Issuu on Google+

1112 clevelandorchestra.com

THE CLEVELAND ORCHESTRA F R ANZ WELSER-MÖST M U SIC DI R ECTOR December 8, 10 SAINT-SAËNS ORGAN SYMPHONY December 9 KEYBANK FRIDAYS @7


Hermès, contemporar y artisan since 1837.

18 East Orange Street Chagrin Falls, Ohio (440) 247-2828


It’s never too early to appreciate great music. 7KDW¶VZK\ZH¶UHVRSURXGWRVXSSRUW7KH&OHYHODQG 2UFKHVWUD¶VPXVLFHGXFDWLRQSURJUDPVIRUFKLOGUHQPDNLQJ SRVVLEOHWKHUHZDUGVDQGEHQHILWVRIPXVLFLQWKHLUOLYHV

AUTO GROUP

LEXUS, BMW, MINI, LINCOLN, CADILLAC. BUICK, CHEVROLET, CHRYSLER, DODGE, FIAT, FORD, GMC, HONDA, HYUNDAI, JEEP, KIA, MAZDA, NISSAN, SCION, TOYOTA, VW. WILLOUGHBY HILLS, MENTOR, PAINESVILLE, STREETSBORO, MADISON.


THE CLEVELAND ORCHESTRA O F

C O N T E N T S

WEEK 7 9

About the Orchestra

1112

CO V E R P H OTO G R A P H BY R O G E R MA S T R O I A N N I

TA B L E

Musical Arts Association . . . . . . . . . . . . . . . . . . . . . . 9 Music Director . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Conductors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Roster of Musicians . . . . . . . . . . . . . . . . . . . . . . . . . 18 Guest Information . . . . . . . . . . . . . . . . . . . . . . . . . . 73 Severance Hall . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 The Cleveland Orchestra . . . . . . . . . . . . . . . . . . . . 92

21

In the News Perspectives . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Orchestra News . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Community and Education . . . . . . . . . . . . . . . . . . In Focus: A Look Back . . . . . . . . . . . . . . . . . . . . . . .

34

21 22 69 93

Concert — Week 7 Concert Previews . . . . . . . . . . . . . . . . . . . . . . . . . . . Program (Thursday/Saturday) . . . . . . . . . . . . . . Program (Friday) . . . . . . . . . . . . . . . . . . . . . . . . . . . KeyBank Fridays@7 . . . . . . . . . . . . . . . . . . . . . . . . Introducing the Program . . . . . . . . . . . . . . . . . . . .

33 34 35 36 37

BARBER

Symphony No. 1 . . . . . . . . . . . . . . . . . . . . . . . . . . 39 BERNSTEIN

Copyright © 2011 by The Cleveland Orchestra and the Musical Arts Association Eric Sellen, Program Book Editor E-MAIL: esellen@clevelandorchestra.com Program books for Cleveland Orchestra concerts are produced by The Cleveland Orchestra and are distributed free to attending audience members. Program book advertising is sold through Live Publishing Company at (216) 721-1800 The Musical Arts Association is grateful to the following organizations for their ongoing generous support of The Cleveland Orchestra: National Endowment for the Arts, the State of Ohio and Ohio Arts Council, and to the residents of Cuyahoga County through Cuyahoga Arts and Culture.

Serenade . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 SAINT-SAËNS Symphony No. 3 . . . . . . . . . . . . . . . . . . . . . . . . . . 47 Conductor: Marin Alsop . . . . . . . . . . . . . . . . . . . . . . Soloist: Peter Otto . . . . . . . . . . . . . . . . . . . . . . . . . . . Soloist: Joela Jones . . . . . . . . . . . . . . . . . . . . . . . . . . Friday@7 Performers . . . . . . . . . . . . . . . . . . . . . . . . . Norton Memorial Organ . . . . . . . . . . . . . . . . . . . . .

48

55 56 57 58 60

Future Concerts

The Cleveland Orchestra is proud of its long-term partnership with Kent State University, made possible in part through generous funding from the State of Ohio. The Cleveland Orchestra is proud to have its home, Severance Hall, located on the campus of Case Western Reserve University, with whom it has a long history of collaboration and partnership.

Concert Calendar . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 In the Season Spotlight . . . . . . . . . . . . . . . . . . . . . 65 Upcoming Concerts . . . . . . . . . . . . . . . . . . . . . . . . 94

66

Donors and Sponsors Endowed Funds . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Corporate Support . . . . . . . . . . . . . . . . . . . . . . . . . . Foundation & Government Support . . . . . . . . . Individual Support. . . . . . . . . . . . . . . . . . . . . . . . . . .

4

This program book is printed on paper that includes 10% recycled post-consumer content. All unused books are recycled as part of the Orchestra’s regular business recycling program.

66 77 79 80

Table of Contents

The Cleveland Orchestra


Enjoy the best of University Circle Choose Judson today

Independent living at Judson Manor or Judson Park, both located in the heart of University Circle, can be a rewarding experience for you 365 days a year. After all, the “Circle” is where it’s happening in Cleveland. Both the Park and Manor offer something for everyone. Come now while you can enjoy all of the benefits. Declare your independence from all the chores, taxes and expenses of your home—start living smart at Judson. Visit us today. Call (216) 791-2004 or visit www.judsonsmartliving.org.

Judson Manor Judson Park South Franklin Circle Smart LivingTM at Home


    

  

 

 !     


Photo by Roger Mastroianni

Exceptional

We are proud to sponsor

The Cleveland Orchestra in helping to build audiences for the future through an annual series of Baker Hostetler Guest Artists

CHICAGO CINCINNATI CLEVELAND COLUMBUS COSTA MESA DENVER HOUSTON LOS ANGELES NEW YORK ORLANDO WASHINGTON, DC

www.bakerlaw.com Š 2011 Baker & Hostetler LLP


OUR INDEPENDENCE IS YOUR PEACE OF MIND :HDUH*OHQPHGH³ZH·UHVWURQJÀQDQFLDOO\VRXQGDQGSURXGO\LQGHSHQGHQW $QGZHLQWHQGWRVWD\WKDWZD\ %HLQJ SULYDWHO\ RZQHG SODFHV XV LQ D SRVLWLRQ RI VWUHQJWK 8QOLNH SXEOLFO\ KHOG FRPSDQLHVZHDUHQRWGULYHQWRFKDVHVKRUWWHUPSURÀWV,QVWHDGLQGHSHQGHQFH JLYHVXVDVHFXUHORQJWHUPRXWORRN2XUDFKLHYHPHQWLVPHDVXUHGVROHO\E\KRZ ZHPDQDJHZHDOWKIURPRQHJHQHUDWLRQWRWKHQH[W )RXQGHG DV D WUXVW FRPSDQ\ PRUH WKDQ  \HDUV DJR ZH·YH JXLGHG IDPLOLHV IDPLO\ RIÀFHV DQG HQGRZPHQW DQG IRXQGDWLRQ FOLHQWV ZLWK WLPHWHVWHG DGYLFH DQGVRSKLVWLFDWHGLQYHVWPHQWPDQDJHPHQW7RGD\ZHKDYHELOOLRQLQDVVHWV XQGHUPDQDJHPHQWIRUFOLHQWVDFURVVWKHFRXQWU\DQGDEURDG 7RZRUNZLWKDSDUWQHUGHGLFDWHGWRLQVSLULQJWUXVW³FRPHWR*OHQPHGH

*OHQPHGH·VVHUYLFHVDUHEHVWVXLWHGIRUWKRVHZLWKPLOOLRQRUPRUHWRLQYHVW 3OHDVHFDOO/LQGD2OHMNRIRUDSHUVRQDOFRQYHUVDWLRQ __OLQGDROHMNR#JOHQPHGHFRP


B O A R D O F T R U S T E E S as of Setember 2011

T H E M U S I C AL ARTS AS SOCIATION operating The Cleveland Orchestra, Severance Hall, and Blossom Festival O F F I C E R S A ND E X E C UT I VE C O MMIT T E E Dennis W. LaBarre, President Richard J. Bogomolny, Chairman The Honorable John D. Ong, Vice President

Norma Lerner, Honorary Chair Raymond T. Sawyer, Secretary Beth E. Mooney, Treasurer

Jeanette Grasselli Brown Matthew V. Crawford Michael J. Horvitz Douglas A. Kern

Virginia M. Lindseth Alex Machaskee Nancy W. McCann John C. Morley

Larry Pollock Alfred M. Rankin, Jr. Audrey Gilbert Ratner Barbara S. Robinson

R E S I D E NT TR U S T E E S Gay Cull Addicott George N. Aronoff Dr. Ronald H. Bell Richard J. Bogomolny Charles P. Bolton Jeanette Grasselli Brown Helen Rankin Butler Scott Chaikin Paul G. Clark Owen M. Colligan Robert D. Conrad Matthew V. Crawford Alexander M. Cutler Bruce P. Dyer Terrance C. Z. Egger Hiroyuki Fujita Paul G. Greig Robert K. Gudbranson Jeffrey A. Healy Stephen H. Hoffman David J. Hooker Michael J. Horvitz Marguerite B. Humphrey

David P. Hunt Christopher Hyland James D. Ireland III Clifford J. Isroff Trevor O. Jones Jean C. Kalberer Nancy F. Keithley Douglas A. Kern John D. Koch S. Lee Kohrman Charlotte R. Kramer Dennis W. LaBarre Norma Lerner Virginia M. Lindseth Alex Machaskee Robert P. Madison Nancy W. McCann Thomas F. McKee Samuel H. Miller Beth E. Mooney John C. Morley Donald W. Morrison Meg Fulton Mueller

Gary A. Oatey Katherine T. O’Neill The Honorable John D. Ong Larry Pollock Alfred M. Rankin, Jr. Clara T. Rankin Audrey Gilbert Ratner Charles A. Ratner James S. Reid, Jr. Barbara S. Robinson Paul Rose Steven M. Ross Raymond T. Sawyer Luci Schey Neil Sethi Hewitt B. Shaw, Jr. David L. Simon Richard K. Smucker R. Thomas Stanton Thomas A. Waltermire Geraldine B. Warner Paul E. Westlake Jr. David A. Wolfort

NO N- R E S I D E NT T RUS T E E S Virginia Nord Barbato (NY) Laurel Blossom (SC) Richard C. Gridley (SC)

George Gund III (CA) Loren W. Hershey (DC) Mrs. Gilbert W. Humphrey (FL)

Herbert Kloiber (Germany) Ludwig Scharinger (Austria)

TR U S TE E S E X- O FFI C I O Iris Harvie, President, Volunteer Council of The Cleveland Orchestra Beth Schreibman Gehring, President, Women’s Committee of The Cleveland Orchestra Phyllis Knauf, State Chair, Blossom Women’s Committee TR U S TE E S E M E RI T I David A. Ruckman Naomi G. Singer

H O N O RARY T RUS T EES FOR LIFE Robert W. Gillespie Francis J. Callahan Dorothy Humel Hovorka Mrs. Webb Chamberlain Robert F. Meyerson Oliver F. Emerson Allen H. Ford

PA S T PR E S I D E NT S D. Z. Norton 1915-21 John L. Severance 1921-36 Dudley S. Blossom 1936-38 Thomas L. Sidlo 1939-53

Percy W. Brown 1953-55 Frank E. Taplin, Jr. 1955-57 Frank E. Joseph 1957-68 Alfred M. Rankin 1968-83

THE CLEVELAND ORCHESTRA Gary Hanson, Executive Director

clevelandorchestra.com

Severance Hall 2011-12

Carolyn Dessin, Chair, Cleveland Orchestra Chorus Operating Committee Dr. Lester Lefton, President, Kent State University Barbara R. Snyder, President, Case Western Reserve University

Ward Smith 1983-95 Richard J. Bogomolny 1995-2002, 2008-09 James D. Ireland III 2002-08

SEVERANCE HALL 11001 Euclid Avenue Cleveland, Ohio 44106 Telephone (216) 231-7300

Musical Arts Association

9


DECEMBER

HOLIDAY 11-23 FESTIVAL

Visit clevelandorchestra.com for full concert details.


Pediatric emergency care is right in your neighborhood. Available 24/7 at six locations. You’re now closer than ever to emergency services designed specifically for babies and children with kid-focused physicians, nurses and support staff and backed by the most trusted name in children’s health care – as well as the region’s only Level I Pediatric Trauma Center, if a higher level of care is required. All in six convenient locations with staff dedicated to getting you and your family the care you need as quickly as possible.

UH Rainbow Babies & Children’s Hospital 11100 Euclid Avenue, Cleveland UH Ahuja Medical Center 3999 Richmond Road, Beachwood UH Geauga Medical Center 13207 Ravenna Road, Chardon UH Twinsburg Health Center 8819 Commons Boulevard, Suite 101, Twinsburg St. John Medical Center 29000 Center Ridge Road, Westlake Southwest General 18697 Bagley Road, Middleburg Heights

There’s only one Rainbow. 216-UH4-KIDS (216-844-5437) | RainbowBabies.org Facebook.com/UHRainbowBabies | Twitter.com/UHRainbowBabies © 2011 University Hospitals

RBC 00438


Franz Welser-Möst Music Director Kelvin Smith Family Endowed Chair The Cleveland Orchestra

marks Franz Welser-Möst’s tenth year as Music Director of The Cleveland Orchestra, with a long-term commitment extending to the Orchestra’s centennial in 2018. Under his direction, the Orchestra is acclaimed for its continuing artistic excellence, is enlarging and enhancing its community programming at home, is presented in a series of ongoing residencies in the United States and Europe, continues its historic championship of new composers through commissions and premieres, and has re-established itself as an important operatic ensemble. Concurrently with his post in Cleveland, Mr. Welser-Möst became General Music Director of the Vienna State Opera in September 2010. With a committed focus on music education in Northeast Ohio, Franz Welser-Möst has taken The Cleveland Orchestra back into public schools with performances in collaboration with the Cleveland Metropolitan School District. The initiative continues and expands upon Mr. Welser-Möst’s active participation in community concerts and educational programs, including the Cleveland Orchestra Youth Orchestra and partnerships with music conservatories and universities across Northeast Ohio. Under Mr. Welser-Möst’s leadership, The Cleveland Orchestra has established an ongoing biennial residency in Vienna at the famed Musikverein concert hall and at the Lucerne Festival in Switzerland. Together, they have appeared in residence at Suntory Hall in Tokyo, Japan, and at the Salzburg Festival, where a 2008 residency included five sold-out performances of a staged production of Dvořák’s opera Rusalka. In the United States, Mr. Welser-Möst has established an annual multi-week Cleveland Orchestra Miami Residency in Florida and launched a new biennial residency at New York’s Lincoln Center Festival in 2011. Under Franz Welser-Möst’s direction, The Cleveland Orchestra has performed thirteen world and fifteen United States premieres. Through the Roche Commissions project, he and the Orchestra have premiered works by Harrison Birtwistle, Chen Yi, Hanspeter Kyburz, George Benjamin, and Toshio Hosokawa in partnership with the Lucerne Festival and Carnegie Hall. In addition, the Daniel R. Lewis Young Composer Fellow program has brought new voices to the repertoire, including Marc-André Dalbavie, Matthias Pintscher, Susan Botti, Julian Anderson, Johannes Maria Staud, Jörg Widmann, and Sean Shepherd. Franz Welser-Möst has led opera performances each season during his P H OTO BY D O N S N Y D E R

T H E 2 01 1 - 1 2 S E A S O N

Severance Hall 2011-12

Music Director

13


P H OTO BY R O G E R MA S T R O I A N N I

tenure in Cleveland, re-establishing the Orchestra as an important operatic ensemble. Following six opera-in-concert presentations, he brought fully staged opera back to Severance Hall with a three-season cycle of Zurich Opera productions of the Mozart-Da Ponte operas. He leads concert performances of Strauss’s Salome at Severance Hall and at Carnegie Hall during the 2011-12 season. Franz Welser-Möst became General Music Director of the Vienna State Opera with the 2010-11 season. His long partnership with the company has included acclaimed performances of Tristan and Isolde, a new production of Wagner’s Ring cycle with stage director Sven-Eric Bechtolf, and, in his first season in the post, critically praised new productions of Hindemith’s Cardillac and Janáček’s Katya Kabanova. During the 2011-12 season, he continues his survey of the operas of Janáček with a new production of From the House of the Dead and also leads a new production of Verdi’s Don Carlo. Mr. Welser-Möst also maintains an ongoing relationship with the Vienna Philharmonic. Recent performances with the Philharmonic include appearances at the Lucerne Festival and Salzburg Festival, in Tokyo, and in concert at La Scala Milan, as well as leading the Philharmonic’s 2011 New Year’s Day concert, viewed by telecast in seventy countries worldwide. Across a decade-long tenure with the Zurich Opera, culminating in three seasons as General Music Director (2005-08), Mr. Welser-Möst led the company in more than 40 new productions and numerous revivals. Franz Welser-Möst’s recordings and videos have won major awards, including the Gramophone Award, Diapason d’Or, Japanese Record Academy Award, and two Grammy nominations. With The Cleveland Orchestra, he has created DVD recordings of live performances of four Bruckner symphonies, presented in three accoustically distinctive venues: Symphony No. 5 in the Abbey of St. Florian in Austria, Symphony No. 9 in Vienna’s Musikverein, and Symphonies Nos. 7 and 8 at Severance Hall. With Cleveland, he has also released a recording of Beethoven’s Ninth Symphony as well as an all-Wagner album featuring soprano Measha Brueggergosman. DVD releases on the EMI label have included Mr. Welser-Möst leading Zurich Opera productions of The Marriage of Figaro, Così fan tutte, Don Giovanni, Der Rosenkavalier, La Bohème, Fierrabras, and Peter Grimes. For his talents and dedication, Mr. Welser-Möst has received honors that include recognition from the Western Law Center for Disability Rights, honorary membership in the Vienna Singverein, appointment as an Academician of the European Academy of Yuste, a Gold Medal from the Upper Austrian government for his work as a cultural ambassador, and the Kilenyi Medal from the Bruckner Society of America. He is the co-author of Cadences: Observations and Conversations, published in a German edition in 2007.

14

Music Director

The Cleveland Orchestra


EVS\WbQ][Sab]bVSTcbc`S]T g]c`TO[WZgยนaeSOZbV g]c`dWaW]\Wa]c`W\a^W`ObW]\ :SbยนabOZYOP]cbg]c`ZSUOQg /b4W`ab4O[WZgeSc\RS`abO\RbVSRSZWQObSQ][^ZSfWbWSaW\d]ZdSReWbV[O\OUW\UeSOZbV7bยนaeVg eSยน`SRSRWQObSRb]ZWabS\W\UO\RZSO`\W\UOa[cQVOP]cbg]c`dWaW]\Oa^]aaWPZSPST]`S]TTS`W\U ]c`^S`a]\OZWhSR]PXSQbWdSORdWQSAS`dW\UOag]c`TO[WZg14=eSยน`S^`S^O`SRb]OQbW\g]c` TO[WZgยนaPSabW\bS`SabObOZZbW[SaยตQOZZW\Uc^]\OeWRS`O\US]TQcab][aS`dWQSaO\RQ]]`RW\ObW\U Q][[c\WQObW]\aO\Rab`ObSUWSaPSbeSS\g]c`ORdWa]`a/ZZeVWZSYSS^W\UW\[W\RbVObbVS[]ab dOZcOPZSOaaSbW\[O\OUW\Ug]c`TO[WZgยนaeSOZbVWag]c`dWaW]\T]`WbaTcbc`S 4]`O^`WdObSQ]\acZbObW]\Q]\bOQb2]cUZOa4`WSa;O\OUW\U2W`SQb]`Ob $'% ''#

2 = C 5 : / A  1   4 @ 7 3 A       ; / < / 5 7 < 5  2 7 @ 3 1 B = @        $  ' %   ' ' # / 9 @ = <      1 / < B = <      1 6 7 1 / 5 =      1 : 3 D 3 : / < 2      1 = : C ; 0 C A

4W`ab4O[WZgWaO^`OQbWQSO`SO]T4W`ab;S`Wb0O\Y</


Itâ&#x20AC;&#x2122;s time to start building towards an economic crescendo.

Like a world-class orchestra, business in Cleveland works best when itâ&#x20AC;&#x2122;s well conducted. And with its convenient proximity to downtown, Burke Lakefront Airport is a vital destination for the corporations, executives, and health care systems that are growing their business here. Which should be music to all of our ears. www.burkeairport.com


1112 clevelandorchestra.com

THE CLEVELAND ORCHESTRA

Franz Welser-Möst MUSIC DIREC TOR Kelvin Smith Family Chair

Christoph von Dohnányi MUSIC DIRECTOR LAUREATE

Giancarlo Guerrero PRINCIPAL GUEST CONDUCTOR THE CLEVELAND ORCHESTRA MIAMI RESIDENCY

James Feddeck ASSISTANT CONDUCTOR Elizabeth Ring and William Gwinn Mather Chair

MUSIC DIRECTOR, CLEVELAND ORCHESTRA YOUTH ORCHESTRA

Sasha Mäkilä ASSISTANT CONDUCTOR Sidney and Doris Dworkin Chair

Robert Porco DIRECTOR OF CHORUSES Frances P. and Chester C. Bolton Chair

Lisa Wong P H OTO BY R O G E R MA S T R O I A N N I

ASSISTANT DIRECTOR OF CHORUSES

Ann Usher DIRECTOR, CLEVELAND ORCHESTRA CHILDREN’S CHORUS

Frank Bianchi DIRECTOR, CLEVELAND ORCHESTRA YOUTH CHORUS

Lisa Manning ASSISTANT DIRECTOR, CLEVELAND ORCHESTRA YOUTH CHORUS


T H E

C L E V E L A N D

FRANZ WELSER-MÖST M U S I C D I R E C TO R Kelvin Smith Family Chair

FIRST VIOLINS William Preucil CONCERTMASTER

Blossom-Lee Chair

Yoko Moore

ASSISTANT CONCERTMASTER

Clara G. and George P. Bickford Chair

Peter Otto

FIRST ASSOCIATE CONCERTMASTER

Jung-Min Amy Lee

ASSOCIATE CONCERTMASTER

Gretchen D. and Ward Smith Chair

Lev Polyakin

ASSISTANT CONCERTMASTER

Dr. Jeanette Grasselli Brown and Dr. Glenn R. Brown Chair

Takako Masame Paul and Lucille Jones Chair

Wei-Fang Gu Drs. Paul M. and Renate H. Duchesneau Chair

Kim Gomez Elizabeth and Leslie Kondorossy Chair

Chul-In Park Harriet T. and David L. Simon Chair

Miho Hashizume Theodore Rautenberg Chair

Jeanne Preucil Rose Dr. Larry J.B. and Barbara S. Robinson Chair

Alicia Koelz Oswald and Phyllis Lerner Gilroy Chair

Yu Yuan Patty and John Collinson Chair

Isabel Trautwein Trevor and Jennie Jones Chair

Mark Dumm Gladys B. Goetz Chair

Alexandra Preucil Katherine Bormann Ying Fu

SECOND VIOLINS Stephen Rose * Alfred M. and Clara T. Rankin Chair

Emilio Llinas

2

James and Donna Reid Chair

Eli Matthews

1

Patricia M. Kozerefski and Richard J. Bogomolny Chair

Elayna Duitman Ioana Missits Carolyn Gadiel Warner Stephen Warner Sae Shiragami Vladimir Deninzon Sonja Braaten Molloy Scott Weber Kathleen Collins Beth Woodside Emma Shook Jeffrey Zehngut VIOLAS Robert Vernon * Chaillé H. and Richard B. Tullis Chair

Lynne Ramsey 1 Charles M. and Janet G. Kimball Chair

Stanley Konopka 2 Mark Jackobs Jean Wall Bennett Chair

Arthur Klima Richard Waugh Lisa Boyko Lembi Veskimets Eliesha Nelson Joanna Patterson Zakany Patrick Connolly

CELLOS Mark Kosower* Louis D. Beaumont Chair

Richard Weiss 1 The GAR Foundation Chair

Charles Bernard 2 Helen Weil Ross Chair

Bryan Dumm Muriel and Noah Butkin Chair

Tanya Ell Ralph Curry Brian Thornton David Alan Harrell Paul Kushious Martha Baldwin Thomas Mansbacher BASSES Maximilian Dimoff * Clarence T. Reinberger Chair

