Page 1


YYYMWGPMGTFG YYYUKZDKFEQO 

$GVTCEJVGP5KGCWEJWPUGTG#WMVKQPUMCVCNQIGKO+PVGTPGV 7POKVVGNDCTPCEJFGT#WMVKQPMรŒPPGP5KGFKG'TIGDPKUUGCWHWPUGTGT *QOGRCIGGKPUGJGP  2NGCUGXKGYQWTCWEVKQPECVCNQIWGUCVYYYMWGPMGTEQO #NNCWEVKQPTGUWNVUYKNNDGCXCKNCDNGQPNKPGHQTXKGYKPICPFRTKPVKPI UJQTVN[CHVGTVJGCWEVKQP  8GWKNNG\ยพICNGOGPVEQPUWNVGTPQUECVCNQIWGUFGXGPVGFCPUNล‰+PVGTPGV UWTYYYMWGPMGTEQO.GURTKZTยพCNKUยพU[UGTQPVRWDNKยพUFKTGEVGOGPV CRTยฝUNCXGPVGCWZGPEJยฝTGU  5WNPQUVTQUKVQYYYMWGPMGTEQORQVGVGEQPUWNVCTGKPQUVTKECVCNQIJK GCEEGFGTGCNNyGNGPEQFGNNGCIIKWFKEC\KQPKGFGKNQVVKKPXGPFWVK.รƒ VTQXGTGVGCPEJGVWVVGNGKPHQTOC\KQPKUWNNGRTQUUKOGCUVG  2QFTยฑEQPUWNVCTPWGUVTQUECVยฑNQIQU[XGTGNGNGPEQFGNCU CFLWFKECEKQPGUQFGNQUNQVGUPQXGPFKFQUGPPWGUVTCRยฑIKPCYGD YYYMWGPMGTEQO  ะ’ั‹ ะผะพะถะตั‚ะต ะฟะพัะผะพั‚ั€ะตั‚ัŒ ะฝะฐัˆะธ ะฐัƒะบั†ะธะพะฝะฝั‹ะต ะบะฐั‚ะฐะปะพะณะธ ะฒ ะธะฝั‚ะตั€ะฝะตั‚ะต! ะ’ัะบะพั€ะต ะฟะพัะปะต ะพะบะพะฝั‡ะฐะฝะธั ะฐัƒะบั†ะธะพะฝะฐ ะผั‹ ะฟัƒะฑะปะธะบัƒะตะผ ั€ะตะทัƒะปัŒั‚ะฐั‚ั‹ ั‚ะพั€ะณะพะฒ ะฝะฐ ะฝะฐัˆะตะน ะธะฝั‚ะตั€ะฝะตั‚ ัั‚ั€ะฐะฝะธั†ะต.

6KVGNHQVQ 0T  

70)#40-ยค0+)4'+%* -รŒPKINKEJ7PICTKUEJGT5V5VGRJCPU1TFGP 1TFGPUVGTPOKVCEJV(NCOOGP\WPIGP\YKUEJGPFGP DTKNNCPVKGTVGP5VTCJNGPDร’PFGNP &WTEJOGUUGTOO


YYYMWGPMGTFG YYYUKZDKFEQO 

$GVTCEJVGP5KGCWEJWPUGTG#WMVKQPUMCVCNQIGKO+PVGTPGV 7POKVVGNDCTPCEJFGT#WMVKQPMรŒPPGP5KGFKG'TIGDPKUUGCWHWPUGTGT *QOGRCIGGKPUGJGP  2NGCUGXKGYQWTCWEVKQPECVCNQIWGUCVYYYMWGPMGTEQO #NNCWEVKQPTGUWNVUYKNNDGCXCKNCDNGQPNKPGHQTXKGYKPICPFRTKPVKPI UJQTVN[CHVGTVJGCWEVKQP  8GWKNNG\ยพICNGOGPVEQPUWNVGTPQUECVCNQIWGUFGXGPVGFCPUNล‰+PVGTPGV UWTYYYMWGPMGTEQO.GURTKZTยพCNKUยพU[UGTQPVRWDNKยพUFKTGEVGOGPV CRTยฝUNCXGPVGCWZGPEJยฝTGU  5WNPQUVTQUKVQYYYMWGPMGTEQORQVGVGEQPUWNVCTGKPQUVTKECVCNQIJK GCEEGFGTGCNNyGNGPEQFGNNGCIIKWFKEC\KQPKGFGKNQVVKKPXGPFWVK.รƒ VTQXGTGVGCPEJGVWVVGNGKPHQTOC\KQPKUWNNGRTQUUKOGCUVG  2QFTยฑEQPUWNVCTPWGUVTQUECVยฑNQIQU[XGTGNGNGPEQFGNCU CFLWFKECEKQPGUQFGNQUNQVGUPQXGPFKFQUGPPWGUVTCRยฑIKPCYGD YYYMWGPMGTEQO  ะ’ั‹ ะผะพะถะตั‚ะต ะฟะพัะผะพั‚ั€ะตั‚ัŒ ะฝะฐัˆะธ ะฐัƒะบั†ะธะพะฝะฝั‹ะต ะบะฐั‚ะฐะปะพะณะธ ะฒ ะธะฝั‚ะตั€ะฝะตั‚ะต! ะ’ัะบะพั€ะต ะฟะพัะปะต ะพะบะพะฝั‡ะฐะฝะธั ะฐัƒะบั†ะธะพะฝะฐ ะผั‹ ะฟัƒะฑะปะธะบัƒะตะผ ั€ะตะทัƒะปัŒั‚ะฐั‚ั‹ ั‚ะพั€ะณะพะฒ ะฝะฐ ะฝะฐัˆะตะน ะธะฝั‚ะตั€ะฝะตั‚ ัั‚ั€ะฐะฝะธั†ะต.

6KVGNHQVQ 0T  

70)#40-ยค0+)4'+%* -รŒPKINKEJ7PICTKUEJGT5V5VGRJCPU1TFGP 1TFGPUVGTPOKVCEJV(NCOOGP\WPIGP\YKUEJGPFGP DTKNNCPVKGTVGP5VTCJNGPDร’PFGNP &WTEJOGUUGTOO


162. AUKTION ORDEN UND EHRENZEICHEN 2. Oktober 2009 Steigenberger Hotel Remarque Osnabrück Natruper-Tor-Wall 1 Hotel-Telefon +49 (0)5 41-60 96 633 Hotel-Fax +49 (0)5 41-60 96 634 (nur während der Auktion/only during the auction/ uniquement pendant la vente/solamente durante l'asta/solamente durante la subasta/только во время аукциона)

ZEITPLAN AUKTIONEN 158 - 162 AUKTION 158 MÜNZEN AUS DER WELT DER ANTIKE

Montag, den 28. September 2009 11.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 391 14.00 Uhr - 17.30 Uhr Nr. 392 bis Nr. 1077

AUKTION 159 MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT MANSFELD - DIE SAMMLUNG DR. HANS KUNZ

Dienstag, den 29. September 2009 9.30 Uhr - 13.00 Uhr Nr. 1501 bis Nr. 2204 14.00 Uhr - 19.00 Uhr Nr. 2205 bis Nr. 3213 Mittwoch, den 30. September 2009 9.30 Uhr - 13.00 Uhr Nr. 3214 bis Nr. 3879

AUKTION 160 1000 GOLDPRÄGUNGEN DEUTSCHE MÜNZEN AB 1871

AUKTION 161 RUSSISCHE MÜNZEN UND MEDAILLEN

14.00 Uhr - 19.00 Uhr Nr. 4001 bis Nr. 5000 Donnerstag, den 1. Oktober 2009 9.30 Uhr - 11.30 Uhr Nr. 5001 bis Nr. 5520 11.30 Uhr - 13.00 Uhr Nr. 6001 bis Nr. 6208 14.00 Uhr - 19.00 Uhr Nr. 6209 bis Nr. 6858

AUKTION 162 ORDEN UND EHRENZEICHEN

Freitag, den 2. Oktober 2009 10.00 Uhr - 13.00 Uhr Nr. 8001 bis Nr. 8606 14.00 Uhr - 18.30 Uhr Nr. 8607 bis Nr. 9470

Detaillierter Zeitplan siehe Seite 5 Besichtigungen siehe Seite 10 Horaire détaillé voir page 5 Exposition des monnaies voir page 10

Detailed timetable view page 5 Viewing of auction good view page 10 Calendario dettagliato veda pagina 5 Esposizione veda pagina 10


Sehr geehrte Kundin, sehr geehrter Kunde und Münzfreund, ich freue mich, daß Sie bereits heute, 4 Wochen vor unserer nächsten Auktion, die neuen Kataloge erhalten haben und wünsche Ihnen viel Freude bei der Lektüre unseres Auktionsangebotes. Wir wurden oft gebeten, den Ablauf einer Auktion etwas näher zu beschreiben, diesem Wunsch kommen wir gerne nach. Am Ende dieses Kataloges finden Sie die Rubrik: “Wie biete ich richtig“, die Ihnen als Ratgeber zur erfolgreichen Teilnahme an unseren Auktionen dienen soll. Sollten Sie darüber hinaus Fragen zum Auktionsablauf haben, helfen wir Ihnen auch gerne persönlich weiter. Die Mitarbeiterinnen unserer Kundenbetreuung stellen wir Ihnen auf der nächsten Seite vor. Mit herzlichen Grüßen aus Osnabrück

Ihr Fritz Rudolf Künker UNSERE ADRESSE OUR ADDRESS

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstr. 23 · 49076 Osnabrück Ust.-Id.-Nr.: DE 256 270 181 Telefon/Phone: Fax: Gebührenfrei: E-Mail: Internet:

+49 (0)5 41-96 20 20 +49 (0)5 41-96 20 222 08 00-58 36 537 service@kuenker.de www.kuenker.de

Montag-Donnerstag Freitag Sonnabend

9.00 - 17.00 Uhr 9.00 - 15.30 Uhr nach Vereinbarung

Außerhalb unserer Geschäftszeit steht unseren Kunden ein automatischer Anrufbeantworter zur Verfügung. Monday-Thursday 9.00 a. m. to 5.00 p. m. Friday 9.00 a. m. to 3.30 p. m. Saturday by prior appointment Answering machine available after opening hours. WWW.KUENKER.DE WWW.KUENKER.COM

Auf unserer Internetseite haben Sie die Möglichkeit • die Abbildungen zu vergrößern • Ihre Gebote direkt abzugeben • die Ergebnisse der Auktionen abzurufen On our website you have the possibility • to zoom all images • to place your bids • to view all auction results

AUKTIONSHOTEL AUCTION LOCATION

Steigenberger Hotel Remarque, Natruper-Tor-Wall 1, 49076 Osnabrück Telefon/Phone: Fax:

2

+49 (0)5 41-60 96 633 +49 (0)5 41-60 96 634

Mitglied im Verband der Deutschen Münzenhändler e. V. Associaton Internationale des Numismates Professionnels (AINP)


UNSERE KUNDENBETREUUNG STEHT IHNEN GERNE ZUR VERFÜGUNG Die Maxime unseres Teams lautet: Nur wenn Sie als Kunde zufrieden sind, sind wir es auch! Geben Sie uns Ihre Auktionsgebote zu treuen Händen, wir sorgen dafür, daß sie korrekt ausgeführt werden. Auch wenn Sie sich von Teilen oder Ihrer gesamten Sammlung trennen möchten, sind wir Ihre ersten Ansprechpartner. Beachten Sie dazu bitte auch die Hinweise für Einlieferer auf der folgenden Seite bzw. im hinteren Teil des Kataloges.

WIR FREUEN UNS AUF IHRE AUKTIONSGEBOTE UND EINLIEFERUNGEN!

Ulrich Künker Leitung Kundenbetreuung ulrich.kuenker@kuenker.de

Marion Künker Deutsch, English marion.kuenker@kuenker.de

Alexandra Elflein English, Français, Italiano alexandra.elflein@kuenker.de

Anastasija Koepsell Russian, Deutsch anastasija.koepsell@kuenker.de

Nadine Zuber Deutsch, English nadine.zuber@kuenker.de

Barbara Westmeyer Deutschsprachige Kundenbetreuung barbara.westmeyer@kuenker.de

Cristina Welzel Italiano, Deutsch, English, Français cristina.welzel@kuenker.de

SO ERREICHEN SIE UNS GEBÜHRENFREI (AUS DEUTSCHLAND) TELEFON FAX INTERNET EMAIL

0800 / 5836537 (0800 / KUENKER) +49 (0) 541/ 96 20 20 +49 (0) 541/ 96 20 222 www.kuenker.de service@kuenker.de

WAS IST ZUR ERFOLGREICHEN AUKTIONSTEILNAHME BESONDERS WICHTIG? • • • • •

Ihr schriftlicher Auftrag sollte möglichst frühzeitig eintreffen, spätestens einen Tag vor der Auktion. Wenn Sie telefonisch an der Auktion teilnehmen möchten, bedarf das unserer vorherigen Genehmigung. Bitte teilen Sie uns diesen Wunsch daher mindestens 48 Stunden vor der Versteigerung mit. Nähere Informationen zum telefonischen Bieten finden Sie auf den folgenden Seiten. Beachten Sie bitte auch die Hinweise „Wie biete ich richtig“ im hinteren Teil des Kataloges. Gerne können Sie Ihre Gebote auch online abgeben. Unter www.kuenker.de bieten wir den gesamten Auktionskatalog online an. Bei Fragen rufen Sie uns an, unsere Kundenbetreuung freut sich auf Ihren Anruf!

3


WICHTIGE HINWEISE FÜR UNSERE EINLIEFERER 1.

Unser Expertenteam garantiert Ihnen eine fachgerechte Bearbeitung der von Ihnen eingelieferten Stücke. 2. Die Schätzpreise werden von uns aufgrund unserer hervorragenden Marktkenntnisse sorgfältig festgelegt. Die Stücke werden zu 80% der im Katalog angegebenen Schätzpreise ausgerufen. Durch diese Regelung werden Sie als Einlieferer geschützt. Für nicht verkaufte Objekte werden keine Gebühren erhoben. 3. Der Standard unserer Kataloge ist von hoher Qualität und findet internationale Anerkennung. Wir haben eine der besten Kundendateien, die es weltweit gibt. 4, Von der individuellen Betreuung unserer Kunden profitieren auch Sie als Einlieferer. 5. Als Einlieferer erhalten Sie Ihren Auktionserlös innerhalb von 45 Tagen nach der Auktion. Sonderregelungen sind nach Absprache möglich. 6. Auf Wunsch kann Ihre Einlieferung bei Ihnen zuhause abgeholt werden. Ab € 2.500,-- Einlieferungssumme übernehmen wir die Kosten, ab € 25.000,-können wir Ihre Einlieferungen unter Umständen und nach Absprache auch an einem vereinbarten Ort persönlich entgegennehmen. Selbstverständlich ist Ihr Versteigerungsgut durch uns versichert. 7. Nicht alle Münzen eignen sich, als Einzelstücke aufgenommen zu werden. Vertrauen Sie auf die Erfahrung unserer Experten, die niedrigpreisige Münzen liebevoll zu interessanten Lots zusammenstellen. 8. Der Schätzwert Ihrer Einlieferung sollte mindestens € 1.000,-- betragen. 9. Ihre Einlieferung wird Ihnen sofort bei Übernahme durch ein Protokoll quittiert. Spätestens fünf Wochen vor der Auktion erhalten Sie eine genaue Auflistung Ihrer Objekte mit den dazugehörenden Katalognummern. 10. Innerhalb einer Woche nach der Auktion erhalten Sie bereits die Ergebnisliste und können alle erzielten Preise feststellen. 11. Profitieren Sie von der Anziehungskraft eines führenden Unternehmens. Bitte wenden Sie sich bei Fragen an unseren Kundenservice unter 05 41 – 96 20 20 oder gebührenfrei unter 08 00-58 36 537. 12. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Wir freuen uns auf Ihren Anruf. Telefon: 05 41 – 96 20 20 oder gebührenfrei unter 08 00-58 36 537.

RENSEIGNEMENTS IMPORTANTS A L'ATTENTION DES VENDEURS 1.

Notre équipe d’experts garantit une prise en charge compétente des pièces que vous nous confiez. 2. Notre excellente connaissance du marché nous permet de fixer soigneusement les prix estimés. Les pièces seront mises aux enchères à un prix représentant 80% du prix estimé indiqué dans le catalogue. Cette réglementation vous protège en tant que vendeur. Aucuns frais ne seront prélevés sur les pièces invendues. 3. Nos catalogues ont un niveau qualitatif élevé, reconnu au plan international. Nous disposons d’un des meilleurs fichiers clients du monde. 4. En tant que vendeur, vous profiterez vous aussi du suivi personnalisé que nous offrons à nos clients. 5. Le vendeur recevra le produit de la vente dans les 45 jours qui suivront les enchères. Des dispositions spéciales pourront être prises sur accord préalable. 6. Nous prendrons en charge les frais d´expédition des pièces dont le montant sera supérieur à € 2.500,--: Si leur montant est supérieur à € 25.000,--, l´un de nos employés pourra se charger de prendre la livraison à un lieu convenu. A votre demande notre assurance couvrira tous les risques. 7. Les pièces de monnaie ne se prêtent pas toutes à une vente individuelle. Faites confiance à l’expérience de nos spécialistes qui se chargeront avec plaisir de rassembler les pièces bon marché de manière à constituer des lots intéressants. 8. La valeur estimée des pièces fournies devra s’élever à un minimum de € 1.000,--. 9. Au moment de la prise en charge, vous recevrez un détail des pièces fournies. Au plus tard cinq semaines avant la vente aux enchères, vous recevrez une liste exacte de vos pièces avec les numéros de catalogue correspondants. 10. Dans la semaine qui suivra la vente aux enchères, vous recevrez déjà la liste de ses résultats et pourrez prendre connaissance des prix obtenus. 11. Profitez de l’attrait du leader du marché. Pour tout renseignement, veuillez-vous adresser à notre service clientèle: +49 (0)5 41-96 20 20. 12. Vous pouvez demander sans engagement de votre part nos contrats de dépôt de pièces? Vous avez d’autres questions? Nous serons heureux de vous répondre au +49 (0)5 41-96 20 20.

4

IMPORTANT INFORMATION FOR OUR CONSIGNERS 1.

Our team of specialists guarantees an expert treatment of the consigned items. 2. The estimates are carefully established by us due to our excellent knowledge of the market. Bidding for the items is then started at 80 % of the estimate price stated in the catalogue. This arrangement protects you as a consigner. Unsold items incur no fees. 3. The standard offered in our catalogue is of the highest quality, and is recognised internationally. We have one of the best clientele lists worldwide. 4. You as a consigner also profit from the individual consultation offered to our customers. 5. As a consigner, you receive the auction proceeds within 45 days of the close of auction. Special arrangements can be made following discussion. 6. For consignments with a value over € 2.500,-- we may bear the transportation costs. For deliveries over € 25.000,-- we may personally collect the items at an arranged place after prior consultation. Upon consultation, the shipping of your goods could be covered by our insurance. 7. Not all coins are suited to be registered as individual items. Trust in our expert´s experience as they carefully combine less-valuable coins into interesting lots. 8. The valuation price of your delivery should be at least € 1.000,--. 9. Your delivery is confirmed in writing immediately on receipt. At least five weeks before the auction, you receive an exact list of your objects with the relevant catalogue numbers. 10. Within a week of the close of auction, you receive a list with the results in order to see what prices were reached for each individual lot. 11. Profit from our position as a leading coin dealer. If you have any questions, please contact our customer service team on +49 (0)5 41-96 20 20. 12. Would you like to receive copies of our contracts for consigner, without making any commitment? Do you have any other questions? Our customer service team will be pleased to help you – please call on +49 (0)5 41-96 20 20.

INFORMAZIONI PER I NOSTRI DEPOSITANTI 1.

Il nostro team di esperti assicura un trattamento accurato dei pezzi che ci avete inviato. 2. Eseguiamo valutazioni finalizzate alla vendita. I prezzi di stima sono frutto della nostra eccezionale conoscenza del mercato e della nostra attenta valutazione. La base d´asta ammonta all´80% del prezzo di stima indicato sul catalogo. Non si addebitano spese per gli oggetti invenduti. 3. I nostri cataloghi sono di alta qualità e sono riconosciuti a livello internazionale. I nostri clienti sono fra i migliori al mondo. 4. Come depositanti potete beneficiare dell’assistenza riservata a ciascuno dei nostri clienti. 5. Come depositanti riceverete gli importi realizzati all’asta entro 45 giorni dal termine della stessa. Si possono concordare condizioni particolari. 6. A partire da un controvalore degli oggetti di € 2.500,--i costi del trasporto sono a nostro carico, mentre a partire da un controvalore di € 25.000 gli oggetti possono essere ritirati personalmente da un nostro incaricato ad un posto concordato. Naturalmente il trasporto dei vostri oggetti puó essere assicurato tramite la nostra assicurazione. 7. Non tutte le monete possono essere negoziate singolarmente. Fidatevi dell´esperienza dei nostri esperti, che raggruppano le monete non molto preziose in lotti di sicuro interesse. 8. Il valore stimato degli oggetti depositati deve ammontare ad almeno € 1.000,--. 9. Nel momento in cui gli oggetti sono presi in consegna, viene rilasciata una ricevuta numerata. Riceverete un elenco preciso degli oggetti che avete depositato con i relativi numeri di catalogo al massimo cinque settimane prima dell’asta. 10. Riceverete l’elenco degli oggetti aggiudicati entro una settimana dalla chiusura dell’asta. Potrete cosi verificare i prezzi realizzati. 11. Approfittate della capacità di un leader di mercato per aumentare il valore dei vostri oggetti. Se avete delle domande, rimaniamo a vostra disposizione per qualsiasi necessità. Rivolgetevi alla nostra consulenza ai clienti diretta al numero +49 (0)5 41-91 20 20. 12. Volete ricevere i nostri contratti senza impegno? Avete altre domande? Potete contattarci al numero +49 (0)5 41-96 20 20.


