Issuu on Google+

1112 clevelandorchestra.com

THE CLEVELAND ORCHESTRA F R ANZ WELSER-MÖST M U SIC DI R ECTOR November 11, 12, 13 ALAN GILBERT CONDUCTS


Hermès, contemporar y artisan since 1837.

18 East Orange Street Chagrin Falls, Ohio (440) 247-2828


It’s never too early to appreciate great music. 7KDW¶VZK\ZH¶UHVRSURXGWRVXSSRUW7KH&OHYHODQG 2UFKHVWUD¶VPXVLFHGXFDWLRQSURJUDPVIRUFKLOGUHQPDNLQJ SRVVLEOHWKHUHZDUGVDQGEHQHILWVRIPXVLFLQWKHLUOLYHV

AUTO GROUP

LEXUS, BMW, MINI, LINCOLN, CADILLAC. BUICK, CHEVROLET, CHRYSLER, DODGE, FIAT, FORD, GMC, HONDA, HYUNDAI, JEEP, KIA, MAZDA, NISSAN, SCION, TOYOTA, VW. WILLOUGHBY HILLS, MENTOR, PAINESVILLE, STREETSBORO, MADISON.


THE CLEVELAND ORCHESTRA O F

C O N T E N T S

WEEK 4 9

About the Orchestra

1112

CO V E R P H OTO G R A P H BY R O G E R MA S T R O I A N N I

TA B L E

Musical Arts Association . . . . . . . . . . . . . . . . . . . . . . 9 Music Director . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Conductors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Roster of Musicians . . . . . . . . . . . . . . . . . . . . . . . . . 18 Norton Memorial Organ . . . . . . . . . . . . . . . . . . . . . 64 Guest Information . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 Severance Hall. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 The Cleveland Orchestra . . . . . . . . . . . . . . . . . . . . 92

21

In the News Perspectives . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Orchestra News . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Community and Education . . . . . . . . . . . . . . . . . . In Focus: A Look Back . . . . . . . . . . . . . . . . . . . . . . .

35

21 22 69 93

Concert — Week 4 Concert Previews . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 Program . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 Introducing the Program . . . . . . . . . . . . . . . . . . . . 37 BEETHOVEN

Romance No. 2 . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 WEBERN

Im Sommerwind . . . . . . . . . . . . . . . . . . . . . . . . . . 41

Copyright © 2011 by The Cleveland Orchestra and the Musical Arts Association Eric Sellen, Program Book Editor E-MAIL: esellen@clevelandorchestra.com Elaine Guregian, Communications Manager Program books for Cleveland Orchestra concerts are produced by The Cleveland Orchestra and are distributed free to attending audience members. Program book advertising is sold through Live Publishing Company at (216) 721-1800 The Musical Arts Association is grateful to the following organizations for their ongoing generous support of The Cleveland Orchestra: National Endowment for the Arts, the State of Ohio and Ohio Arts Council, and to the residents of Cuyahoga County through Cuyahoga Arts and Culture.

BRUCH

Adagio appassionato . . . . . . . . . . . . . . . . . . . . . 45 SCHOENBERG

Pelleas and Melisande . . . . . . . . . . . . . . . . . . . . 51 Conductor: Alan Gilbert . . . . . . . . . . . . . . . . . . . . . . 57 Soloist: William Preucil . . . . . . . . . . . . . . . . . . . . . . 59

48

Future Concerts Concert Calendar . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 Upcoming Concerts . . . . . . . . . . . . . . . . . . . . . . . . 94

77

The Cleveland Orchestra is proud of its long-term partnership with Kent State University, made possible in part through generous funding from the State of Ohio. The Cleveland Orchestra is proud to have its home, Severance Hall, located on the campus of Case Western Reserve University, with whom it has a long history of collaboration and partnership.

Donors and Sponsors Corporate Support . . . . . . . . . . . . . . . . . . . . . . . . . . 77 Foundation & Government Support . . . . . . . . . 79 Individual Support. . . . . . . . . . . . . . . . . . . . . . . . . . . 80

4

This program book is printed on paper that includes 10% recycled post-consumer content. All unused books are recycled as part of the Orchestra’s regular business recycling program.

Table of Contents

The Cleveland Orchestra


Enjoy the best of University Circle Choose Judson today

Independent living at Judson Manor or Judson Park, both located in the heart of University Circle, can be a rewarding experience for you 365 days a year. After all, the “Circle” is where it’s happening in Cleveland. Both the Park and Manor offer something for everyone. Come now while you can enjoy all of the benefits. Declare your independence from all the chores, taxes and expenses of your home—start living smart at Judson. Visit us today. Call (216) 791-2004 or visit www.judsonsmartliving.org.

Judson Manor Judson Park South Franklin Circle Smart LivingTM at Home


    

  

 

 !     


Photo by Roger Mastroianni

Exceptional

We are proud to sponsor

The Cleveland Orchestra in helping to build audiences for the future through an annual series of Baker Hostetler Guest Artists

CHICAGO CINCINNATI CLEVELAND COLUMBUS COSTA MESA DENVER HOUSTON LOS ANGELES NEW YORK ORLANDO WASHINGTON, DC

www.bakerlaw.com Š 2011 Baker & Hostetler LLP


OUR INDEPENDENCE IS YOUR PEACE OF MIND :HDUH*OHQPHGH³ZH·UHVWURQJÀQDQFLDOO\VRXQGDQGSURXGO\LQGHSHQGHQW $QGZHLQWHQGWRVWD\WKDWZD\ %HLQJ SULYDWHO\ RZQHG SODFHV XV LQ D SRVLWLRQ RI VWUHQJWK 8QOLNH SXEOLFO\ KHOG FRPSDQLHVZHDUHQRWGULYHQWRFKDVHVKRUWWHUPSURÀWV,QVWHDGLQGHSHQGHQFH JLYHVXVDVHFXUHORQJWHUPRXWORRN2XUDFKLHYHPHQWLVPHDVXUHGVROHO\E\KRZ ZHPDQDJHZHDOWKIURPRQHJHQHUDWLRQWRWKHQH[W )RXQGHG DV D WUXVW FRPSDQ\ PRUH WKDQ  \HDUV DJR ZH·YH JXLGHG IDPLOLHV IDPLO\ RIÀFHV DQG HQGRZPHQW DQG IRXQGDWLRQ FOLHQWV ZLWK WLPHWHVWHG DGYLFH DQGVRSKLVWLFDWHGLQYHVWPHQWPDQDJHPHQW7RGD\ZHKDYHELOOLRQLQDVVHWV XQGHUPDQDJHPHQWIRUFOLHQWVDFURVVWKHFRXQWU\DQGDEURDG 7RZRUNZLWKDSDUWQHUGHGLFDWHGWRLQVSLULQJWUXVW³FRPHWR*OHQPHGH

*OHQPHGH·VVHUYLFHVDUHEHVWVXLWHGIRUWKRVHZLWKPLOOLRQRUPRUHWRLQYHVW 3OHDVHFDOO/LQGD2OHMNRIRUDSHUVRQDOFRQYHUVDWLRQ __OLQGDROHMNR#JOHQPHGHFRP


B O A R D O F T R U S T E E S as of Setember 2011

T H E M U S I C AL ARTS AS SOCIATION operating The Cleveland Orchestra, Severance Hall, and Blossom Festival O F F I C E R S A ND E X E C UT I VE C O MMIT T E E Dennis W. LaBarre, President Richard J. Bogomolny, Chairman The Honorable John D. Ong, Vice President

Norma Lerner, Honorary Chair Raymond T. Sawyer, Secretary Beth E. Mooney, Treasurer

Jeanette Grasselli Brown Matthew V. Crawford Michael J. Horvitz Douglas A. Kern

Virginia M. Lindseth Alex Machaskee Nancy W. McCann John C. Morley

Larry Pollock Alfred M. Rankin, Jr. Audrey Gilbert Ratner Barbara S. Robinson

R E S I D E NT TR U S T E E S Gay Cull Addicott George N. Aronoff Dr. Ronald H. Bell Richard J. Bogomolny Charles P. Bolton Jeanette Grasselli Brown Helen Rankin Butler Scott Chaikin Paul G. Clark Owen M. Colligan Robert D. Conrad Matthew V. Crawford Alexander M. Cutler Bruce P. Dyer Terrance C. Z. Egger Hiroyuki Fujita Paul G. Greig Robert K. Gudbranson Jeffrey A. Healy Stephen H. Hoffman David J. Hooker Michael J. Horvitz Marguerite B. Humphrey

David P. Hunt Christopher Hyland James D. Ireland III Clifford J. Isroff Trevor O. Jones Jean C. Kalberer Nancy F. Keithley Douglas A. Kern John D. Koch S. Lee Kohrman Charlotte R. Kramer Dennis W. LaBarre Norma Lerner Virginia M. Lindseth Alex Machaskee Robert P. Madison Nancy W. McCann Thomas F. McKee Samuel H. Miller Beth E. Mooney John C. Morley Donald W. Morrison Meg Fulton Mueller

Gary A. Oatey Katherine T. O’Neill The Honorable John D. Ong Larry Pollock Alfred M. Rankin, Jr. Clara T. Rankin Audrey Gilbert Ratner Charles A. Ratner James S. Reid, Jr. Barbara S. Robinson Paul Rose Steven M. Ross Raymond T. Sawyer Luci Schey Neil Sethi Hewitt B. Shaw, Jr. David L. Simon Richard K. Smucker R. Thomas Stanton Thomas A. Waltermire Geraldine B. Warner Paul E. Westlake Jr. David A. Wolfort

NO N- R E S I D E NT T RUS T E E S Virginia Nord Barbato (NY) Laurel Blossom (SC) Richard C. Gridley (SC)

George Gund III (CA) Loren W. Hershey (DC) Mrs. Gilbert W. Humphrey (FL)

Herbert Kloiber (Germany) Ludwig Scharinger (Austria)

TR U S TE E S E X- O FFI C I O Iris Harvie, President, Volunteer Council of The Cleveland Orchestra Beth Schreibman Gehring, President, Women’s Committee of The Cleveland Orchestra Phyllis Knauf, State Chair, Blossom Women’s Committee TR U S TE E S E M E RI T I David A. Ruckman Naomi G. Singer

H O N O RARY T RUS T EES FOR LIFE Robert W. Gillespie Francis J. Callahan Dorothy Humel Hovorka Mrs. Webb Chamberlain Robert F. Meyerson Oliver F. Emerson Allen H. Ford

PA S T PR E S I D E NT S D. Z. Norton 1915-21 John L. Severance 1921-36 Dudley S. Blossom 1936-38 Thomas L. Sidlo 1939-53

Percy W. Brown 1953-55 Frank E. Taplin, Jr. 1955-57 Frank E. Joseph 1957-68 Alfred M. Rankin 1968-83

THE CLEVELAND ORCHESTRA Gary Hanson, Executive Director

clevelandorchestra.com

Severance Hall 2011-12

Carolyn Dessin, Chair, Cleveland Orchestra Chorus Operating Committee Dr. Lester Lefton, President, Kent State University Barbara R. Snyder, President, Case Western Reserve University

Ward Smith 1983-95 Richard J. Bogomolny 1995-2002, 2008-09 James D. Ireland III 2002-08

SEVERANCE HALL 11001 Euclid Avenue Cleveland, Ohio 44106 Telephone (216) 231-7300

Musical Arts Association

9


DECEMBER

HOLIDAY 11-23 FESTIVAL

Visit clevelandorchestra.com for full concert details.


Pediatric emergency care is right in your neighborhood. Available 24/7 at six locations. You’re now closer than ever to emergency services designed specifically for babies and children with kid-focused physicians, nurses and support staff and backed by the most trusted name in children’s health care – as well as the region’s only Level I Pediatric Trauma Center, if a higher level of care is required. All in six convenient locations with staff dedicated to getting you and your family the care you need as quickly as possible.

UH Rainbow Babies & Children’s Hospital 11100 Euclid Avenue, Cleveland UH Ahuja Medical Center 3999 Richmond Road, Beachwood UH Geauga Medical Center 13207 Ravenna Road, Chardon UH Twinsburg Health Center 8819 Commons Boulevard, Suite 101, Twinsburg St. John Medical Center 29000 Center Ridge Road, Westlake Southwest General 18697 Bagley Road, Middleburg Heights

There’s only one Rainbow. 216-UH4-KIDS (216-844-5437) | RainbowBabies.org Facebook.com/UHRainbowBabies | Twitter.com/UHRainbowBabies © 2011 University Hospitals

RBC 00438


Franz Welser-Möst Music Director Kelvin Smith Family Endowed Chair The Cleveland Orchestra

marks Franz Welser-Möst’s tenth year as Music Director of The Cleveland Orchestra, with a long-term commitment extending to the Orchestra’s centennial in 2018. Under his direction, the Orchestra is acclaimed for its continuing artistic excellence, is enlarging and enhancing its community programming at home, is presented in a series of ongoing residencies in the United States and Europe, continues its historic championship of new composers through commissions and premieres, and has re-established itself as an important operatic ensemble. Concurrently with his post in Cleveland, Mr. Welser-Möst became General Music Director of the Vienna State Opera in September 2010. With a committed focus on music education in Northeast Ohio, Franz Welser-Möst has taken The Cleveland Orchestra back into public schools with performances in collaboration with the Cleveland Metropolitan School District. The initiative continues and expands upon Mr. Welser-Möst’s active participation in community concerts and educational programs, including the Cleveland Orchestra Youth Orchestra and partnerships with music conservatories and universities across Northeast Ohio. Under Mr. Welser-Möst’s leadership, The Cleveland Orchestra has established an ongoing biennial residency in Vienna at the famed Musikverein concert hall and at the Lucerne Festival in Switzerland. Together, they have appeared in residence at Suntory Hall in Tokyo, Japan, and at the Salzburg Festival, where a 2008 residency included five sold-out performances of a staged production of Dvořák’s opera Rusalka. In the United States, Mr. Welser-Möst has established an annual multi-week Cleveland Orchestra Miami Residency in Florida and launched a new biennial residency at New York’s Lincoln Center Festival in 2011. Under Franz Welser-Möst’s direction, The Cleveland Orchestra has performed thirteen world and fifteen United States premieres. Through the Roche Commissions project, he and the Orchestra have premiered works by Harrison Birtwistle, Chen Yi, Hanspeter Kyburz, George Benjamin, and Toshio Hosokawa in partnership with the Lucerne Festival and Carnegie Hall. In addition, the Daniel R. Lewis Young Composer Fellow program has brought new voices to the repertoire, including Marc-André Dalbavie, Matthias Pintscher, Susan Botti, Julian Anderson, Johannes Maria Staud, Jörg Widmann, and Sean Shepherd. Franz Welser-Möst has led opera performances each season during his P H OTO BY D O N S N Y D E R

T H E 2 01 1 - 1 2 S E A S O N

Severance Hall 2011-12

Music Director

13


P H OTO BY R O G E R MA S T R O I A N N I

tenure in Cleveland, re-establishing the Orchestra as an important operatic ensemble. Following six opera-in-concert presentations, he brought fully staged opera back to Severance Hall with a three-season cycle of Zurich Opera productions of the Mozart-Da Ponte operas. He leads concert performances of Strauss’s Salome at Severance Hall and at Carnegie Hall during the 2011-12 season. Franz Welser-Möst became General Music Director of the Vienna State Opera with the 2010-11 season. His long partnership with the company has included acclaimed performances of Tristan and Isolde, a new production of Wagner’s Ring cycle with stage director Sven-Eric Bechtolf, and, in his first season in the post, critically praised new productions of Hindemith’s Cardillac and Janáček’s Katya Kabanova. During the 2011-12 season, he continues his survey of the operas of Janáček with a new production of From the House of the Dead and also leads a new production of Verdi’s Don Carlo. Mr. Welser-Möst also maintains an ongoing relationship with the Vienna Philharmonic. Recent performances with the Philharmonic include appearances at the Lucerne Festival and Salzburg Festival, in Tokyo, and in concert at La Scala Milan, as well as leading the Philharmonic’s 2011 New Year’s Day concert, viewed by telecast in seventy countries worldwide. Across a decade-long tenure with the Zurich Opera, culminating in three seasons as General Music Director (2005-08), Mr. Welser-Möst led the company in more than 40 new productions and numerous revivals. Franz Welser-Möst’s recordings and videos have won major awards, including the Gramophone Award, Diapason d’Or, Japanese Record Academy Award, and two Grammy nominations. With The Cleveland Orchestra, he has created DVD recordings of live performances of four Bruckner symphonies, presented in three accoustically distinctive venues: Symphony No. 5 in the Abbey of St. Florian in Austria, Symphony No. 9 in Vienna’s Musikverein, and Symphonies Nos. 7 and 8 at Severance Hall. With Cleveland, he has also released a recording of Beethoven’s Ninth Symphony as well as an all-Wagner album featuring soprano Measha Brueggergosman. DVD releases on the EMI label have included Mr. Welser-Möst leading Zurich Opera productions of The Marriage of Figaro, Così fan tutte, Don Giovanni, Der Rosenkavalier, La Bohème, Fierrabras, and Peter Grimes. For his talents and dedication, Mr. Welser-Möst has received honors that include recognition from the Western Law Center for Disability Rights, honorary membership in the Vienna Singverein, appointment as an Academician of the European Academy of Yuste, a Gold Medal from the Upper Austrian government for his work as a cultural ambassador, and the Kilenyi Medal from the Bruckner Society of America. He is the co-author of Cadences: Observations and Conversations, published in a German edition in 2007.

14

Music Director

The Cleveland Orchestra


EVS\WbQ][Sab]bVSTcbc`S]T g]c`TO[WZgยนaeSOZbV g]c`dWaW]\Wa]c`W\a^W`ObW]\ :SbยนabOZYOP]cbg]c`ZSUOQg /b4W`ab4O[WZgeSc\RS`abO\RbVSRSZWQObSQ][^ZSfWbWSaW\d]ZdSReWbV[O\OUW\UeSOZbV7bยนaeVg eSยน`SRSRWQObSRb]ZWabS\W\UO\RZSO`\W\UOa[cQVOP]cbg]c`dWaW]\Oa^]aaWPZSPST]`S]TTS`W\U ]c`^S`a]\OZWhSR]PXSQbWdSORdWQSAS`dW\UOag]c`TO[WZg14=eSยน`S^`S^O`SRb]OQbW\g]c` TO[WZgยนaPSabW\bS`SabObOZZbW[SaยตQOZZW\Uc^]\OeWRS`O\US]TQcab][aS`dWQSaO\RQ]]`RW\ObW\U Q][[c\WQObW]\aO\Rab`ObSUWSaPSbeSS\g]c`ORdWa]`a/ZZeVWZSYSS^W\UW\[W\RbVObbVS[]ab dOZcOPZSOaaSbW\[O\OUW\Ug]c`TO[WZgยนaeSOZbVWag]c`dWaW]\T]`WbaTcbc`S 4]`O^`WdObSQ]\acZbObW]\Q]\bOQb2]cUZOa4`WSa;O\OUW\U2W`SQb]`Ob $'% ''#

2 = C 5 : / A  1   4 @ 7 3 A       ; / < / 5 7 < 5  2 7 @ 3 1 B = @        $  ' %   ' ' # / 9 @ = <      1 / < B = <      1 6 7 1 / 5 =      1 : 3 D 3 : / < 2      1 = : C ; 0 C A

4W`ab4O[WZgWaO^`OQbWQSO`SO]T4W`ab;S`Wb0O\Y</


Itâ&#x20AC;&#x2122;s time to start building towards an economic crescendo.

Like a world-class orchestra, business in Cleveland works best when itâ&#x20AC;&#x2122;s well conducted. And with its convenient proximity to downtown, Burke Lakefront Airport is a vital destination for the corporations, executives, and health care systems that are growing their business here. Which should be music to all of our ears. www.burkeairport.com


1112 clevelandorchestra.com

THE CLEVELAND ORCHESTRA

Franz Welser-Möst MUSIC DIREC TOR Kelvin Smith Family Chair

Christoph von Dohnányi MUSIC DIRECTOR LAUREATE

Giancarlo Guerrero PRINCIPAL GUEST CONDUCTOR THE CLEVELAND ORCHESTRA MIAMI RESIDENCY

James Feddeck ASSISTANT CONDUCTOR Elizabeth Ring and William Gwinn Mather Chair

MUSIC DIRECTOR, CLEVELAND ORCHESTRA YOUTH ORCHESTRA

Sasha Mäkilä ASSISTANT CONDUCTOR Sidney and Doris Dworkin Chair

Robert Porco DIRECTOR OF CHORUSES Frances P. and Chester C. Bolton Chair

Lisa Wong P H OTO BY R O G E R MA S T R O I A N N I

ASSISTANT DIRECTOR OF CHORUSES

Ann Usher DIRECTOR, CLEVELAND ORCHESTRA CHILDREN’S CHORUS

Frank Bianchi DIRECTOR, CLEVELAND ORCHESTRA YOUTH CHORUS

Lisa Manning ASSISTANT DIRECTOR, CLEVELAND ORCHESTRA YOUTH CHORUS


T H E

C L E V E L A N D

FRANZ WELSER-MÖST M U S I C D I R E C TO R Kelvin Smith Family Chair

FIRST VIOLINS William Preucil CONCERTMASTER

Blossom-Lee Chair

Yoko Moore

ASSISTANT CONCERTMASTER

Clara G. and George P. Bickford Chair

Peter Otto

FIRST ASSOCIATE CONCERTMASTER

Jung-Min Amy Lee

ASSOCIATE CONCERTMASTER

Gretchen D. and Ward Smith Chair

Lev Polyakin

ASSISTANT CONCERTMASTER

Dr. Jeanette Grasselli Brown and Dr. Glenn R. Brown Chair

Takako Masame Paul and Lucille Jones Chair

Wei-Fang Gu Drs. Paul M. and Renate H. Duchesneau Chair

Kim Gomez Elizabeth and Leslie Kondorossy Chair

Chul-In Park Harriet T. and David L. Simon Chair

Miho Hashizume Theodore Rautenberg Chair

Jeanne Preucil Rose Dr. Larry J.B. and Barbara S. Robinson Chair

Alicia Koelz Oswald and Phyllis Lerner Gilroy Chair

Yu Yuan Patty and John Collinson Chair

Isabel Trautwein Trevor and Jennie Jones Chair

Mark Dumm Gladys B. Goetz Chair

Alexandra Preucil Katherine Bormann Ying Fu

SECOND VIOLINS Stephen Rose * Alfred M. and Clara T. Rankin Chair

Emilio Llinas

2

James and Donna Reid Chair

Eli Matthews

1

Patricia M. Kozerefski and Richard J. Bogomolny Chair

Elayna Duitman Ioana Missits Carolyn Gadiel Warner Stephen Warner Sae Shiragami Vladimir Deninzon Sonja Braaten Molloy Scott Weber Kathleen Collins Beth Woodside Emma Shook Jeffrey Zehngut VIOLAS Robert Vernon * Chaillé H. and Richard B. Tullis Chair

Lynne Ramsey 1 Charles M. and Janet G. Kimball Chair

Stanley Konopka 2 Mark Jackobs Jean Wall Bennett Chair

Arthur Klima Richard Waugh Lisa Boyko Lembi Veskimets Eliesha Nelson Joanna Patterson Zakany Patrick Connolly

CELLOS Mark Kosower* Louis D. Beaumont Chair

Richard Weiss 1 The GAR Foundation Chair

Charles Bernard 2 Helen Weil Ross Chair

Bryan Dumm Muriel and Noah Butkin Chair

Tanya Ell Ralph Curry Brian Thornton David Alan Harrell Paul Kushious Martha Baldwin Thomas Mansbacher BASSES Maximilian Dimoff * Clarence T. Reinberger Chair