Kevin Switalski 2 Scott Haigh 1 Mary E. and F. Joseph Callahan Chair

Mark Atherton Thomas Sperl Henry Peyrebrune Charles Barr Memorial Chair

Charles Carleton Scott Dixon HARP Trina Struble * Alice Chalifoux Chair

FLUTES Joshua Smith * Elizabeth M. and William C. Treuhaft Chair

Saeran St. Christopher Marisela Sager 2 Austin B. and Ellen W. Chinn Chair

Mary Kay Fink

18

The Orchestra

The Cleveland Orchestra


1112 clevelandorchestra.com

O R C H E S T R A

PICCOLO Mary Kay Fink Anne M. and M. Roger Clapp Chair

HORNS Richard King *

TIMPANI Paul Yancich *

George Szell Memorial Chair

Michael Mayhew §

Otto G. and Corinne T. Voss Chair

Tom Freer 2

Knight Foundation Chair

OBOES Frank Rosenwein * Edith S. Taplin Chair

Jeffrey Rathbun 2 Everett D. and Eugenia S. McCurdy Chair

Robert Walters ENGLISH HORN Robert Walters Samuel C. and Bernette K. Jaffe Chair

CLARINETS Franklin Cohen * Robert Marcellus Chair

Robert Woolfrey Daniel McKelway 2 Robert R. and Vilma L. Kohn Chair

Linnea Nereim E-FLAT CLARINET Daniel McKelway Stanley L. and Eloise M. Morgan Chair

Jesse McCormick Hans Clebsch Richard Solis Alan DeMattia TRUMPETS Michael Sachs * Robert and Eunice Podis Weiskopf Chair

Jack Sutte Lyle Steelman2 James P. and Dolores D. Storer Chair

CORNETS Michael Sachs * Mary Elizabeth and G. Robert Klein Chair

Michael Miller TROMBONES Massimo La Rosa* Gilbert W. and Louise I. Humphrey Chair

Richard Stout

BASSOONS John Clouser *

Shachar Israel 2

Louise Harkness Ingalls Chair Sandra L. Haslinger Chair

Jonathan Sherwin CONTRABASSOON Jonathan Sherwin

Margaret Allen Ireland Chair

Donald Miller Tom Freer Marc Damoulakis KEYBOARD INSTRUMENTS Joela Jones * Rudolf Serkin Chair

Carolyn Gadiel Warner Marjory and Marc L. Swartzbaugh Chair

Michael Miller

BASS CLARINET Linnea Nereim

Barrick Stees 2

PERCUSSION Jacob Nissly *

Alexander and Marianna C. McAfee Chair

BASS TROMBONE Thomas Klaber EUPHONIUM AND BASS TRUMPET Richard Stout TUBA Yasuhito Sugiyama*

LIBRARIANS Robert O’Brien Donald Miller ORCHESTRA PERSONNEL Carol Lee Iott DIRECTOR

Rebecca Vineyard MANAGER

ENDOWED CHAIRS CURRENTLY UNOCCUPIED ASSISTANT PRINCIPAL HARP

Sunshine Chair

* Principal § 1 2

Associate Principal First Assistant Principal Assistant Principal

Nathalie C. Spence and Nathalie S. Boswell Chair

Severance Hall 2011-12

The Orchestra

19


Hold the hand of this generation and the next Doing the Most Good

4.4% - 9.8%

Charitable Gift Annuities Call

1-866-364-6446


Perspectivesfrom the Executive Director “A pure-bred elegance is transmitted to all sections; the brilliance of the winds is inspired by the transparency of the strings, though their sound is never overpowering. Are American orchestras too flashy, too thundering? Cleveland is the dream antidote to this persistent cliché. Here is the most refined of orchestras, where the supernatural cohesion of the attacks never turns into a power show by an advancing army.” —Le Figaro, October 28, 2011 Conquering musical Europe isn’t easy for an American orchestra. But once again our own Cleveland musicians under Franz’s direction came home last weekend triumphant from a demanding concert tour in some of the most competitive music centers anywhere, including Madrid, Paris, and Vienna. Winning the championship, in music no different than in sports, and doing so year after year, takes talent, dedication, and hard work. It also takes practice. Over the course of a three-week roadtrip, within a packed schedule of rehearsals, concerts and travel, Cleveland’s musicians stole time to practice scales, arpeggios, and etudes so that with the downbeat of each evening’s performance their collective artistry was at its peak. It’s an extraordinary aural experience to walk down the hotel hallway on the afternoon of a concert. The space is alive with music emanating from behind the doors to the rooms. Disconnected musical phrases rise and fall as you pass by. A tricky viola passage gives way to a clarinet melody, followed by a set of challenging, high register doublestops from a cello. Members of the Orchestra also found time on tour to share their talents with others outside the concert hall. Musicians taught masterclasses in Lisbon, Granada, Valencia, and Venice among other cities, and also came together to perform chamber music for generous sponsors. This hard work and dedication on tour is no less than what these musicians do here at home. Cleveland Orchestra players have a tradition of giving back to the community and to the institution wherever they are. Musicians generously organize and support fundraisers for a variety of worthy causes. They support the United Way annually, and when called upon, they organize benefit concerts in response to natural disasters, as they did for recent earthquake victims in Haiti and Japan. They teach students of all levels in Northeast Ohio, serve as volunteer leaders in non-profits, and contribute to charities of all kinds. There is even a group of ace orthographers who are renowned as winners of the annual spelling bee fundraiser that supports the Cleveland Heights-University Heights public schools. Franz and I, together with our Trustee leaders, admire and appreciate all the time and effort that the members of The Cleveland Orchestra devote to their art form and to the many important needs of the community. And I know that the musicians join with us in thanking you for your generous support of The Cleveland Orchestra.

Severance Hall 2011-12

Gary Hanson

21


THE CLEVELAND ORCHES-

News

OrchestraNews Franz Welser-Möst and Orchestra receive accolades throughout European Tour and Vienna Residency

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

THE CLEVELAND ORCHESTRA

Music Director Franz Welser-Möst and The Cleveland Orchestra returned home on November 6 from their eleventh international tour together, including the Orchestra’s fifth biennial residency at Vienna’s historic Musikverein concert hall. Throughout the tour, press reviews — excerpted on these pages — extended praise and accolades to the Orchestra for its precision and musicality. In addition to the Vienna Musikverein Residency, the tour featured two concerts in Madrid, Paris, and Luxembourg, and single concerts in Valencia, Cologne, and Linz. During the four-concert Musikverein Residency, the Orchestra gave two performances of Mozart’s “Great” Mass in C minor, featuring soprano Malin Hartelius, soprano Juliane Banse, tenor Martin Mitterrutzner, baritone Ruben Drole, and the Vienna Singverein. Cellist Truls Mørk was soloist with the Orchestra in Luxembourg. The thirteen-concert, seven-city tour began with performances in Madrid, Spain, on October 20 and 21 and ended in Vienna on November 5. Tour sponsors included Raiffeisenlandesbank Oberösterreich, Tele München Group, Jones Day, LNE Group / Lee Weingart, Miba AG, and SEMAG GmbH, with additional support from a group of generous individuals. “And in fact, the music sounded fabulous — with the weapons that Welser-Möst handles so scrupulously: precision, rhythmic control, a certain highly effective minimalism. All that, plus the assurance of having an orchestra like Cleveland at his command: compact, secure, even luminous.” —El Pais, October 22, 2011 “Welser-Möst was restrained in Mendelssohn, dominating in Stravinsky, and brilliant in Ravel. His gestures are sober, his movements a bit mechanical; his image ranges from timid to robot-like, from subtle to introverted. The analytic part takes precedence over the expressive. The artistic results are overwhelmingly effective. It is the art of perfection, pure and simple. No excessive emphases, no special effects, none of those ‘strokes of genius’ that are so often arbitrary. He even smiled in the Ravel, completely won over by the work’s rhythmic and timbral richness. All sections of the orchestra responded homogeneously and with great class.” —El Pais, October 22, 2011 “We were immediately won over by the agility of the strings, the warmly streaming sound of the woodwind, the unshakable security of the brass. The true miracle, then, occurred in the two major works on the program, Tchaikovsky’s Fourth Symphony and, before intermission, the Doctor Atomic Symphony by John Adams.” —KlassikInfo.de, October 30, 2011

22

Cleveland Orchestra News

The Cleveland Orchestra


HE CLEVELAND ORCHESTRA HESTR

News

THE CLEVELAND ORCHESTRA

“Franz Welser-Möst navigated his orchestra, which cannot be called anything but fantastic, with a secure sense of control and great restraint. At no time did he give in to sensationalism in this music, which is so rich in contrasts between pandemonic eruptions and soothing major-mode consonance. Some members of the orchestra distinguished themselves with impressive solos; above all, trumpeter Michael Sachs knocked our socks off with his sovereign technique.” —KlassikInfo.de, October 30, 2011 “In concerts Tuesday and Wednesday at Salle Pleyel, an historic hall near L’Arc de Triomphe, the orchestra and music director Franz Welser-Möst more than proved themselves worthy of a long-term presence here, dazzling two nearly sold-out crowds and leaving audiences eager for more. Both nights, in fact, they were regaled with multiple rounds of synchronized clapping.”

THE CLEVELAND ORCHESTRA

—Zachary Lewis, The Plain Dealer, October 27, 2011 “This pure-bred elegance is transmitted to all sections; the brilliance of the winds is inspired by the transparencey of the strings, though their sound is never overpowering. Are American orchestras too flashy, too thundering? Cleveland is the dream antidote to this persistent cliché. Here is the most refined of orchestras, where the supernatural cohesion of the attacks never turns into a power show by an advancing army.” —Le Figaro, October 28, 2011 “The triumph of the evening, marked by a prolonged acclaim, was due to Mozart’s great C-minor Mass (K. 427). Here Welser-Möst gradually unveiled an overall plan that was as comprehensive as it was successful, dashing and radiant, expressive and stylish.” —Vienna Kurier, November 2, 2011

—Die Presse, November 1, 2011

Severance Hall 2011-12

Cleveland Orchestra News

23

THE CLEVELAND OR-

“Yet for all the technical craftsmanship, one can also bring out the eloquence of this music, if one lets true emotions resonate. Franz Welser-Möst has succeeded in doing just that, since he has the finest string playing to build upon and is thus able to turn a breathtakingly beautiful study in sound into a moving, expressive musical statement without forcing the interpretation in the least.”


THE CLEVELAND ORCHES-

News

OrchestraNews

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

THE CLEVELAND ORCHESTRA

New Cleveland Orchestra recording features live performance of “Rusalka” from Salzburg Festival The Cleveland Orchestra’s newest recording is a live audio recording of Dvořák’s opera Rusalka, performed under Franz Welser-Möst’s direction as part of the 2008 Salzburg Festival. The album on the Orfeo label was released at the end of September and New! comes in CD format or as a music download. The August 2008 performances of Rusalka marked the first time that The Cleveland Orchestra played from the orchestra pit for an opera production at the Salzburg Festival. The five sold-out Rusalka performances were part of a Festival Residency that also included Welser-Möst conducting the Orchestra in three different concert programs. Prior to the staged Salzburg performances, Welser-Möst and the Orchestra presented in-concert performances of Rusalka in Cleveland.

Free tickets to Martin Luther King Jr. Celebration Concert go on sale January 3 On Sunday, January 15, The Cleveland Orchestra performs its 32nd annual concert celebrating the spirit of Dr. King’s life, leadership, and vision in music, song, and community recognition. Admission to the concert is free, but tickets are required. Tickets will be available on a first-come, first-served basis beginning Tuesday, January 3, through the Severance Hall Ticket Office in person, by phone, or online at clevelandorchestra.com. There is a limit of 2 tickets per person. Due to high demand, all tickets are usually distributed by 4 p.m. on the day they are made available.

24

Cleveland Orchestra and partner Conn-Selmer provide violins to El Sistema@Rainey Thirty very excited students received brand-new violins at a special event in October as part of the inaugural year of El Sistema@Rainey, a comprehensive afterschool orchestral music program launched by the Rainey Institute and Cleveland Orchestra violinist Isabel Trautwein with the 2011-12 school year. The Cleveland Orchestra with its partner Conn-Selmer are the official providers of Scherl & Roth violins for the El Sistema@Rainey program. In its first year, El Sistema@ Rainey is providing ten hours of weekly group violin instruction and educational support to 30 children in Cleveland in grades 1-4, with plans to expand to more students in future years. Young musicians will also have opportunities to perform onstage at Severance Hall and participate in masterclasses with Cleveland Orchestra musicians. Isabel Trautwein, who serves as the artistic director of El Sistema@Rainey, was granted a year-long leave of absence from The Cleveland Orchestra last season to participate in a formal training program to study the methods of El Sistema (“the system”) in Venezuela and Boston, with the goal of building an El Sistema “nucleo” in Cleveland. El Sistema was founded more than 35 years ago in Venezuela by economist, musician, and social reformer Dr. José Antonio Abreu. Today, the program serves more than 350,000 children through neighborhood-based daily music instruction. El Sistema@Rainey joins El Sistema programs worldwide, including those based in Atlanta, Baltimore, Boston, Chicago, Los Angeles, and Philadelphia.

Cleveland Orchestra News

The Cleveland Orchestra


HE CLEVELAND ORCHESTRA HESTR

News

OrchestraNews

$5 million gift from Alexander and Sarah Cutler announced, to subsidize student attendance for Orchestra concerts at Severance Hall

P H OTO G R A P H BY R O G E R M A S T R O I A N N I

Alexander and Sarah Cutler at Severance Hall for the pre-concert announcement of their gift. audiences is a critical element in that evolution. The opportunity to attend the performances of a truly world-class orchestra right here in our own community has meant a great deal to us and we are hopeful that our gift will enhance the opportunity of students to have this same experience.” 8,000 students attended concerts last year at Severance Hall, making up an average of 8% of the current audience. With full subsidy, student attendance should increase to 15% by the Orchestra’s centennial in 2018. Among programs serving student audiences are: an annual student weekend that launched in November with deeply discounted tickets available in advance, and a new Student Ambassadors program that engages college students to invite their friends and peers. The current Student Advantage Program attendance will be increased through enhanced partnerships with colleges and universities.

THE CLEVELAND ORCHESTRA

O R C H E S T R A

CENTER FOR FUTURE AUDIENCES Endowed by the Maltz Family Foundation

Severance Hall 2011-12

Cleveland Orchestra News

25

THE CLEVELAND OR-

T H E C L E V E L A N D

THE CLEVELAND ORCHESTRA

On Saturday night, November 12, Cleveland Orchestra Executive Director Gary Hanson announced a pledge to The Cleveland Orchestra’s Endowment Fund of $5 million from Alexander and Sarah Cutler. The Alexander and Sarah Cutler Fund for Student Audiences will support existing and new programs that encourage and facilitate student attendance in perpetuity to Cleveland Orchestra concerts in Severance Hall. The Cutlers’ gift is another step toward fully funding the Orchestra’s Center for Future Audiences at $60 million, increasing the current total to $25 million. The Center, endowed by the Maltz Family Foundation, is a multi-faceted and long-term audience development initiative announced in 2010 with a lead gift from the Foundation. The Center aims to increase audiences, including more young people, each season. The Center is taking the Orchestra in a new strategic direction where the primary goal is to create broader access for the Northeast Ohio community. In announcing the gift, Hanson said, “We are grateful to Sandy and Sally for their extraordinary philanthropy and their belief in the future of The Cleveland Orchestra. This generous gift is an endorsement of our mission to transform the institution and our audience. We are committed to becoming an even more relevant and responsive community resource for Northeast Ohio.” Alexander Cutler has been an Orchestra Trustee since 2000. “Sally and I are honored to help the Orchestra evolve,” he said. “Outreach to younger


News

Joshua Smith featured in new recording from Marlboro Music

1.9.12

12.12.11

Town Hall Speaker Series

CAPITOL STEPS “The Lighter Side of Politics”

AARON DAVID MILLER

2.6.12

“ Gulliver’s Troubles: How America Will Fare in a Changing Middle East”

LARRY ELDER

2.27.12

“American Exceptionalism: Is America Still a Land of Opportunity”

ERSKINE B. BOWLES “Practical Implications of the Debt Ceiling Level”

Tickets are $45 each. Ohio Theatre 6:00 PM

Call for tickets at

216.241.1919 or order online at www.townhallofcleveland.org

Academic Sponsor

26

A new album in a series of recordings titled “Live from the Marlboro Music Festival” features Cleveland Orchestra principal flute Joshua Smith. Among three albums of live performances released this year in conjunction with ArchivMusic to celebrate Marlboro’s 60th anniversary, the recording includes Smith’s performance in Ravel’s Introduction et Allegro from the 2010 festival in Vermont. Also on the album are the string quartets of Ravel and Debussy. The performances chosen for the three albums were selected by Marlboro artistic directors Mitsuko Uchida and Richard Goode.

Orchestra violist has new CD release Following the success of her Grammy award-winning last album, Cleveland Orchestra violist Eliesha Nelson has a new album titled Russian Viola Sonatas, featuring the music of Varvara Gaigerova, Alexander Winkler, and Paul Juon and released this past July on the Sono Luminus label. The CD is available for purchase at the Cleveland Orchestra Store at Severance Hall.

Committed to Accessibility Severance Hall is committed to making performances and facilities accessible to all patrons. For information about accessibility or for assistance, call the House Manager at (216) 231-7425.

Cleveland Orchestra News

The Cleveland Orchestra


THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA TRA THE CLEVELAND ORCHESTRA

News

OrchestraNews

Women’s Committee continues a holiday tradition with Silver Bells raising money for The Cleveland Orchestra

The Cleveland Orchestra’s season of Celebrity Series concerts was announced over the summer and is now on sale as series subscriptions or on an individual concert basis. The Celebrity Series features the Orchestra and guest artists performing popular, film, and jazz music. The season’s four programs are: Singer-songwriter Randy Newman (December 3), known for his scores for such films as Toy Story and hit singles such as “Short People,” performs with The Cleveland Orchestra. The Colors of Christmas (December 20), featuring vocalists Peabo Bryson, Jennifer Holliday, Lea Salonga, and Ben Vereen performing Christmas and holiday favorites with the Orchestra. Charlie Chaplin’s City Lights (March 31), a timeless romantic comedy, shown on a large screen with the film score performed live by The Cleveland Orchestra, with guest conductor William Eddins. John Pizzarelli (April 10), jazz guitarist and vocalist, joins the Orchestra to pay tribute to Nat “King” Cole with favorites from the Great American Songbook.

Silver Bells and The Cleveland Orchestra have gone hand in hand for more than four decades, and they’re ringing in another year. Reed & Barton silver bells inscribed with “Christmas 2011” are being sold to benefit Community and Education programs of The Cleveland Orchestra. A project of the Women’s Committee of The Cleveland Orchestra, the Silver Bells sale is also a labor of love for Beth Schreibman Gehring, president of the Women’s Committee, whose parents began selling the bells to benefit the Orchestra more than 40 years ago. Silver-plated Reed & Barton bells to benefit the Orchestra cost $20. The bells can be purchased from the Cleveland Orchestra Store and from several local gift shops. In addition, Women’s Committee members will be selling the bells in the lobbies of Severance Hall at many Cleveland Orchestra concerts throughout November and December.

3099 MAYFIELD ROAD CLEVEL AND HEIGHTS, OH 216 | 321.0477

tuesday through saturday 4pm to 1am Severance Hall 2011-12

Cleveland Orchestra News

27

THE CLEVELAND ORC

restaurant+ lounge

THE CLEVELAND ORCHESTRA

2011-12 Celebrity Series on sale now — featuring variety of artists with The Cleveland Orchestra


THE CLEVELAND ORCH

News

OrchestraNews Read and watch more Cleveland Orchestra news online . . .

THE CLEVELAND ORCHESTRA

Looking for the latest news about The Cleveland Orchestra? Or behind-thescenes information about an upcoming artist or event? Photographs from a recent event? Learn more online on the Orchestra’s facebook page or at clevelandorchestrablog.com. Check out recent postings to: — Listen to pianist Jonathan Biss in audio clips and videos; — View photos and read reports from the Orchestra’s recent European Tour and Vienna Residency; — Visit the Cleveland School of the Arts via photos from The Cleveland Orchestra’s recent school concert there; — Watch a video of Randy Newman, who came to Severance on December 3 to

28

perform with The Cleveland Orchestra; — Read about former members of the Cleveland Orchestra Youth Orchestra and how this youth ensemble helped shape their life and values; Read all this and more at our Blog. You can post your own comments, too. Or visit the Orchestra on Facebook, follow us on Twitter, and watch us on YouTube!

The Cleveland Orchestra Blog

Cleveland Orchestra News

The Cleveland Orchestra


OrchestraNews

IN THE SCHOOLS

P H OTO G R A P H BY R O G E R M A S T R O I A N N I

Cleveland Orchestra Chorus offers special thanks with new Christmas CD

Music and the holidays are a perfect match. The Cleveland Orchestra Store offers a host of musical performances this holiday season, including the Orchestra’s latest DVDs and CDs, as well as releases by Orchestra musicians. Music boxes and music-themed holiday ornaments, stationery, books, stuffed toys and musical gifts for children of all ages, fashion scarves, jewelry, and Cleveland Orchestra logo apparel are also on sale at the Store. In addition, Cleveland Orchestra Gift Certificates and Blossom Lawn Ticket Books for the Orchestra’s 2012 Blossom Festival are available at the Severance Hall Ticket Office by calling 216-231-1111 or 800686-1141, or at clevelandorchestra.com.

Cleveland Orchestra News

29

THE CLEVELAND OR-

Severance Hall 2011-12

THE CLEVELAND ORCHESTRA

The Cleveland Orchestra Chorus has a brand-new Christmas album — available only to donors contributing a new gift of $25 or more to the Chorus Fund. Titled Spirit of the Season, the CD features selections from recent Christmas Concerts with the Chorus and The Cleveland Orchestra under the direction of Robert Porco. This new album is one in a long line of special Christmas CDs produced to help raise money for the Chorus’s touring and educational activities. The private label CD is not available for purchase, but is offered as a special thank-you gift for donations of $25 or more. Donations can be made at any of this season’s Cleveland Orchestra Christmas Concerts at Severance Hall, or by calling the Chorus Office at 216-231-7374.

Cleveland Orchestra offers gift ideas for the holidays, including new recordings, gift certificates, and more . . .

THE CLEVELAND ORCHESTRA

The Cleveland Orchestra has performed concerts in two area high schools this season. Franz Welser-Möst led the Orchestra in a presentation at Saint Ignatius High School (left) that featured John Adams’s “Doctor Atomic Symphony” on October 14, and Sasha Mäkilä led a performance at the Cleveland School of the Arts titled “American Journey” on November 16. These performances marked the Orchestra’s third season of Cleveland Orchestra concerts in high schools, launched in 2009 by Welser-Möst.

HE CLEVELAND ORCHESTRA HESTR

News


THE CLEVELAND ORCHES-

News

OrchestraNews

THE CLEVELAND ORCHESTRA

P H OTO G R A P H BY R O G E R M A S T R O I A N N I

Cleveland Orchestra now available as an app for mobile phones

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

Franz Welser-Möst given “Key to the City” by Cleveland Mayor at Opening Night Gala The Cleveland Orchestra’s Opening Night Gala at Severance Hall on October 1 featured a special surprise moment for Franz Welser-Möst, when Cleveland Mayor Frank Jackson presented the Orchestra’s conductor with a ceremonial “key to the city” (above). The award was given to recognize the value of Franz’s work in extending and enhancing Cleveland’s reputation internationally. The gala evening, presented under the leadership of gala chair Norma Lerner and gala corporate chair Beth Mooney, marked the official start of Franz WelserMöst’s tenth season as music director. The event, which included an hour-long concert by The Cleveland Orchestra, raised $650,000. Proceeds from the evening will be used to create an education fund in Franz’s name, honoring his initiatives on behalf of music education. Of Ravel’s Boléro from the evening’s concert, The Plain Dealer wrote: “Proving he holds the key to Ravel as well as Cleveland, Welser-Möst offered a hardhitting performance, one that began with near-silent tapping . . . and ended with a cataclysmic punch.”