DETAILLIERTER ZEITPLAN AUKTIONEN 158-162 AUKTION 158 MÜNZEN AUS DER WELT DER ANTIKE

Montag, den 28. September 2009 11.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 391 Kelten, Griechen 14.00 Uhr - 17.30 Uhr Nr. 392 bis Nr. 1077 Römer, Imperatoren, Völkerwanderung, Byzanz, Kreuzfahrer, Orientalen

AUKTION 159 MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT MANSFELD - DIE SAMMLUNG DR. HANS KUNZ

Dienstag, den 29. September 2009 9.30 Uhr - 13.00 Uhr Nr. 1501 bis Nr. 2204 Europa: Albanien - Schweden 14.00 Uhr - 19.00 Uhr Nr. 2205 bis Nr. 3213 Europa: Schweiz - Ungarn, Übersee, Habsburgische Erblande, Deutsche Münzen und Medaillen: Aachen - Sammlung Mansfeld Mittwoch, den 30. September 2009 9.30 Uhr - 13.00 Uhr Nr. 3214 bis Nr. 3879 Deutsche Münzen und Medaillen: Mecklenburg Würzburg, Medaillen, Papiergeld, Münzwaagen, Münzgefäße, Lots

AUKTION 160 1000 GOLDPRÄGUNGEN DEUTSCHE MÜNZEN AB 1871

AUKTION 161 RUSSISCHE MÜNZEN UND MEDAILLEN

14.00 Uhr - 19.00 Uhr Nr. 4001 bis Nr. 5000 Donnerstag, den 1. Oktober 2009 9.30 Uhr - 11.30 Uhr Nr. 5001 bis Nr. 5520 11.30 Uhr - 13.00 Uhr Nr. 6001 bis Nr. 6208 Wassili Iwanowitsch - Elisabeth I. 14.00 Uhr - 19.00 Uhr Nr. 6209 bis Nr. 6858 Peter III. - Republik, Lots, Georgien, Khoqand, Krim, Nowgorod, Papiergeld, Schmuck

AUKTION 162 ORDEN UND EHRENZEICHEN

Freitag, den 2. Oktober 2009 10.00 Uhr - 13.00 Uhr Nr. 8001 bis Nr. 8606 Deutsche Staaten, Deutsches Reich, Weimarer Republik, Drittes Reich, BRD, Europa: Albanien - Monaco 14.00 Uhr - 18.30 Uhr Nr. 8607 bis Nr. 9470 Europa: Montenegro - Vatikan, Übersee, Vereinte Nationen (UN), Ordensschnallen, Konvolute 5


INHALT AUKTION 162 ORDEN UND EHRENZEICHEN Deutsche Staaten Baden Bayern Braunschweig Frankfurt Hannover Hessen Lippe Mainz Mecklenburg-Schwerin Nassau Oldenburg Preußen Reuß Sachsen Sächsische Herzogtümer Sachsen-Altenburg Sachsen-Meiningen Thurn und Taxis Waldeck Württemberg Deutsches Reich 1871-1918 Weimarer Republik 1919-1933 Freikorps Soldaten- und Veteranenverbände Freistaat und Republik Preußen Drittes Reich 1933-1945 Bundesrepublik Deutschland seit 1949 Deutschland - Ordensschnallen Deutschland - Konvolute Unbekannte Auszeichnungen Albanien Fürstentum (1914) Volksrepublik Belgien Belgisch Kongo Bulgarien Fürstentum (1878-1908) Zarentum (1908-1944) Königliche Familie Sachsen-Coburg und Gotha von Bulgarien (seit 1946) Volksrepublik Bulgarien Dänemark Estland Finnland Frankreich Ancien Regime (bis 1789) Konstitutionelle Monarchie (1789-1792) Erste Republik (1792-1804) Erstes Kaiserreich (1804-1814/15) Zweite Restauration (1815-1830) 6

8001 8001 8001 8003 8009 8011 8013 8016

Nr. -

8022 8024

-

8079

-

8085

-

8090 8094 8096 8099

-

8104 8134 8148 8166 8172 8174

-

8176 8206 8208 8208 8210

-

8213 8217 8230 8239 8284 8284

-

8290 8292 8295

-

9470 8089 8002 8008 8010 8012 8015 8017 8018 8019 8020 8021 8023 8077 8078 8082 8083 8084 8086 8087 8088 8089 8093 8103 8098 8102 8103 8133 8147 8165 8171 8173 8175 8174 8175 8207 8207 8216 8209 8211 8212 8216 8229 8238 8283 8437 8288 8289 8291 8294 8301

Seite 13 316 13 31 13 13 14 14 15 15 15 16 16 16 16 17 18 18 28 28 28 29 30 30 30 30 31 31 32 33 34 33 34 34 34 35 37 37 40 40 45 46 46 47 47 47 47 53 53 54 55 54 54

54 55 58 61 68 68

-

69 70 71

-

54 55 57 61 67 91 69 69 70 71 72


Bürgerkönigtum (1830-1848) Zweite Republik (1848-1851) Zweite Republik, Présidence (1851-1852) Zweites Kaiserreich (1852-1870) Dritte Republik (1870-1940) Vichy-Regierung (1940-1944/45) Vierte Republik Fünfte Republik Dritte bis fünfte Republik - Orden Dritte bis fünfte Republik – Ehrenzeichen Kolonialauszeichnungen Griechenland Regierung König Ottos (1832-1862) Zweites Königreich (1863-1924) Drittes Königreich (1935-1973) Vierte Republik (seit 1974) Großbritannien Orden Ehrenzeichen Internationale und Gesellschaftsorden Island Republik (seit 1944) Italien Herzogtum Modena (bis 1861) Neapel, Königreich (1806-1815) Piemont-Sardinien, Königreich Beider Sizilien, Königreich Königliche Familie Bourbon - Beide Sizilien Toskana, Großherzogtum Königreich (1861-1946) Republik (seit 1946) Kroatien Lettland Liechtenstein Litauen Luxemburg Souveräner Malteser Ritterorden Monaco Montenegro Niederlande Norwegen Personalunion mit Schweden (bis 1905) Unabhängiges Königreich (seit 1905) Regierung der Nasjonal Samling (1940-1945) Österreich Kaiserreich (1804-1918) Erste Republik (1918-1934) Ständestaat (1934-1938) Zweite Republik (seit 1945) Niederösterreich Polen Prägestempel Erste Republik (1918-1939) Volksrepublik (1944-1989) Dritte Republik (seit 1989)

8302

8312 8332 8340 8343 8347 8373 8431 8438 8439 8441

Nr. - 8309 8310 8311 - 8331 - 8339 - 8341 8342 - 8346 - 8372 - 8430 - 8437 - 8443 8438 - 8440 - 8442 8443

8444 8444 8456 8496 8502 8502 8505

-

8507 8510

-

8514 8517 8555 8563 8571 8583 8585 8589 8591 8603 8607 8630 8646 8646 8648

-

8656 8656 8688

-

8693

-

8700

-

8701 8708

-

8495 8455 8495 8501 8504 8504 8562 8505 8506 8509 8512 8513 8516 8554 8562 8570 8582 8584 8588 8590 8602 8606 8629 8645 8655 8647 8654 8655 8699 8687 8691 8692 8698 8699 8710 8700 8707 8709 8710

72

Seite -

74 76

-

79 83 90 92

-

93 93 96 102 103 103 105

-

107 114 116 117

-

120

-

122

-

124 129 132 132 133

-

136 136 141

-

142

-

144

-

144

-

73 73 74 76 78 78 78 79 83 90 91 93 92 92 92 93 102 96 102 103 104 104 115 105 105 105 106 106 107 113 115 117 119 120 121 121 123 123 129 132 135 133 135 135 144 140 142 142 143 144 145 144 145 145 145 7


Portugal Königreich (bis 1910) Republik (seit 1910) Rumänien Königreich (1881-1947) Sozialistische Republik (1965-1989) Russland Zarentum (bis 1917) Russischer Bürgerkrieg (1918-1922) Exil Sowjetunion

8711 8711 8721 8731 8731 8763 8783 8783 8828

Nr. -

8831

San Marino Schweden Orden Ehrenzeichen Ordensschnallen Schweiz Neuenburg und Valangin, Fürstentum Serbien und Jugoslawien Fürstentum und Königreich (1817/1867-1918) Jugoslawien, Königreich (1918-1941) Jugoslawien, Volksrepublik Slowakische Republik Erste Republik (1939-1945)

8836 8841 8841 8899 8932 8936 8945 8948

Spanisches Gold aus zwei Jahrhunderten Königreich (bis 1808) Restauration (Drittes Königreich, Periode von 1813-1843) Regierung Isabellas II. (1843-1868) Regierung Amadeos I. (1870-1873) Carlisten Provisorische Regierung (1868) Fünftes Königreich (1874-1931) Spanischer Staat unter Francisco Franco (1936-1975) Sechstes Königreich (seit 1975) Spanien Regierung Isabellas II. (1843-1868) Fünftes Königreich (1874-1931) Zweite Republik (1931-1939) Spanischer Staat unter Francisco Franco (1936-1975) Katalonien Kirchliche Auszeichnungen oder Abzeichen Tschechoslowakei Erste Republik (1918-1939/46) Volksrepublik (1946-1960) Sozialistische Republik Ungarn Königreich Volksrepublik (1949-1889) Vatikan, heiliger Stuhl und Kirchenstaat Ägypten Königreich (1923-1953) Republik (seit 1953) 8

145 145 147 150 150 158 160 160

Seite -

-

8730 8720 8730 8782 8762 8782 8835 8827 8829 8830 8835

169

-

-

8840 8935 8898 8931 8935 8947 8947 9006

170 171 171 182 186 188

-

189

-

8948 8978 8986

-

8977 8985 9006 9007 9007

189 196 198

-

196 197 202 202 202

9008 9008

-

9184 9010

203 203

-

255 204

9011 9035

-

205 212

-

9090 9096

-

9034 9087 9088 9089 9095 9171

227 229

-

211 227 227 227 229 251

9172 9182 9185 9185 9187 9197

-

9181 9184 9206 9186 9196 9198

251 254 255

-

256

-

9199

-

257

-

9204 9207 9207

-

259 259

-

9218 9221 9221 9225

-

9202 9203 9206 9220 9216 9217 9220 9226 9224 9226

262 262

-

9227 9251

-

9250 9252 9251 9252

264

-

149 147 149 160 158 160 170 168 169 169 170 171 187 182 186 187 189 189 202

254 255 258 255 257 257 258 258 258 262 261 261 262 263 263 263 268 269 269 269


Äthiopien Afghanistan Emirat und Königreich Republik (1978-1989) Argentinien Bolivien Brasilien Kaiserreich (1822-1889) Bundesrepublik (seit 1891) Chile China Kaiserreich (bis 1912) Republik (1912-1928) Taiwan Volksrepublik Dominikanische Republik Ecuador Elfenbeinküste Gabun Ghana Honduras Indonesien Irak Israel Japan Jordanien Kambodscha Kamerun Kolumbien Komor Kongo Republik (1960-71 und seit 1997) Zaire, Republik (1971-1997) Korea Laos Libanon Mandatsgebiet (1941) Republik (seit 1941) Liberia Madagaskar Malaysia Marokko Protektorat Königreich (seit 1957) Mexiko Mongolei Nepal Niger Nigeria Katanga, Republik Persien, Kaiserreich (seit 1935) Iran (bis 1979)

9253 9255 9255 9260 9265 9267 9267 9270 9277 9289

9296 9300 9303 9306 9308 9313 9315 9319 9322 9325

9328 9330 9331 9335

9339 9340 9350 9353

9363

Nr. - 9254 - 9259 - 9258 9259 - 9264 - 9266 - 9276 - 9269 - 9276 - 9288 - 9292 9289 9290 9291 9292 9293 9294 9295 - 9298 9299 - 9301 9302 - 9305 - 9307 - 9312 - 9314 - 9318 - 9321 - 9323 9324 - 9326 9325 9326 9327 - 9329 - 9334 9330 - 9334 - 9336 9337 9338 - 9349 9339 - 9349 - 9352 - 9359 9360 9361 9362 9362 -

9364

Seite 270 270

-

271

-

273 273 274 277 280

-

282

-

283

-

285 286

-

287

-

290

-

290

-

292

-

292

-

270 271 271 271 272 273 276 274 276 279 281 280 280 280 281 281 281 282 283 283 284 284 284 285 286 287 287 288 288 288 289 289 289 289 289 291 290 291 291 292 292 294 292 294 295 296 297 297 297 297 297 9


Peru Ruanda Saudi-Arabien Senegal Somalia Syrien Mandatsgebiet (1920-1946) Republik (seit 1946) Thailand Togo Tschad Türkei Tunesien Fürstentum (bis 1956) Republik (seit 1956) Uruguay Venezuela U. S. A. Vietnam Annam, Kaiserreich (Süd-) Vietnam Thai-Föderation Zentralafrikanische Republik Vereinte Nationen Ordenschnallen-International Konvolute-International

9365

9379

9381 9387 9390 9415 9415

9431 9433 9441 9441

9445 9447 9449 9451

Nr. - 9374 9375 9376 9377 9378 - 9380 9379 9380 - 9385 9386 - 9389 - 9414 - 9429 - 9428 9429 9430 - 9432 - 9440 - 9444 - 9442 9443 9444 - 9446 - 9448 - 9450 - 9470

Seite 300 300 300 301 301 301 302 301 302 302 303 303 303 307 307 310 307 310 310 310 310 311 311 312 313 314 313 313 314 314 314 315 315 316 298

___________________________

BESICHTIGUNG Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, ab dem 01. September 2009, nach vorheriger telefonischer Vereinbarung unter +49 (0)5 41 96 20 20.

EXPOSITION Les monnaies seront visibles à partir du 01 septembre 2009, Gutenbergstr. 23, 49076 Osnabrück, sur rendez-vous téléphonique +49 (0)541 96 20 20.

EXPOSICIÓN Con cita previa +49 (0)541 96 20 20 podrá ver todos los lotes a partir del 01 de septiembre de 2009 en nuestras oficinas en 49076 Osnabrück, Gutenbergstr. 23.

ON VIEW The coins are on view at our premises in 49076 Osnabrueck, Gutenbergstr. 23, from September 01st 2009, by prior appointment: +49 (0)541 96 20 20.

ESPOSIZIONE Tutti i lotti 01 settembre Gutenbergstr. appuntamento 20.

sono visionabili a partire dal 2009 presso la nostra sede, 23, 49076 Osnabrück previo telefonico +49 (0)541 96 20

ПРОСМОТР АУКЦИОННЫХ ЛОТОВ Просмотр аукционных лотов проходит с 01 сентября 2009 года в нашем офисе по телефонной договоренности +49 (0)541 96 20 20 по адресу: Gutenbergstr. 23, 49076 Osnabrück.

Abbildungen sind, sofern nicht anders angegeben, auf 3/4 Größe verkleinert. Erhaltungsangaben und das Literaturverzeichnis finden Sie am Ende des Kataloges. 10


WICHTIGE HINWEISE FÜR UNSERE TELEFONBIETER

IMPORTANT INFORMATION ON TELEPHONE BIDDING

Wenn Sie telefonisch mitbieten möchten, bitten wir Sie aus organisatorischen Gründen, uns diesen Wunsch bis spätestens 48 Stunden vor der Versteigerung schriftlich mitzuteilen. Voraussetzung für ein telefonisches Mitbieten ist, daß Sie mindestens den Schätzpreis bieten. Telefonisches Bieten ist erst ab einem Schätzpreis von ca. 500 Euro pro Los möglich.

If you wish to participate in the auction as a telephone bidder, please inform us at least 48 hours in advance as we have to approve and schedule all calls. To register for telephone bidding, we require that you submit at least the estimate as written bid in addition to being called. Telephone bidding is accepted on lot numbers with estimates starting at 500 Euro.

Bitte beachten Sie, daß wir keinerlei Haftung übernehmen, falls die telefonische Verbindung während der Auktion nicht zustande kommt.

We do not assume liability should the telephone line be interrupted or not be achieved.

Sollten Sie Fragen zu der telefonischen Teilnahme an unseren Auktionen haben, können Sie uns vor der Auktion unter +49 (0)5 41-96 20 20 oder 08 00-58 36 537 (gebührenfrei) anrufen. Während der Auktion erreichen Sie uns unter der auf der ersten Seite angegebenen Telefonnummer.

INFORMATIONS POUR LA PARTICIPATION PAR TELEPHONE

Please call +49 (0)5 41-96 20 20 for more information or to register for telephone bidding. During the auction you will be able to reach us at the telephone number indicated on page 1.

INFORMAZIONI PER LA PARTECIPAZIONE TELEFONICA

Si vous désirez participer par téléphone à nos ventes aux enchères, veuillez vous mettre en relation avec Alexandra Elflein au moins 48 heures avant la vente au numéro +49 (0)5 41-96 20 233. Pendant la vente aux enchères nous vous prions d'appeler le numéro indiqué sur page no. 1 de ce catalogue.

Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare la Signora Cristina Welzel al numero diretto +49 (0)5 41-96 20 250 come minimo 48 ore prima dell´asta e di inviarci la vostra offerta, la quale deve ammontare come minimo al prezzo di stima anche per iscritto.

Une participation téléphonique à la vente sera possible à la condition que vous nous fassiez parvenir aussi votre ordre par écrit. Cet ordre devra être au moins égal au minimum au prix d’estimation et concerner un lot estimé au moins 500 Euros.

Accettiamo una partecipazione telefonica in diretta durante l´asta per oggetti il cui prezzo di stima ammonta come minimo ai 500 Euro. Non assumeremo nessuna responsabilità se la linea telefonica è occupata o se non siete raggiungibili.

Nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

INFORMACIONES DE COMO PARTICIPAR POR TELÉFONO Si quiere participar por teléfono en la subasta por favor se ponga en contacto anteriormente con la señora Cristina Welzel +49 (0)5 41-96 20 250 y envienos las pujas tambien por escrito por lo menos 48 oras antes de la subasta. Autorizamos una participación por teléfono solamente para lotes cuyos precio de estima es por lo menos 500 Euro. No asumimos la responsabilidad si la conexión telefónica se interumpa sin previsión o si está comunicando.

ВАЖНАЯ ИНФОРМАЦИЯ ДЛЯ УЧАСТИЯ ПО ТЕЛЕФОНУ Для участия в торгах по телефону просим Вас связаться с нами не позднее 48 часов до начала аукциона. Условием проведения телефонных торгов является письменное подтверждение ставки, равной как минимум стартовой цене. Участие в телефонных торгах возможно только для лотов со стартовой ценой свыше 500 евро. Для получения дополнительной информации и регистрации на аукционе звоните Анастасии Кепселль до аукциона по телефону +49 (0)5 41-96 20 268 и во время аукциона по телефону, указанному на первой странице каталога.

11


VORWORT





8QT +JPGP NKGIV DGTGKVU FGT HÒPHVG #WMVKQPUMCVCNQI FGT (KTOC   -ÒPMGTOKV1TFGPWPF'JTGP\GKEJGP+PFKGUGT#WMVKQPDKGVGPYKT +JPGP OGJT CNU  RJCNGTKUVKUEJG 1DLGMVG KP  -CVCNQI   PWOOGTP CP <WP·EJUV IGNCPIGP  2QUKVKQPGP FGWVUEJG 1TFGP   WPF'JTGP\GKEJGPOKVGKPGTICP\GP4GKJGDGFGWVGPFGT'KP\GNUVÒEMG \WO#WHTWH  7PVGTFGPGWTQR·KUEJGP#WU\GKEJPWPIGPPKOOVFKGYQJNITÌ­VGLG CW­GTJCND (TCPMTGKEJU CPIGDQVGPG 5COONWPI HTCP\ÌUKUEJGT 1TFGP   WPF'JTGP\GKEJGPCWUFTGK,CJTJWPFGTVGPFGPGTUVGP2NCV\GKP'KP CPFGTGU *KIJNKIJV FGT #WMVKQP DKNFGV GKPG CW­GTIGYÌJPNKEJG   5COONWPIURCPKUEJGT1TFGPWPF'JTGP\GKEJGPCWU)QNF QFGTOKV IQNFGPGP#WHNCIGP CWU\YGKJWPFGTV,CJTGP9GKVGTG5EJYGTRWPMVG FGT #WMVKQP DKNFGP FKG UMCPFKPCXKUEJGP .·PFGT DGUQPFGTU   5EJYGFGP  UQYKG FKG $CNMCPN·PFGT DGUQPFGTU /QPVGPGITQ WPF   5GTDKGP  

&CTÒDGTJKPCWUUKPFYGKVGTGGWTQR·KUEJG.·PFGTIWVXGTVTGVGPYKG \WO $GKURKGN $GNIKGP FKG DCNVKUEJGP 5VCCVGP )TQ­DTKVCPPKGP   +VCNKGP FKG 0KGFGTNCPFG ¤UVGTTGKEJ 2QTVWICN 4W­NCPF FKG   5EJYGK\FKG6UEJGEJQUNQYCMGKWPFFGT*GKNKIG5VWJN 8CVKMCP +PIGUCOVWOHC­VFGTGWTQR·KUEJG6GKN ÒDGT  -CVCNQIPWOOGTP &GT ÒDGTUGGKUEJG 6GKN HÒJTV WPU PCEJ #HTKMC #UKGP 0QTF WPF   5ÒFCOGTKMC #DIGUEJNQUUGP YKTF FKG #WMVKQP OKV GKPGT ICP\GP 4GKJG KPVGTGUUCPVGT -QPXQNWVG XQP   1TFGP'JTGP\GKEJGP#D\GKEJGP#WU\GKEJPWPIUOKPKCVWTGPCWUFGTICP\GP9GNV   &GT -CVCNQI YWTFG YKGFGT WPVGT YKUUGPUEJCHVNKEJGP )GUKEJVURWPMVGP GTUVGNNV OKV \CJNTGKEJGP   #POGTMWPIGP WPVGTJCND FGT GKIGPVNKEJGP $GUEJTGKDWPI FGU LGYGKNKIGP .QVU +P FKGUGO <WUCOOGPJCPI   FCPMG KEJ DGUQPFGTU *GTTP 2TQH &T &T ) #PFTGCU 6COOCPP $CUGN  CWH FGUUGP WOHCPITGKEJG   8QTCTDGKVGPKEJQHV\WTÒEMITGKHGPMQPPVG   +EJYÒPUEJG+JPGPUGJTIGGJTVG-WPFGPXKGN(TGWFGDGKO5VWFKWOFKGUGU-CVCNQIGUWPFJQHHGFCUU 5KGFCUGKPGQFGTCPFGTG1DLGMV\WT'TI·P\WPI+JTGT5COONWPIHKPFGP        /KEJCGN#WVGPITWDGT