Kevin Switalski 2 Scott Haigh 1 Mary E. and F. Joseph Callahan Chair

Mark Atherton Thomas Sperl Henry Peyrebrune Charles Barr Memorial Chair

Charles Carleton Scott Dixon HARP Trina Struble * Alice Chalifoux Chair

FLUTES Joshua Smith * Elizabeth M. and William C. Treuhaft Chair

Saeran St. Christopher Marisela Sager 2 Austin B. and Ellen W. Chinn Chair

Mary Kay Fink

18

The Orchestra

The Cleveland Orchestra


1112 clevelandorchestra.com

O R C H E S T R A

PICCOLO Mary Kay Fink Anne M. and M. Roger Clapp Chair

HORNS Richard King *

TIMPANI Paul Yancich *

George Szell Memorial Chair

Michael Mayhew §

Otto G. and Corinne T. Voss Chair

Tom Freer 2

Knight Foundation Chair

OBOES Frank Rosenwein * Edith S. Taplin Chair

Jeffrey Rathbun 2 Everett D. and Eugenia S. McCurdy Chair

Robert Walters ENGLISH HORN Robert Walters Samuel C. and Bernette K. Jaffe Chair

CLARINETS Franklin Cohen * Robert Marcellus Chair

Robert Woolfrey Daniel McKelway 2 Robert R. and Vilma L. Kohn Chair

Linnea Nereim E-FLAT CLARINET Daniel McKelway Stanley L. and Eloise M. Morgan Chair

Jesse McCormick Hans Clebsch Richard Solis Alan DeMattia TRUMPETS Michael Sachs * Robert and Eunice Podis Weiskopf Chair

Jack Sutte Lyle Steelman2 James P. and Dolores D. Storer Chair

CORNETS Michael Sachs * Mary Elizabeth and G. Robert Klein Chair

Michael Miller TROMBONES Massimo La Rosa* Gilbert W. and Louise I. Humphrey Chair

Richard Stout

BASSOONS John Clouser *

Shachar Israel 2

Louise Harkness Ingalls Chair Sandra L. Haslinger Chair

Jonathan Sherwin CONTRABASSOON Jonathan Sherwin

Margaret Allen Ireland Chair

Donald Miller Tom Freer Marc Damoulakis KEYBOARD INSTRUMENTS Joela Jones * Rudolf Serkin Chair

Carolyn Gadiel Warner Marjory and Marc L. Swartzbaugh Chair

Michael Miller

BASS CLARINET Linnea Nereim

Barrick Stees 2

PERCUSSION Jacob Nissly *

Alexander and Marianna C. McAfee Chair

BASS TROMBONE Thomas Klaber EUPHONIUM AND BASS TRUMPET Richard Stout TUBA Yasuhito Sugiyama*

LIBRARIANS Robert O’Brien Donald Miller ORCHESTRA PERSONNEL Carol Lee Iott DIRECTOR

Rebecca Vineyard MANAGER

ENDOWED CHAIRS CURRENTLY UNOCCUPIED ASSISTANT PRINCIPAL HARP

Sunshine Chair

* Principal § 1 2

Associate Principal First Assistant Principal Assistant Principal

Nathalie C. Spence and Nathalie S. Boswell Chair

Severance Hall 2011-12

The Orchestra

19


Hold the hand of this generation and the next Doing the Most Good

4.4% - 9.8%

Charitable Gift Annuities Call

1-866-364-6446


Perspectivesfrom the Executive Director “A pure-bred elegance is transmitted to all sections; the brilliance of the winds is inspired by the transparency of the strings, though their sound is never overpowering. Are American orchestras too flashy, too thundering? Cleveland is the dream antidote to this persistent cliché. Here is the most refined of orchestras, where the supernatural cohesion of the attacks never turns into a power show by an advancing army.” —Le Figaro, October 28, 2011 Conquering musical Europe isn’t easy for an American orchestra. But once again our own Cleveland musicians under Franz’s direction came home last weekend triumphant from a demanding concert tour in some of the most competitive music centers anywhere, including Madrid, Paris, and Vienna. Winning the championship, in music no different than in sports, and doing so year after year, takes talent, dedication, and hard work. It also takes practice. Over the course of a three-week roadtrip, within a packed schedule of rehearsals, concerts and travel, Cleveland’s musicians stole time to practice scales, arpeggios, and etudes so that with the downbeat of each evening’s performance their collective artistry was at its peak. It’s an extraordinary aural experience to walk down the hotel hallway on the afternoon of a concert. The space is alive with music emanating from behind the doors to the rooms. Disconnected musical phrases rise and fall as you pass by. A tricky viola passage gives way to a clarinet melody, followed by a set of challenging, high register doublestops from a cello. Members of the Orchestra also found time on tour to share their talents with others outside the concert hall. Musicians taught masterclasses in Lisbon, Granada, Valencia, and Venice among other cities, and also came together to perform chamber music for generous sponsors. This hard work and dedication on tour is no less than what these musicians do here at home. Cleveland Orchestra players have a tradition of giving back to the community and to the institution wherever they are. Musicians generously organize and support fundraisers for a variety of worthy causes. They support the United Way annually, and when called upon, they organize benefit concerts in response to natural disasters, as they did for recent earthquake victims in Haiti and Japan. They teach students of all levels in Northeast Ohio, serve as volunteer leaders in non-profits, and contribute to charities of all kinds. There is even a group of ace orthographers who are renowned as winners of the annual spelling bee fundraiser that supports the Cleveland Heights-University Heights public schools. Franz and I, together with our Trustee leaders, admire and appreciate all the time and effort that the members of The Cleveland Orchestra devote to their art form and to the many important needs of the community. And I know that the musicians join with us in thanking you for your generous support of The Cleveland Orchestra.

Severance Hall 2011-12

Gary Hanson

21


THE CLEVELAND ORCHES-

News

OrchestraNews Franz Welser-Möst and Orchestra receive accolades throughout European Tour and Vienna Residency

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

THE CLEVELAND ORCHESTRA

Music Director Franz Welser-Möst and The Cleveland Orchestra returned home on November 6 from their eleventh international tour together, including the Orchestra’s fifth biennial residency at Vienna’s historic Musikverein concert hall. Throughout the tour, press reviews — excerpted on these pages — extended praise and accolades to the Orchestra for its precision and musicality. In addition to the Vienna Musikverein Residency, the tour featured two concerts in Madrid, Paris, and Luxembourg, and single concerts in Valencia, Cologne, and Linz. During the four-concert Musikverein Residency, the Orchestra gave two performances of Mozart’s “Great” Mass in C minor, featuring soprano Malin Hartelius, soprano Juliane Banse, tenor Martin Mitterrutzner, baritone Ruben Drole, and the Vienna Singverein. Cellist Truls Mørk was soloist with the Orchestra in Luxembourg. The thirteen-concert, seven-city tour began with performances in Madrid, Spain, on October 20 and 21 and ended in Vienna on November 5. Tour sponsors included Raiffeisenlandesbank Oberösterreich, Tele München Group, Jones Day, LNE Group / Lee Weingart, Miba AG, and SEMAG GmbH, with additional support from a group of generous individuals. “And in fact, the music sounded fabulous — with the weapons that Welser-Möst handles so scrupulously: precision, rhythmic control, a certain highly effective minimalism. All that, plus the assurance of having an orchestra like Cleveland at his command: compact, secure, even luminous.” —El Pais, October 22, 2011 “Welser-Möst was restrained in Mendelssohn, dominating in Stravinsky, and brilliant in Ravel. His gestures are sober, his movements a bit mechanical; his image ranges from timid to robot-like, from subtle to introverted. The analytic part takes precedence over the expressive. The artistic results are overwhelmingly effective. It is the art of perfection, pure and simple. No excessive emphases, no special effects, none of those ‘strokes of genius’ that are so often arbitrary. He even smiled in the Ravel, completely won over by the work’s rhythmic and timbral richness. All sections of the orchestra responded homogeneously and with great class.” —El Pais, October 22, 2011 “We were immediately won over by the agility of the strings, the warmly streaming sound of the woodwind, the unshakable security of the brass. The true miracle, then, occurred in the two major works on the program, Tchaikovsky’s Fourth Symphony and, before intermission, the Doctor Atomic Symphony by John Adams.” —KlassikInfo.de, October 30, 2011

22

Cleveland Orchestra News

The Cleveland Orchestra


HE CLEVELAND ORCHESTRA HESTR

News

THE CLEVELAND ORCHESTRA

“Franz Welser-Möst navigated his orchestra, which cannot be called anything but fantastic, with a secure sense of control and great restraint. At no time did he give in to sensationalism in this music, which is so rich in contrasts between pandemonic eruptions and soothing major-mode consonance. Some members of the orchestra distinguished themselves with impressive solos; above all, trumpeter Michael Sachs knocked our socks off with his sovereign technique.” —KlassikInfo.de, October 30, 2011 “In concerts Tuesday and Wednesday at Salle Pleyel, an historic hall near L’Arc de Triomphe, the orchestra and music director Franz Welser-Möst more than proved themselves worthy of a long-term presence here, dazzling two nearly sold-out crowds and leaving audiences eager for more. Both nights, in fact, they were regaled with multiple rounds of synchronized clapping.”

THE CLEVELAND ORCHESTRA

—Zachary Lewis, The Plain Dealer, October 27, 2011 “This pure-bred elegance is transmitted to all sections; the brilliance of the winds is inspired by the transparencey of the strings, though their sound is never overpowering. Are American orchestras too flashy, too thundering? Cleveland is the dream antidote to this persistent cliché. Here is the most refined of orchestras, where the supernatural cohesion of the attacks never turns into a power show by an advancing army.” —Le Figaro, October 28, 2011 “The triumph of the evening, marked by a prolonged acclaim, was due to Mozart’s great C-minor Mass (K. 427). Here Welser-Möst gradually unveiled an overall plan that was as comprehensive as it was successful, dashing and radiant, expressive and stylish.” —Vienna Kurier, November 2, 2011

—Die Presse, November 1, 2011

Severance Hall 2011-12

Cleveland Orchestra News

23

THE CLEVELAND OR-

“Yet for all the technical craftsmanship, one can also bring out the eloquence of this music, if one lets true emotions resonate. Franz Welser-Möst has succeeded in doing just that, since he has the finest string playing to build upon and is thus able to turn a breathtakingly beautiful study in sound into a moving, expressive musical statement without forcing the interpretation in the least.”


THE CLEVELAND ORCHES-

News

OrchestraNews Gary Hanson invited to join Nestlé and Salzburg Festival Young Conductors Award Jury

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

THE CLEVELAND ORCHESTRA

Cleveland Orchestra Executive Director Gary Hanson will join the jury for the Nestlé and Salzburg Festival Young Conductors Award in 2012. He joins a panel of 13 jurors invited to participate, including chairman Ingo Metzmacher and American baritone Thomas Hampson. The Nestlé and Salzburg Festival Young Conductors Award was created in 2010 as an initiative of Nestlé and the Salzburg Festival under the patronage of Pierre Boulez. The competition aims to give career momentum to highly talented young conductors. German conductor David Afkham (who made his Cleveland Orchestra debut at the 2011 Blossom Festival) was the first prize-winner in 2010, and Ainars Rubikis from Latvia won the award in 2011. In 2012, the three final candidates will each conduct a concert during a weekend in April in the famous Felsenreitschule in Salzburg. In three public concerts, the partner orchestras of the weekend will be the Camerata Salzburg, the Salzburg Mozarteum Orchestra, and the Munich Radio Orchestra. The prize of € 15,000 is awarded annually to a conductor ages 22 to 35. “I am honored to join my distinguished colleagues on the jury for this award, and to have this unique chance to discover and promote the best among the next generation of orchestral conductors,” Gary Hanson said upon his selection.

F.A.M.I.L.Y N.E.W.S Please join in extending congratulations and warm wishes to: Sonja Braaten Molloy (violin) and Owen Molloy, whose baby daughter, Annika Swede, was born on October 10. Alicia Koelz (violin) and Chris Georgalis, whose baby daughter, Penelope Maria Georgalis, was born on September 30.

24

Welcome to new musicians The Cleveland Orchestra welcomes three new musicians who joined the Orchestra in August or September. Jacob Nissly joins The Cleveland Orchestra as principal percussion with the start of the 2011-12 season. Mr. Nissly previously served as principal percussion of the Detroit Symphony and has performed with ensembles including the New World Symphony, Metropolitan Opera Orchestra, and the Chicago Symphony Orchestra. He holds a bachelor of music and jazz studies degree from Northwestern University and a master of music degree from the Juilliard School, and was recently appointed to the faculty of the Eastman School of Music. Also joining the Orchestra at the start of the season is Ying Fu, as a member of the first violin section. A native of Shanghai, China, Mr. Fu has won prizes in competitions in Europe, China, and the United States. He holds a bachelor of music degree from the Shanghai Conservatory and a master of music degree from Rice University. He is currently a doctor of musical arts degree candidate at Rice University, studying with Cho-Liang Lin and Sergiu Luca. The Cleveland Orchestra welcomed Jeffrey Zehngut as a new member of the second violin section in August during this summer’s Blossom Festival concerts. Zehngut served as associate principal second violin of the San Diego Symphony 2005-11 and as principal second of the Canton Symphony Orchestra 2002-05. He holds degrees from the Cleveland Institute of Music, where he studied with William Preucil and Paul Kantor.

Cleveland Orchestra News

The Cleveland Orchestra


HE CLEVELAND ORCHESTRA HESTR

News

OrchestraNews P H OTO G R A P H BY R O G E R MA S T R O I A N N I

Cleveland Orchestra and partner Conn-Selmer provide violins to El Sistema@Rainey

Cleveland Orchestra News

25

THE CLEVELAND OR-

Severance Hall 2011-12

THE CLEVELAND ORCHESTRA

The Cleveland Orchestra’s Opening Night Gala at Severance Hall on October 1 featured a special surprise moment for Franz Welser-Möst, when Cleveland Mayor Frank Jackson presented the Orchestra’s conductor with a ceremonial “key to the city” (above). The award was given to recognize the value of Franz’s work in extending and enhancing Cleveland’s reputation internationally. The gala evening, presented under the leadership of gala chair Norma Lerner and gala corporate chair Beth Mooney, marked the official start of Franz WelserMöst’s tenth season as music director. The event, which included an hour-long concert by The Cleveland Orchestra, raised $650,000. Proceeds from the evening will be used to create an education fund in Franz’s name, honoring his initiatives on behalf of music education. Of Ravel’s Boléro from the evening’s concert, The Plain Dealer wrote: “Proving he holds the key to Ravel as well as Cleveland, Welser-Möst offered a hardhitting performance, one that began with near-silent tapping . . . and ended with a cataclysmic punch.”

THE CLEVELAND ORCHESTRA

Franz Welser-Möst given “Key to the City” by Cleveland Mayor at Opening Night Gala

Thirty very excited students received brand-new violins at a special event in October as part of the inaugural year of El Sistema@Rainey, a comprehensive after-school orchestral music program launched by the Rainey Institute and Cleveland Orchestra violinist Isabel Trautwein with the 2011-12 school year. The Cleveland Orchestra with its partner Conn-Selmer are the official providers of Scherl & Roth violins for the El Sistema@ Rainey program. In its first year, El Sistema@Rainey is providing ten hours of weekly group violin instruction and educational support to 30 children in Cleveland in grades 1-4, with plans to expand to more students in future years. Young musicians will also have opportunities to perform onstage at Severance Hall and participate in masterclasses with Cleveland Orchestra musicians. Isabel Trautwein, who serves as the artistic director for El Sistema@Rainey, was granted a year-long leave of absence from The Cleveland Orchestra last season to participate in a formal training program to study the methods of El Sistema (“the system”) in Venezuela and Boston, with the goal of building an El Sistema “nucleo” in Cleveland. El Sistema was founded more than 35 years ago in Venezuela by economist, musician, and social reformer Dr. José Antonio Abreu. Today, the program serves more than 350,000 children through neighborhood-based daily music instruction. El Sistema@Rainey joins El Sistema programs worldwide, including those based in Atlanta, Baltimore, Boston, Chicago, Los Angeles, and Philadelphia.


THE CLEVELAND ORCHES-

News

OrchestraNews A.R.O.U.N.D T.O.W.N Recitals and presentations featuring Orchestra musicians

THE CLEVELAND ORCHESTRA

Upcoming performances by members of The Cleveland Orchestra in Northeast Ohio include: Cleveland Orchestra musicians Franklin Cohen (clarinet) and Mark Kosower (cello) perform a faculty recital at the Cleveland Insitute of Music on Monday evening, November 21, beginning at 7:30 p.m. The all-Brahms program also features pianist Orion Weiss and includes two clarinet sonatas, Opus 120 Nos. 1 and 2, plus the Clarinet Trio in A minor. Admission to the concert at Kulas Hall is free and open to the public.

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

Orchestra violist has new CD release Following the success of her Grammy award-winning last album, Cleveland Orchestra violist Eliesha Nelson has a new album titled Russian Viola Sonatas, featuring the music of Varvara Gaigerova, Alexander Winkler, and Paul Juon and released in July on the Sono Luminus label. Music from the album was featured on Cleveland Orchestra showcase on WCLV on October 7. The CD is available for purchase at the Cleveland Orchestra Store at Severance Hall.

Silence is golden As a courtesy to the performers onstage and the audience around you, all patrons are reminded to turn off cell phones and to disengage electronic watch alarms prior to the concert.

26

Cleveland Orchestra now available as an app for mobile phones The Cleveland Orchestra’s website is now available in a streamlined format as an application for cell phones. The “app” can be downloaded in versions for iPhone or Android phones, and many of its features also display on other webready mobile phones. The new app offers fans a convenient and streamlined way to purchase tickets, listen to Cleveland Orchestra radio broadcasts, and connect to the Orchestra’s social media. Created in partnership with InstantEncore.com, a leading performing arts digital platform, the app connects fans to The Cleveland Orchestra Blog, Facebook, YouTube, and information about the Orchestra (including musicians’ photos and biographies) and venues. The app also allows on-demand, streaming broadcasts from WCLV of performances by The Cleveland Orchestra and Cleveland Orchestra Youth Orchestra. This latest tech innovation is an addition to the Orchestra’s ongoing social media platforms and website, including The Cleveland Orchestra Blog (viewed by readers in all 50 states and more than 100 countries), Facebook, Twitter, Flickr, and YouTube. The Cleveland Orchestra’s website offers convenient online seat selection and print-at-home ticketing. Additional features to the mobile app will be added in the coming months. The app can be downloaded free from the iTunes Stores or Android Marketplace. Links for downloading can also be found on the Orchestra’s homepage.

Cleveland Orchestra News

The Cleveland Orchestra


OrchestraNews 2011-12 Celebrity Series on sale now — featuring variety of artists with The Cleveland Orchestra

THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA TRA THE CLEVELAND ORCHESTRA

News

Cleveland Orchestra education programs discussed at White House conference

THE CLEVELAND ORCHEST RA

The Cleveland Orchestra’s season of Celebrity Series was announced over the summer and is now on sale as series subscriptions or on an individual concert basis. The Celebrity Series features the Orchestra and guest artists performing popular, film, and jazz music. The season’s four programs are: Singer-songwriter Randy Newman (December 3), known for his scores for such films as Toy Story and hit singles such as “Short People,” performs with The Cleveland Orchestra. The Colors of Christmas (December 20), featuring vocalists Peabo Bryson, Jennifer Holliday, Lea Salonga, and Ben Vereen performing Christmas and holiday favorites with the Orchestra. Charlie Chaplin’s City Lights (March 31), a timeless romantic comedy, shown on a large screen with the film score performed live by The Cleveland Orchestra, with guest conductor William Eddins. John Pizzarelli (April 10), jazz guitarist and vocalist, joins the Orchestra to pay tribute to Nat “King” Cole with favorites from the Great American Songbook.

Cleveland Orchestra Director of Education & Community Programs Joan Katz Napoli was included in a group of performing artists and leaders invited to the White House in July as part of a program titled Champions of Change. While there, she shared information about the ways The Cleveland Orchestra serves more than 70,000 people annually through programs including school fieldtrip concerts, youth performing ensembles, and Music Study Groups for adults, as well as Music Mentors and Music Masters programs to support instrumental music programs in local schools. As part of the one-day event, Katz Napoli (shown at right, at the White House with Minnie Driver and Patricia Arquette) discussed how The Cleveland Orchestra was among the first symphony orchestras in the country to implement an arts integration program, Learning Through Music, which is now in its fourteenth year. Learning Through Music supports learning across the K-5 curriculum utilizing music as a tool.

La Clemenza di Tito, 2011

OBERLIN OPERA THEATER PRESENTS

Wednesday, November 16, 8 p.m.

A Wedding

Friday, November 18, 8 p.m.

An Ohio premiere

Sunday, November 20, 2 p.m.

—A Wedding

1.800.371.0178

t

Severance Hall 2011-12

Hall Auditorium, Oberlin Tickets: $5 - 12

www.oberlin.edu/artsguide

Cleveland Orchestra News

27

THE CLEVELAND ORC

with libretto by Arnold Weinstein and Robert Altman, and music by William Bolcom

“Stark raving married!”

Saturday, November 19, 8 p.m.


THE CLEVELAND ORCH

News

OrchestraNews Blog presents more Cleveland Orchestra news online The Cleveland Orchestra Blog

THE CLEVELAND ORCHESTRA

Looking for the latest news about The Cleveland Orchestra? Or behindthe-scenes information about an upcoming artist or event? Photographs from a recent event? Learn more online at clevelandorchestrablog.com. Check out recent postings to: â&#x20AC;&#x201D; Read reports and view photos from the Orchestraâ&#x20AC;&#x2122;s recent European Tour and Vienna Residency; â&#x20AC;&#x201D; Admire a local artistâ&#x20AC;&#x2122;s rendering of Severance Hallâ&#x20AC;&#x201D;number 93 in a series of 100 depictions of Cleveland sights; â&#x20AC;&#x201D; Connect to a Plain Dealer preview of Franzâ&#x20AC;&#x2122;s 10th season â&#x20AC;&#x201D; and remember what our music director looked like when

he took the helm; â&#x20AC;&#x201D; View photos from the Orchestraâ&#x20AC;&#x2122;s 9/11 Commemoration Concert; â&#x20AC;&#x201D; Meet the new members of the Orchestra. Read all this and more at our Blog. You can post your own comments, too. Or visit the Orchestra at Facebook, follow us on Twitter, and watch us on YouTube!

))'$  " #$!!#

"  % #+$"# '

"$ *(  '$"&$ $&#" % 

"#"  " $ $ # #"$' " 28

Cleveland Orchestra News

The Cleveland Orchestra


OrchestraNews Family Concerts continue with “Scenes from The Nutcracker” on Friday, December 2

Severance Hall 2011-12

Cleveland Orchestra News

29

THE CLEVELAND OR-

As a courtesy to the performers onstage and the audience around you, all patrons are reminded to turn off cell phones and to disengage electronic watch alarms prior to the concert.