30

The Cleveland Orchestra’s website is now available in a streamlined format as an application for cell phones. The “app” can be downloaded in versions for iPhone or Android phones, and many of its features also display on other webready mobile phones. The new app offers fans a convenient and streamlined way to purchase tickets, listen to Cleveland Orchestra radio broadcasts, and connect to the Orchestra’s social media. Created in partnership with InstantEncore.com, a leading performing arts digital platform, the app connects fans to The Cleveland Orchestra Blog, Facebook, YouTube, and information about the Orchestra (including musicians’ photos and biographies) and venues. The app also allows on-demand, streaming broadcasts from WCLV of performances by The Cleveland Orchestra and Cleveland Orchestra Youth Orchestra. This latest tech innovation is an addition to the Orchestra’s ongoing social media platforms and website, including The Cleveland Orchestra Blog (viewed by readers in all 50 states and more than 100 countries), Facebook, Twitter, Flickr, and YouTube. The Cleveland Orchestra’s website offers convenient online seat selection and print-at-home ticketing. Additional features to the mobile app will be added in the coming months. The app can be downloaded free from the iTunes Stores or Android Marketplace. Links for downloading can also be found on the Orchestra’s homepage.

Cleveland Orchestra News

The Cleveland Orchestra


Sfmfbtf!Zpvs!Joofs!Dsjujd!gps!b!Dibodf!bu!%2-111

bu!uif!Pcfsmjo!Dpotfswbupsz!pg!Nvtjd

Jobvhvsbm!Tfbtpo!Kbovbsz!29!.!33-!3123!!! B!hspvoe.csfbljoh!tfsjft!pg!qvcmjd!fwfout!gpdvtjoh!! po!qfsgpsnbodf!boe!qfsgpsnbodf!dsjujdjtn/ Dpodfsut!cz!Uif!Dmfwfmboe!Psdiftusb-!! qjbojtu!Kfsfnz!Efol-!BqpmmpÖt!Gjsf-!boe!JDF Lfzopuft!boe!ejtdvttjpot!cz!mfbejoh!dsjujdt!Bmfy!Sptt-! Ujn!Qbhf-!Boof!Njehfuuf-!boe!Ifjej!Xbmftpo

%21-111!Svcjo!Qsj{f! bxbsefe!up!bo!Jotujuvuf!! Tuvefou!Gfmmpx!gps!! dpoujovfe!tuvez!jo!! nvtjd!dsjujdjtn %2-111!Bvejfodf!Bxbse!! gps!uif!ßoftu!sfwjfx!pg!! bo!Jotujuvuf!dpodfsu!cz!! bo!bvejfodf!nfncfs 2.911.482.1289!ps!! xxx/pcfsmjo/fev0! svcjojotujuvuf/! Tvctdsjqujpo!qbdlbhft!! bsf!bwbjmbcmf/

Uif!Svcjo!Jotujuvuf!gps!Nvtjd!Dsjujdjtn!jt!nbef!qpttjcmf!cz!uif!hfofsptjuz!pg!!Tufqifo!Svcjo-!Qsftjefou!boe!Qvcmjtifs!pg!Ifosz!Ipmu!'!Dp/

Severance Hall 2011-12

31


Conservatory of Music Excellence ...from Bach to Broadway

Dramatic renovation with new construction has nearly doubled the space of the Baldwin-Wallace College Conservatory of Music, making it a world-class facility for students, faculty and the community.

Q

Full NASM accreditation with 320 undergraduate music majors

AUDITION DATES for Fall 2012

Q BM and BME degrees: performance, music therapy, composition,

Instrumental Saturday, February 11 Saturday, February 25

Q First collegiate Bach Festival in the nation (Celebrating its 80th year

Instrumentalists only may submit a recorded audition: digitalaudition.bw.edu

Music Theatre January 20 and 21 February 3 and 4 February 24 and 25 Special off-campus, January 14, Interlochen

Voice Saturday, January 21 Saturday, February 4 Saturday, February 25 All music majors should apply to Baldwin-Wallace and the Conservatory by January 1, 2012. www.bw.edu/apply

theory, history and literature, music theatre, education, arts management, jazz emphasis April 13-15, 2012!) Q

Conservatory of Music set within a beautiful liberal arts campus near Cleveland, Ohio

Specialized B-W Conservatory faculty, including these members of The Cleveland Orchestra (pictured left to right in front of Severance Hall): Yasuhito Sugiyama, tuba; Jesse McCormick, horn; Dan McKelway, clarinet; Jeffrey Rathbun, oboe; Jonathan Sherwin, bassoon; Jack Sutte, trumpet; Henry Peyrebrune, double bass. Baldwin-Wallace College Conservatory of Music XXXCXFEVDPOTFSWBUPSZtNVTJD!CXFEVt#8.64*$ Baldwin-Wallace College does not discriminate on the basis of race, creed, age, disability, national origin, gender or sexual orientation in the administration of any policies or programs.


1112

LEARNING MORE ABOUT THE MUSIC

clevelandorchestra.com

Concert Previews The Cleveland Orchestra offers a variety of options for learning more about the music before each concert begins. For each concert, the program book includes program notes commenting on and providing background about the composer and his or her work being performed that week, along with biographies of the guest artists and other information. You can read these before the concert, at intermission, or afterward. (Program notes are also posted ahead of time online at clevelandorchestra.com, usually by the Monday directly preceding the concert.) The Orchestra’s Music Study Groups also provide a way of exploring the music in more depth. These classes, professionally led by Dr. Rose Breckenridge, meet weekly in locations around Cleveland to explore the music being played each week and the stories behind the composers’ lives. Free Concert Previews are presented one hour before most subscription concerts throughout the season at Severance Hall. The previews (see listing at right) feature a variety of speakers and guest artists speaking or conversing about that weekend’s program, and often include the opportunity for audience members to ask questions.

Severance Hall 2011-12

Cleveland Orchestra Concert Previews are presented before every regular subscription concert, and are free to all ticketholders to that day’s performance. Previews are designed to enrich the concert-going experience for audience members of all levels of musical knowledge through a variety of interviews and through talks by local and national experts. Concert Previews are made possible by a generous endowment gift from Dorothy Humel Hovorka. December 8 and 10 “Musical Splendor and Radiance” with Rabbi Roger Klein, The Temple – Tifereth Israel

January 12, 13, and 14 “Beloved Favorites” with Rose Breckenridge, Cleveland Orchestra Music Study Groups administrator and lecturer

January 19, 20, and 21 “A Conversation Between Composers” with composer Sean Shepherd in conversation with Keith Fitch, head of composition at the Cleveland Institute of Music

February 2, 3, and 4 “Back to the Future: Mozart, Brahms, and the Idea of Progress” with speaker Francesca Brittan, assistant professor of music, Case Western Reserve University

For future Concert Preview details, visit clevelandorchestra.com

Concert Previews

33


T H E C L E V E L A N D O R C H E S T R A F R A N Z

W E L S E R - M Ö ST M U S I C

D I R E C T O R

Severance Hall

Thursday evening, December 8, 2011, at 8:00 p.m. Saturday evening, December 10, 2011, at 8:00 p.m.

Marin Alsop, conductor SAMUEL BARBER (1910-1981)

LEONARD BERNSTEIN (1918-1990)

Symphony No. 1, Opus 9 1. Allegro ma non troppo — 2. Allegro molto — 3. Andante tranquillo — 4. Con moto (Passacaille) (performed as one continuous movement)

Serenade (after Plato’s Symposium) 1. 2. 3. 4. 5.

Phaedras: Lento — Pausanias: Allegro Aristophanes: Allegretto Eryximachus: Presto Agathon: Adagio Socrates: Molto tenuto — Alcibiades: Allegro molto

PETER OTTO, violin

INTERMISSION CAMILLE SAINT-SAËNS (1835-1921)

Symphony No. 3 (“Organ Symphony”) in C minor, Opus 78 1. Adagio — Allegro moderato — Poco adagio 2. Allegro moderato — Presto — Maestoso — Allegro JOELA JONES, organ

These concerts are sponsored by Medical Mutual of Ohio, the exclusive health insurer of The Cleveland Orchestra. Peter Otto’s solo appearance with The Cleveland Orchestra at this week’s concerts is made possible by a contribution to the Orchestra’s Guest Artist Fund from Mrs. Warren H. Corning. Joela Jones’s solo appearance with The Cleveland Orchestra at this week’s concerts is made possible by a contribution to the Orchestra’s Guest Artist Fund from Mrs. Paul D. Wurzburger. The concert will end at about 9:55 p.m. LIVE RADIO BROADCAST

Saturday evening’s concert is being broadcast live on WCLV (104.9 FM). The concert will be rebroadcast as part of regular weekly programming on WCLV on Sunday afternoon, January 29, at 4:00 p.m.

34

Concert Program — Week 7

The Cleveland Orchestra


1112 clevelandorchestra.com

KeyBank Fridays@7 Friday evening, December 9, 2011, at 7:00 p.m.

Marin Alsop, conductor LEONARD BERNSTEIN (1918-1990)

Serenade (after Plato’s Symposium) 1. 2. 3. 4. 5.

Phaedras: Lento — Pausanias: Allegro Aristophanes: Allegretto Eryximachus: Presto Agathon: Adagio Socrates: Molto tenuto — Alcibiades: Allegro molto

PETER OTTO, violin CAMILLE SAINT-SAËNS (1835-1921)

Symphony No. 3 (“Organ Symphony”) in C minor, Opus 78 1. Adagio — Allegro moderato — Poco adagio 2. Allegro moderato — Presto — Maestoso — Allegro JOELA JONES, organ

The KeyBank Fridays@7 series is sponsored by KeyBank, a Cleveland Orchestra Partner in Excellence, and is also made possible in part through the generous support of The Andrew W. Mellon Foundation. The concert is performed without intermission and will end at about 8:10 p.m.

Information about the Fridays@7 pre-concert performers and the @fter party music can be found on the next page. > Severance Hall 2011-12

Concert Program — Week 7

>

>

35

>

>


T H E C L E F R A N Z W E L V E L A S E R N D - M Ö ST M O R C H U S I E S T C D R A I R E C

Fridays@7

T O R

concert + @fter party

DECEMBER 9 friday evening SEVERANCE HALL 5:00 p.m.

doors open, snacks and drinks available

da

Concert Prelude in Reinberger Chamber Hall: featuring Alon Yavnai with special guest Jamey Haddad and students from the CIM and Oberlin Improv Ensembles

6:00 p.m.

7:00 p.m.

gda-ban

read about the performers on page 58 > > >

The Cleveland Orchestra biographical information on page 55

lena-ma

conducted by Marin Alsop > > >

with soloists Peter Otto and Joela Jones biographical information on pages 56-57 > > >

magda-

“ORGAN SYMPHONY” featuring works by Bernstein and Saint-Saëns < < < musical selections details listed on previous page read commentary about the music: Bernstein (page 43), Saint-Saëns (page 47) > > >

@ f t e r par

after the concert ends, the evening continues . . .

@fter party

ty t

in Bogomolny-Kozerefski Grand Foyer: 8:30 p.m.

Banda Magda

biographical information on page 59 > > >

Fridays@7 Media Partners: WQAL (Q104) and WNWV (V107.3)

36

KeyBank Fridays@7 — December 9

es

Each Fridays@7 evening features a Cleveland Orchestra concert followed by a post-concert music presentation curated by world percussionist Jamey Haddad.

he f u n c o ntinu

bars are open around the performance

The Cleveland Orchestra


INTRODUCING THE PROGRAM

Scales Large & Small

O U R C O N C E R T S this week feature two of the most prominent American composers of the 20th century. Despite their chronological positions, neither of these musicians embraced the modernist trends that largely defined their era. Instead, both Samuel Barber and Leonard Bernstein cultivated more accessible idioms. Barber’s music, in particular, expressed an essentially Romantic outlook that was an integral part of the composer’s temperament. His most characteristic music evinces an allegiance to fairly traditional harmonies, an unabashed lyricism, strong emotional expression, and a fundamentally 19thcentury approach to compositional form, orchestration, and musical rhetoric. These are the virtues of Barber’s First Symphony, which opens the program on Thursday and Saturday evenings. The music of Leonard Bernstein also reveals a relatively conservative harmonic idiom, an innately lyrical impulse, and a penchant for strong emotional expression. But it differs from Barber’s in several respects. Whereas Barber fastidiously avoided the sound of American popular music, Bernstein embraced this with gusto. The rhythms of jazz inform many of his works — not only his Broadway masterpiece, West Side Story, but many of his concert pieces, including the final movement of his Serenade for violin and small orchestra. The contrast in these two composers’ attitudes toward vernacular American music reflects a larger contrast in their characters. Barber was a somewhat reserved personality. Even the most emotive passages in his music retain a formal, dignified demeanor. Bernstein, on the other hand, was outgoing and exuberant, far more inclined to “let it all hang out,” as the popular expression came to say. This, too, is clear at the close of Serenade. While by no means miniatures, neither of these two American compositions are large-scale works. Not so the “Organ Symphony” of Camille Saint-Saëns, which comprises the second half of each evening’s concert. In its broad four-part structure, its use of a substantial orchestra plus piano and organ, and its imposing gestures and sonorities, this is an expansive symphony, the largest orchestral work that Saint-Saëns ever composed. It is also, in the view of many, the finest. Saint-Saëns shared this opinion. “I have given everything I have to give,” the composer said of this piece. “What I have achieved here I will never achieve again.” —Paul Schiavo Paul Schiavo is program annotator for the Saint Louis Symphony Orchestra and Seattle Symphony, as well as a frequent contributor to the program magazines of Lincoln Center, Carnegie Hall, and other organizations. He has lectured on musical subjects at the Spoleto Festival USA, Ojai Festival, and Seattle Opera’s Ring Symposium.

Severance Hall 2011-12

About the Music

37


THE CLEVELAND MUSEUM OF ART

Chinese Art in an Age of Revolution

FU BAOSHI OCTOBER 16, 2011– JANUARY 8, 2012 Presenting sponsor:

Additional support from:

Organized by the Cleveland Museum of Art with the Nanjing Museum. Heaven and Earth Glowing Red, 1964. Nanjing Museum.

Baker Hostetler

Fu Baoshi Exhibition Programs MODERN CHINA: A Multidisciplinary Exploration Saturday, October 29, 1:30–4:00. Wen-hsin Yeh, University of California, Berkeley, Peter Galassi Museum of Modern Art, and Julia Andrews, Ohio State University. Book Club: The White-Haired Girl 3 Wednesdays, November 2, 9, 16, 1:30–2:45. China: Art and Technology Art Cart 3 Sundays, November 6, December 4, January 8, 1:00–3:00. Perspectives on Contemporary Chinese Art Wednesday, November 30, 6:30. Artist Ji Yunfei and Paola Morsiani, Curator of Contemporary Art

Two films on the Three Gorges Dam Up the Yangtze Friday, December 2, 7:00 and Still Life Sunday, December 4, 1:30. Holiday Film Festival: Recent Chinese Cinema 1:30 each afternoon, December 26–31. Chinese Art Music: Yang Wei and Ensemble Friday, December 9, 7:30. Mandarin and Cantonese language tours Sunday, October 23, Saturday, November 26, and Wednesday, December 28, 1:00–2:00 (Mandarin) and 2:00–3:00 (Cantonese). Chinese Painting Demonstration Sunday, December 4, 1:30-3:30 The Art of Reinvention: China, Ohio, and the New Global Economy January 4, 2012.

11150 East Blvd. University Circle ClevelandArt.org 216-421-7350 1-888-CMA-0033

Rembrandt in America February 19–May 28, 2012 This exhibition brings together about 50 autograph paintings by Rembrandt as well as others thought to be by the artist when they entered American collections. Adults $14, members free. Organized by the Cleveland Museum of Art, the North Carolina Museum of Art, Raleigh, and the Minneapolis Institute of Arts. The exhibition is supported by an indemnity from the Federal Council on the Arts and the Humanities. Additional support provided by the Samuel H. Kress Foundation. Sponsored by KeyBank. Self-Portrait, 1659. Rembrandt van Rijn. National Gallery of Art, Washington 1937.1.72


Symphony No. 1 (in one movement), Opus 9 composed 1935-36 SAMUEL BARBER

by

Samuel

BARBER born March 9, 1910 West Chester, Pennsylvania died January 23, 1981 New York City

Severance Hall 2011-12

was the son of a physician in West Chester, Pennsylvania, a suburb of Philadelphia. He began writing music at the age of ten and worked as a church organist from the time he was twelve. Four years later, he became a member of the charter class of the Curtis Institute of Music, in Philadelphia. There he studied piano, singing, and composition, and there his first polished pieces gained the attention of some of the leading musicians of his day. During the years that followed, Barber produced a respected body of music. This earned the composer numerous honors, including, on two occasions, the Pulitzer Prize. Works such as his Violin Concerto and the cantata Knoxville: Summer of 1915 turn up frequently on orchestra concert programs, while his poignant Adagio for Strings has achieved a degree of popularity rare among 20th-century compositions. Barber composed his First Symphony in the winter of 1935-36, which he spent in Italy. Although this is a youthful work — Barber was only twenty-five when he wrote it — its author was no novice in matters of orchestral composition. Two years earlier, he had scored a major success with his School for Scandal Overture, and he had followed that work with the impressive Music for a Scene from Shelley. A symphony, at least a small-scale one, must have seemed to the composer his logical next step. In crafting this piece, Barber used a symphonic design that compressed the usual four movements into one — although the four sections are often listed out in program books, they are played continuously as one movement. The opening section, marked Allegro ma non troppo, introduces three themes, as prescribed in classical sonata form: a principal subject (with a bold rhythmic profile presented by the full orchestra in the opening measures), a second, more lyrical melody (first heard in the english horn and violas), and a closing theme (of running sixteenth-notes, sounded by clarinets and strings). Barber gives these materials an energetic development that builds from modest beginnings to an intense climax, a procedure he follows in each of the work’s succeeding sections. But here in the opening section, instead of proceeding to recapitulate his melodies in more or less their original form, as would About the Music

39


Health & Life Insurance Š 2011 Medical Mutual of Ohio


be customary in a true classical work, the composer plunges into the second “movement” of his symphony. This is a scherzo section, marked Allegro molto, based on a rapid variation of the symphony’s first theme. Building from nervous rhythms and concise woodwind phrases, it culminates with a stirring recollection of the work’s opening motif. The third section offers a change of pace. Labelled with the tempo marking Andante tranquillo, it opens with a gracefully arching melody for the oboe, based on the symphony’s second, more lyrical, theme. From the final, climactic measures of this section emerges a brief phrase in the cellos and basses that begins the finale, marked Con moto. As this recurring figure is repeated (and repeated and repeated), Barber begins to add other ideas to it, in the manner of a passacaglia (or passacaille). In doing so, he draws upon all three of the symphony’s themes, weaving them into a tightly-knit and highly dramatic discourse. —Paul Schiavo © 2011 At a Glance Barber wrote his Symphony No. 1 during the winter of 1935-36 while in Italy. The work received its first performance on December 13, 1936, in Rome, with Bernardino Molinari conducting the Augusteo Orchestra. The Cleveland Orchestra gave the United States premiere, in January 1937, conducted by music director Artur Rodzinski. Barber revised the score in 1944, and dedicated the symphony to Gian Carlo Menotti. This symphony runs about 20 minutes in performance. Barber scored it for piccolo and 2

flutes, 2 oboes and english horn, 2 clarinets and bass clarinet, 2 bassoons and contrabassoon, 4 horns, 3 trumpets, 3 trombones, tuba, timpani, percussion (cymbals, bass drum), harp, and strings. Following the work’s American premiere at Severance Hall in 1937, The Cleveland Orchestra has presented this work on several later occasions, including two sets of concerts led by George Szell and, most recently, as part of the 2000 Blossom Festival, conducted by Steven Smith.

GILMOUR

ACADEMY TM

Where Inspiration Happens

Family Open House Wednesday, October 12 Sunday, November 20 Co-ed Preschool – Grade 12 gilmour.org A Catholic, independent school sponsored by the Congregation of Holy Cross, Notre Dame, Indiana

Severance Hall 2011-12

About the Music

41


Great people.

Great clients.

Great results.

www.tuckerellis.com

The Plain Dealerâ&#x20AC;&#x2122;s #1 Top Midsize Workplace


Serenade after Plato’s Symposium

(for violin, string orchestra, harp, and percussion) composed 1954 LEONARD BERNSTEIN

by

Leonard

BERNSTEIN born August 25, 1918 Lawrence, Massachusetts died October 14, 1990 New York City

Severance Hall 2011-12

was called a Renaissance man of American music, and with good reason. One of the world’s pre-eminent conductors, he also distinguished himself as a composer, pianist, author, and teacher. His famous Young People’s Concerts with the New York Philharmonic showed him to be an engaging television personality, and he proved equally capable of delivering the prestigious Charles Eliot Norton lectures at Harvard. The diversity of Bernstein’s compositions mirrored the wide range of his career as a whole. Equally at home with pop tunes, jazz, and modern orchestral writing, his wide-ranging output included songs, film scores, and musicals, as well as symphonies, choral works, and chamber music. Frequently, he combined “serious” and American popular styles in the same composition, blending these more successfully than any musician since George Gershwin. Bernstein’s Serenade, scored for solo violin with strings and percussion, is widely regarded as his finest concert piece. The composer wrote it in 1954, after re-reading Plato’s The Symposium. In that work, one of the Greek philosopher’s famous pedagogical dialogues, Plato recounts a conversation among a group of inquiring minds that has gathered over dinner in ancient Athens to consider the nature of love. The titles of the five movements of Serenade clearly refer to The Symposium, although Bernstein denied a literal correspondence between Plato’s work and his own. He admitted only that “the music, like the dialogue, is a series of related statements in praise of love, and generally follows the Platonic form through the succession of speakers at the banquet.” Each movement grows out of musical ideas presented in the previous one, just as each part of The Symposium commences with the speaker acknowledging and summarizing the points made by the previous orator, which he then amplifies, varies, or disputes. Each movement, moreover, is dominated by the solo violin. (Bernstein wrote the piece for Isaac Stern, who played its premiere performance.) Bernstein identified Plato’s speakers in the headings of each movement. The opening presents Phaedrus, who begins About the Music

43


Kulas Series Keyboard ConversationsÂŽ Kulas Series of of Keyboard ConversationsÂŽ with Siegel withJeffrey Jeffrey Siegel

24th Season 2011-2012 24th Season 2011-2012

Presented by Cleveland State Universityâ&#x20AC;&#x2122;s Center for Arts and Innovation

Presented by Cleveland State Universityâ&#x20AC;&#x2122;s Center for Arts and Innovation

Masterly Masterly

Sunday, Sunday,October 2, 2011 Sunday, October October 2, 2, 2011 2011

AA A Beethoven BeethovenBonanza! Bonanza!The Themany many Beethoven Bonanza! The many

A Beethoven Bonanza! The many B moods moodsofof ofgenius! genius! moods moods of genius! genius! Enthralling Enthralling Sunday, March 4, 2012 B Rachmaninoff and Tchaikovsky Sunday, Sunday,November November 20, 20, 2011 2011 Charming Charming The The Romantic Romantic Music Music of of Franz Franz Liszt The Romantic Music of FranzLiszt Liszt B Scintillating Scintillating Sunday, Sunday, March March 4,4,2012 2012 Sunday, May 6, 2012

â&#x20AC;&#x153;An afternoon of entertaining talk and â&#x20AC;&#x153;An afternoon of entertaining talk and exhilarating music.â&#x20AC;? exhilarating music.â&#x20AC;? â&#x20AC;&#x201C;The Washington Post - The Washington Post

AaMusical Love Triangle: Rochmaninoff Rochmaninoff and andTchaikovsky Tchaikovsky Robert, Clara and Johannes!