12


DEUTSCHE STAATEN

14&'070&'*4'0<'+%*'0

8002 8001

8001

&'765%*'56##6'0 $#&'0/#4-)4#(5%*#(6 $+5 -74(ª456'067/  70& )4155*'4<1)67/ 

)TQ­JGT\QINKEJGT 1TFGP XQO <·JTKPIGT .ÌYGP 4KVVGTMTGW\  -NCUUG OKV 'KEJGPNCWD  6[R  

#WUHÒJTWPI OKV JQTK\QPVCN CPIGDTCEJVGT HNCEJGT ¤UG WPF TQUC *KOOGN KP FGT 'OCKNNGOCNGTGK  )QNF   GOCKNNKGTV 'OCKNNGOCNGTGK FWPMGNITÒPGT )NCUHNWUU FCU 'KEJGPNCWD )QNF JQJN IGRT·IV CO CNVGP   1TKIKPCNDCPFOKVCWHIGNGIVGT4QUGVVG1'- +p++



(GNFFKGPUV#WU\GKEJPWPI$TQP\GCOCNVGP1TKIKPCNDCPFOKV\YGK5RCPIGPWPF 1'- ++



.CWV FGT 6[RQNQIKG XQP -NGPCW KP )-. 5 ++  JCPFGNV GU UKEJ JKGTDGK WO GKPG #PHGTVKIWPI FGT (KTOC ,CEQD   %JT2GVT[KP-CTNUTWJGXQPECDKU#PHCPIFGTGT,CJTG&KG4QUGVVGN·UUVCWHGKPGOWVOC­NKEJG8GTNGKJWPI CPGKPGP(TCP\QUGPUEJNKG­GP\WFGON·UUVUKEJJKGTCWUCWEJUEJNKG­GPFCUUFKG8GTNGKJWPIPCEJGTHQNIVKUVFC KP FKGUGO ,CJT FCU 4KVVGTMTGW\ ++ -NCUUG GKPIGHÒJTV YQTFGP KUV YQFWTEJ FGT DKUJGTKIG 4KVVGT \WO 4KVVGT + -NCUUG   YWTFGYCUPCEJHTCP\ÌUKUEJGT+PVGTRTGVCVKQPFGT1HHK\KGTUMNCUUG OKV4QUGVVG GPVURTKEJV



8003

8004

8004

$#;'40-74(ª456'067/ $+5 70&-¤0+)4'+%*   



/GFCKNNG FGU 8GTFKGPUVQTFGPU FGT $C[GTKUEJGP -TQPG CD  CWEJ <KXKN8GTFKGPUVOGFCKNNG 5KN   DGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGKFGT5KIPCVWT.15%*OKVHNCEJGO$CPFTKPIQJPG$CPF)-. 1'- ++



/KNKV·T8GTFKGPUVQTFGP -TGW\  -NCUUG )QNF GOCKNNKGTV  OO QJPG 2WP\KGTWPI QFGT   *GTUVGNNGTDG\GKEJPWPI FTGK MNGKPG $GUEJ·FKIWPIGP KP FGT DNCWGP 'OCKNNG CO *CNUDCPFCDUEJPKVV   1'- 4++p+++  13


DEUTSCHE STAATEN

8006 8005



8007

6JGTGUKGPQTFGP-TGW\FGT1TFGPUFCOGP)QNFGOCKNNKGTVCPFGTQTKIKPCNGPCNVGPGVYCUCWUIGDNKEJGPGP &COGPUEJNGKHG1'- +p++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



/KNKV·T&KGPUVCWU\GKEJPWPI  /QFGNN #WU\GKEJPWPI  -NCUUG 5EJPCNNG HÒT  &KGPUVLCJTG   XGTIQNFGVCP6TCIGURCPIG1'- ++





$C[GTKUEJG$ÒTIGTOGKUVGTOGFCKNNG/QFGNNOKVFGO2QTVTCKV-ÌPKI.WFYKI+++#WUICDGHÒTFKG)G OGKPFG*GTIGPUYGKNGT5KNDGTCWHFGT4ÒEMUGKVGFKG1TVUDG\GKEJPWPIQJPG$CPF ++



*GTIGPUYGKNGTKUVGKPG)GOGKPFGKO.CPFMTGKU.KPFCWKO4GIKGTWPIUDG\KTM5EJYCDGP

8009



8008 1:2

8009

9CRRGP FGT 2TKP\GP FGU DC[GTKUEJGP -ÌPKIUJCWUGU  Z  OO /GUUKPI OGJTVGKNKI   IGHGTVKIVXGTIQNFGV ++



&CU9CRRGPFGT2TKP\GPFGUDC[GTKUEJGP*CWUGUWPVGTUEJGKFGVUKEJXQO-ÌPKIUYCRRGPFWTEJFKGHGJNGPFG-ÌPKIU MTQPGFKTGMVCWHFGO9CRRGPUEJKNF'UJCPFGNVUKEJJKGTDGKYQJNWOFCU9CRRGPGKPGU5EJNCIGUGKPGT-WVUEJGFGU MÌPKINKEJDC[GTKUEJGP*CWUJCNVU

$4#705%*9'+)*'4<1)67/ $+5  

*GT\QINKEJ $TCWPUEJYGKIKUEJGT 1TFGP *GKPTKEJU FGU .ÌYGP -QOOCPFGWTMTGW\ )QNF HGKPUV \KUG   NKGTV GOCKNNKGTV  I HGKPUVG 'OCKNNGOCNGTGK OKP #WUDTWEJ KP FGT ITÒPGP 'OCKNNG CO MWT\GP   QTKIKPCNGP*CNUDCPFCDUEJPKVV)-.XCT1'- ++  (TÒJG WPF ·W­GTUV SWCNKV·VUXQNNG #PHGTVKIWPI FGT (KTOC 9KNJGNO -CWUEJG #WUHÒJTWPI FWTEJ FKG (KTOC .   *GKPGOPPKP*CODWTI \YKUEJGPWPF.CWV-NGPCW KP)-.5++HDCUKGTGPFCWH4'%- UKPFKPFKGUGO <GKVTCWOXQPFKGUGT(KTOCPWT-QOOCPFGWTMTGW\GIGNKGHGTVWPFKPUIGUCOV OKVWPFQJPG5VGTP XGTNKGJGP YQTFGP

14


DEUTSCHE STAATEN

8012

8010



8011

'TKPPGTWPIUOGFCKNNG \WO 'KPJWPFGTVL·JTKIGP ,WDKN·WO    FGT 6GKNPCJOG FGT $TCWP   UEJYGKIGT 6QVGPMQRH*WUCTGP CP FGP 2GPUKPUWNC-TKGIGP KP 5RCPKGP 5KNDGTPG /GFCKNNG $TQP\G  

CNV XGTUKNDGTVQJPG$CPF 4++



&KGUGNVGP\WHKPFGPFGP5KNDGTPGP/GFCKNNGPUKPFOÌINKEJGTYGKUGHÒTFKG1HHK\KGTGFGU4GIKOGPVUDGUVKOOVIGYGUGP

(4#0-(746(4'+'56#&6   

&KGPUVCNVGTU\GKEJGP HÒT FCU .KPKGPOKNKV·T -TGW\ HÒT L·JTKIG &KGPUV\GKV FGT 1HHK\KGTG 5KNDGT  

IGRT·IV XGTIQNFGVCOCNVGP\GKVIGPÌUUKUEJGP1TKIKPCNDCPF1'- ++





&KGPUVCNVGTU\GKEJGPHÒTFCU.KPKGPOKNKV·T-TGW\HÒTL·JTKIG&KGPUV\GKVFGT7PVGTQHHK\KGTGWPF5QNFC VGP5KNDGT IGRT·IV COCNVGP\GKVIGPÌUUKUEJGP1TKIKPCNDCPF1'- ++



8013

*#0018'4-74(ª456'067/ $+5 70&-¤0+)4'+%*   

'TPUV #WIWUV1TFGP #WUHÒJTWPI OKV QHHGPGP JGTCNFKUEJGP -ÌPKIUMTQPGP WPF UQIGP *GT\QIUJÒVGP   \YKUEJGPFGP-TGW\CTOGP-QOOCPFGWTMTGW\)QNFVGKNYGKUGHGKPUV\KUGNKGTVGOCKNNKGTVI'OCKN NGTGRCTCVWTGP WPF UEJ·FGP CWH 8QTFGT WPF 4ÒEMUGKVG KP FGT ¤UG RWP\KGTV QJPG $CPFTKPI WPF   *CNUDCPF)-.1'- +++



-NGPCWIKDVKP)-. 5++ HÒTFKG,CJTGXQPDKU8GTNGKJWPIGPFGU-QOVWTMTGW\GU-NCUUGWPF FGU-QOVWTMTGW\GU-NCUUGCP

8014



8015

'TPUV #WIWUV1TFGP #WUHÒJTWPI OKV QHHGPGP JGTCNFKUEJGP -ÌPKIUMTQPGP WPF UQIGP *GT\QIUJÒVGP   \YKUEJGP FGP -TGW\CTOGP 4KVVGTMTGW\  -NCUUG 5KNDGT GOCKNNKGTV CO QTKIKPCNGP CNVGP $CPF )-.   1'- +p++



-NGPCWIKDVKP)-. 5++ HÒTFKG,CJTGXQPDKU8GTNGKJWPIGPFGU4KVVGTMTGW\GU-NCUUGCP



-TKGIUFGPMOÒP\GHÒTFKG(TGKYKNNKIGPXQP$TQP\GCOCNVGP1TKIKPCNDCPF

++

 15


DEUTSCHE STAATEN

8016

8017

*'55'0 &#4/56#&6 .#0&)4#(5%*#(6 $+5 70& )4155*'4<1)67/   

)TQ­JGT\QINKEJ*GUUKUEJGT8GTFKGPUV1TFGP2JKNKRRUFGU)TQ­OÒVKIGPD\Y)TQ­JGT\QINKEJ*GUUK UEJGT 2JKNKRRU1TFGP  /QFGNN   OKV FGT $ÒUVG FGU .CPFITCHGP 2JKNKRR  4KVVGTMTGW\    -NCUUGOKV5EJYGTVGTP)QNFGOCKNNKGTVICWHFGT4ÒEMUGKVGOGJTGTGOKP'OCKNNGEJKRUKOJGUUK UEJGP.ÌYGPFKG5EJYGTVGTUKPFIGIQUUGPWPFCWHFGP<[NKPFGTCWHIGNÌVGVOKVGTI·P\VGOCNVGPIQNFGP $CPFTKPIHÒTFKG$GHGUVKIWPICPFGTITQ­GP1TFGPUUEJPCNNGCOQTKIKPCNGP$CPF1'- ++



*'55'0 -#55'. .#0&)4#(5%*#(6 $+570&$+5 70& -74(ª456'067/ 

2TGKUOGFCKNNG FGT #MCFGOKG FGT $KNFGPFGP -ÒPUVG 5KNDGTPG /GFCKNNG PKEJV VTCIDCT &WTEJOGUUGT   OO5KNDGTKO4CPFIGRT·IV#%#&'/+'&'4$+.&'0&'0-ª056' ++



&KG /GFCKNNG YWTFG  FWTEJ -WTHÒTUV 9KNJGNO ++ CNU \YGKMNCUUKIG /KNKV·TXGTFKGPUVOGFCKNNG IGUVKHVGV .CWV 0KO   OGTIWV KP0+//5 YWTFGFGTGP8GTNGKJWPIGKPIGUVGNNVFKGPQEJXQTJCPFGP/GFCKNNGPXQPFGT#MCFG OKGFGT$KNFGPFGP-ÒPUVGKP-CUUGNÒDGTPQOOGP FKGCWEJGKPG0GWRT·IWPIXGTCPNCUUVG WPFCNU2TGKUOGFCKNNGPOKV FGT4CPFITCXWT#%#&'/+'&'4$+.&'0&'0-ª056'CWUIGIGDGP

8019 1:1

8018

8019 1:1

.+22'(ª456'067/ .+22'&'6/1.&$+5  

-TKGIUGJTGPMTGW\HÒTJGNFGPOÒVKIG6CV$TQP\GXGTIQNFGVCPTWPFGT0CFGN1'-

++



<WUCOOGPOKVFGO-TKGIUXGTFKGPUVMTGW\YWTFGFCU-TGW\CO&G\GODGTXQP(ÒTUV.GQRQNF+8IGUVKHVGV.CWV 5EJYCTM 5%*9#4-5 KUVGUXQO,CPWCTDKU\WO(GDTWCTKPUIGUCOVOCNXGTNKGJGPYQTFGP

/#+0<'4<56+(6&'5-74(ª456'4<$+567/5 $+5  

6CRHGTMGKVUOGFCKNNG/GFCKNNGKP$TQP\G$TQP\GOKV5VGORGNUEJPGKFGTUKIPCVWT+.+0&'05%*/+6 OKVUR·VGTGTI·P\VGO$CPFDÒIGNCOPGWGP$CPF 44++



)CTCPVKGTVGU \GKVIGPÌUUKUEJ IGRT·IVGU 1TKIKPCNGZGORNCT XQP ITQ­GT 5GNVGPJGKV  &CU FTGKMNCUUKIG 'JTGP\GKEJGP   YWTFGKO1MVQDGTXQP(TKGFTKEJ%CTN,QUGRJXQP'TVJCN-WTHÒTUVWPF'T\DKUEJQHXQP/CKP\IGUVKHVGVWPFDKU \WT5·MWNCTKUCVKQPFGU'T\UVKHVGUXGTNKGJGP

/'%-.'0$74)5%*9'4+0*'4<1)67/ $+5 70& )4155*'4<1)67/    16

/KNKV·TXGTFKGPUVMTGW\  -TGW\  -NCUUG $TQP\G XGTIQNFGV CO CNVGP &TGKGEMUDCPF   FC\W   0CEJHGTVKIWPIFGU-TGW\GU-NCUUGXGTIQNFGVCPHNCEJGTDCWEJKIGT0CFGN 5VÒEM++




DEUTSCHE STAATEN

8021 (1:1)

0#55#775+0)'0(ª456'067/  70&0#55#7*'4<1)67/

  

*GT\QINKEJ0CUUCWKUEJGT/KNKV·TWPF<KXKN8GTFKGPUVQTFGP#FQNRJUXQP0CUUCW/QFGNN   )TQ­MTGW\UGVOKV5EJYGTVGTPDGUVGJGPFCWU-NGKQPF)QNFVGKNYGKUGITCXKGTVGOCKNNKGTV5KNDGT ICWHFGT4Ã&#x2019;EMUGKVGFGUQDGTGP#TOUQDGTHN·EJNKEJG'OCKNNGMTCV\GTCOPGWGP5EJWNVGTDCPFWPF $TWUVUVGTP5KNDGT#WHNCIGP)QNFVGKNYGKUGHGKPUVITCXKGTVVGKNYGKUGGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG*GT UVGNNGTDG\GKEJPWPI FGT (KTOC % / 9GKUJCWRV KP *CPCW CP 0CFGN FKGUG OKV *CPCWGT 5VCFVRWP\G   1'- 5VÃ&#x2019;EM44++  4QUGPYCNF =4QUGPYCNF 9CNVGT &GT *GT\QINKEJ 0CUUCWKUEJG /KNKV·T WPF %KXKN8GTFKGPUVQTFGP #FQNRJU XQP 0CU   UCW+P1TFGP/KNKVCTKC/CIC\KP0T  5?DGNGIVHÃ&#x2019;TFGP<GKVTCWOXQPDKU   8GTNGKJWPIGPFGU)TQ­MTGW\GUOKV5EJYGTVGTPFCXQPUGEJUCP/KVINKGFGTUQWXGT·PGT*·WUGT  &GTXKGTMNCUUKIG1TFGP )TQ­MTGW\-QOVWTGWPF-NCUUG4KVVGT-TGW\-NCUUG YWTFGXQP*GT\QI#FQNRJ XQP 0CUUCW CO  /CK  IGUVKHVGV  YWTFGP GKP CHHKNKKGTVGU 8GTFKGPUVMTGW\ WPF GKPG CHHKNKKGTVGT \YGKUVWHKIG   /GFCKNNG HÃ&#x2019;T -WPUV WPF 9KUUGPUEJCHV JKP\WIGHÃ&#x2019;IV /KV FGT #PPGMVKQP 0CUUCWU FWTEJ 2TGW­GP  YWTFGP FKG   8GTNGKJWPIGPFGU1TFGPU\WP·EJUVGKPIGUVGNNVNCWV5EJQQU KP5%*1155 NGDVGGTFGLWTGCO*QHGFGU FGRQUUGFKGTVGP *GT\QIU YGKVGTJKP GKP DGUEJGKFGPGU &CUGKP &KG 6JTQPDGUVGKIWPI *GT\QI #FQNRU KP .WZGODWTI KO   ,CJTGUQNNVGPKEJVCPFGTTGEJVNKEJGP5VGNNWPIFGU1TFGPU·PFGTP&GTPGWG)TQ­JGT\QIFCEJVGCPUEJGKPGPFPKEJV KO GPVHGTPVGUVGP FCTCP KJP \W GKPGO 1TFGP FGU )TQ­JGT\QIVWOU \W OCEJGP    <YCT YWTFG FGT 1TFGP PWOGJT   YKGFGTJ·WHKIGTXGTNKGJGPCWEJÃ&#x2019;DGTFGP4CJOGPFGU*QHGUJKPCWUCDGTGTDNKGDHÃ&#x2019;T)TQ­JGT\QI#FQNRJ\GKVNGDGPU UGKP*GT\QINKEJ0CUUCWKUEJGT1TFGP 

17


DEUTSCHE STAATEN

8022

8023

1.&'0$74)*'4<1)67/ $+5 70&)4155*'4<1)67/   

#WU\GKEJPWPIU WPF 7TMWPFGP0CEJNCUU FGU ITQ­JGT\QINKEJGP *QHNCMCKGP *KNLG DGUVGJGPF CWU     1TCPKGP0CUUCW1TFGP 5KNDGTPG 8GTFKGPUVOGFCKNNG 5KNDGT CO $CPF OKV PKGFGTN·PFKUEJGO   8GTNGKJWPIUGTNCUU FCVKGTV *GV .QQ  #RTKN  ªDGTUGPFWPIUUEJTGKDGP FGU -CP\NGTU FGT   0KGFGTN·PFKUEJGP 1TFGP FCVKGTV U )TCXGPJCIG CO  #RTKN  WPF QNFGPDWTIKUEJGT   6TCIGIGPGJOKIWPI JKGT\W FCVKGTV 1NFGPDWTI CO  ,WPK  KO QTKIKPCNGP 7OUEJNCI     1UOCPKUEJGU 4GKEJ /GFCKNNG HÒT -WPUV +HVKJCT/GFCKNNG  =UKE? 5KNDGT OKV CPIGNÌVGVGT ¤UG QJPG   $CPF OKV QTKIKPCNGO 8GTNGKJWPIU(KTOCP FCVKGTV -QPUVCPVKPQRGN   #RTKN   QHHK\KGNNGT   ªDGTUGV\WPI WPF QNFGPDWTIKUEJGT #PPCJOGIGPGJOKIWPI JKGT CNU 5KPCK/GFCKNNG DG\GKEJPGV  FCVKGTV   1NFGPDWTI#RTKNKOQTKIKPCNGP7OUEJNCI 5VÒEM++



*KNLGYCT*QHNCMCKFGT*GT\QIKP5QRJKG%JCTNQVVGXQP1NFGPDWTIWPFPCJOCNU5VGYCTFCPFGT1TKGPVTGKUGCWH FGT )TQ­JGT\QINKEJ 1NFGPDWTIKUEJGP ;CEJV .GPUQJP VGKN  8QNNUV·PFKIGT #WU\GKEJPWPI WPF 7TMWPFGP0CEJNCUU   FGTDGUQPFGTUFWTEJFGPQTKIKPCNGPQUOCPKUEJGP(KTOCPKPIQNFGPGTWPFUEJYCT\GT5EJTKHVDGUVKEJV



(TKGFTKEJ#WIWUV-TGW\-TGW\-NCUUG$TQP\GIGUEJY·T\VCP0CFGN1'-

+p++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T #WUFGO$GUKV\FGU-TKGIUYKUUGPUEJCHVNGTUWPFRTGW­KUEJGP)GPGTCNUFGT+PHCPVGTKG&TJE*WIQ(TGKJGTT XQP(TG[VCI.QTKPIJQXGP  +PJCDGTUFGU1TFGPRQWTNGO¾TKVGHÒT9KUUGPUEJCHVGPWPF-ÒPUVG'TYQTDGP CWUFGT(COKNKGFGU+PJCDGTU  )GUVKHVGV CO  5GRVGODGT  KP \YGK -NCUUGP FWTEJ )TQ­JGT\QI (TKGFTKEJ #WIWUV #O  5GRVGODGT    UVKHVGVGFGT)TQ­JGT\QIPQEJFKG5RCPIG814&'/('+0&'\WT-NCUUGFGU'JTGP\GKEJGPU

8024

24'755'0-¤0+)4'+%*   

*QJGT 1TFGP XQO 5EJYCT\GP #FNGT $TWUVUVGTP  Z OO 5KNDGTNCCP WPF 2CKNNGVVGP   $KNFUVKEMGTGK CP FGP 5VTCJNGPURKV\GP OKV 5EJNCWHGP \WO #PP·JGP HCUV XQNNUV·PFKI GTJCNVGP  CWH FGT   4ÒEMUGKVG #DFGEMRCRKGT OKV JCPFUEJTKHVNKEJGT $GUEJTKHVWPI %4/  O KO QTKIKPCNGP WPF   RCUUGPFGP\GKVIGPÌUUKUEJGP'VWK 4++ 5GJTUEJÌPIGCTDGKVGVGT$TWUVUVGTPXQO'PFGFGU#EJV\GJPVGP,CJTJWPFGTVUKPHCTDHTKUEJGT'TJCNVWPIWPFKO\WIG JÌTKIGP'VWKYKTMNKEJUGJTUGNVGP

