behövs för att arbeta med utveckling och förbättring av trafiksystemen med hänsyn till bl a kapacitet, miljöpåverkan och säkerhet. Du lär dig också vägbyggnad, hela kedjan från utformning och produktion till drift och underhåll. Vattenresurshantering I denna specialisering finns kurser inriktade mot grundvatten och miljö, hydrologi, hydraulik, och vatten- och avloppsteknik. Du får bl a lära dig att hantera frågor som rör vattenförsörjning och avloppsvattenhantering samt skydd av vattentäkter och recipienter. Du kan även arbeta med vattenfrågor relaterade till miljö, infrastruktur, vattenkraft och industriell VA-teknik. All undervisning sker på engelska – inslaget av internationella studenter är stort. Framtiden Samhället har behov av civilingenjörer som har kompetens att delta i planering, byggande och förvaltande av byggnader och anläggningar, transportsystem och samhällen. Detta gäller såväl nationellt som internationellt vilket innebär att du har en bred framtida arbetsmarknad. Din arbetsplats kan finnas både inom privat såväl som offentlig sektor, den kan finnas hos mindre konsultfirmor eller stora entreprenad-företag. Oavsett var du arbetar i framtiden kommer du att ha stora möjligheter att få ett intressant arbete där din insats kan göra skillnad.

Läs mer...

beständighet, energiförbrukning, innemiljö och säkerhet.

Niclas Unnervik – student

Ida Rasmark – student

Det bästa med LTH är att det går så mycket bra människor där – studenter med olika bakgrunder och olika intressen, människor som man kanske aldrig hade kommit i kontakt med annars. Det bästa med själva utbildningen är att den är krävande, men otroligt givande. Lärarna förväntar sig ofta mycket, men är själva villiga att ställa upp med sin tid för att förklara och gå igenom saker, även utanför lektionstid, vilket är väldigt motiverande och sporrande.

Jag tycker om att friheten är så stor på utbildningen. Man kan lägga upp sitt schema hur som helst, göra tentor närsom, de flesta schemalagda aktiviteterna är frivilliga och man kan plugga när man vill, universitetet är alltid öppet.

Jag valde Kinainriktningen för att jag alltid varit intresserad av språk, och det lät väldigt roligt och bra att kunna väva in språk i utbildningen. Att man sen var garanterad en utbytesplats i Kina var ju inte helt fel det heller. Något man märker fort i Kina är att studiemiljön är helt annorlunda där, men det kanske inte är så oväntat eftersom Kina skiljer sig från Sverige på de flesta sätt. Gällande språkstudierna är utbytestudier ett enormt bra sätt att lära sig ett språk eftersom man får använda språket varje dag – något man inte gör när man läser ett språk på hemmaplan. Kort och gott: jag skulle inte tveka att läsa Kinainriktningen om jag fick göra om valet!

ÅRSKURS 1

ÅRSKURS 2

Eftersom jag är från Lund hade jag egentligen tänkt läsa någon annanstans. Men Kinainriktningen fick mig att vilja läsa i Lund – det var något annorlunda som inte fanns någon annanstans. Jag är även intresserad av språk och av att resa, och jag planerar att åka utomlands igen i årskurs 5 eftersom det var så roligt! Jag funderade inte så mycket på hur det skulle vara att studera i Kina. Kanske var det därför som jag upplevde flera stora kulturkrockar när jag kom till Hangzhou: sättet de undervisade på, vilken mat man åt, hur man åt, hur man bodde, etc. Detta kunde både vara frustrerade och väldigt roligt, och jag tycker personligen att det är just hur annorlunda Kina är som gör det så spännande och utmanade att åka dit och studera.

ÅRSKURS 3

ÅRSKURS 4 & 5

Obligatoriska kurser Obligatoriska kurser inom: Datateknik Elektroteknik InfoCom

Signalbehandling Reglerteknik

Obligatoriska kurser Kinesiska & kinakunskap

42

Valfri sommarpraktik i Kina

Kinesiska Specialiseringar & valfria kurser

Obligatoriska kurser

Examensarbete

www.lth.se/kinainriktningen | 046-222 47 83 | kinainriktningen@kansli.lth.se

Kinainriktningen 

43

–– En väg som är öppen för dig som är intresserad av civilingenjörsutbildningarna i datateknik, elektroteknik eller informations- och kommunikationsteknik! –– En unik utbildning som kombinerar teknik och språk. –– Du får en värdefull inblick i kinesisk kultur och tillgång till en av världens mest expansiva jobbmarknader. –– Utbildningen innehåller en till två terminer vid kinesiska toppuniversitet. –– Du kan ansöka om sommarpraktik på svenska företag i Kina.

Är du intresserad av Kina, världens folkrikaste nation och mest expansiva marknad? Vill du utbilda dig för ett internationellt jobb inom högteknologi? Då ska du satsa på LTHs Kinainriktning! Utbildningen Svenska företag satsar enormt mycket i Kina. Till det behövs det duktiga civilingenjörer som både har en teknikutbildning i toppklass och förståelse för hur det är att arbeta i en annorlunda kultur och miljö. Kinainriktningen är öppen för dig som vill studera till civilingenjör i Datateknik, Elektroteknik eller Informationsoch kommunikationsteknik. För att kunna läsa Kininriktningen ska du ansöka till och börja på något av dessa program. Sedan söker du till Kinainriktningen i slutet av ditt första år på LTH. Kinainriktningen omfattar det andra året och framåt på din utbildning. Under det andra året läser du kurser i kinesiska och Kinas kultur och samhällsliv parallellt med dina teknikstudier i Lund. Kurserna ges av Språk- och litteraturcentrum vid Lunds universitet och är skräddarsydda för inriktningen. Under höstterminen det tredje läsåret studerar du språk och teknik vid Zhejiang University i Hangzhou – ett topprankat kinesiskt universitet. Teknikkurserna anordnas av LTH och läses tillsammans med kinesiska studenter.

Under de sista åren kan du bygga vidare med språkstudier i Lund och tillbringa ytterligare en termin vid något av Lunds universitets kinesiska partneruniversitet. Som kronan på verket kan du göra ditt examensarbete i Kina. Du kan givetvis också bredda din internationella erfarenhet genom utbytesstudier vid något av LTHs hundratals partneruniversitet runt om i världen. För att trivas på Kinainriktningen måste du vara beredd på att anta krävande utmaningar både när det gäller språk- och teknikstudierna. Du måste också vara beredd att anpassa dig till en ny kultur under dina utlandsstudier.

Läs mer...

Det kinesiska tecknet för familj, gemenskap

Karin Andersson – Supply Chain Graduate, Novo Nordisk A/S

Tor Blomdell – Trainee, Ericsson

Jag läste Teknisk fysik som grundutbildning och avslutade mina sista år på LTH med avslutningen Technology Management. Jag måste säga att de båda delarna av min utbildning kompletterade varandra mycket bra. Teknisk fysik gav en riktigt bred teknisk grund och just den där utmaningen i problemlösning jag sökt efter. På Technology Management fick jag helt nya utmaningar i form av effektivt ledarskap och teamarbete och en helt ny förståelse för vad dagens företag står inför och dagligen arbetar med. I kombination gav Teknisk fysik mig de tekniska och matematiska detaljerna som grund och Technology Management lärde mig sedan att analysera problemen från ett holistiskt och mer strategiskt perspektiv. Genom hela utbildningen har jag haft en mycket brant lärkurva och lärare, övningsledare och andra studenter har hela tiden varit ett fantastiskt stöd.

Jag valde att studera i Lund och vid LTH baserat på två parametrar, ett varierande och anrikt studentliv samt en välrenommerad utbildning. Båda bidrog starkt till min personliga utveckling och lärande, vidare gav de mig möjligheten att uppleva och leda varierande verksamheter samt att träffa nya människor. Det är kombinationen av de två som gör att min studietid var den bästa tiden i mitt liv!

Det senaste året, efter examen, har jag varit en del av Novo Nordisk Graduate Program med inriktningen Supply Chain, ett 2 år långt program med tre rotationer inom olika områden i företaget. Novo Nordisk är ett danskt företag inom pharmabranschen som är världsledande inom diabetesbehandling och verksamma i hela världen. Mina första åtta månader spenderade jag i Strategic Sourcing där jag fick arbeta mycket med strategiska inköpsprocesser och Supplier Relationship Management. Just nu arbetar jag i Kina som Project Portfolio Manager och min främsta arbetsuppgift är att etablera effektiv projekt governance process i vår nya fabrik här. Jobbet innebär många spännande utmaningar, inte minst tack vare den mångkulturella miljö som jag dagligen verkar i.

44

På Industriell ekonomi skaffade jag mig min tekniska och ekonomiska bas, men det var först när jag började på Technology Management som jag fick kombinera dessa med ledarskap och management. Allt detta applicerat i en industriell kontext med verkliga case och utmaningar i näringslivet. Vidare fick jag möjligheten att studera och umgås med motiverande och ödmjuka människor, många som än i dag är mina bästa vänner. Det är verkligen människorna som jag skulle vilja belysa med Technology Management, lärdomen av att få starka individer att arbeta bättre tillsammans, som en grupp, mot ett gemensamt mål är det som gör utbildningen unik och även det som jag har störst nytta av idag. Efter mitt examensarbete i Kina började jag som Trainee på Ericsson, en fantastisk möjlighet att utforska verksamheten och industrin både från ett geografiskt och ett organisatoriskt perspektiv. Genom arbetet har jag fått nya vänner i hela världen samt fått möjlighet att arbeta i Sverige, Indien och USA med allt från företagsförvärv, strategi- och organisationsutveckling samt försäljning och innovation. Rollen som trainee och anställd liknar mycket studietiden vid Technology Management, då det handlar om att praktiskt, identifiera och lösa tekniska och ekonomiska problem tillsammans med mina kollegor genom att utveckla individerna, gruppen och verksamheten som jag arbetar med.

www.tm.lu.se  |  046-222 84 91

Technology Management 

45

Technology Management (TM) är en avslutande inriktning för ingenjörs- och ekonomistudenter som vill arbeta integrerat med teknologi, ekonomi och management. TM bedrivs i samverkan med Ekonomihögskolan vid Lunds universitet (EHL). Utbildningens mål är att förse näringsliv och samhälle med goda medarbetare som kan möta framför allt industrins behov av mångsidighet, kreativitet samt ledarskap.

Technology Management ska ge kunskap och förståelse för samspelet mellan teknologi, ekonomi och människa och skapa förutsättningar för att framgångsrikt kunna leda utvecklingen av framtidens produkter och tjänster. Utbildningen ger studenterna tillfälle att, i nära samarbete med näringslivet, studera och praktisera ledarskap, projektledning och strategi, innovation och industriell marknadsföring. I TM-avslutningen kombineras och sammanstrålar ämnesområden, lärare och studenter från LTH och EHL. Under den första fasen läser ekonomerna teknologikurser och LTH-studenterna strategi

TM avslutas med ett examensarbete där ekonomer och teknologer arbetar tillsammans. Alla som läser ett civilingenjörsprogram (förutom Riskhantering och Maskinteknik med teknisk design) vid LTH kan söka till TM. Ansökan görs under sjätte studieterminen och antagningen grundas på uppnådda studieresultat, en skriftlig motivering samt personlig intervju. Till utbildning antas varje år 20 studenter från LTH samt 20 ekonomie kandidater.

& styrsystem vid Ekonomihögskolan i Lund. I den andra fasen läser studenterna tillsammans kurserna: Teknologi, strategi och struktur Marknadsdriven produktutveckling Innovativt utvecklingsarbete - Intraprenörskap i praktiken Projektledarskap Teamwork och ledarskap

Läs mer...

• • • • •

Kristina Philipson – arkitekt, White Arkitekter

Farhad Jalalvand – student

LTH har en väldig omsorg om sina studenter. Hos lärare och personal finns en vilja att liksom hjälpa, vägleda och peppa studenterna som jag inte mött på någon annan skola. Att flytta omkring och se sig om under studietiden uppmuntras och ses som något positivt. Jag har fått möjlighet att läsa en utbytestermin i Montpellier, Frankrike och en termin som gäststudent på Arkitekturskolan på KTH.

Jag tycker att det bästa med LTH och Arkitekskolan är alla kontakter och utbyten, både gästlärare och studenter, med andra universitet runtom i världen. En arkitektutbildning är en väldigt praktisk och kreativ utbildning. Skolan utbildar oss allsidigt, dvs både inom fysiskt byggande i form av modeller och installationer samt inom digitala verktyg. Arkitektskolan i Lund är en internationellt välrenommerad skola som utbildar bra arkitekter, för nuet samt för framtiden, med en stor konstnärlig inriktning och gestaltningsförmåga.

Jag arbetar nu på White i Stockholm, samma kontor där jag gjorde praktik efter fjärde året. Arbetsuppgifterna är varierade. Så här i början vill jag vara med och prova på olika typer av projekt i olika skeden. Just nu arbetar jag framförallt med en ny byggnad till en grundskola, där jag varit med från start och intervjuat de personer som i framtiden kommer använda lokalerna. För tillfället skissar vi på olika former, storlekar och lägen för byggnaden. Spännande att få vara med från start och att, så småningom, få se det färdigt på plats!

Jag valde att utbilda mig till arkitekt på grund av det konstnärliga och kreativa arbete som arkitekter utför. Dessutom visste jag att det finns mycket goda möjligheter att jobba internationellt och vara med och påverka städer och miljöer för människor. Jag vill jobba med något praktiskt som faktiskt kan ge fysiska resultat och jag brinner för arkitektur. Jag tycker det är väldigt intressant hur en idé kan utvecklas från skiss till färdig brukbar konst - eller byggnader, möbler, landskap och städer om man så vill. Efter att ha tagit min kandidatexamen på LTH befinner jag mig nu i USA för ett utbytesår på UC Berkeley.