Sunday,March March 2012 2012 y 6,6,6, Sunday, 2012

musical love triangle: Robert, Clara AA A musical musicallove lovetriangle: triangle:Robert, Robert,Clara Clara and Johannes! and andJohannes! Johannes! All concerts at 3:00 All concerts beginbegin at 3:00 pmpm at at Cleveland State Universityâ&#x20AC;&#x2122;sWaetjen Waetjen Cleveland State Universityâ&#x20AC;&#x2122;s Auditorium, EuclidAve. Ave.and and E. E. 21st Auditorium, Euclid 21stSt. St. For more information call 216.687.5018 For more information call 216.687.5018 visitwww.csuohio.edu/concert www.csuohio.edu/concertseries/kc ororvisit series/kc series/kc

))'$  " #$!!#

"  % #+$"# '

"$ *(  '$"&$ $&#" % 

"#"  " $ $ # #"$' " 44

The Cleveland Orchestra


the proceedings with a lyrical ode to Eros; and then Pausanias, whose description of the dual quality of love â&#x20AC;&#x201D; earthly and celestial, physical and spiritual â&#x20AC;&#x201D; is mirrored in the movementâ&#x20AC;&#x2122;s two contrasting themes. In the second movement, the playwright Aristophanes invokes the mythology of love. Bernsteinâ&#x20AC;&#x2122;s rendition of his speech includes allusions to Baroque and Classical-period musical styles. Next comes the physician Erixymathus, who proposes bodily harmony as a model for loversâ&#x20AC;&#x2122; compatibility. Bernstein described the music for this third movement as â&#x20AC;&#x153;an extremely short fugato scherzo, born of a blend of mystery and humor.â&#x20AC;? By contrast, the ensuing movement, inspired by Agathonâ&#x20AC;&#x2122;s speech praising loveâ&#x20AC;&#x2122;s charms, is a simple aria in slow tempo. The fifth-movement finale begins with a weighty prologue, representing Socratesâ&#x20AC;&#x2122;s speech on the demonic power of love. He is interrupted, however, by the entrance of Alcibiades, who leads a band of drunken followers. They turn the gathering into a hedonistic revel that Plato seems to suggest is as true to the spirit of love as any of the sober discourses that have gone before. â&#x20AC;&#x153;If there is a hint of jazz in the celebration,â&#x20AC;? Bernstein wrote of this final part of his composition, â&#x20AC;&#x153;I hope it will not be taken as anachronistic Greek party music, but rather the natural expression of a contemporary American composer imbued with the spirit of that timeless dinner party.â&#x20AC;? â&#x20AC;&#x201D;Paul Schiavo Š 2011

At a Glance Bernstein wrote this work during the summer of 1954 on Marthaâ&#x20AC;&#x2122;s Vineyard, Massachusetts. The work was supported by commissioning funds from the Koussevitzky Foundation. The first performance took place on September 12, 1954, in Venice. Isaac Stern was the featured violinist, with the composer conducting the Israel Philharmonic. This work runs about 30 minutes in performance. Bernstein scored it for solo violin accompanied by an ensemble of harp, strings, and percussion (snare drum, tenor drum, bass drum, triangle, suspended cymbal, tambourine, Chinese blocks, xylophone, glockenspiel, and chimes). The Cleveland Orchestra first performed Bernsteinâ&#x20AC;&#x2122;s Serenade in December 1957, conducted by Louis Lane and with Daniel Majeske (later concertmaster of the Orchestra) as soloist. It has been presented on several occasions since that time, at Severance Hall and Blossom, most recently in February 2000, when Franz Welser-MĂśst conducted a weekend of performances with concertmaster William Preucil as soloist.

 7KH0\VWHULRXV 7KUHH3KDQWRPV

6HYHUDQFH

:KDWZLOOWKH\GR":KDWZLOOWKH\VLQJ" &DUO7RSLORZ &OHYHODQG3236FHOHEUDWHG

+DOO 

1HZ<HDUV(9( &RQFHUW 'DQFH &UDLJ6KXOPDQa*DU\0DXHU &LDUiQ6KHHKDQ

&21&(57$730Â?'$1&($730

)RUWLFNHWVFDOO   )RUWLFNHWVFDOO  RU   RU  RURQOLQHFOHYHODQGSRSVFRP RURQOLQHFOHYHODQGSRSVFRP Severance Hall 2011-12

About the Music

45


Dad’s my hero. He can fix everything from hot water tanks to BB guns. My son has the only two-story tree fort in the neighborhood thanks to him. He’s my go-to guy. Ask him about the big Cleveland game in ` 64, stocks, deep frying turkeys-he knows it all. But he doesn’t get around like he used to. He’s getting older and he can’t fix that. Wonder what he wants for the future? How do I bring it up?

What should our game plan be?

Have you ever thought about what your loved ones want in their final years of life? Thinking about it is the first step to talking about it. At Hospice of the Western Reserve, we believe discussing it early will help you and your family make the right decisions when the time comes. That’s why we encourage you to talk about it now. Contact us for a booklet that explains our services and helps you start the conversation. hospicewr.org/plan 855.852.5050


Symphony No. 3 (“Organ Symphony”) in C minor, Opus 78 composed 1886 A S R I VA L C L A I M A N T S

by

Camille

SAINT-SAËNS born October 9, 1835 Paris died December 16, 1921 Algiers

Severance Hall 2011-12

to the title “King of Instruments,” the pipe organ and the symphony orchestra have traditionally been competitors more often than collaborators. Historical as well as purely musical reasons account for this. The organ developed during a period when music-making was centered in the church, and the masterpieces of organ composition — the works of Dietrich Buxtehude and J. S. Bach, for example, and more recently those of Olivier Messiaen — have served an ecclesiastical as well as musical purpose. The orchestra, by contrast, was from its inception a secular institution, and the great works of its repertoire are imbued with the humanistic spirit of more recent times. Orchestral playing, moreover, calls for a blending of different instruments, a task to which many of the majestic tones of the organ do not readily lend themselves. Nevertheless, the temptation to join these two great musical resources has proved irresistible for some composers. While relatively few compositions use organ and orchestra together, the best of them produce an extraordinary sonic effect. Among such works, pride of place belongs to the “Organ Symphony” of Camille Saint-Saëns. Saint-Saëns’s reputation as an orchestral composer rests principally on his concertos and on tone poems (such as the famous Danse macabre). Even though his colleague Charles Gounod admiringly referred to him as “the French Beethoven,” Saint-Saëns was not by disposition a symphonist. The symphony, which had emerged as an independent compositional genre during the second half of the 18th century, was a central-European invention, the product of the Austro-German Classical school. Its spirit has always been somewhat foreign to French composers. Saint-Saëns wrote two youthful works in this form, but soon turned to what were for him more congenial areas of endeavor — concertos, tone poems, vocal works, and chamber music. Thirty years passed before Saint-Saëns finally had occasion to return to symphonic composition. He was fifty and at the height of his creative power when an invitation to conduct his music in London brought with it a commission for a new About the Music

47


THE CLEVELAND C O N C E R T

C A L E N D A R

FALL SEASON Thursday December 8 at 8:00 p.m. Saturday December 10 at 8:00 p.m. THE CLEVELAND ORCHESTRA Marin Alsop, conductor Peter Otto, violin Joela Jones, organ

PNC Holiday Musical Rainbows for young people ages 3 and up

Wednesday December 14 at 10 a.m. Saturday December 17 at 11 a.m.

CHRISTMAS BRASS QUINTET

BARBER Symphony No. 1 BERNSTEIN Serenade (for violin) SAINT-SAËNS “Organ” Symphony

Thursday December 15 at 10 a.m.

CELEBRATION OF KWANZAA

Concert Sponsor: Medical Mutual of Ohio

Sunday December 18 at 12:30 p.m.

MUSIC OF CHANUKAH

Friday December 9 at 7:00 p.m. THE CLEVELAND ORCHESTRA

KeyBank Fridays@7 Concert BERNSTEIN Serenade (for violin) SAINT-SAËNS “Organ” Symphony

WINTER SEASON Thursday January 12 at 8:00 p.m. Friday January 13 at 11:00 a.m. Saturday January 14 at 8:00 p.m. THE CLEVELAND ORCHESTRA Franz Welser-Möst, conductor Lisa Batiashvili, violin

followed by post-concert music with Magda Giannikou and Banda Magda

Sunday December 11 at 3:00 p.m. Friday December 16 at 8:00 p.m. Saturday December 17 at 3:00 p.m. Saturday December 17 at 8:00 p.m. Sunday December 18 at 3:00 p.m. Sunday December 18 at 7:00 p.m. Thursday December 22 at 8:00 p.m. Friday December 23 at 3:00 p.m. Friday December 23 at 8:00 p.m. THE CLEVELAND ORCHESTRA Robert Porco, conductor Cleveland Orchestra Chorus and guest choruses

BRAHMS Violin Concerto SAARIAHO Orion SMETANA from Má Vlast [“My Homeland”] — Vysehrad, The Moldau, and Sárka Concert Sponsor: Eaton Corporation

Sunday January 15 at 7:00 p.m. THE CLEVELAND ORCHESTRA Chelsea Tipton, conductor Central State University Chorus Martin Luther King Jr. Celebration Chorus

CLEVELAND ORCHESTRA CHRISTMAS CONCERTS Celebrate the holiday season with The Cleveland Orchestra and Chorus in these annual offerings of music for the season, including sing-alongs and a very special guest.

Thursday December 15 at 8:00 p.m. Burning River Brass

BURNING RIVER BRASS Tuesday December 20 at 8:00 p.m. Wednesday December 21 at 8:00 p.m. THE CLEVELAND ORCHESTRA Herman Jackson, conductor with Peabo Bryson, Jennifer Holliday, Lea Salonga, and Ben Vereen

THE COLORS OF CHRISTMAS 48

MARTIN LUTHER KING JR. CELEBRATION CONCERT The Cleveland Orchestra’s 32nd annual concert celebrating the spirit of Dr. King’s life, leadership, and vision. Presented in collaboration with the City of Cleveland. TICKETS: Admission is free, but tickets are required. Tickets become available beginning January 3, 2012. Sponsored by KeyBank, with additional support from The Cleveland Foundation.

Monday January 16 noon to 5:00 p.m.

MARTIN LUTHER KING JR. COMMUNITY OPEN HOUSE Severance Hall joins in a city-wide celebration of Martin Luther King Jr’s life and achievements with a free public open house featuring musical performances by the Cleveland Orchestra Youth Orchestra, Cleveland Orchestra Youth Chorus, and more! Watch for complete details. Sponsored by Medical Mutual of Ohio, the exclusive health insurer of The Cleveland Orchestra

Concert Calendar

The Cleveland Orchestra


1112

ORCHESTRA

clevelandorchestra.com

T H E

BRYSON

S P O T L I G H T

BRAHMS Piano Concerto No. 2 SHEPHERD Wanderlust SHOSTAKOVICH Symphony No. 6

VEREEN

I N Thursday January 19 at 8:00 p.m. Friday January 20 at 8:00 p.m. Saturday January 21 at 8:00 p.m. THE CLEVELAND ORCHESTRA Franz Welser-Möst, conductor Yefim Bronfman, piano

Concert Sponsor: FirstMerit Bank

HOLLIDAY

Thursday February 2 at 8:00 p.m. Friday February 3 at 8:00 p.m. Saturday February 4 at 8:00 p.m. THE CLEVELAND ORCHESTRA Franz Welser-Möst, conductor Yefim Bronfman, piano

SAARIAHO Laterna Magica MOZART Symphony No. 39 BRAHMS Piano Concerto No. 1

THE COLORS OF CHRISTMAS

Sunday February 5 at 2:00 p.m. Yefim Bronfman, piano and members of The Cleveland Orchestra

BRAHMS Piano Sonata No. 3, Opus 5 BRAHMS Violin Sonata No. 3, Opus 108 BRAHMS Piano Quintet, Opus 34 Thursday February 9 at 8:00 p.m. Saturday February 11 at 8:00 p.m. Sunday February 12 at 3:00 p.m. THE CLEVELAND ORCHESTRA Pierre Boulez, conductor Men of the Cleveland Orchestra Chorus

SCHUBERT Hymn to the Holy Spirit SCHUBERT Night Song in the Forest SCHUBERT Song of the Spirits over the Waters MAHLER Symphony No. 7 Concert Sponsor: Baker Hostetler

Tuesday December 20 at 8 p.m. Wednesday December 21 at 8 p.m. THE CLEVELAND ORCHESTRA Herman Jackson, conductor with vocalists Peabo Bryson Jennifer Holliday Lea Salonga Ben Vereen

One of the most festive and memorable Christmas programs comes to Cleveland for two unforgettable evenings filled with music and singing. Featuring legendary vocalists joining together with The Cleveland Orchestra in such holiday favorites as “Joy to the World” and “It’s the Most Wonderful Time of the Year” alongside solo performances of chart-topping hits from all four star performers.

For a complete schedule of future events and performances, or to purchase tickets online 24/ 7 for Severance Hall concerts, visit www.clevelandorchestra.com. Cleveland Orchestra Radio Broadcasts: Radio broadcasts of current and past concert performances by The Cleveland Orchestra can be heard as part of regular weekly programming on WCLV (104.9 FM), with programs broadcast on Saturday at 8:00 p.m. and Sunday at 4:00 p.m. Program Notes for each regular concert are usually posted in advance online at clevelandorchestra.com.

Severance Hall 2011-12

Concert Calendar

CLEVELAND ORCHESTRA TICKETS PHONE

(216) 231-1111 800-686-1141

clevelandorchestra.com 49


+ + + + +

IF YOU’RE DRIVING ONE OF OUR CARS, YOU’VE ALREADY EXPERIENCED A GREAT PERFORMANCE TONIGHT.

of North Olmsted

of North Olmsted

North Olmsted

Mercedes-Benz Sprinter of North Olmsted

of North Olmsted

of North Olmsted

of Cleveland

Airport Acura

Airport Infiniti

Beachwood Buick

Beachwood GMC

of Cleveland

of Cleveland

of Cleveland

Collection Auto Group has more #1 dealers than any other dealer group in Ohio.

www.collectionautogroup.com


work, specifically a symphony. The composer accepted this offer and began sketching a large symphony in the early part of 1886. Saint-Saëns may have conceived this work as a tribute to Franz Liszt. Liszt’s works represented a musical ideal for many French composers of the late 19th century, but especially for Saint-Saëns, who shared his Hungarian counterpart’s preference for descriptive program music and for a colorful virtuosity in both keyboard and orchestral composition. Moreover, Liszt had encouraged and materially aided Saint-Saëns during the latter’s youth, and the two men had remained devoted though distant friends over the years. The inclusion of prominent roles for both piano and organ fit neatly into the conception of a Lisztian tribute. Liszt enjoyed, of course, a brilliant career as a concert pianist, but he spent much of his final years in a monastery composing sacred music, much of it for the organ. Less tangible but equally important homages are the recurrent use throughout the score of a single principal motif (a technique favored by Liszt), and the work’s lush, often ecstatic Romanticism, a quality that marks many of Liszt’s own compositions. Shortly after he conducted the premiere performance of this symphony, in London, Saint-Saëns received word that Liszt had died. The news affected Saint-Saëns deeply, and he dedicated the score to Liszt’s memory. THE MUSIC

Symphony No. 3 is nominally in two large movements, but each of these is divided into two distinct parts, thus yielding a traditional four-movement symphonic structure. Saint-Saëns opens his work with a brief prelude in slow tempo that presents a rising figure of four notes, first played by the oboe. Various transformations of this motif make up most of the succeeding Allegro section, and the figure’s ascending contour also appears at the start of the long and beautiful melody of the Adagio that follows. The organ, heard for the first time at this point, underscores the feeling of religious serenity that this second portion of the symphony conveys. A rustic theme, combining melancholy harmonies with energetic rhythms, launches the ensuing “third movement” scherzo. Saint-Saëns develops the subject in several brilliant episodes, but in the midst of the last of these passages a new, Severance Hall 2011-12

About the Music

Saint-Saëns may have conceived this symphony as a tribute to Franz Liszt. Liszt’s works represented a musical ideal for many French composers of the late 19th century, but especially for Saint-Saëns, who shared his Hungarian counterpart’s preference for descriptive program music and for a colorful virtuosity in both keyboard and orchestral composition.

51


medium is the message.” “The

— Marshall McLuhan, 1911-1980

Photo by Roger Mastroianni

World-Class venue. World-Class advertisers.

Cleveland Orchestra Program Book Advertising information: John Moore • 216-721-4300 • jmoore@LPCpub.com


more austere melody is heard rising in the strings. This theme, again an outgrowth of the symphony’s initial motif (it also bears a strong resemblance to the “Jupiter theme” of Mozart’s last symphony), soon dispels the fantastic atmosphere of the scherzo and leads to a series of contrapuntal passages punctuated by massive organ chords. New ideas are introduced and earlier ones recalled as the symphony builds to a brilliant final climax. —Paul Schiavo © 2011 At a Glance Saint-Saëns wrote this symphony in 1886. He conducted the first performance, on May 19, 1886, with the London Philharmonic Society. It was soon nicknamed the “Organ Symphony” because of its prominent role of the organ in a quasi-solo role. The published score is dedicated to Franz Liszt. This symphony runs about 40 minutes in performance. Saint-Saëns scored it for 3 flutes (third doubling piccolo), 2 oboes and english horn, 2 clarinets and bass clarinet,

2 bassoons and contrabassoon, 4 horns, 3 trumpets, 3 trombones, tuba, timpani, percussion (triangle, cymbals, bass drum), organ, piano (four hands), and strings. The Cleveland Orchestra first performed Saint-Saëns’s “Organ Symphony” in November 1926, with Nikolai Sokoloff conducting and Edwin Arthur Kraft playing the organ. The most recent performances were at Severance Hall in December 2003, with guest conductor Hans Graf and principal keyboard Joela Jones.

Gifts and musical items for every occasion . . .

Open before and after every Cleveland Orchestra performance, at intermissions, and daytimes 11- 6 Tuesday-Friday. Or visit us online at

north O point portfolio managers c o r p o r a t i o n

clevelandorchestra.com Severance Hall 2011-12

About the Music

Ronald J. Lang Diane M. Stack Daniel J. Dreiling

440.720.1102 440.720.1105 440.720.1104

53


Marin Alsop Internationally acclaimed for her creative approach to programming and her wideranging repertoire, American conductor Marin Alsop currently serves as music director of the Baltimore Symphony Orchestra. She is making her Cleveland Orchestra debut with this weekend’s concerts. Born in New York City, Marin Alsop attended Yale University and earned bachelor’s and master’s degrees in violin from the Juilliard School. She received the Koussevitsky Conducting Prize from the Tanglewood Music Center, where she became a protégé of Leonard Bernstein. Marin Alsop became the first woman to head a major American orchestra, beginning her tenure as music director of the Baltimore Symphony Orchestra in 2007. She previously served as music director of the Colorado Symphony Orchestra (1993-2005) and in England as principal conductor of the Bournemouth Symphony Orchestra (2002-2008). She now holds the title of conductor emeritus with Bournemouth and of music director laureate in Colorado. In addition, she has served as music director of California’s Cabrillo Festival of Contemporary Music since 1992. As a guest conductor, Ms. Alsop appears regularly with major ensembles in North America and Europe, including the orchestras of Los Angeles, New York, and Philadelphia, as well as Amsterdam’s Royal Concertgebouw Orchestra, London Symphony Orchestra and London Philharmonic, Munich Philharmonic, Orchestre de Paris, and Zurich’s Tonhalle Orchestra. This season, she is serving as artist-inresidence at London’s Southbank Centre. With the Baltimore Symphony Orchestra, Marin Alsop has launched many educational initiatives, including an after-school program for the city’s disadvantaged young people. Her arts advocacy has included appearances at the 2006 annual meeting of the World Economic Forum in Davos, Switzerland, and at the National Press Club in Washington D.C. in 2008. Marin Alsop was Musical America’s 2009 Conductor of the Year. In 2008, she became a fellow of the American Academy of Arts and Sciences, and she received a MacArthur Fellowship in 2005. Her leadership of the Cabrillo Festival of Contemporary Music has been recognized annually with ASCAP awards for Adventurous Programming of Contemporary Music. Ms. Alsop’s other honors include being named Gramophone’s 2003 Artist of the Year, receiving the Royal Philharmonic Society’s 2003 Conductor’s Award, and a European Women of Achievement Award. Ms. Alsop’s discography on Naxos and Sony includes works by Barber, Bartók, Bernstein, Brahms, Dvořák, Orff, Takemitsu, and Weill. For more information, visit www.marinalsop.com. Severance Hall 2011-12

Conductor

55


Peter Otto

First Associate Concertmaster The Cleveland Orchestra

German-born violinist Peter Otto is a graduate of the Juilliard School. Before joining The Cleveland Orchestra in 2007, he was a member of the first violin section of the Saint Louis Symphony Orchestra, where he served as assistant concertmaster for two seasons. Mr. Otto has also served as guest concertmaster of the Nashville Symphony and the Pittsburgh Symphony. In recent years, Mr. Otto’s concerto appearances have included performances with the Czech Philharmonic, Saint Louis Symphony, Rostock Philharmonic, Heidelberg Chamber Orchestra, and the National Youth Orchestra of Germany. He has appeared in solo and chamber music recitals throughout Germany, Austria, Switzerland, Italy, and Japan. He performed Franz Waxman’s Carmen Fantasy live on German national radio, and has appeared on Austrian National Television and the Norddeutscher Rundfunk. His most recent solo performances with The Cleveland Orchestra were in Vivaldi’s The Four Seasons as part of the 2010 Blossom Festival and in Tartini’s Violin Concerto in G major as part of the Cleveland Museum of Art’s Baroque Masterworks series in 2011. Peter Otto holds a bachelor of music degree from the Hochschule für Musik und Theater in Rostock, Germany, and a master of music degree from the Juilliard School. He has studied with Felix Galimir, Christiane Hutcap, Lewis Kaplan, Vera Kramarowa, Igor Ozim, and Samuel Sanders, and participated in masterclasses of Anne-Sophie Mutter, Igor Oistrakh, and Ruggiero Ricci. He was second-prize winner in the 1998 Max Rostal International Violin Competition in Berlin and the 1999 Kingsville Young Performers Competition in Texas. Mr. Otto has participated as soloist and chamber musician in a variety of music festivals, including those of Schleswig-Holstein, Baden-Baden, Schwerin, and Heidelberger Fruehling. He has also taught at the Innsbrook Festival, Bowdoin Summer Music Festival, Cactus Pear Music Festival, and Kent/Blossom Music. In addition, he is a regular coach at the New World Symphony in Miami, teaching masterclasses and symphonic repertoire for aspiring orchestral musicians. Mr. Otto joined the violin faculty of Cleveland State University in September 2010. Peter Otto is a member of the Cleveland Orchestra Piano Trio, along with fellow orchestra members Joela Jones (piano) and Richard Weiss (cello). Mr. Otto plays a violin by G.B. Guadagnini from the year 1769.

56

Soloist

The Cleveland Orchestra


Joela Jones

Principal Keyboard Rudolf Serkin Endowed Chair The Cleveland Orchestra

An artist of exceptional versatility, Joela Jones plays piano, harpsichord, organ, celesta, synthesizer, and accordion with The Cleveland Orchestra. She has appeared frequently as soloist with the Orchestra at home and on tour, in a wide repertoire of fift y different works ranging from Bach to Bernstein. In January 2001, Ms. Jones was featured as soloist in the first orchestral performances utilizing Severance Hall’s newly restored Norton Memorial Organ. Since then, she has performed in works for orchestra and organ by Barber, Poulenc, Saint-Saëns, and Janácˇek. Ms. Jones is also principal accompanist for the Cleveland Orchestra Chorus. A native of Miami, Florida, Joela Jones began her musical studies with her parents. As a child, she also studied at Florida State University with Edward Kilenyi and the renowned Hungarian pianist and composer Ernö (Ernst von) Dohnányi. At the age of 12, she was invited to appear as soloist with the Miami Symphony Orchestra. The next year, she received a scholarship to the Eastman School of Music, where she studied with José Echaniz. While at Eastman, she performed frequently with the Rochester Philharmonic and the Eastman Philharmonia. She made her New York debut with Arthur Fiedler and the Metropolitan Opera Orchestra at Lewisohn Stadium. Ms. Jones earned a master of music degree from the Cleveland Institute of Music, where she studied with Victor Babin and Arthur Loesser. She studied organ with Warren Berryman at the Baldwin-Wallace College Conservatory of Music. Ms. Jones has appeared as soloist with the symphony orchestras of Boston, Chicago, Detroit, Houston, Philadelphia, and San Francisco, and has performed extensively in solo and chamber music recitals. She teaches classes in advanced orchestral keyboard technique at the Cleveland Institute of Music and chairs the collaborative piano department at Kent/Blossom Music. Ms. Jones has recorded works by Poulenc and d’Indy with the London Symphony Orchestra. With The Cleveland Orchestra, she has recorded Janáček’s Capriccio for Left Hand with Christoph von Dohnányi and Messiaen’s La Ville d’en Haut and Sept haïkaï with Pierre Boulez. Her performance of Rachmaninoff ’s Rhapsody on a Theme of Paganini with the Boston Pops has been rebroadcast several times on the PBS network. In recent years, Joela Jones released a CD of Claude Bolling’s Suite for Cello and Jazz Piano Trio with Cleveland Orchestra colleagues Richard Weiss, Maximilian Dimoff, and Donald Miller. Joela Jones is married to Richard Weiss, first assistant principal cello of The Cleveland Orchestra. They are the parents of a son, Justin Jordan. Severance Hall 2011-12

Soloist

57


PRE-CONCER T

prelude

December 9 PRELUDE Piano – Alon Yavnai Flute – James Romeo Clarinet – Nikola Djurica Saxophone – Max Porter Violin – Anthony Bracewell Bass – Matt Adomeit Guitar – Jesse Limbacher Percussion – Dylan Moffitt, Peter Manheim, and Jamey Haddad

Alon Yavnai Pianist & composer Alon Yavnai performs in a wide variety of musical styles and genres. He was born and raised in Israel, began formal musical studies there, and started performing professionally at an early age. He moved to the United States at the age of twenty-two. He has toured worldwide, performing and recording with a diverse range of artists, including Paquito D’Rivera, Yo-Yo Ma, Nancy Wilson, Freddie Hubbard, Joe Lovano, Claudio Roditi, and Romero Lubambo. He has also recorded with the Zurich Symphony Orchestra and performed as a soloist with the Colón Theater Philharmonic Orchestra in Argentina. Other engagements have included performances at Carnegie Hall and the Library of Congress, as well as appearing in festivals around the world and jazz clubs. He recently spent a year in Israel, teaching at Hebrew University in Jerusalem and completing a master’s degree in composition. Adding to his three previous albums, the coming year will see the release of a Big Band album, featuring original compositions and arrangements recorded in Hamburg with the NDR Bigband. A solo piano album is also planned. Mr. Yavnai lives in New York and is an associate professor at Berklee College of Music in Boston.