18




DEUTSCHE STAATEN

8025



*QJGT1TFGPXQO5EJYCT\GP#FNGT(·NUEJWPIGKPGU1TFGPUUGVUDGUVGJGPFCWU-NGKPQF5KNDGTXGT IQNFGVWPFGOCKNNKGTVQJPG2WP\KGTWPIGPCO5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVWPFTGRGT EKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGOKVWPFXGTUEJNCIGPGT5KNDGTRWP\G 5VÒEM++



5GJT UEJÌP IGCTDGKVGVGT 5GV CWU FGT <YGKVGP *·NHVG FGU <YCP\KIUVGP ,CJTJWPFGTVU JGTXQTTCIGPFGT 'TUCV\ HÒT PWT   PQEJUGJTUEJYGTGTJ·NVNKEJG1TKIKPCNGZGORNCTG

8026





8027

4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG#WUHÒJTWPIOKV IGMÌTPVGP-TGW\CTOGP5KNDGTVGKNYGKUGGOCKNNKGTV'OCKNNGOCNGTGKKO<[NKPFGTRWP\KGTV4CO$CPF \WUCOOGP OKV GKPUGKVKIGT  8GTNGKJWPIUWTMWPFG HÒT FGP 1DGTRQUVUGMTGV·T 4GEJPWPIUTCV (TCP\ 6KORG   CWU/CIFGDWTIFCVKGTV$GTNKPCO&G\GODGT7PVGTUEJTKHV-CPKV\ ++



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG)QNFGOCKNNKGTV HGKPUVG'OCKNNGOCNGTGKCWHFGO4CPFFGUWPVGTGP-TGW\CTOU4KV\OCTMG0COPGWGP$CPFCDUEJPKVV 1'-24-C +p++



8029 8028



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG)QNFGOCKNNKGTV HGKPUVG'OCKNNGOCNGTGKCWHFGO4CPFFGUWPVGTGP-TGW\CTOU4KV\OCTMG0COQTKIKPCNGPCNVGP$CPF 1'-24-C 4++



&KG-TGW\G-NCUUGUKPFKPFGPNGV\VGP,CJTGPPWTPQEJUGNVGPCWHFGO/CTMV\WHKPFGPIGYGUGP



4QVGT#FNGT1TFGP/QFGNN OKV\KGIGNTQVGO#FNGT -TGW\-NCUUG#WUICDGOKVIG MÌTPVGP -TGW\CTOHN·EJGP CD   5KNDGT VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK OKP #WUDTWEJ KO   4CPFFGU'OCKNNGHGNFGUKO<[NKPFGT*GTUVGNNGTDG\GKEJPWPI9+./COQTKIKPCNGPCNVGP&TGKGEMUDCPF KOQTKIKPCNGPRCUUGPFGP'VWKÌUVGTTGKEJKUEJGT#TV1'-24-C ++

 19


DEUTSCHE STAATEN

8030

8031 8031



-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVMNGKPGTJGTCNFKUEJGT-TQPG -TGW\-NCUUG $TQP\GXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVQJPG$CPF1'-24-C 4++





-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGEC (·N UEJWPIGKPGU5GVUFGT-NCUUGOKV5EJYGTVGTPDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTV FKG 5EJYGTVGT HGUV XGTNÌVGV QJPG 2WP\KGTWPIGP CO 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG   XGTIQNFGV WPF GOCKNNKGTV FKG5EJYGTVGTHGUVXGTNÌVGVWPFOKVVGNU*QJNPKGVGPDGHGUVKIVCPXGTIQNFGVGT 0CFGNFKGUGRWP\KGTVOKVWPF5+.$'4 ++



5GJT UEJÌP IGCTDGKVGVGT 5GV CWU FGT <YGKVGP *·NHVG FGU <YCP\KIUVGP ,CJTJWPFGTVU JGTXQTTCIGPFGT 'TUCV\ HÒT PWT   PQEJUGJTUEJYGTGTJ·NVNKEJG1TKIKPCNGZGORNCTG

8032





8033

-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGEC $TWUV UVGTP\WT-NCUUG5KNDGT/GFCKNNQP)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVGDGKO0CFGNJCMGP4KV\OCTMG 9CPXGTIQNFGVGT0CFGN1'-24-C +p++



-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGEC PKEJV RTQDGO·­KIG#PHGTVKIWPIGKPGU$TWUVUVGTP\WT-NCUUG5KNDGT/GFCKNNQP5KNDGTXGTIQNFGVWPFGOCKN NKGTVOGJTGTG'OCKNNGTGRCTCVWTGPCPXGTIQNFGVGT0CFGNFKGUGOKVFTGKGEMKIGT2WP\G ++p+++



1D GU UKEJ DGK FKGUGO 'ZGORNCT WO GKPG ·NVGTG PKEJV RTGW­KUEJG #PHGTVKIWPI QFGT WO GKPG (·NUEJWPI CWU FGT    \YGKVGP*·NHVGFGU<YCP\KIUVGP,CJTJWPFGTVUJCPFGNVMQPPVGNGKFGTPKEJVIGMN·TVYGTFGP

20


DEUTSCHE STAATEN

8034 (1:1)



-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIUMTQPGEC $TWUV UVGTP \WT  -NCUUG OKV FGT ,WDKN·WOU\CJN  5KNDGT /GFCKNNQP )QNF GOCKNNKGTV FKG <CJN  5KNDGT   GOCKNNKGTVCPXGTIQNFGVGT0CFGN1'-24- 44++  +PCNNGP6GKNGPGZVTGOUGNVGPGURTQDGO·­KIGUXGTNKGJGPGU1TKIKPCNGZGORNCT

8037

8035



8036

-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIMTQPGEC -TGW\ -NCUUG#WUHÒJTWPIOKVGEMKIGP-TGW\CTOT·PFGTP)QNFGOCKNNKGTVKO<[NKPFGT*GTUVGNNGTRWP\G9- FGT(KTOC9KNNKDCNF-NWIG%QKP$GTNKPQJPG*CNUDCPF1'-24- +



'ZGORNCTGKPGUUGNVGP\WHKPFGPFGP*GTUVGNNGTU





-ÌPKINKEJGT-TQPGP1TFGP/QFGNN OKVITQ­GTRTGW­KUEJGT-ÌPKIMTQPGEC -TGW\ -NCUUG #WUHÒJTWPI OKV GEMKIGP -TGW\CTOT·PFGTP )QNF GOCKNNKGTV CWH FGO 4CPF FGU WPVGTGP   -TGW\CTOU4KV\OCTMG9COCNVGPVGKNYGKUGCWUIGDNGKEJVGP*CNUDCPFCDUEJPKVV1'-24- +



-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT JGTCNFKUEJGT RTGW­KUEJGT -TQPG  EC     -TGW\-NCUUG)QNFGOCKNNKGTV\YGK/GVCNNWPFFTGK'OCKNNGUEJ·FGPKO<[NKPFGTRWP\KGTV4CO $CPF +++

 21


DEUTSCHE STAATEN

8038

8040

8039 (1:1)

8042





8041

-ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT RTGW­KUEJGT -ÌPKIMTQPG  EC     (·NUEJWPI  FGU-TGW\GU-NCUUGOKV5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG5EJYGTVITKHHG OKVFGO<[NKPFGTXGTNÌVGVFKG5EJYGTVMNKPIGPXGTUEJTCWDVQJPGLGINKEJG2WP\KGTWPIQFGT/CTMKGTWPI QJPG$CPF ++



$CNNGK $TCPFGPDWTI FGU ,QJCPPKVGTQTFGPU -TGW\ FGT -QOOGPFCVQTGP WPF 'JTGPMQOOGPFCVQTGP   )QNF IGRTÒHV  GOCKNNKGTV  I QJPG LGINKEJG 2WP\KGTWPI QFGT *GTUVGNNGTMGPP\GKEJPWPI QJPG   *CNUDCPF 44+p++  +P GEJV IQNFGPGT #WUHÒJTWPI UGJT UGNVGP 'PVYGFGT JCPFGNV GU UKEJ JKGTDGK WO GKPG UEJYGFKUEJG QFGT PKGFGTN·PFK   UEJG#PHGTVKIWPIFCFGTGP1TFGPUTKVVGTDKUD\YFKG+PUKIPKGPFGT$CNNGK$TCPFGPDWTIVTWIGPQFGTWO GKPG FGWVUEJG #PHGTVKIWPI XQP PCEJ  CNUQ OÌINKEJGTYGKUG CWU FGT <GKV FGT 9GKOCTGT 4GRWDNKM GT D\Y   GT,CJTG 



$CNNGK $TCPFGPDWTI FGU ,QJCPPKVGTQTFGPU -TGW\ FGT 4GEJVUTKVVGT $TQP\G XGTIQNFGV WPF GOCKNNKGTV   OKP'OCKNNGEJKRUKPFGP5RKV\GPFGUQDGTGP-TGW\CTOUCO$CPFTKPIUEJYGFKUEJGT#TVQJPG*CNUDCPF 1'-24- ++



#PHGTVKIWPI CWU FGT <GKV FGT 9GKOCTGT 4GRWDNKM 8QT  VTWIGP CWEJ FKG 4KVVGT FGT 5EJYGFKUEJGP )GPQUUGP   UEJCHVFGU,QJCPPKVGTQTFGPUFKG+PUKIPKGPFGT$CNNGK$TCPFGPDWTI



$CNNGK $TCPFGPDWTI FGU ,QJCPPKVGTQTFGPU -TGW\ FGT 4GEJVUTKVVGT $TQP\G XGTIQNFGV WPF GOCKNNKGTV   OKP 'OCKNNGEJKRU KP FGP 5RKV\GP CWH FGT 4ÒEMUGKVG FGU QDGTGP -TGW\CTOU CO *CNUDCPFCDUEJPKVV   1'-24- ++



#PHGTVKIWPICWUFGT<GKVFGT9GKOCTGT4GRWDNKM



$CNNGK $TCPFGPDWTI FGU ,QJCPPKVGTQTFGPU -TGW\ FGT 'JTGPTKVVGT $TQP\G XGTIQNFGV WPF GOCKNNKGTV   GKPKIG*CCTTKUUGCWHFGT4ÒEMUGKVGGKPGU-TGW\CTOUWPFOKP'OCKNNGEJKRUKO<GPVTWOUEJYCT\G(CTDG FGT#FNGTGVYCUDGTKGDGPCO*CNUDCPFCDUEJPKVV1'-24- ++ #PHGTVKIWPICWUFGT<GKVFGT9GKOCTGT4GRWDNKM

22




DEUTSCHE STAATEN

8044

8043



$CNNGK $TCPFGPDWTI FGU ,QJCPPKVGTQTFGPU $TWUVUVGEMMTGW\ FGT 1TFGPUTKVVGT $TQP\G XGTIQNFGV WPF   GOCKNNKGTVCWHFGT4ÒEMUGKVG\YGKOKPKOCNG2TÒHURWTGPCP0CFGN24-XCT<'+XCT ++



#PHGTVKIWPICWUFGT<GKVFGT9GKOCTGT4GRWDNKM



$CNNGK $TCPFGPDWTI FGU ,QJCPPKVGTQTFGPU $TWUVUVGEMMTGW\ FGT 1TFGPUTKVVGT 5KNDGT PKEJV GOCKNNKGTV   CP0CFGN ++



8046 (1:1)

8045 (1:1)



8045 (1:1)

9CNRWTIKWU&COGPUVKHV \W 5QGUV KP 9GUVHCNGP -TGW\ FGT 5VKHVUFCOGP  /QFGNN  Z  OO   )QNF GOCKNNKGTV  I OKV &COGPUEJNGKHG  HGKPUVG 'OCKNNGOCNGTGK CWH FGO 4CPF FGU WPVGTGP   -TGW\CTOU 4KV\OCTMG ' -TQPG UVCTT OKV FGO -TGW\ XGTDWPFGP CP FGT QTKIKPCNGP \GKVIGPÌUUKUEJGP   &COGPUEJNGKHG*ª52 44+  5VKHVUFGMQTCVKQPXQPITQ­GT5GNVGPJGKVKPGKPGTJGTXQTTCIGPFGP#PHGTVKIWPIUSWCNKV·VYQJNCWUFGT\YGKVGP*·NHVGFGU 0GWP\GJPVGP,CJTJWPFGTVUWPFKPGKPGTCDUQNWVJGTXQTTCIGPFGP'TJCNVWPI  0CEJ )TKV\PGT )TKV\PGT /CZKOKNKCP *CPFDWEJ FGT KO &GWVUEJGP 4GKEJG KP ¤UVGTTGKEJ7PICTP &·PGOCTM   5EJYGFGP WPF FGP4WUUKUEJGP1UVUGGRTQXKP\GPDGUVGJGPFGP&COGPUVKHVGTWPFKO4CPIGINGKEJUVGJGPFGT9QJNV·VKI MGKVUCPUVCNVGPPGDUVFGP1TFGPU\GKEJGPFGT'TUVGTGP(TCPMHWTVC/5HH CNU(TCWGPMNQUVGTDGTGKVU IGITÒPFGV YWTFG GU KP (QNIG FGT 4GHQTOCVKQP KO  ,CJTJWPFGTV KP GKP IGOKUEJV MQPHGUUKQPGNNGU HTGKYGNVNKEJGU   CFNKIGU &COGPUVKHV WOIGYCPFGNV FCU KP (QNIG GKPGU &GMTGVU -CKUGT 0CRQNGQPU + XQO  &G\GODGT   CO    ,CPWCT  CWHIGJQDGP YWTFG 0CEJ FGT 4ÒEMMGJT 9GUVHCNGP WPVGT FKG -TQPG 2TGW­GPU YWTFG FCU   5VKHV PGW IGITÒPFGV /KV -CDKPGVVU1TFGT XQO  ,CPWCT  JCVVG -ÌPKI (TKGFTKEJ ++ FGT )TQ­G  XQP 2TGW­GP   FGO 5VKHV DGTGKVU 5VKHVUFGMQTCVKQPGP XGTNKGJGP DGUVGJGPF CWU -TGW\ WPF $TWUVUVGTP /KV FGT 0GWITÒPFWPI CNU   GXCPIGNKUEJGU&COGPUVKHVGTJKGNVGUCWEJPGWIGUVCNVGVG5VKHVUFGMQTCVKQPGP



8GTFKGPUV'JTGP\GKEJGPHÒT4GVVWPICWU)GHCJT/KPKCVWTFGT/GFCKNNG&WTEJOGUUGTOO   5KNDGTKO4CPFRWP\KGTVCO$·PFEJGPOKV6TCIGPMPQRH&C\WGKPYGKVGTGU'ZGORNCT$TQP\GCO $·PFEJGPOKV6TCIGMPQRH 5VÒEM++



$GUQPFGTUUEJÌPCWUIGHÒJTVG/KPKCVWTOGFCKNNG

23


DEUTSCHE STAATEN

8052 8047

8049

8054

8048



8050

/GFCKNNG \WO 'KPJWPFGTVL·JTKIGP ,WDKN·WO FGU -CKUGT (TCP\ )CTFG)TGPCFKGT4GIKOGPVU 0T    KO,CJT$TQP\GCOQTKIKPCNGPCNVGP$QIGPDCPFOKVCWHIGNGIVGT4GIKOGPVU%JKHHTG 4++





-TKGIUFGPMOÒP\G  HÒT -QODCVVCPVGP 'TUVG 2T·IWPI OKV IGDQIGPGP -TGW\CTOGPFGP  $TQP\G   IGVÌPVOKV4CPFRT·IWPI#75'41$'46'/)'5%*76<QJPG$CPF ++





0GWHEJ³VGNGT 'TKPPGTWPIUOGFCKNNG 5KNDGT CO QTKIKPCNGP CNVGP \GKVIGPÌUUKUEJGP $CPF 1'-    24- +p++



0GWHEJ³VGNGT'TKPPGTWPIUOGFCKNNG5KNDGTCOQTKIKPCNGPCNVGP\GKVIGPÌUUKUEJGP-QODKPCVKQPUDCPFOKV FGOFGU4QVGP#FNGT1TFGPU1'-24- ++



%JGHFGU4GIKOGPVUYCT-CKUGT(TCP\,QUGRJ+XQP¤UVGTTGKEJ  

'ZGORNCTKPJGTXQTTCIGPFGT'TJCNVWPI

  

5GJTKPVGTGUUCPVG$CPFMQODKPCVKQP

0GWHEJ³VGNGT'TKPPGTWPIUOGFCKNNG5KNDGTQJPG$CPF1'-24-

'ZGORNCTKPJGTXQTTCIGPFGT'TJCNVWPI

+p++



0GWHEJ³VGNGT 'TKPPGTWPIUOGFCKNNG )TCXKGTVG #WUHÒJTWPI &WTEJOGUUGT  OO 5KNDGT CO   QTKIKPCNGPCNVGP$CPF1'-XCT24-XCT ++





-TKGIUFGPMOÒP\G  8GTNGKJWPIUWTMWPFG HÒT FGP 7PVGTQHHK\KGT 9KNJGNO 2TKGYG XQP FGT    -QORCPKGFGU9GUVH·NKUEJGP+PHCPVGTKG4GIKOGPVU0TFCVKGTV/ÒJNJCWUGPCO,WPKOKV 1TKIKPCNWPVGTUEJTKHVFGU1DGTUVGPWPF4GIKOGPVUMQOOCPFGWTU/CUUQYIGFWPMGNVIGHCNVGVWPFGVYCUGKP IGTKUUGP&C\W/KPKCVWTFGT/GFCKNNGWPF/KPKCVWTFGU'-++LGYGKNUCO$·PFEJGP 5VÒEM++





-TKGIUFGPMOÒP\G  OKV    XGTUEJKGFGPGP )GHGEJVUURCPIGP $TQP\G OKV 4CPFRT·IWPI   CO NCPIGP $CPF FCTCWH FKG )GHGEJVUURCPIGP $'.(146 2#4+5 /'6< 564#55$74) /106   8#.—4+'0 .' /#05 $#2#7/' #0 &'4 *#..7' $'#7)'0%;%4#8#06 14.—#05   .1+)0;21724;8+..+'45#/+'055'&#001+55'8+..'$'#7/106)4#8'.166' 5624+8#6 8+18+..'/#45 .# 6174 %1.1/$';017+..; 9¤46* 52+%*'40 WPF   9'+55'0$74) LGYGKNU OKV MWT\GP QFGT NCPIGP TWPFGP 5RNKPVGP OKV CNVGO 5COONWPIUGVKMGVV FGT   5COONWPI(#NDGTVKP'RKPCN 5VÒEM4++



5GJTMWTKQUGWPFUGNVGPG#WUHÒJTWPIOÌINKEJGTYGKUGGKP\GKVIGPÌUUKUEJGU7PKMCV

24


DEUTSCHE STAATEN

8058

8056

8057

8059

8055





-TKGIUFGPMOÒP\GOKV  XGTUEJKGFGPGP)GHGEJVUURCPIGP$TQP\GQJPG4CPFRT·IWPI CO NCPIGP $CPF FCTCWH FKG )GHGEJVUURCPIGP 9¤46* 9'+55'0$74) 8+..+'45 8+18+..'   /#45.#6174564#55$74)5637'06+014.—#0501+55'8+..'/1068#.—4+'0 .' /#05 $'#7)'0%;%4#8#06 $'#70' .# 41.#0&' $#2#7/' WPF $'#7/106   LGYGKNUOKVMWT\GPQFGTNCPIGPTWPFGPQFGTHNCEJGP5RNKPVGPOKVCNVGO5COONWPIUGVKMGVVFGT5COONWPI (#NDGTVKP'RKPCN 5VÒEM++



1HHK\KGTU&KGPUVCWU\GKEJPWPI \YGKVG #WUHÒJTWPI OKV XGTVKMCNGT ¤UG FTGK <KGTUVGIGP WPF INCVVGP   -TGW\CTOHN·EJGP  PCEJ 1'- XGTNKGJGP XQP  DKU   CO FQRRGNVGP 4KPI OKV CNVGO   $CPFUVÒEM1'-24- 4++



&C FKG 1HHK\KGTU&KGPUVCWU\GKEJPWPI KP FKGUGT <GKV UVTGPI TÒEMICDGRHNKEJVKI YCTGP UKPF FKGUG 'ZGORNCTG VTQV\ FGT   )TÌ­GFGURTGW­KUEJGP*GGTGUWPFFGTFCOKVITQ­GP'ORH·PIGT\CJNPKEJVCNN\WJ·WHKI\WHKPFGP





$GTNKPGT'KUGPCWHFKG5EJNCEJVXQP9CVGTNQQ'KUGPIGUEJY·T\V-QTTQUKQPUURWTGP8QTFGTUGKVGPKP UEJTKHV5+')&9$+70+4ÒEMUGKVGPKPUEJTKHV&'40+%*6)415'/#0 /'*4+56OKVIGMÌTFGNVGO4KPI ++



$TQUEJG OKV )CTFGUVGTP &WTEJOGUUGT FGU 5VGTPU  OO 5KNDGT VGKNYGKUG XGTIQNFGV $TQP\G   VGKNYGKUG GOCKNNKGTV \YGK OKP 'OCKNNGCWUDTÒEJG CWH FGT 4ÒEMUGKVG *GTDUVGNNGTRWP\G 9) WPF   5KNDGTRWP\GCP0CFGN ++p



3WCNKV·VUXQNNGOGJTVGKNKIG#PHGTVKIWPI



)CTFGUVGTPCNU4GXGTUPCFGN8GTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN

++

 25


DEUTSCHE STAATEN

8061

8060

24'755'0-¤0+)4'+%*'+5'40'5-4'7< 

'KUGTPGU-TGW\#WUICDG-TGW\++-NCUUGIGUVWHVGT'KUGPMGTPIGUEJY·T\V5KNDGT\CTIG¤UGTG UVCWTKGTVCOCNVGPLGFQEJPKEJV\GKVIGPÌUUKUEJGP$CPFHÒT-·ORHGT1'-24-E ++p+++



&CU 'KUGTPG -TGW\ YWTFG CWH RGTUÌPNKEJG +PKVKCVKXG CO  /·T\  XQP -ÌPKI (TKGFTKEJ 9KNJGNO +++ KP FTGK   -NCUUGP 'KUGTPGU-TGW\-NCUUG'KUGTPGU-TGW\-NCUUG)TQ­MTGW\FGU'KUGTPGP-TGW\GU CNU-TKGIU'JTGP \GKEJGP KO DGUVGJGPFGP 8GTVGKFKIWPIUHCNN  HÒT     8GTFKGPUV YGNEJGU KP FGO LGV\V CWUDTGEJGPFGP -TKGIGGPVYG FGT KO YKTMNKEJGP -CORH OKV FGO (GKPFG QFGT CW­GTFGO KO (GNFG QFGT FCJGKO LGFQEJ KP $G\KGJWPI CWH FKGUGP   ITQ­GP-CORHWO(TGKJGKVWPF5GNDUVUV·PFKIMGKVGTYQTDGPYKTF 5VKHVWPIUWTMWPFG 'UUQNNVGPCEJFGOCWU FTÒEMNKEJGP 9KNNGP FGU -ÌPKIU KP FGT  WPF  -NCUUG QJPG #PUGJGP XQP 2GTUQP WPF *GTMWPHV CP LGFGP /CPP   XGTNKGJGPYGTFGPFGTUKEJFGUUGPCNUYÒTFKIGTYKGU  +P FGT (QNIG\GKV YWTFG FCU 'KUGTPG -TGW\ \WO 5[ODQN FGT $GHTGKWPIUMTKGIG WPF GTTGKEJVG GKP JQJGU #PUGJGP +P   (QNIG FGT -TKGIUGTMN·TWPI (TCPMTGKEJU CP 2TGW­GP CO  ,WNK  GTPGWGTVG -ÌPKI 9KNJGNO + XQP 2TGW­GP FCU   'KUGTPGU -TGW\ YGPKIG 6CIG UR·VGT TÒEMFCVKGTV CWH FGP 6CI FGT -TKGIUGTMN·TWPI =8IN CWEJ W X C 5EJPGKFGT   .QWKU&KG2TGW­KUEJGP1TFGP'JTGP\GKEJGPWPF#WU\GKEJPWPIGP&CU$WEJXQO'KUGTPGP-TGW\G$GTNKP *ÒVVG 9GTPGT 1VVQ &KG )GUEJKEJVG FGU 'KUGTPGP -TGW\GU WPF UGKPG $GFGWVWPI HÒT FCU RTGW­KUEJG WPF FGWVUEJG   #WU\GKEJPWPIUYGUGPXQPDKU\WT)GIGPYCTV$QPP0KOOGTIWV,ÌTI *I &CU'KUGTPG-TGW\ .ÒFGPUEJGKF)GK­NGT*CTCNF&CU'KUGTPG-TGW\XQPDKUJGWVG0QTFGTUVGFV$QYGP8 ' 6JG 2TWUUKCP CPF )GTOCP +TQP %TQUU  #WHNCIG QJPG 1TV WPF QJPG,CJT2TGXKVGTC5VGRJGP6JQOCU6JG +TQP6KOG#*KUVQT[QH6JG+TQP%TQUU#WHNCIG?