ÅRSKURS 1

ÅRSKURS 2

ÅRSKURS 3

Arkitektens redskap

Gestaltningsprocess o prototyp

Stadsbyggandets grunder Hållbar arkitektonisk gestaltning

Arkitektur baskurs

46

Arkitektur baskurs

ÅRSKURS 4

Arkitektur fördjupningsprojekt Arkitektur fördjupningsprojekt

Arkitektur kandidatprojekt

Arkitekturteknik

Arkitekturteknik

Arkitekturteknik

Arkitekturhistoria

Arkitekturhistoria

Arkitekturhistoria

Arkitekturteori

Arkitekturteori

Exp. workshop

Exp. workshop

Digitala verktyg

Digitala verktyg

Föreläsningar

Föreläsningar

Arkitekturteori

Arkitektur fördjupningskurser Examensarbete

Byggnadsekonomi

Föreläsningar

Arkitektur fördjupningskurser Valbara kurser

Int. workshop

Digitala verktyg

ÅRSKURS 5

Valbara kurser

300 hp | 5 år

www.arch.lth.se | 046-222 37 36 | arkitektur@kansli.lth.se Master of Architecture

Arkitekt 

47

–– V i utbildar kreativa arkitekter med förmåga att identifiera, behandla och lösa problem inom arkitekturens och samhällsbyggandets område. –– Utbildningen är konstnärlig och akademisk och ger en allsidig träning i att bearbeta och gestalta rumsliga och teoretiska frågeställningar. Det finns goda förutsättningar att studera och utveckla experimentell arkitektur. –– Projektarbeten är den centrala studieformen med tema från arkitektur, interiör arkitektur, möbeldesign, stadsbyggande och restaurering. –– Du har möjlighet att förlägga någon del av din utbildning vid ett universitet utomlands.

Utbildningen

Framtiden

Under studietiden tränas du i att bearbeta och gestalta rum, byggnader och den byggda miljön i sitt sammanhang. Studier av goda förebilder används ofta som utgångspunkt i olika gestaltningsövningar för att förstå hur och varför de utformas på olika vis. I begreppet gestaltning ingår att på ett tektoniskt,

Arbetsmarknaden utvecklas ständigt. För en examinerad arkitekt öppnar sig ett brett arbetsområde som kan innebära allt från arbete inom privat, offentlig eller statlig verksamhet och förvaltning, både i Sverige och utomlands.

funktionellt och estetiskt sätt formge byggnader och samhällen.

Antagning

Mycket i utbildningen är praktiskt och handgripligt - du skissar, ritar och bygger modeller. Parallellt pågår teoretiska studier med föreläsningar, seminarier och tentamina; du läser, räknar, skriver, diskuterar och reflekterar. Du använder såväl manuella som digitala verktyg samt andra metoder för att pröva dig fram i ditt gestaltningsarbete och din förståelse för rummet. Undervisningen förutsätter aktivt deltagande och heltidsnärvaro på Arkitektskolan.

Vid sidan av betyg och resultat från högskoleprov som urvalsgrund vid antagning till utbildningen har 1/3 av platserna hittills avsatts till sökande som gör ett särskilt antagningsprov, arkitektprovet. Provet består av en hemuppgift som kommer att finnas tillgänglig på arkitektprovets hemsida, www.arkitektprovet.nu. Hemuppgifterna bedöms av en bedömningsgrupp. De deltagare vars uppgifter bedöms hålla en hög nivå kallas till prov som genomförs på Arkitektskolan. En jury rangordnar sedan de utförda proven som ligger till grund för antagningen.

Fördjupningsområden

Läs mer...

Efter en treårig basutbildning följer en avslutande fördjupningsutbildning som omfattar två år. Fördjupningsområdena behandlar olika uppgifter inom arkitektens arbetsfält med anknytning till samhällsvetenskap, humaniora och teknologi. Som student kan du antingen välja ett avgränsat fördjupningsområde eller en mer allmän och bredare fördjupning.

Frida Niméus – områdeschef, Södra Älvsborgs Räddningstjänstförbund

Roni Nasr – student

Jag stormtrivdes på LTH, även om det stundom var tufft med många tentor och arbete. Men med bra studiekamrater och stark vilja så går allt. Ett år av mina studier tillbringade jag på Nya Zeeland där jag läste delar av min utbildning på University of Canterbury, en fantastisk upplevelse och erfarenhet.

Det bästa med brandingenjörsutbildningen är helt klart variationen i arbetsmarknaden. Utbildningen ger säkra jobb inom allt från räddningstjänst till konsultjobb. Vill du vara en del av räddningsinsatserna runt om i landet tillsammans med MSB och brandmän eller räkna på byggnaders brandskydd eller en kombination av båda - då finns det helt enkelt ingen alternativ utbildning. Intresset för brandingenjörer och dess spetskompetens ökar i hela världen för varje år som går. Det finns inte många skolor som den på LTH och jobb är inga problem. Jobb som betyder något. Jobb som säkrar inte bara ens egen framtid men även samhällets utifrån de arbetsuppgifter som brandingenjörer oftast får.

Jag blev färdig som Brandingenjör och civilingenjör i Riskhantering 2003. Jag har därefter jobbat på Räddningstjänsten Storgöteborg och försäkringsmäklaren Willis, där jag gjorde riskbesiktningar över hela världen. Nu arbetar jag som områdeschef på Södra Älvsborgs Räddningstjänstförbund. Här får jag den perfekta utmaningen med kombinationen räddningstjänst och ledarskap. Jag gillar alla olika kontakter som jag jobbar med här såsom brandmännen, kommunchefer och kommuninvånare. Inom området jobbbar vi bland annat med tillsyner av brandskydd, risk-, kris- och säkerhetshantering, olycksutredningar samt insatsplanering. Jag kommer även efter introduktion att jobba som operativ chef i den utryckande styrkan.

ÅRSKURS 1 Introduktion till Brand och Risk

ÅRSKURS 2

Byggnadsmaterial

ÅRSKURS 3

Termodynamik Flerdimensionell analys

Endimensionell analys

Orsaken till varför jag valde att utbilda mig till brandingenjör är att även om utbildningen funnits i nästan 25 år så är det fortfarande en ”ung” utbildning. Det finns områden som ännu inte är utforskade. En marknad som är långt ifrån mättad och arbetstillfällen som kan ta en runt om i hela världen. Frågan är egentligen: Vilken annan utbildning skulle jag annars valt?

Samhällsplanering Aktiva system

Husbyggnadsteknik Examensarbete Brandkemi

Riskanalysmetoder

Fysik Linjär algebra Mekanik Kemi

48

ÅRSKURS 4

Branddynamik

Brandteknik riskvärdering

Offentlig organisation och adm. Statistik Geoteknologi

Valfria kurser

210 hp | 3,5 år

www.brandingenjor.lth.se | 046-222 08 79 | brandingenjor@kansli.lth.se Bachelor of Science in Fire Protection Engineering

Brandingenjör  –– –– –– ––

49

I nternationellt erkänd utbildning i världsklass rankad nummer 1. Mycket lätt att få ett jobb nationellt och internationellt och göra en snabb karriär. Relativt litet program vilket skapar möjlighet till individuellt fokus och en härlig sammanhållning. God sammanhållning även efter utbildningen.

Drygt hälften av dem som utbildar sig till brandingenjörer arbetar inom den kommunala räddningstjänsten. Att vara utbildad brandingenjör krävs för att bli räddningsledare. Många brandingenjörer arbetar även inom den privata sektorn, i kemiska industrier, bygg- och konsultföretag och försäkringsbolag. Även inom olika myndigheter kan man hitta brandingenjörer. Unik utbildning Brandingenjörsprogrammet är unikt i sitt slag. Det är den enda högskoleutbildningen i Sverige som ger kompetens inom både brand- och räddningstjänstområdet. Utbildningen består av 3,5 års studier (210 högskolepoäng) och leder till brandingenjörsexamen. Efter examen finns möjlighet till 1 års påbyggnadsutbildning vid MSB (Myndigheten för samhällsskydd och beredskap) i Revinge utanför Lund. Påbyggnadsåret ger kompetens att arbeta som räddningsledare inom kommunal räddningstjänst. Efter 3 års studier på brandingenjörsprogrammet har du möjlighet att fortsätta läsa till civilingenjör i riskhantering vid LTH i Lund. Bred grundkunskap Utbildningens 210 högskolepoäng fördelas mellan ca 20 olika kurser. Där ingår både breda grundkurser och kvalificerade specialkurser. Inledningsvis ges en grundläggande teknisk utbildning. Förutom ämnen som matematik, fysik, kemi och statistik innehåller den grundläggande utbildningen byggnadstekniska ämnen samt mer praktiskt tillämpade ämnen. Kvalificerad specialkunskap Den grundläggande utbildningen kompletteras med specialkurser inom brandteknik och riskhantering. De brandtekniska ämnena behandlar bränders uppkomst, tillväxt och spridning, hur bränder påverkas och sprider sig med hänsyn till byggnader (passiva system), sprinkler och brandventilation (aktiva system),

Stor vikt läggs vid utrymningen när det uppstår fara för brand, och vid andra frågor som rör människors säkerhet. Orsaker, konsekvenser och risker kring olika typer av brandolyckor studeras också, exempelvis olyckor med farligt gods, explosioner, skred mm. I den del av kursen som behandlar riskhantering lär man sig både att göra riskanalyser och att skapa underlag för riskhänsyn i samhällsplaneringsprocessen. Praktik Efter första året kan studenterna genomgå en tre veckors introduktionsutbildning för brandmän följd av sju veckors sommarpraktik inom räddningstjänsten. Praktiken är frivillig och ges i mån av plats. Återstående somrar under utbildningen använder många studenter till projektarbeten på olika företag inom brandområdet både i Sverige och utomlands. Under påbyggnadsåret ingår ytterligare åtta veckors praktik inom räddningstjänsten. Forskning Avdelningen för Brandteknik och Riskhantering bedriver forskningsverksamhet inom brand- och riskområdet. Inom forskningsområdet brand utförs forskning vad gäller modellering av brandförlopp, mänskligt beteende vid brand, släckmedel och släckverkan, optimering av industriellt brandskydd, riskbaserad brandteknisk dimensionering och samhällets räddningstjänst.

Läs mer...

och hur släckinsatserna genomförs.

Therese Broberg – industridesigner, Designbyrån Tb & Ajkay

Jesper Eriksson – student

Jag trivdes som fisken i vattnet på LTH och utbildningen var över mina förväntningar. Många roliga och varierade kurser, engagerade lärare, utbyten med företag som t ex TetraPak, IKEA, SonyEricsson, NASA. Jag gjorde en utbytestermin i

Jag valde främst industridesign för att kunna kreativt forma enklare produkter. Jag vill kunna påverka folks beteenden positivt inte minst utifrån ett hållbarhetsperspektiv.

Köpenhamn på Danmarks Design Skole vilket var väldigt lärorikt och roligt, samtidigt som det fick mig att uppskatta utbildningen hemma i Lund ännu mer. Under hösten i fyran gjorde jag praktik på designbyrån FRONT i Stockholm, vilket var omvälvande och fantastiskt roligt.

Det bästa med utbildningen är sammanhållningen i klassen men även årskurser emellan. Industridesign handlar mycket om kommunikation, det känns bra att kunna dela med sig av sina idéer och be om tips från andra mer erfarna studenter. Vad som gör LTH så bra är att det är ett campus med så många olika utbildningar - det är en otrolig kunskapsresurs! Dessutom ligger LTH i Öresundsregionen med enkla förbindelser till livliga storstäder som Malmö och Köpenhamn, där det finns ett stort kulturellt utbud.

Efter examen startade jag designstudion Tb&Ajkay tillsammans med en vän som är textildesigner. Vi formger möbler, belysning, interiörer, mm. Sedan ett halvår befinner vi oss i Laos där vi gör ett uppdrag tillsammans med WWF - Världsnaturfonden. Vi tar fram miljövänliga produkter i rotting. Nästa designprojekt som vi tar oss an ser ut att bli i Taiwan.

ÅRSKURS 1

ÅRSKURS 2

ÅRSKURS 3

Masterutbildning 2 år

Industridesign Industridesign Industridesign Estetik Estetik Estetik

Övriga ämnen ex. Material

50

Övriga ämnen ex. Ergonomi

Övriga ämnen ex. Produktionsteknik Filosofi

Examensarbete

Masterutbildning vid LTH eller annat lärosäte i Sverige eller utomlands

www.industrialdesign.lth.se  |  046-222 71 88, 222 42 74  |  industridesign@kansli.lth.se Bachelor of Fine Arts in Design

180 hp | 3 år

Industridesign – kandidatutbildning  –– –– –– ––

51

Du vistas i en internationell miljö. Du vistas i en teknisk omgivning med möjlighet att konsultera experter i dina projekt. Du får chans att delta i internationella utställningar. Du jobbar i små grupper med stor interaktion, vilket ger dig stor möjlighet att påverka din utbildning.

Industridesign innebär att delta i hela processen kring produktframtagning, från idé till färdig produkt. Den yttre formen blir en konsekvens av produktens funktion och sammanhang. Detta ställer krav på ny kunskap och medvetenhet inom många olika områden. Industridesignern bör även ha förmåga att snabbt reflektera över kulturella och tekniska växlingar i samhället. En starkare koppling mellan estetiska, tekniska, industriella och ekonomiska aspekter har blivit nödvändig. Utbildningen

Särskilda förkunskaper

Utbildningen är uppdelad i två delar, en kandidatutbildning på 180 högskolepoäng (3 år) som leder till konstnärlig kandidat-

Områdesbehörighet 3 samt godkänt antagningsprov. Behörighetskurser:

examen i industridesign Bachelor of Fine Arts in Design, main field of study Industrial Design. Du har sedan möjlighet att söka till en masterutbildning på 120 högskolepoäng (2 år), som leder till en masterexamen Master of Fine Arts in Design.