Jamey Haddad Born in Cleveland, Ohio, percussionist Jamey Haddad holds a unique position in the world of jazz and contemporary music, with his musical voice transcending styles and trends. Regarded as one of the foremost world music and jazz percussionists in the United States, Mr. Haddad is an associate professor at Boston’s Berklee College of Music, New England Conservatory, Oberlin Conservatory of Music, and the Cleveland Institute of Music. He performed with Paul Simon (he has been a member of Simon’s band for more than a decade) when Simon was the recipient of the first annual Library of Congress Gershwin Prize for Popular Song. Jamey Haddad has curated and planned the world music performances for The Cleveland Orchestra’s Fridays@7 concerts since the series began in 2009. For more information, visit www.jameyhaddadmusic.com.

58

KeyBank Fridays@7

The Cleveland Orchestra


POS T-CONCER T

@fter party

Banda Magda Magda Giannikou, accordion Mika Mimura, vibraphone Ignacio Hernandez, acoustic and electric guitar Petros Klampanis, acoustic bass Marcelo Woloski, percussion Keita Ogawa, percussion

Banda Magda boasts an intricate, tropical, and eclectic sound, drawing from world rhythms infused in South American grooves with a twist of jazz. Formed in New York in 2010, Banda Magda appears regularly in venues throughout New York City, blending French repertoire, original music, and songs from all over the world, arranged in the Banda Magda way and sung in English, Italian, Portuguese, Spanish, Greek, and Japanese. Banda Magda are working on their first album, to be titled Twelve French Songs, due to be released in spring 2012.

THE CLEVELAND ORCHESTRA

7 @ ys

a d i r F

arty er p t f +@

1112

rto e co c on C is o s th y d n n r o i i t rt ta ia6 b e P sen f ter Pa ge r e i r g 1 p ch ore an @ ns t a eF Mar h GrFriie o m n, and rmal o music T w t day ky rld ss fo in wi th i s sio s ues interm ts are le er t, wo o r a t e g n n i i t b v n c r i 1 o a o n e l nn 1 n l c o c ries t time, @7 con estra c s t o c o our eve May Stra e y s a s t d y 7 h ar rt nce

clevelandorchestra.com

rc st tis s@ ut day iday n early nd, Fri eland O n o f a r un d o fun! r F ro tio ga l ev vela ank he eyB eaturin e in Cle each C s e l e c u s i c to . and t K e . a Th on. F ng els wing t m u sic . ite s i re a s o sea e any th . Foll a d i nv i o n. G r the m d t e k unli of fstag e y H a d el e b r a ome fo c C and r t J a m u s i c al izons. r e o m p rh ex i qu e you n a u expand and Fri

59


Norton Memorial Organ The restoration and reinstallation in 2001 of the Norton Memorial Organ was funded through The Cleveland Orchestra’s Twenty-First Century Campaign. These leadership donors made major gifts to the Organ Fund endowment: D. Robert and Kathleen Barber Descendants of D. Z. Norton Arlene and Arthur Holden

Kulas Foundation Oglebay Norton Foundation

The Cleveland Orchestra is also grateful to the donors listed on these three pages, whose gifts to the Orchestra’s endowment were recognized through the naming of individual pipes within the Norton Memorial Organ: Anonymous (4) Mrs. Rebecca E. Adler Judy Buckle Airhart and Robert E. Airhart II Reta Biehle Alder American Guild of Organists Cleveland Chapter Deborah S. Amundsen William and Donna Anderson David A. Andreano Mrs. J. R. Andrisek Dr. Albert C. and June S. Antoine In Memory of Adam M. Araca Agnes M. Armstrong, in Memory of Floyd St. Clair Mr. and Mrs. Lawrence J. Badar The Families of Sara W. Baker and Duncan A. White, Jr., in Memory of Duncan A. White Thomas D. Balch and Harry D. Balch Michelle and Anthony Bandy-Zalatoris Alvin and C. Clair Barkley Mr. and Mrs. Michael P. Barrick Patricia Baskin Russell and Joanne Bearss Ercil F. Beck Gene and Helen Beer Richard L. and Sandra Y. Beery Fred G. and Mary W. Behm Leo and Judith Bender In Memory of Eunice J. Bernard In Memory of Susan A. Bernard Mrs. Lorin S. Berne, in Memory of Alex L. Siegel and Lorin S. Berne John and Laura, David and Mary Bertsch The Nicholas Besser, Jr. Family, in Memory of Nicholas Besser, Jr. Mrs. Edith Bettendorf Ralph L. Beuthin Mr. and Mrs. Woodrow J. Beville, Jr. Mr. and Mrs. William H. Beyer Mr. and Mrs. Jeffrey M. Biggar In Honor of Bascom Biggers III Mr. and Mrs. Robert B. Billman, Jr. Mark and Kathleen Binnig In Memory of Bertha and Jack Bloch and Anne and Bill Fast Mr. and Mrs. A. Richard Boerner Mr. and Mrs. Donald P. Bogner Richard J. Bogomolny, Patricia M. Kozerefski, and Julie Xing Bogomolny Ruth Turvy Bowman Grace W. Bregenzer Nancy H. Bright, M.D.

60

Marjorie J. Brines In Honor of Jerry Brodkey Drs. Michael A. and Sharon G. Broniatowski Mr. and Mrs. Peter R. Brooks Mr. and Mrs. Kenneth L. Brown Peter and Ann Brown John and Maria Cristina Bruch Dr. and Mrs. William E. Bruner II Diane Catherine Buehner Ruth E. Bueschlen Charles and Virginia Burchard Honnie and Stanley Busch In Memory of Mr. and Mrs. Dwight B. Buss J.C. and Helen Rankin Butler Wilton H. and Ruth B. Cahn The Carreras Family Richard and Nancy Cecil Mr. and Mrs. Paul Chaffee Mary Lou Chalfant Carmelline E. Charnas Thomas V. and Barbara Chema Drs. Chiou S. and Suio L. Chen Mrs. Charles R. Chew Mary E. Chilcote Henry Chisholm IV Bernie and Stan Christensen Mrs. Chester D. Christie John M. Clough, M.D. In Honor of Helen Champney Cole Al, Mimi, Lisa, and Chris Connors, in Honor of Birute Smetona Mr. and Mrs. Homer E. Cook, Jr. Mr. and Mrs. Alfred G. Corrado Glee A. Cousino Norman and Ann Craig Doris and Marvin Cramer W. S. Cumming Dr. and Mrs. James R. Cunningham Barbara Ann Davis Mr. and Mrs. B. Neil Davis, in Honor of Joela Jones Sally and David de Roulet Bradford E. DeBusk Mr. and Mrs. John W. Decker Shelley G. Dedmon Miss Linda L. Dembeck Mr. and Mrs. Thomas Demitrack Mr. and Mrs. Del Denny Mrs. Marjorie Dickard-Comella Pierre and Margaret Diemer Gabriel and Nancy DiFrancesco John and Kathleen Dogger In Memory of Christine Bonhoeffer von Dohnányi In Honor of Christoph von Dohnányi

Norton Memorial Organ

Mr. and Mrs. Joseph C. Domiano Gail and Michael Dowell Mr. and Mrs. Theodore D. Driscol Jane Seelbach Driver Mrs. Charles C. Dugan Mr. and Mrs. Richard Egan Anne F. Eiben Robert M. Eiben, M.D. Dr. and Mrs. Robert M. Eiben, in Honor of their Children Mr. and Mrs. Milton J. Ellis William Mitchell Ellison Worth Ellison Mrs. Frederick L. Emeny In Honor of Mr. and Mrs. Oliver F. Emerson Mary Grace and Robert Richard Engisch Edith Virginia Enkler, in Memory of Mrs. Edith Ann Enkler in Memory of Henry Enkler in Memory of Isaac Parey Masten in Memory of Mrs. Isaac Parey Masten in Memory of John Parey Masten Richard L. and Jean A. Erickson Dr. Wilma M. Evans Brian L. Ewart and William K. McHenry The Fagerhaug Six: Lauren, David, Hadyn, Raleigh, Zoe, and Mya Edward R. and Joan M. Falkner Mr. and Mrs. Herbert J. Farr III Dr. and Mrs. J. Peter Fegen James and Linda Focareto Jean and Greg Foust Mrs. Jessica R. Franklin, in Memory of her Husband James E. Franklin Mr. and Mrs. Dempwolf Frey Kent and Paula Frisby Michael, Joan, Gregory, Timothy, Marie, and Rebecca Fry In Honor of Peggy Fullmer Jack and Katherine Ganz Richard K. Gardner Michael and Barbara Garrison In Memory of Myrna Macklin Garvin Mr. and Mrs. R.H. Geissenhainer Patricia J. Genchi Claudette and Ron Giesinger Pastor Andrea R. Cermak Gifford Alda and Nick Giorgianni In Memory of Kelly Jean Mitchell Golonka Lynn, Shelley, and Laura Gordon Dr. Barbara Gothe and Dr. Harvey Rodman Mr. and Mrs. Dennis M. Grapo, in Memory of their Son Larry Mr. and Mrs. William A. Gray Elaine Harris Green

The Cleveland Orchestra


Loretta Gregoric Dr. Raymond and JoAnn Greiner Linda and Fred Griffith Tom and Nancy Griffith Sally K. Griswold In Memory of Henry S. Grossman Mrs. Jerome E. Grover, in Loving Memory of her Husband Jerome John A. and Ashley M. Gustafson Michael H. Hackett In Honor of Marianne Millikin Hadden Rita H. Haier Gary and Pat Halford James and Diane Hall James and Ruth Hall Phillip M. and Mary E. Hall Judith Lee Hallam Nancy Y. Hammond The Hanes Family, in Memory of Edgar A. and Mary C. Hanes Curt and Margie Harler Duncan and Adrienne Hartley Eloise Haugh, in Loving Memory of her Daughter Susan E. Garrison Donald R. Hausser In Memory of Mr. and Mrs. Fred J. Hausser Mr. and Mrs. Donald G. Havener Mr. and Mrs. David W. Hay In Memory of Lloyd David Hayes John D. Hays and Denise A. Hunyadi Dr. Robert T. Heath and Dr. Elizabeth L. Buchanan H. Arlan Heiser, in Honor of his Wife Janice D. Heiser Ron and Pam Heldorfer Clyde J. Henry, Jr. M. Diane Henry Gary and Ginna Hermann Douglas and Suzanne Hicks Mr. and Mrs. Theodore H. Hieronymus William W. and Alix B. Hill Marilou and Robert Hiltabiddle Barbara Hiney Dr. and Mrs. Thomas Hirsch In Memory of Sarah C. Hirsh Dale and Nancy Holwick David and Nancy Hooker William E. and Donna H. Horton Phoebe Hostetler Lorraine Angus and Sam Hubish and Boys, in Honor of Rev. Caroline G. and Dr. John C. Angus Valerie A. Hughes George Mitchell Hunter Eleanor Mandala Iacobelli Yoshiko Ikuta and Family Glenn T. Imhoff Paul and Jean Ingalls Carol S. and William G. E. Jacobs, in Honor of their Parents Louise R. and Bernard W. Lindgren and Betty L. and Elmer E. Jacobs The James Family Paul J. and Nancy Jankowski Dr. Guy and Judith Jeanblanc Mr. and Mrs. Robert H. Jeffreys Jean and Rick Jerauld, in Memory of F. Meade Bailey Marjorie T. Johnson

Severance Hall 2011-12

Mr. and Mrs. William J. Jones Mr. and Mrs. H.S. Jorgensen, Jr. Mrs. Reynold H. Juengel Don and Nancy Junglas Robert and Mary Kaczmarski Etole and Julian Kahan Mr. and Mrs. Robert E. Kahelin Ben and Charlotte Kahn Philanthropic Fund of Cleveland Mr. and Mrs. Rudolf Kamper Gary and Angela Karges Donald and Maribeth Katt Donna and Milton Katz Dr. Steven and Karen Katz Mr. and Mrs. Ned G. Kendall Winnetta Kennedy and Mickey R. Kennedy Donald R. Kern Mr. and Mrs. Michael T. Kestner Anita and S.I. Khayat Gail and Robert Kichler Mr. and Mrs. Albert F. Klavora Jimmy and Lynn Kleinman Mr. and Mrs. Mark S. Klingbeil Mrs. C. Landon Knight Mr. and Mrs. William F. Knoble Robert and Betty Koch Raymond and Katharine Kolcaba Ursula Korneitchouk E.J. Kovac David B. Krakowski Marjorie N. Krause Michael and Jane Krauss Mr. and Mrs. Lawrence M. Krejci, Jr. Donald N. Krosin Bob Kuebler and Jeff Segal Charles and Jo Anne Lake The Lampl Family, in Loving Memory of Jack W. Lampl, Jr. Jo Ann D. and John J. Lane Mr. and Mrs. Leonard R. Lang Mr. and Mrs. R. Gordon Latimer Dr. and Mrs. Randolph C. Leach Joe, Sue-Min, and Kent Lee Leo and Delores Leiden In Honor of Katherine Grace Lenhart A Friend, in Memory of Mildred L. Lewis Katie Liekoski Judge Sara Lioi Nan and Art Livergood Mrs. Elliot L. Ludvigsen Steven J. Lutgen and Delilah I. Flores Herbert and Marianna Luxenberg John MacFarland and Shirley Wesley Laura and Clark Maciag, in Honor of their Son Samuel Q. Winegardner In Memory of Clara Caldwell Macklin Robert and Sara Madison Robert G. and Nanci Markey Andrew and Sabra Massey Kiki and Vaughan Matthews Robert and Meredith McCreary Barb and Dave McKissock Frank and Mary Mehwald In Memory of Karl Meinhardt Mr. Daniel D. Merrill, in Memory of Kenneth Griggs Merrill Barbara L. and Stephen A. Messner Claudia Metz and Thomas Woodworth Brenda Clark Mikota Mr. and Mrs. Louis T. Milic Richard A. and Caroline Miller Drs. Terry E. and Sara S. Miller Lois and Paul Moeller

Norton Memorial Organ

Catherine D. Montgomery Roger and Sally Mook Mrs. Marta B. Mota Mr. and Mrs. Stephen T. Murphy Mr. and Mrs. Richard B. Nash In Memory of E. Loraine Nelson Roger and Martha Nelson Mary A. Neumann Edward E. and Linda D. Noble Mr. and Mrs. Wilbur Nordstrom Mr. and Mrs. Clarence B. Olmsted William and Barbara Oâ&#x20AC;&#x2122;Riordan Dennis and Lanette Parise Patricia J. Pasco Mr. and Mrs. Timothy Patterson Thomas J. and Thomasina B. Patton James F. and Barbara G. Pelowski Mrs. Margaret P. Pennington Mr. and Mrs. E. Lee Perry in Memory of Mr. and Mrs. A. Dean Perry in Memory of Mr. and Mrs. Edward B. Greene in Memory of John Erwin Hollis in Memory of John and Slocumb Hollis Kenneth and Katherine Petrey Mrs. Gene Phillips and Daughters, in Memory of Bert R. Phillips Janet G. Pierce William T. Plesec and Susan M. Stechschulte Alan and Marjorie Poorman David S. Popa Joyce Pope, in Honor of W. Nicholas Pope Char Portman, in Memory of her Husband Robert G. Portman Robert W. Price Lois and Stanley Proctor Elizabeth J. Ptak Rosella M. Puskas Mr. and Mrs. Linn J. Raney Tom and Helen Rathburn Scott and Mary Rawlings Conrad and Helen Rawski In Honor of Dr. Sandford Reichart The Dr. David and Hope Reynolds Family Dr. and Mrs. Robert W. Reynolds Mr. and Mrs. Bunn S. Rhea Dr. and Mrs. Frederick C. Robbins Viola Startzman Robertson Keith and Margaret Robinson Mr. Timothy D. Robson Paul and Anastacia Rose In Memory of Enid Rothenfeld Marjorie A. Rott Dr. Edward L. Ruch and Dr. Teresa D. Ruch Mr. and Mrs. Robert C. Ruhl In Memory of Estelle Ruth Barry and Karol Sabol Burt Saltzman In Honor of Dorothy S. Sawyer Bob and Ellie Scheuer Sandra J. Schlub Dr. E. Karl and Lisa Schneider The Herbert A. Schneider Family, Brian Jao and Stephen Jao Mr. and Mrs. Richard F. Schubert Robert and Linda Schumacher Richard and Marcy Schwarz Joel and Beth Scott LISTING CONTINUES

61


LISTING CONTINUED

Dr. James L. Sechler and Veronika Ilyes-Sechler Edward Seely Donald M. Shafer and Kathrine Stokes-Shafer Mrs. Robert S. Shankland, in Memory of Dr. Robert S. Shankland Frances L. Sharp Mr. and Mrs. Jerry Shaw Jerry and Laurie Sheets Don, Sue, Sarah, and Mark Sheldon Mr. and Mrs. Terrence E. Sheridan Dr. and Mrs. Earl K. Shirey Richard Shirey William and Marjorie Shorrock David and Julie Siegel Toby and Jay Siegel Mr. and Mrs. Milan J. Skorepa Rosanne H. Skuly Ray and Eleanor Smiley Christopher, Michelle, Jennifer, and Heather Smith Dr. and Mrs. Lynn A. Smith Sidney B. and Beverly J. Smith Mr. and Mrs. William E. Smith Janice Horter Smuda Mr. and Mrs. Jeffrey H. Smythe Dr. and Mrs. Ralph E. Snelson Dr. Marvin and Mimi Sobel In Memory of Jacob and Theodosia Soehnlen The Spencer Family, in Honor and Memory of Paul and Margaret Mendenhall In Memory of Stanley R. Stahurski Helga and Ron Stanger Gary and Sue Stark and Family Dr. Frank J. and Arlene R. Staub Mr. and Mrs. S. Finley Stay, in Honor of the 1999-2000 Gilmour Academy Middle School Ellen M. Stepanian, in Memory of her Parents James H. and Armenuie G. Stepanian Barbara A. Sterk The Families of David J., Paul F., and Roger M. Stiller, in Memory of their Parents Paul F. and Caroline L. Stiller C. Chester Stock James Storry Faye and Sel Strassman

In Loving Memory of Marilyn Henderson Stull by her Husband and Children Bill and Edith Taft Mr. and Mrs. John J. Tanis Anne L. Taylor, M.D., in Honor of M. Alexandra Taylor Ronald E. Teare, in Honor of Charles H. Teare Harold G. Telford The Family of Herman Teske, in his Memory The Thomas Thoburn Family E. Jean Thom Dr. Katherine M. Thomas Katherine K. Tibbetts, in Memory of her Husband William D. Tibbetts In Memory of Dr. and Mrs. Jesse E. Titus and Mr. and Mrs. E. William Simon Betty Trump, in Memory of her Husband Robert C. Trump Robert J. and Marti J. Vagi In Memory of John Valley Mr. and Mrs. Charles Valone, Jr., in Memory of Susan Elizabeth Valone, M.D. The VanDyke Family Donna L. VanRaaphorst Dona Grace Wood Vernon, With Gratitude in Loving Memory of Jabez Hall Wood Kathryn M. Vine Vera Grdina Virant Mr. and Mrs. Elmer F. Vitek In Honor of James Gregory Wagner, Sr. Kenneth C. Waldo, Jr. Cathy and Scott Wallenstein Eleanor M. Warner, in Memory of her Husband William S. Warner Robert, Ruth, and Roberta Wavrek Dr. and Mrs. Frank L. Weakley Suzanne and Bob Weber Susan Weir and Leif Ancker Mr. and Mrs. John Weisel Eugene P. Wenninger and Cheryl A. Casper Western Reserve Theatre Organ Society Rodney and Judy Whitwell Mr. and Mrs. Robert L. Wilcox

Deborah A. and Louise I. Wiles Donald R. Wilkinson, in Memory of his Wife Betty N. Wilkinson Audrey B. and Hazel M. Willacy Jane C. Williams Meredith Williams, in Loving Memory of his Wife Helen Sue Williams Dr. Michael and Barbara Williams Paul and Catherine Williams Reese and Nancy Williams, in Honor of their Parents Mrs. James A. Winton Womenâ&#x20AC;&#x2122;s Committee of The Cleveland Orchestra In Honor of Dr. Denton Wyse Sally T. and Robert E. Yocum, in Memory of Dorothy D. and James M. Taylor Michael D. Zaverton Ms. Liga A. Zemesarajs Marguerite J. Ziegler Matt, Adam, Mary Frances, and Kal Zucker In Memory of Larry E. Zupon

To learn about making an endowment gift of your own in support of The Cleveland Orchestra, please call (216) 231-7521

THE CLEVELANDORCHESTRA clevelandorchestra.com 24/7 news, tickets & more 62

Norton Memorial Organ

The Cleveland Orchestra


0DNLQJWKHZRUOGD EHWWHUSODFHNQRZV QRUHOLJLRQ

7KDW·VZK\ODVW\HDUWKH-HZLVK)HGHUDWLRQRI&OHYHODQGUDLVHGDQG DOORFDWHGPRUHWKDQPLOOLRQWRVRFLDOVHUYLFHHGXFDWLRQDODQG KXPDQLWDULDQRUJDQL]DWLRQVWKDWVXSSRUW&OHYHODQG·V-HZLVKDQGJHQHUDO FRPPXQLWLHVDVZHOODVWKRVHLQPRUHWKDQFRXQWULHVDURXQGWKH ZRUOG7KURXJKWKHJHQHURVLW\RIRXUGRQRUVWKH-HZLVK)HGHUDWLRQRI &OHYHODQGLV2KLR·VODUJHVWJUDQWPDNLQJRUJDQL]DWLRQ



7RJHWKHUZH·UHKHOSLQJWRPDNHWKHZRUOGDEHWWHUSODFHIRUDOOSHRSOH   " $ $& ( !&!" # 

   ( ''' '%!&!" #$

Jewish Federation  


KEN LUDWIGâ&#x20AC;&#x2122;S

THE GAMEâ&#x20AC;&#x2122;S AFOOT

(O R H O L M E S F O R T H E H O L I DAY S)

EXTRA PERFORMANCES ADDED! NOW THROUGH DECEMBER 24

Itâ&#x20AC;&#x2122;s Sherlock Holmes meets Noises Off in the world premiere of a hilarious holiday whodunit by Ken Ludwig, author of Crazy For You.

ph o n e 216.241.6000

o n lin e CLEVELANDPLAYHOUSE.COM



         

Call Alan Weinberg, Managing Partner, at 216-685-1100. Weltman, Weinberg & Reis Co., LPA

64

The Cleveland Orchestra


season spotlight

Brahms

CONCERTOS

January-February 2012 at Severance Hall

In January 2012, The Cleveland Orchestra and Franz Welser-Möst embark on a three-week program of presenting the three solo concertos of Johannes Brahms at Severance Hall, with violinist Lisa Batiashvili and pianist Yefim Bronfman. The mini-festival — featuring the Violin Concerto and both Piano Concertos — reunites Welser-Möst and Bronfman, who performed together in Franz’s debut here as a guest conductor in 1993. More recently, they performed together last year in a special outdoor concert with the Vienna Philharmonic that was televised internationally and released on the Deutsche Grammophon label. “I’m really overwhelmed with excitement to play with Franz and The Cleveland Orchestra,” says Bronfman. “Franz has always been a great conductor, but he has also become such a great personality, with so much knowledge. He has grown into a major figure in music.” Playing the Brahms concertos is probably among “the greatest experiences I’ve ever had,” he continues. “Especially playing the second one, which is so majestic. There is Beethoven’s ‘Emperor’ Concerto, but maybe Brahms Two is also an Emperor.” “From the very first note,” says Bronfman, “you can tell this is a journey, that this requires a collaboration between the soloist and the orchestra at all times. It’s always an exchange of ideas, back and forth. And the cello solo is arguably the most famous in the repertoire. I cannot think of a better orchestra than Cleveland to play with, for the chamber music character of the Second Concerto.’’ For tickets, visit clevelandorchestra.com. Severance Hall 2011-12

Brahms Concerto Festival

65


Endowed Funds

funds established as of June 2011

Generous contributions to the endowment have been made to support specific artistic initiatives, ensembles, educational programming and performances, facilities maintenance costs, touring and residencies, and more. These funding opportunities currently represent new gifts of $250,000 or more. For information about making your own endowment gift to the Orchestra, please call (216) 231-7549.