'KUGTPGU -TGW\ #WUICDG  -TGW\ ++ -NCUUG #WUHÒJTWPI  PKEJV IGUVWHVGT 'KUGPMGTP   IGUEJY·T\V 5KNDGT\CTIG ¤UG TGUVCWTKGTV CO CNVGP LGFQEJ PKEJV \GKVIGPÌUUKUEJGP $CPF HÒT -·ORHGT   1'-XCT24-EXCT ++p



(TKGFJGNO*G[FGUEJTGKDV\WFKGUGT#WUHÒJTWPIKP*';'- 5 WC'UJCPFGNVUKEJWOGKP-TGW\FGT5GTKGXQP  PQVYGPFKI IGYQTFGPGP 0GWCPHGTVKIWPI HÒT FKG XQP (9 +++ XGTHÒIVG UVWHGPYGKUG  UQHQTVKIG 8GTNGKJWPI CP   'TDDGTGEJVKIVG

8062



8063

8064

8065

'KUGTPGU-TGW\#WUICDG-TGW\-NCUUG'KUGPMGTPIGUEJY·T\V5KNDGT\CTIGOKVUGJTMWT\GO 5VÒEM-·ORHGTDCPF1'-24-C ++



8GTNKGJGPGU1TKIKPCNPKEJV\WXGTYGEJUGNPOKVFGPXQTYKGIGPFNCEMKGTVGPUR·VGTGP#WUHÒJTWPIGP



'KUGTPGU-TGW\#WUICDG-TGW\-NCUUG'KUGPMGTPIGUEJY·T\V5KNDGT\CTIG¤UGHCEJIGTGEJV TGRCTKGTVCOMWT\GP5VÒEM-·ORHGTDCPF1'-24-C ++p+++





'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG XGTNKGJGPGU 1TKIKPCNGZGORNCT IGUEJY·T\VGT   'KUGPMGTP OKV 5KNDGT\CTIG ,CJTGU\CJNGP /QPQITCOOG WPF -TQPGP NCKGPJCHV OKV )QNFDTQP\G XGT\KGTV   QJPG$CPF1'-24- ++p+++



'KUGTPGU -TGW\ #WUICDG  <YGKVCPHGTVKIWPI FGU -TGW\GU  -NCUUG 'KUGP NCEMKGTV 5KNDGT\CTIG   KO4KPIRWP\KGTV/CO$CPF ++





#PHGTVKIWPI\YKUEJGPWPF

26


DEUTSCHE STAATEN



8068

8066

8067

'KUGTPGU-TGW\#WUICDGNVGTG/WUGWOUCPHGTVKIWPIFGU)TQ­MTGW\GUOGJTVGKNKIIGUEJY·T\VGT 'KUGPMGTPXGTUKNDGTVG<CTIGCO*CNUDCPFCDUEJPKVV ++



*GTXQTTCIGPFGU·NVGTGUWPFKP3WCNKV·VWPF#WUHÒJTWPIMGKPGUHCNNUOKVFGPJGWVGCPIGHGTVKIVGP5VÒEMGPXGTINGKEJDC TGU 'TUCV\UVÒEM HÒT GKP PKEJV DGUEJCHHDCTGU \GKVIGPÌUUKUEJGU 1TKIKPCNGZGORNCT XQP FGO PWT HÒPH +PJCDGT DGMCPPV  

-CKUGT9KNJGNO++*KPFGPDWTI.WFGPFQTHH/CEMGPUGPWPF2TKP\.GQRQNFXQP$C[GTP UKPF



'KUGTPGU-TGW\#WUICDG-TGW\-NCUUGHNCEJG#WUHÒJTWPINCEMKGTVGT'KUGPMGTP5KNDGT\CTIG CWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\G-1CP0CFGN ++





'KUGTPGU-TGW\#WUICDG-TGW\-NCUUGHNCEJG#WUHÒJTWPI'KUGPMGTPIGUEJY·T\V<CTIG5KN DGTCPDCWEJKIGT0CFGNFKGUGOKV*GTUVGNNGTRWP\G-#)KOQTKIKPCNGPUKNDGTPDGFTWEMVGPGVYCU DGUEJ·FKIVGP'VWK1'-24-C ++



8069



8070

8071

8072

8073

'KUGTPGU-TGW\#WUICDG-TGW\-NCUUGHNCEJG#WUHÒJTWPI'KUGPMGTPIGUEJY·T\V<CTIG5KN DGTCPDCWEJKIGT0CFGNOKV5VGIWPVGTFGO0CFGNJCMGPKOQTKIKPCNGPUKNDGTPDGFTWEMVGP'VWK1'- 24-C ++



'KUGTPGU-TGW\#WUICDG-TGW\-NCUUGHNCEJG#WUHÒJTWPI'KUGPMGTPIGUEJY·T\V<CTIG5KN DGT CWH FGT 4ÒEMUGKVG GKPHCEJG -TCV\)TCXWT *RVO 8QGNVGT 4(GNF#4 CP 0CFGN FKGUG XGT   DQIGP1'-24-C ++





'KUGTPGU-TGW\#WUICDG-TGW\-NCUUGNGKEJVIGYÌNDVG#WUHÒJTWPI'KUGPMGTPIGUEJY·T\V <CTIG5KNDGTCWHFGT4ÒEMUGKVG5KNDGTRWP\GCPDCWEJKIGT0CFGN1'-24-D ++





'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG NGKEJV IGYÌNDVG #WUHÒJTWPI 'KUGPMGTP NCEMKGTV   <CTIGXGTUKNDGTVCPDCWEJKIGT0CFGNKOQTKIKPCNGPUKNDGTPDGFTWEMVGP'VWK1'-24-D ++



'KUGTPGU-TGW\#WUICDG-TGW\-NCUUGIGYÌNDVG#WUHÒJTWPI'KUGPMGTPIGUEJY·T\V<CTIG 5KNDGT CP URKV\ \WNCWHGPFGT 0CFGN KO QTKIKPCNGP UKNDGTP DGFTWEMVGP 'VWK QJPG 'KPNCIG KO &GEMGN   1'-24-D ++







27


DEUTSCHE STAATEN

8074



8075 8078

'KUGTPGU-TGW\#WUICDG-TGW\-NCUUGIGYÌNDVG#WUHÒJTWPIOKV5EJTCWDUEJGKDG'KUGPMGTP IGUEJY·T\V<CTIG5KNDGTCWHFGT4ÒEMUGKVGRWP\KGTVCP5EJTCWDGOKV5EJTCWDUEJGKDGXGTUKNDGTV OKV*GTUVGNNGTDG\GKEJPWPI8+%614+#&4)/1'-24-E ++



'KUGTPGU-TGW\#WUICDG-TGW\-NCUUG'KUGPNCEMKGTV5KNDGT\CTIGOKVQTKIKPCNGO$CPFKO 4KPIRWP\KGTV-1KOCNVGPRCUUGPFGPNGFGTPGPUEJYCT\GP'VWKOKVYGK­GO&TWEMMPQRH1'- 24-C 4++





'KUGTPGU -TGW\ #WUICDG  -TGW\  -NCUUG GKPVGKNKIG PKEJV OCIPGVKUEJG #WUHÒJTWPI OKV   IGUEJNQUUGPGO4KPIOKVDGJGNHUO·­KIIGHGTVKIVGO$CPFKOQTKIKPCNGPCNVGPWPFRCUUGPFGP'VWK ++





'KUGTPGU-TGW\#WUICDG-QPXQNWVXQPFTGK-TGW\GP-NCUUGKPXGTUEJKGFGPGP#PHGTVKIWPIGP \YGK5VÒEMOKV5KNDGT\CTIGLGYGKNUKO4KPIRWP\KGTV(TD\Y / FCUFTKVVGGKPVGKNKICWUYGK­GO PKEJVOCIPGVKUEJGP/GVCNNVGKNYGKUGNCEMKGTVOKVIGUEJNQUUGPGO$CPFTKPI1'-24-C  5VÒEM++





4'755(ª456'06ª/'4)'/'+05#/ 

(ÒTUVNKEJ4GWUUKUEJGU'JTGPMTGW\5KNDGTPG8GTFKGPUVOGFCKNNGOKV5EJYGTVGTP5KNDGTCO-TKGIUDCPF KO QTKIKPCNGP IQNFHCTDGP DG\GKEJPGVGP 8GTNGKJWPIUGVWK FGT (KTOC $WT[  .GQPJCTF KP *CPCW &C\W   'KUGTPGU-TGW\++-NCUUGKO$CPFTKPIRWP\KGTV-/CO$CPF1'- ++



8079 (1:1)

8080 (1:1)

8080 (1:1)

5#%*5'0-74(ª456'067/ $+5 70&-¤0+)4'+%*   

-ÌPKINKEJ 5·EJUKUEJGT <KXKNXGTFKGPUVQTFGP D\Y -ÌPKINKEJ 5·EJUKUEJGT 8GTFKGPUVQTFGP  /QFGNN  

OKVIGOCNVGP/GFCKNNQPU 4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP FKGUGGKPUGKVKIIG RT·IVWPFGKPIGUGV\V 5KNDGTVGKNYGKUGXGTIQNFGV  GOCKNNKGTV'OCKNNGOCNGTGKCOQTKIKPCNGP CNVGP&TGKGEMUDCPF)'$1'- 444++ 



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP-WTHÒTUV,QJCPP FGU$GUV·PFKIGPOKVFGTUQIGP$·EMGTOÒV\G -QOVWTMTGW\)QNFGOCKNNKGTVIQJPG$CPFTKPI \WUCOOGP OKV QTKIKPCNGO MWT\GP *CNUDCPFCDUEJPKVV KO IQNFGP DGFTWEMVGP QTKIKPCNGP 8GTNGKJWPIUGVWK   FGT(KTOC)#5EJCTHHGPDGTIKP&TGUFGP1'- +p++ 

28


DEUTSCHE STAATEN

8081 (1:1)



-ÌPKINKEJ5·EJUKUEJGT#NDTGEJVUQTFGP/QFGNN OKVFGO2QTVTCKVXQP-WTHÒTUV,QJCPP FGU $GUV·PFKIGP OKV FGT UQIGP $·EMGTOÒV\G  $TWUVUVGTP \WO )TQ­MTGW\  #WUHÒJTWPI     5KNDGTDNGEJ 5KNDGTFTCJV /GFCKNNQP )QNF GOCKNNKGTV )QNFFTCJV FGT WONCWHGPFG 5KNDGTFTCJV CP XKGT   5VGNNGPGVYCUIGNÌUVCWHFGT4ÒEMUGKVG#DFGEMUVQHH1'- ++p  'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T &CXQTGTYQTDGPKO0QXGODGTDGK/OG5VGNNCKP2CTKU$GFGWVGPFGT$TWUVUVGTPCWUFGT5VKHVWPIU\GKVFGU 1TFGPUCNUFKGUGPQEJHGUVCWHFGO4QEMCPIGDTCEJVYCTGPXQPITÌ­VGT5GNVGPJGKVWPFKP#PDGVTCEJVFGU#NVGTUKP DGUVGT'TJCNVWPI.CWV9GDGT#TPQNFWPF2HGKN KP9'$5 YWTFGFKGUGGTUVGFÒPPIGRTG­VG#WUHÒJTWPI XQO,WYGNKGT)#5EJCTHHGPDGTIKP&TGUFGPJGTIGUVGNNV&GPINGKEJGP#WVQTGP\WHQNIG KP9'$5 KUVFKGUG -NCUUGXQPDKUKPUIGUCOVOCNXGTNKGJGPYQTFGP'KPKFGPVKUEJG'ZGORNCTLGFQEJKPGVYCUDGUUGTGT 'TJCNVWPIFKGPVCNU6KVGNUVÒEMFGTXQP&T)GTV5EJCTHGPDGTIDGCTDGKVGVGP#WHNCIGFGU1'- 0KOOGTIWV,ÌTI &GWVUEJG1TFGPWPF'JTGP\GKEJGP4GIGPUVCWH#WHNCIG   )GUVKHVGV CO  &G\GODGT  XQP -ÌPKI (TKGFTKEJ #WIWUV ++ CNU \WP·EJUV HÒPHMNCUUKIGT CNNIGOGKPGT   8GTFKGPUVQTFGP   5VKHVWPI FGT 5EJYGTVGT  WPF  GTHQNIVGP 8GT·PFGTWPIGP WPF 'TYGKVGTWPIGP    YWTFG OKV FGO 'TNC­ PGWGT 1TFGPUUVCVWVGP FCU 2QTVTCKV CWH FGO 8QTFGTUGKVGPOGFCKNNQP IG·PFGTV 9GKVGTG   'TYGKVGTWPIGP GTHQNIVGP    WPF  /KV FGO 6JTQPXGT\KEJV -ÌPKI (TKGFTKEJ #WIWUVU +++ KO   0QXGODGTGTNQUEJCWEJFGT1TFGP

8082 (1:1)



/CTKC#PPC1TFGP-TGW\GTUVGT-NCUUG OKVFGT-TQPG CPFGT&COGPUEJNGKHG5KNDGTXGTIQNFGVWPF GOCKNNKGTVCPQTKIKPCNGT&COGPUEJNGKHG1'-9'$ 444++



'ZVTGOUGNVGPGUICTCPVKGTVGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCTXQPFGO9GDGT#TPQNFWPF-GKN KP9'$5  CWUHÒJTGPFCUUFKGUG-NCUUGPWTUKGDGPOCNXGTNKGJGPYQTFGPKUV

29


DEUTSCHE STAATEN

8083

8084

5%*5+5%*'*'4<1)6ª/'4 

&KGPUVCWU\GKEJPWPIUMTGW\HÒT1HHK\KGTGPCEJ&KGPUVLCJTGP5KNDGT<GPVTGP4CPFWPF¤UG)QNF RNCVVKGTVQJPG$CPF 444++



'ZVTGOUGNVGPGGKPFGWVKIGWPF\YGKHGNUHTGKG·W­GTUVSWCNKV·VUXQNNG#TDGKVCWUFGO\YGKVGP&TKVVGNFGU0GWP\GJPVGP ,CJTJWPFGTVU $GK FGO /QPQITCOO FÒTHVG GU UKEJ WO GKP ' KP IQVJKUEJGT 5EJTKHV JCPFGNP YKGYQJNGUFGP&TWEM OWUVGTP FKGUGT 5EJTKHV PKEJV ICP\ GPVURTKEJV UKEJ CDGT CWEJ PKEJV CNU CPFGTGT $WEJUVCDG KFGPVKHK\KGTGP N·­V 5QOKV   MCPPGUUKEJWOGKP-TGW\FGU\YGKVGP/QFGNNUFGT1HHK\KGTU&KGPUVCWU\GKEJPWPIFGU*GT\QIVWO5CEJUGP#NVGPDWTI

OKV FGO /QPQITCOO *GT\QI 'TPUV +  UQ XGTNKGJGP \YKUEJGP  WPF  QFGT WO GKP -TGW\ FGU GTUVGP   /QFGNNU FGT 1HHK\KGTU&KGPUVCWU\GKEJPWPI FGU *GT\QIVWOU 5CEJUGP%QDWTI WPF )QVJC OKV FGO /QPQITCOO   *GT\QI 'TPUVU ++  UQ XGTNKGJGP \YKUEJGP  WPF  JCPFGNP &KG /GKPWPI FGU -CVCNQI#WVQTU VGPFKGTV CWH   ITWPF FGT #TV FGT #PHGTVKIWPI GJGT KP FKG 4KEJVWPI FC­ GU UKEJ JKGTDGK VCVU·EJNKEJ WO GKPG WO  JGTIGUVGNNVG   'TUVCWUHÒJTWPIFGT&KGPUVCWU\GKEJPWPIXQP5CEJUGP%QDWTIWPF)QVJCJCPFGNV

*'4<1)67/5#%*5'0#.6'0$74)   

*GT\QINKEJ 5CEJUGP'TPGUVKPKUEJGT *CWUQTFGP 8GTFKGPUVOGFCKNNG  /QFGNN OKV FGO 2QTVTCKV   *GT\QI 'TPUVU ++    )QNFGPG 8GTFKGPUVOGFCKNNG OKV 5EJYGTVGTP #WUHÒJTWPI QJPG   5VGORGNUEJPGKFGTUKIPCVWT QJPG 4CPFRWP\KGTWPI CO CNVGP LGFQEJ WPTKEJVKIGP $CPF FCTCWH FKG OKV   \YGK HNCEJGP 5RNKPVGP DGHGUVKIVGP 5EJYGTVGT OKV CNVGO 5COONWPIUGVKMGVV FGT 5COONWPI ( #NDGTV KP   'RKPCN1'- 444+p++



.CWV 0KOOGTIWV KP 0+// 5  IGNCPIVGP XQP FKGUGT /GFCKNNG PWT CEJV \WT 8GTNGKJWPI FCXQP HÒPH  WPF   FTGK

8085

8086

8087

5#%*5'0/'+0+0)'0*'4<1)67/   

8GTFKGPUVQTFGPHÒT-WPUVWPF9KUUGPUEJCHV/QFGNN TÒEMUGKVKIG+PUEJTKHV)'14)810  5KNDGT IGRT·IV VGKNYGKUGGOCKNNKGTVCOUR·VGTGP$CPF1'- ++





1TFGP HÒT 8GTFKGPUVG XQP (TCWGP WPF ,WPIHTCWGP KP FGT -TKGIUHÒTUQTIG $TQP\G CO CWH   -CTVQPUVÒEMCWHIGNGIVGO$CPF1'- ++



6*74070&6#:+5(ª456'067/ $+5 70&(ª456.+%*'(#/+.+' 

1TFGP FG RCTHCKVG COKVK¾  /QFGNN OKV /QPQITCOO # CWH FGT 4ÒEMUGKVG  UGKV     5COONGTCPHGTVKIWPIFGU4KVVGTMTGW\GUHÒT*GTTGPZOO5KNDGTIWUUXGTIQNFGVWPFGOCKNNKGTV IOGJTGTG'OCKNNGCWUDTÒEJGWPFTGRCTCVWTGPCWH8QTFGTWPF4ÒEMUGKVGQJPG$CPF +++ 5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGP GT ,CJTGP *GTXQTTCIGPFGU 'TUCV\GZGORNCT HÒT GKP PWT ·W­GTUV UEJYGT   GTJ·NVNKEJGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCT

30




DEUTSCHE STAATEN

8088 (1:1)

9#.&'%-70&2;4/1068'4'+0+)6'5 5'+6 (ª456'067/ $+5  

/KNKV·TXGTFKGPUVMTGW\-TGW\-NCUUG5KNDGTXGTIQNFGV8GTIQNFWPIVGKNYGKUGXGTICPIGP8QTFGTUGK VGPOGFCKNNQP)QNFGOCKNNKGTVICWHFGT4ÒEMUGKVGFGUWPVGTGP-TGW\CTOUMNGKPGT'OCKNNGEJKRCO UR·VGTGP$CPF1'- 44++p



)CTCPVKGTVGU \GKVIGPÌUUKUEJGU 1TKIKPCN .CWV 'HNGT KP '(9# 5   YWTFGP XQP  DKU  KPUIGUCOV    'ZGORNCTGXGTNKGJGPYQXQPPCEJFGO6QFFGU+PJCDGTU\WTÒEMIGIGDGPYQTFGPUKPF

8089 (1:1)