Matematik C, Naturkunskap B, Samhällskunskap A. Naturkunskap B kan ersättas med Fysik A+ Kemi A+ Biologi A. LTH ger sökande till kandidatutbildning i industridesign generell dispens från krav om Biologi A och Samhällskunskap A.

Industridesign syftar på utveckling av vardagens produkter och system; produkter oftast avsedda för tillverkning i stora serier. Industridesign identifieras i allt större sammanhang som en betydande konkurrensfaktor i ett globalt perspektiv. Industridesignutbildningen i Lund utgår från ett konstnärligt och tekniskt perspektiv med hänsyn taget till de industriella villkoren. Utbildningen drar nytta av bredden inom Lunds universitet. Studenten får följa kurser på avdelningar som är specialiserade inom olika ämnesområden. De teoretiska kunskaperna tillämpas på ett eller flera projekt. Projekten genomförs ibland med företag, någon gång tillsammans med ingenjörsstudenter och ibland efter egna idéer. Som stöd för projektarbetet lär sig studenterna bygga modeller både i 3D-datorprogram och i verkstäderna.

Antagning

Utbildningen har en stark internationell prägel. Industridesigners från hela världen gästar utbildningen som undervisare eller ledare av workshops. Studenterna har möjlighet att vistas en termin vid ett utländskt universitet och varje termin kommer gäster hit. Kandidatutbildningen avslutas med ett examensarbete om 15 högskolepoäng.

Trettio studenter tas in varje höst.

Läs mer...

Antagning till kandidatutbildningen i industridesign sker enbart genom antagningsprov. Första delen av provet består av en hemuppgift som skall lösas och skickas in till LTH, samtidigt som ansökan till programmet görs på antagning.se, senast den 15 april. Hemuppgiften finns tillgänglig runt den 15 februari. De sökande som bedöms ha goda förutsättningar för utbildningen, kallas till fortsatt antagningsprov. Denna del av provet genomförs under två dagar på Ingvar Kamprad Designcentrum i Lund. Behörighetsbedömningen av såväl hemuppgiften som av prestationerna under provdagarna sker ur ett konstnärligt perspektiv utifrån följande bedömningskriterier: kreativitet, gestaltningsförmåga och analytisk förmåga.

Isabelle Olsson – industridesigner, Google, USA

Jonas Lagerstedt – student

Det finns flera anledningar varför jag sökte till LTH. För det första var jag sugen på en studentstad och att flytta från Stockholm. För det andra var att industridesignutbildningen finns i anslutning till tekniska utbildningar vilket jag såg som en stor fördel för att kunna samarbeta och lära mig av studenter med olika inriktningar.

LTH är en väldigt innovativ miljö med experter inom de flesta tekniska områden. På industridesignprogrammet har vi en möjlighet att hela tiden snabbt få svar på frågor som rör allt från nanoteknik till hur förbränningsmotorer fungerar.

För mig var det en fantastisk tid; roligt, stressigt, utmanande och över all förväntan, speciellt med tanke hur mycket jag växte både som designer och person. Industridesignutbildningen har betytt jättemycket för min karriär och verkligen förberett mig inför de utmaningar som jag har mött hitills. Först och främst har utbildningen stärkt mitt självförtroende. Att t ex nästan alltid presentera på engelska och den ständiga uppmuntran att gå sin egen väg är två anledningar till varför jag har kunnat stå på mig och vara intressant på den amerikanska arbetsmarknaden. Jag jobbar numera på Google som industridesigner. Jag kom till San Francisco för lite drygt två år sedan och jobbade först på en framgångsrik designkonsultbyrå som heter Fuseproject. Men i början av året blev jag ‘head hunted’ till ett av Googles mest innovativa ingenjörsteam för att jobba med ‘special projects’, som är en hemlig grupp. Det enda jag kan säga är att det verkligen känns som en ‘once in a lifetime opportunity’ och att om allt går enligt planerna så kommer jag vara med om att skapa något som kan förändra världen.

52

Positivt med mastersprogrammet är att vi tillåts vara väldigt fria i vår inriktning vilket ger oss en stor möjlighet att verkligen bli bra på det vi själva brinner för och det kan vara allt från forskning inom ett specifikt ämne till produktdesign, form eller ren fokus på hur vi ska kunna designa för en mer hållbar värld. Som industridesigners får vi vara med där den verkliga innovationen sker. Vi är med väldigt tidigt i processen att skapa framtida produkter och lösningar vilket är otroligt spännande. Eftersom vi är med och skapar nya produkter har vi ett ansvar att hela tiden tänka på vilka konsekvenser våra produkter får för användaren, miljön och producenten vilket naturligtvis också inspirerar oss att bli pålästa om världen runt omkring oss. Dessutom är det otroligt kul att hela tiden använda olika verktyg för att komma vidare i den kreativa processen. Att vi, när vi är trötta på datorskärmen, kan ställa oss i en verkstad och bygga en prototyp eller sätta oss med papper och penna. Det blir aldrig tråkigt.

www.industrialdesign.lth.se  |  046-222 71 88, 222 42 74  |  industridesign@kansli.lth.se Master of Fine Arts in Design

120 hp | 2 år

Industridesign - masterutbildning 

53

Utbildningen

livsmönster, hållbar utveckling och miljöfrågor.

Utbildningen är en internationell tvåårig masterutbildning, som leder till en konstnärlig masterexamen i design med huvudområdet industridesign. Utbildningen är öppen för sökande från hela världen. Inte bara studenterna kommer från olika delar av världen utan även lärare och gästlärare.

Masterutbildningen syftar till att utveckla studentens kunskaper, färdigheter och värderingsförmåga inom design, särskilt inom industridesignområdet. Utbildningen skall även syfta till att stärka den framtida yrkesrollen som industridesigner.

Studenterna kan välja tre områden att fördjupa sig inom, ”form och teknologi”, ”boende och beteende” och ”människa och natur”. Syftet med utbildningens tre teman är att ge studenten en djupare insikt, kunskap och förmåga att reflektera kring samtida och framtida tekniska utveckling inom industridesign, de senaste rönen om samtida och framtida mänskliga behov och

Form & Technology

Living & Behaviour

Behörighet Behörig att söka är den som avlagt en kandidatexamen i industridesign eller motsvarande examen. Dessutom krävs kunskaper i engelska motsvarande Engelska B. Mer information på www.industrialdesign.lth.se

Man & Nature

Academics

Introduction and phasing in (5 ECTS) Aesthetics (5 ECTS) CAD evolution (5 ECTS)

Industrial design project I (15 ECTS) Year 1 (autumn, 30 ECTS)

Production and materials (5 ECTS) Philosophy of mind and design (5 ECTS)

Industrial design project II (20 ECTS) Year 1 (spring, 30 ECTS)

Design management (5 ECTS) Research methods (5 ECTS))

Industrial design project III (20 ECTS) Year 2 (autumn, 30 ECTS) Master degree project (30 ECTS)

Läs mer...

Year 2 (spring, 30 ECTS)

54

Campus Helsingborg – högskolan vid havet LTH finns inte bara i Lund. Om du väljer någon av våra högskoleingenjörsutbildningar är dessa förlagda till Helsingborg. Väljer du att läsa i Helsingborg får du en havsnära studiemiljö och ett gemytligt stadsliv – allt beläget så nära Danmark du kan komma i Sverige.

En europeisk knutpunkt

En modern högskola

Även på den svenska sidan är rörelsefriheten stor. Här passerar såväl motorväg som intercitytåg. Med pendeltåg når du Lund på under halvtimmen och Malmö på under timmen. Större delen av Skånes attraktioner finns runt hörnet via buss eller bil.

LTH finns på Campus som ligger mitt i Helsingborg. Här kastas du rakt in i en rolig och inspirerande tillvaro. Campus Helsingborg är mötesplats, inte bara för LTHs studenter, utan för en mängd andra utbildningar. Totalt huserar här ungefär 3000 studenter i fräscha och modernt utrustade miljöer. Du möter kompisar från hela landet och lärare från både Helsingborg och institutionerna i Lund. Liksom i Lund genomförs utbildningarna i tydlig relation till det närliggande näringslivet.

Helsingör når du på bara tjugo minuter. Härifrån gör du enkelt en utflykt med tåg till Louisiana, Humlebäcks världsberömda konsthall, och ska du på längre resa är förbindelserna till Köpenhamn minst lika bra.

För dig som söker en kontinentalt inramad och modern studiemiljö är LTH vid Campus Helsingborg ett givet alternativ.

Välkommen!

Goda utsikter Helsingborg är utan tvekan en av Sveriges vackraste städer. På ena sidan har du grönskande stråk och i stadens utkant en vacker bokskog och en magnifik utsikt över Öresund. På den andra sidan finns det blå sundet. I omnejden finns också strövområden, klättrings- och dykmöjligheter och vackra små kustorter. Centrala Helsingborg ståtar med ett flertal parker, en Medelhavsinspirerad marina och en trivsam shoppingvänlig stadskärna. Helsingborg är känt för sitt ungdomliga sinne, sin företag samhet och sin optimism. Näringslivet i regionen blomstrar och ropar ständigt efter välutbildad personal. Helsingborg har ett rikt kultur- och nöjesliv, bland annat en egen stadsteater och ett rikt konsertutbud. Fotbollslaget ( HIF) får heller inte glömmas i sammanhanget.

55

Josefine Schedvin – student

Niklas Engqvist – konstruktör, Peab PGS

Det jag gillar med LTH är att det är erkänt inte bara i Sverige utan att LTH också har kontakter utomlands. I och med att jag pluggar högskoleingenjör på Campus Helsingborg men ändå är knuten till LTH så har jag också möjligheten att studera vidare till civilingenjör inom mitt område om jag så önskar.

LTH var ett naturligt val när min akademiska bana skulle krökas kring en byggingenjörsutbildning. Ingenjörshögskolan på Campus har tillgång till hela LTHs kompetens och seriositet, samtidigt som jag tycker att studentlivet i Helsingborg är mer behagligt avslappnat och otvunget än det i Lund.

Efter mycket velande fram och tillbaka kring vad jag tänkt plugga så bestämde jag mig för att söka till LTHs högskoleingenjörsutbildning med inriktning bygg och arkitektur. Anledningen var att jag hade insett att jag alltid fascinerats av stora och ståtliga byggnader och att jag kanske kunde kombinera nyttan med nöjet och utbilda mig inom området. Jag har fått intrycket att man som ingenjör är rätt allsidig och att behovet av ingenjörer alltid finns. Dessutom har det på senare tid kommit till allt fler och fler tjejer vilket jag uppfattat som väldigt positivt inom byggbranschen!

Byggteknik med arkitektur var för mig en god, bred utbildning som rymde grundkurser i alla väsentliga delar jag som ny byggingenjör behövde för att börja lära mig förstå husbyggandets problematik. Kort sagt en väldigt god grund att stå på. Idag arbetar jag som konstruktör på Peab PGS, Peabs byggsystem för industriellt byggande av flerbostadshus. Mina arbetsuppgifter är varierande med allt från arbetsplanering och styrning till utveckling och sortimentanalys. Det är en fantastiskt spännande resa där otrampad mark fortfarande väntar på oss.

Det känns som jag valt en bra utbildning att stå på när jag sedan ska ut i arbetslivet. Möjligheterna för vad som händer sen är oändliga!

ÅRSKURS 1

ÅRSKURS 2

ÅRSKURS 3

Grundläggande statistik Matematik Materiallära Byggteknik med arkitektur Arkitektur och byggteknikhistoria

Strukturmekanik Byggnadskonstruktion

Projektarbete i byggprocessen: Ledning Programarbete Samhällsplanering och gestaltning Projektering och design Produktion, styrning och planering

Byggnadsfysik Kommunikation och datorverktyg Installationsteknik Husbyggnadsteknik Geomatik

Geologi och geoteknik BIM modellering och visualisering

Miljövetenskap Fysik

56

Byggprocessen med företagsekonomi

Valfria kurser

Examensarbete

180 hp | 3 år

www.byggteknik.hbg.lth.se | 042-35 67 40 | infohbg@kansli.lth.se Bachelor of Science in Engineering  |  Civil Engineering

Byggteknik med arkitektur 

57

–– H ögskoleingenjören – den mest eftersökta av alla ingenjörer! Speciellt inom byggsektorn där väldigt många pensionsavgångar äger rum inom de närmaste åren. –– Arbetslivsförankrad utbildning i form av studiebesök, praktikkurs, mentorsverksamhet, projektkurser varvat med teoretiska kurser för att få fram en praktiskt tillämpad och direkt användbar högskoleingenjör. –– Möjlighet att läsa vidare på LTH till en civilingenjörs- eller masterutbildning inom ditt område.

Ett byggprojekt har många olika intressenter exempelvis beställare, byggkonsulter, arkitekter, entreprenörer, materialtillverkare, myndigheter, finansiärer med flera. Arbetsuppgifterna för en byggingenjör kan således vara mycket varierande. Planering, konstruktion, produktion, projektledning, byggnadskontroll, administration, ekonomi är exempel på arbetsområden. Ofta arbetar man i projektgrupper tillsammans med arkitekter och andra ingenjörer. Samsyn och förståelse för varandras kunskapsområden krävs, inte minst för arkitekternas arbets- och uttryckssätt.