The Cleveland Orchestra’s sixteeth annual Distinguished Service Award was presented to former principal percussionist Richard Weiner on October 13, at the start of that week’s Thursday evening concert at Severance Hall. The award, created in 1997, honors a person or organization that has provided continuing exemplary service to the Musical Arts Association, the non-profit parent organization that operates The Cleveland Orchestra, Severance Hall, and Blossom Festival. Richard Weiner was appointed to The Cleveland Orchestra in 1963 by George Szell, who appointed him principal percussionist in 1968. Weiner served as principal percussionist of the Orchestra for 43 years up to his retirement in August this year, leading the section longer than anyone else in the Orchestra’s history. He also served on a variety of Cleveland Orchestra committees over the decades, including the Negotiation Committee (which he chaired for many years), Artistic Advisory Committee, Pension Committee, Travel Committee, and the Severance Hall Renovation Committee. In announcing Weiner’s selection in August, Executive Director Gary Hanson said, “Richard Weiner has served The Cleveland Orchestra with distinction over his 48-year tenure. As principal percussionist, Rich has exemplified the Orchestra’s devotion to the highest standards of artistic excellence. He has also played a vital role off-stage representing the musicians’ interests during more than four decades of institutional growth. Everyone in the Orchestra family owes Rich a debt of gratitude for his selfless and dedicated service.”

THE CLEVELAND ORCHESTRA

Silence is golden

Cleveland Orchestra’s Distinguished Service Award be given to Richard Weiner at concert on October 13

THE CLEVELAND ORCHESTRA

The Cleveland Orchestra’s 2011-12 Family Concert Series, for young people ages 7 and older, began with a special Halloween Spooktacular! in October and continues on December 2 with Scenes from The Nutcracker featuring the Joffrey Academy Trainees from The Joffrey Ballet. This favorite holiday story comes to life on the Severance Hall stage with all the fun and magic of the Christmas season as these talented young dancers add a special sparkle to Tchaikovsky’s music. In addition to the concert, each of the season’s four Family Concerts features free pre-concert activities and post-concert treats. The activities, starting one hour before each concert, include Instrument Discovery, where children can try various instruments. After each performance, families are invited to enjoy a free treat compliments of series sponsor Giant Eagle. The series features two more concerts after The Nutcraker — Scenes from Tchaikovsky’s Nutcracker (with Academy Trainees from The Joffrey Ballet) in December, Carnival of the Animals in April, and Beethoven Lives Upstairs (with Classical Kids Live!) in May. Family Concert Series subscriptions and individual tickets are now available at clevelandorchestra.com or thru the Severance Hall Ticket Office.

HE CLEVELAND ORCHESTRA HESTR

News


THE CLEVELAND ORCHES-

News

OrchestraNews

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

THE CLEVELAND ORCHESTRA

New Cleveland Orchestra recording features live performance of “Rusalka” from Salzburg Festival The Cleveland Orchestra’s newest recording is a live audio recording of Dvořák’s opera Rusalka, performed under Franz Welser-Möst’s direction as part of the 2008 Salzburg Festival. The album on the Orfeo label was released at the end of September and New! comes in CD format or as a music download. The CD version is available from the Cleveland Orchestra Store at Severance Hall. The August 2008 performances of Rusalka marked the first time that The Cleveland Orchestra played from the orchestra pit for an opera production at the Salzburg Festival. The five soldout Rusalka performances were part of a Festival Residency that also included WelserMöst conducting the Orchestra in three different concert programs. Prior to the staged Salzburg performances, WelserMöst and the Orchestra presented in-concert performances of Rusalka in Cleveland in June 2008. The reviewer for London’s Sunday Times praised the Salzburg production, calling it “the most spellbinding account of Dvořák’s miraculous score I have ever heard, either in the theatre or on record. . . . I doubt this music can be better played than by the Clevelanders, the most ‘European’ of the American orchestras, with wind and brass soloists to die for and a string sound of superlative warmth and sensitivity.” The London Sunday Telegraph review said, “the playing of the Cleveland Orchestra under Franz WelserMöst is sumptuously beautiful and exquisitely detailed, allowing Dvořák’s operatic masterpiece to weave a strong spell at its first-ever Salzburg showing.”

30

Women’s Committee celebrates ninety years with special fashion show The Women’s Committee of The Cleveland Orchestra celebrated their 90th anniversary with a fashion revue and luncheon at Severance Hall on July 18, attended by more than 300 members and guests. President Beth Schreibman Gehring welcomed the Ursuline College School of Fashion Design in a presentation of fashions from the past 90 years. The Women’s Committee is dedicated to providing support for The Cleveland Orchestra through volunteer service, education activities, and fundraising opportunities. For additional information on volunteering, please call 216-231-7557.

“Endless Summer” gala celebrates Blossom and The Cleveland Orchestra The State Blossom Women’s Committee staged an end-of-summer gala on Friday, September 9, in Twinsburg to benefit The Cleveland Orchestra and Blossom. Titled “Endless Summer,” the benefit commemorated the 2011 Blossom Festival season and all things musical. State Chairman Phyllis Knauf notes that the event was a collaboration of all chapters of BWC and was their most ambitious fundraising effort in the 43-year history of the organization. The “Endless Summer” gala evening featured a Strolling Supper prepared by nine Celebrity Chefs from Northeast Ohio. Among the evening’s fundraising items were six steamer trunks once belonging to Cleveland Orchestra musicians, which had been restored and decorated by local artists commissioned by the Blossom Women’s Committee.

Cleveland Orchestra News

The Cleveland Orchestra


0DNLQJWKHZRUOGD EHWWHUSODFHNQRZV QRUHOLJLRQ

7KDW·VZK\ODVW\HDUWKH-HZLVK)HGHUDWLRQRI&OHYHODQGUDLVHGDQG DOORFDWHGPRUHWKDQPLOOLRQWRVRFLDOVHUYLFHHGXFDWLRQDODQG KXPDQLWDULDQRUJDQL]DWLRQVWKDWVXSSRUW&OHYHODQG·V-HZLVKDQGJHQHUDO FRPPXQLWLHVDVZHOODVWKRVHLQPRUHWKDQFRXQWULHVDURXQGWKH ZRUOG7KURXJKWKHJHQHURVLW\RIRXUGRQRUVWKH-HZLVK)HGHUDWLRQRI &OHYHODQGLV2KLR·VODUJHVWJUDQWPDNLQJRUJDQL]DWLRQ



7RJHWKHUZH·UHKHOSLQJWRPDNHWKHZRUOGDEHWWHUSODFHIRUDOOSHRSOH   " $ $& ( !&!" # 

   ( ''' '%!&!" #$

Jewish Federation  


1.9.12

12.12.11

11.14.11

Town Hall Speaker Series

DAVID POGUE “The Digital Generation Comes Of Age”

CAPITOL STEPS “The Lighter Side of Politics”

AARON DAVID MILLER “ Gulliver’s Troubles: How America Will Fare in a Changing Middle East”

Beautifully restored and updated, Washington Place Bistro & Inn is the perfect spot for business, entertaining, relaxing or romance. Intimate, comfortable dining rooms, a warm attractive lounge, exquisite patio, and well-appointed sleeping rooms round out this charming gem in Little Italy.

— 2011 AWARDS — Best New Restaurant Best Romantic Resturant 2011 Top Cleveland Patio 2011

2203 Cornell Road | Cleveland, OH 44106 216-791-6500 washingtonplacelittleitaly.com

The Cleveland Orchestra

2.6.12

Guide to Fine Schools LARRY ELDER

2.27.12

“American Exceptionalism: Is America Still a Land of Opportunity”

ERSKINE B. BOWLES “Practical Implications of the Debt Ceiling Level”

Tickets are $45 each. Ohio Theatre 6:00 PM

Call for tickets at

216.241.1919 or order online at www.townhallofcleveland.org

Academic Sponsor

32

Consistently ranked among “Best Communities for Music Education” in the Nation!

216-898-8300 www.berea.k12.oh.us

2WKHUÀQHVFKRROVDGYHUWLVLQJLQ7KH&OHYHODQG2UFKHVWUD·V 6HYHUDQFH+DOOSURJUDPVLQFOXGH

Baldwin-Wallace College Conservatory of Music 440-826-2369 Cleveland Institute of Music 216-791-5000 Cleveland State University Kulas Series of Keyboard Conversations with Jeffrey Siegel 216-687-5018 Gilmour Academy 440-473-8050 The Oberlin Conservatory of Music 440-775-8413

The Cleveland Orchestra


1112

LEARNING MORE ABOUT THE MUSIC

clevelandorchestra.com

Concert Previews The Cleveland Orchestra offers a variety of options for learning more about the music before each concert begins. For each concert, the program book includes program notes commenting on and providing background about the composer and his or her work being performed that week, along with biographies of the guest artists and other information. You can read these before the concert, at intermission, or afterward. (Program notes are also posted ahead of time online at clevelandorchestra.com, usually by the Monday directly preceding the concert.) The Orchestra’s Music Study Groups also provide a way of exploring the music in more depth. These classes, professionally led by Dr. Rose Breckenridge, meet weekly in locations around Cleveland to explore the music being played each week and the stories behind the composers’ lives. Free Concert Previews are presented one hour before most subscription concerts throughout the season at Severance Hall. The previews (see listing at right) feature a variety of speakers and guest artists speaking or conversing about that weekend’s program, and often include the opportunity for audience members to ask questions.

Severance Hall 2011-12

Cleveland Orchestra Concert Previews are presented before every regular subscription concert, and are free to all ticketholders to that day’s performance. Previews are designed to enrich the concert-going experience for audience members of all levels of musical knowledge through a variety of interviews and through talks by local and national experts. Concert Previews are made possible by a generous endowment gift from Dorothy Humel Hovorka. November 11, 12, and 13 “Being a Sorcerer’s Apprentice” with Michael Charry, author of George Szell: A Life of Music

November 17, 18, and 19 “Bach’s Music for Court and City” with David J. Rothenberg, associate professor of musicology, Case Western Reserve University

November 25, 26, and 27 “Symphonic Opera, Vocal Piano” with Michael Strasser, professor of musicology, Baldwin-Wallace College Conservatory of Music

December 8 and 10 “Musical Splendor and Radiance” with Rabbi Roger Klein, The Temple – Tifereth Israel

January 12, 13, and 14 “Beloved Favorites” with Rose Breckenridge, Cleveland Orchestra Music Study Groups administrator and lecturer For future Concert Preview details, visit clevelandorchestra.com

Concert Previews

33


The Essential Ingredient Music is an essential ingredient in the life of a city, providing a rhythm to our daily activities. At Lubrizol, we strive to be an essential ingredient in our customers’ success. With the right mix of people, ideas and market knowledge we create unique formulations and ingredients that work with their products to make everyday life easier and better. In a thousand different ways—from the metalworking fluids that help form microwave ovens and musical instruments to the polymers that help hair stay soft and shiny—we are an essential part of the things that are essential to you. Please join us in celebrating an organization that is essential to our city. Lubrizol is proud to sponsor this evening’s performance The Cleveland Orchestra. ese performances by Theof Cleveland Orchestra.

www.lubrizol.com


T H E C L E V E L A N D O R C H E S T R A F R A N Z

W E L S E R - M Ö ST M U S I C

D I R E C T O R

Severance Hall

Friday evening, November 11, 2011, at 8:00 p.m. Saturday evening, November 12, 2011, at 8:00 p.m. Sunday afternoon, November 13, 2011, at 3:00 p.m.

1112 clevelandorchestra.com

Alan Gilbert, conductor LUDWIG VAN BEETHOVEN (1770-1827)

Romance No. 2 in F major, Opus 50 (for violin and orchestra) WILLIAM PREUCIL, violin

ANTON WEBERN (1883-1945)

MAX BRUCH (1838-1920)

Im Sommerwind [In the Summer Breeze] Adagio appassionato, Opus 57 (for violin and orchestra) WILLIAM PREUCIL, violin

INTERMISSION ARNOLD SCHOENBERG (1874-1951)

Pelleas and Melisande, Opus 5

These concerts are sponsored by The Lubrizol Foundation. William Preucil’s solo appearance with The Cleveland Orchestra is made possible by a contribution to the Orchestra’s Guest Artist Fund from Dr. and Mrs. Sam I. Sato. The Saturday evening concert is dedicated to Mr. and Mrs. Alexander M. Cutler in recognition of their extraordinary generosity in support of The Cleveland Orchestra’s 2010-11 Annual Fund. The concerts will end on Friday and Saturday at about 9:50 p.m. and on Sunday afternoon at about 4:50 p.m. LIVE RADIO BROADCAST

Saturday evening’s concert is being broadcast live on WCLV (104.9 FM). The concert will be rebroadcast as part of regular weekly programming on WCLV on Sunday afternoon, January 1, 2012, at 4:00 p.m.

Severance Hall 2011-12

Concert Program — Week 4

35


Ludwig van Beethoven, 1818, pencil drawing by August von Klöber

‘‘

Music should strike fire from the heart of man, and bring tears from the eyes of woman.

‘‘

—Ludwig van Beethoven


INTRODUCING THE PROGRAM

Romantic Soundings THIS WEEK’S CONCERTS

feature four works of Romantic intent. Romantic in the 19th-century sense of being emotionally charged — to experience life and the world through the wonder and joy and anguish and passion of our senses. Romanticism as a movement was, in part, a reaction against the 18th century’s desire to explain everything logically. Music plays well to both extremes. It is systematic and ordered, yet it can carry and elicit a strong emotional force, and its waves and eddies can feel spontaneous and filled with reality. Two of the musical works chosen by guest conductor Alan Gilbert are by 19th-century composers who fully embraced the power of musical emotion: Beethoven and Bruch. The two pieces, written nearly a hundred years apart, feature solo violin, played here by concertmaster William Preucil. One is called Romance, the other features Passion in its title. Both are, for the most part, joyful in their emotional content, filled with sunshine and bright focus. The week’s other two works provide contrast. They were written early in the careers of two 20th-century composers who later explored and excelled in writing a much more rational style of music. Rational and systematic, but no less emotionally intense. Webern’s Im Sommerwind and Schoenberg’s Pelleas and Melisande were written at the very beginning of the 20th century and are still strongly immersed in the musical traditions of Romanticism, before each composer took up Serialism (and its inherent sense of atonality). In these works, the sunshine is disturbed by musical shadows and interruption. Schoenberg’s Pelleas, in particular, depicts a shifting and mystery-laden storyline, and defies some musical boundaries while still strongly in the mainstream. Romanticism is a river of many different currents. ABOVE

A 19th-century illustration of Melisande and Pelleas at the fountain where they discover their love.

Severance Hall 2011-12

About the Music

37


THE CLEVELAND MUSEUM OF ART

Chinese Art in an Age of Revolution

FU BAOSHI OCTOBER 16, 2011– JANUARY 8, 2012 Presenting sponsor:

Additional support from:

Organized by the Cleveland Museum of Art with the Nanjing Museum. Heaven and Earth Glowing Red, 1964. Nanjing Museum.

Baker Hostetler

Fu Baoshi Exhibition Programs MODERN CHINA: A Multidisciplinary Exploration Saturday, October 29, 1:30–4:00. Wen-hsin Yeh, University of California, Berkeley, Peter Galassi Museum of Modern Art, and Julia Andrews, Ohio State University. Book Club: The White-Haired Girl 3 Wednesdays, November 2, 9, 16, 1:30–2:45. China: Art and Technology Art Cart 3 Sundays, November 6, December 4, January 8, 1:00–3:00. Perspectives on Contemporary Chinese Art Wednesday, November 30, 6:30. Artist Ji Yunfei and Paola Morsiani, Curator of Contemporary Art

Two films on the Three Gorges Dam Up the Yangtze Friday, December 2, 7:00 and Still Life Sunday, December 4, 1:30. Holiday Film Festival: Recent Chinese Cinema 1:30 each afternoon, December 26–31. Chinese Art Music: Yang Wei and Ensemble Friday, December 9, 7:30. Mandarin and Cantonese language tours Sunday, October 23, Saturday, November 26, and Wednesday, December 28, 1:00–2:00 (Mandarin) and 2:00–3:00 (Cantonese). Chinese Painting Demonstration Sunday, December 4, 1:30-3:30 The Art of Reinvention: China, Ohio, and the New Global Economy January 4, 2012.

11150 East Blvd. University Circle ClevelandArt.org 216-421-7350 1-888-CMA-0033

Rembrandt in America February 19–May 28, 2012 This exhibition brings together about 50 autograph paintings by Rembrandt as well as others thought to be by the artist when they entered American collections. Adults $14, members free. Organized by the Cleveland Museum of Art, the North Carolina Museum of Art, Raleigh, and the Minneapolis Institute of Arts. The exhibition is supported by an indemnity from the Federal Council on the Arts and the Humanities. Additional support provided by the Samuel H. Kress Foundation. Sponsored by KeyBank. Self-Portrait, 1659. Rembrandt van Rijn. National Gallery of Art, Washington 1937.1.72


Romance No. 2 in F major, Opus 50 composed 1798 B E E T H O V E N ’ S T W O R O M A N C E S , written for solo violin and

by

Ludwig van

BEETHOVEN born December 16 or 17, 1770 Bonn died March 26, 1827 Vienna

orchestra, are both early works, written when the composer was in his twenties. Their refined, classical poise is clearly anchored in the late 18th century and is never seriously perturbed by any of the violent upheavals that so marked the Romantic Era in the next century. The virtually uninterrupted flow of lyrical melodies in these Romances makes these works come across as rather straightforward “love songs.” And yet, the very intensity of those melodies also points toward the new era, increasingly focused on emotional expression. The Romance in F major — the longer and more complex of the two — manifests this new sensibility even more strongly than does its companion piece in G major. It is cast in the form of a rondo, with the beguiling main theme alternating with episodes in which the minor mode, always a harbinger of “stormy” moods, comes to the fore. These darker, Romantic moments are balanced by rapid virtuoso passages. The final return of the rondo theme closes the work on a dreamy note. —Peter Laki © 2011 At a Glance Beethoven almost certainly composed the second of his two Romances for solo violin in 1798, as it must be identical to the “Adagio” that violinist Ignaz Schuppanzigh performed in Vienna on November 5 of that year. The work was first published in 1805. The F-major Romance runs about 10 minutes in performance. Beethoven scored it for an orchestra of flute, 2 oboes, 2 bassoons, 2 horns, and

Severance Hall 2011-12

About the Music

strings, plus the solo violin. The Cleveland Orchestra first performed this work in October 1964, under the direction of George Szell, with Leonid Kogan as soloist. It has been programmed on just a few occasions since that time, most recently with William Preucil as soloist with music director Franz Welser-Möst at a Miami Residency concert in January 2010.

39


Anton Webern, 1914, painted by Oskar Kokoschka

‘‘

Your ears will always lead you right, but you must know why.

‘‘

—Anton Webern


Im Sommerwind [In the Summer Breeze] Idyll for Large Orchestra

composed 1904

by

Anton

WEBERN born December 3, 1883 Vienna died September 15, 1945 Mittersill, near Salzburg

T H E R E I S L I T T L E in the orchestral idyll Im Sommerwind to indicate that its composer would eventually develop into one of the greatest innovators of 20th-century music. In 1904, when he wrote the piece, Webern was a 21-year-old student in Guido Adler’s musicology class at the University of Vienna; he had yet to meet Arnold Schoenberg, the man who was to change his music and life forever. In the summer of 1904, Webern was considering choosing the conservative Hans Pfitzner as his composition teacher. He and a friend travelled to Berlin to meet Pfitzner, but legend has it that they left in indignation after Pfitzner made some disparaging remarks about Mahler, who at the time was already Webern’s idol. Webern instead began studies with Schoenberg in the autumn of 1904. To his first lesson he brought with him the score of Im Sommerwind — no mean achievement from a young man only about to begin his serious studies, although he had, of course, taken music theory in Klagenfurt where he grew up and had studied the works of Wagner and Mahler with great diligence. Schoenberg must have been impressed by the facility with which Webern used the late Romantic idiom of the day within Im Sommerwind and the occasional personal contributions he made. And let us remember the context of 1904, when only the first four of Mahler’s symphonies had been performed in Vienna. Strauss had not yet completed his opera Salome, and Schoenberg himself was still writing in a Romantic, post-Wag-

GILMOUR

ACADEMY TM

Where Inspiration Happens

Family Open House Wednesday, October 12 Sunday, November 20 Co-ed Preschool – Grade 12 gilmour.org A Catholic, independent school sponsored by the Congregation of Holy Cross, Notre Dame, Indiana

Severance Hall 2011-12

About the Music

41


Great people.

Great clients.

Great results.

www.tuckerellis.com

The Plain Dealerâ&#x20AC;&#x2122;s #1 Top Midsize Workplace


nerian style, creating such works as Transfigured Night, Gurrelieder, and Pelleas and Melisande. As a young musicology student, Webern entered the musical and cultural milieu of his elders with astonishing ease and naturalness, fluent in the highly refined language of turn-of-thecentury German music. For Im Sommerwind, he was inspired by a literary work â&#x20AC;&#x201D; as Strauss, Mahler, and Schoenberg also so often were. In Webernâ&#x20AC;&#x2122;s case, the inspiration was a poem by Bruno Wille (1860-1928), a writer and philosopher who had published Offenbarungen eines Wacholderbaums [â&#x20AC;&#x153;Revelations of a Juniper Treeâ&#x20AC;?] in 1901. The poem, taken from that book, was characterized by Hans Moldenhauer, one of the first great Webern scholars, as â&#x20AC;&#x153;a paean to nature, an impressionistic description of a summer day in woods and fields.â&#x20AC;? Something of a Germanic equivalent of the young Debussyâ&#x20AC;&#x2122;s â&#x20AC;&#x153;paean to natureâ&#x20AC;? in his Printemps [â&#x20AC;&#x153;Springâ&#x20AC;?] of 1887, Im Sommerwind explores orchestral color in a way that can also be called impressionistic. In hindsight, we may recognize the composerâ&#x20AC;&#x2122;s sensitivity to sounds, which would later give rise to the Webernian Klangfarbenmelodie [â&#x20AC;&#x153;sound-color melodyâ&#x20AC;?]. The form is created by an alternation of solemn, cheerful, and passionate characters delineated with admirable clarity and concision. From a soft beginning, the music grows to a powerful climax and back to softness, even â&#x20AC;&#x153;inaudibilityâ&#x20AC;? (as Webern wrote in the score). In 1904, the atonality of Schoenberg and Webern was, of course, â&#x20AC;&#x153;music of the future.â&#x20AC;? And Im Sommerwind is firmly anchored in the lushly orchestrated D-major sonorities of its beginning and ending. â&#x20AC;&#x201D;PETER LAKI Š 2011

At a Glance Webern wrote Im Sommerwind in 1904. It was neither performed nor published during the composerâ&#x20AC;&#x2122;s lifetime, and the premiere did not take place until May 25, 1962, with Eugene Ormandy conducting the Philadelphia Orchestra at the first International Webern Festival, held during the Seattle Worldâ&#x20AC;&#x2122;s Fair. Im Sommerwind runs just over 10 minutes in performance. Webern scored it for 3 flutes, 2 oboes, english horn, 4 clarinets, bass clarinet, 2 bassoons, 6 horns, 2 trumpets, timpani, percussion (triangle, cymbals), 2 harps, and strings. The Cleveland Orchestra first performed Im Sommerwind during the 1972 Blossom Festival, conducted by AndrĂŠ Kostelanetz. The most recent performances were at Severance Hall in October 2006, led by Matthias Pintscher.