9ª466'/$'4)*'4<1)67/ $+5 -74(ª456'067/   70&-¤0+)4'+%*  

1TFGPFGT9ÒTVVGODGTIKUEJGP-TQPG)TQ­MTGW\)QNFHGKPUV\KUGNKGTVWPFGOCKNNKGTVQJPG5EJWNVGT DCPF1'- +



'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPG5COONWPICWUCNVGO#FGNUDG UKV\0T*GTXQTTCIGPFIGCTDGKVGVGUWPFHGKPUV\KUGNKGTVGUICTCPVKGTVGU1TKIKPCNGZGORNCT9QJNGKPG#PHGTVK IWPIFGT(KTOC'FWCTF(QGJTKP5VWVVICTVWO

31


DEUTSCHES REICH 1871-1918

8091

8093

8092

8090

&'765%*'54'+%* &'765%*'54'+%* 

5ÒFYGUVCHTKMC&GPMOÒP\GHÒT-·ORHGTOKVXGTUEJKGFGPGP)GHGEJVUURCPIGP$TQP\GCONCPIGP CNVGP GVYCU XGTH·TDVGP $CPF FCTCWH FKG )GHGEJVUURCPIGP -#.#*#4+   *'4'41.#0&   0747&#5 *71.7 -#7/+ )41550#$#5 #71$ 5';/174':2'&+6+10 61#5+5   1/#*'-'10)#0,+4#14#0,'WPF)41550#/#.#0&LGYGKNUOKVMWT\GPTWPFGPQFGTHNC EJGP5RNKPVGPOKVCNVGO5COONWPIUGVKMGVVFGT5COONWPI(#NDGTVKP'RKPCN 5VÒEM++



&'765%*'54'+%* 

5ÒFYGUVCHTKMC&GPMOÒP\G #WUICDG KP 5VCJN HÒT 0KEJV-·ORHGT 5VCJN CO NCPIGP \GKVIGPÌUUKUEJGP   1TKIKPCNDCPF1'- ++



-QNQPKCN&GPMOÒP\GHÒT-·ORHGTOKVXKGT)GHGEJVUURCPIGP$TQP\GCOCNVGP$CPFFCTCWHFKG)G HGEJVUURCPIGP 9#6'4$'4) &'765%*156#(4+-#  (#*.)4#5 WPF -#4#5$'4)'   LGYGKNUOKVMWT\GPTWPFGPQFGTNCPIGPHNCEJGP5RNKPVGPOKVCNVGO5COONWPIUGVKMGVVFGT5COONWPI( #NDGTVKP'RKPCN 5VÒEM++



&'765%*'54'+%*



&'765%*'54'+%*  32

8GTYWPFGVGPCD\GKEJGPHÒTFKG/CTKPG)QNFGPGU#D\GKEJGPJQJNIGRT·IVG#WUHÒJTWPI/GUUKPIDNGEJ XGTIQNFGV CWHFGT8QTFGTUGKVGDGTKGDGP CP0CFGN0+'/C1'- ++




DEUTSCHES REICH 1919-1933

8094

&'765%*'54'+%* 51)'09'+/#4'44'27$.+-  

)QGVJGOGFCKNNGHÒT-WPUVWPF9KUUGPUEJCHV0KEJVVTCIDCT5KNDGT&WTEJOGUUGTOOIOKV 5VGORGNUEJPGKFGT\GKEJGP 9  4 HÒT 9CNFGOCT 4CGOKUEJ  CWH FGO 4CPF 0COGPITCXWT *'+04+%*   7*.'0&#*. QJPG'VWK0+'/ 4++



&KG)QGVJGOGFCKNNGHÒT-WPUVWPF9KUUGPUEJCHVKUVCP)QGVJG U'KPJWPFGTVUVGO)GDWTVUVCICO/·T\XQP 4GKEJURT·UKFGPV 2CWN XQP *KPFGPDWTI IGUVKHVGV YQTFGP 7TURTÒPINKEJ IGFCEJV CNU #PGTMGPPWPI HÒT 2GTUQPGP FKG   UKEJ WO FKG )QGVJG)GFGPMHGKGT KP 9GKOCT  XGTFKGPV IGOCEJV JCVVGP YWTFG FKG ō)QGVJG/GFCKNNG HÒT -WPUV   WPF9KUUGPUEJCHVŋKP*KPFGPDWTIU0COGPCD#RTKNCWEJCPCPFGTG)QGVJGHQTUEJGT-ÒPUVNGT9KUUGPUEJCHVNGT $GCOVGWPF2QNKVKMGTXGTNKGJGP<YKUEJGPFGO/·T\WPFFGO,WPKYWTFGPMPCRR2GTUQPGP OKVFGT/GFCKNNGCWUIG\GKEJPGVXQTFGO,CPWCT7PVGTFGPGTUVGP'ORH·PIGTPFGT/GFCKNNGYCTGP WC 4GKEJUMCP\NGT *GKPTKEJ $TÒPKPI WPF FKG 0QDGNRTGKUVT·IGT )GTJCTV *CWRVOCPP WPF 6JQOCU /CPP #D #RTKN    HQNIVGP /CZ 2NCPEM WPF FKG FCOCNKIGP QFGT UR·VGTGP 0QDGNRTGKUVT·IGT 0KEJQNCU /WTTC[ $WVNGT #PFT¾ )KFG   -PWV *COUWP 8GTPGT XQP *GKFGPUVCO )WINKGNOQ /CTEQPK #NDGTV 5EJYGKV\GT (TKV\ *CDGT #NDTGEJV 2GPEM WPF   4KEJCTF 9KNNUV·VVGT #PFGTG 'ORH·PIGT YCTGP $GPKVQ /WUUQNKPK ,QU¾ 1TVGIC[)CUUGV9KNJGNO(WTVY·PINGT1VVQ -NGORGTGT(TCP\.GJ±T%CTN(TKGFTKEJ)QGTFGNGT2CWN'TPUV*CPU)TKOOWPF'TYKP)WKFQ-QNDGPJG[GT'VYC GKP 8KGTVGN FGT DKU ,WPK  OKV FGT ō)QGVJG/GFCKNNG HÒT -WPUV WPF 9KUUGPUEJCHVŋ #WUIG\GKEJPGVGP YCTGP #WU   N·PFGT (TCWGP YWTFGP MCWO DGTÒEMUKEJVKIV PWT 4KECTFC *WEJ #IPGU /KGIGN +PC 5GKFGN (GQFQTC )TQ­JGT\QIKP   XQP 5CEJUGP9GKOCT 'PTKEC XQP *CPFGN/C\GVVK WPF FKG VÒTMKUEJG 5EJTKHVUVGNNGTKP 5GPKJC $GFTK YWTFGP FGT /G   FCKNNG HÒT YÒTFKI DGHWPFGP &KG NGV\VG 8GTNGKJWPI FGT /GFCKNNG KP *KPFGPDWTIU 0COGP KUV FCVKGTV CWH FGP  ,WPK     &T*GKPTKEJ7JNGPFCJN  YCTUGKVCPFGT&GWVUEJGP$ÒEJGTGKKP.GKR\KIV·VKI'TDCWVGFCU5[UVGO FGT &GWVUEJGP 0CVKQPCNDKDNKQITCHKG CWH KP FGTGP XGTUEJKGFGPGP 4GKJGP FCU XQP FGT &GWVUEJGP $ÒEJGTGK OÌINKEJUV   XQNNUV·PFKI IGUCOOGNVG 5EJTKHVVWO FGT FGWVUEJURTCEJKIGP .·PFGT XGT\GKEJPGV YWTFG 8QP  DKU  YCT GT   UVGNNXGTVTGVGPFGT 8QTUKV\GPFGT FGU 8GTGKPU &GWVUEJGT $KDNKQVJGMCTG 9·JTGPF UGKPGT #OVU\GKV YWTFGP FGT $WEJDG   UVCPF WPF FKG &KGPUVNGKUVWPIGP FGT &GWVUEJGP $ÒEJGTGK UVGVKI CWUIGDCWV FKG <CJN FGT /KVCTDGKVGT UVKGI XQP  CWH    9·JTGPF FGU <YGKVGP 9GNVMTKGIGU MQPPVG GT FKG $GUV·PFG FGT $KDNKQVJGM FWTEJ TGEJV\GKVKIG #WUNCIGTWPI XQT   <GTUVÌTWPIGP DGYCJTGP +P FGT 0CEJMTKGIU\GKV IGJÌTVG GT KP FGT &&4 FGO 9KUUGPUEJCHVNKEJGP $GKTCV FGU $KDNKQ   VJGMUYGUGPUCPYWTFG.GKVGTFGT$KDNKQVJGMUMQOOKUUKQPHÒT$KDNKQITCRJKGWPF&QMWOGPVCVKQPWPFWPVGTUVCPFFGO 5VCCVUUGMTKV·T HÒT *QEJUEJWNYGUGP ÒDGTUVCPF GT FGP 8GTUWEJ GKPKIGT 5'&(WPMVKQP·TG KJP XQP UGKPGO   &KTGMVQTGPRQUVGP\WGPVHGTPGPUVCTDLGFQEJCPGKPGO*GT\KPHCTMV

8096

8097 8095



-QNQPKCN#D\GKEJGP UQIGP'NGRJCPVGPQTFGP 8GTUKNDGTVCP0CFGN0+'/

++



&'765%*'54'+%*(4'+-1425 

$CNVGPMTGW\ FGU $CNVKUEJGP 0CVKQPCN#WUUEJWUUGU $CNVGPMTGW\ CNU 5VGEMFGMQTCVKQP CWEJ IGP    -NCUUG $TQP\GVNYXGTIQNFGV#WHNCIGCWHFGT4ÒEMUGKVGOKV\YGK0KGVGPDGHGUVKIVCP0CFGN0+'/  ++



<GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCT



$CNVGPMTGW\ FGU $CNVKUEJGP 0CVKQPCN#WUUEJWUUGU $CNVGPMTGW\ CNU $CPFFGMQTCVKQP CWEJ IGP    -NCUUG $TQP\GVNYXGTIQNFGV#WHNCIGCWHFGT4ÒEMUGKVGOKV\YGK*QJNPKGVGPDGHGUVKIVCOCNVGP$CPF UVÒEM0+'/ ++



<GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCT

33


DEUTSCHES REICH 1919-1933

8099

8098



8100

/GFCKNNGFGT'KUGTPGP&KXKUKQP$TQP\GXGTUKNDGTVCOQTKIKPCNGP$CPF0+'/1'-  ++



&'765%*'54'+%*51.&#6'070&8'6'4#0'08'4$0&' 



'JTGPFGPMOÒP\GFGU4GKEJUMTKGIGTDWPFGU-[HHJ·WUGTHÒTFGP9GNVMTKGI5RCPIG QJPG FKG /GFCKNNG  OKV CWHIGNGIVGO $CPF OKV FTGK $CPFURCPIGP .+8.#0&  -74.#0&  WPF   &ª0# CP0CFGN ++



.CPFGUXGTDCPF$C[GTPKO&GWVUEJGP-TKGIGT$WPFG8$C[GTKUEJGU-TKGIUGTKPPGTWPIU MTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOPKEJVMQTTGMVGP$CPF0+'/ ++



8102

8101



8GTGKPKIWPI2TGW­KUEJGT-TKGIUVGKNPGJOGTKO&GWVUEJGP-TKGIGT$WPFG82TGW­KUEJGU 'JTGPMTGW\-NCUUGXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN0+'/C ++





7PDGMCPPVGU'JTGP\GKEJGP(ÒT8GTFKGPUVWPF6TGWGGKPGUFGWVUEJGP5QNFCVGPXGTDCPFGU&WTEJ OGUUGTOOXGTIQNFGVWPFGOCKNNKGTVCP0CFGN ++



8103 (1:1)

&'765%*'54'+%*(4'+56##670&4'27$.+-24'755'0   

34

4GVVWPIUOGFCKNNG CO $CPF  /QFGNN OKV FGT +PUEJTKHV 4'27$.+-  24'755'0      5KNDGT &WTEJOGUUGT OO  I QJPG $CPFTKPI  CP FGT QTKIKPCNGP &COGPUEJNGKHG \WUCOOGP OKV   8GTNGKJWPIUWTMWPFG HÒT FKG *CWUVQEJVGT %JTKUVKCPG 5RKGTQ CWU $GTNKP FCVKGTV $GTNKP  ,CPWCT    OKV 1TKIKPCNWPVGTUEJTKHV FGU RTGW­KUEJGP /KPKUVGTRT·UKFGPVGP 1VVQ $TCWP 52&   WPF FGU   RTGW­KUEJGP +PPGPOKPKUVGTU #NDGTV )T\GUKPUMK   OKV ITQ­GO 2T·IGUKGIGN FGU RTGW­KUEJGP   5VCCVUOKPKUVGTKWOUQDGPNKPMU$ÒTQMNCOOGTPHNGEMGP0+//1'- 444++




DEUTSCHES REICH 1933-1945 9+%*6+)'4*+09'+5  5QNCPIG UKEJ -WPFG WPF 8GTM·WHGT PKEJV IGIGPVGKNKI ·W­GTP XGTUKEJGTP UKG FCUU UKG )GIGPUV·PFG WPF   $ÒEJGTCWUFGT<GKVFGU&GWVUEJGP4GKEJGUXQPDKUPWT\W<YGEMGPFGTUVCCVUDÒTIGTNKEJGP #WHMN·TWPI FGT #DYGJT XGTHCUUWPIUYKFTKIGT $GUVTGDWPIGP FGT -WPUV QFGT FGT 9KUUGPUEJCHV FGT   (QTUEJWPIQFGTFGT.GJTGFGT$GTKEJVGTUVCVVWPIÒDGT8QTI·PIGFGU<GKVIGUEJGJGPUQFGTFGT)GUEJKEJVG QFGT ·JPNKEJGP <YGEMGP GTYGTDGP &KGUG )GIGPUV·PFG WPF $ÒEJGT YGTFGP ITWPFU·V\NKEJ PWT WPVGT   FKGUGP8QTCWUUGV\WPIGPCPIGDQVGPWPFCDIGIGDGP  5QOKV UVGNNV FGT 'TYGTD XQP )GIGPUV·PFGP WPF $ÒEJGTP CWU FKGUGT <GKV WPVGT FGP QDGP CWHIGHÒJTVGP   8QTCWUUGV\WPIGPIGO·­FGThhC#DUD\Y#DU5V)$MGKPGP5VTCHVCVDGUVCPFKO5KPPGFGUh C #DU  5V)$ FCT 7PVGT FKGUGP 7OUV·PFGP KUV GU CNUQ ITWPFU·V\NKEJ GTNCWDV 1TFGP WPF 'JTGP\GK   EJGPFKGKPh#DU)GUGV\ÒDGT6KVGN1TFGPWPF'JTGP\GKEJGPPKEJVCWHIGHÒJTVUKPFUQYKG#D\GK EJGP OKV PCVKQPCNUQ\KCNKUVKUEJGP 'ODNGOGP \W XGTMCWHGP WPF \W GTYGTDGP WPF FKGU GPVIGIGP FGP $G   UVKOOWPIGPFGUh#DU)GUGV\ÒDGT6KVGN1TFGPWPF'JTGP\GKEJGP  &GUJCND JCV FGT $WPFGUOKPKUVGT FGT ,WUVK\ OKV 5EJTGKDGP  ++  XQO  FGO   UGKPGT\GKVKIGP 8QTUKV\GPFGP FGU $WPFGU FGWVUEJGT 1TFGPUUCOONGT G 8 CWUFTÒEMNKEJ GTMN·TV FCUU FGT   'TYGTDXQP1TFGPWPF'JTGP\GKEJGPCWUFGT<GKVFGUUQIGPCPPVGPō&TKVVGP4GKEJGUŋFWTEJGTPUVJCHVG WPFQTICPKUKGTVG5COONGTOKVFGO<KGNFKGUGP)GIGPUVCPFKPGKPG5COONWPIGKP\WHÒIGPMGKPGP5VTCH VCVDGUVCPFKO5KPPGFGU)GUGV\GUFCTUVGNNV #WHITWPFGZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÒTFKG1DLGMVGFGU&GWVUEJGP4GKEJGU  UQIGPCPPVGU&TKVVGU4GKEJ NGKFGTMGKPG)GY·JTHÒT1TKIKPCNKV·VIGIGDGPYGTFGP&GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV

&'765%*'54'+%* 51)'0&4+66'54'+%*  









   

 

8GTFKGPUVQTFGP XQO &GWVUEJGP #FNGT DKU   D\Y &GWVUEJGT #FNGTQTFGP -NGKPQF \WO )TQ­   MTGW\#WUHÒJTWPI OKV#ITCHHGCD ZOO5KNDGTXGTIQNFGVWPFGOCKNNKGTVI KO4KPIRWP\KGTVQJPG5EJWNVGTDCPF-&1'0+'/C1'- 44++



8GTFKGPUVQTFGPXQO&GWVUEJGP#FNGT DKU D\Y&GWVUEJGT#FNGTQTFGP$TWUVUVGTP\WO)TQ­ MTGW\D\YCD\WT-NCUUGZOO5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVI CWH FGT 4ÒEMUGKVG UKPF \YGK *QJNPKGVGP UKEJVDCT CP 0CFGN FKGUG RWP\KGTV  -&1'  0+'/   E1'- 44++  8GTFKGPUVQTFGP XQO &GWVUEJGP #FNGT DKU   D\Y &GWVUEJGT #FNGTQTFGP$TWUVUVGTP\WO8GT FKGPUVMTGW\OKVFGO5VGTPD\YCD\WT-NCUUGZOO5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTV  I CWH FGT 4ÒEMUGKVG UKPF \YGK *QJNPKGVGP UKEJVDCT CP 0CFGN FKGUG RWP\KGTV    -&1'0+'/E1'- ++  8GTFKGPUVQTFGP XQO &GWVUEJGP #FNGT DKU   D\Y &GWVUEJGT #FNGTQTFGP  /QFGNN      8GTFKGPUVMTGW\  5VWHG CD   -NCUUG #WUHÒJTWPI OKV #ITCHHG  5KNDGT XGTIQNFGV WPF   GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK <WUCOOGP OKV   FGT QTKIKPCNGP 8GTNGKJWPIUWTMWPFG HÒT &T +YCP #RQUVQNQHH &GMCP FGT 4GEJVUHCMWNV·V FGT 7PKXGTUKV·V   5QXKC FCVKGTV $GTNKP CO  #WIWUV  OKV ITQ­GO 2T·IGUKGIGP WPF 7PVGTUEJTKHVGP # *KVNGT  

1TKIKPCNKV·V PKEJV IGRTÒHV  WPF /GKUUPGT KP &QMWOGPVGPOCRRG UQYKG *GHV OKV FGT 8GTQTFPWPI WPF   5CV\WPI0+'/C1'- ++  8GTFKGPUVQTFGP XQO &GWVUEJGP #FNGT DKU   D\Y &GWVUEJGT #FNGTQTFGP  /QFGNN     8GTFKGPUVMTGW\5VWHG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGOKV5KNDGTRWP\G KO QTKIKPCNGP OKP QDGTHN·EJNKEJ DGUEJ·FKIVGP 8GTNGKJWPIUGVWK -&1'  0+'/ C   1'- ++  'JTGP\GKEJGP XQO  0QXGODGT  UQIGPCPPVGT $NWVQTFGP 5COONGTCPHGTVKIWPI GKPGT /GFCKNNG   FGT\YGKVGP#WUICDG5KNDGTCWHFGT4ÒEMUGKVGRWP\KGTVRWP\KGTVG6T·IGTPWOOGTCO$CPF ++  &GWVUEJGU4GKVGTCD\GKEJGP4GKVGTCD\GKEJGPKP)QNF$WPVOGVCNNXGTIQNFGVCWHFGT4ÒEMUGKVG*GTUVGN NGTDG\GKEJPWPI FGT (KTOC . %JT .CWGT KP 0ÒTPDGTI WPF $GTNKP CP 0CFGN \WUCOOGP OKV   /KPKCVWTPCFGN0+'/C 5VÒEM++p  &GWVUEJGU4GKVGTCD\GKEJGP4GKVGTCD\GKEJGPKP5KNDGT5KNDGTCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI FGT(KTOC.%JT.CWGTKP0ÒTPDGTIWPF$GTNKPWPF5KNDGTRWP\GCP0CFGN0+'/D ++ &GWVUEJGU 4GKVGTCD\GKEJGP 4GKVGTCD\GKEJGP KP $TQP\G $TQP\G CWH FGT 4ÒEMUGKVG *GTUVGNNGT   DG\GKEJPWPIFGT(KTOC.%JT.CWGTKP0ÒTPDGTIWPF$GTNKPCP0CFGN\WUCOOGPOKV/KPKCVWTPCFGN KP QTKIKPCNGT ITÒPGT WPF UEJYCT\ DG\GKEJPGVGT 5EJCEJVGN FKG 2CRRGKPNCIG IGTKUUGP 0+'/  E   5VÒEM++

 



&GWVUEJGU(CJTGTCD\GKEJGP(CJTGTCD\GKEJGPKP)QNF$WPVOGVCNNXGTIQNFGV8GTIQNFWPICWHFGT8QT FGTUGKVGUVCTMXGTICPIGPCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC.%JT.CWGTKP0ÒTPDGTI WPF$GTNKPCP0CFGN0+'/C ++p+++



'JTGP\GKEJGPFGT6GEJPKUEJGP0QVJKNHG#WUICDGOKVFGT,CJTGU\CJN$WPVOGVCNNVGKNYGKUGXGTUKN DGTVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG/CVTKMGNPWOOGTCP0CFGNFKGUGOKV*GTUVGNNGTDG\GKEJPWPI FGT(KTOC9KNJGNO(ÒJPGTKP2HQT\JGKO1'- ++

 35


DEUTSCHES REICH 1933-1945 

5RCPKGPMTGW\KP5KNDGTOKV5EJYGTVGTP5KNDGTCP0CFGNFCTCWHWPXQNNUV·PFKIG.0WOOGT0+'/  ++





1TFGPFGU'KUGTPGP-TGW\GU  5QIGP5QWXCN(·NUEJWPIFGU4KVVGTMTGW\GUFGU'KUGTPGP-TGW\GU 'KUGPIGUEJY·T\V5KNDGT\CTIGWPVGTFGT¤UGDGKFUGKVKISWCFTCVKUEJGGT5KNDGTRWP\GOKV*CNUDCPFCD UEJPKVV ++