Om du är intresserad av utformningen av vårt samhälle och tycker att gestaltning och planering av byggnader är viktig, ska du söka denna utbildning. Det hållbara samhället ställer krav inte bara på tekniskt godtagbara lösningar utan även på ett estetiskt tilltalande innehåll. En sådan syntes - mellan byggteknik, miljökunnande och estetik - finner du på denna utbildning. Inriktningen mot arkitektur innebär att du får fördjupade kunskaper inom byggnaders planering och gestaltning, arkitekturhistoria och visualiseringsteknik. För att knyta utbildningen till byggbranschen är arbetslivsförankrad utbildning inlagd med möjlighet att komma ut på ingenjörs- och arkitektkontor, byggarbetsplatser, kommunala tekniska kontor, byggmaterialföretag eller fastighetsbolag. Första året innehåller en kombination av breda introducerande översiktskurser inom

byggområdet och grundläggande kurser inom matematik, cad och fysik. Det andra året domineras av tillämpningsämnen. Det tredje avslutande året innehåller ett stort tillämpat projektarbete som pågår under hela höstterminen. Parallellt läser du kurser med mer påtaglig arkitekturprägel. Sista terminen i årskurs tre utförs ett examensarbete som normalt bedrivs ute i näringslivet. Fortsatt utbildning Efter avklarad högskoleingenjörsutbildning har du möjlighet till fortsatta studier till civilingenjör vid LTH i Lund eller masterutbildningen Energieffektivt byggande i Helsingborg.

Läs mer...

Utbildningen

Anders Liss – projekteringsledare, Tyréns AB

Mohammed Taha – student

Jag började på LTH av en slump. Jag arbetade som konsult inom databranschen och hade ett uppdrag på Banverkets huvudkontor i Borlänge (idag Trafikverket). På deras intranät läste jag om utbildningen som kändes intressant, således skickade jag iväg en ansökan. När antagningsbeskedet kom var beslutet att börja plugga på LTH enkelt.

LTH har flera attraktiva ingenjörsutbildningar att erbjuda och LTH/Campus Helsingborg anordnar mässor under året då vi får träffa många representanter åt olika företag. Det är till stor hjälp när studenten är ute och söker jobb efter examen.

Jag tyckte att utbildningen var riktigt bra och har gett mig en kunskapsbredd som är en klar fördel att ha när man arbetar i branschen. Lärarna har varit bra och engagerade och det har varit lätt att påverka och komma i kontakt med ansvariga för utbildningen.

Jag valde att läsa till högskoleingenjör inom bygg- & järnvägsteknik eftersom det är brist på dessa och chansen att få jobb blir automatiskt större. Personligen tycker jag att det är häftig att få vara med då ett projekt övergår från en simpel idé, till ritningar på papper för att senare stå färdigtbyggt i verklighet!

Jag arbetar i dag på Tyréns AB med projektering och projekteringsledning. Jag känner att jag har stor nytta av utbildningens bredd. Den ger en förståelse mellan teknikslag som är nödvändig i detta arbete.

ÅRSKURS 1

Matematik

ÅRSKURS 2

ÅRSKURS 3

Grundläggande statistik

Planerings- och projekteringsmetodik av järnvägsanläggningar

Materialmekanik

Grundläggande avtals- och entreprenadrätt

Trafikstyrning och telekommunikation Transport och samhälle

Drift och underhåll av järnvägsanläggningar Elteknik

Fysik

Samverkan fordon- bana Geologi och geoteknik

Miljövetenskap Geomatik

Järnväg i ett europeiskt perspektiv Samhälls- och transportekonomi Trafikteknisk teori

Kommunikation och datorverktyg Väg- och järnvägsteknik

58

Examensarbete Banteknik för ingenjörer

180 hp | 3 år

www.jarnvagsteknik.hbg.lth.se | 042-35 67 40 | infohbg@kansli.lth.se Bachelor of Science in Engineering  |  Civil Engineering

Byggteknik – Järnvägsteknik 

59

–– J ärnvägsingenjörsutbildningen på LTH – en unik utbildning i norra Europa inom den expansiva infrastrukturbranschen. –– Arbetslivsförankrad utbildning i form av studiebesök, praktikkurs, projektkurser varvat med teoretiska kurser för att få fram en praktiskt tillämpad och direkt användbar högskoleingenjör. –– Möjlighet att läsa vidare på LTH till en civilingenjörs- eller masterutbildning inom ditt område.

Om du vill vara med att påverka utformningen av framtidens transportsystem och är intresserad av teknik är denna utbildning rätt för dig. Under överskådlig tid kommer en kraftig utbyggnad av framför allt våra järnvägssystem att ske. Det behövs många duktiga ingenjörer inom järnvägssektorn för att denna satsning ska kunna genomföras. Det råder i dag brist på järnvägsingenjörer som inte bara är duktiga tekniker utan även förstår samspelet mellan olika trafikslag. Vi kan erbjuda en mycket intressant utbildning där du har möjlighet att bidra till tågtrafikens utveckling, planering, byggande, förvaltning och operativa ledning.

Utbildningen bedrivs i samarbete med Järnvägsskolan i Ängelholm dit också flera av kurserna är förlagda. För att knyta utbildningen till järnvägsbranschen är arbetslivsförankrad utbildning inlagd med möjlighet att komma ut på ingenjörsoch entreprenadföretag, myndigheter och förvaltningar. Under första året får du läsa flera kurser som berör hela samhällsbyggnadsprocessen. Dessutom ingår traditionella ämnen som matematik, fysik, mekanik mm. Andra året är till största delen förlagt till Järnvägsskolan i Ängelholm och innehåller en blandning av teori och praktik inom det järnvägstekniska området. Fördjupning sker inom områdena banteknik, elteknik, signal- och teleteknik. Tredje året fokuserar på projektering och nybyggnation av järnvägsanläggningar. Fördjupningskurser kan komma att läsas i Lund. Utbildningen avslutas med ett examensarbete som normalt genomförs i samarbete med

något företag inom järnvägssektorn. Utbildningen ger dels grundläggande kunskaper inom matematik, grundläggande statistik, mekanik, fysik och geomatik, dels bred kunskap av hela det järnvägstekniska området innefattande ban-, elektro-, signal- och telekommunikationsteknik. Utbildningen förbereder särskilt för verksamheter inom järnvägsteknik, underhållsteknik och järnvägsförvaltning. Fortsatt utbildning Efter avklarad högskoleingenjörsutbildning har du möjlighet till fortsatta studier till civilingenjör vid LTH i Lund.

Läs mer...

Utbildningen

Alex Forsberg – student

Hooman Ahoori – väg- och gatuprojektör, Atkins Sverige AB

Det bästa med LTH är den fina gemenskapen och kamratskapen som finns på universitet. Min utbildning går både i Helsingborg och i Lund och det gör att jag får lära känna många nya personer.

Utbildningen passade mig väldigt bra då den är inriktad från dag ett på enbart väg och järnväg, samt erbjuder studier i praktik. Ett stort plus med utbildningen var att vi var endast 10 personer och därmed fick vi en närmare relation till lärare och kursansvariga. Utbildningen i sig erbjuder den kompetens som krävs för att kunna arbeta inom infrastruktur. Framtidsutsikterna är väldigt lovande och samhällsbyggare behöver samhället många fler utav!

Vår utbildning är otroligt bred och det gör att man lär sig lite om allt möjligt. Vi har även företagsförlagd praktik som ger en möjlighet att få arbetslivserfarenhet och kontakt med företag inom branschen. Jag har alltid varit intresserad av att bli byggingenjör. Varför det blev vägingenjör var nog för att jag vill vara med och förändra och göra våra vägar bättre. Dessutom finns det goda möjligheter som ingenjör att få jobb när studierna är slut.

ÅRSKURS 1

Det senaste året har jag arbetat som väg- och gatuprojektör på Atkins Sverige som är ett konsultföretag inom samhällsbyggnad, planering, miljö och järnväg. Mina dagliga arbetsuppgifter innefattar olika projekt där vi projekterar allt från VA-system, vägar & gator, markarbeten och utbyggnaden av svenska järnvägsnätet. I nuläget arbetar jag med bl.a projekt H+ där Helsingborg centrum ska växa med en tredjedel. Jag skrev mitt examensarbete tillsammans med en studiekamrat här på Atkins och detta ledde sedan till jobb efter avslutade studier. Mitt arbete involverar mycket social kontakt med nya människor och som konsult vet man inte alltid vad man arbetar med på längre sikt vilket jag finner väldigt spännande, där finns alltid nya utmaningar.

ÅRSKURS 2

ÅRSKURS 3

Grundläggande statistik

Trafikteknisk teori

Materialmekanik

Grundläggande avtals- och entreprenadrätt

Matematik

Transport och samhälle

Geologi och geoteknik

Fysik

Design av väg- och gaturummet

Miljövetenskap

Drift och underhåll av vägar

Geomatik

60

Trafikens effekter Utformning av vägar och järnvägar Vägbyggnadsteknik

Vägbyggnadsteknik

Kommunikation och datorverktyg

Vägkonstruktion/Produktionsplanering

Väg- och järnvägsteknik

Samhälls- och transportekonomi

Examensarbete

180 hp | 3 år

www.vagtrafikteknik.hbg.lth.se | 042-35 67 40 | infohbg@kansli.lth.se Bachelor of Science in Engineering  |  Civil Engineering

Byggteknik – Väg och trafikteknik 

61

–– V äg- och trafikingenjörsutbildningen på LTH - en unik utbildning i Sverige inom det viktiga samhällsbyggområdet. –– Arbetslivsförankrad utbildning i form av studiebesök, praktikkurs, projektkurser varvat med teoretiska kurser för att få fram en praktiskt tillämpad och direkt användbar högskoleingenjör. –– Möjlighet att läsa vidare på LTH till en civilingenjörs- eller masterutbildning inom ditt område.

Som väg- och trafikingenjör har du, förutom kunskaper i teknik, även kunskaper om och förståelse för transportsektorns funktion i samhällsbyggandet. Utbildningen ger dig förutsättningar att verka inom hela väg- och trafikområdet. Detta innebär att du får kunskaper inom samhällsbyggnad, transportsektorns marknad och krav, trafikplanering, projektering, byggande samt drift och underhåll av väganläggningar. I din framtida yrkesroll kommer du ofta att arbeta i projektgrupper tillsammans med olika specialister för t ex miljökonsekvensbeskrivningar, landskapsanalyser, trafikprognoser och samhällsekonomiska kalkyler.

Utbildningen bedrivs i samarbete med civilingenjörsutbildningen för Väg- och vattenbyggnad vid LTH i Lund och en del av kurserna i årskurs två och tre läses i Lund. För att knyta utbildningen till väg- och trafikbranschen är arbetslivsförankrad utbildning inlagd med möjlighet att komma ut på ingenjörs- och entreprenadföretag, myndigheter och förvaltningar. Första året innehåller introducerande kurser inom området väg- och trafikteknik samt grundläggande ingenjörskurser i t ex mekanik, fysik och matematik.

Under den första terminen får du även kunskaper i presentationsteknik, retorik och i att hantera olika datorverktyg. Andra året innehåller grundläggande ingenjörskurser, ekonomi samt en fördjupning inom områdena vägbyggnad, geodetisk mätningsteknik och trafikteknik. Tredje året fokuserar på vägbyggnad och trafiktekniska planeringsmodeller. Utbildningen avslutas med ett examensarbete. Fortsatt utbildning Efter avklarad högskoleingenjörsutbildning har du möjlighet till fortsatta studier till civilingenjör vid LTH i Lund.

Läs mer...

Utbildningen

Elvis Barudzija - student

Louann Cronqvist – Deputy projectmanager, IKEA

Som snart färdig högskoleingenjör ser min framtid lysande ut – med fantastiskt goda jobbmöjligheter. Att dessutom läst på LTH som har hög status var avgörande när jag valde att utbilda mig till högskoleingenjör i datateknik.

För mig står LTH för en välrenommerad högskola med hög status i företagsbranchen. Den drivs med tydliga mål och flexibilitet där studenterna går ut med hög kompetens inom sitt valda område. Detta var för mig otroligt viktigt när jag sen skulle söka jobb då IT-branchen varit nere i en rejäl svacka och kraven på nyanställda antagligen skulle bli relativt höga de kommande åren.

Jag kommer från Landskrona och läste först tekniskt basår innan jag började på programmet. Efter ett par år på Campus så trivs jag fortfarande mycket bra och tycker att lokalerna känns ljusa och fräscha. Dessutom ligger Campus centralt, så det är nära till både affärer och restauranger. Lärarna på datateknik finns ofta till hands och är lätta att få tag på om man har frågor. De brukar också vara bra på att bjuda in gästföreläsare från olika företag. Föreläsningarna ger mig som student en bra förankring gentemot näringslivet. Dessutom ger de mig en bra bild av hur företagen arbetar med olika projekt och verksamheter. Under föreläsningarna brukar jag också snappa upp ett och annat tips och några goda råd som kan vara bra att ha med sig i framtiden.

ÅRSKURS 1

Matematik

Översikt datorteknik

Digital- och datorteknik

62

Jag hade ett tidigt mål redan när jag sökte min LTH-utbildning. Jag ville arbeta som projektledare, helst på IKEA IT. Det har gått 5 år sen jag bytte ingången till Campus till ingången något söderut till IKEA IT. Idag arbetar jag på IKEA IT som aktivitetsledare för en förstudie och ett mindre komplext projekt samt som deputy projektledare där vi ska byta ut ett Business Intelligence-verktyg mot ett annat för tusentals användare. Vägen dit har gått via omedelbar anställning efter studierna hos Sigma i Helsingborg, som konsult för IKEA IT som systemutvecklare, till IKEA-anställd som produktansvarig och deputy application manager. Jag stormtrivs och vet idag att LTH var helt rätt väg för att komma hit.