 BREAKING N E W S! Carl Topilow & Cleveland POPS present

Featuring the talented reporters of

3DODFH

7KHDWUH 

An Old-Fashioned Christmas



SUNDAY, NOV.27TH 2 PM

)RUWLFNHWVFDOO   )RUWLFNHWVFDOO  RU   RU  RURQOLQHFOHYHODQGSRSVFRP RURQOLQHFOHYHODQGSRSVFRP Severance Hall 2011-12

About the Music

43


Kulas Series Keyboard ConversationsÂŽ Kulas Series of of Keyboard ConversationsÂŽ with Siegel withJeffrey Jeffrey Siegel

24th Season 2011-2012 24th Season 2011-2012

Presented by Cleveland State Universityâ&#x20AC;&#x2122;s Center for Arts and Innovation

Presented by Cleveland State Universityâ&#x20AC;&#x2122;s Center for Arts and Innovation

Masterly Masterly

Sunday, Sunday,October 2,2,2011 October Sunday, October 2, 2011 2011 Sunday, October 2, 2011 AA A Beethoven BeethovenBonanza! Bonanza!The Themany many Beethoven Bonanza! The many

AABeethoven Bonanza! The many B Beethoven moods moods ofof ofgenius! genius!Bonanza! The many moods genius! moods of genius! moods of genius! Enthralling Enthralling B Sunday, Sunday, November November 20, 20,2011 2011 Sunday, November 20, 2011 Charming Charming The The Romantic Romantic Music Music of of Franz Franz Liszt The Romantic Music of Franz The Romantic Music of FranzLiszt LisztLiszt B Scintillating Sunday, March 4, 2012 Scintillating Sunday, Sunday, March March 4,4,2012 2012 Rachmaninoff and Tchaikovsky a Rochmaninoff Rochmaninoff and andTchaikovsky Tchaikovsky â&#x20AC;&#x153;An afternoon of entertaining talk and â&#x20AC;&#x153;An afternoon of entertaining talk and Sunday, May 6, 2012 exhilarating music.â&#x20AC;? exhilarating music.â&#x20AC;? Sunday, March 2012 2012 y 6,6,6, Sunday, March 2012 A musical love triangle: Robert, Clara â&#x20AC;&#x201C;The Washington Post - The Washington Post A musicallove lovetriangle: triangle:Robert, Robert,Clara Clara Aand A musical musical love triangle: Robert, Clara Johannes! and Johannes! and andJohannes! Johannes!

All concerts at 3:00 All concerts beginbegin at 3:00 pmpm at at Cleveland State Universityâ&#x20AC;&#x2122;sWaetjen Waetjen Cleveland State Universityâ&#x20AC;&#x2122;s Auditorium, EuclidAve. Ave.and and E. E. 21st Auditorium, Euclid 21stSt. St. For more information call 216.687.5018 For more information call 216.687.5018 visitwww.csuohio.edu/concert www.csuohio.edu/concertseries/kc ororvisit series/kc series/kc



         

Call Alan Weinberg, Managing Partner, at 216-685-1100. Weltman, Weinberg & Reis Co., LPA

44

The Cleveland Orchestra


Adagio appassionato, Opus 57 composed 1890 T W O O F M A X B R U C H ’s

by

Max

BRUCH born January 6, 1838 Cologne died October 2, 1920 Berlin

best-known works — his Concerto in G minor and his Scottish Fantasy — were written for violin and orchestra. Yet he composed many other works for this particular combination of forces, including two more concertos and no fewer than five additional shorter works, including the Adagio appassionato. This rich harvest is due, in no small part, to Bruch’s friendship with one of the greatest violinists of his time, Joseph Joachim (1831-1907), the man who had also inspired the violin concertos of Brahms and Dvořák, among others. The Hungarian-born Joachim, a central figure on the German musical scene for much of the 19th century, was a steadfast champion of Bruch’s music, although other commitments prevented him from giving the premiere of this Adagio. In a letter to his publisher Fritz Simrock, Bruch called Adagio appassionato “one of my best works.” It is certainly an emotionally intense composition that fully lives up to its title. Adopting the dramatic F-minor key of Beethoven’s “Appassionata” Piano Sonata, Bruch’s feelings erupt right at the beginning of the piece with a succession of accented high notes, fast runs, and one expressive melody after another. Numerous figures in dotted (or even double-dotted) rhythm — providing contrasts between longer and shorter notes — create additional tension as the piece progresses along a path prescribed by classical sonata form. Shortly after completing this work, Bruch moved from Breslau (now Wrocław, Poland) to Berlin, where he had accepted a professorship at the Conservatory. His relocation to the capital was a sure sign that the 52-year-old composer had reached the apex of his career; his status as one of the most distinguished German musicians of his time was thus firmly established. —PETER LAKI © 2011

At a Glance Bruch composed his Adagio appassionato in 1890 for Joseph Joachim; the first performance, however, was given by Pablo Sarasate, in England in June 1891. This work runs about 10 minutes in performance. Bruch scored it for an

Severance Hall 2011-12

About the Music

orchestra of 2 flutes, 2 oboes, 2 clarinets, 2 bassoons, 4 horns, 2 trumpets, 3 trombones, timpani, and strings, plus the solo violin. The Cleveland Orchestra is presenting this work for the first time at this weekend’s concerts.

45


Dad’s my hero. He can fix everything from hot water tanks to BB guns. My son has the only two-story tree fort in the neighborhood thanks to him. He’s my go-to guy. Ask him about the big Cleveland game in ` 64, stocks, deep frying turkeys-he knows it all. But he doesn’t get around like he used to. He’s getting older and he can’t fix that. Wonder what he wants for the future? How do I bring it up?

What should our game plan be?

Have you ever thought about what your loved ones want in their final years of life? Thinking about it is the first step to talking about it. At Hospice of the Western Reserve, we believe discussing it early will help you and your family make the right decisions when the time comes. That’s why we encourage you to talk about it now. Contact us for a booklet that explains our services and helps you start the conversation. hospicewr.org/plan 855.852.5050


Arnold Schoenberg, 1917, portrait by Egon Schiele

‘‘

Whether one calls oneself conservative or revolutionary, whether one composes in a conventional or progressive manner, whether one tries to imitate old styles or is destined to express new ideas — one must be convinced of the infallibility of your own fantasy and believe in your own inspiration.

‘‘

—Arnold Schoenberg


THE CLEVELAND C O N C E R T

C A L E N D A R

FALL SEASON Thursday November 17 at 8:00 p.m. Friday November 18 at 8:00 p.m. Saturday November 19 at 8:00 p.m. THE CLEVELAND ORCHESTRA Ton Koopman, conductor Teresa Wakim, soprano

BACH BACH BACH BACH BACH

Brandenburg Concerto No. 1 Cantata No. 202 (“Wedding”) Sinfonia from Cantata No. 209 Sinfonia from Cantata No. 42 Orchestral Suite No. 3

Concert Sponsor: Jones Day

Sunday November 20 at 3:00 p.m. CLEVELAND ORCHESTRA YOUTH ORCHESTRA James Feddeck, conductor

BRAHMS Academic Festival Overture BACH Prelude and Fugue (“St. Anne”) transcribed by Arnold Schoenberg DVORÁK Symphony No. 8 Friday November 25 at 8:00 p.m. Saturday November 26 at 8:00 p.m. Sunday November 27 at 3:00 p.m. THE CLEVELAND ORCHESTRA Fabio Luisi, conductor Jonathan Biss, piano

R. STRAUSS Till Eulenspiegel MOZART Piano Concerto No. 17 R. STRAUSS Aus Italien Concert Sponsor: PNC

Friday December 2 at 7:00 p.m. THE CLEVELAND ORCHESTRA James Feddeck, conductor FAMILY CONCERT:

Scenes from The Nutcracker

The Joffrey Academy Trainees join The Cleveland Orchestra to capture the magic of the holiday season in scenes from Tchaikovsky’s beloved Nutcracker ballet. Concert Sponsor: Giant Eagle

Saturday December 3 at 8:00 p.m. THE CLEVELAND ORCHESTRA James Feddeck, conductor with Randy Newman CELEBRITY CONCERT:

Randy Newman

Academy Award-winning songwriter Randy Newman joins the Orchestra for one special evening to perform such chart-toppers as “You’ve Got a Friend in Me” and “Short People.” Plus music from Toy Story, The Natural, Avalon, and more!

48

Thursday December 8 at 8:00 p.m. Saturday December 10 at 8:00 p.m. THE CLEVELAND ORCHESTRA Marin Alsop, conductor Peter Otto, violin Joela Jones, organ

BARBER Symphony No. 1 BERNSTEIN Serenade (for violin) SAINT-SAËNS “Organ” Symphony Concert Sponsor: Medical Mutual of Ohio

Friday December 9 at 7:00 p.m. THE CLEVELAND ORCHESTRA

KeyBank Fridays@7 Concert BERNSTEIN Serenade (for violin) SAINT-SAËNS “Organ” Symphony followed by post-concert music with Magda Giannikou and Banda Magda

Sunday December 11 at 3:00 p.m. Friday December 16 at 8:00 p.m. Saturday December 17 at 3:00 p.m. Saturday December 17 at 8:00 p.m. Sunday December 18 at 3:00 p.m. Sunday December 18 at 7:00 p.m. Thursday December 22 at 8:00 p.m. Friday December 23 at 3:00 p.m. Friday December 23 at 8:00 p.m. THE CLEVELAND ORCHESTRA Robert Porco, conductor Cleveland Orchestra Chorus and guest choruses

CLEVELAND ORCHESTRA CHRISTMAS CONCERTS Celebrate the holiday season with The Cleveland Orchestra and Choruses in these annual offerings of music for the season, including sing-alongs and special guests.

Thursday December 15 at 8:00 p.m. Burning River Brass

BURNING RIVER BRASS Tuesday December 20 at 8:00 p.m. Wednesday December 21 at 8:00 p.m. THE CLEVELAND ORCHESTRA Herman Jackson, conductor with Peabo Bryson, Jennifer Holliday, Lea Salonga, and Ben Vereen

THE COLORS OF CHRISTMAS Concert Calendar

The Cleveland Orchestra


1112

ORCHESTRA

clevelandorchestra.com

WINTER SEASON

I N

T H E

S P O T L I G H T

Thursday January 12 at 8:00 p.m. Friday January 13 at 11:00 a.m. Saturday January 14 at 8:00 p.m. THE CLEVELAND ORCHESTRA Franz Welser-Möst, conductor Lisa Batiashvili, violin

BRAHMS Violin Concerto SAARIAHO Orion SMETANA from Má Vlast [“My Homeland”] — Vysehrad, The Moldau, and Sárka Concert Sponsor: Eaton Corporation

Sunday January 15 at 7:00 p.m. THE CLEVELAND ORCHESTRA Chelsea Tipton, conductor Central State University Chorus Martin Luther King Jr. Celebration Chorus

MARTIN LUTHER KING JR. CELEBRATION CONCERT The Cleveland Orchestra’s 32nd annual concert celebrating the spirit of Dr. King’s life, leadership, and vision. Presented in collaboration with the City of Cleveland. TICKETS: Admission is free, but tickets are required. Tickets become available beginning January 5, 2012. Sponsored by KeyBank, with additional support from The Cleveland Foundation.

Thursday January 19 at 8:00 p.m. Friday January 20 at 8:00 p.m. Saturday January 21 at 8:00 p.m. THE CLEVELAND ORCHESTRA Franz Welser-Möst, conductor Yefim Bronfman, piano

BRAHMS Piano Concerto No. 2 SHEPHERD Wanderlust SHOSTAKOVICH Symphony No. 6 Concert Sponsor: FirstMerit Bank

TON KOOPMAN CONDUCTS BACH Thursday November 17 at 8:00 p.m. Friday November 18 at 8:00 p.m. Saturday November 19 at 8:00 p.m. THE CLEVELAND ORCHESTRA Ton Koopman, conductor Teresa Wakim, soprano

The Cleveland Orchestra’s new artist-inresidence, internationally acclaimed conductor and early music authority Ton Koopman, returns to Severance Hall to lead an all-Bach program. Featuring well-known favorites and more unusual gems from the greatest Baroque composer of them all! Concert Sponsor: Jones Day Ton Koopman is serving as The Cleveland Orchestra’s artist-in-residence, a position supported by the Orchestra’s Malcolm E. Kenney Artist-in-Residence Fund.

For a complete schedule of future events and performances, or to purchase tickets online 24/ 7 for Severance Hall concerts, visit www.clevelandorchestra.com. Cleveland Orchestra Radio Broadcasts: Radio broadcasts of current and past concert performances by The Cleveland Orchestra can be heard as part of regular weekly programming on WCLV (104.9 FM), with programs broadcast on Saturday evenings at 8:00 p.m. and Sunday afternoons at 4:00 p.m. Program Notes for each regular concert are usually posted in advance online at clevelandorchestra.com.

CLEVELAND ORCHESTRA TICKETS PHONE

(216) 231-1111 800-686-1141

clevelandorchestra.com Severance Hall 2011-12

Concert Calendar

49


+ + + + +

IF YOU’RE DRIVING ONE OF OUR CARS, YOU’VE ALREADY EXPERIENCED A GREAT PERFORMANCE TONIGHT.

of North Olmsted

of North Olmsted

North Olmsted

Mercedes-Benz Sprinter of North Olmsted

of North Olmsted

of North Olmsted

of Cleveland

Airport Acura

Airport Infiniti

Beachwood Buick

Beachwood GMC

of Cleveland

of Cleveland

of Cleveland

Collection Auto Group has more #1 dealers than any other dealer group in Ohio.

www.collectionautogroup.com


Symphonic Poem: Pelleas and Melisande, Opus 5 composed 1902-03 T H E E A R LY W O R K S

by

Arnold

SCHOENBERG born September 13, 1874 Vienna died July 13, 1951 Los Angeles

Severance Hall 2011-12

of Arnold Schoenberg usually evoke one of two reactions. Some people feel that this music is not yet the “real” Schoenberg, with much that sounds still firmly rooted in late Romanticism. Others wish Schoenberg had stopped right there, with the early works, and had never developed further — into atonality and serialism. Both reactions are missing part of the real point. Surely, Pelleas and Melisande must be “real” Schoenberg. It is the work of a composer who knew exactly what he wanted and how to get it — a feat all the more impressive because Schoenberg was almost entirely self-taught in composition. And, as far as his later music is concerned, there is a definite continuity across the various periods. Serialism was nothing but an attempt to impose a new order on musical ideas that had been developing since the beginning of Schoenberg’s career and had, over a period of twenty years, gradually broken loose from tonal control. When Schoenberg began work on his symphonic poem Pelleas and Melisande in Berlin in 1902, he was apparently unaware that Debussy’s opera of the same name had just been performed in Paris. It was Richard Strauss who had suggested Maurice Maeterlinck’s drama as a musical subject to the young Schoenberg, even though, as principal conductor at the Imperial Court Opera in Berlin, he must have known of the recent operatic sensation that Debussy’s impressionistic work had caused. In any case, Schoenberg quickly gave up his original plans to write an opera on Pelleas and composed a tone poem instead, more or less along Straussian lines. Thanks to research done by Walter B. Bailey, we know that Schoenberg had very precise ideas about how the music expressed the characters and actions in the drama. These ideas survive in sketches and correspondence, but Schoenberg did not publish them until a year before his death, when (in 1950) he wrote jacket notes for a recording of the work. And even at that point, he only printed part of the information. Of course, the essence of Maeterlinck’s play — which Debussy captured so masterfully in his opera — is its mystery, its tendency of never spelling things out completely. Thus, some mystery from Schoenberg seems appropriate. Nevertheless, Schoenberg’s approach — and indeed, his About the Music

51


medium is the message.” “The

— Marshall McLuhan, 1911-1980

Photo by Roger Mastroianni

World-Class venue. World-Class advertisers.

Cleveland Orchestra Program Book Advertising information: John Moore • 216-721-4300 • jmoore@LPCpub.com


entire musical style — was the total opposite of Debussy’s. Schoenberg later commented that, had he written his Pelleas opera, “it would have differed from Debussy’s. I might have missed the wonderful perfume of the poem, but I might have made my characters more singing.” Indeed, he made them sing even in the symphonic poem, with their themes reaching the kind of post-Wagnerian Romantic heights of passion that Debussy took great pains to avoid. The story in a nutshell: Golaud, the grandson of the mythical King Arkel, discovers a young girl in the forest. Her name is Mélisande; her origins are never revealed. Golaud takes her home and marries her; but she falls in love with his younger half-brother Pelléas. Golaud kills Pelléas. Mélisande dies in childbirth, leaving her husband forever in doubt about the nature of the love between her and Pelléas. Schoenberg’s 40-minute tone poem is structured as a four-movement symphony, played with no pauses between the movements, with a scherzo in second place and a slow section coming third. The work opens with a somber introduction, with a bass clarinet theme that Schoenberg called the “Fate” motif. It is the first meeting between Golaud and Melisande in the forest; she is pictured by an expressive oboe melody, he by a theme played by the three horns “softly but with determination.” Pelleas enters later, to music of “youthful and knightly character” (Schoenberg’s words), with the principal voice in the trumpet. The themes of the three characters are intertwined as their fates are in the drama. The scherzo section (which is in a dance-like triple meter, at least at first) shows Melisande playing with her wedding ring in the forest, but the fun is over when she drops it into a deep well. The scene then changes, and we hear a magical passage scored for three solo strings, woodwind, and harps, corresponding to the moment where Melisande’s long hair falls down from her window so that Pelleas (who is standing on the ground) can touch it. Golaud’s motif, scored menacingly for the full orchestra, marks the arrival of the jealous husband. The next section (technically still within the scherzo) is a highly dramatic, eerie passage suggesting Golaud and Pelleas in the deep vaults of the castle. We are now approaching the emotional high point of the piece, the lush lovescene reminiscent of Wagner’s Tristan and Severance Hall 2011-12

About the Music

Schoenberg’s 40-minute tone poem is structured much like a four-movement symphony, played with no pauses between movements, with a scherzo in second place and a slow section coming third.

53


Campaign by MARC USA. Photography: Rieder Photography.

Bizetâ&#x20AC;&#x2122;s

Just 4 performances! NOV. 12, 15, 18, 20(m) Benedum Center, Pittsburgh

Tickets: 412-456-6666 www.pittsburghopera.org Groups of 6+ get great service and save money! Contact Randy Adams: 412-281-0912 x 213 radams@pittsburghopera.org


Isolde, here between Pelleas and Melisande, that occupies most of the slow third movement of the tone poem. The moment when Golaud appears and slays his brother is almost graphic in its violence — the “Fate” motif is played by the entire orchestra, followed by a series of short, repeated chords in the brass. The final movement begins with a return to the somber introduction. At the moment of her death, everything about Melisande is as mysterious as it was when we first met her. Aside from occasional outbursts of passion, the tempo remains slow and the mood tragic. A characteristic sliding harp glissando introduces a quiet, procession-like motif representing the grave entrance of the servants “as a premonition of the death of Melisande.” The rest of the piece is a solemn eulogy that works to sum up this great tragedy of human beings utterly incapable of understanding one another. —Peter Laki © 2011 Peter Laki is a musicologist and frequent lecturer on classical music, and a visiting associate professor at Bard College.

At a Glance Schoenberg composed his symphonic poem Pelleas and Melisande between July 2, 1902, and February 28, 1903. The composer conducted the first performance on January 26, 1905, at a concert organized by the Verein der schaffenden Tonkünstler (Society of Creative Musicians) in Vienna. Schoenberg also led the first American performance on March 16, 1934, with the Boston Symphony Orchestra. This work runs about 40 minutes in performance. Schoenberg scored it for 3 flutes, 2 piccolos, 3 oboes, 2 english horns, 3 clarinets,

piccolo clarinet in E-flat, 2 bass clarinets, 3 bassoons, contrabassoon, 8 horns, 4 trumpets, 5 trombones, tuba, timpani, percussion (large military drum, bass drum, triangle, 2 cymbals, tam-tam, glockenspiel), harp, and strings. The Cleveland Orchestra first performed Schoenberg’s Pelleas and Melisande in March 1972, under the direction of Pierre Boulez. It has been performed on a few occasions since that time, most recently under the direction of Boulez at Severance Hall concerts in February 2008.

restaurant+ lounge 3099 MAYFIELD ROAD CLEVEL AND HEIGHTS, OH 216 | 321.0477

tuesday through saturday 4pm to 1am Severance Hall 2011-12

About the Music

55


Special Book Signing MEET THE AUTHOR! George Szell A Life of Music

Michael Charry, former assistant conductor of The Cleveland Orchestra, will be signing books at intermission and after each of this weekendâ&#x20AC;&#x2122;s concerts, outside the Cleveland Orchestra Store on the groundfloor. Take home your copy of the first full-length biography of this legendary maestro.

Michael Charry

7 @ ys

a d i r F t

cer

arty er p t f +@

1112

ny o h m9p y rto S e r n e c b a OrFrgiday Decem no Con this d ions nr t i a a t u n Pih 16 ese arty reb i g e pr @fter P tage F r e o c i r em ons an GrFriday Ma The thre n, and formal music h y t i o k w a issi less orld ues ins11 v ntin o interm erts are ncert, w orate in o c a es me, n nc ra co ollab ning Str ay May seri c ti 7 co st eve

con

clevelandorchestra.com

ur ys@ tart che s@7 s to iday early s d, Frida land Or f ar tist out yo fun! r F k n d n o e e n a ela h Clev ction Ba uring o u n and th t Key e Clev to r c The on. Fea else in ing ea s a sel music sic . . . w u e s sea nything . Follo d invit . Great r the m a a e n o d g f e o i d a t e lik offst y Ha e b r a Com and r t J a m e i c a l c e l izons. r e exp ue mus your ho q i d un expan and Frid


Alan Gilbert Alan Gilbert became music director of the New York Philharmonic in September 2009, launching what New York magazine called “a fresh future for the Philharmonic.” He is the first native New Yorker to hold the post. His creative approach to programming combines works in new and innovative ways, and he has developed a variety of artistic partnerships including the appointment of a composerin-residence and artist-in-residence. He seeks to make the Philharmonic a point of civic pride for the city of New York and for the country. Mr. Gilbert first led performances of The Cleveland Orchestra while a conducting assistant here in the 1990s, and most recently returned as a guest conductor in March 2007. Born to two New York Philharmonic violinists, Alan Gilbert learned violin, viola, and piano as a youth. He studied music at Harvard University and conducting at the Curtis Institute of Music and the Juilliard School. In 1994, he won both the Georg Solti Prize and first prize in the International Competition for Music Performance in Geneva. He served as an assistant conductor of The Cleveland Orchestra 1994-97, and received the Seaver/National Endowment for the Arts Conductors Award in 1997. He was chief conductor of the Royal Stockholm Philharmonic Orchestra 2000-08, and now serves as the ensemble’s conductor laureate. He has been principal guest conductor of Hamburg’s NDR Orchestra since 2004. Mr. Gilbert’s creative approach to programming clearly demonstrates his commitment to new music. In September 2011, he became director of conducting and orchestral studies at the Juilliard School, where he also is the first holder of Juilliard’s William Schuman Chair in musical studies. He regularly conducts leading orchestras nationally and internationally, including the Boston Symphony Orchestra, Amsterdam’s Royal Concertgebouw Orchestra, and the Berlin Philharmonic. His schedule during the 2011-12 season includes appearances with the Munich Philharmonic, San Francisco Symphony, Royal Stockholm Philharmonic, and Royal Swedish Opera. After serving as assistant concertmaster of the Santa Fe Opera in 1993, and making his conducting debut there in 2001, Alan Gilbert was named the opera’s first music director in 2003. He made his Metropolitan Opera debut in November 2008 leading John Adams’s Doctor Atomic, and has also conducted the Royal Swedish Opera, Vienna State Opera, and Zurich Opera. Alan Gilbert and his wife, Swedish cellist Kajsa William-Olsson, are the parents of three children. Although his father has retired, Mr. Gilbert’s mother continues to perform as a member of the New York Philharmonic. For additional information, visit www.alangilbert.com. Severance Hall 2011-12

Guest Conductor

57


While you enjoy your Thanksgiving feast, satisfy your taste Cleveland Orchestra. Orchestra. for The the Cleveland On Thanksgiving Day, WCLV will present an all-day marathon of Cleveland Orchestra broadcasts. Between 6am and Midnight youâ&#x20AC;&#x2122;ll hear eight full length concerts. Visit wclv.com for details.