1TFGP FGU 'KUGTPGP -TGW\GU   'KUGTPGU -TGW\  -NCUUG HNCEJG #WUHÒJTWPI 'KUGPMGTP  

OCIPGVKUEJ  OCVV NCEMKGTV OKP CDIGRNCV\V  <CTIG XGTUKNDGTV CP 0CFGN FKGUG CWH FGT 7PVGTUGKVG OKV   *GTUVGNNGTRWP\G.FGT(KTOC%(<KOOGTOCPPKP2HQT\JGKORWP\KGTV0+'/F ++



1TFGPFGU'KUGTPGP-TGW\GU  'KUGTPGU-TGW\-NCUUGHNCEJG#WUHÒJTWPIOKV5EJTCWDUEJGKDG 'KUGPMGTP OCIPGVKUEJ  OCVV NCEMKGTV VGKNYGKUG CDIGRNCV\V  <CTIG XGTUKNDGTV CWH FGT 4ÒEMUGKVG   *CNVGFQTPCP5EJTCWDUEJGKDGOKV*GTUVGNNGTOCTMG.FGT(KTOC)NCUGTW5ÌJPGKP&TGUFGP0+'/ H ++



1TFGP FGU 'KUGTPGP -TGW\GU   'KUGTPGU -TGW\  -NCUUG HNCEJG #WUHÒJTWPI 'KUGPMGTP  

OCIPGVKUEJ OCVVNCEMKGTV VGKNYGKUGCDIGRNCV\V <CTIGXGTUKNDGTVCP0CFGNFKGUGCWHFGT7PVGTUGKVGOKV *GTUVGNNGTRWP\GFGT(KTOC%(<KOOGTOCPPKP2HQT\JGKORWP\KGTV0+'/F ++



1TFGPFGU'KUGTPGP-TGW\GU  'KUGTPGU-TGW\-NCUUGHNCEJG#WUHÒJTWPIOKV5EJTCWDUEJGKDG 'KUGPMGTP OCIPGVKUEJ  OCVV NCEMKGTV VGKNYGKUG CDIGRNCV\V  <CTIG XGTUKNDGTV CWH FGT 4ÒEMUGKVG   *CNVGFQTPCP5EJTCWDUEJGKDGOKV*GTUVGNNGTOCTMG.FGT(KTOC)NCUGTW5ÌJPGKP&TGUFGP0+'/ H ++



1TFGPFGU'KUGTPGP-TGW\GU  9KGFGTJQNWPIUURCPIG\WO'KUGTPGP-TGW\-NCUUG\YGKVG #WUHÒJTWPI$WPVOGVCNNXGTUKNDGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\G.FGT(KTOC9KNJGNO&GWOGT KP .ÒFGPUEJGKF CP TWPFGT 0CFGN &C\W 9KGFGTJQNWPIUURCPIG \WO 'KUGTPGP -TGW\   -NCUUG   \YGKVG #WUHÒJTWPI $WPVOGVCNN XGTUKNDGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTRWP\G . FGT (KTOC $ *   /C[GT -WPUVRT·IGCPUVCNV KP 2HQT\JGKO OKV XKGT HNCEJGP 5RNKPVGP 0+'/  D  D   5VÒEM++



1TFGPFGU'KUGTPGP-TGW\GU  9KGFGTJQNWPIUURCPIG\WO'KUGTPGP-TGW\-NCUUG\YGKVG #WUHÒJTWPI $WPVOGVCNNXGTUKNDGTV8GTUKNDGTWPIDGTKGDGPCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\G.FGT (KTOC(WPM$TÒPKPIJCWUKP.ÒFGPUEJGKFCP0CFGN0+'/D ++





1TFGPFGU-TKGIUXGTFKGPUVMTGW\GU  <YGKVCPHGTVKIWPI PCEJ FGU4KVVGTMTGW\GUFGU-TKGIU XGTFKGPUVMTGW\GU OKV 5EJYGTVGTP 5KNDGT CWH FGO 4CPF FGU TGEJVGP 5GKVGPCTOU RWP\KGTV  CO   MQPHGMVKQPKGTVGP*CNUDCPFKPGKPGO·NVGTGP8GTNGKJWPIUGVWK&C\W-TKGIXGTFKGPUVMTGW\-NCUUG QJPG 5EJYGTVGT $TQP\GQJPG$CPF ++





5EJPGNNDQQV-TKGIUCD\GKEJGP  /QFGNN <KPM VNY XGTIQNFGV 8GTUKNDGTWPI XGTICPIGP VGKNYGKUG IG   UEJY·T\V CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI ('% 9 ' 2''-*#75 $'4.+0  #75(   5%*9'4+0 $'4.+0  OKV JQTK\QPVCNGT HNCEJGT DCWEJKIGT 0CFGN WPF $GHGUVKIWPIUJCMGP CWH FGT   4ÒEMUGKVGFGU#FNGTU-&1'0+'/C1'- ++p+++



7$QQV-TKGIUCD\GKEJGP<KPMFKG8GTIQNFWPIXQNNUV·PFKIXGTICPIGPCWHFGT4ÒEMUGKVG*GTUVGNNGTDG \GKEJPWPIHQCPJQTK\QPVCNCPIGDTCEJVGTTWPFGT0CFGN-&1'0+'/F1'- +++



7$QQV(TQPVURCPIG(TQPVURCPIGKP5KNDGT<KPMXGTUKNDGTV8GTUKNDGTWPIVGKNYGKUGXGTICPIGPCWHFGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI'06974(2''-*#75#75(5%*9'4+0$'4.+0OKVHNC EJGTDCWEJKIGTWPFIGMGJNVGT0CFGN-&1'0+'/C1'- 4+++



















&KG4ÒEMUGKVGFGU'ZGORNCTUGPVURTKEJVKPCNNGP&GVCKNUFGTWPVGTUVGP#DDKNFWPICWH5GKVG



#WU\GKEJPWPIU-QPXQNWV 'KUGTPGU-TGW\-NCUUGCWHFGT4ÒEMUGKVGRWP\KGTV.CP0CFGNKO QTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC2CWN/G[DCWGTKP$GTNKP8GTUEJNW­DGUEJ·FKIV 'KUGTPGU-TGW\  -NCUUG  CO $CPF   5#5RQTV#D\GKEJGP KP $TQP\G  6[R CWH FGT 4ÒEMUGKVG *GTUVGNNGT   DG\GKEJPWPI FGT (KTOC $GTI  0QNVG #) KP .ÒFGPUEJGKF '+)'067/ & 5#52146#$<'+%    *#72656'..'WPF6T·IGTPWOOGTCP0CFGN /GFCKNNG<WT'TKPPGTWPICPFGP1MVQDGT CO$CPF 'JTGPMTGW\FGU9GNVMTKGIUHÒT-TKGIUVGKNPGJOGTQJPG$CPF 7$QQV -TKGIUCD\GKEJGP <KPM FKG 8GTIQNFWPI PCJG\W XQNNUV·PFKI XGTICPIGP CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG   \GKEJPWPI HQ CP JQTK\QPVCN CPIGDTCEJVGT TWPFGT 0CFGN   'KP YGKVGTGU 'ZGORNCT <KPM FKG   8GTIQNFWPIPCJG\WXQNNUV·PFKIXGTICPIGPQJPG*GTUVGNNGTDG\GKEJPWPICPXGTVKMCNCPIGDTCEJVGTHNCEJGT DCWEJKIGT 0CFGN   'KP YGKVGTGU 'ZGORNCT $WPVOGVCNN XGTIQNFGV QJPG *GTUVGNNGTDG\GKEJPWPI CP   XGTVKMCN CPIGDTCEJVGT UKNDGTHCTDGPGT HNCEJGT DCWEJKIGT 0CFGN   -TKGIUCD\GKEJGP HÒT /KPGPUWEJ 7   $QQV,CIF WPF 5KEJGTWPIUXGTD·PFG $WPVOGVCNN XGTUKNDGTV VGKNYGKUG XGTIQNFGV QJPG *GTUVGNNGT   DG\GKEJPWPICPJQTK\QPVCNCPIGDTCEJVGTHNCEJGTDCWEJKIGT0CFGNCWHFGT4ÒEMUGKVGFGU*CMGPMTGW\GU $GHGUVKIWPIUJCMGP   'KP YGKVGTGU 'ZGORNCT XGTUKNDGTV VGKNYGKUG XGTIQNFGV QJPG *GTUVGNNGT   DG\GKEJPWPICPXGTVKMCNCPIGDTCEJVGTTWPFGT0CFGN /KPKCVWTCD\GKEJGPJKGT\WXGTIQNFGVVGKNYGKUG XGTUKNDGTVCP0CFGN 5VÒEM++



(TQPVHNWIURCPIGHÒT-CORHHNKGIGT(TQPVHNWIURCPIGKP$TQP\G$WPVOGVCNNVGKNYGKUGIGUEJY·T\VQJPG *GTUVGNNGTDG\GKEJPWPI CP 0CFGN KO QTKIKPCNGP FWPMGNDNCWGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGT #WH   UEJTKHV(TQPVHNWIURCPIGHÒT#WHMN·TGTDTQP\G UKE 0+'/G ++



*KGTDGKJCPFGNVGUUKEJJKGTDGKWOFGP#WU\GKEJPWPIUPCEJNCUUGKPGU-TKGIUVGKNPGJOGTUFGT7$QQV9CHHG



36


BUNDESREPUBLIK DEUTSCHLAND 

  

7OICPITGKEJGT 0CEJNCUU FGU .GWVPCPVU FGT  5VCHHGN FGU -CORHIGUEJYCFGTU  9CNVGT &KNEJGT  

IGHCNNGP   $GUVGJGPF CWU   $GQDCEJVGT#D\GKEJGP $WPVOGVCNN VGKNYGKUG XGTUKNDGTV CWH FGT   4ÒEMUGKVG FGU #FNGTU *GTUVGNNGTDG\GKEJPWPI 9 &'7/'4  .ª&'05%*'+& CP TWPFGT 0CFGN KO   'VWK OKV #WHUEJTKHV $GQDCE+ GT OKV 8GTNGKJWPIUWTMWPFG   'KUGTPGU -TGW\  + -NCUUG QJPG   *GTUVGNNGTDG\GKEJPWPI CP 0CFGN KO UKNDGTDGFTWEMVGP 8GTNGKJWPIUGVWK   'KUGTPGU -TGW\  ++   -NCUUGCONCPIGP$CPFKP8GTNGKJWPIUVÒVGOKVXQTN·WHKIGO$GUKV\\GWIPKUWPF8GTNGKJWPIUWTMWPFG 5# 9GJTCD\GKEJGP KP $TQP\G CWH FGT 4ÒEMUGKVG +PUEJTKHV '+)'067/&%*'(5&#75$+.&70)5 9'5'05  $100'4  -7056#$<  $'&#4(  $100 C 4* OKV /CVTKMGNPWOOGT  CP   0CFGN   4GKEJUURQTVCD\GKEJGP KP $TQP\G TÒEMUGKVKIG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 9GTPUVGKP KP   ,GPCCP0CFGN 2NCMGVVGHÒTFKG6GKNPGJOGTFGU05(-&GWVUEJNCPFHNWIGUOKV$GUKV\WTMWPFG KO 1TKIKPCNGVWK   #D\GKEJGP FGU 05(-&GWVUEJNCPFHNWIGU < XGTUKNDGTV WPF GOCKNNKGTV CWH FGT   4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC $TGJOGT KP/CTMPGWMKTEJGPCP0CFGN 'JTGPMTGW\FGT &GWVUEJGP /WVVGT KP $TQP\G \YGKVGU /QFGNN KP FGT 8GTNGKJWPIUVÒVG XQP ,CMQD $GPIGN KP +FCT   1DGTUVGKP &TGK2CCT-TCIGPURKGIGNGKPGU.GWVPCPVUFGT.WHVYCHHGOKV\WIGJÌTKIGP5EJWNVGTUVÒEMGP UQYKG GKP IGUVKEMVGT .WHVYCHHGPCFNGT   5KNDGT\KRHGN   <WUCOOGP OKV OGJTGTGP 2JQVQCNDGP OKV   \CJNTGKEJGP 2JQVQU CWU FGO <YGKVGP 9GNVMTKGI XKGNGP <GKVWPIUCWUUEJKVVGP &KGPUVDÒEJGT   HNWIVGEJPKUEJG #PNGKVWPIGP WPF (CEJNKVGTCVWT WP\·JNKIG RGTUÌPNKEJG &QMWOGPVG WPF 7PVGTNCIGP +P   WPVGTUEJKGFNKEJGP<WUVCPF 5VÒEM++++p+++  6CRHGTMGKVUWPF8GTFKGPUVCWU\GKEJPWPIHÒT#PIGJÌTKIGFGT1UVXÌNMGT#WUHÒJTWPIHÒT6CRHGTMGKV OKV 5EJYGTVGTP -NCUUG 5VGEMFGMQTCVKQP KP)QNF<KPMXGTIQNFGVGVYCUDGTKGDGPCP0CFGNFKGUGRWP\KGT . HÒTFKG(KTOC)NCUGT5ÌJPGKP&TGUFGP -&1'0+'/C1'- ++  -QPXQNWV XQP  #WU\GKEJPWPIGP 1TKIKPCNGZGORNCTG (·NUEJWPIGP WPF 5COONGTCPHGTVKIWPI KP XGT   UEJKGFGPGP/GVCNNGPVGKNUXGTUKNDGTVVGKNUXGTIQNFGVVGKNUGOCKNNKGTVVGKNUCP0CFGNPVGKNUCP$·PFGTPKP WPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++  .GGTGUITÒPGU.&1'VWKHÒTGKP5VGEMCD\GKEJGP

++



&'765%*'54'+%* #75(ª*470)  

'JTGP\GKEJGP FGU &GWVUEJGP 4QVGP -TGW\GU 'JTGP\GKEJGP  -NCUUG XGTIQNFGV WPF GOCKNNKGTV CO   *CNUDCPFCDUEJPKVVKORCUUGPFGP'VWKFGT(KTOC)QFGVKP$GTNKP-&1' ++



$70&'54'27$.+-&'765%*.#0& 5'+6  9+%*6+)'4*+09'+5  1TFGP WPF 'JTGP\GKEJGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF WPF KJTGT $WPFGUN·PFGT GDGPUQ YKG FGTGP   /KPKCVWTGP$CPFUVGIG-PQRHNQEJUEJNGKHGPWPF$CPFUEJPCNNGPFÒTHGPIGO·­h#DU)GUGV\ÒDGT 6KVGN 1TFGP WPF 'JTGP\GKEJGP PWT CP $GTGEJVKIVG CDIGIGDGP YGTFGP #NU $GTGEJVKIVG IGNVGP JKGTDGK   PGDGP FGP $GNKGJGPGP CWEJ CNNG FKGLGPKIGP 2GTUQPGP FKG KO $GUKV\ GKPGT 5COOGNIGPGJOKIWPI UKPF   &KGUG5COOGNIGPGJOKIWPIGTVGKNVCWH#PHTCIGFKGLGYGKNU\WUV·PFKIG$GJÌTFG &KG<WUV·PFKIMGKVKUVKP FGPGKP\GNPGP$WPFGUN·PFGTPWPVGTUEJKGFNKEJIGTGIGNV &KG'TVGKNWPIGKPGTUQNEJGP)GPGJOKIWPIMCPP IGO·­ FGU -QOOGPVCTU \WO )GUGV\ XQP FGT \WUV·PFKIGP $GJÌTFGPWTDGK8QTNKGIGPUEJYGTYKGIGPFGT   )TÒPFGXGTYGKIGTVYGTFGP/KVGKPGO)GDQVCWH1TFGPWPF'JTGP\GKEJGPFGT$WPFGUTGRWDNKMWPFKJTGT $WPFGUN·PFGTXGTUKEJGTVFGT$KGVGTKOQTFPWPIUIGO·­GP$GUKV\GKPGTUQNEJGP5COOGNIGPGJOKIWPI\WUGKP

8134



8GTFKGPUVQTFGPFGT$WPFGUTGRWDNKM&GWVUEJNCPF5GVFGU)TQ­MTGW\GUDGUVGJGPFCWU-NGKPQFZ OO$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFOKVGKPIGYGDVGP PKEJVIGUVKEM VGP N·PINKEJGP$WPFGUCFNGTPWPF$TWUVUVGTP&WTEJOOO5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKN NKGTVCP0CFGNFKGUGOKV*GTUVGNNGTDG\GKEJPWPI5V.WPF5KNDGTRWP\G\WUCOOGPOKV$CPFUVGI OKV#WHNCIGKOUGRCTCVGP5EJ·EJVGNEJGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC5VGKPJCWGT.ÒEMKP .ÒFGPUEJGKFOKVIQNFGPIGFTWEMVGO$WPFGUCFNGT#&'05$74-'5HH1#0 5#..581.2'55#.. 5VÒEM+p++

&GT 8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF CWEJ $WPFGUXGTFKGPUVQTFGP IGPCPPV  YWTFG XQP $WPFGURT·UK   FGPV 6JGQFQT *GWUU OKV 'TNCUU XQO  5GRVGODGT  CNU \WP·EJUV HÒPHMNCUUKIGT CNNIGOGKPGT 8GTFKGPUVQTFGP   IGUVKHVGV8GTUEJKGFGPGPFGTWPIGPKPFGP,CJTGPWPFHÒJTVGP\WOKVVNGTYGKNGPGWP-NCUUGP



37


BUNDESREPUBLIK DEUTSCHLAND

8135 (1:1)



8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF 5GV FGU )TQ­GP 8GTFKGPUVMTGW\GU OKV 5VGTP WPF   5EJWNVGTDCPFDGUVGJGPFCWU-NGKPQFZOO$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP  Z  OO 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CP 0CFGN   FKGUGOKV*GTUVGNNGTDG\GKEJPWPI5V.WPF5KNDGTRWP\G\WUCOOGPOKV$CPFUVGIOKV#WHNCIG KO UGRCTCVGP 5EJ·EJVGNEJGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC 5VGKPJCWGT  .ÒEM KP   .ÒFGPUEJGKFOKVIQNFGPIGFTWEMVGO$WPFGUCFNGT5#.. 5VÒEM+p++



8136 (1:1)



8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM&GWVUEJNCPF5GVFGU)TQ­GP8GTFKGPUVMTGW\GUOKV5VGTPDGUVG JGPF CWU )TQ­GU 8GTFKGPUVMTGW\ XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF OKV /GVCNNUEJNKG­GP WPF   $TWUVUVGTP 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV CP 0CFGN FKGUG OKV *GTUVGNNGTRWP\G 5V. WPF   5KNDGTRWP\G\WUCOOGPOKV-PQRHNQEJTQUGVVGWPF4GXGTUCD\GKEJGPKOQTKIKPCNGPOKVIQNFHCTDGPGO $WPFGUCFNGTDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC5VGKPJCWUWPF.ÒEMKP.ÒFGPUEJGKF<WUCOOGPOKV FGTQTKIKPCNGP8GTNGKJWPIUWTMWPFGHÒTFGPHTCP\ÌUKUEJGP)GPGTCN/KEJGN(QWTSWGV)GPGTCNUVCDUEJGHFGT HTCP\ÌUKUEJGP 5VTGKVMT·HVG FCVKGTV $QPP CO  #RTKN  OKV ITQ­GO 2T·IGUKGIGN WPF   1TKIKPCNWPVGTUEJTKHV XQP $WPFGURT·UKFGPV *GKPPGOCPP KP FGT &QMWOGPVGPOCRRG OKV IQNFHCTDGPGO   $WPFGUCFNGT5#.. 5VÒEM4+p++ 5GNVGPG 8GTNGKJWPI CP GKPGP JQJGP CWUN·PFKUEJGP )GPGTCN  /KEJGN /CTVKP .¾QP (QWTSWGV   YCT 1HHK   \KGT KP FGP .WHVUVTGKVMT·HVGP FGU (TGKGP (TCPMTGKEJ KP .QPFQP UR·VGT )GPGTCN FGT HTCP\ÌUKUEJGP .WHVYCHHG 8QP   DKUYCTGT%JGHFGU)GPGTCNUVCDGUFGTHTCP\ÌUKUEJGP5VTGKVMT·HVG'TYCTWC)TQ­MTGW\FGU0CVKQPCNGP 1TFGPUFGT'JTGPNGIKQPWPF+PJCDGTFGU1TFGPUFGT$GHTGKWPI

38




BUNDESREPUBLIK DEUTSCHLAND

8139

8137



8138

8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF )TQ­GU 8GTFKGPUVMTGW\ XGTIQNFGV WPF GOCKNNKGTV   CO*CNUDCPFOKV/GVCNNUEJNKG­GPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%',WPEMGTKP$GTNKPOKV IQNFGPIGFTWEMVGO$WPFGUCFNGT-&1'5#.. ++



8QPFKGUGO*GTUVGNNGTPKEJVJ·WHKI\WHKPFGP'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5 KP$CUGNCOWPF0QXGODGT.QV0T



8GTFKGPUVQTFGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF )TQ­GU 8GTFKGPUVMTGW\ XGTIQNFGV WPF GOCKNNKGTV   CO*CNUDCPFOKV/GVCNNUEJNKG­GP-&1'5#.. ++





8GTFKGPUVQTFGPFGT$WPFGUTGRWDNKM&GWVUEJNCPF8GTFKGPUVMTGW\-NCUUGHÒT*GTTGPXGTIQNFGVWPF GOCKNNKGTVCP0CFGN-&1'5.. +p++





$WPFGUXGTFKGPUVQTFGP.GGTGU'VWK\WO8GTFKGPUVMTGW\-NCUUGHÒT*GTTGPQJPGDGUQPFGTG#WUURC TWPIHÒTFCU4GXGTUCD\GKEJGPXQP5VGKPJCWGT.ÒEMKP.ÒFGPUEJGKFFC\WFTGKYGKVGTGNGGTG'VWKUHÒT PKEJVVTCIDCTG/GFCKNNGP ++





$CNNGK$TCPFGPDWTIFGU,QJCPPKVGTQTFGPU.GGTGU'VWKHÒTGKP-TGW\FGT4GEJVUQFGT'JTGPTKVVGTFGU ,QJCPPKVGTQTFGPULÒPIGTGITÌ­GTG#WUHÒJTWPI ++