ÅRSKURS 2

ÅRSKURS 3

Matematik och statistik

Projekt

Datorarkitekturer

Kravhantering

Datastrukturer

Realtidssystem

Databaser

Programmering

Styr- och reglerteknik

Datorsäkerhet

Kretsteknik

Tekniska gränssnitt

Datorkommunikation

Datorkommunikation

Programmering

Projekt

Examensarbete

180 hp | 3 år

www.datateknik.hbg.lth.se | 042-35 67 25 | infohbg@kansli.lth.se Bachelor of Science in Engineering  |  Computer Science and Engineering

Datateknik 

63

–– S tor efterfrågan på högskoleingenjörer inom datateknikområdet. –– Bred datautbildning vilket efterfrågas av arbetsgivarna. –– Mycket goda kontakter med det lokala näringslivet. Som student har du möjlighet att knyta personlig kontakt med ett företag redan i första årskursen. –– Förberedande inför kommande yrkesliv genom träning i olika projekt- och kravhanteringsmetoder.

Datateknik är ett område i ständig förändring. Du kommer både under din utbildning och i ditt arbetsliv vara delaktig i denna spännande utveckling - en utveckling av nya idéer, tekniker och oanade möjligheter! Datateknikutbildningen ger dig goda tekniska kunskaper vilket innebär att du efter avslutad utbildning kommer genom din tekniska bredd och branschkunskap vara produktiv direkt och därmed mycket attraktiv på arbetsmarknaden. Utbildningen

Fortsatt utbildning

Datateknikutbildningen handlar om datorsystem, både programvara och hårdvara samt de tekniska gränssnitten mot

Efter avklarad högskoleingenjörsutbildning har du möjlighet till fortsatta studier till civilingenjör vid LTH i Lund.

Det första året ger kunskap om de grundläggande byggstenarna i datorn: digitalteknik, datorteknik, inledande datorkommunikation, programmering samt basfärdigheter i matematik. Utbildningen startar med en översiktskurs i datateknik, där du får en helhetsbild av ämnesområdet. Det andra året ägnas åt projektarbete och programmets p rof ilä m n e n: d a to r s y s te m , d a t a b a s e r, te l e - o ch datorkommunikation samt gränssnittsteknik. Det tredje året innehåller fördjupningskurser, projekt med introduktion till idéutveckling och entreprenörskap samt examensarbete. Utveckling av datorbaserade system är oftast en uppgift för projektgrupper av olika storlek. Därför är projektarbete en central del av utbildningen. Under andra och tredje året bedrivs projekten i större grupper. Vi tycker kontakten med näringslivet är mycket viktig, vilket innebär att du kommer att erbjudas en möjlighet att delta i ett företagsteam tillsammans med ett företag. Förutom detta får du som student även inblick i arbetslivet genom gästföreläsare från näringslivet samt möjlighet att delta i projekt med företag som kunder.

Framtiden Att arbeta som dataingenjör innebär att man kan arbeta inom hela fältet mellan teknik och människa. Ett datorsystem är sällan en isolerad del, utan finns i samverkan med människor och andra system. Tekniken håller på att få en allt större betydelse för hur vi lever våra liv; tänk bara på allt vi idag utför med hjälp av en mobiltelefon. Vi kan och kommer också att kunna t ex styra olika saker via trådlöskommunikation så som hushållsmaskiner, betalningar, bilar mm. Denna utveckling kommer att innebära ett allt större ansvar hos ingenjören som måste kunna anpassa tekniken till det samhälle vi lever i. Detta är en av de stora utmaningarna och det som gör ingenjörsyrket till ett framtidsyrke. Dataingenjörer har en bred arbetsmarknad och behövs idag inom många branscher såsom design, sjukvård, miljö, finans, energi, media, tillverkning och många fler. Det innebär att du kan arbeta i nästan vilken bransch som helst. Nya produkter och tjänster för olika typer av företag och branscher skapas ständigt. En ny trend är att kunderna själva mer och mer deltar i utvecklingen av produkter och tjänster som t ex via open source och Web 2.0 vilket skapar nya former av samverkan och nätverkskapande. En annan trend är att vi kommunicerar - chattar, bloggar, twittrar - mer och mer med varandra på olika sätt och med hjälp av olika tekniker. Det dyker ständigt upp nya sätt och möjligheter. Som dataingenjör har du definitivt fantastiska möjligheter att vara med och påverka utvecklingen och framtiden.

Läs mer...

den miljö i vilken datorsystemen skall verka. Utbildningen i datateknik präglas av ett ingenjörsmässigt arbetssätt och ger dig en bred teoretisk kunskapsbas inom datateknikområdet. För att verklighetsförankra och ge dig färdigheter kopplas denna kunskap under utbildningen till praktiska uppgifter, projekt och problemlösning.

Mats Klinglöf – automationsingenjör, Epsilon Utvecklingscentrum Syd AB

Linus Jönsson – student

Den största fördelen med yrket som automationsingenjör är i mina ögon möjligheten till varierande arbetsuppgifter. Vissa perioder kanske man sitter och arbetar med programmering av styrsystem eller konstruerar elskåp vid sitt skrivbord och andra perioder driftsätter man maskiner ”ute i verkligheten”.

Jag hade börjat på datateknikprogrammet förra året men bytte program eftersom jag tyckte att detta nya verkade intressantare. Även om det är nytt så känns det genomtänkt, det märks att LTH satt ihop liknande program förr.

Beroende på intresse så finns det många områden att specialisera sig inom - elkonstruktion, PLC-, HMI/Scada- eller servo-programmering. Jag har sedan jag gick utbildningen till automationsingenjör på LTH i Helsingborg fått se väldigt varierande typer av industrier – livsmedel, läkemedel, träindustri, bilindustri etc. Flertalet av dessa har dessutom legat utanför Sveriges gränser varav den längst bort har varit i USA.

ÅRSKURS 1

Första året är rätt tufft med mycket matematik men det var bra och passade mig. Nu på andra året är det mer specifika kurser. Jag vet inte vad jag ska bli men vi träffar företagsrepresentanter som berättar om sina verksamheter och de är ofta spännande. Ingen i min familj är ingenjör men jag umgås med en del som är det eller studerar för att bli det och har blivit inspirerad av dem. Jag valde att bli ingenjör för jag är lagd åt matematiken. I framtiden vill jag arbeta med projekt, gärna i internationell miljö.

ÅRSKURS 2

ÅRSKURS 3

Utvidgad ellära Projekt inom automations- och elektroteknik

Matematik Elenergiteknik och elektriska drivsystem

Automationsteknik fortsättningskurs

Elektroteknik - översikt

Digital- och datorteknik

64

Kraftelektronik

Programmering i C++

Styr- och reglerteknik

Datorsäkerhet

Ellära

Automationsteknik

Datorkommunikation

Dator- och telekommunikation

Programmering i Java

Databaser

Examensarbete

180 hp | 3 år

www.elautomation.hbg.lth.se | 042-35 67 25 | infohbg@kansli.lth.se Bachelor of Science in Engineering  |  Electrical Engineering

Elektroteknik med automationsteknik 

65

–– Utbildningen har stor anknytning till näringslivet. –– Utbildningen blandar teori med praktiska tillämpningar. –– Den färdiga högskoleingenjören är snabbt användbar i näringslivet.

Vi inser alla hur viktiga elleveranserna till våra företag och hem är. Vad händer om elleveranserna upphör? Jo, värmesystemen slås ut, vattenleveranserna bryts, mobiltrafiken försvinner, SMS, MMS och internet ur funktion - hela samhället slutar att fungera!

Automationssystem driver och övervakar medicinsk utrustning, bil-, tåg- och flygtrafik, dvs stora delar av samhällets infrastruktur. I de framtida miljöriktiga energisystemen såsom vind-, sol- och vågkraft kommer det att krävas högteknologiska datorstyrda automationssystem för att ge en säker energiförsörjning. Även i hemmen finns idag avancerade automationssystem för att styra och reglera inomhusklimatet och energianvändningen. En elektro/automationsingenjör arbetar med projektering, konstruktion, underhåll och drift av automations- och elanläggningar. Inom dessa områden ingår såväl hårdvaru- som mjukvaruarbete. Därför krävs kunskaper inom elektroteknik, automationsteknik och datorteknik. Målet med utbildningen är att ge kunskap om såväl elkraftsystem som installationsteknik samt automationsteknik med givare, reglersystem och datorbaserade styr- och automationssystem. I utbildningen ingår realistiska projekt, som utförs i samarbete med företag i regionen. Eftersom programmet syftar till att utbilda högskoleingenjörer är anknytningen till näringslivet stort och de grundläggande teorierna ansluter till befintlig teknik. Inslag av pågående forskning läggs också in i kurserna. Du får också möjlighet att följa ett företag redan från våren i årskurs 1 och sedan genom hela utbildningen. Utbildningen börjar med grundläggande matematik, elektrisk kretsteori och digital- och datorteknik samt programmering i årskurs 1. I en introduktionskurs får du en inblick i programmets kurser och ser den röda tråden i utbildningen.

I årskurs 2 fördjupas kunskapen i elektroteknik med såväl elektromagnetism med EMC, signalbehandling, elektrisk mätteknik, energiteknik och elektriska drivsystem. Dessutom inleds automationsdelen i årskurs 2 med styr- och reglersystem för att sedan fortsätta i årskurs 3 med automationskonstruktion och installationsteknik. Utbildningen avslutas med ett examensarbete omfattande 15 veckor och som oftast utförs på ett företag i regionen. Av en ingenjör inom automations- och elektroteknikbranschen krävs idag även kunskaper inom datateknik och data- och telekommunikation varför kurser i dessa ämnen också ingår i utbildningen. Framtiden Eftersom bristen på ingenjörer inom området är stort har LTH tillsammans med näringslivet tagit fram denna högskoleingenjörsutbildning. Behovet av att anställa nya ingenjörer inom elektroteknik och automationsteknik är stort enligt näringslivets egna prognoser. Studenter med en högskoleingenjörsexamen inom området kan förväntas gå ut till en mycket god arbetsmarknad. Genom den här treåriga utbildningen får du en lysande möjlighet till att utbilda dig inom ett spännande ämne och du kommer att kunna välja mellan många attraktiva jobb då du är färdig högskoleingenjör. Fortsatt utbildning Efter avklarad högskoleingenjörsutbildning har du möjlighet till fortsatta studier till civilingenjör vid LTH i Lund.

Läs mer...

Utbildningen

Niklas Hugosson – student, Tekniskt basår

Johanna Faye-Hansen – student, Teknisk bastermin

Det bästa med tekniskt basår är att man läser på gymnasienivå, men i högskoletakt. Det gör att man kommer in i högskolestudierna på ett smidigt sätt, och att man sedan har matte och fysik färskt i minnet när man läser vidare.

Jag är jätteglad att jag läste basterminen nu i vår. Eftersom jag tog studenten 2007 och bara har jobbat sen dess fick jag en mindre chock när jag började plugga igen, det kändes som att jag inte kom ihåg någonting av det jag lärt mig på gymnasiet och jag började till och med tvivla på om detta verkligen var rätt. Men efter bara ett par veckor kände jag att allt kom tillbaka och jag började tycka att det var riktigt roligt att plugga och använda hjärnan igen.

Jag valde att läsa tekniskt basår eftersom jag fick upp ögonen för högskoleingenjörsutbildningen Byggteknik med arkitektur på LTH. Jag har läst samhällslinje på gymnasiet och saknade därför lite matte och fysik, så det passade extra bra att få en ”mjukstart” med basåret eftersom jag inte pluggat på ett tag. Jag tycker att det bästa med LTH är att det satsas mycket på studenterna här. Både när det gäller studierna och vid sidan av. Fast Campus Helsingborg inte är så stort är det ofta aktiviteter runt utbildningen eller via studentföreningarna. Det gör att det alltid händer något, så man får verkligen chansen att leva som en student.

Det var ganska högt tempo på basterminen, högre än på gymnasiet men det är inte så högt som när man läser till ingenjör. För mig känns det som att basterminen är som en bra uppvärmning inför hösten när jag ska läsa till civilingenjör och jag tror att övergången mellan att inte plugga alls till att börja läsa en tuff utbildning med högt tempo blir mjukare. Ett plus med att läsa vid LTH är dess goda rykte. LTH är ju känd för att ha väldigt hög klass på sina utbildningar. Det tror jag kan vara en fördel när jag sen ska ge mig ut och söka jobb efter utbildningen.

66

www.teknisktbasar.hbg.lth.se  |  042-35 67 25 |  infohbg@kansli.lth.se

Tekniskt basår och Teknisk bastermin 

67

Vill du utbilda dig till högskoleingenjör, civilingenjör eller brandingenjör men saknar kurser som krävs för behörighet? På LTH vid Campus Helsingborg har du möjlighet att skaffa dig rätt förkunskaper. Beroende på din studiebakgrund kan du söka till Tekniskt basår eller Teknisk bastermin. Utbildningarna omfattar matematik, fysik, kemi och teknisk orienteringskurs.

Tekniskt basår

Teknisk bastermin

Tekniskt basår vänder sig till dig som saknar den särskilda behörigheten för att läsa på teknisk högskola. Basåret pågår under höst- och vårterminen och undervisningen är uppdelad i föreläsningar, övningar och laborationer. I början av utbildningen repeteras viktiga moment från Matematik A och B.