William Preucil Concertmaster Blossom-Lee Endowed Chair The Cleveland Orchestra

William Preucil became concertmaster of The Cleveland Orchestra in April 1995 and has appeared regularly as a soloist with the Orchestra in concerto performances at both Severance Hall and the annual Blossom Festival. Prior to joining The Cleveland Orchestra, Mr. Preucil served for seven seasons as first violinist of the Grammywinning Cleveland Quartet, performing more than 100 concerts each year in the world’s major music capitals. Telarc International recorded the Cleveland Quartet performing the complete cycle of Beethoven’s 17 string quartets, as well as a variety of chamber works by Haydn, Mozart, Schubert, and Brahms. From 1982 to 1989, William Preucil served as concertmaster of the Atlanta Symphony Orchestra, after previously holding the same position with the orchestras of Utah and Nashville. During his tenure in Atlanta, he appeared with the Atlanta Symphony as soloist in 70 performances of 15 different concertos. Composer Stephen Paulus’s Violin Concerto was written for, and dedicated to, Mr. Preucil, who premiered it and then recorded it for New World Records with the Atlanta Symphony and conductor Robert Shaw. Mr. Preucil also has made solo appearances with the symphony orchestras of Detroit, Hong Kong, Minnesota, Rochester, and Taipei. Mr. Preucil regularly performs chamber music, as a guest soloist with other orchestras, and at summer music festivals. His North American festival performances have included Santa Fe, Sarasota, Seattle, and Sitka, with international appearances in France, Germany, and Switzerland. Each summer, he serves as concertmaster and violin soloist with the Mainly Mozart Festival Orchestra in San Diego. Mr. Preucil also continues to perform as a member of the Lanier Trio, whose recording of the complete Dvorˇák piano trios was honored as one of Time magazine’s top 10 compact discs for 1993. The Lanier Trio also has recorded the trios of Mendelssohn and Paulus for Gasparo Records. Actively involved as an educator, Mr. Preucil serves as Distinguished Professor of Violin at the Cleveland Institute of Music and at Furman University. He previously taught at the Eastman School of Music and at the University of Georgia. William Preucil began studying violin at the age of five with his mother, Doris Preucil, a pioneer in Suzuki violin instruction in the United States. At 16, he graduated with honors from the Interlochen Arts Academy and entered Indiana University to study with Josef Gingold (former concertmaster of The Cleveland Orchestra). He was awarded a performer’s certificate at Indiana University and also studied with Zino Francescatti and György Sebök.

Severance Hall 2011-12

Soloist

59


Conservatory Excellence of Music We proudly welcome . . .

George Szell A Life of Music MICHAEL CHARRY

“Charry not only gives us invaluable insights into his leadership style and musical tastes . . . but details some of the financial and political issues facing the orchestra during that era.”—SymphonyNow “Musicians, concert-goers, and general readers will be captivated by the author's behind-thescenes look at what goes into shaping a worldclass orchestra.”—The Washington Times

UNIVERSITY OF I L L I NO I S PR E S S www.press.uillinois.edu

Ms. Annie Fullard Distinguished Resident Artist Baldwin-Wallace College Violinist, Cavani String Quartet Annie Fullard joins the B-W Conservatory faculty for the 2011-2012 academic year. A recent solo appearance received this review in The Plain Dealer... “Fullard’s gleaming artistry added dramatic flair and chamber-music intimacy, she managed her role with bravura and sensitivity.” Conservatory of Music 1-866-BW-MUSIC 440-826-2368 music@bw.edu www.bw.edu/conservatory

60

north W point portfolio managers c o r p o r a t i o n Ronald J. Lang Diane M. Stack Daniel J. Dreiling

440.720.1102 440.720.1105 440.720.1104

The Cleveland Orchestra


season spotlight

Young Talent

Cleveland Orchestra Youth Orchestra November 20 at Severance Hall

When former members of the Cleveland Orchestra Youth Orchestra flocked back to town last spring for a special Alumni Concert and reunion weekend celebrating the ensemble’s 25th season, it was clear that this ensemble does far more than develop musicianship. Sixty former members of the Youth Orchestra — including five members from its inaugural season — came from as far as Portland, Oregon, and Seattle, Washington. Reunited, they remembered the hard work together and the quality of the resulting concerts. And they spoke of what a tremendous difference the Youth Orchestra made in shaping their lives. Bass player Laura Preslan joined in the inaugural season, 1986, and played through 1990. Today she lives in Seattle, where she is a sales and marketing executive for Microsoft. “My first lessons in leadership came from watching music director Jahja Ling on the podium,’’ Preslan says, noting that when they played the Mozart Oboe Concerto, she once miscounted and came in early, guns blazing, with a loud entrance. The musicians in the orchestra burst out laughing, and she was mortified, but Ling stopped them. “She’s right,’’ he said. “If you’re going to make a mistake, make it loud. I’d rather have you come-in in the wrong place than not come-in at all.’’ Today, Preslan says, “That’s where I learned about leadership and how to lead teams, and how it’s better to take action versus take no action. I carry that lesson with me to this day, 25 years later.” The Youth Orchestra’s first concert of the season is on Sunday afternoon, November 20, featuring music of Brahms, Bach, and Dvořák. Experience the quality of tomorrow yourself, at Severance Hall. For tickets (at just $12), visit clevelandorchestra.com. Severance Hall 2011-12

Youth Orchestra

61


216.791.8000 www.benrose.org A leader in service, research, and advocacy for older adults

The Cleveland Orchestra guide to Fine Dining

photo by Hernan Herrero

WWW.CLUB

two great restaurants minutes from Severance Hall... university circle 216.231.1234 shaker square 216.295.1200 www.sergioscleveland.com

ISABELLA.COM

2175 CORNELL ROAD CLEVELAND, OHIO 44106 216.229.1111

Join us for dinner before or after the orchestra. Reservations â&#x20AC;&#x2122;til 11pm on Thurs. ~ 216.721.0300 2198 Murray Hill Rd. U Cleveland, OH 44106 U mangelos.com

Open for lunch Tuesday ~ Friday

In the heart of Little Italy! *APANESE)ZAKAYA!SIAN"ISTRO 3HAKER3QUARE 3HAKER3QUARE\\ \\WWWSASAMATSUCOM WWWSASAMATSUCOM /PENUNTIL-IDNIGHT-ON 3AT PM3UN

TheCanopy MediterraneanGrille

World-class performances. World-class audiences. Advertise among friends in The Cleveland Orchestra programs.

Letâ&#x20AC;&#x2122;s talk.

Mediterranean & Middle Eastern Cuisine The Tudor Arms Hotel, 10660 Carnegie Avenue 216-456-2684 t Free valet parking with Orchestra ticket!

62

www.livepub.com

contact John Moore 216.721.4300 jmoore@livepub.com

The Cleveland Orchestra


season spotlight

Brahms

CONCERTOS

January-February 2012 at Severance Hall

In January 2012, The Cleveland Orchestra and Franz Welser-Möst embark on a three-week program of presenting the three solo concertos of Johannes Brahms at Severance Hall, with violinist Lisa Batiashvili and pianist Yefim Bronfman. The mini-festival — featuring the Violin Concerto and both Piano Concertos — reunites Welser-Möst and Bronfman, who performed together in Franz’s debut here as a guest conductor in 1993. More recently, they performed together last year in a special outdoor concert with the Vienna Philharmonic that was televised internationally and released on the Deutsche Grammophon label. “I’m really overwhelmed with excitement to play with Franz and The Cleveland Orchestra,” says Bronfman. “Franz has always been a great conductor, but he has also become such a great personality, with so much knowledge. He has grown into a major figure in music.” Playing the Brahms concertos is probably among “the greatest experiences I’ve ever had,” he continues. “Especially playing the second one, which is so majestic. There is Beethoven’s ‘Emperor’ Concerto, but maybe Brahms Two is also an Emperor.” “From the very first note,” says Bronfman, “you can tell this is a journey, that this requires a collaboration between the soloist and the orchestra at all times. It’s always an exchange of ideas, back and forth. And the cello solo is arguably the most famous in the repertoire. I cannot think of a better orchestra than Cleveland to play with, for the chamber music character of the Second Concerto.’’ For tickets, visit clevelandorchestra.com. Severance Hall 2011-12

Brahms Concerto Festival

63


Norton Memorial Organ The restoration and reinstallation in 2001 of the Norton Memorial Organ was funded through The Cleveland Orchestra’s Twenty-First Century Campaign. These leadership donors made major gifts to the Organ Fund endowment: D. Robert and Kathleen Barber Descendants of D. Z. Norton Arlene and Arthur Holden

Kulas Foundation Oglebay Norton Foundation

The Cleveland Orchestra is also grateful to the donors listed on these three pages, whose gifts to the Orchestra’s endowment were recognized through the naming of individual pipes within the Norton Memorial Organ: Anonymous (4) Mrs. Rebecca E. Adler Judy Buckle Airhart and Robert E. Airhart II Reta Biehle Alder American Guild of Organists Cleveland Chapter Deborah S. Amundsen William and Donna Anderson David A. Andreano Mrs. J. R. Andrisek Dr. Albert C. and June S. Antoine In Memory of Adam M. Araca Agnes M. Armstrong, in Memory of Floyd St. Clair Mr. and Mrs. Lawrence J. Badar The Families of Sara W. Baker and Duncan A. White, Jr., in Memory of Duncan A. White Thomas D. Balch and Harry D. Balch Michelle and Anthony Bandy-Zalatoris Alvin and C. Clair Barkley Mr. and Mrs. Michael P. Barrick Patricia Baskin Russell and Joanne Bearss Ercil F. Beck Gene and Helen Beer Richard L. and Sandra Y. Beery Fred G. and Mary W. Behm Leo and Judith Bender In Memory of Eunice J. Bernard In Memory of Susan A. Bernard Mrs. Lorin S. Berne, in Memory of Alex L. Siegel and Lorin S. Berne John and Laura, David and Mary Bertsch The Nicholas Besser, Jr. Family, in Memory of Nicholas Besser, Jr. Mrs. Edith Bettendorf Ralph L. Beuthin Mr. and Mrs. Woodrow J. Beville, Jr. Mr. and Mrs. William H. Beyer Mr. and Mrs. Jeffrey M. Biggar In Honor of Bascom Biggers III Mr. and Mrs. Robert B. Billman, Jr. Mark and Kathleen Binnig In Memory of Bertha and Jack Bloch and Anne and Bill Fast Mr. and Mrs. A. Richard Boerner Mr. and Mrs. Donald P. Bogner Richard J. Bogomolny, Patricia M. Kozerefski, and Julie Xing Bogomolny Ruth Turvy Bowman Grace W. Bregenzer Nancy H. Bright, M.D.

64

Marjorie J. Brines In Honor of Jerry Brodkey Drs. Michael A. and Sharon G. Broniatowski Mr. and Mrs. Peter R. Brooks Mr. and Mrs. Kenneth L. Brown Peter and Ann Brown John and Maria Cristina Bruch Dr. and Mrs. William E. Bruner II Diane Catherine Buehner Ruth E. Bueschlen Charles and Virginia Burchard Honnie and Stanley Busch In Memory of Mr. and Mrs. Dwight B. Buss J.C. and Helen Rankin Butler Wilton H. and Ruth B. Cahn The Carreras Family Richard and Nancy Cecil Mr. and Mrs. Paul Chaffee Mary Lou Chalfant Carmelline E. Charnas Thomas V. and Barbara Chema Drs. Chiou S. and Suio L. Chen Mrs. Charles R. Chew Mary E. Chilcote Henry Chisholm IV Bernie and Stan Christensen Mrs. Chester D. Christie John M. Clough, M.D. In Honor of Helen Champney Cole Al, Mimi, Lisa, and Chris Connors, in Honor of Birute Smetona Mr. and Mrs. Homer E. Cook, Jr. Mr. and Mrs. Alfred G. Corrado Glee A. Cousino Norman and Ann Craig Doris and Marvin Cramer W. S. Cumming Dr. and Mrs. James R. Cunningham Barbara Ann Davis Mr. and Mrs. B. Neil Davis, in Honor of Joela Jones Sally and David de Roulet Bradford E. DeBusk Mr. and Mrs. John W. Decker Shelley G. Dedmon Miss Linda L. Dembeck Mr. and Mrs. Thomas Demitrack Mr. and Mrs. Del Denny Mrs. Marjorie Dickard-Comella Pierre and Margaret Diemer Gabriel and Nancy DiFrancesco John and Kathleen Dogger In Memory of Christine Bonhoeffer von Dohnányi In Honor of Christoph von Dohnányi

Norton Memorial Organ

Mr. and Mrs. Joseph C. Domiano Gail and Michael Dowell Mr. and Mrs. Theodore D. Driscol Jane Seelbach Driver Mrs. Charles C. Dugan Mr. and Mrs. Richard Egan Anne F. Eiben Robert M. Eiben, M.D. Dr. and Mrs. Robert M. Eiben, in Honor of their Children Mr. and Mrs. Milton J. Ellis William Mitchell Ellison Worth Ellison Mrs. Frederick L. Emeny In Honor of Mr. and Mrs. Oliver F. Emerson Mary Grace and Robert Richard Engisch Edith Virginia Enkler, in Memory of Mrs. Edith Ann Enkler in Memory of Henry Enkler in Memory of Isaac Parey Masten in Memory of Mrs. Isaac Parey Masten in Memory of John Parey Masten Richard L. and Jean A. Erickson Dr. Wilma M. Evans Brian L. Ewart and William K. McHenry The Fagerhaug Six: Lauren, David, Hadyn, Raleigh, Zoe, and Mya Edward R. and Joan M. Falkner Mr. and Mrs. Herbert J. Farr III Dr. and Mrs. J. Peter Fegen James and Linda Focareto Jean and Greg Foust Mrs. Jessica R. Franklin, in Memory of her Husband James E. Franklin Mr. and Mrs. Dempwolf Frey Kent and Paula Frisby Michael, Joan, Gregory, Timothy, Marie, and Rebecca Fry In Honor of Peggy Fullmer Jack and Katherine Ganz Richard K. Gardner Michael and Barbara Garrison In Memory of Myrna Macklin Garvin Mr. and Mrs. R.H. Geissenhainer Patricia J. Genchi Claudette and Ron Giesinger Pastor Andrea R. Cermak Gifford Alda and Nick Giorgianni In Memory of Kelly Jean Mitchell Golonka Lynn, Shelley, and Laura Gordon Dr. Barbara Gothe and Dr. Harvey Rodman Mr. and Mrs. Dennis M. Grapo, in Memory of their Son Larry Mr. and Mrs. William A. Gray Elaine Harris Green

The Cleveland Orchestra


Loretta Gregoric Dr. Raymond and JoAnn Greiner Linda and Fred Griffith Tom and Nancy Griffith Sally K. Griswold In Memory of Henry S. Grossman Mrs. Jerome E. Grover, in Loving Memory of her Husband Jerome John A. and Ashley M. Gustafson Michael H. Hackett In Honor of Marianne Millikin Hadden Rita H. Haier Gary and Pat Halford James and Diane Hall James and Ruth Hall Phillip M. and Mary E. Hall Judith Lee Hallam Nancy Y. Hammond The Hanes Family, in Memory of Edgar A. and Mary C. Hanes Curt and Margie Harler Duncan and Adrienne Hartley Eloise Haugh, in Loving Memory of her Daughter Susan E. Garrison Donald R. Hausser In Memory of Mr. and Mrs. Fred J. Hausser Mr. and Mrs. Donald G. Havener Mr. and Mrs. David W. Hay In Memory of Lloyd David Hayes John D. Hays and Denise A. Hunyadi Dr. Robert T. Heath and Dr. Elizabeth L. Buchanan H. Arlan Heiser, in Honor of his Wife Janice D. Heiser Ron and Pam Heldorfer Clyde J. Henry, Jr. M. Diane Henry Gary and Ginna Hermann Douglas and Suzanne Hicks Mr. and Mrs. Theodore H. Hieronymus William W. and Alix B. Hill Marilou and Robert Hiltabiddle Barbara Hiney Dr. and Mrs. Thomas Hirsch In Memory of Sarah C. Hirsh Dale and Nancy Holwick David and Nancy Hooker William E. and Donna H. Horton Phoebe Hostetler Lorraine Angus and Sam Hubish and Boys, in Honor of Rev. Caroline G. and Dr. John C. Angus Valerie A. Hughes George Mitchell Hunter Eleanor Mandala Iacobelli Yoshiko Ikuta and Family Glenn T. Imhoff Paul and Jean Ingalls Carol S. and William G. E. Jacobs, in Honor of their Parents Louise R. and Bernard W. Lindgren and Betty L. and Elmer E. Jacobs The James Family Paul J. and Nancy Jankowski Dr. Guy and Judith Jeanblanc Mr. and Mrs. Robert H. Jeffreys Jean and Rick Jerauld, in Memory of F. Meade Bailey Marjorie T. Johnson

Severance Hall 2011-12

Mr. and Mrs. William J. Jones Mr. and Mrs. H.S. Jorgensen, Jr. Mrs. Reynold H. Juengel Don and Nancy Junglas Robert and Mary Kaczmarski Etole and Julian Kahan Mr. and Mrs. Robert E. Kahelin Ben and Charlotte Kahn Philanthropic Fund of Cleveland Mr. and Mrs. Rudolf Kamper Gary and Angela Karges Donald and Maribeth Katt Donna and Milton Katz Dr. Steven and Karen Katz Mr. and Mrs. Ned G. Kendall Winnetta Kennedy and Mickey R. Kennedy Donald R. Kern Mr. and Mrs. Michael T. Kestner Anita and S.I. Khayat Gail and Robert Kichler Mr. and Mrs. Albert F. Klavora Jimmy and Lynn Kleinman Mr. and Mrs. Mark S. Klingbeil Mrs. C. Landon Knight Mr. and Mrs. William F. Knoble Robert and Betty Koch Raymond and Katharine Kolcaba Ursula Korneitchouk E.J. Kovac David B. Krakowski Marjorie N. Krause Michael and Jane Krauss Mr. and Mrs. Lawrence M. Krejci, Jr. Donald N. Krosin Bob Kuebler and Jeff Segal Charles and Jo Anne Lake The Lampl Family, in Loving Memory of Jack W. Lampl, Jr. Jo Ann D. and John J. Lane Mr. and Mrs. Leonard R. Lang Mr. and Mrs. R. Gordon Latimer Dr. and Mrs. Randolph C. Leach Joe, Sue-Min, and Kent Lee Leo and Delores Leiden In Honor of Katherine Grace Lenhart A Friend, in Memory of Mildred L. Lewis Katie Liekoski Judge Sara Lioi Nan and Art Livergood Mrs. Elliot L. Ludvigsen Steven J. Lutgen and Delilah I. Flores Herbert and Marianna Luxenberg John MacFarland and Shirley Wesley Laura and Clark Maciag, in Honor of their Son Samuel Q. Winegardner In Memory of Clara Caldwell Macklin Robert and Sara Madison Robert G. and Nanci Markey Andrew and Sabra Massey Kiki and Vaughan Matthews Robert and Meredith McCreary Barb and Dave McKissock Frank and Mary Mehwald In Memory of Karl Meinhardt Mr. Daniel D. Merrill, in Memory of Kenneth Griggs Merrill Barbara L. and Stephen A. Messner Claudia Metz and Thomas Woodworth Brenda Clark Mikota Mr. and Mrs. Louis T. Milic Richard A. and Caroline Miller Drs. Terry E. and Sara S. Miller Lois and Paul Moeller

Norton Memorial Organ

Catherine D. Montgomery Roger and Sally Mook Mrs. Marta B. Mota Mr. and Mrs. Stephen T. Murphy Mr. and Mrs. Richard B. Nash In Memory of E. Loraine Nelson Roger and Martha Nelson Mary A. Neumann Edward E. and Linda D. Noble Mr. and Mrs. Wilbur Nordstrom Mr. and Mrs. Clarence B. Olmsted William and Barbara Oâ&#x20AC;&#x2122;Riordan Dennis and Lanette Parise Patricia J. Pasco Mr. and Mrs. Timothy Patterson Thomas J. and Thomasina B. Patton James F. and Barbara G. Pelowski Mrs. Margaret P. Pennington Mr. and Mrs. E. Lee Perry in Memory of Mr. and Mrs. A. Dean Perry in Memory of Mr. and Mrs. Edward B. Greene in Memory of John Erwin Hollis in Memory of John and Slocumb Hollis Kenneth and Katherine Petrey Mrs. Gene Phillips and Daughters, in Memory of Bert R. Phillips Janet G. Pierce William T. Plesec and Susan M. Stechschulte Alan and Marjorie Poorman David S. Popa Joyce Pope, in Honor of W. Nicholas Pope Char Portman, in Memory of her Husband Robert G. Portman Robert W. Price Lois and Stanley Proctor Elizabeth J. Ptak Rosella M. Puskas Mr. and Mrs. Linn J. Raney Tom and Helen Rathburn Scott and Mary Rawlings Conrad and Helen Rawski In Honor of Dr. Sandford Reichart The Dr. David and Hope Reynolds Family Dr. and Mrs. Robert W. Reynolds Mr. and Mrs. Bunn S. Rhea Dr. and Mrs. Frederick C. Robbins Viola Startzman Robertson Keith and Margaret Robinson Mr. Timothy D. Robson Paul and Anastacia Rose In Memory of Enid Rothenfeld Marjorie A. Rott Dr. Edward L. Ruch and Dr. Teresa D. Ruch Mr. and Mrs. Robert C. Ruhl In Memory of Estelle Ruth Barry and Karol Sabol Burt Saltzman In Honor of Dorothy S. Sawyer Bob and Ellie Scheuer Sandra J. Schlub Dr. E. Karl and Lisa Schneider The Herbert A. Schneider Family, Brian Jao and Stephen Jao Mr. and Mrs. Richard F. Schubert Robert and Linda Schumacher Richard and Marcy Schwarz Joel and Beth Scott LISTING CONTINUES

65


LISTING CONTINUED

Dr. James L. Sechler and Veronika Ilyes-Sechler Edward Seely Donald M. Shafer and Kathrine Stokes-Shafer Mrs. Robert S. Shankland, in Memory of Dr. Robert S. Shankland Frances L. Sharp Mr. and Mrs. Jerry Shaw Jerry and Laurie Sheets Don, Sue, Sarah, and Mark Sheldon Mr. and Mrs. Terrence E. Sheridan Dr. and Mrs. Earl K. Shirey Richard Shirey William and Marjorie Shorrock David and Julie Siegel Toby and Jay Siegel Mr. and Mrs. Milan J. Skorepa Rosanne H. Skuly Ray and Eleanor Smiley Christopher, Michelle, Jennifer, and Heather Smith Dr. and Mrs. Lynn A. Smith Sidney B. and Beverly J. Smith Mr. and Mrs. William E. Smith Janice Horter Smuda Mr. and Mrs. Jeffrey H. Smythe Dr. and Mrs. Ralph E. Snelson Dr. Marvin and Mimi Sobel In Memory of Jacob and Theodosia Soehnlen The Spencer Family, in Honor and Memory of Paul and Margaret Mendenhall In Memory of Stanley R. Stahurski Helga and Ron Stanger Gary and Sue Stark and Family Dr. Frank J. and Arlene R. Staub Mr. and Mrs. S. Finley Stay, in Honor of the 1999-2000 Gilmour Academy Middle School Ellen M. Stepanian, in Memory of her Parents James H. and Armenuie G. Stepanian Barbara A. Sterk The Families of David J., Paul F., and Roger M. Stiller, in Memory of their Parents Paul F. and Caroline L. Stiller C. Chester Stock James Storry Faye and Sel Strassman

In Loving Memory of Marilyn Henderson Stull by her Husband and Children Bill and Edith Taft Mr. and Mrs. John J. Tanis Anne L. Taylor, M.D., in Honor of M. Alexandra Taylor Ronald E. Teare, in Honor of Charles H. Teare Harold G. Telford The Family of Herman Teske, in his Memory The Thomas Thoburn Family E. Jean Thom Dr. Katherine M. Thomas Katherine K. Tibbetts, in Memory of her Husband William D. Tibbetts In Memory of Dr. and Mrs. Jesse E. Titus and Mr. and Mrs. E. William Simon Betty Trump, in Memory of her Husband Robert C. Trump Robert J. and Marti J. Vagi In Memory of John Valley Mr. and Mrs. Charles Valone, Jr., in Memory of Susan Elizabeth Valone, M.D. The VanDyke Family Donna L. VanRaaphorst Dona Grace Wood Vernon, With Gratitude in Loving Memory of Jabez Hall Wood Kathryn M. Vine Vera Grdina Virant Mr. and Mrs. Elmer F. Vitek In Honor of James Gregory Wagner, Sr. Kenneth C. Waldo, Jr. Cathy and Scott Wallenstein Eleanor M. Warner, in Memory of her Husband William S. Warner Robert, Ruth, and Roberta Wavrek Dr. and Mrs. Frank L. Weakley Suzanne and Bob Weber Susan Weir and Leif Ancker Mr. and Mrs. John Weisel Eugene P. Wenninger and Cheryl A. Casper Western Reserve Theatre Organ Society Rodney and Judy Whitwell Mr. and Mrs. Robert L. Wilcox

Deborah A. and Louise I. Wiles Donald R. Wilkinson, in Memory of his Wife Betty N. Wilkinson Audrey B. and Hazel M. Willacy Jane C. Williams Meredith Williams, in Loving Memory of his Wife Helen Sue Williams Dr. Michael and Barbara Williams Paul and Catherine Williams Reese and Nancy Williams, in Honor of their Parents Mrs. James A. Winton Womenâ&#x20AC;&#x2122;s Committee of The Cleveland Orchestra In Honor of Dr. Denton Wyse Sally T. and Robert E. Yocum, in Memory of Dorothy D. and James M. Taylor Michael D. Zaverton Ms. Liga A. Zemesarajs Marguerite J. Ziegler Matt, Adam, Mary Frances, and Kal Zucker In Memory of Larry E. Zupon

To learn about making an endowment gift of your own in support of The Cleveland Orchestra, please call (216) 231-7521

THE CLEVELANDORCHESTRA clevelandorchestra.com 24/7 news, tickets & more 66

Norton Memorial Organ

The Cleveland Orchestra


The Cleveland Orchestra guide to

Fine Shops & Services EXQUISITE PIECES VISIT OUR NEW IN A SURPRISING SHOWROOM SETTING

AAVery verySurprising special place Place

Advertise among friends in The Cleveland Orchestra programs.