ARTISTIC endowed funds support a variety of programmatic initiatives ranging from guest artists and radio broadcasts to the all-volunteer Cleveland Orchestra Chorus. American Conductors Fund

Guest Artist

Douglas Peace Handyside Holsey Gates Handyside

The Eleanore T. and Joseph E. Adams Fund Mrs. Warren H. Corning The Gerhard Foundation Margaret R. Griffiths Trust The Virginia M. and Newman T. Halvorson Fund The Hershey Foundation The Humel Hovorka Fund Kulas Foundation The Payne Fund Elizabeth Dorothy Robson Dr. and Mrs. Sam I. Sato The Julia Severance Millikin Fund The Sherwick Fund Mr. and Mrs. Michael Sherwin Sterling A. Spaulding Mr. and Mrs. James P. Storer Mrs. Paul D. Wurzburger

Artist-in-Residence Malcolm E. Kenney

Artistic Collaboration The Keithley Fund

Young Composers Jan R. and Daniel R. Lewis

Friday Morning Concerts Mary E. and F. Joseph Callahan Foundation

International Touring Frances Elizabeth Wilkinson

Cleveland Orchestra Chorus Jerome and Shirley Grover Meacham Hitchcock and Family

Radio Broadcasts Robert and Jean Conrad

Concert Previews

Unrestricted

Dorothy Humel Hovorka

John P. Bergren and Sarah S. Evans

EDUCATION endowed funds help support programs that deepen connections to symphonic music at every age and stage of life, including training, performances, and classroom resources for thousands of students and adults each year. Education

Education Programs

Anonymous, in memory of Georg Solti Hope and Stanley I. Adelstein Kathleen L. Barber Isabelle and Ronald Brown Dr. Jeanette Grasselli Brown and Dr. Glenn R. Brown Alice B. Cull Memorial Frank and Margaret Hyncik Junior Committee of The Cleveland Orchestra Mr. and Mrs. David T. Morgenthaler

Cleveland Orchestra Youth Orchestra The George Gund Foundation Christine Gitlin Miles, in honor of Jahja Ling Jules and Ruth Vinney Touring Fund

Classroom Resources Charles and Marguerite C. Galanie

Musical Rainbows

Education Concerts Week The Max Ratner Education Fund, given by the Ratner, Miller, and Shafran families and by Forest City Enterprises, Inc.

66

The William N. Skirball Endowment

Pysht Fund

Endowed Funds

The Cleveland Orchestra


Supporting The Cleveland Orchestra THE CLEVELAND ORCHESTRA

SEVERANCE HALL endowed funds support performance initiatives for the Orchestra’s winter season in Cleveland and maintenance of Severance Hall: Severance Guest Conductor

Organ

Roger and Anne Clapp James and Donna Reid

D. Robert and Kathleen L. Barber Arlene and Arthur Holden Kulas Foundation Descendants of D.Z. Norton Oglebay Norton Foundation

Keyboard Maintenance William R. Dew The Frederick W. and Janet P. Dorn Foundation Mr. and Mrs. Richard A. Manuel Vincent K. and Edith H. Smith Memorial Trust

Severance Hall Preservation Severance family and friends

BLOSSOM MUSIC CENTER and BLOSSOM FESTIVAL endowed funds support the Orchestra’s summer performances and maintenance of Blossom Music Center. Blossom Festival Guest Artist

Landscaping and Maintenance

Dr. and Mrs. Murray M. Bett The Hershey Foundation The Payne Fund Mr. and Mrs. William C. Zekan

The Bingham Foundation Emily Blossom family members and friends The GAR Foundation John S. and James L. Knight Foundation

Blossom Festival Family Concerts David E. and Jane J. Griffiths

CENTER FOR FUTURE AUDIENCES — Announced in October 2010, the Center for Future Audiences will transform the way The Cleveland Orchestra attracts and welcomes audiences to Severance Hall, throughout Northeast Ohio, and around the world. The Center was created with a generous naming lead gift of $20 million from the Maltz Family Foundation providing onethird of the $60 million endowment that will eventually help fully fund these activities. T H E C L E V E L A N D

O R C H E S T R A

CENTER FOR FUTURE AUDIENCES Endowed by the Maltz Family Foundation

Severance Hall 2011-12

Endowed Funds

67


The Cleveland Orchestra

Guide to Fine Schools

Beautifully restored and updated, Washington Place Bistro & Inn is the perfect spot for business, entertaining, relaxing or romance. Intimate, comfortable dining rooms, a warm attractive lounge, exquisite patio, and well-appointed sleeping rooms round out this charming gem in Little Italy.

Consistently ranked among â&#x20AC;&#x153;Best Communities for Music Educationâ&#x20AC;? in the Nation!

216-898-8300 www.berea.k12.oh.us

2WKHUĂ&#x20AC;QHVFKRROVDGYHUWLVLQJLQ7KH&OHYHODQG2UFKHVWUD¡V 6HYHUDQFH+DOOSURJUDPVLQFOXGH

Baldwin-Wallace College Conservatory of Music 440-826-2369 Cleveland Institute of Music 216-791-5000 Cleveland State University Kulas Series of Keyboard Conversations with Jeffrey Siegel 216-687-5018 Gilmour Academy 440-473-8050 The Oberlin Conservatory of Music 440-775-8413

â&#x20AC;&#x201D; 2011 AWARDS â&#x20AC;&#x201D; Best New Restaurant Best Romantic Resturant 2011 Top Cleveland Patio 2011

2203 Cornell Road | Cleveland, OH 44106 216-791-6500 washingtonplacelittleitaly.com

Larchmere Boulevard Clevelandâ&#x20AC;&#x2122;s Art and Antique District (one block north of Shaker Square) A remarkable ass

A remarkable assortment of more than 50 shops â&#x20AC;&#x201C; art, antique, and craft galleries; restaurants; services; designer and vintage clothing; and specialty shops. Qbujp!Tfbujoh

xxx/dppmqmbdftupfbu/dpn

Sftfswbujpot!Bddfqufe

Xfeoftebzt;!Bqqfuj{fs-!Fousff!BOE!Efttfsu!pomz!%33"

Ibqqz!Ipvs; Uvft/Ă&#x2019;Gsj/!5qnĂ&#x2019;8qn

Sfwfstf!Ibqqz!Ipvs; Gsj/!'!Tbu/!21qnĂ&#x2019;2bn

/RJDQEHUU\%RRNVFRP

Vscbo!Dbgf Mbsdinfsf

/DUFKPHUHÂ&#x160;

Uvftebzt;!ibmg!pgg!BOZ!cpuumf!pg!xjof"

Ejoofs; Uvft/Ă&#x2019;Uivst/!5qnĂ&#x2019;21qn Gsj/!'!Tbu/!5qnĂ&#x2019;23bn Csvodi; Tbu/!'!Tvo/!21bnĂ&#x2019;5qn

23613!Mbsdinfsf!Cmwe/-!Dmfwfmboe-!PI!55231!Â&#x2021; 327.8:2.1:29

Views    of Brittany and    Paris 

   14 Recently Discovered Oil Paintings  

    Abel Warshawsky (Cleveland 1883-1962)

 Monday,    

Tuesday & Thursday 12-5 p.m.  Wednesday, Friday & Saturday 12-6 p.m.

      CorcoranFineArts.com

 !" Larchmere # $  Blvd. %& 216-767-0770 !'!'"''" 12610

68

8E:@E>,?<<G

K?<

Corcoran  Arts & 

Appraisals  

WEARABLEART CONTEMPORARYCRAFT GIFTS /NE OF A KINDAND LIMITEDEDITIONCLOTHING

,ARCHMERE"LVD    #ALLFORUPCOMINGEVENTS

-ON &RIAMTOPMq3ATAMTOPMq3UNTOPM

The Cleveland Orchestra


The Cleveland Orchestra: Serving the Community The Cleveland Orchestra’s Education and Community programs provide shared musical experiences that engage, inspire, support, and deepen connections with audiences throughout Northeast Ohio

P H OTO G R A P H Y BY R O G E R M A S T R O I A N N I

T H E C L E V E L A N D O R C H E S T R A has a long and proud history of sharing the value and joy of music with citizens throughout Northeast Ohio. Education and community programs date to the Orchestra’s founding in 1918 and have remained a central focus of the ensemble’s actitivities for over ninety years. Today, with the support of many generous individual, foundation, corporate, and governmental funding partners, the Orchestra’s educational and community programs reach more than 70,000 young people and adults annually, helping to foster a love of music and a lifetime of involvement with the musical arts. On these pages, we share photographs from a sampling of these many programs. For additional information about these and other programs, visit us at clevelandorchestra.com or contact the Education & Community Programs Office by calling (216) 231-7355.

School buses delivering students to Severance Hall. More than four million schoolchildren have been introduced to symphonic music in nine decades of Cleveland Orchestra education concerts. Severance Hall 2011-12

Education & Community

69


T H E

The Cleveland Orchestra helps celebrate the seasons and special events throughout the year. On October 30, the season’s first Family Concert featured the second annual “Halloween Spookatcular!” including a special audience costume contest.

C L E V E L A N D

Music Study Groups provide a way of exploring the Orchestra’s music in depth. These professionally led classes meet weekly to explore the music being played each week and the stories behind the composers’ lives.

A Family Concert featuring Stravinsky’s Firebird Suite brought audiences up close for a thrilling performance by Academy Trainees of the Joffrey Ballet and performers from the Cleveland School of Dance. The Joffrey Academy returned on December 2 to Severance Hall for the season’s second Family Concert, “Scenes from Tchaikovsky’s Nutcracker.”

70

Education & Community

The Cleveland Orchestra


O R C H E S T R A

The Cleveland Orchestra is creating “Musical Neighborhoods” in Cleveland preschools as part of PNC Grow Up Great, using music to support pre-literacy and school readiness skills.

THANK YOU

Cleveland Orchestra clarinetist Robert Woolfrey leads a Learning Through Music program at H. Barbara Booker School in Cleveland.

The Cleveland Orchestra’s Education programs are made possible by many generous individuals, foundations, and corporations, including: The Abington Foundation The Eva L. and Joseph M. Bruening Foundation Chubb Group of Insurance Companies Cleveland Clinic The Cleveland Foundation Conn-Selmer, Inc. Dominion Foundation The Harry K. Fox and Emma R. Fox Charitable Foundation Giant Eagle Muna & Basem Hishmeh Foundation Martha Holden Jennings Foundation JPMorgan Chase Foundation The Laub Foundation The Lincoln Electric Foundation The Lubrizol Corporation The Nord Family Foundation Ohio Arts Council Ohio Savings Bank PNC The Reinberger Foundation Albert G. & Olive H. Schlink Foundation The Sherwin-Williams Foundation The South Waite Foundation Surdna Foundation Thomas H. White Foundation, a KeyBank Trust The Edward & Ruth Wilkof Foundation Women’s Committee of The Cleveland Orchestra

Severance Hall 2011-12

Education & Community

More than 1,000 talented young musicians have performed as members of the Cleveland Orchestra Youth Orchestra in the 25 years since its founding in 1986.

71


The Cleveland Orchestra guide to

Fine Shops & Services IMMIGRATION LAW THE CAXTON BUILDING 812 HURON ROAD SUITE 601 CLEVELAND, OH 44115

Ă&#x152;    i IMMIGRATION

\

v   

ROSNERLAWCOM

\

WWWROSNERLAWCOM

$63,5( $8&7,216 ),1($57 $17,48(6

ZZZDVSLUHDXFWLRQVFRP

$XFWLRQHHUV $SSUDLVHUVRI )LQH$UW$QWLTXHVDQG-HZHOU\ 6XSHULRU$YH6WH &OHYHODQG2+ 3KRQH

Michael Hauser DMD MD Implants and Oral Surgery For Music Lovers Beachwood 216-464-1200

Â&#x192; Â&#x192; Â&#x192; Â&#x192;

www.drhauser.com >VYSKJSHZZ performances. >VYSKJSHZZ audiences. Advertise among friends in The Cleveland Orchestra programs.

LPCpublishing.com

Insulation Systems 

Letâ&#x20AC;&#x2122;s talk.

contact John Moore 216.721.4300 jmoore@LPCpub.com

EXQUISITE PIECES VISIT OUR NEW IN A SURPRISING SHOWROOM SETTING

Recognized experts re-insulating period-built homes using the latest Green Technology â&#x20AC;&#x201C; featuring Thermal Imaging 440.975.1122 www.insulationsystems.net



9F6;4";6<; )XOO6HUYLFH&DWHULQJ

AAVery verySurprising special place Place

on Chagrin Blvd., across across from from Eton. Eton

Ă&#x201C;n{näĂ&#x160; Â&#x2026;>}Ă&#x20AC;Â&#x2C6;Â&#x2DC;Ă&#x160; Â?Ă&#x203A;`°]Ă&#x160;7Â&#x153;Â&#x153;`Â&#x201C;iĂ&#x20AC;iĂ&#x160;6Â&#x2C6;Â?Â?>}iĂ&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°nĂ&#x17D;Â&#x2122;°Ă&#x2C6;£ää °]Ă&#x160;Ă&#x160; Â?iĂ&#x203A;i°Ă&#x160;Ă&#x152;Ă&#x192;°Ă&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°Â&#x2122;Ă&#x17D;Ă&#x201C;°xxĂ&#x17D;x >Ă&#x17E;wiÂ?`Ă&#x160;EĂ&#x160;iiĂ&#x160;,`Ă&#x192;°Ă&#x160; >Ă&#x17E;wiÂ?`Ă&#x160;EĂ&#x160;iiĂ&#x160;,`Ă&#x192;°Ă&#x160; Â?iĂ&#x203A;i°Ă&#x160;Ă&#x152;Ă&#x192;°Ă&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°Â&#x2122;Ă&#x17D;Ă&#x201C;°xxĂ&#x17D;x

72





3HUVRQDO&KHI6HUYLFH

999T(.;+0)10+10T%1/ FEJTIHLTJJMM 'HEUD.UDXV&KHIa&KULV:R]QLDN&KHI

The Cleveland Orchestra


11001 Euclid Avenue, Cleveland, Ohio 44106 CLEVELANDORCHESTRA.COM

AT SE V E R A NC E H A LL CONCERT DINING AND CONCESSION SERVICE Severance Restaurant at Severance Hall is open for concert dining. For reservations, call (216) 231-7373, or click on the reservations link at clevelandorchestra.com Concert concession service of beverages and light refreshments is available before most concerts and at intermissions in the Smith Lobby on the street level, in the Bogomolny-Kozerefski Grand Foyer, and in the Dress Circle Lobby.

FREE PUBLIC TOURS Free public tours of Severance Hall are offered on select Sundays during the year. Free public tours of Severance Hall are being offered this season on November 27, February 12, March 18, and May 13. For additional information or to book for one of these tours, please call the Cleveland Orchestra Ticket Office at (216) 231-1111. Private tours can be arranged for a fee by calling (216) 231-7421.

THE CLEVELAND ORCHESTRA STORE A wide variety of items relating to The Cleveland Orchestra — including logo apparel, compact disc recordings, and gifts — are available for purchase at the Cleveland Orchestra Store before and after concerts and during intermission. The Store is also open Tuesday through Friday from 11 a.m. to 6 p.m. Cleveland Orchestra subscribers receive a 10% discount on most items purchased. Call (216) 231-7478 for more information, or visit the Store online at clevelandorchestra.com

RENTAL OPPORTUNITIES Severance Hall, a Cleveland landmark and home of the world-renowned Cleveland Orchestra, is the perfect location for business meetings and conferences, pre- or post-concert dinners and receptions, weddings, and social events. Exclusive catering provided by Sammy’s. Premium dates are available. Call the Facility Sales Office at (216) 231-7420 or email to hallrental@clevelandorchestra.com

BE FO R E T H E CO NC E R T GARAGE PARKING AND PATRON ACCESS Parking can be purchased for $10 per vehicle when space in the Campus Center Garage permits. However, the garage often fills up well before concert time; only ticket holders who purchase prepaid parking passes are ensured a parking space. Overflow parking is available in CWRU Lot 1 off Euclid Avenue, across from Severance Hall; University Circle Lot 13A on Adelbert Road; and the Cleveland Botanical Garden. Pre-paid parking for the Campus Center Garage can be purchased in advance through the Ticket Office for $14 per concert. This pre-paid parking ensures you a parking space, but availability of prepaid parking passes is limited. To order pre-paid parking, call the Cleveland Orchestra Ticket Office at (216) 231-1111.

FRIDAY MATINEE PARKING

For our patrons’ convenience, an ATM is located in the Lerner Lobby of Severance Hall, on the ground floor across from the Cleveland Orchestra Store.

Due to limited parking availability for Friday Matinee performances, patrons are strongly encouraged to take advantage of convenient off-site parking and round-trip shuttle services available from the Cedar Hill Baptist Church (12601 Cedar Road). The fee for this service is $10.

QUESTIONS

CONCERT PREVIEWS

ATM — Automated Teller Machine

If you have any questions, please ask an usher or a staff member, or call (216) 231-7300 during regular weekday business hours, or email to info@clevelandorchestra.com

Severance Hall 2011-12

Guest Information

Concert Previews at Severance Hall are presented in Reinberger Chamber Hall on the ground floor, except when noted, beginning one hour before the start of most subscription concerts.

73


AT T H E CO NC E R T COAT CHECK Complimentary coat check is available for concertgoers. The main coat check is located on the street level midway along each gallery on the ground floor.

PHOTOGRAPHY, VIDEO, AND AUDIO RECORDING For the safety of guests and performers, photography and videography are strictly prohibited during performances at Severance Hall.

REMINDERS Please disarm electronic watch alarms and turn off all pagers, cell phones, and mechanical devices before entering the concert hall. Patrons with hearing aids are asked to be attentive to the sound level of their hearing devices and adjust them accordingly. To ensure the listening pleasure of all patrons, please note that anyone creating a disturbance of any kind may be asked to leave the concert hall.

LATE SEATING Performances at Severance Hall start at the time designated on the ticket. In deference to the comfort and listening pleasure of the audience, late-arriving patrons will not be seated while music is being performed. Latecomers are asked to wait quietly until the first break in the program, when ushers will assist them to their seats. Please note that performances without intermission may not have a seating break. These arrangements are at the discretion of the House Manager in consultation with the conductor and performing artists.

SERVICES FOR PERSONS WITH DISABILITIES Severance Hall staff are experienced in assisting patrons to find seats that meet their needs. Wheelchair seating is available on the Orchestra Level, Box Level, and Dress Circle, and in Reinberger Chamber Hall at a variety of prices. For patrons who prefer to transfer from a wheelchair, seats with removable arms are available on the Orchestra Level in the Concert Hall. ADA seats are held for those with special needs until 48 hours prior to the performance, unless sell-out conditions exist before that time. Severance Hall features seating locations for people with mobility impairments and offers wheelchair transport for all performances. To discuss your seating requirements, please call the Ticket Office at (216) 231-1111. TTY line access is available at the public pay telephone located in the Security Office. Infrared Assistive Listening Devices are available from a

74

Head Usher or the House Manager for all performances. If you need assistance, please contact the House Manager at (216) 231-7425 in advance if possible. Service animals are welcome at Severance Hall. Please notify the Ticket Office when purchasing tickets.

IN THE EVENT OF AN EMERGENCY Contact an usher or a member of the house staff if you require medical assistance. Emergency exits are clearly marked throughout the building. Ushers and house staff will provide instructions in the event of an emergency.

SECURITY For security reasons, backpacks, musical instrument cases, and large bags are prohibited in the concert halls. These items must be checked at coat check and may be subject to search. Severance Hall is a firearms-free facility. No person may possess a firearm on the premises.

CHILDREN Regardless of age, each person must have a ticket and be able to sit quietly in a seat throughout the performance. Season subscription concerts are not recommended for children under the age of eight. However, Family Concerts and Musical Rainbow programs are designed for families with young children. Cleveland Orchestra Youth Orchestra performances are recommended for older children.

T IC K ET SE RV IC ES TICKET EXCHANGES Subscribers unable to attend on a particular concert date can exchange their tickets for a different performance of the same week’s program. Subscribers may exchange their subscription tickets for another subscription program up to five days prior to a performance. There will be no service charge for the five-day advance ticket exchanges. If a ticket exchange is requested within 5 days of the performance, there is a $10 service charge per concert. Visit clevelandorchestra.com for details and blackout dates.

UNABLE TO USE YOUR TICKETS? Ticket holders unable to use or exchange their tickets are encouraged to notify the Ticket Office so that those tickets can be resold. Because of the demand for tickets to Cleveland Orchestra performances, “turnbacks” make seats available to other music lovers and can provide additional income to the Orchestra. If you return your tickets at least 2 hours before the concert, the value of each ticket can be used as a tax-deductible contribution. Patrons who turn back tickets receive a cumulative donation acknowledgement at the end of each calendar year.

Guest Information

The Cleveland Orchestra


CUYAHOGA ARTS & CULTURE IS PROUD TO SUPPORT APOLLO'S FIRE ‡ BAYARTS ‡ BECK CENTER FOR THE ARTS ‡ CLEVELAND BOTANICAL GARDEN ‡ CLEVELAND INTERNATIONAL FILM FESTIVAL‡ CLEVELAND MUSEUM OF ART‡ CLEVELAND MUSEUM OF NATURAL HISTORY‡THE CLEVELAND ORCHESTRA‡ CLEVELAND PLAY HOUSE‡CLEVELAND PUBLIC THEATRE‡ DANCECLEVELAND‡ GREAT LAKES SCIENCE CENTER‡ GREAT LAKES THEATER FESTIVAL‡

SHAKER LAKES ‡ OPERA CLEVELAND ‡ ROCK AND ROLL HALL OF FAME AND MUSEUM ‡ SPACES ‡ WESTERN RESERVE HISTORICAL SOCIETY‡& MANY OTHERS

WWW.CACGRANTS.ORG 216 515 8303

Severance Hall 2011-12

P H OTO BY R O G E R MA S T R O I A N N I

GROUNDWORKS DANCETHEATER‡HEIGHTS YOUTH THEATRE‡IDEASTREAM‡KARAMU HOUSE‡MALTZ MUSEUM OF JEWISH HERITAGE‡MUSEUM OF CONTEMPORARY ART CLEVELAND‡NATURE CENTER AT

75


216.791.8000 www.benrose.org A leader in service, research, and advocacy for older adults

The Cleveland Orchestra guide to Fine Dining

photo by Hernan Herrero

World-class performances. World-class audiences. Advertise among friends in The Cleveland Orchestra programs.

Letâ&#x20AC;&#x2122;s talk.