Du som saknar vissa behörighetsgivande kurser har möjlighet att läsa Teknisk bastermin. Det gäller dig som har läst Matematik C, Fysik A och Kemi A på gymnasiet men ändå inte uppfyller den särskilda behörigheten för att gå vidare till en teknisk högskoleutbildning. Basterminen pågår under vårterminen och undervisningen är uppdelad i föreläsningar, övningar samt laborationer.

Obligatoriska kurser • • • •

Matematik CD Fysik AB Kemi A Teknisk orienteringskurs

Obligatoriska kurser • Matematik D • Fysik B • Teknisk orienteringskurs

Tillvalskurser

Tillvalskurser

• Matematik E • Kemi B

• Matematik E • Kemi B

Anmälan till Tekniskt basår görs senast 15 april.

Anmälan till Teknisk bastermin görs senast 15 oktober.

Fortsatta studier efter tekniskt basår/bastermin

Läs mer...

Godkänt Tekniskt basår eller godkänd Teknisk bastermin ger platsgaranti till valfri h��gskoleingenjörsutbildning i Helsingborg. För att platsgarantin ska gälla ska du söka via www.antagning.se senast den 15 april 2013. Har du uppnått godkänt resultat på tillvalskursen Matematik E, är du även behörig att söka (ej platsgatanti) civilingenjörsutbildningar samt brandingenjörsutbildning vid LTH i Lund. Goda studieresultat från basåret/basterminen beaktas vid antagningen till utbildning inom LTH.

Michael Johansson – livsmedelsinspektör, Allingsås kommun

Viktoria Karlsson – student

Jag började studera på LTH för att jag ville gå vidare i livet och få ett arbete med mer ansvar och mer utmanande arbetsuppgifter. Jag började min yrkesmässiga bana som bagare och därefter gick jag över till dagligvaruhandeln där jag arbetade i ungefär 5 års tid. Efter detta har jag gjort några säsonger inom fiskeindustrin i Norge och rest mycket över hela världen. Efter några år på resande fot ville jag få en fast plats i tillvaron och eftersom jag i alla år arbetat med livsmedel så kändes det naturligt att studera Livsmedelsteknik.

Alla kurser på programmet handlar om livsmedel, vilket gör det lättare att ta till sig informationen och relatera till sina tidigare arbetserfarenheter. Det är intressant att få svar på vad som händer kemiskt och mikrobiellt vid tillverkning av livsmedel. Eftersom alla som går utbildningen har tidigare arbetserfarenheter så har vi olika kunskaper med oss, vilket vi kunnat dra nytta av vid t ex grupparbeten.

Utbildningen var bred och gav mig en viktig förståelse för hela livsmedelskedjan. Det som intresserade mig mest och som jag haft mest nytta av är mikrobiologin. Mikrobiologin har lärt mig mycket viktigt om livsmedelshygien som jag tillämpar varje dag i mitt arbete.

Livsmedel behöver alla och det gör ämnet intressant och efter några år inom bageribranschen ville jag öka på mina kunskaper inom livsmedel för att kunna jobba med utveckling och säkerhet inom området. Utbildningen innehåller både praktiska och teoretiska avsnitt som kompletterar varandra, vilket tilltalar mig som alltid har jobbat praktiskt. Det är dessutom en bred utbildning som kan ge många olika typer av jobbmöjligheter.

Jag arbetar nu som Livsmedelsinspektör i Alingsås kommun. Arbetet är det bästa jag någonsin haft och jag trivs oerhört bra med arbetsuppgifterna. Eftersom jag tycker mycket om att träffa olika människor är arbetet perfekt då jag varje dag är ute och träffar folk på inspektioner. Jag är idag väldigt glad och tacksam för att jag gick utbildningen, eftersom jag aldrigt kunnat få det jobb jag har idag utan att ha gått på Livsmedelsteknisk högskoleutbildning.

68

ÅR 1

Livsmedelskedjans förutsättningar

Livsmedelsteknik I

Livsmedels kemiska och mokrobiella grunder

Livsmedels näringsmässiga och mikrobiella kvalitet

Livsmedelskemi

År 2

Vegetabiliska livsmedel

Animaliska livsmedel

Livsmedelsteknik II

Produktutveckling

Examensarbete

Produktionsplanering

Näringslära II

Metodik

120 hp | 2 år

www.livsmedel.lth.se  |  042-35 67 40 / 042-35 67 25   |  infohbg@kansli.lth.se

Livsmedelsteknisk högskoleutbildning 

69

–– Du kan bygga på dina tidigare livsmedelserfarenheter med en teoretisk utbildning. –– Med din teoretiska utbildning får du möjligheter att söka kvalificerade jobb inom hela livsmedelssektorn. –– Du har möjligheter att få ett jobb med bättre arbetstider och en högre lön. –– Du får kunskaper inom livsmedelssäkerhet, näring och hälsa, produktframställning, livsmedelsegenskaper m m. –– Du får kunskap om vad som påverkar matens kvalitet under hela kedjan från råvara till slutlig produkt.

Samhället behöver personer med stort kunnande om mat och livsmedel. Du som redan jobbar någonstans i livsmedelskedjan har här möjligheter att utvecklas och förbättra din arbetssituation, samtidigt som du kan bidra till utveckling och förbättring av framtidens mat. Framtiden

Utbildningen omfattar fyra terminer, 120 hp. De teoretiska studierna varvas med laborationer, projektarbeten och studiebesök. Kurser som ingår i utbildningen är t ex livsmedelskemi, mikrobiologi, näringslära, animaliska livsmedel, vegetabiliska livsmedel, produktutveckling, livsmedelskedjans förutsättningar mm. För att bli antagen till utbildningen krävs grundläggande behörighet samt två års yrkeserfarenhet från livsmedelsindustri, livsmedelsbutik, storhushåll eller restaurang.

Som färdig livsmedelstekniker kan du arbeta som exempelvis produktionsledare, arbetsledare, produktutvecklare, industrikonsulent, kvalitetsledare, hygienansvarig, försäljare, livsmedelsinspektör, livsmedelstekniker, kökschef, kostchef, lärare eller som egen företagare/konsult.

Läs mer...

Utbildningen

Läs utomlands under din studietid på LTH! På LTH har du många olika möjligheter att göra en del av din utbildning utomlands – i stort sett var som helst i världen! Du väljer själv om du inom din specialisering vill läsa kurser, göra examensarbete eller praktisera utomlands. Är du beredd att förlänga din studietid en termin eller två, kan du få ytterligare en examen från något annat europeiskt land eller Japan. Vill du trots allt helst läsa din specialisering på LTH, finns för flera program möjligheten att tillbringa en termin i årskurs 3 på ett nordmerikanskt universitet, enligt en i förväg fastställd studieplan. Möjligheterna är många – tag chansen! Europa Även om det är bra att kunna ytterligare ett europeiskt språk, kan du idag finna kurser på engelska vid ett flertal universitet i Europa. Det är tryggt att i början veta att det finns möjlighet att hitta kurser på engelska, innan man successivt förbättrat sina språkkunskaper. Europas bästa tekniska högskolor och universitet är öppna för dig. Ta möjligheten att fördjupa dig inom ditt teknikområde och samtidigt utveckla dina språkkunskaper. Nordamerika LTH och Lunds universitet samarbetar med prestigefyllda universitet i både USA och Kanada, vilket öppnar många möjligheter för dig som student. Sedan drygt 40 år tillbaka finns t ex ett samarbete mellan Lunds universitet och University of California. Detta är ett mycket populärt utbyte som omfattar alla Lunds universitets studenter. Som teknolog kan du dessutom söka till Georgia Tech, University of Illinois eller varför inte Queen’s University eller University of Waterloo i Kanada?

70

Sydamerika Talar du spanska eller portugisiska och funderar på att studera i Sydamerika? LTH är med i nätverket Magalhães, där femton universitet med inriktning mot teknik och arkitektur, spridda över hela den sydamerikanska kontinenten ingår. Buenos Aires, Rio de Janeiro, Lima, Caracas och Valparaiso är exempel på orter där du kan läsa. Asien, Australien och Nya Zeeland Även Kina och Japan utökar sitt kursutbud på engelska och i Hong Kong och Singapore är naturligtvis undervisningen helt engelskspråkig. Väljer du programmet Ekosystemteknik kan du läsa en sommarkurs vid Xiamen University i Kina. På civilingenjörsutbildningarna i Datateknik, Elektroteknik samt Informations- och kommunikationsteknik kan du välja att följa Kinainriktningen. Läs mer på sidan 43 och www.lth.se/kinainriktningen. I Japan kan du läsa en termin eller två vid University of Tokyo, eller satsa på dubbelsexamen vid University of Keio eller University of Kyushu. Förbered dina studier i Asien genom att läsa kinesiska eller japanska för tekniker vid Lunds universitet innan du åker. Språkkurser Skräddarsydda språkkurser erbjuds LTHs studenter som förberedelse för utbytesstudierna. Bygg vidare på tidigare kunskap i de traditionella europeiska språken, eller läs en nybörjarkurs i kinesiska eller japanska. Även om du beslutar dig för att läsa hela utbildningen i Lund, kan du inte undgå att någon gång under din utbildning komma i kontakt med olika kulturer. Studiemiljön i Lund är internationell och mångkulturell!

Elisabeth Wahlstedt, student på Industriell ekonomi Universidad Politécnica de Madrid, Spanien Att få lära känna och leva i en ny kultur har varit väldigt värdefullt och blev för mig en större behållning än de tekniska studierna på plats. Heltidsstudierna på spanska innebar att jag var tvungen att lära mig språket illa kvickt och jag gick från ingenting via en sommarkurs till att idag vara flytande i mitt nya favoritspråk. Madrid är en fantastisk stad med fantastiska människor och året där har gett mig ökade möjligheter för framtiden.

Johan Mattsson, student på Datateknik University of Illinois at UrbanaChampaign, USA

Alexander Grossmann, student på Ekosystemteknik Xiamen university, Kina Att jag i sista minuten sökte till utbytesstudier var mitt livs bästa val! På en så kort tid som ett halvår, bands kontakter med människor från världens alla hörn, jag dök in i en ny kultur och tog del av en livsstil helt främmande från vad jag tidigare upplevt. Jag lärde mig att anpassa mina prestationer utifrån vad som förväntas i nya miljöer samt att se världen och dess problem ur en främmande synvinkel. Mina erfarenheter från landet och språket, som jag lärde mig att ta mig fram med, ökade mina chanser att få ett Minor Field Studies stipendium till examensarbetet. Jag är nu på väg till ett nytt äventyr i mittens rike – för att göra examensarbete som MFSstipendiat.

Mina utbytesstudier har gett mig vänner för livet och en bekräftelse på att jag kan klara mig själv! Det var också roligt att få en inblick hur skolsystemet fungerade och att inse att det var ganska likt en amerikansk collegefilm.

Melissa Denbaum, student på Ekosystemteknik Institut Nationale Polytechnique de Grenoble, Frankrike Att göra ett internationellt utbyte i samband med studierna är en möjlighet man inte får missa! Jag såg mitt utbytesår som en chans att uppleva ett annat land utan att komma efter i mina studier samtidigt som det var en möjlighet att boosta mitt CV med språkkunskaper och unika kurser. Med mig hem från Grenoble i de franska alperna har jag många erfarenheter, utökad baguette-kunskap, bättre självförtroende, nya vänner världen över och energi för fortsatta studier i Lund.

Jonas Ytterfors, student på Industriell ekonomi University of Hongkong, Kina Att studera utomlands var för mig en unik möjlighet att upptäcka en kultur och en del av världen jag inte visste mycket om. Det innebar också att jag kunde läsa ämnen på Asiens bästa universitet som inte går att läsa i Sverige. Men framför allt hade jag fantastiskt roligt och lärde känna massor av människor från hela världen!

Johanna Bolander, student på Bioteknik Vrije Universiteit Brussels, Belgien Att läsa som ERASMUS-student i den europeiska huvudstaden Bryssel har för mig inneburit flera värdefulla kontakter världen över, både på ett personligt och professionellt plan. Studierna på VUB har hållit hög kvalitèt genom att undervisningen sker i små studentgrupper och med engagerade föreläsande professorer som även är aktiva inom aktuell forskning. Det allra bästa med mitt år får dock ses som det faktum att jag blir kvar i höst för att skriva mitt examensarbete vid en av mina professorers labb, Laboratorium for Skeletal Diseases and Joint Disorders vid K.U Leuven.

Peter Andrén, student på Arkitektur University of Queensland, Austrialien Mina utbytesstudier har först och främst gett mig möjligheten att hamna i hjärtat av ett främmande samhälle, nära inpå människor som är formade av denna plats på jorden. Det har gett mig erfarenheter av hur olika universitet undervisar och utvecklat min förmåga att hantera mina studier. Min förmåga att se kritiskt på uppgifter inom min utbildning har också förbättrats. Studierna utanför Sverige har även lärt mig att uppskatta de positiva aspekterna av undervisningen på LTH. Det har fått mig att se mer positivt på den utbildning som erbjuds i Sverige, med gratis högskolestudier till exempel.