9F6;4";6<;

Michael Hauser DMD MD Implants and Oral Surgery For Music Lovers Beachwood 216-464-1200

3HUVRQDO&KHI6HUYLFH

999T(.;+0)10+10T%1/ FEJTIHLTJJMM



contact John Moore 216.721.4300 jmoore@LPCpub.com

LPCpublishing.com

)XOO6HUYLFH&DWHULQJ 

www.drhauser.com

'HEUD.UDXV&KHIa&KULV:R]QLDN&KHI

Insulation Systems 

Recognized experts re-insulating period-built homes using the latest Green Technology â&#x20AC;&#x201C; featuring Thermal Imaging 440.975.1122 www.insulationsystems.net

IMMIGRATION LAW THE CAXTON BUILDING 812 HURON ROAD SUITE 601 CLEVELAND, OH 44115

Ă&#x152;    i IMMIGRATION

),1($57 $17,48(6

Â&#x192; Â&#x192; Â&#x192;

Severance Hall 2011-12

\

v   

ROSNERLAWCOM

$63,5( $8&7,216 Â&#x192;

Letâ&#x20AC;&#x2122;s talk.

on Chagrin Blvd., across across from from Eton. Eton

Ă&#x201C;n{näĂ&#x160; Â&#x2026;>}Ă&#x20AC;Â&#x2C6;Â&#x2DC;Ă&#x160; Â?Ă&#x203A;`°]Ă&#x160;7Â&#x153;Â&#x153;`Â&#x201C;iĂ&#x20AC;iĂ&#x160;6Â&#x2C6;Â?Â?>}iĂ&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°nĂ&#x17D;Â&#x2122;°Ă&#x2C6;£ää °]Ă&#x160;Ă&#x160; Â?iĂ&#x203A;i°Ă&#x160;Ă&#x152;Ă&#x192;°Ă&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°Â&#x2122;Ă&#x17D;Ă&#x201C;°xxĂ&#x17D;x >Ă&#x17E;wiÂ?`Ă&#x160;EĂ&#x160;iiĂ&#x160;,`Ă&#x192;°Ă&#x160; >Ă&#x17E;wiÂ?`Ă&#x160;EĂ&#x160;iiĂ&#x160;,`Ă&#x192;°Ă&#x160; Â?iĂ&#x203A;i°Ă&#x160;Ă&#x152;Ă&#x192;°Ă&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°Â&#x2122;Ă&#x17D;Ă&#x201C;°xxĂ&#x17D;x



>VYSKJSHZZ performances. >VYSKJSHZZ audiences.

\

WWWROSNERLAWCOM

ZZZDVSLUHDXFWLRQVFRP

$XFWLRQHHUV $SSUDLVHUVRI )LQH$UW$QWLTXHVDQG-HZHOU\ 6XSHULRU$YH6WH &OHYHODQG2+ 3KRQH

67


Be one of of Northeast NortheastOhioâ&#x20AC;&#x2122;s Ohioâ&#x20AC;&#x2122;s Be aa part part of one favorite holiday holiday traditions. traditions. Reserve your your space space in inthe the Reserve

Call

2010 Holiday Festival Festival 2011 Holiday Program Program Book. John Moore, 216-721-1800 x124 Call John Moore, 216-721-4300

Larchmere Boulevard Clevelandâ&#x20AC;&#x2122;s Art and Antique District (one block north of Shaker Square)

Qbujp!Tfbujoh

xxx/dppmqmbdftupfbu/dpn

Sftfswbujpot!Bddfqufe

Xfeoftebzt;!Bqqfuj{fs-!Fousff!BOE!Efttfsu!pomz!%33"

Ibqqz!Ipvs; Uvft/Ă&#x2019;Gsj/!5qnĂ&#x2019;8qn

Sfwfstf!Ibqqz!Ipvs; Gsj/!'!Tbu/!21qnĂ&#x2019;2bn Ejoofs; Uvft/Ă&#x2019;Uivst/!5qnĂ&#x2019;21qn Vscbo!Dbgf Gsj/!'!Tbu/!5qnĂ&#x2019;23bn Mbsdinfsf Csvodi; Tbu/!'!Tvo/!21bnĂ&#x2019;5qn Uvftebzt;!ibmg!pgg!BOZ!cpuumf!pg!xjof"

23613!Mbsdinfsf!Cmwe/-!Dmfwfmboe-!PI!55231!Â&#x2021; 327.8:2.1:29

8E:@E>,?<<G

K?<

A remarkable ass

A remarkable assortment of more than 50 shops â&#x20AC;&#x201C; art, antique, and craft galleries; restaurants; services; designer and vintage clothing; and specialty shops.

WEARABLEART CONTEMPORARYCRAFT GIFTS /NE OF A KINDAND LIMITEDEDITIONCLOTHING

,ARCHMERE"LVD    #ALLFORUPCOMINGEVENTS

-ON &RIAMTOPMq3ATAMTOPMq3UNTOPM

Corcoran  Arts & 

Appraisals  

Views    of Brittany and    Paris 

   14 Recently Discovered Oil Paintings  

    Abel Warshawsky (Cleveland 1883-1962)

/RJDQEHUU\%RRNVFRP

/DUFKPHUHÂ&#x160;

 Monday,    

Tuesday & Thursday 12-5 p.m. 

Wednesday, Friday & Saturday 12-6 p.m.       CorcoranFineArts.com  !" Larchmere # $  Blvd. %& 216-767-0770 !'!'"''" 12610

Gifts and musical items for every occasion . . . Open before and after every Cleveland Orchestra performance, at intermissions, and daytimes 11- 6 Tuesday-Friday. Or visit us online at clevelandorchestra.com

68

The Cleveland Orchestra


The Cleveland Orchestra: Serving the Community The Cleveland Orchestra’s Education and Community programs provide shared musical experiences that engage, inspire, support, and deepen connections with audiences throughout Northeast Ohio

P H OTO G R A P H Y BY R O G E R M A S T R O I A N N I

THE C L E V E L A N D O RC H E S T R A has a long and proud history of sharing the value and joy of music with citizens throughout Northeast Ohio. Education and community programs date to the Orchestra’s founding in 1918 and have remained a central focus of the ensemble’s actitivities for over ninety years. Today, with the support of many generous individual, foundation, corporate, and governmental funding partners, the Orchestra’s educational and community programs reach more than 70,000 young people and adults annually, helping to foster a love of music and a lifetime of involvement with the musical arts. On these pages, we share photographs from a sampling of these many programs. For additional information about these and other programs, visit us at clevelandorchestra.com or contact the Education & Community Programs Office by calling (216) 231-7355.

School buses delivering students to Severance Hall. More than four million schoolchildren have been introduced to symphonic music in nine decades of Cleveland Orchestra weekday Education Concerts. Severance Hall 2011-12

Education & Community

69


T H E

The Cleveland Orchestra helps celebrate the seasons and special events throughout the year. On October 30, the season’s first Family Concert features the second annual “Halloween Spookatcular!” including a special audience costume contest.

C L E V E L A N D

Music Study Groups provide a way of exploring the Orchestra’s music in depth. These professionally led classes meet weekly to explore the music being played each week and the stories behind the composers’ lives.

A Family Concert featuring Stravinsky’s Firebird Suite brought audiences up close for a thrilling performance by Academy Trainees of the Joffrey Ballet and performers from the Cleveland School of Dance. The Joffrey Academy returns in December to Severance Hall for the season’s second Family Concert, “Scenes from Tchaikovsky’s Nutcracker.”

70

Education & Community

The Cleveland Orchestra


O R C H E S T R A

The Cleveland Orchestra is creating “Musical Neighborhoods” in Cleveland preschools as part of PNC Grow Up Great, using music to support pre-literacy and school readiness skills.

THANK YOU

Cleveland Orchestra clarinetist Robert Woolfrey leads a Learning Through Music program at H. Barbara Booker School in Cleveland.

The Cleveland Orchestra’s Education programs are made possible by many generous individuals, foundations, and corporations, including: The Abington Foundation The Eva L. and Joseph M. Bruening Foundation Chubb Group of Insurance Companies Cleveland Clinic The Cleveland Foundation Conn-Selmer, Inc. Dominion Foundation The Harry K. Fox and Emma R. Fox Charitable Foundation Giant Eagle Muna & Basem Hishmeh Foundation Martha Holden Jennings Foundation JPMorgan Chase Foundation The Laub Foundation The Lincoln Electric Foundation The Lubrizol Corporation The Nord Family Foundation Ohio Arts Council Ohio Savings Bank PNC The Reinberger Foundation Albert G. & Olive H. Schlink Foundation The Sherwin-Williams Foundation The South Waite Foundation Surdna Foundation Thomas H. White Foundation, a KeyBank Trust The Edward & Ruth Wilkof Foundation Women’s Committee of The Cleveland Orchestra

Severance Hall 2011-12

Education & Community

More than 1,000 talented young musicians have performed as members of the Cleveland Orchestra Youth Orchestra in the 25 years since its founding in 1986.

71


CUYAHOGA ARTS & CULTURE IS PROUD TO SUPPORT APOLLO'S FIRE ‡ BAYARTS ‡ BECK CENTER FOR THE ARTS ‡ CLEVELAND BOTANICAL GARDEN ‡ CLEVELAND INTERNATIONAL FILM FESTIVAL‡ CLEVELAND MUSEUM OF ART‡ CLEVELAND MUSEUM OF NATURAL HISTORY‡THE CLEVELAND ORCHESTRA‡ CLEVELAND PLAY HOUSE‡CLEVELAND PUBLIC THEATRE‡ DANCECLEVELAND‡ GREAT LAKES SCIENCE CENTER‡ GREAT LAKES THEATER FESTIVAL‡

SHAKER LAKES ‡ OPERA CLEVELAND ‡ ROCK AND ROLL HALL OF FAME AND MUSEUM ‡ SPACES ‡ WESTERN RESERVE HISTORICAL SOCIETY‡& MANY OTHERS

WWW.CACGRANTS.ORG 216 515 8303

72

P H OTO BY R O G E R MA S T R O I A N N I

GROUNDWORKS DANCETHEATER‡HEIGHTS YOUTH THEATRE‡IDEASTREAM‡KARAMU HOUSE‡MALTZ MUSEUM OF JEWISH HERITAGE‡MUSEUM OF CONTEMPORARY ART CLEVELAND‡NATURE CENTER AT

The Cleveland Orchestra


11001 Euclid Avenue, Cleveland, Ohio 44106 CLEVELANDORCHESTRA.COM

AT SE V E R A NC E H A LL CONCERT DINING AND CONCESSION SERVICE Severance Restaurant at Severance Hall is open for concert dining. For reservations, call (216) 231-7373, or click on the reservations link at clevelandorchestra.com Concert concession service of beverages and light refreshments is available before most concerts and at intermissions in the Smith Lobby on the street level, in the Bogomolny-Kozerefski Grand Foyer, and in the Dress Circle Lobby.

FREE PUBLIC TOURS Free public tours of Severance Hall are offered on select Sundays during the year. Free public tours of Severance Hall are being offered this fall on October 10 and November 28. For additional information or to book for one of these tours, please call the Cleveland Orchestra Ticket Office at (216) 231-1111. Private tours can be arranged for a fee by calling (216) 231-7421.

THE CLEVELAND ORCHESTRA STORE A wide variety of items relating to The Cleveland Orchestra — including logo apparel, compact disc recordings, and gifts — are available for purchase at the Cleveland Orchestra Store before and after concerts and during intermission. The Store is also open Tuesday through Friday from 11 a.m. to 6 p.m. Cleveland Orchestra subscribers receive a 10% discount on most items purchased. Call (216) 231-7478 for more information, or visit the Store online at clevelandorchestra.com

RENTAL OPPORTUNITIES Severance Hall, a Cleveland landmark and home of the world-renowned Cleveland Orchestra, is the perfect location for business meetings and conferences, pre- or post-concert dinners and receptions, weddings, and social events. Exclusive catering provided by Sammy’s. Premium dates are available. Call the Facility Sales Office at (216) 231-7420 or email to hallrental@clevelandorchestra.com

BE FO R E T H E CO NC E R T GARAGE PARKING AND PATRON ACCESS Parking can be purchased for $10 per vehicle when space in the Campus Center Garage permits. However, the garage often fills up well before concert time; only ticket holders who purchase prepaid parking passes are ensured a parking space. Overflow parking is available in CWRU Lot 1 off Euclid Avenue, across from Severance Hall; University Circle Lot 13A on Adelbert Road; and the Cleveland Botanical Garden. Pre-paid parking for the Campus Center Garage can be purchased in advance through the Ticket Office for $14 per concert. This pre-paid parking ensures you a parking space, but availability of prepaid parking passes is limited. To order pre-paid parking, call the Cleveland Orchestra Ticket Office at (216) 231-1111.

FRIDAY MATINEE PARKING

For our patrons’ convenience, an ATM is located in the Lerner Lobby of Severance Hall, on the ground floor across from the Cleveland Orchestra Store.

Due to limited parking availability for Friday Matinee performances, patrons are strongly encouraged to take advantage of convenient off-site parking and round-trip shuttle services available from the Cedar Hill Baptist Church (12601 Cedar Road). The fee for this service is $10.

QUESTIONS

CONCERT PREVIEWS

ATM — Automated Teller Machine

If you have any questions, please ask an usher or a staff member, or call (216) 231-7300 during regular weekday business hours, or email to info@clevelandorchestra.com

Severance Hall 2011-12

Guest Information

Concert Previews at Severance Hall are presented in Reinberger Chamber Hall on the ground floor, except when noted, beginning one hour before the start of most subscription concerts.

73


AT T H E CO NC E R T COAT CHECK Complimentary coat check is available for concertgoers. The main coat check is located on the street level midway along each gallery on the ground floor.

PHOTOGRAPHY, VIDEO, AND AUDIO RECORDING For the safety of guests and performers, photography and videography are strictly prohibited during performances at Severance Hall.

REMINDERS Please disarm electronic watch alarms and turn off all pagers, cell phones, and mechanical devices before entering the concert hall. Patrons with hearing aids are asked to be attentive to the sound level of their hearing devices and adjust them accordingly. To ensure the listening pleasure of all patrons, please note that anyone creating a disturbance of any kind may be asked to leave the concert hall.

LATE SEATING Performances at Severance Hall start at the time designated on the ticket. In deference to the comfort and listening pleasure of the audience, late-arriving patrons will not be seated while music is being performed. Latecomers are asked to wait quietly until the first break in the program, when ushers will assist them to their seats. Please note that performances without intermission may not have a seating break. These arrangements are at the discretion of the House Manager in consultation with the conductor and performing artists.

SERVICES FOR PERSONS WITH DISABILITIES Severance Hall staff are experienced in assisting patrons to find seats that meet their needs. Wheelchair seating is available on the Orchestra Level, Box Level, and Dress Circle, and in Reinberger Chamber Hall at a variety of prices. For patrons who prefer to transfer from a wheelchair, seats with removable arms are available on the Orchestra Level in the Concert Hall. ADA seats are held for those with special needs until 48 hours prior to the performance, unless sell-out conditions exist before that time. Severance Hall features seating locations for people with mobility impairments and offers wheelchair transport for all performances. To discuss your seating requirements, please call the Ticket Office at (216) 231-1111. TTY line access is available at the public pay telephone located in the Security Office. Infrared Assistive Listening Devices are available from a

74

Head Usher or the House Manager for all performances. If you need assistance, please contact the House Manager at (216) 231-7425 in advance if possible. Service animals are welcome at Severance Hall. Please notify the Ticket Office when purchasing tickets.

IN THE EVENT OF AN EMERGENCY Contact an usher or a member of the house staff if you require medical assistance. Emergency exits are clearly marked throughout the building. Ushers and house staff will provide instructions in the event of an emergency.

SECURITY For security reasons, backpacks, musical instrument cases, and large bags are prohibited in the concert halls. These items must be checked at coat check and may be subject to search. Severance Hall is a firearms-free facility. No person may possess a firearm on the premises.

CHILDREN Regardless of age, each person must have a ticket and be able to sit quietly in a seat throughout the performance. Season subscription concerts are not recommended for children under the age of eight. However, Family Concerts and Musical Rainbow programs are designed for families with young children. Cleveland Orchestra Youth Orchestra performances are recommended for older children.

T IC K ET SE RV IC ES TICKET EXCHANGES Subscribers unable to attend on a particular concert date can exchange their tickets for a different performance of the same week’s program. Subscribers may exchange their subscription tickets for another subscription program up to five days prior to a performance. There will be no service charge for the five-day advance ticket exchanges. If a ticket exchange is requested within 5 days of the performance, there is a $10 service charge per concert. Visit clevelandorchestra.com for details and blackout dates.

UNABLE TO USE YOUR TICKETS? Ticket holders unable to use or exchange their tickets are encouraged to notify the Ticket Office so that those tickets can be resold. Because of the demand for tickets to Cleveland Orchestra performances, “turnbacks” make seats available to other music lovers and can provide additional income to the Orchestra. If you return your tickets at least 2 hours before the concert, the value of each ticket can be used as a tax-deductible contribution. Patrons who turn back tickets receive a cumulative donation acknowledgement at the end of each calendar year.

Guest Information

The Cleveland Orchestra


Meet Margaret Mitchell Cleveland Orchestra Heritage Society Co-Chair, member, and Heritage Society ambassador on WCLV How many years have you been attending Orchestra concerts? Bill and I have been going to Orchestra concerts ever since we were married and came to Cleveland — sixty years. We spent many family summer evenings at Blossom when our children were young. Your favorite composer? I really love the ability of the Orchestra to play any music well, so I have to say I like whatever the Orchestra plays. But Mahler and Bruckner are classical favorites; Ives and Adams, among more recent composers. Your most memorable concerts? Because of the different venues, Dvořák’s “New World” Symphony in old Lucerne; Shostakovich in Miami. Prokofiev’s Fifth Symphony — the final movement encore in the Canary Islands. It’s difficult to pick out a favorite at Severance. I love most all of them. And, in Margaret’s own words, from her WCLV invitation to Orchestra lovers everywhere . . . Bill and I think The Cleveland Orchestra makes Cleveland a great place to live. — the superb concerts. — the talented orchestra musicians who contribute much to our community and represent us so well around the world. — the education programs building future audiences. These are some of the reasons we created a planned gift, securing lifelong income for us. It also makes sense for the Orchestra, helping to build the endowment. We want The Cleveland Orchestra that we love to enrich the lives of our children and grandchildren as it has for us. With your own planned gift, please join us as proud members of the Heritage Society. To learn how you can become a member of the Heritage Society, contact Jim Kozel, Director of Legacy and Planned Giving, by calling 216-231-7549 or via email at jkozel@clevelandorchestra.com or go to clevelandorchestra.com and click on Support, then Heritage Society THE CLEVELAND ORCHESTRA

Severance Hall 2011-12

H ER I TAGE SO C I ET Y

75


76

The Cleveland Orchestra


THE CLEVELAN D ORCHESTRA

Corporate Support The Cleveland Orchestra gratefully acknowledges and salutes these corporations for their generous support toward the Orchestra’s Endowment, Annual Fund, Special Projects, and/or Programs. Additional legacy gifts from these organizations and others are recognized through The Cleveland Orchestra Heritage Society.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

The Partners in Excellence program salutes companies with annual contributions of $100,000 and more, exemplifying leadership and commitment to artistic excellence at the highest level.