TheCanopy MediterraneanGrille Mediterranean & Middle Eastern Cuisine

contact John Moore 216.721.4300 jmoore@livepub.com

www.livepub.com

The Tudor Arms Hotel, 10660 Carnegie Avenue 216-456-2684 t Free valet parking with Orchestra ticket! Join us for dinner before or after the orchestra. Reservations â&#x20AC;&#x2122;til 11pm on Thurs. ~ 216.721.0300 2198 Murray Hill Rd. U Cleveland, OH 44106 U mangelos.com

Open for lunch Tuesday ~ Friday

In the heart of Little Italy! *APANESE)ZAKAYA!SIAN"ISTRO 3HAKER3QUARE 3HAKER3QUARE\\ \\WWWSASAMATSUCOM WWWSASAMATSUCOM /PENUNTIL-IDNIGHT-ON 3AT PM3UN

WWW.CLUB

ISABELLA.COM

2175 CORNELL ROAD CLEVELAND, OHIO 44106 216.229.1111

76

two great restaurants minutes from Severance Hall... university circle 216.231.1234 shaker square 216.295.1200 www.sergioscleveland.com

The Cleveland Orchestra


THE CLEVELAN D ORCHESTRA

Corporate Support The Cleveland Orchestra gratefully acknowledges and salutes these corporations for their generous support toward the Orchestra’s Endowment, Annual Fund, Special Projects, and/or Programs. Additional legacy gifts from these organizations and others are recognized through The Cleveland Orchestra Heritage Society.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

The Partners in Excellence program salutes companies with annual contributions of $100,000 and more, exemplifying leadership and commitment to artistic excellence at the highest level.

$5 MILLION AND MORE

KeyBank $1 MILLION TO $5 MILLION

Baker Hostetler Bank of America Eaton Corporation FirstEnergy Foundation Forest City Enterprises, Inc. The Goodyear Tire & Rubber Company The Lubrizol Corporation / The Lubrizol Foundation Merrill Lynch NACCO Industries, Inc. Parker Hannifin Corporation The Plain Dealer PNC Bank PolyOne Corporation The J. M. Smucker Company The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. Listing as of September 2011.

gifts of $2,500 or more during the past year, as of September 20, 2011

PARTNERS IN EXCELLENCE $300,000 AND MORE

KeyBank The Lubrizol Corporation NACCO Industries, Inc. PNC Raiffeisenlandesbank Oberösterreich (Europe) PARTNERS IN EXCELLENCE $200,000 TO $299,999

Baker Hostetler Eaton Corporation Forest City Enterprises, Inc. The Plain Dealer PARTNERS IN EXCELLENCE $100,000 TO $199,999

The J. M. Smucker Company Medical Mutual of Ohio $50,000

TO

$99,999

FirstMerit Bank The Goodyear Tire & Rubber Company Jones Day Parker Hannifin Corporation The Sage Cleveland Foundation Tele München Group (Europe) $25,000 TO $49,999 Conn-Selmer, Inc. Giant Eagle JPMorgan Chase Foundation Northern Trust Bank of Florida (Miami) Quality Electrodynamics (QED) Richard L. Bowen & Associates, Inc. Squire, Sanders & Dempsey (US) LLP Thompson Hine LLP

$2,500 TO $24,999 Akron Tool & Die Company American Fireworks, Inc. American Greetings Corporation Arnstein & Lehr LLP (Miami) Bank of America

Severance Hall 2011-12

Corporate Support

BDI Brouse McDowell Eileen M. Burkhart & Co. LLC Buyers Products Company Calfee, Halter & Griswold LLP The Cliffs Foundation Community Behavioral Health Center Consolidated Graphics Group, Inc. Dealer Tire LLC Dollar Bank Dominion Foundation Ernst & Young LLP Evarts-Tremaine-Flicker Company Feldman Gale, P.A. (Miami) Ferro Corporation Fifth Third Bank Frantz Ward LLP Gallagher Benefit Services Genovese Vanderhoof & Associates Great Lakes Brewing Company Gross Builders Hahn Loeser + Parks LLP Higer Lichter & Givner LLP (Miami) Houck Anderson P.A. (Miami) Hyland Software, Inc. Keithley Foundation The Lincoln Electric Foundation C. A. Litzler Co., Inc. Live Publishing Company LNE Group / Lee Weingart (Europe) Macy’s Miba AG (Europe) MindCrafted Systems MTD Products, Inc. Nordson Corporation North Coast Container Corp. Northern Haserot Oatey Co. Octavia Press Ohio CAT Ohio Savings Bank, A Division of New York Community Bank Olympic Steel, Inc. Park-Ohio Holdings Corp. PolyOne Corporation The Prince & Izant Company Richey Industries, Inc. RPM International Inc. SEMAG GmbH (Europe) The Sherwin-Williams Company Stearns Weaver Miller Weissler Alha (Miami) Stern Advertising Agency Summa Health System Swagelok Company Towers Watson TriMark S.S. Kemp Trionix Research Laboratory, Inc. Tucker Ellis & West LLP Ulmer & Berne LLP Ver Ploeg & Lumpkin, P.A. Westlake Reed Leskosky Anonymous (3)

77


Live Publishing helps you

break through the marketing clutter to deliver powerful, memorable messages

Live Publishing provides comprehensive communications and marketing services to a who’s who roster of clients, including the world-renowned Cleveland Orchestra. Our unsurpassed client satisfaction is built on decades of hard-earned experience, in all the various aspects of magazine publishing and custom marketing communications. We know how to deliver the most meaningful messages in the most effective media, all in the most cost-effective manner. We’re easy to do business with, and our experienced crew has handled every kind of project – from large to small, print to web.

2026 Murray Hill Road, Suite 103, Cleveland, Ohio 44106 216.721.1800 email: info@livepub.com web: www.lpcpublishing.com


THE CLEVELAN D ORCHESTRA

Foundation & Government Support The Cleveland Orchestra gratefully acknowledges and salutes these Foundations and Government agencies for their generous support toward the Orchestraâ&#x20AC;&#x2122;s Endowment, Annual Fund, Special Projects, and/or Programs. Additional legacy gifts from these organizations and others are recognized through The Cleveland Orchestra Heritage Society.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

$1 MILLION AND MORE

$10 MILLION AND MORE

The Cleveland Foundation Maltz Family Foundation State of Ohio Ohio Arts Council The Kelvin and Eleanor Smith Foundation $5 MILLION TO $10 MILLION

Cuyahoga County residents through Cuyahoga Arts & Culture Kulas Foundation $1 MILLION TO $5 MILLION

Ann and Gordon Getty Foundation The GAR Foundation The George Gund Foundation The Louise H. and David S. Ingalls Foundation Martha Holden Jennings Foundation John S. and James L. Knight Foundation (Miami) Andrew W. Mellon Foundation John P. Murphy Foundation David and Inez Myers Foundation National Endowment for the Arts The Payne Fund The Reinberger Foundation

gifts of $2,000 or more during the past year, as of September 20, 2011

The Cleveland Foundation Cuyahoga County residents through Cuyahoga Arts and Culture Maltz Family Foundation The Kelvin and Eleanor Smith Foundation $250,000 TO $500,000

Andrew W. Mellon Foundation David and Inez Myers Foundation Ohio Arts Council The Skirball Foundation $100,000 TO $249,999

Sidney E. Frank Foundation The GAR Foundation The George Gund Foundation Martha Holden Jennings Foundation Kulas Foundation The Mandel Foundation The Miami Foundation, from a fund established by the John S. and James L. Knight Foundation (Miami) John P. Murphy Foundation Surdna Foundation $50,000 TO $99,999

The George W. Codrington Charitable Foundation The Louise H. and David S. Ingalls Foundation Myra Tuteur Kahn Memorial Fund of The Cleveland Foundation National Endowment for the Arts The Payne Fund The Reinberger Foundation $20,000 TO $49,999

The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. Listing as of September 2011.

The Abington Foundation Akron Community Foundation The Helen C. Cole Charitable Trust The Mary S. and David C. Corbin Foundation The Gerhard Foundation, Inc. Ann and Gordon Getty Foundation Elizabeth Ring Mather and William Gwinn Mather Fund The Nonneman Family Foundation

Severance Hall 2011-12

Foundation/Government Support

The Esther and Hyman Rapport Philanthropic Trust The Sisler McFawn Foundation

$2,000 TO $19,999 Ayco Charitable Foundation The Ruth and Elmer Babin Foundation Bicknell Fund The Eva L. and Joseph M. Bruening Foundation The Collacott Foundation The Frances G. and Lewis Allen Davies Endowment Fund Mary and Dr. George L. Demetros Charitable Trust Elisha-Bolton Foundation Fisher-Renkert Foundation The Harry K. Fox and Emma R. Fox Charitable Foundation Funding Arts Network (Miami) The Helen Wade Greene Charitable Trust The Hankins Foundation Muna & Basem Hishmeh Foundation Richard H. Holzer Memorial Foundation The Kangesser Foundation The Laub Foundation Victor C. Laughlin, M.D. Memorial Foundation Trust The G. R. Lincoln Family Foundation Margaret Clark Morgan Foundation Miami-Dade County Department of Cultural Affairs (Miami) Laura R. & Lucian Q. Moffitt Foundation The Nord Family Foundation Paintstone Foundation The Charles E. & Mabel M. Ritchie Memorial Foundation The Leighton A. Rosenthal Family Foundation SCH Foundation Albert G. & Olive H. Schlink Foundation The Sherwick Fund Lloyd L. and Louise K. Smith Memorial Foundation The South Waite Foundation Jean C. Shroeder Foundation The Taylor-Winfield Foundation The George Garretson Wade Charitable Trust The S. K. Wellman Foundation The Wells Family Foundation, Inc. Thomas H. White Foundation, a KeyBank Trust The Edward & Ruth Wilkof Foundation Wright Foundation The Wuliger Foundation Anonymous (2)

79


THE CLEVELAN D ORCHESTRA

Individual Support The Cleveland Orchestra and Musical Arts Association gratefully recognize the individuals listed here, who have provided generous gifts of cash or pledges of $2,500 or more in annual operating, endowment, special project, or benefit event support.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

gifts during the past year, as of September 20, 2011

$10 MILLION AND MORE

INDIVIDUAL GIFTS OF $500,000 AND MORE

Daniel R. and Jan R. Lewis (Miami)

Mr. and Mrs. Alexander M. Cutler Daniel R. and Jan R. Lewis (Miami)

$5 MILLION TO $10 MILLION

INDIVIDUAL GIFTS OF $200,000 TO $499,999

Mr. Richard J. Bogomolny and Ms. Patricia M. Kozerefski Mr. and Mrs. Alexander M. Cutler Mrs. Norma Lerner and The Lerner Foundation Mr. and Mrs. Albert B. Ratner Anonymous

Irma and Norman Braman (Miami) The Walter and Jean Kalberer Foundation Susan Miller (Miami) Mr. and Mrs. Albert B. Ratner James and Donna Reid

$1 MILLION TO $5 MILLION

Irma and Norman Braman (Miami) Mr. and Mrs. Francis J. Callahan Mrs. Anne M. Clapp Mr. George Gund III Mr. and Mrs. Michael J. Horvitz Mr. James D. Ireland III The Walter and Jean Kalberer Foundation Mr. and Mrs. Joseph P. Keithley Mr. and Mrs. Dennis W. LaBarre Susan Miller (Miami) Sally S. and John C. Morley The Family of D. Z. Norton The Honorable and Mrs. John Doyle Ong Mr. and Mrs. Alfred M. Rankin, Jr. Charles and Ilana Horowitz Ratner James and Donna Reid Barbara S. Robinson Anonymous (2) The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. As of September 2011.

80

INDIVIDUAL GIFTS OF $100,000 TO $199,999

Ben and Ingrid Bowman Francie and David Horvitz (Miami) Mr. and Mrs. Michael J. Horvitz Mr. and Mrs. Joseph P. Keithley Dr. and Mrs. Herbert Kloiber (Europe) Mrs. Norma Lerner Mr. and Mrs. Herbert McBride Sally S. and John C. Morley Ms. Ginger Warner (Cleveland, Miami) Janet and Richard Yulman (Miami) INDIVIDUAL GIFTS OF $75,000 TO $99,999

Robert and Jean* Conrad Trevor and Jennie Jones Mr. and Mrs. Douglas A. Kern Mr. and Mrs. Dennis W. LaBarre The Honorable and Mrs. John Doyle Ong Julia and Larry Pollock Barbara S. Robinson

Leadership Council The Leadership Council salutes those extraordinary donors who have pledged to sustain their annual giving at the highest level for three years or more. Leadership Council donors are recognized in these Annual Support listings with the Leadership Council symbol next to their name:

Individual Donors

Severance Hall 2011-12


INDIVIDUAL GIFTS OF $50,000 TO $74,999

John P. Bergren* and Sarah M. Evans Mr. William P. Blair III Mr. Richard J. Bogomolny and Ms. Patricia M. Kozerefski Mr. and Mrs. Charles P. Bolton Hector D. Fortun (Miami) James D. Ireland III R. Kirk Landon and Pamela Garrison (Miami) Peter B. Lewis and Janet Rosel (Miami) Toby Devan Lewis Mrs. Emma S. Lincoln Ms. Nancy W. McCann Mr. and Mrs. Alfred M. Rankin, Jr. Mr. and Mrs. Richard K. Smucker David A. and Barbara Wolfort Anonymous INDIVIDUAL GIFTS OF $30,000 TO $49,999

Dr. and Mrs. Wolfgang Berndt (Europe) Blossom Women’s Committee The Brown and Kunze Foundation Jeanette Grasselli Brown and Glenn R. Brown Mrs. Gerald N. Cannon Mr. and Mrs. Matthew V. Crawford Mr. and Mrs. Geoffrey Gund George Gund Mrs. Marguerite B. Humphrey Giuliana C. and John D. Koch Foundation (Cleveland, Miami) Dr. Vilma L. Kohn Charlotte R. Kramer Mr. and Mrs. Jon A. Lindseth Ms. Beth E. Mooney Mrs. Alfred M. Rankin, Sr. Brian and Patricia Ratner Charles and Ilana Horowitz Ratner Luci and Ralph* Schey Mr. and Mrs. Franz Welser-Möst Women’s Committee of The Cleveland Orchestra Anonymous INDIVIDUAL GIFTS OF $25,000 TO $29,999

Sheldon and Florence Anderson (Miami) Mr. and Mrs. Gerald A. Conway Tati and Ezra Katz (Miami) Mr. and Mrs. S. Lee Kohrman Dr. and Mrs. David Leshner Mr. and Mrs. Alex Machaskee

Severance Hall 2011-12

Individual Donors

Mrs. Jane B. Nord Mr. and Mrs. James A. Ratner Hewitt and Paula Shaw Richard and Nancy Sneed R. Thomas and Meg Harris Stanton Rick, Margarita and Steven Tonkinson (Miami) Judy and Sherwood Weiser (Miami) INDIVIDUAL GIFTS OF $20,000 TO $24,999

Gay Cull Addicott Mr. and Mrs. Daniel M. Bell (Miami) Martha and Bruce Clinton (Miami) Bruce and Beth Dyer Dr. Edward S. Godleski Andrew and Judy Green Margaret Fulton-Mueller and Scott Mueller William J. and Katherine T. O’Neill Dr. and Mrs. Ronald J. Ross Marc and Rennie Saltzberg Dr. and Mrs. Neil Sethi Paul and Suzanne Westlake Anonymous gift from Switzerland (Europe) Anonymous INDIVIDUAL GIFTS OF $15,000 TO $19,999

Mr. and Mrs. William W. Baker Randall and Virginia Barbato Jayusia and Alan Bernstein (Miami) Scott Chaikin and Mary Beth Cooper Do Unto Others Trust (Miami) Colleen and Richard Fain (Miami) Mr. Allen H. Ford Richard and Ann Gridley Mrs. John A Hadden Jr. Gary Hanson and Barbara Klante Jack Harley and Judy Ernest Iris and Tom Harvie Joan and Leonard Horvitz Richard and Erica Horvitz (Cleveland, Miami) Elizabeth B. Juliano Mr. Thomas F. McKee Mrs. Stanley L. Morgan* Lucia S. Nash Mr. Gary A. Oatey Mr. and Mrs. James A. Saks Raymond T. and Katherine S. Sawyer Nancy and Neil Schaffel (Miami) David and Harriet Simon Mary M. Spencer (Miami) Dr. and Mrs. William P. Steffee Dr. Kenneth F. Swanson Mr. Joseph F. Tetlak listings continue

81


THE CLEVELAN D ORCHESTRA

INDIVIDUAL GIFTS OF $12,500 TO $14,999

Mr. and Mrs. George M. Aronoff Mr. and Mrs. David J. Carpenter George* and Becky Dunn Robert M. Maloney and Laura Goyanes Mrs. David Seidenfeld Mrs. Jean H. Taber Mr. and Mrs. Alfred Umdasch (Europe) INDIVIDUAL GIFTS OF $10,000 TO $12,499

Fred G. and Mary W. Behm Marsha and Brian Bilzin (Miami) Dr. Christopher P. Brandt and Dr. Beth Sersig Mr. D. McGregor Brandt, Jr. Mr. and Mrs. Eugene A. Buehler J. C. and Helen Rankin Butler Augustine* and Grace Caliguire Richard J. and Joanne Clark Mr. Bruce Coppock (Miami) Judith and George W. Diehl Mr. and Mrs. Robert P. Duvin Mike S. and Margaret Eidson (Miami) Dr. and Mrs. Lloyd H. Ellis Jr. Mr. and Mrs.* David K. Ford Ms. Dawn M. Full Mr. Francisco A. Garcia (Miami) Mr. and Mrs. Richard T. Garrett

Crescendo

Annual Campaign Patrons

Barbara Robinson, chair Robert Gudbranson, vice chair Gay Cull Addicott William W. Baker Ronald H. Bell Henry C. Doll Judy Ernest Nicki Gudbranson Jack Harley

Iris Harvie Brinton L. Hyde Randall N. Huff Elizabeth Kelley David C. Lamb Raymond T. Sawyer

Ongoing annual support gifts are a critical component toward sustaining The Cleveland Orchestra’s economic health. Ticket revenues provide only a small portion of the funding needed to support the Orchestra’s outstanding performances, educational activities, and community projects. The Crescendo Patron Program recognizes generous donors of $2,500 or more to the Orchestra’s Annual Campaign. For more information on the benefits of playing a supporting role each year, please contact Hayden Howland, Manager of Leadership Giving, by calling (216) 231-7545.

82

Albert I. and Norma C. Geller Mr. and Mrs. Robert W. Gillespie Sondra and Steve Hardis Henry R. Hatch and Robin Hitchcock Hatch Mr. and Mrs. Jeffrey Healy Mary and Jon Heider (Cleveland, Miami) David and Nancy Hooker Mr. and Mrs. Richard A. Janus Mr. and Mrs. Ferdinand Jereb Janet and Gerald Kelfer (Miami) Jonathan and Tina Kislak (Miami) Mrs. Elizabeth R. Koch Tim and Linda Koelz Mr. and Mrs. Edward A. Lozick Mr. and Mrs. Richard A. Manuel Mrs. Robert H. Martindale Mr. and Mrs. Arch J. McCartney William and Eleanor McCoy Mr. and Mrs. Stanley A. Meisel Mr. Walter N. Mirapaul Elisabeth and Karlheinz Muhr (Europe) Brian and Cindy Murphy Claudia and Steven Perles (Miami) Mr. and Mrs. George M. Rose Mr. and Mrs. David A. Ruckman David M. and Betty Schneider Rachel R. Schneider, PhD Mr. and Mrs. Oliver E. Seikel Kim Sherwin Lois and Tom Stauffer Mrs. Blythe Sundberg Dr. Russell A. Trusso Clara and David Williams INDIVIDUAL GIFTS OF $7,500 TO $9,999

Mr. William Berger Laurel Blossom Dr. and Mrs. Jerald S. Brodkey Dr. Ben H. and Julia Brouhard Dr. Thomas Brugger and Dr. Sandra Russ Ellen E. & Victor J. Cohn Supporting Foundation Mr. Owen Colligan Mr. and Mrs. William E. Conway Mr. and Mrs. Edward B. Davis Henry and Mary Doll Nancy and Richard Dotson Mr. and Mrs. Terry C. Z. Egger Mr. David J. Golden Robert K. Gudbranson and Joon-Li Kim Kathleen E. Hancock Dr.* and Mrs. Shattuck W. Hartwell, Jr. Mrs. Sandra L. Haslinger In memory of Philip J. Hastings Pamela and Scott Isquick Mr. and Mrs. Donald M. Jack, Jr. Allan V. Johnson Joela Jones and Richard Weiss Mr. Lawrence B. and Christine H. Levey Judith and Morton Q. Levin Mr. and Mrs. Thomas B. McGowan Mr. Donald W. Morrison Mr. and Mrs. Stephen E. Myers Mr. and Mrs. William M. Osborne, Jr. Pannonius Foundation listings continue

Individual Donors

Severance Hall 2011-12


PHOTOGRAPH Š BY HEDRICH BLESSING

Imagine your picture-perfect event at Severance Hall.

Severance Hall, a Cleveland landmark and home of the world-renowned Cleveland Orchestra, is perfect for business meetings and conferences, pre-concert or post-concert dinners, and receptions, weddings, and social events. Exclusive catering by Sammyâ&#x20AC;&#x2122;s

Premium dates available! Call the Manager of Facility Sales at (216) 231-7421 or email hallrental@clevelandorchestra.com


THE CLEVELAN D ORCHESTRA

listings continued

Rosskamm Family Trust Mr. Larry J. Santon Patricia J. Sawvel Carol and Albert Schupp Naomi G. and Edwin Z. Singer Family Fund Mrs. Gretchen D. Smith Mr. and Mrs. Donald W. Strang, Jr. Bruce and Virginia Taylor Sandy and Ted Wiese Anonymous (2) INDIVIDUAL GIFTS OF $5,000 TO $7,499

Dr. Jacqueline Acho and Mr. John LeMay Mr. and Mrs. Monte Ahuja Susan S. Angell Agnes Armstrong Mr. and Mrs. Albert A. Augustus Ms. Jody Bacon Mr. and Mrs. Dean Barry Mr. Jon Batchelor (Miami) James and Reita Bayman Dr. and Mrs. Nathan A. Berger Dr. and Mrs. Eugene H. Blackstone In memory of Claude M. Blair Mrs. Flora Blumenthal Brennan Family Foundation Mr. Robert W. Briggs Mr. and Mrs. William C. Butler Mr. and Mrs. R. Bruce Campbell Ms. Maria Cashy Drs. Wuu-Shung and Amy Chuang Dr. William & Dottie Clark Mrs. Lester E. Coleman Corinne L. Dodero Trust for the Arts and Sciences Mr. and Mrs. Evan R. Corns Mr. Peter and Mrs. Julie Cummings (Miami) Mrs. Barbara Ann Davis Peter and Kathryn Eloff Dr. and Mrs. Robert Elston Mary and Oliver Emerson Mr. and Mrs. Charles R. Emrick, Jr. Mr. and Mrs. Henry J. Goodman Mr. and Mrs. Randall J. Gordon Harry and Joyce Graham Mr. Paul Greig Mr.* and Mrs. David E. Griffiths David and Robin Gunning Clark Harvey and Holly Selvaggi T. K. and Faye A. Heston Mr. Clifford Hill Amy and Stephen Hoffman Mr. and Mrs. Brinton L. Hyde Mr. and Mrs. Christopher Hyland Ms. Martha Ingram (Miami) Judith* and Clifford Isroff Rudolf D. and Joan T. Kamper Andrew and Katherine Kartalis Milton and Donna* Katz Dr. and Mrs. William S. Kiser Cynthia Knight (Miami) Julius and Doris Kramer Mrs. Justin Krent Mr. and Mrs. Peter A. Kuhn Mr. and Mrs. Arthur J. Lafave, Jr.

84

Robert and Judie Lasser Judy and Donald Lefton (Miami) Shirley and William Lehman (Miami) Mr.* and Mrs. Leo Leiden Mr. Jeff Litwiller Mr. and Mrs. Robert P. Madison Ms. Jennifer R. Malkin Mr. and Mrs. Morton L. Mandel Alan Markowitz M.D. and Cathy Pollard Mrs. Kay Marshall Alexander and Marianna C. McAfee Claudia Metz and Thomas Woodworth Edith and Ted* Miller Mr. and Mrs. William A. Mitchell Robert Moss (Miami) Mr. and Mrs. Herbert Newman Richard and Kathleen Nord John and Margi Oâ&#x20AC;&#x2122;Brien Mr. Michael G. Oravecz Mr. Henry Ott-Hansen Mr. J. William and Dr. Suzanne Palmer Nancy and Robert Pfeifer Dr. and Mrs. John N. Posch Douglas and Noreen Powers Lois S.* and Stanley M. Proctor Drs. Raymond R. Rackley and Carmen M. Fonseca Mr. and Mrs. Roger F. Rankin Mrs. Nancy L. Reymann Mr. and Mrs. James E. Rohr Carol Rolf and Steven Adler Dr. Tom D. Rose Steven and Ellen Ross Mr. Christopher Roy Mr. Klaus G. Roy and Mrs. Gene J. Roy Mr. and Mrs. Robert C. Ruhl Drs. Michael and Judith Samuels (Miami) Larry and Sally Sears Dr. and Mrs. James L. Sechler Mr. Eric Sellen and Mr. Ron Seidman Dr. Gerard and Phyllis Seltzer Drs. Daniel and Ximena Sessler Mrs. Frances G. Shoolroy Mrs. William I. Shorrock Laura and Alvin A. Siegal David Kane Smith Jim and Myrna Spira George and Mary Stark Mrs. Marie S. Strawbridge Charles B. and Rosalyn Stuzin (Miami) Mr. and Mrs. Paul A. Teel, Jr. Mr. and Mrs. Bill Thornton Mr. Brian Thornton Mr. and Mrs. Lyman H. Treadway Mr.* and Mrs. Robert N. Trombly Robert A. Valente Don and Mary Louise Van Dyke Bill Appert and Chris Wallace (Miami) Tom and Shirley Waltermire Dr. Edward L. and Mrs. Susan Westbrook Tom and Betsy Wheeler Mr. Roy Woda Mrs. Janet A. Wright Mr. David Zauder Anonymous (5) listings continue

Individual Donors

The Cleveland Orchestra


The Center for Music & Medicine University Hospitals Center for Music and Medicine is proud to support The Cleveland Orchestra.