71

Lund – studenternas stad Lund är en alldeles äkta studentstad. Av drygt 110 000 invånare är hela 47 000 studenter. Veckorna före terminsstart känns det alltid i luften att något är på gång. Sedan strömmar ivriga, entusiastiska studenter in, åter från sina hemorter. Kaféer, restauranger, gator och torg väcks till liv och fylls med glada leenden. Den lundensiska andan Lund och studenterna har under många år blomstrat sida vid sida. Universitetets långa historia och studenternas stora antal har satt sin självklara prägel på staden. Universitetsbyggnader och bibliotek är tydliga landmärken i stadsbilden och vart man vänder sig susar det förbi studenter, energiskt trampande sina cyklar på väg till nästa föreläsning. Även stadens själ har hämtat sin karaktär i universitetsvärlden. Man brukar prata om den lundensiska andan. Den är inte helt lätt att beskriva, men humor, ironi och att inte ta sig själv på för stort allvar är viktiga ingredienser – studieallvaret till trots. Att många tidigare studenter väljer att arbeta och bosätta sig i Lund bidrar till att traditionerna upprätthålls. Som exempel är de många spexen och de återkommande karnevalerna självklara nöjen för både nya och gamla lundensare. En liten metropol När du pluggar i Lund behöver du aldrig ha tråkigt. Biobesök, teater, konserter, allehanda idrott eller konst – det är bara att välja. Krogar, kaféer och turistattraktioner varvas med shopping i alltifrån stora gallerior till små butiker i medeltida gränder. Självklart ska du flanera bland kullersten och stockrosor i stadens gamla delar. Och kanske avrunda med en fika på gräset i soliga Lundagård – parken som är studentlivets självklara mittpunkt. Skulle du mot all förmodan tröttna på Lund når du såväl Österlens idyll som Köpenhamns storstadspuls inom en timme. På mindre än en kvart är du i Malmö med ett stort utbud av inte minst nöjesliv och krogar. Nationerna och studentlivet Nationerna är en värld i sig. Lunds 13 studentnationer är centrum för mycket av studentlivet. Nationerna erbjuder bostäder, lunchservering, kaféer, restauranger, nattklubbar, konserter och fester i alla dess former – från sillfrukost till frackfest. Allt arrangeras ideellt av studenter som arbetar med det de tycker är kul. Nationerna har egna tidningar, radiostationer, idrottslag, danskurser etc. Endast din egen fantasi sätter stopp för vad nationerna kan syssla med. I Lundagård, mitt i stan, finns studenternas egen borg: AF-borgen. Här hålls det inte bara spex, baler och frackfester utan hela byggnaden sjuder av studentaktivitet. I nations- och studentlivet kan alla smakriktningar och intressen verkligen få sitt lystmäte!

72

Campus LTH Campus LTH ligger i den norra delen av Lund, bara några cykeltramp från centrum. Området sjuder av liv med sina 9600 studenter och närmare 700 forskarstuderande. Ett stenkast från Campus LTH ligger forskningsbyn Ideon. Här omsätts forskningsidéer från LTH och universitetet till affärsdrivande företag. Nära LTH ligger också Ekonomihögskolan och flera studentbostadsområden som Sparta och Delphi. Campus mittpunkt är Kårhuset. Här kan du fika och äta lunch, gå på bal, underhålla i teknologernas eget spex, spela innebandy, bada bastu eller delta i diskussioner med lärare och rektor. Här möts nämligen lärare och studenter regelbundet för att diskutera utformningen av LTHs utbildningar. På LTHs Studiecentrum finns bibliotek, kafeteria och studieplatser till studenterna. Till informationsdisken kan du vända dig med alla typer av frågor om LTH. Här kan du hämta studieintyg, anmälningsblanketter och olika sorters kataloger och broschyrer. Mycket av studentlivet på Campus organiseras av Teknologkåren och dess sektioner. Allt från nollning till sångarstrider och gasquer. För att inte tala om den viktiga studiebevakande verksamhet som är kårens huvudverksamhet. Studenterna ÄR Lund Till sist: på många sätt ÄR studenterna Lund. Studenter och studier har alltid varit en viktig del av staden och dess självbild. Ja, faktiskt enda sedan 1666. I Lund vet vi hur man tar hand om studenter och får dem att lyckas och trivas, både med studierna och i livet utanför föreläsningssalen!

Välkommen till Lund och Campus LTH!

73

Prisade LTH-studenter Arvid Rudberg tilldelades Lilla Polhemspriset för bästa examensarbete som delas ut av SVERIGES INGENJÖRER . På 2011 års Livsmedelsdagar fick två LTH-studenter Mattias Andersson , teknisk fysik, och Matilda Axelson, industriell ekonomi priset för ”ÅRETS IDÉ” för sitt koncept ”SmartFood.” Kristofer Eriksson, industridesignstudent från LTH, vann VOLKSWAGENS DESIGNTÄVLING DESIGN CHALLENGE . Uppdraget var att designa en Volkswagen anno 2018. LTH-laget Home Consulting vann Sverigefinalen i casetävlingen ”I-CASE CHALLENGE”. Laget bestod av Olof Petterson, Malin Rylander, Emilia Wiking och Hannes Teder från Industriell ekonomi. I-Case Challenge är en tävling mellan de fem I-sektionerna i Sverige på LTH, KTH, LiTH, LuTH och Chalmers. 2011 års AXISSTIPENDIE gick till studenterna Dennis Laks och Martin Sandgren för examensarbetet ”Using Time-of-Flight camera for Motion Detection and People Counting”. Ett lag från Technology Management tog hem SVENSKA STUDENTMÄSTERSKAPEN I FÖRETAGSANALYS 2011. Laget, TM Intelligence, bestod av Ola Cewers, Marianne Johansson, Meriem Manouchi, Robin Rendahl och Wilhelm Rosendahl. På en racertävling för hybridbilar, konstruerade av studenter, i New Hampshire Motor Speedway i USA hamnade LTH på en hedrande tredje plats. Dessutom fick LTH-studenterna ”THE IEEE ENGINEERING FUTURE AWARD”.

74

LTH-studenten Marion Guegan fick pris av BYGGFÖRETAGET RAMBÖLL för sitt examensarbete ”Climate warming effects on hydropower demand and pricing in California”. Christer Gerdin och Louise Hammarberg, studenter på Technology Management, har belönats med SWECOS PRIS FÖR BÄSTA EXAMENSARBETE 2010. Titeln är ”Varför genomförs inte lönsamma energiinvesteringar – en studie av beslutsfaktorerna vid investeringar inom fastighetsbranschen”. Dessutom belönades deras uppsats med förstapriset i STORA PROPERTY-PRISET 2010. I

regionfinalen

inom

ACM

INTERNATIONAL

COLLEGIATE

PROGRAMMING CONTEST - the ”2010 Northwestern European

Regional Contest” vid Jacobs University i Bremen, Tyskland erövrade ett LTH-lag en mycket meriterande bronsmedalj och var samtidigt bäst placerade svenska lag. Laget bestod av Rasmus Henningsson, Robin Karlsson, Jonathan Wulcan. Tävlingen är en lagtävling för studenter i programmering. Karin Hartman och Per Eldénius, som studerar industridesign respektive arkitektur på LTH, har vunnit SCA:s europeiska designtävling ”DESIGN CHALLENGE” i Bryssel. Per och Karins förslag ”Bright Light” vann tack vare sin ”geniala enkelhet”, enligt juryns motivering.

LUracing i sin fjärde upplaga har gjort det bästa resultatet hittills i den internationella tävlingen FORMULA STUDENT PÅ SILVERSTONE i Storbritannien. Den hybrid-racer som 36 LTH-studenter byggde under ett läsår, lyckades i juli 2010 vinna andra pris i klassen för miljövänliga bilar. LTH vann SM I FÖRETAGSANALYS 2010. En grupp studenter på Technology Management: Erik Björkegren, Caroline Nyquist, Malin Eklund, Olle Eliasson och Magnus Frostberg vann tävlingen. SVENSKA BYGGINGENJÖRERS RIKSFÖRBUND (SBR) har utsett och belö-

nat de bästa byggstudenterna, Katrin Almquist och Salam Jassim, på Campus Helsingborg med ett stipendium. Nils-Erik Fransson, arkitekturstudent vid LTH, fick ett särskilt omnämnande av KONST/DESIGN/ÖRESTAD vid en möbelutställning i Karlskrona. Bakom den står den nämnda organisationen tillsammans med Form/Design Center i Malmö och SVID/Exandera och avsikten är att lyfta fram nya, unga designers.

Alexander Mirholm, teknolog vid bioteknikprogrammet, fick FRANKE-STIPENDIUMET för ”sitt enastående engagemang för att popularisera naturvetenskap och teknik och för sin ambition att sprida kunskap till andra, bland annat genom LTH:s kemijulkalender med 25 olika experiment. Hans insatser har betytt mycket för och påverkat tusentals ungdomar över hela världen”. Laget från LTH vann finalen av TEKNIK-SM i Stockholm 2010. Lundalaget, som bestod av Per Sidén, Adam Wiman och Olof Troeng i laget Gerty, vann en resa till Kina. Teknik-SM arrangeras av Sveriges Ingenjörer tillsammans med Saab och Sandvik som huvudsponsorer. Liv Andersson, industridesigner som tog examen på LTH för något år sedan, fick REGION SKÅNES DESIGNSTIPENDIUM för sitt examensprojekt ”Dust to dust”. Juryn hoppas att stipendiet ska hjälpa henne att få produkterna i produktion. ”Dust to dust” formger miljövänliga kistor och urnor.

75

Så här fungerar det på LTH Att studera på högskola och universitet skiljer sig en hel del från grundskola och gymnasium. Undervisningsformen är betydligt friare med lite mindre lektionstid och mer studier på egen hand. Du har själv ansvaret för dina studier, vilket de flesta upplever som roligare och bättre. Utöver dina lärare får du träffa gästföreläsare, gå på seminarier och jobba mycket i grupp. I början kan det kännas lite annorlunda men snart känner du dig som hemma. Undervisning Undervisningen ser ganska olika ut på olika utbildningar. Men på alla utbildningar är undervisningen upplagd så att du snabbt ska bli insatt i och förstå din framtida yrkesroll som ingenjör, arkitekt eller industridesigner. De första terminerna på ingenjörsutbildningarna har du många föreläsningar, övningar, lektioner och laborationer. På föreläsningarna går lärarna igenom teoretiska moment, men visar också hur teorin används i praktiken. Lektionerna och övningsgrupperna påminner om de klasser du är van vid från gymnasiet, medan laborationerna är praktiska övningar i mindre grupper. Under övningar och laborationer är läraren ett viktigt stöd för din inlärning. På många utbildningar gör du intressanta projekt redan första året. Under den senare delen av din utbildning blir det mindre lektionstid och istället gör du olika uppgifter på egen hand, till exempel ditt examensarbete. Du som skall bli arkitekt eller industridesigner jobbar mycket i din ateljé eller studio. Föreläsningar och seminarier ger dig teoretiska kunskaper och perspektiv på din personliga utveckling.

76

Kursinnehåll Under de första terminerna på ingenjörsutbildningarna läggs den naturvetenskapliga grunden för resten av dina studier. På en viss utbildning kan det vara ämnen som fysik och programmering. På en annan kan du läsa ekologi och geologi. Gemensamt är matematiken som är en viktig grund för alla ingenjörer. Från det tredje året på civilingenjörsutbildningarna koncentreras studierna på de teknikvetenskaper som du kommer att inrikta dig på. I utbildningens senare del väljer du dina kurser själv. På de längre utbildningarna har du också stora möjligheter att studera utomlands. Under de sista terminerna får du en specialinriktning där du fördjupar dina kunskaper inom ett område som du vill lära dig mer om. Högskoleingenjörsutbildningarna avslutas med större block av tillämpade tekniska ämnen. Vidare ingår kurser eller moment i muntlig och skriftlig framställning, ekonomi, arbetsmiljö, etik. På arkitekt- och industridesignutbildningarna får du kunskaper och färdigheter både i konstnärliga ämnen och i de teknikämnen du behöver i din yrkesroll. Läsårsindelning Studierna vid LTH är indelade i fyra läsperioder per år och varje läsperiod avslutas med en tentamensvecka. Under varje läsperiod läser du normalt två till tre kurser.

Poäng

LTH-app

Utbildningen är indelad i poäng. 1,5 högskolepoäng motsvarar en veckas heltidsstudier. En termin på heltid ger 30 poäng och ett helt läsår ger 60 poäng. Du får dina poäng i samband med att du fullgör de olika kursdelarna, genom till exempel grupparbeten, projektkurser eller tentor.

När man är ny student på LTH är det inte alldeles lätt att hitta på campus och att orientera sig i universitetsvärlden. Därför har LTH tagit fram en app för iPhone och Android – LTH-guide – som hjälper studenterna att hitta. Du kan navigera dig rakt in i klassrummet eller till närmaste kopp kaffe, mikrovågsugn eller lunchställe. För att inte tala om att appen håller reda på ditt schema och vad som händer i studentlivet. LTH-guide guidar dig även i staden Lund.

Betyg Din insats bedöms antingen med betyg på en graderad skala eller enbart med godkänd respektive underkänd. Blir du underkänd på ett prov får du göra om det. Tentamen Ett prov kan vara antingen muntligt, skriftligt eller i form av ett projektarbete eller en laboration. På högskolan kallas ett skriftligt prov för en tentamen, eller i dagligt tal för en tenta. Tentan ger olika antal poäng beroende på hur stor kursdel den gäller. Missar du en tenta kan du skriva om den igen vid nästa tentamenstillfälle. Examensarbete Utbildningens avslutande moment är examensarbetet. Här löser du en ingenjörsmässig eller konstnärlig uppgift hos ett företag eller i en forskargrupp inom LTH. Du har hjälp av en handledare och du kan jobba antingen på egen hand eller tillsammans med en kurskamrat. Om du vill finns det möjlighet att göra examensarbetet utomlands och få kunskap om ett annat lands språk och kultur på köpet. Många företag visar stort intresse för examensarbeten och formulerar hela tiden aktuella uppgifter att lösa. Examensarbete i samarbete med ett företag leder ofta till en anställning.