$5 MILLION AND MORE

KeyBank $1 MILLION TO $5 MILLION

Baker Hostetler Bank of America Eaton Corporation FirstEnergy Foundation Forest City Enterprises, Inc. The Goodyear Tire & Rubber Company The Lubrizol Corporation / The Lubrizol Foundation Merrill Lynch NACCO Industries, Inc. Parker Hannifin Corporation The Plain Dealer PNC Bank PolyOne Corporation The J. M. Smucker Company The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. Listing as of September 2011.

gifts of $2,500 or more during the past year, as of September 20, 2011

PARTNERS IN EXCELLENCE $300,000 AND MORE

KeyBank The Lubrizol Corporation NACCO Industries, Inc. PNC Raiffeisenlandesbank Oberösterreich (Europe) PARTNERS IN EXCELLENCE $200,000 TO $299,999

Baker Hostetler Eaton Corporation Forest City Enterprises, Inc. The Plain Dealer PARTNERS IN EXCELLENCE $100,000 TO $199,999

The J. M. Smucker Company Medical Mutual of Ohio $50,000

TO

$99,999

FirstMerit Bank The Goodyear Tire & Rubber Company Jones Day Parker Hannifin Corporation The Sage Cleveland Foundation Tele München Group (Europe) $25,000 TO $49,999 Conn-Selmer, Inc. Giant Eagle JPMorgan Chase Foundation Northern Trust Bank of Florida (Miami) Quality Electrodynamics (QED) Richard L. Bowen & Associates, Inc. Squire, Sanders & Dempsey (US) LLP Thompson Hine LLP

$2,500 TO $24,999 Akron Tool & Die Company American Fireworks, Inc. American Greetings Corporation Arnstein & Lehr LLP (Miami) Bank of America

Severance Hall 2011-12

Corporate Support

BDI Brouse McDowell Eileen M. Burkhart & Co. LLC Buyers Products Company Calfee, Halter & Griswold LLP The Cliffs Foundation Community Behavioral Health Center Consolidated Graphics Group, Inc. Dealer Tire LLC Dollar Bank Dominion Foundation Ernst & Young LLP Evarts-Tremaine-Flicker Company Feldman Gale, P.A. (Miami) Ferro Corporation Fifth Third Bank Frantz Ward LLP Gallagher Benefit Services Genovese Vanderhoof & Associates Great Lakes Brewing Company Gross Builders Hahn Loeser + Parks LLP Higer Lichter & Givner LLP (Miami) Houck Anderson P.A. (Miami) Hyland Software, Inc. Keithley Foundation The Lincoln Electric Foundation C. A. Litzler Co., Inc. Live Publishing Company LNE Group / Lee Weingart (Europe) Macy’s Miba AG (Europe) MindCrafted Systems MTD Products, Inc. Nordson Corporation North Coast Container Corp. Northern Haserot Oatey Co. Octavia Press Ohio CAT Ohio Savings Bank, A Division of New York Community Bank Olympic Steel, Inc. Park-Ohio Holdings Corp. PolyOne Corporation The Prince & Izant Company Richey Industries, Inc. RPM International Inc. SEMAG GmbH (Europe) The Sherwin-Williams Company Stearns Weaver Miller Weissler Alha (Miami) Stern Advertising Agency Summa Health System Swagelok Company Towers Watson TriMark S.S. Kemp Trionix Research Laboratory, Inc. Tucker Ellis & West LLP Ulmer & Berne LLP Ver Ploeg & Lumpkin, P.A. Westlake Reed Leskosky Anonymous (3)

77


Live Publishing helps you

break through the marketing clutter to deliver powerful, memorable messages

Live Publishing provides comprehensive communications and marketing services to a who’s who roster of clients, including the world-renowned Cleveland Orchestra. Our unsurpassed client satisfaction is built on decades of hard-earned experience, in all the various aspects of magazine publishing and custom marketing communications. We know how to deliver the most meaningful messages in the most effective media, all in the most cost-effective manner. We’re easy to do business with, and our experienced crew has handled every kind of project – from large to small, print to web.

2026 Murray Hill Road, Suite 103, Cleveland, Ohio 44106 216.721.1800 email: info@livepub.com web: www.lpcpublishing.com


THE CLEVELAN D ORCHESTRA

Foundation & Government Support The Cleveland Orchestra gratefully acknowledges and salutes these Foundations and Government agencies for their generous support toward the Orchestraâ&#x20AC;&#x2122;s Endowment, Annual Fund, Special Projects, and/or Programs. Additional legacy gifts from these organizations and others are recognized through The Cleveland Orchestra Heritage Society.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

$1 MILLION AND MORE

$10 MILLION AND MORE

The Cleveland Foundation Maltz Family Foundation State of Ohio Ohio Arts Council The Kelvin and Eleanor Smith Foundation $5 MILLION TO $10 MILLION

Cuyahoga County residents through Cuyahoga Arts & Culture Kulas Foundation $1 MILLION TO $5 MILLION

Ann and Gordon Getty Foundation The GAR Foundation The George Gund Foundation The Louise H. and David S. Ingalls Foundation Martha Holden Jennings Foundation John S. and James L. Knight Foundation (Miami) Andrew W. Mellon Foundation John P. Murphy Foundation David and Inez Myers Foundation National Endowment for the Arts The Payne Fund The Reinberger Foundation

gifts of $2,000 or more during the past year, as of September 20, 2011

The Cleveland Foundation Cuyahoga County residents through Cuyahoga Arts and Culture Maltz Family Foundation The Kelvin and Eleanor Smith Foundation $250,000 TO $500,000

Andrew W. Mellon Foundation David and Inez Myers Foundation Ohio Arts Council The Skirball Foundation $100,000 TO $249,999

Sidney E. Frank Foundation The GAR Foundation The George Gund Foundation Martha Holden Jennings Foundation Kulas Foundation The Mandel Foundation The Miami Foundation, from a fund established by the John S. and James L. Knight Foundation (Miami) John P. Murphy Foundation Surdna Foundation $50,000 TO $99,999

The George W. Codrington Charitable Foundation The Louise H. and David S. Ingalls Foundation Myra Tuteur Kahn Memorial Fund of The Cleveland Foundation National Endowment for the Arts The Payne Fund The Reinberger Foundation $20,000 TO $49,999

The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. Listing as of September 2011.

The Abington Foundation Akron Community Foundation The Helen C. Cole Charitable Trust The Mary S. and David C. Corbin Foundation The Gerhard Foundation, Inc. Ann and Gordon Getty Foundation Elizabeth Ring Mather and William Gwinn Mather Fund The Nonneman Family Foundation

Severance Hall 2011-12

Foundation/Government Support

The Esther and Hyman Rapport Philanthropic Trust The Sisler McFawn Foundation

$2,000 TO $19,999 Ayco Charitable Foundation The Ruth and Elmer Babin Foundation Bicknell Fund The Eva L. and Joseph M. Bruening Foundation The Collacott Foundation The Frances G. and Lewis Allen Davies Endowment Fund Mary and Dr. George L. Demetros Charitable Trust Elisha-Bolton Foundation Fisher-Renkert Foundation The Harry K. Fox and Emma R. Fox Charitable Foundation Funding Arts Network (Miami) The Helen Wade Greene Charitable Trust The Hankins Foundation Muna & Basem Hishmeh Foundation Richard H. Holzer Memorial Foundation The Kangesser Foundation The Laub Foundation Victor C. Laughlin, M.D. Memorial Foundation Trust The G. R. Lincoln Family Foundation Margaret Clark Morgan Foundation Miami-Dade County Department of Cultural Affairs (Miami) Laura R. & Lucian Q. Moffitt Foundation The Nord Family Foundation Paintstone Foundation The Charles E. & Mabel M. Ritchie Memorial Foundation The Leighton A. Rosenthal Family Foundation SCH Foundation Albert G. & Olive H. Schlink Foundation The Sherwick Fund Lloyd L. and Louise K. Smith Memorial Foundation The South Waite Foundation Jean C. Shroeder Foundation The Taylor-Winfield Foundation The George Garretson Wade Charitable Trust The S. K. Wellman Foundation The Wells Family Foundation, Inc. Thomas H. White Foundation, a KeyBank Trust The Edward & Ruth Wilkof Foundation Wright Foundation The Wuliger Foundation Anonymous (2)

79


THE CLEVELAN D ORCHESTRA

Individual Support The Cleveland Orchestra and Musical Arts Association gratefully recognize the individuals listed here, who have provided generous gifts of cash or pledges of $2,500 or more in annual operating, endowment, special project, or benefit event support.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

gifts during the past year, as of September 20, 2011

$10 MILLION AND MORE

INDIVIDUAL GIFTS OF $500,000 AND MORE

Daniel R. and Jan R. Lewis (Miami)

Mr. and Mrs. Alexander M. Cutler Daniel R. and Jan R. Lewis (Miami)

$5 MILLION TO $10 MILLION

INDIVIDUAL GIFTS OF $200,000 TO $499,999

Mr. Richard J. Bogomolny and Ms. Patricia M. Kozerefski Mr. and Mrs. Alexander M. Cutler Mrs. Norma Lerner and The Lerner Foundation Mr. and Mrs. Albert B. Ratner Anonymous

Irma and Norman Braman (Miami) The Walter and Jean Kalberer Foundation Susan Miller (Miami) Mr. and Mrs. Albert B. Ratner James and Donna Reid

$1 MILLION TO $5 MILLION

Irma and Norman Braman (Miami) Mr. and Mrs. Francis J. Callahan Mrs. Anne M. Clapp Mr. George Gund III Mr. and Mrs. Michael J. Horvitz Mr. James D. Ireland III The Walter and Jean Kalberer Foundation Mr. and Mrs. Joseph P. Keithley Mr. and Mrs. Dennis W. LaBarre Susan Miller (Miami) Sally S. and John C. Morley The Family of D. Z. Norton The Honorable and Mrs. John Doyle Ong Mr. and Mrs. Alfred M. Rankin, Jr. Charles and Ilana Horowitz Ratner James and Donna Reid Barbara S. Robinson Anonymous (2) The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. As of September 2011.

80

INDIVIDUAL GIFTS OF $100,000 TO $199,999

Ben and Ingrid Bowman Francie and David Horvitz (Miami) Mr. and Mrs. Michael J. Horvitz Mr. and Mrs. Joseph P. Keithley Dr. and Mrs. Herbert Kloiber (Europe) Mrs. Norma Lerner Mr. and Mrs. Herbert McBride Sally S. and John C. Morley Ms. Ginger Warner (Cleveland, Miami) Janet and Richard Yulman (Miami) INDIVIDUAL GIFTS OF $75,000 TO $99,999

Robert and Jean* Conrad Trevor and Jennie Jones Mr. and Mrs. Douglas A. Kern Mr. and Mrs. Dennis W. LaBarre The Honorable and Mrs. John Doyle Ong Julia and Larry Pollock Barbara S. Robinson

Leadership Council The Leadership Council salutes those extraordinary donors who have pledged to sustain their annual giving at the highest level for three years or more. Leadership Council donors are recognized in these Annual Support listings with the Leadership Council symbol next to their name:

Individual Donors

Severance Hall 2011-12


INDIVIDUAL GIFTS OF $50,000 TO $74,999

John P. Bergren* and Sarah M. Evans Mr. William P. Blair III Mr. Richard J. Bogomolny and Ms. Patricia M. Kozerefski Mr. and Mrs. Charles P. Bolton Hector D. Fortun (Miami) James D. Ireland III R. Kirk Landon and Pamela Garrison (Miami) Peter B. Lewis and Janet Rosel (Miami) Toby Devan Lewis Mrs. Emma S. Lincoln Ms. Nancy W. McCann Mr. and Mrs. Alfred M. Rankin, Jr. Mr. and Mrs. Richard K. Smucker David A. and Barbara Wolfort Anonymous INDIVIDUAL GIFTS OF $30,000 TO $49,999

Dr. and Mrs. Wolfgang Berndt (Europe) Blossom Women’s Committee The Brown and Kunze Foundation Jeanette Grasselli Brown and Glenn R. Brown Mrs. Gerald N. Cannon Mr. and Mrs. Matthew V. Crawford Mr. and Mrs. Geoffrey Gund George Gund Mrs. Marguerite B. Humphrey Giuliana C. and John D. Koch Foundation (Cleveland, Miami) Dr. Vilma L. Kohn Charlotte R. Kramer Mr. and Mrs. Jon A. Lindseth Ms. Beth E. Mooney Mrs. Alfred M. Rankin, Sr. Brian and Patricia Ratner Charles and Ilana Horowitz Ratner Luci and Ralph* Schey Mr. and Mrs. Franz Welser-Möst Women’s Committee of The Cleveland Orchestra Anonymous INDIVIDUAL GIFTS OF $25,000 TO $29,999

Sheldon and Florence Anderson (Miami) Mr. and Mrs. Gerald A. Conway Tati and Ezra Katz (Miami) Mr. and Mrs. S. Lee Kohrman Dr. and Mrs. David Leshner Mr. and Mrs. Alex Machaskee

Severance Hall 2011-12

Individual Donors

Mrs. Jane B. Nord Mr. and Mrs. James A. Ratner Hewitt and Paula Shaw Richard and Nancy Sneed R. Thomas and Meg Harris Stanton Rick, Margarita and Steven Tonkinson (Miami) Judy and Sherwood Weiser (Miami) INDIVIDUAL GIFTS OF $20,000 TO $24,999

Gay Cull Addicott Mr. and Mrs. Daniel M. Bell (Miami) Martha and Bruce Clinton (Miami) Bruce and Beth Dyer Dr. Edward S. Godleski Andrew and Judy Green Margaret Fulton-Mueller and Scott Mueller William J. and Katherine T. O’Neill Dr. and Mrs. Ronald J. Ross Marc and Rennie Saltzberg Dr. and Mrs. Neil Sethi Paul and Suzanne Westlake Anonymous gift from Switzerland (Europe) Anonymous INDIVIDUAL GIFTS OF $15,000 TO $19,999

Mr. and Mrs. William W. Baker Randall and Virginia Barbato Jayusia and Alan Bernstein (Miami) Scott Chaikin and Mary Beth Cooper Do Unto Others Trust (Miami) Colleen and Richard Fain (Miami) Mr. Allen H. Ford Richard and Ann Gridley Mrs. John A Hadden Jr. Gary Hanson and Barbara Klante Jack Harley and Judy Ernest Iris and Tom Harvie Joan and Leonard Horvitz Richard and Erica Horvitz (Cleveland, Miami) Elizabeth B. Juliano Mr. Thomas F. McKee Mrs. Stanley L. Morgan* Lucia S. Nash Mr. Gary A. Oatey Mr. and Mrs. James A. Saks Raymond T. and Katherine S. Sawyer Nancy and Neil Schaffel (Miami) David and Harriet Simon Mary M. Spencer (Miami) Dr. and Mrs. William P. Steffee Dr. Kenneth F. Swanson Mr. Joseph F. Tetlak listings continue

81


THE CLEVELAN D ORCHESTRA

INDIVIDUAL GIFTS OF $12,500 TO $14,999

Mr. and Mrs. George M. Aronoff Mr. and Mrs. David J. Carpenter George* and Becky Dunn Robert M. Maloney and Laura Goyanes Mrs. David Seidenfeld Mrs. Jean H. Taber Mr. and Mrs. Alfred Umdasch (Europe) INDIVIDUAL GIFTS OF $10,000 TO $12,499

Fred G. and Mary W. Behm Marsha and Brian Bilzin (Miami) Dr. Christopher P. Brandt and Dr. Beth Sersig Mr. D. McGregor Brandt, Jr. Mr. and Mrs. Eugene A. Buehler J. C. and Helen Rankin Butler Augustine* and Grace Caliguire Richard J. and Joanne Clark Mr. Bruce Coppock (Miami) Judith and George W. Diehl Mr. and Mrs. Robert P. Duvin Mike S. and Margaret Eidson (Miami) Dr. and Mrs. Lloyd H. Ellis Jr. Mr. and Mrs.* David K. Ford Ms. Dawn M. Full Mr. Francisco A. Garcia (Miami) Mr. and Mrs. Richard T. Garrett

Crescendo

Annual Campaign Patrons

Barbara Robinson, chair Robert Gudbranson, vice chair Gay Cull Addicott William W. Baker Ronald H. Bell Henry C. Doll Judy Ernest Nicki Gudbranson Jack Harley

Iris Harvie Brinton L. Hyde Randall N. Huff Elizabeth Kelley David C. Lamb Raymond T. Sawyer

Ongoing annual support gifts are a critical component toward sustaining The Cleveland Orchestra’s economic health. Ticket revenues provide only a small portion of the funding needed to support the Orchestra’s outstanding performances, educational activities, and community projects. The Crescendo Patron Program recognizes generous donors of $2,500 or more to the Orchestra’s Annual Campaign. For more information on the benefits of playing a supporting role each year, please contact Hayden Howland, Manager of Leadership Giving, by calling (216) 231-7545.

82

Albert I. and Norma C. Geller Mr. and Mrs. Robert W. Gillespie Sondra and Steve Hardis Henry R. Hatch and Robin Hitchcock Hatch Mr. and Mrs. Jeffrey Healy Mary and Jon Heider (Cleveland, Miami) David and Nancy Hooker Mr. and Mrs. Richard A. Janus Mr. and Mrs. Ferdinand Jereb Janet and Gerald Kelfer (Miami) Jonathan and Tina Kislak (Miami) Mrs. Elizabeth R. Koch Tim and Linda Koelz Mr. and Mrs. Edward A. Lozick Mr. and Mrs. Richard A. Manuel Mrs. Robert H. Martindale Mr. and Mrs. Arch J. McCartney William and Eleanor McCoy Mr. and Mrs. Stanley A. Meisel Mr. Walter N. Mirapaul Elisabeth and Karlheinz Muhr (Europe) Brian and Cindy Murphy Claudia and Steven Perles (Miami) Mr. and Mrs. George M. Rose Mr. and Mrs. David A. Ruckman David M. and Betty Schneider Rachel R. Schneider, PhD Mr. and Mrs. Oliver E. Seikel Kim Sherwin Lois and Tom Stauffer Mrs. Blythe Sundberg Dr. Russell A. Trusso Clara and David Williams INDIVIDUAL GIFTS OF $7,500 TO $9,999

Mr. William Berger Laurel Blossom Dr. and Mrs. Jerald S. Brodkey Dr. Ben H. and Julia Brouhard Dr. Thomas Brugger and Dr. Sandra Russ Ellen E. & Victor J. Cohn Supporting Foundation Mr. Owen Colligan Mr. and Mrs. William E. Conway Mr. and Mrs. Edward B. Davis Henry and Mary Doll Nancy and Richard Dotson Mr. and Mrs. Terry C. Z. Egger Mr. David J. Golden Robert K. Gudbranson and Joon-Li Kim Kathleen E. Hancock Dr.* and Mrs. Shattuck W. Hartwell, Jr. Mrs. Sandra L. Haslinger In memory of Philip J. Hastings Pamela and Scott Isquick Mr. and Mrs. Donald M. Jack, Jr. Allan V. Johnson Joela Jones and Richard Weiss Mr. Lawrence B. and Christine H. Levey Judith and Morton Q. Levin Mr. and Mrs. Thomas B. McGowan Mr. Donald W. Morrison Mr. and Mrs. Stephen E. Myers Mr. and Mrs. William M. Osborne, Jr. Pannonius Foundation listings continue

Individual Donors

Severance Hall 2011-12


Imagine your picture-perfect event at Severance Hall.

Severance Hall, a Cleveland landmark and home of the world-renowned Cleveland Orchestra, is perfect for business meetings and conferences, pre-concert or post-concert dinners, and receptions, weddings, and social events. Exclusive catering by Sammyâ&#x20AC;&#x2122;s

Premium dates available! Call the Manager of Facility Sales at (216) 231-7421 or email hallrental@clevelandorchestra.com


THE CLEVELAN D ORCHESTRA

listings continued

Rosskamm Family Trust Mr. Larry J. Santon Patricia J. Sawvel Carol and Albert Schupp Naomi G. and Edwin Z. Singer Family Fund Mrs. Gretchen D. Smith Mr. and Mrs. Donald W. Strang, Jr. Bruce and Virginia Taylor Sandy and Ted Wiese Anonymous (2) INDIVIDUAL GIFTS OF $5,000 TO $7,499

Dr. Jacqueline Acho and Mr. John LeMay Mr. and Mrs. Monte Ahuja Susan S. Angell Agnes Armstrong Mr. and Mrs. Albert A. Augustus Ms. Jody Bacon Mr. and Mrs. Dean Barry Mr. Jon Batchelor (Miami) James and Reita Bayman Dr. and Mrs. Nathan A. Berger Dr. and Mrs. Eugene H. Blackstone In memory of Claude M. Blair Mrs. Flora Blumenthal Brennan Family Foundation Mr. Robert W. Briggs Mr. and Mrs. William C. Butler Mr. and Mrs. R. Bruce Campbell Ms. Maria Cashy Drs. Wuu-Shung and Amy Chuang Dr. William & Dottie Clark Mrs. Lester E. Coleman Corinne L. Dodero Trust for the Arts and Sciences Mr. and Mrs. Evan R. Corns Mr. Peter and Mrs. Julie Cummings (Miami) Mrs. Barbara Ann Davis Peter and Kathryn Eloff Dr. and Mrs. Robert Elston Mary and Oliver Emerson Mr. and Mrs. Charles R. Emrick, Jr. Mr. and Mrs. Henry J. Goodman Mr. and Mrs. Randall J. Gordon Harry and Joyce Graham Mr. Paul Greig Mr.* and Mrs. David E. Griffiths David and Robin Gunning Clark Harvey and Holly Selvaggi T. K. and Faye A. Heston Mr. Clifford Hill Amy and Stephen Hoffman Mr. and Mrs. Brinton L. Hyde Mr. and Mrs. Christopher Hyland Ms. Martha Ingram (Miami) Judith* and Clifford Isroff Rudolf D. and Joan T. Kamper Andrew and Katherine Kartalis Milton and Donna* Katz Dr. and Mrs. William S. Kiser Cynthia Knight (Miami) Julius and Doris Kramer Mrs. Justin Krent Mr. and Mrs. Peter A. Kuhn Mr. and Mrs. Arthur J. Lafave, Jr.

84

Robert and Judie Lasser Judy and Donald Lefton (Miami) Shirley and William Lehman (Miami) Mr.* and Mrs. Leo Leiden Mr. Jeff Litwiller Mr. and Mrs. Robert P. Madison Ms. Jennifer R. Malkin Mr. and Mrs. Morton L. Mandel Alan Markowitz M.D. and Cathy Pollard Mrs. Kay Marshall Alexander and Marianna C. McAfee Claudia Metz and Thomas Woodworth Edith and Ted* Miller Mr. and Mrs. William A. Mitchell Robert Moss (Miami) Mr. and Mrs. Herbert Newman Richard and Kathleen Nord John and Margi Oâ&#x20AC;&#x2122;Brien Mr. Michael G. Oravecz Mr. Henry Ott-Hansen Mr. J. William and Dr. Suzanne Palmer Nancy and Robert Pfeifer Dr. and Mrs. John N. Posch Douglas and Noreen Powers Lois S.* and Stanley M. Proctor Drs. Raymond R. Rackley and Carmen M. Fonseca Mr. and Mrs. Roger F. Rankin Mrs. Nancy L. Reymann Mr. and Mrs. James E. Rohr Carol Rolf and Steven Adler Dr. Tom D. Rose Steven and Ellen Ross Mr. Christopher Roy Mr. Klaus G. Roy and Mrs. Gene J. Roy Mr. and Mrs. Robert C. Ruhl Drs. Michael and Judith Samuels (Miami) Larry and Sally Sears Dr. and Mrs. James L. Sechler Mr. Eric Sellen and Mr. Ron Seidman Dr. Gerard and Phyllis Seltzer Drs. Daniel and Ximena Sessler Mrs. Frances G. Shoolroy Mrs. William I. Shorrock Laura and Alvin A. Siegal David Kane Smith Jim and Myrna Spira George and Mary Stark Mrs. Marie S. Strawbridge Charles B. and Rosalyn Stuzin (Miami) Mr. and Mrs. Paul A. Teel, Jr. Mr. and Mrs. Bill Thornton Mr. Brian Thornton Mr. and Mrs. Lyman H. Treadway Mr.* and Mrs. Robert N. Trombly Robert A. Valente Don and Mary Louise Van Dyke Bill Appert and Chris Wallace (Miami) Tom and Shirley Waltermire Dr. Edward L. and Mrs. Susan Westbrook Tom and Betsy Wheeler Mr. Roy Woda Mrs. Janet A. Wright Mr. David Zauder Anonymous (5) listings continue

Individual Donors

The Cleveland Orchestra


The Center for Music & Medicine University Hospitals Center for Music and Medicine is proud to support The Cleveland Orchestra.