1-866-UH4-CARE | 1-866-844-2273 UHhospitals.org/musicandmedicine

© 2011 University Hospitals NEU 00262

Creativity, Passion, Accountability, and Integrity are our guiding principles principles.

Providing Controllership, CFO, Transaction Management, and Traditional Accounting Services to enterpreneurs and not-for-profit organizations. Contact Jonathan Green • 216.593.0900 ext. 109 • www.jmgreencpa.com

We believe in working for the greater good of all and we are proud to support any organization that shares this value. We thank The Cleveland Orchestra for its commitment to excellence! Ken Lanci, Chairman & CEO Consolidated Companies Severance Hall 2011-12

85


THE CLEVELAN D ORCHESTRA

listings continued INDIVIDUAL GIFTS OF $3,500 TO $4,999

Dr. and Mrs. D. P. Agamanolis Mr. and Mrs. Quentin Alexander Mr. and Mrs. Robert H. Baker Ms. Delphine Barrett Mr.* and Mrs. Russell Bearss Mr. and Mrs. Jules Belkin Dr. Ronald and Diane Bell Dr. Robert Benyo Suzanne and Jim Blaser Mr. and Mrs. Dennis A. Block Paul and Marilyn* Brentlinger Ms. Elizabeth E. Brumbaugh Frank and Leslie Buck Dr. and Mrs. William E. Cappaert Mrs. Millie L. Carlson Ms. Mary E. Chilcote Drs. Mark Cohen and Miriam Vishny Diane Lynn Collier Marjorie Dickard Comella Mr. and Mrs. David J. Cook Pete and Margaret Dobbins Mr.* and Mrs. Sidney Dworkin Mr. Brian L. Ewart and Mr. William McHenry Mr. J. Gilbert and Mrs. Eleanor Frey Mrs. Cora C. Gigax Robert N. and Nicki N. Gudbranson

John and Virginia Hansen Mr. Robert D. Hart Barbara Hawley and David Goodman Matthew D. Healy and Richard S. Agnes Ms. Mary Beth Hedlund Hazel Helgesen and Gary D. Helgesen Anita and William Heller Bob and Edith Hudson (Miami) Mr. James J. Hummer Dr. and Mrs. Scott R. Inkley Donna L. and Robert H. Jackson Mrs. Rita G. Kelly Mr. and Mrs. Robert M. Koch Ronald and Barbara Leirvik Mr. and Mrs. Irvin A. Leonard Mrs. Emma S. Lincoln Mr. and Mrs. Robert C. Loesch Anne R. and Kenneth E. Love Robert and LaVerne Lugibihl Elsie and Byron Lutman Joel and Mary Ann Makee Martin and Lois Marcus Dr. Susan M. Merzweiler Drs. Terry E. and Sara S. Miller Ann Jones Morgan

Dr. Joan R. Mortimer Mr. and Mrs. Peter R. Osenar Mrs. Ingrid Petrus Mr. and Mrs. John S. Piety In memory of Henry Pollak Dr. Laurine Purola Dr. Robert W. Reynolds Amy and Ken Rogat Bob and Ellie Scheuer Ms. Freda Seavert Ginger and Larry Shane Dr. Marvin and Mimi Sobel Mr. and Mrs. William E. Spatz Dr. Elizabeth Swenson Ms. Lorraine S. Szabo Mr. and Mrs. Leonard K. Tower Robert J. and Marti J. Vagi Mr. and Mrs. Fred A. Watkins Mr. and Mrs. Mark Allen Weigand Mr. Peter and Mrs. Laurie Weinberger Robert C. Weppler Nancy V. and Robert L. Wilcox Ms. Judith H. Wright Anonymous (3)

Mr. and Mrs. James B. Chaney Dr. and Mrs. Ronald Chapnick Dr. Christopher and Mrs. Maryann Chengelis Mr. and Mrs. Homer D. W. Chisholm Mr. and Mrs. Robert A. Clark Dr. Dale and Susan Cowan Mrs. Frederick F. Dannemiller Charles and Fanny Dascal (Miami) Jeffrey and Eileen Davis Mrs. Lois Joan Davis Ms. Nancy J. Davis (Miami) Scott and Laura Desmond Dr. and Mrs. Richard C. Distad Ms. Maureen A. Doerner and Mr. Geoffrey T. White Mr. George and Mrs. Beth Downes David Jack and Elaine Drage Mrs. Mary S. Eaton Esther L. and Alfred M. Eich, Jr. Erich Eichhorn and Ursel Dougherty Mrs. Margaret Estill David and Margaret Ewart Harry and Ann Farmer Scott Foerster, Forester and Bohnert Joan Alice Ford Mrs. Mary Elizabeth Ford Mr. Randall and Mrs. Patrice Fortin Mr. Monte Friedkin (Miami) Marvin Ross Friedman and Adrienne bon Haes (Miami) Peggy and David* Fullmer Richard L. Furry

Marilee L. Gallagher Barbara and Peter Galvin Joy E. Garapic Mrs. Georgia T. Garner Mr. Wilbert C. Geiss, Sr. Mrs. Joan Getz (Miami) Mr. Herman Gilbert Anne and Walter Ginn Joyce and Ab* Glickman Mr. and Mrs. David A. Goldfinger Dr. and Mrs. Ronald L. Gould Cynthia and David Greenberg Mr. and Mrs. Brent R. Grover The Thomas J. and Judith Fay Gruber Charitable Foundation Nancy and James Grunzweig Dr. Phillip M. and Mrs. Mary Hall Ronald M. and Sallie M. Hall (Miami) Mr. Holsey G. Handyside Mr. George P. Haskell Virginia and George Havens Oliver and Sally Henkel Mr. and Mrs. Jerry Herschman Mr. Robert T. Hexter Dr. and Mrs. John D. Hines Dr. and Mrs. Robert L. Hinnes Dr. Feite F. Hofman Mr. and Mrs. Edmond H. Hohertz Peter A. and Judith Holmes Thomas and Mary Holmes Dr. Keith A. and Mrs. Kathleen M. Hoover

INDIVIDUAL GIFTS OF $2,500 TO $3,499

Stanley I. and Hope S. Adelstein Norman and Rosalyn Adler Family Philanthropic Fund Mr. Gerald O. Allen Norman and Helen Allison Mr. and Mrs. Robert J. Amsdell Rev. Dr. and Mrs. Kenneth J. Anderson Mr. and Mrs. Jeffrey R. Appelbaum Mr. and Mrs. Stanley H. Arkin (Miami) Geraldine and Joseph Babin Mr. William Baldwin Reverend Thomas and Dr. Joan Baumgardner Mr. and Mrs. Mike Belkin Ms. Pamela D. Belknap Mr. Roger G. Berk Kerrin and Peter Bermont (Miami) Barbara and Sheldon Berns Julia & David Bianchi (Cleveland, Miami) John A. Biek and Christina J. Norton Carmen and Karl Bishopric (Miami) Bill and Zeda Blau Mr. Doug Bletcher Mrs. Mary Wick Bole John and Anne Bourassa Ms. Barbara E. Boyle Betty Madigan Brandt David M. and Carol M. Briggs Ms. Mary R. Bynum and Mr. J. Philip Calabrese Mr. and Mrs. Frank H. Carpenter Leigh and Mary Carter

86

listings continue

Individual Donors

The Cleveland Orchestra


investments | trust | banking

does your ďŹ nancial advisor know the score? A well-planned financial life has all the complexity â&#x20AC;&#x201C; and the fluidity â&#x20AC;&#x201C; of a symphony orchestra. Real life is complicated. People come to Key Private Bank for the simpliďŹ ed sophistication we bring to their ďŹ nancial lives. Our team can help you achieve what matters most to you, delivering strategic advice and objective wealth management solutions based on a ďŹ duciary standard of care that puts your interests before our own. Your ďŹ nances, your life â&#x20AC;&#x201C; in tune, on key â&#x20AC;&#x201C; for generations.

go to keyprivatebank.com call Louisa Guthrie, Key Private Bank Executive at 216-828-7877

Bank and trust products from KeyBank National Association, Member FDIC and Equal Housing Lender. Investment products are:   !  !   !  !      Key.com is a federally registered service mark of KeyCorp. ©2010 KeyCorp.    ADL1735.04


THE CLEVELAN D ORCHESTRA

listings continued INDIVIDUAL GIFTS OF $2,500 TO $3,499

Xavier-Nichols Foundation Robert and Karen Hostoffer Mr. and Mrs. Mark Houck Dr. Randal N. Huff and Ms. Paulette Beech Ms. Charlotte L. Hughes Ms. Luan K. Hutchinson Mr. and Ms. Charles S. Hyle Ruth F. Ihde Carol Lee and James Iott Helen and Erik Jensen Mr. Peter and Mrs. Mary Joyce Mr. Daniel Kamionkowski Mr. William and Mrs. Mary Jo Kannen Barbara and Michael J. Kaplan Rev. William C. Keene Elizabeth Kelley Ms. Angela Kelsey (Miami) The Kendis Family Trust: Hilary & Robert Kendis and Susan & James Kendis Bruce and Eleanor Kendrick Mr. James Kish Fred and Judith Klotzman Jacqueline and Irwin Kott (Miami) Dr. Ronald H. Krasney and Ms. Sherry Latimer* Dr. James and Mrs. Margaret Kreiner Mr. James and Mrs. Patricia Krohngold Mr. Donald N. Krosin David C. Lamb Mrs. Carolyn Lampl Kenneth M. Lapine Anthony T. and Patricia A. Lauria Mr. and Mrs. Leon Lazarev Jeffrey and Ellen Leavitt Dr. Hasoon Lee Dr. and Mrs. Jai H. Lee Michael and Lois A. Lemr Dr. Edith Lerner Dr. Stephen B. and Mrs. Lillian S. Levine Robert G. Levy Dr. Alan and Mrs. Joni Lichtin Isabelle and Sidney* Lobe Drs. Alex and Marilyn Lotas Martha Klein Lottman Sandi M. A. Macdonald and Henry J. Grzes (Miami) Herbert L. and Rhonda Marcus Dr. and Mrs. Sanford E. Marovitz Mr. and Mrs.* Duane J. Marsh Dr. Ernest and Mrs. Marian Marsolais Mr. Julien L. McCall Mrs. Alice Mecredy Dr.* and Mrs. Hermann Menges, Jr Stephen and Barbara Messner Donald D. Miller MindCrafted Systems Bert and Marjorie Moyar Mr. Raymond M. Murphy Richard B. and Jane E. Nash Marshall I. Nurenberg and Joanne Klein

88

Richard and Jolene O’Callaghan Nedra and Mark Oren (Miami) James P. Ostryniec (Miami) Mr. and Mrs. Christopher I. Page Deborah and Zachary Paris Dr. Lewis and Janice B. Patterson Mr. Thomas F. Peterson, Jr. Dr. Roland S. Philip and Dr. Linda M. Sandhaus Dale and Susan Phillip Mr. and Mrs. Richard W. Pogue Dr. Marc and Mrs. Carol Pohl William and Gwen Preucil Mr. Richard and Mrs. Jenny Proeschel Mr. Lute and Mrs. Lynn Quintrell Mr. and Mrs. Thomas A. Quintrell Ms. C. A. Reagan David and Gloria Richards Mrs. Florence Brewster Rutter Fred Rzepka and Anne Rzepka Family Foundation Dr. Harry S. and Rita K. Rzepka Nathan N. and Esther Rzepka Family Philanthropic Fund of the Jewish Federation of Cleveland Dr. and Mrs. Martin I. Saltzman Ms. Patricia E. Say Mr. Paul H. Scarbrough Mr. James Schutte Dr. John Sedor and Ms. Geralyn Presti Lee G. and Jane Seidman Charles Seitz (Miami) Harry and Ilene Shapiro Norine W. Sharp Dr. and Mrs. William C. Sheldon Mr. Richard Shirey Dr. Howard and Mrs. Judith Siegel Donald Singer and Helene Love Mr. and Mrs.* Jeffrey H. Smythe Pete and Linda Smythe Mrs. Virginia Snapp Jay and Ellen Solowksy (Miami) Mr. John C. Soper and Dr. Judith S. Brenneke Mr. John D. Specht Howard Stark M.D. and Rene Rodriguez (Miami) Mr. and Mrs.* Lawrence E. Stewart Mrs. Barbara Stiefel (Miami) Mr. and Mrs. G. W. Stuelpe Mr. and Mrs. Daniel C. Sussen Mr. Nelson S. Talbott Mr. Karl and Mrs. Carol Theil Colin Blades Thomas Dr. and Mrs. Thomas A. Timko Mr. and Mrs. Robert J. Tomsich Mr. Erik Trimble Drs. Anna* and Gilbert True Miss Kathleen Turner Mrs. H. Lansing Vail, Jr. Mr. and Mrs. Joaquin Vinas (Miami) Mr. and Mrs. Les C. Vinney Mr. and Mrs. Joseph F. Wasserbauer

Individual Donors

Ms. Laure A. Wasserbauer Philip and Peggy Wasserstrom Mr. and Mrs. Jerome A. Weinberger Richard Wiedemer, Jr. Helen Sue* and Meredith Williams Mr. Peter and Mrs. Ann Williams Richard and Mary Lynn Wills Charles Winans Michael H. Wolf and Antonia Rivas-Wolf Drs. Nancy Wolf and Aric Greenfield Mr. Robert Wolff and Dr. Paula Silverman Kay and Rod Woolsey Rad and Patty Yates Fred and Marcia Zakrajsek Mr. Kal Zucker and Mrs. Mary Frances Haerr Anonymous (11)

member of the Leadership Council (see page 80)

* deceased

The Cleveland Orchestra is sustained through the annual support of thousands of generous patrons, including members of the Crescrendo Patron Program listed on these pages. Listings of all donors of $300 and more each year are published in the Orchestra’s Annual Report, which can be viewed online at CLEVELANDORCHESTRA.COM For information about how you can play a supporting role for The Cleveland Orchestra’s artistic excellence and community partnerships, please contact our Philanthropy & Advancement Office by calling (216) 231-7545.

The Cleveland Orchestra


,&"/ #&& )/((.',)* ,*"# )/)#-+ )+# *

" !0*% /#!+ )+#1+ *

Since its founding in 1920, CIM has offered a world-class education to students of all ages and skill levels and presented concerts and operas to the community. To get your FREE CIM 2011-12 Concert Guide or for more details about CIM concerts or classes, call 216.791.5000 or visit cim.edu.

  216.707.4045TBL45.COM 

     

216.791.5000 | cim.edu 11021 east boulevard | cleveland

HARNESSES THE POWER OF THE ARTS ) $!*+/,&"/ #&& )/ '$+#%* ** )+*/((.',)*/)#-+ )+# * '%#.*/ % )+#'&*/#!+ )+#1+ *

  216.707.4054C2RESTAURANT.COM

::::::::::::::::::::::::::::::::::::::::::::::

PNC supports those who make the world a more beautiful place. Thatâ&#x20AC;&#x2122;s why weâ&#x20AC;&#x2122;re proud to sponsor the Orchestra. Cleveland Orchestra. Tthe Cleveland Because we know that achievement is an art form all its own.

       

Š2011 The PNC Financial Services Group, Inc. All rights reserved. PNC Bank, National Association. Member FDIC. ACHIEVEMENT is a registered mark of The PNC Financial Services Group, Inc.

COMMSERV AD JUN 2010 001

Severance Hall 2011-12

89


THE CLEVELAN D ORCHESTRA R E C O R D I N G S great gift ideas

New!

The Cleveland Orchestra’s catalog of recordings continues to grow. The newest DVD features Bruckner’s Eighth Symphony recorded live at Severance Hall under the direction of Music Director Franz Welser-Möst in 2010 and released in May 2011. And, just released, Dvořák’s opera Rusalka on CD, recorded live at the Salzburg Festival. Writing of the Rusalka performances, the reviewer for London’s Sunday Times praised the performance as “the most spellbinding account of Dvořák’s miraculous score I have ever heard, either in the theatre or on record. . . . I doubt this music can be better played than by the Clevelanders, the most ‘European’ of the American orchestras, with wind and brass soloists to die for and a string sound of superlative warmth and sensitivity.” Other recordings released in the past year include two under the baton of Pierre Boulez and a second album of Mozart piano concertos with Mitsuko Uchida, whose first Cleveland Orchestra Mozart album won a Grammy Award this past year. Visit the Cleveland Orchestra Store for the latest and best Cleveland Orchestra recordings and DVDs. New!


11001 Euclid Avenue Cleveland, Ohio 44106

P H OTO BY S T E V E H A L L © H E D R I C H B L E S S I N G

CLEVELANDORCHESTRA.COM

the world’s most beautiful concert halls, Severance Hall has been home to The Cleveland Orchestra since its opening on February 5, 1931. After that first concert, a Cleveland newspaper editorial stated: “We believe that Mr. Severance intended to build a temple to music, and not a temple to wealth; and we believe it is his intention that all music lovers should be welcome there.” John Long Severance (president of the Musical Arts Association, 1921-1936) and his wife, Elisabeth, donated most of the funds necessary to erect this magnificent building. Designed by Walker & Weeks, its elegant

HAILED AS ONE OF

Severance Hall 2011-12

Severance Hall

Georgian exterior was constructed to harmonize with the classical architecture of other prominent buildings in the University Circle area. The interior of the building reflects a combination of design styles, including Art Deco, Egyptian Revival, Classicism, and Modernism. An extensive renovation, restoration, and expansion of the facility was completed in January 2000. In addition to serving as the home of The Cleveland Orchestra for concerts and rehearsals, the building is rented by a wide variety of local organizations and private citizens for performances, meetings, and gala events each year.

91


of Music Director Franz Welser-Möst, The Cleveland Orchestra has become one of the most sought-after performing ensembles in the world. In concerts at its winter home at Severance Hall and at each summer’s Blossom Festival, in residencies from Miami to Vienna, and on tour around the world, The Cleveland Orchestra sets standards of artistic excellence, creative programming, and community engagement. The partnership with Franz Welser-Möst, now in its tenth season, and with a commitment to the Orchestra’s centennial in 2018, has moved the ensemble forward with a series of new and ongoing initiatives, including: UNDER THE LEADERSHIP

the establishment of residencies around the world, fostering creative artistic growth and an expanded financial base, including an ongoing residency at the Vienna Musikverein (the first of its kind by an American orchestra); an annual Miami Residency involving three weeks of concerts, community activities, and educational presentations and collaborations; concert tours from coast to coast in the United States, including regular appearances at Carnegie Hall; regular concert tours to Europe (including biennial residencies at the Lucerne Festival) and Asia (including a residency at Tokyo’s Suntory Hall in the autumn 2010); ongoing recording activities, including new releases under the direction of Franz Welser-Möst and Pierre Boulez as well as a series of DVD concert presentations of four of Bruckner’s symphonies; additional new residencies at Indiana University and at New York’s Lincoln Center Festival; an expanded offering of education and community programs with a comprehensive approach designed to make music an integral and regular part of everyday life in Northeast Ohio; continuing and expanded educational partnerships with schools, colleges, and universities from across Northeast Ohio and in the Miami-Dade community; creative new artistic collaborations, including staged works and chamber music performances, with arts institutions in Northeast Ohio and across the Miami-Dade community; the return of staged opera to Severance Hall with the presentation of acclaimed Zurich Opera productions of the three Mozart/Da Ponte operas;

92

The Orchestra Today

The Cleveland Orchestra


an array of new concert offerings (including Fridays@7 and Celebrity Series at Severance Hall as well as movie, themed, and family presentations at Blossom) to make a wider variety of concerts more available and affordable; the return of ballet to Blossom, with performances by The Joffrey Ballet. The Cleveland Orchestra was founded in 1918 by a group of local citizens intent on creating an ensemble worthy of joining America’s ranks of major symphony orchestras. Over the ensuing decades, the Orchestra quickly grew from a fine regional organization to being one of the most admired symphony orchestras in the world. The opening of Severance Hall as the Orchestra’s home in 1931 brought a special pride to the ensemble and its hometown, as well as providing an enviable and intimate acoustic environment in which to develop and refine the Orchestra’s artistry. Year-round performances became a reality in 1968 with the opening of Blossom Music Center, one of the most beautiful and acoustically admired outdoor concert facilities in the United States.

CLEVELAND ORCHESTRA ARCHIVES

IN FOCUS

SATURDAY INSTRUMENTAL SCHOOL. Music students line up for a photograph in April 1929 at East Technical High School. The students were part of a program in which Cleveland Orchestra musicians taught instrument lessons on Saturdays throughout the school year — nearly 3,000 students took part during the late 1920s and early ’30s. The Orchestra has a long and successful history as an education partner with schools, colleges, and universities throughout Northeast Ohio.

Severance Hall 2011-12

The Cleveland Orchestra

93


THE CLEVELAND ORCHESTRA U P C O M I N G

C O N C E R T S

At Severance Hall . . .

Cleveland Orchestra

CHRISTMAS

Sunday December 11 at 3 p.m. Friday December 16 at 8 p.m. Saturday December 17 at 3 & 8 p.m. Sunday December 18 at 3 & 7 p.m. Thursday December 22 at 8 p.m. Friday December 23 at 3 & 8 p.m. THE CLEVELAND ORCHESTRA Robert Porco, conductor Cleveland Orchestra Chorus and guest choruses

Celebrate the holiday season with a favorite Cleveland tradition — with The Cleveland Orchestra and Chorus in these annual offerings of music for the Christmas Season. Including sing-alongs and guest choruses, all in the festive yuletide splendor of Severance Hall.

LISA BATIASHVILI PLAYS BRAHMS VIOLIN CONCERTO Thursday January 12 at 8:00 p.m. Friday January 13 at 11:00 a.m. Saturday January 14 at 8:00 p.m. THE CLEVELAND ORCHESTRA Franz Welser-Möst, conductor Lisa Batiashvili, violin

Violinist Lisa Batiashvili makes her Severance Hall debut at the start of a three-week Brahms Concerto Festival. Brahms wrote his Violin Concerto on the shores of a lake where, he later remarked, “melodies are so abundant one must take care not to step on them.” The concerto remains one of the greatest and most lyrical. The program also features favorite movements from Smetana’s My Country, including The Moldau — a nation’s river boldly portrayed as a rippling musical adventure. Concert Sponsor: Eaton Corporation

See also the concert calendar listing on pages 48-49, or visit The Cleveland Orchestra online for a complete schedule of future events and performances, or to purchase tickets online 24 / 7 for Severance Hall concerts.

TICKETS

94

216-231-1111

clevelandorchestra.com

Upcoming Concerts

The Cleveland Orchestra


Bringing you classical music 24 hours a day.

Mobile | Online | HD Radio | FM

wksu.org/channels


A world of talent...

is inspiring Cleveland youth

The Cleveland Foundation’s Creative Fusion program is bringing international artists to Cleveland for long-term residencies at our cultural and educational institutions, giving our community a rich appreciation of diverse cultures and art forms. If the arts are important to you, why not join us? When you give to your favorite causes through the Cleveland Foundation, you can tap into our experts in investing and grantmaking so that your gift lasts – and keeps on giving – forever.

216.861.3810 877.554.5054 www.ClevelandFoundation.org

If you want to be remembered, do something memorable.SM


The Cleveland Orchestra Concert Program