Vid varje föreläsning kan du se bild på i vilket hus föreläsningssalen ligger och du kan också se på en karta vart du skall, och via GPS:en ser du var du själv är i förhållande till föreläsningssalen. Ursprungligen togs LTH-guide fram för att hjälpa nya studenter, och appen togs fram av två LTH-studenter som kom ihåg hur svårt det var att hitta i början, men nu har appen byggts ut för att vara till hjälp för alla studenter på LTH. Det finns även en inställning för besökare som visar information om hotell, taxi, bussar och sevärdheter i Lund. Funderar du på att plugga på LTH eller besöka oss så ladda gärna ner LTH-guide och bekanta dig med oss. Appen är såklart gratis.

77

Moderna yrkesutbildningar för en internationell arbetsmarknad Med en examen från LTH är du väl förberedd för ett arbete i en internationell miljö. Innehållet i din utbildning motsvarar vad svenska och utländska företag förväntar av en ingenjör, arkitekt eller industridesigner. Civilingenjörs- och arkitektutbildningarna är sammanhållna 5-åriga utbildningar som leder till en yrkesexamen, civilingenjörs- respektive arkitektexamen. Precis som i övriga världen ligger civilingenjörsexamen på samma nivå som en Masterexamen. Som civilingenjör från LTH uppfyller du också kraven för en examen som Master of Science. Efter ca tre år på LTHs civilingenjörsutbildningar kan du ta examen som teknologie kandidat, även kallad bachelorexamen. Det är en möjlighet men inget tvång för dig som student och förutsätter att du har gjort ett självständigt arbete på 15 hp. Kandidatexamen är inte avsedd som en yrkesförberedande examen.

78

Men om du efter tre år på LTH söker dig vidare till andra, utländska universitet är det ett sätt för dig att visa att du fullföljt tre års kvalificerade studier på LTH. För arkitektexamen gäller samma sak som för civilingenjörsutbildningarna, även här kan du ta ut en kandidatexamen efter 3 års studier. Som svensk arkitekt har du examen som Master of Architecture. Denna examen omfattas av ett särskilt EU-direktiv som underlättar för den som jobbar utomlands. Du som börjar läsa Industridesign kan läsa utbildningen på två nivåer. Först 3 år till en kandidatexamen. Därefter söker du påbyggnad till Master of Fine Arts in Design vid LTH eller annat universitet i Sverige eller utomlands. Även Högskoleingenjörsexamen har sin motsvarighet i de flesta europeiska länder, bland annat i alla nordiska grannländer. Examen översätts till Bachelor of Science in Engineering.

Studenten i fokus För att du ska lyckas med dina studier är det viktigt att alltifrån utbildningens upplägg och studiemiljö till avkoppling på fritiden fungerar bra. Därför försöker vi på LTH ge dig så goda förutsättningar som möjligt, hela vägen från gymnasiet fram till din examen. På LTH arbetar ett stort antal lärare, studievägledare, administratörer och inte minst studenter i olika verksamheter som rör dina studier. Alla med syftet att din tid vid LTH ska bli en framgång. Här är några axplock. Gymnasiekontakt Redan på gymnasiet möter du LTH. Bland annat åker studentambassadörer regelbundet ut till gymnasieskolorna, där de berättar om våra olika utbildningar, studierna och studentlivet. Kanske har du redan mött någon av dem eller kommit i kontakt med något av våra andra projekt till exempel Flickor på Teknis, Innovationsprojektet, Gemstone eller SI. Kanske har du besökt Vattenhallen, Science center LTH, och sett vår Kemishow eller själv gjort något experiment. Introduktionsveckan Under introduktionsveckan blir du och alla andra nya LTHstudenter välkomnad av rektor på LTH. Därefter tar programledningen, lärarna och studievägledningen hand om dig. De presenterar utbildningen och tydliggör både mål och innehåll. På utbildningsprogrammen varvas introduktionen av utbildningen och matematikrepetitioner med teambuilding den första veckan. Vi bildar även faddergrupper av äldre och nya studenter. Alltihop varvat med många och traditionsenliga teknologupptåg. För att vi ska kunna bistå dig på bästa sätt under din tid på LTH behöver vi veta vad du har för förväntningar och behov. Därför får du fylla i en enkät redan vid kursstarten. Dina svar använder vi såväl i vårt rekryteringsarbete som vid vår uppföljning. SI-mentorprogrammet Under ditt första studieår finns det möjlighet att få hjälp av frivilliga studiegrupper att hitta rätt studieteknik. SI-mentorprogrammet utbildar varje termin äldre studenter, som själva har läst kurserna, i studieteknik. De blir SI-ledare och har hand om studiegrupperna som träffas en gång i veckan under terminens gång. Träffarna läggs in på schemat och i studiegrupperna möter du SI-ledaren tillsammans med andra studenter från kursen. Du kan diskutera saker och ting som uppstår under utbildningens gång, ställa alla de frågor som du inte fick svar på under föreläsningen och jämföra dina tankar och idéer med andra studenter. SI-mentorprogrammet är ett komplement till den ordinarie undervisningen som har visat sig mycket uppskattat och väldigt effektivt för den enskilde studentens resultat. Att delta i frivilliga SI-gruppmöten ger en bra start för framtiden. Ryktet har spritt sig ut i näringslivet om studenter som redan vet hur problemlösning och samarbete i grupp går till.

Praktisera som civilingenjör LTH är först i Sverige med att återinföra praktiken i utbildningen av civilingenjörer. Det sker genom den frivilliga poänggivande kursen ingenjörsinriktad yrkesträning under det fjärde året. Då har du chansen att möta en arbetsgivare och under åtta veckor bekanta dig med ingenjörsuppgifter i de grupper och med de aktörer som förekommer på moderna arbetsplatser. Dina erfarenheter reflekteras i en rapport på ett seminarium under ledning av en lärare. Karriärvägledning tidigt i utbildningen Vid LTH vill vi ge dig som student möjlighet att redan tidigt kunna reflektera över din utbildning och din kommande yrkesroll. Via ett samarbetsprojekt mellan studievägledare och karriärvägledare vid LTH erbjuds du detta. Redan i årskurs 1 får du ta del av häftet ” Min studie och karriärplanering” där du bland annat kan hitta tips på hur du finner information om din blivande yrkesroll. Via föreläsningar från KarriärcenterLTH erbjuds du en första introduktion i ämnet karriärplanering. Detta följer dig sedan under hela din studietid hos oss med olika fokus vid olika tidpunkt i din utbildning. Teknologkåren Teknologkåren (TLTH) är teknologernas organisation för dig som studerar på LTH. Under din studietid får du chansen att uppleva allt vad det innebär att studera på LTH. Det kan vara allt från att stå på scen och spexa, arbeta på Kårens arbetsmarknadsmässa ARKAD eller arbeta med studiebevakning. Teknologkårens vision är: ”Du är nöjd på LTH” och arbetar med utbildning, näringsliv och fritid för att tillsammans med LTH göra utbildningen och skolan så bra som möjligt. Teknologkåren har även ett antal studenter som tagit ett år ledigt från sina studier och på heltid arbetar för att uppnå visionen. Till dem kan man alltid vända sig om man har frågor som rör hur det är att studera, hur studiemedel fungerar, vad man kan göra under studietiden men framförallt vad man kan göra efter utbildningen. Inom TLTH finns även sektionerna som omfattar en eller flera utbildningsprogram. De har hand om frågor som är specifika för de egna programmen. Sektionerna är den närmsta kontaktytan mot studenterna och där finns studieråd, fritidsaktiviteter och annat spännande att engagera sig i. De flesta sektioner har ett café där medlemmarna kan äta och träffas.

79

Bostad Se möjligheterna

Övriga möjligheter

Efterfrågan på rum ökar i början av terminerna eftersom många nya studenter börjar samtidigt. Var därför ute i god tid – ställ dig i bostadskö så fort som möjligt.

Du har också möjlighet att vända dig till BoPoolen, www. bopoolen.nu, en bostadsförmedling som drivs av Lunds universitets studentkår.

Kom ihåg att Lund har bra kommunikationer till kranskommunerna och avstånden är korta. Kanske du vill bo på landet? Vid havet? Se möjligheterna. Det går att få en bra bostad.

På universitets hemsida om bostäder, www.lu.se/student/bostad, kan du hitta ytterligare boendealternativ.

Stiftelsen AF Bostäder

I Helsingborg finns det idag sju olika studenthem, och ingen av dem ligger längre bort än 15-20 minuters cykelväg från Campus.

Stiftelsen AF Bostäder har en stor mängd rum till uthyrning – allt från mindre lägenheter till korridorrum där man delar kök med ett antal andra studenter. Information och möjlighet att anmäla dig får du genom att besöka webbplatsen: www.afb.lu.se .

80

Bostäder i Helsingborg

På Campus Helsingborgs hemsida www.helsingborgsstudent.se får du mer information.

Anmälan och behörighet Antagning till utbildningen sker en gång om året, till höstterminen, genom Verket för högskoleservice (VHS). Sista dag för anmälan är den 15 april! Du gör din anmälan via webben på www.antagning.se som öppnar för anmälan i mitten av mars. Information från VHS kommer även att finnas hos studievägledare vid gymnasieskolor och högskolor vid samma tid. Du är behörig att söka till LTHs utbildningsprogram om du uppfyller grundläggande behörighet för högskolestudier samt särskild behörighet för det program du söker till. Grundläggande behörighet På www.antagning.se/sv/ kan du läsa vad som gäller för dig och vad som krävs för att just du ska uppfylla grundläggande behörighet. Särskild behörighet Den särskilda behörigheten är oftast formulerad som krav på kunskaper i vissa kurser eller ämnen från gymnasieskolan eller komvux (lägsta betygskrav är G/3). Även arbetslivserfarenhet eller annat som är relevant för aktuell utbildning kan krävas. Kontrollera alltid mot aktuellt anmälningsmaterial! Arkitektutbildning, 300 hp - 5 år Områdesbehörighet 3

Brandingenjörsutbildning, 210 hp - 3,5 år Områdesbehörighet 9 Behörighetskurser: Matematik E, Fysik B, Kemi A Civilingenjörsutbildning, 300 hp - 5 år Områdesbehörighet 9 Behörighetskurser: Matematik E, Fysik B, Kemi A Högskoleingenjörsutbildning, 180 hp - 3 år Områdesbehörighet 8 Behörighetskurser: Matematik D, Fysik B, Kemi A Tekniskt basår, 40 veckor Matematik B Sökande med godkänt betyg i mer än en av kurserna Ma D, Fy A, Fy B, Ke A är inte behörig. Vidare krävs slutbetyg/avgångsbetyg från gymnasieskolan eller komvux. Teknisk bastermin, 20 veckor Matematik C, Fysik A, Kemi A Sökande med godkänt betyg i mer än en av kurserna Ma D, Fy B är inte behörig. Vidare krävs slutbetyg/avgångsbetyg från gymnasieskolan eller komvux.

Behörighetskurser: Matematik C, Naturkunskap B, Samhällskunskap A Naturkunskap B kan ersättas med Fysik A + Kemi A + Biologi A

SISTA DAG FÖR ANMÄLAN 15 APRIL

LTH ger sökande till Arkitektprogrammet generell dispens från krav om Biologi A Kandidatutbildning i industridesign, 180 hp - 3år Områdesbehörighet 3 samt godkänt antagningsprov. Behörighetskurser: Matematik C, Naturkunskap B, Samhällskunskap A Naturkunskap B kan ersättas med Fysik A + Kemi A + Biologi A LTH ger sökande till kandidatutbildning i industridesign generell dispens från krav om Biologi A och Samhällskunskap A.

81

Kontaktinformation och viktiga datum Lund

Helsingborg

LUNDS TEKNISKA HÖGSKOLA Box 118, 221 00 Lund Informationsdisk tel: 046-222 72 00

LTH CAMPUS HELSINGBORG Box 882, 251 08 Helsingborg Tel: 042-35 65 00

Besöksadress: Kårhuset, John Ericssons väg 3, Lund www.lth.se

Besöksadress: Universitetsplatsen 2, Helsingborg www.ch.lu.se

STUDIEVÄGLEDARE Telefonnummer till studievägledare finns under respektive program i katalogen.

UTBILDNINGSSERVICE HELSINGBORG Tel: 042-35 67 40 eller 35 67 25

STUDIEKURATOR Tel: 046-222 71 93 eller 222 37 14

INGENJÖRSSEKTIONEN, TLTH (TEKNOLOGKÅREN) Universitetsplatsen 2, Helsingborg Tel: 042-13 07 37

STUDENTHÄLSAN Tel: 046-222 43 77 TEKNOLOGKÅREN VID LTH (TLTH) Kårhuset, John Ericssons väg 3, Lund Tel: 046-14 03 90 www.tlth.se LUNDS UNIVERSITET Box 117, 221 00 Lund Vxl: 046-222 00 00 www.lu.se STUDENTSERVICE VID LUNDS UNIVERSITET Gamla Kirurgen Sandgatan 3, Lund Tel: 046-222 01 00 (mån-fre 10-12)

82

CSN – studiemedel Tel: 0771-27 60 00 www.csn.se VHS - Verket för högskoleservice Tel: 0771-55 07 20 www.vhs.se

Sista dag för anmälan 15 april

ÖPPET HUS LUND Lördagen den 17 mars kl 10-15, AF-borgen i Lundagård HELSINGBORG Torsdagen den 22 mars kl 15.30 – 18.00, Campus Helsingborg

ÖPPET HUS Lund – Lördagen den 17 mars kl 10 -15, AF-borgen i Lundagård Helsingborg – Torsdagen den 22 mars kl 15.30 – 18.00, Campus Helsingborg


Utbildningskatalogen LTH 2012