1-866-UH4-CARE | 1-866-844-2273 UHhospitals.org/musicandmedicine

© 2011 University Hospitals NEU 00262

Creativity, Passion, Accountability, and Integrity are our guiding principles principles.

Providing Controllership, CFO, Transaction Management, and Traditional Accounting Services to enterpreneurs and not-for-profit organizations. Contact Jonathan Green • 216.593.0900 ext. 109 • www.jmgreencpa.com

We believe in working for the greater good of all and we are proud to support any organization that shares this value. We thank The Cleveland Orchestra for its commitment to excellence! Ken Lanci, Chairman & CEO Consolidated Companies Severance Hall 2011-12

85


THE CLEVELAN D ORCHESTRA

listings continued INDIVIDUAL GIFTS OF $3,500 TO $4,999

Dr. and Mrs. D. P. Agamanolis Mr. and Mrs. Quentin Alexander Mr. and Mrs. Robert H. Baker Ms. Delphine Barrett Mr.* and Mrs. Russell Bearss Mr. and Mrs. Jules Belkin Dr. Ronald and Diane Bell Dr. Robert Benyo Suzanne and Jim Blaser Mr. and Mrs. Dennis A. Block Paul and Marilyn* Brentlinger Ms. Elizabeth E. Brumbaugh Frank and Leslie Buck Dr. and Mrs. William E. Cappaert Mrs. Millie L. Carlson Ms. Mary E. Chilcote Drs. Mark Cohen and Miriam Vishny Diane Lynn Collier Marjorie Dickard Comella Mr. and Mrs. David J. Cook Pete and Margaret Dobbins Mr.* and Mrs. Sidney Dworkin Mr. Brian L. Ewart and Mr. William McHenry Mr. J. Gilbert and Mrs. Eleanor Frey Mrs. Cora C. Gigax Robert N. and Nicki N. Gudbranson

John and Virginia Hansen Mr. Robert D. Hart Barbara Hawley and David Goodman Matthew D. Healy and Richard S. Agnes Ms. Mary Beth Hedlund Hazel Helgesen and Gary D. Helgesen Anita and William Heller Bob and Edith Hudson (Miami) Mr. James J. Hummer Dr. and Mrs. Scott R. Inkley Donna L. and Robert H. Jackson Mrs. Rita G. Kelly Mr. and Mrs. Robert M. Koch Ronald and Barbara Leirvik Mr. and Mrs. Irvin A. Leonard Mrs. Emma S. Lincoln Mr. and Mrs. Robert C. Loesch Anne R. and Kenneth E. Love Robert and LaVerne Lugibihl Elsie and Byron Lutman Joel and Mary Ann Makee Martin and Lois Marcus Dr. Susan M. Merzweiler Drs. Terry E. and Sara S. Miller Ann Jones Morgan

Dr. Joan R. Mortimer Mr. and Mrs. Peter R. Osenar Mrs. Ingrid Petrus Mr. and Mrs. John S. Piety In memory of Henry Pollak Dr. Laurine Purola Dr. Robert W. Reynolds Amy and Ken Rogat Bob and Ellie Scheuer Ms. Freda Seavert Ginger and Larry Shane Dr. Marvin and Mimi Sobel Mr. and Mrs. William E. Spatz Dr. Elizabeth Swenson Ms. Lorraine S. Szabo Mr. and Mrs. Leonard K. Tower Robert J. and Marti J. Vagi Mr. and Mrs. Fred A. Watkins Mr. and Mrs. Mark Allen Weigand Mr. Peter and Mrs. Laurie Weinberger Robert C. Weppler Nancy V. and Robert L. Wilcox Ms. Judith H. Wright Anonymous (3)

Mr. and Mrs. James B. Chaney Dr. and Mrs. Ronald Chapnick Dr. Christopher and Mrs. Maryann Chengelis Mr. and Mrs. Homer D. W. Chisholm Mr. and Mrs. Robert A. Clark Dr. Dale and Susan Cowan Mrs. Frederick F. Dannemiller Charles and Fanny Dascal (Miami) Jeffrey and Eileen Davis Mrs. Lois Joan Davis Ms. Nancy J. Davis (Miami) Scott and Laura Desmond Dr. and Mrs. Richard C. Distad Ms. Maureen A. Doerner and Mr. Geoffrey T. White Mr. George and Mrs. Beth Downes David Jack and Elaine Drage Mrs. Mary S. Eaton Esther L. and Alfred M. Eich, Jr. Erich Eichhorn and Ursel Dougherty Mrs. Margaret Estill David and Margaret Ewart Harry and Ann Farmer Scott Foerster, Forester and Bohnert Joan Alice Ford Mrs. Mary Elizabeth Ford Mr. Randall and Mrs. Patrice Fortin Mr. Monte Friedkin (Miami) Marvin Ross Friedman and Adrienne bon Haes (Miami) Peggy and David* Fullmer Richard L. Furry

Marilee L. Gallagher Barbara and Peter Galvin Joy E. Garapic Mrs. Georgia T. Garner Mr. Wilbert C. Geiss, Sr. Mrs. Joan Getz (Miami) Mr. Herman Gilbert Anne and Walter Ginn Joyce and Ab* Glickman Mr. and Mrs. David A. Goldfinger Dr. and Mrs. Ronald L. Gould Cynthia and David Greenberg Mr. and Mrs. Brent R. Grover The Thomas J. and Judith Fay Gruber Charitable Foundation Nancy and James Grunzweig Dr. Phillip M. and Mrs. Mary Hall Ronald M. and Sallie M. Hall (Miami) Mr. Holsey G. Handyside Mr. George P. Haskell Virginia and George Havens Oliver and Sally Henkel Mr. and Mrs. Jerry Herschman Mr. Robert T. Hexter Dr. and Mrs. John D. Hines Dr. and Mrs. Robert L. Hinnes Dr. Feite F. Hofman Mr. and Mrs. Edmond H. Hohertz Peter A. and Judith Holmes Thomas and Mary Holmes Dr. Keith A. and Mrs. Kathleen M. Hoover

INDIVIDUAL GIFTS OF $2,500 TO $3,499

Stanley I. and Hope S. Adelstein Norman and Rosalyn Adler Family Philanthropic Fund Mr. Gerald O. Allen Norman and Helen Allison Mr. and Mrs. Robert J. Amsdell Rev. Dr. and Mrs. Kenneth J. Anderson Mr. and Mrs. Jeffrey R. Appelbaum Mr. and Mrs. Stanley H. Arkin (Miami) Geraldine and Joseph Babin Mr. William Baldwin Reverend Thomas and Dr. Joan Baumgardner Mr. and Mrs. Mike Belkin Ms. Pamela D. Belknap Mr. Roger G. Berk Kerrin and Peter Bermont (Miami) Barbara and Sheldon Berns Julia & David Bianchi (Cleveland, Miami) John A. Biek and Christina J. Norton Carmen and Karl Bishopric (Miami) Bill and Zeda Blau Mr. Doug Bletcher Mrs. Mary Wick Bole John and Anne Bourassa Ms. Barbara E. Boyle Betty Madigan Brandt David M. and Carol M. Briggs Ms. Mary R. Bynum and Mr. J. Philip Calabrese Mr. and Mrs. Frank H. Carpenter Leigh and Mary Carter

86

listings continue

Individual Donors

The Cleveland Orchestra


investments | trust | banking

does your ďŹ nancial advisor know the score? A well-planned financial life has all the complexity â&#x20AC;&#x201C; and the fluidity â&#x20AC;&#x201C; of a symphony orchestra. Real life is complicated. People come to Key Private Bank for the simpliďŹ ed sophistication we bring to their ďŹ nancial lives. Our team can help you achieve what matters most to you, delivering strategic advice and objective wealth management solutions based on a ďŹ duciary standard of care that puts your interests before our own. Your ďŹ nances, your life â&#x20AC;&#x201C; in tune, on key â&#x20AC;&#x201C; for generations.

go to keyprivatebank.com call Louisa Guthrie, Key Private Bank Executive at 216-828-7877

Bank and trust products from KeyBank National Association, Member FDIC and Equal Housing Lender. Investment products are:   !  !   !  !      Key.com is a federally registered service mark of KeyCorp. ©2010 KeyCorp.    ADL1735.04


THE CLEVELAN D ORCHESTRA

listings continued INDIVIDUAL GIFTS OF $2,500 TO $3,499

Xavier-Nichols Foundation Robert and Karen Hostoffer Mr. and Mrs. Mark Houck Dr. Randal N. Huff and Ms. Paulette Beech Ms. Charlotte L. Hughes Ms. Luan K. Hutchinson Mr. and Ms. Charles S. Hyle Ruth F. Ihde Carol Lee and James Iott Helen and Erik Jensen Mr. Peter and Mrs. Mary Joyce Mr. Daniel Kamionkowski Mr. William and Mrs. Mary Jo Kannen Barbara and Michael J. Kaplan Rev. William C. Keene Elizabeth Kelley Ms. Angela Kelsey (Miami) The Kendis Family Trust: Hilary & Robert Kendis and Susan & James Kendis Bruce and Eleanor Kendrick Mr. James Kish Fred and Judith Klotzman Jacqueline and Irwin Kott (Miami) Dr. Ronald H. Krasney and Ms. Sherry Latimer* Dr. James and Mrs. Margaret Kreiner Mr. James and Mrs. Patricia Krohngold Mr. Donald N. Krosin David C. Lamb Mrs. Carolyn Lampl Kenneth M. Lapine Anthony T. and Patricia A. Lauria Mr. and Mrs. Leon Lazarev Jeffrey and Ellen Leavitt Dr. Hasoon Lee Dr. and Mrs. Jai H. Lee Michael and Lois A. Lemr Dr. Edith Lerner Dr. Stephen B. and Mrs. Lillian S. Levine Robert G. Levy Dr. Alan and Mrs. Joni Lichtin Isabelle and Sidney* Lobe Drs. Alex and Marilyn Lotas Martha Klein Lottman Sandi M. A. Macdonald and Henry J. Grzes (Miami) Herbert L. and Rhonda Marcus Dr. and Mrs. Sanford E. Marovitz Mr. and Mrs.* Duane J. Marsh Dr. Ernest and Mrs. Marian Marsolais Mr. Julien L. McCall Mrs. Alice Mecredy Dr.* and Mrs. Hermann Menges, Jr Stephen and Barbara Messner Donald D. Miller MindCrafted Systems Bert and Marjorie Moyar Mr. Raymond M. Murphy Richard B. and Jane E. Nash Marshall I. Nurenberg and Joanne Klein

88

Richard and Jolene O’Callaghan Nedra and Mark Oren (Miami) James P. Ostryniec (Miami) Mr. and Mrs. Christopher I. Page Deborah and Zachary Paris Dr. Lewis and Janice B. Patterson Mr. Thomas F. Peterson, Jr. Dr. Roland S. Philip and Dr. Linda M. Sandhaus Dale and Susan Phillip Mr. and Mrs. Richard W. Pogue Dr. Marc and Mrs. Carol Pohl William and Gwen Preucil Mr. Richard and Mrs. Jenny Proeschel Mr. Lute and Mrs. Lynn Quintrell Mr. and Mrs. Thomas A. Quintrell Ms. C. A. Reagan David and Gloria Richards Mrs. Florence Brewster Rutter Fred Rzepka and Anne Rzepka Family Foundation Dr. Harry S. and Rita K. Rzepka Nathan N. and Esther Rzepka Family Philanthropic Fund of the Jewish Federation of Cleveland Dr. and Mrs. Martin I. Saltzman Ms. Patricia E. Say Mr. Paul H. Scarbrough Mr. James Schutte Dr. John Sedor and Ms. Geralyn Presti Lee G. and Jane Seidman Charles Seitz (Miami) Harry and Ilene Shapiro Norine W. Sharp Dr. and Mrs. William C. Sheldon Mr. Richard Shirey Dr. Howard and Mrs. Judith Siegel Donald Singer and Helene Love Mr. and Mrs.* Jeffrey H. Smythe Pete and Linda Smythe Mrs. Virginia Snapp Jay and Ellen Solowksy (Miami) Mr. John C. Soper and Dr. Judith S. Brenneke Mr. John D. Specht Howard Stark M.D. and Rene Rodriguez (Miami) Mr. and Mrs.* Lawrence E. Stewart Mrs. Barbara Stiefel (Miami) Mr. and Mrs. G. W. Stuelpe Mr. and Mrs. Daniel C. Sussen Mr. Nelson S. Talbott Mr. Karl and Mrs. Carol Theil Colin Blades Thomas Dr. and Mrs. Thomas A. Timko Mr. and Mrs. Robert J. Tomsich Mr. Erik Trimble Drs. Anna* and Gilbert True Miss Kathleen Turner Mrs. H. Lansing Vail, Jr. Mr. and Mrs. Joaquin Vinas (Miami) Mr. and Mrs. Les C. Vinney Mr. and Mrs. Joseph F. Wasserbauer

Individual Donors

Ms. Laure A. Wasserbauer Philip and Peggy Wasserstrom Mr. and Mrs. Jerome A. Weinberger Richard Wiedemer, Jr. Helen Sue* and Meredith Williams Mr. Peter and Mrs. Ann Williams Richard and Mary Lynn Wills Charles Winans Michael H. Wolf and Antonia Rivas-Wolf Drs. Nancy Wolf and Aric Greenfield Mr. Robert Wolff and Dr. Paula Silverman Kay and Rod Woolsey Rad and Patty Yates Fred and Marcia Zakrajsek Mr. Kal Zucker and Mrs. Mary Frances Haerr Anonymous (11)

member of the Leadership Council (see page 80)

* deceased

The Cleveland Orchestra is sustained through the annual support of thousands of generous patrons, including members of the Crescrendo Patron Program listed on these pages. Listings of all donors of $300 and more each year are published in the Orchestra’s Annual Report, which can be viewed online at CLEVELANDORCHESTRA.COM For information about how you can play a supporting role for The Cleveland Orchestra’s artistic excellence and community partnerships, please contact our Philanthropy & Advancement Office by calling (216) 231-7545.

The Cleveland Orchestra


,&"/ #&& )/((.',)* ,*"# )/)#-+ )+# *

" !0*% /#!+ )+#1+ *

Since its founding in 1920, CIM has offered a world-class education to students of all ages and skill levels and presented concerts and operas to the community. To get your FREE CIM 2011-12 Concert Guide or for more details about CIM concerts or classes, call 216.791.5000 or visit cim.edu.

  216.707.4045TBL45.COM 

     

216.791.5000 | cim.edu 11021 east boulevard | cleveland

HARNESSES THE POWER OF THE ARTS ) $!*+/,&"/ #&& )/ '$+#%* ** )+*/((.',)*/)#-+ )+# * '%#.*/ % )+#'&*/#!+ )+#1+ *

  216.707.4054C2RESTAURANT.COM

::::::::::::::::::::::::::::::::::::::::::::::

PNC supports those who make the world a more beautiful place. Thatâ&#x20AC;&#x2122;s why weâ&#x20AC;&#x2122;re proud to sponsor the Orchestra. Cleveland Orchestra. Tthe Cleveland Because we know that achievement is an art form all its own.

       

Š2011 The PNC Financial Services Group, Inc. All rights reserved. PNC Bank, National Association. Member FDIC. ACHIEVEMENT is a registered mark of The PNC Financial Services Group, Inc.

COMMSERV AD JUN 2010 001

Severance Hall 2011-12

89


THE CLEVELAN D ORCHESTRA R E C O R D I N G S great gift ideas

New!

The Cleveland Orchestra’s catalog of recordings continues to grow. The newest DVD features Bruckner’s Eighth Symphony recorded live at Severance Hall under the direction of Music Director Franz Welser-Möst in 2010 and released in May 2011. And, just released, Dvořák’s opera Rusalka on CD, recorded live at the Salzburg Festival. Writing of the Rusalka performances, the reviewer for London’s Sunday Times praised the performance as “the most spellbinding account of Dvořák’s miraculous score I have ever heard, either in the theatre or on record. . . . I doubt this music can be better played than by the Clevelanders, the most ‘European’ of the American orchestras, with wind and brass soloists to die for and a string sound of superlative warmth and sensitivity.” Other recordings released in the past year include two under the baton of Pierre Boulez and a second album of Mozart piano concertos with Mitsuko Uchida, whose first Cleveland Orchestra Mozart album won a Grammy Award this past year. Visit the Cleveland Orchestra Store for the latest and best Cleveland Orchestra recordings and DVDs. New!


11001 Euclid Avenue Cleveland, Ohio 44106

P H OTO BY S T E V E H A L L © H E D R I C H B L E S S I N G

CLEVELANDORCHESTRA.COM

the world’s most beautiful concert halls, Severance Hall has been home to The Cleveland Orchestra since its opening on February 5, 1931. After that first concert, a Cleveland newspaper editorial stated: “We believe that Mr. Severance intended to build a temple to music, and not a temple to wealth; and we believe it is his intention that all music lovers should be welcome there.” John Long Severance (president of the Musical Arts Association, 1921-1936) and his wife, Elisabeth, donated most of the funds necessary to erect this magnificent building. Designed by Walker & Weeks, its elegant HAILED AS ONE OF

Severance Hall 2011-12

Severance Hall

Georgian exterior was constructed to harmonize with the classical architecture of other prominent buildings in the University Circle area. The interior of the building reflects a combination of design styles, including Art Deco, Egyptian Revival, Classicism, and Modernism. An extensive renovation, restoration, and expansion of the facility was completed in January 2000. In addition to serving as the home of The Cleveland Orchestra for concerts and rehearsals, the building is rented by a wide variety of local organizations and private citizens for performances, meetings, and gala events each year.

91


of Music Director Franz Welser-Möst, The Cleveland Orchestra has become one of the most sought-after performing ensembles in the world. In concerts at its winter home at Severance Hall and at each summer’s Blossom Festival, in residencies from Miami to Vienna, and on tour around the world, The Cleveland Orchestra sets standards of artistic excellence, creative programming, and community engagement. The partnership with Franz Welser-Möst, now in its tenth season, and with a commitment to the Orchestra’s centennial in 2018, has moved the ensemble forward with a series of new and ongoing initiatives, including: UNDER THE LEADERSHIP

the establishment of residencies around the world, fostering creative artistic growth and an expanded financial base, including an ongoing residency at the Vienna Musikverein (the first of its kind by an American orchestra); an annual Miami Residency involving three weeks of concerts, community activities, and educational presentations and collaborations; concert tours from coast to coast in the United States, including regular appearances at Carnegie Hall; regular concert tours to Europe (including biennial residencies at the Lucerne Festival) and Asia (including a residency at Tokyo’s Suntory Hall in the autumn 2010); ongoing recording activities, including new releases under the direction of Franz Welser-Möst and Pierre Boulez as well as a series of DVD concert presentations of four of Bruckner’s symphonies; additional new residencies at Indiana University and at New York’s Lincoln Center Festival; an expanded offering of education and community programs with a comprehensive approach designed to make music an integral and regular part of everyday life in Northeast Ohio; continuing and expanded educational partnerships with schools, colleges, and universities from across Northeast Ohio and in the Miami-Dade community; creative new artistic collaborations, including staged works and chamber music performances, with arts institutions in Northeast Ohio and across the Miami-Dade community; the return of staged opera to Severance Hall with the presentation of acclaimed Zurich Opera productions of the three Mozart /Da Ponte operas;

92

The Orchestra Today

The Cleveland Orchestra


an array of new concert offerings (including Fridays@7 and Celebrity Series at Severance Hall as well as movie, themed, and family presentations at Blossom) to make a wider variety of concerts more available and affordable; the return of ballet to Blossom, with performances by The Joffrey Ballet. The Cleveland Orchestra was founded in 1918 by a group of local citizens intent on creating an ensemble worthy of joining America’s ranks of major symphony orchestras. Over the ensuing decades, the Orchestra quickly grew from a fine regional organization to being one of the most admired symphony orchestras in the world. The opening of Severance Hall as the Orchestra’s home in 1931 brought a special pride to the ensemble and its hometown, as well as providing an enviable and intimate acoustic environment in which to develop and refine the Orchestra’s artistry. Year-round performances became a reality in 1968 with the opening of Blossom Music Center, one of the most beautiful and acoustically admired outdoor concert facilities in the United States.

CLEVELAND ORCHESTRA ARCHIVES / ROGER MASTROIANNI

IN FOCUS

Throughout his tenure as music director, Franz Welser-Möst has been a strong advocate for reinvigorating and expanding The Cleveland Orchestra’s education programs. Here he is shown leading a rehearsal of the Cleveland Orchestra Youth Orchestra in 2002.

Severance Hall 2011-12

The Cleveland Orchestra

93


THE CLEVELAND ORCHESTRA U P C O M I N G

C O N C E R T S

At Severance Hall . . .

LUISI LEADS MOZART AND STRAUSS

ALSOP CONDUCTS .. SAINT-SAENS ORGAN SYMPHONY

Friday November 25 at 8:00 p.m. Saturday November 26 at 8:00 p.m. Sunday November 27 at 3:00 p.m.

Thursday December 8 at 8:00 p.m. Friday December 9 at 7:00 p.m. Saturday December 10 at 8:00 p.m.

THE CLEVELAND ORCHESTRA Fabio Luisi, conductor Jonathan Biss, piano

THE CLEVELAND ORCHESTRA Marin Alsop, conductor Peter Otto, violin Joela Jones, organ

Fabio Luisi, recently appointed principal conductor of the Metropolitan Opera, makes his much-anticipated Cleveland Orchestra debut with a program pairing favorite orchestral works by two all-star operatic composers. American pianist Jonathan Biss returns to Cleveland for one of Mozart’s most alluring piano concertos, while Luisi leads the Orchestra in two of Richard Strauss’s most endearing tone poems, Till Eulenspiegel and Aus Italien. Concert Sponsor: PNC

Marin Alsop, music director of the Baltimore Symphony, makes her Cleveland Orchestra debut with a program of American daring and French sizzle. The concert thunders to a finish with the gargantuan sounds of Saint-Saëns’s spirited “Organ” Symphony. Featuring regular evening concerts and a KeyBank Fridays@7 presentation (with world music by Magda Giannikou and Banda Magda). Concert Sponsor: Medical Mutual of Ohio Fridays@7 Sponsor: KeyBank

See also the concert calendar listing on pages 48-49, or visit The Cleveland Orchestra online for a complete schedule of future events and performances, or to purchase tickets online 24/ 7 for Severance Hall concerts.

TICKETS

94

216-231-1111

clevelandorchestra.com

Upcoming Concerts

The Cleveland Orchestra


Bringing you classical music 24 hours a day.

Mobile | Online | HD Radio | FM

wksu.org/channels


A world of talent...

is inspiring Cleveland youth

The Cleveland Foundation’s Creative Fusion program is bringing international artists to Cleveland for long-term residencies at our cultural and educational institutions, giving our community a rich appreciation of diverse cultures and art forms. If the arts are important to you, why not join us? When you give to your favorite causes through the Cleveland Foundation, you can tap into our experts in investing and grantmaking so that your gift lasts – and keeps on giving – forever.

216.861.3810 877.554.5054 www.ClevelandFoundation.org

If you want to be remembered, do something memorable.SM


The Cleveland Orchestra concert program Nov. 11-13