$CNNGK$TCPFGPDWTIFGU,QJCPPKVGTQTFGPU.GGTGU'VWKHÒTGKP-TGW\FGT'JTGPTKVVGTFGU,QJCPPKVGTQT FGPU·NVGTG#WUHÒJTWPI ++





$CNNGK$TCPFGPDWTIFGU,QJCPPKVGTQTFGPU.GGTGU'VWKHÒTGKP-TGW\FGT'JTGPTKVVGTFGU,QJCPPKVGTQT FGPULÒPIGTGMNGKPG#WUHÒJTWPI ++



ex 8144





8145

-QPXQNWV XQP GNH XGTUEJKGFGPGP 1TFGP WPF 'JTGP\GKEJGP FGT $WPFGUTGRWDNKM &GWVUEJNCPF FGP   $WPFGUN·PFGTPWPFFGU&GWVUEJGP4GKEJGUKPFGTGT#WUHÒJTWPI&CTWPVGTWC'JTGPMTGW\FGT $WPFGUYGJT  #WUHÒJTWPI  6*9'JTGP\GKEJGP KP )QNF WPF 5KNDGT 5CCTN·PFKUEJGT 8GTFKGPUVQTFGP   WPF0KGFGTU·EJUKUEJGT8GTFKGPUVQTFGPCWEJ\YGK*CNUQTFGP8GTUEJKGFGPG/GVCNNGVGKNUXGTIQNFGVVGKNU XGTUKNDGTVVGKNUGOCKNNKGTVCP$·PFGTPD\YCP0CFGNPKPQTFGPVNKEJGP'TJCNVWPIGP 5VÒEM++



&CPM WPF #PGTMGPPWPIU/GFCKNNG FGU GTUVGP $WPFGUMCP\NGTU &T -QPTCF #FGPCWGT CWU #PNCUU   UGKPGU)GDWTVUVCIUCO,CPWCT0KEJVVTCIDCT&WTEJOGUUGTOO$TQP\GXGTUKNDGTVKO 1TKIKPCNGVWK ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV 0T7TURTÒPINKEJXGTNKGJGPCP5VCCVUUGMTGV·T2TQH&T9CNVGT*CNNUVGKP  

39


DEUTSCHLAND - ORDENSSCHNALLEN 

-QPXQNWVXQPFTGK#PPCJOGIGPGJOKIWPIGPFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFTGKCWUN·PFK UEJG 1TFGP (ÒT FGP .GICVKQPUTCV D\Y 1DGTTGIKGTWPIUTCV *GNOWV /ÒNNGT   )TQ­DTKVCPPKGP   -ÌPKINKEJGT 8KMVQTKC1TFGP  -NCUUG FCVKGTV  0QXGODGT    ,CRCP 1TFGP FGU JGKNKIGP   5EJCV\GU  -NCUUG FCVKGTV  /·T\    )TQ­DTKVCPPKGP -ÌPKINKEJGT 8KMVQTKC1TFGP   -QOOCPFGWTMTGW\FCVKGTV,WNK&C\W8GT\GKEJPKUXQP\YKUEJGPWPFCP/ÒNNGT XGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT ++



$70&'54'27$.+-&'765%*.#0&$70&'5.#0&$#&'09ª466'/$'4)

5'+6 

8147



8GTFKGPUVOGFCKNNGFGU.CPFGU$CFGP9ÒTVVGODGTI#WUHÒJTWPI  )QNFKO4CPFRWP \KGTVCO$CPFOKV0CFGN5#.. 4++



+P FKGUGT GTUVGP #WUHÒJTWPI UGNVGP #D  YWTFG FKG 8GTFKGPUVOGFCKNNG PWT PQEJ KP GT )QNF CWUIGHÒJTV WPF   FGOGPVURTGEJGPFRWP\KGTV

8148 (1:2)

&'765%*.#0&14&'055%*0#..'0 

)TQ­GMTCWUIGP·JVG1TFGPUUEJPCNNG OKV$QIGPD·PFGTP OKVCEJV'JTGP\GKEJGP 2TGW­GP'KUGT PGU -TGW\  ++ -NCUUG   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT   (TQPVM·ORHGTOKV*GTUVGNNGTDG\GKEJPWPI,- ¤UVGTTGKEJ9GNVMTKGIU'TKPPGTWPIUOGFCKNNG OKV5EJYGTVGTP &GWVUEJG4GKEJ2QNK\GK&KGPUVCWU\GKEJPWPI5VWHG-TGW\HÒT&KGPUVLCJTG  &GWVUEJGU4GKEJ/GFCKNNG\WT'TKPPGTWPICPFGP/·T\ #PUEJNWUU¤UVGTTGKEJU  &GWVUEJG 1N[ORKC'TKPPGTWPIUOGFCKNNG 'KUGP XGTUKNDGTV   7PICTP 7PICTKUEJG 9GNVMTKGIU 'TKPPGTWPIU   OGFCKNNGOKV*GNOWPF5EJYGTVGTP $WNICTKGP-TKGIUGTKPPGTWPIUOGFCKNNGCO $CPFHÒT-QODCVVCPVGP4ÒEMUGKVKIG#DFGEMWPIOKV/QVVGPHTC­CP0CFGN 5VÒEM++ 5EJÌPG5EJPCNNGGKPGUNCPIIGFKGPVGP2QNK\GKDGCOVGP



8149 (1:2)



40

)TQ­G DC[GTKUEJG MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV UKGDGP 'JTGP\GKEJGP   $C[GTKUEJGT /KNKV·T   8GTFKGPUVQTFGP/KNKV·T8GTFKGPUVMTGW\/QFGNN8GTFKGPUVMTGW\OKV-TQPGWPF5EJYGTVGTP 2TGW ­GP 'KUGTPGU -TGW\  ++ -NCUUG   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT   (TQPVM·ORHGTOKV*GTUVGNNGTDG\GKEJPWPI) $C[GTP,WDKN·WOUOGFCKNNGHÒTFKG$C[GTKUEJG #TOGG$TQP\G $C[GTP/KNKV·T&KGPUVCWU\GKEJPWPI/QFGNN  -NCUUG/GFCKNNGHÒT +:&KGPUVLCJTG#TIGPVCP $C[GTP-ÌPKI.WFYKI-TGW\ 5KNDGTPGU$GPGOGTGPVK-TGW\FGT %GPVWTKGFGT(ÌTFGTWPIFGU7PDGFKPIVGP)GJQTUCOUIGIGPÒDGTFGO'TNÌUGT,GUWU%JTKUVWU5KNDGTCO WPMQTTGMVGP$CPFCP0CFGN<WUCOOGPOKVFGO)QNFGPGP'JTGP\GKEJGP'JTGFGT#TDGKVFGU$C[GTK UEJGP +PFWUVTKGNNGP8GTDCPFGU 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV CP $CPFURCPIG \WUCOOGP OKV   /KPKCVWT5KNDGTXGTIQNFGVCP5EJNGKHEJGPKOQTKIKPCNGPIQNFGPDG\GKEJPGVGP8GTNGKJWPIUGVWK  5VÒEM++




DEUTSCHLAND - ORDENSSCHNALLEN

8150



)TQ­G RTGW­KUEJG MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV $QIGPD·PFGTP  OKV UGEJU #WU\GKEJPWPIGP   \WUCOOGP OKV FC\WIGJÌTKIGP /KPKCVWTGPMGVVEJGP   'KUGTPGU -TGW\  ++ -NCUUG   4QVGT   #FNGT1TFGP  /QFGNN OKV \KGIGNTQVGO #FNGT    -TGW\  -NCUUG CWH FGO 4CPF FGU   WPVGTGP -TGW\CTOU 4KV\OCTMG 0   -ÌPKINKEJGT -TQPGP1TFGP  /QFGNN OKV ITQ­GT JGTCNFKUEJGT   RTGW­KUEJGT-TQPGEC -TGW\-NCUUG$TQP\GXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVCWH FGO 4CPF FGU WPVGTGP -TGW\CTOU 4KV\OCTMG 9   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU    HÒT (TQPVM·ORHGT CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI (  %Q   1HHK\KGTU   &KGPUVCWU\GKEJPWPI HÒT  &KGPUVLCJTG #WUHÒJTWPI OKV IGMÌTPVGP #TOGP   %GPVGPCTOGFCKNNG    #P0CFGN 5VÒEM++



5GJTUEJÌPG5EJPCNNGGKPGUNCPIIGFKGPVGPRTGW­KUEJGP1HHK\KGTUWPF8GVGTCPGPFGU'TUVGP9GNVMTKGIGU

8151



)TQ­GRTGW­KUEJG1TFGPUUEJPCNNG OKVHNCEJGP$·PFGTP OKVUGEJU'JTGP\GKEJGP -TGW\FGU#NN IGOGKPGP 'JTGP\GKEJGPU 5KNDGT /GFCKNNQPU )QNF   #NNIGOGKPGU 'JTGP\GKEJGP  -NCUUG 5KNDGT     -TKGIUFGPMOÒP\GHÒT-QODCVVCPVGPOKV4CPFRT·IWPIOKVFTGK)GHGEJVUURCPIGP#0&'4 *#..7' #/+'05 WPF /'6<   'TKPPGTWPIUMTGW\ &GT /CKP #TOGG  %GPVGPCTOGFCKNNG    /KNKV·T&KGPUVCWU\GKEJPWPI  /QFGNN   5RCPIGPCWUHÒJTWPI FGT  -NCUUG HÒT    &KGPUVLCJTG$TQP\GXGTUKNDGTV#P0CFGN 5VÒEM++p



'VYCU XGTUEJOWV\VG WPF FGPPQEJ UGJT UEJÌPG WPF KP CNNGP 6GKNGP QTKIKPCNG WPF CNV IGP·JVG 5EJPCNNG GKPGU RTGW­K   UEJGP$GCOVGPWPF8GVGTCPGPFGU2TGW­KUEJ¤UVGTTGKEJKUEJGPWPFFGU&GWVUEJ(TCP\ÌUKUEJGP-TKGIGU

41


DEUTSCHLAND - ORDENSSCHNALLEN

8152 (1:1)





)TQ­G MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV $QIGPD·PFGTP  OKV UGEJU 'JTGP\GKEJGP   2TGW­GP   'KUGTPGU -TGW\  ++ -NCUUG   1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\  -NCUUG 'KUGP IGUEJY·T\V   OKV NGKEJVGP -QTTQUKQPUURWTGP   2TGW­GP .CPFYGJT&KGPUVCWU\GKEJPWPI -TGW\  -NCUUG 5KNDGT   /GFCKNNQPU )QNF   2TGW­GP 4QVG -TGW\ /GFCKNNG  -NCUUG $TQP\G   &GWVUEJGU 4GKEJ   -TKGIUFGPMOÒP\G  FGU 4GKEJUMTKGIGTDWPFGU -[HHJ·WUGT   2TGW­GP 2TGW­KUEJGT .CPFGU   -TKGIGTXGTDCPF -TKGIGTXGTGKPU'JTGPMTGW\  -NCUUG #WH FGT 4ÒEMUGKVG *GTUVGNNGTGVKMGVV FGT (KTOC   9KNJGNO9GKNJCWUGPKP*CPPQXGTCP0CFGN 5VÒEM++



)TQ­GMTCWUIGP·JVG1TFGPUUEJPCNNG OKV$QIGPD·PFGTP OKVHÒPH'JTGP\GKEJGP 2TGW­GP'KUGT PGU-TGW\++-NCUUG 5CEJUGP#NVGPDWTI6CRHGTMGKVUOGFCKNNG#WUICDGKP$TQP\G &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT (TQPVM·ORHGT OKV *GTUVGNNGTDG\GKEJPWPI ))     &GWVUEJGU 4GKEJ 6TGWFKGPUV'JTGP\GKEJGP HÒT  &KGPUVLCJTG   2TGW­GP /KNKV·T&KGPUVCWU\GKEJ   PWPI/QFGNN  -NCUUG/GFCKNNGHÒT+:&KGPUVLCJTG#TIGPVCP#P0CFGN 5VÒEM++



&KG 5CEJUGP#NVGPDWTIKUEJG 6CRHGTMGKVUOGFCKNNG KP XGTNKGJGPGT $TQP\G#WUHÒJTWPI   KUV CP QTKIKPCNGP   1TFGPUUEJPCNNGPPKEJVJ·WHKI\WHKPFGP

8154 (1:1)



)TQ­G MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV $QIGPD·PFGTP  OKV HÒPH 'JTGP\GKEJGP   &GWVUEJGU   4GKEJ'JTGPMTGW\FGU9GNVMTKGIGUHÒT(TQPVM·ORHGTQJPG*GTUVGNNGTDG\GKEJPWPI 2TGW ­GP8GTFKGPUV'JTGP\GKEJGPHÒT4GVVWPICWU)GHCJT#WUICDGOKV-1'0+)WPF5VGTPEJGPXGTUKNDGTVGU YGK­GU /GVCNN     &GWVUEJGU 4GKEJ %JKPC&GPMOÒP\G HÒT -·ORHGT OKV )GHGEJVUURCPIG   65'-+0)-9#0   2TGW­GP .CPFYGJT&KGPUVCWU\GKEJPWPI  -NCUUG  /QFGNN     ITÌ­GTG#WUHÒJTWPI &WTEJOGUUGTOO  %GPVGPCTOGFCKNNG#P0CFGN 5VÒEM++p+++ 'VYCUXGTUEJOWV\VG5EJPCNNGGKPGU8GVGTCPGPFGUUQIGP$QZGT-TKGIGU

42




DEUTSCHLAND - ORDENSSCHNALLEN 

)TQ­GMTCWUIGP·JVG1TFGPUUEJPCNNG OKV$QIGPD·PFGTP OKVHÒPH'JTGP\GKEJGP 2TGW­GP'KUGT PGU-TGW\++-NCUUG 5CEJUGP%QDWTIWPF)QVJC5CEJUGP'TPGUVKPKUEJGT*CWUQTFGP5KNDGTPG 8GTFKGPUVOGFCKNNG OKV 5EJYGTVGTURCPIG  /QFGNN WPVGT *GT\QI %CTN 'FWCTF 5KNDGT #WUICDG   QJPG5VGORGNUEJPGKFGTUKIPCVWTDGKFGT5EJYGTVGTURCPIGUKPFFKG5RNKPVGCDIGDTQEJGPFGUJCNDPWTNQUG CWHIGP·JV   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT (TQPVM·ORHGT *GTUVGNNGT  DG\GKEJPWPI PKEJV UKEJVDCT   &GWVUEJGU 4GKEJ 6TGWFKGPUV'JTGP\GKEJGP HÒT  &KGPUVLCJTG     7PICTP 7PICTKUEJG 9GNVMTKGIU'TKPPGTWPIUOGFCKNNG  OKV *GNO WPF 5EJYGTVGTP #P   0CFGN<WUCOOGPOKV5VWFGPVGP\KRHGNYQJNFGU6T·IGTUOKV)TCXWT4*COOGTUEJOKFV #ODQUU UN (5GNOQPU 4ÒJTGK \HT'TI95 5VÒEM++



8156 1:2



)TQ­G MTCWU IGP·JVG U·EJUKUEJG 1TFGPUUEJPCNNG OKV HÒPH 'JTGP\GKEJGP   #NNIGOGKPGU   'JTGP\GKEJGP D\Y 'JTGPMTGW\   2TGW­GP -TKGIUFGPMOÒP\G  HÒT -QODCVVCPVGP OKV   4CPFRT·IWPI   5CEJUGP 'TKPPGTWPIUMTGW\ HÒT  CO $CPF HÒT -·ORHGT   5CEJUGP /KNKV·T   &KGPUVCWU\GKEJPWPI  /QFGNN  #WUHÒJTWPI   /GFCKNNG  -NCUUG HÒT  D\Y HÒT    &KGPUVLCJTG %GPVGPCTOGFCKNNG#P0CFGN 5VÒEM++ #NV IGP·JVG 5EJPCNNG GKPGU U·EJUKUEJGP $GCOVGP WPF 8GVGTCPGP FGU 2TGW­KUEJ¤UVGTTGKEJKUEJGP WPF FGU &GWVUEJ   (TCP\ÌUKUEJGP-TKGIGU



8157



)TQ­G U·EJUKUEJG MTCWU IGP·JVG (TCEMUEJPCNNG OKV $QIGPD·PFGTP  OKV XKGT #WU\GKEJPWPIGP \W   UCOOGP OKV FC\WIGJÌTKIGP /KPKCVWTGPMGVVEJGP XQP TGEJVU PCEJ NKPMU    -ÌPKINKEJ 5·EJUKUEJGT   #NDTGEJVUQTFGP  /QFGNN#WUICDG 5KNDGTXGTIQNFGVOKVGKPVGKNKIGO/GFCKNNQPDKU  4KVVGTMTGW\-NCUUGOKV5EJYGTVGTPCWHFGO4CPFFGUWPVGTGP-TGW\CTOURWP\KGTV5 (TKGFTKEJ#W IWUV/GFCKNNG KP 5KNDGT 5KNDGT CO -TKGIUDCPF   2TGW­GP 'KUGTPGU -TGW\  ++ -NCUUG     &GWVUEJGU4GKEJ-TKGIUFGPMOÒP\GFGT&GWVUEJGP'JTGPNGIKQPXGTIQNFGVOKV$GY·JTWPIU CD\GKEJGP4ÒEMUGKVKIG#DFGEMWPIGTPGWGTVCP0CFGN 5VÒEM++ 5EJÌPG 5EJPCNNG GKPGU U·EJUKUEJGP 7PVGTQHHK\KGTU FGT Y·JTGPF FGU 'TUVGP 9GNVMTKGIU \WO 1HHK\KGT DGHÌTFGTV YQT   FGPKUV



43


DEUTSCHLAND - ORDENSSCHNALLEN

8158



)TQ­G RTGW­KUEJG MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV $QIGPD·PFGTP  OKV XKGT 'JTGP\GKEJGP \W   UCOOGP OKV FC\WIGJÌTKIGP /KPKCVWTGPMGVVEJGP   'KUGTPGU -TGW\  ++ -NCUUG   &GWVUEJGU   4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT (TQPVM·ORHGT CWH FGT 4ÒEMUGKVG *GTUVGNNGT   DG\GKEJPWPI0$0 1HHK\KGTU&KGPUVCWU\GKEJPWPIHÒT&KGPUVLCJTG#WUHÒJTWPIOKVIGMÌTPVGP #TOGP %GPVGPCTOGFCKNNG#P0CFGN 5VÒEM++



8159 (1:1)



44

)TQ­G1TFGPUUEJPCNNGOKVXKGT#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\++-NCUUG /KNK V·T8GTFKGPUVQTFGP -TGW\  -NCUUG OKV 5EJYGTVGTP  5KNDGT /GFCKNNQPU )QNF OGJTGTG   $GUEJ·FKIWPIGPKPFGTDNCWGP'OCKNNGFGT8QTFGTWPF4ÒEMUGKVGFKG5EJYGTVGTGTI·P\V 'JTGPMTGW\ FGU9GNVMTKGIGUHÒT(TQPVM·ORHGT /KNKV·T&KGPUVCWU\GKEJPWPI-TGW\-NCUUGHÒT:.,CJTG5KNDGT GOCKNNKGTVOGJTGTGOKP#DRNCV\WPIGPKPFGTITÒPGP'OCKNNGFGT8QTFGTWPF4ÒEMUGKVG#P0CFGN  5VÒEM++++p++++++




DEUTSCHLAND - ORDENSSCHNALLEN

8160





)TQ­G U·EJUKUEJG MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV $QIGPD·PFGTP  OKV FTGK 'JTGP\GKEJGP    5CEJUGP/KNKV·T5CPMV*GKPTKEJ1TFGP5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGKFGT\GKEJGP(7KO *CNUCPUCV\ OKV UEJÌPGT CNVGT 2CVKPC   'KUGTPGU -TGW\  ++ -NCUUG   &GWVUEJGU 4GKEJ   'JTGPMTGW\FGU9GNVMTKGIGUHÒT(TQPVM·ORHGTCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI9 ./$·PFGTGVYCUXGTUEJOWV\VTÒEMUGKVKIG#DFGEMWPIGTPGWGTVCP0CFGN 5VÒEM+++



)TQ­G MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV $QIGPD·PFGTP  OKV FTGK 'JTGP\GKEJGP \WUCOOGP OKV   FGT \WIGJÌTKIGP (GNFUEJPCNNG   &GWVUEJGU 4GKEJ 'JTGPMTGW\ FGU 9GNVMTKGIGU  HÒT   (TQPVM·ORHGT OKV *GTUVGNNGTDG\GKEJPWPI //(   &GWVUEJG 1N[ORKC'TKPPGTWPIUOGFCKNNG 'KUGP   XGTUKNDGTV &GWVUEJG4GKEJ2QNK\GK&KGPUVCWU\GKEJPWPI5VWHG-TGW\HÒT&KGPUVLCJTGCP0CFGN 5VÒEM++



8162









)TQ­G RTGW­KUEJG MTCWU IGP·JVG (TCEMUEJPCNNG OKV $QIGPD·PFGTP  OKV FTGK #WU\GKEJPWPIGP     4QVGT #FNGT1TFGP  /QFGNN OKV \KGIGNTQVGO #FNGT    -TGW\  -NCUUG CWH FGO   4CPFFGUWPVGTGP-TGW\CTOU4KV\OCTMG9 -TKGIUFGPMOÒP\GHÒT-QODCVVCPVGPQJPG 4CPFRT·IWPI OKV \WUCOOGPIGNÌVGVGP )GHGEJVUURCPIGP 2#4+5 .' /#05 $'#7)'0%;   %4#8#0614.'#05.1+)0;21724;WPF5'&#0 %GPVGPCTOGFCKNNG#P0CFGN  5VÒEM++



-QPXQNWV XQP \YGK ITQ­GP 1TFGPUUEJPCNNGP OKV KPUIGUCOVCEJV#WU\GKEJPWPIGP&CTWPVGT$C[GTK UEJGU /KNKV·TXGTFKGPUVMTGW\  -NCUUG OKV -TQPG WPF 5EJYGTVGTP WPF 'KUGTPGU -TGW\ ++ -NCUUG    #P0CFGN 5VÒEM++



-QPXQNWVXQPFTGKITQ­GP1TFGPUUEJPCNNGPOKVKPUIGUCOV#WU\GKEJPWPIGP '-++.ÒDGE MGT *CPUGCVGPMTGW\ (TQPVM·ORHGTMTGW\ FC\W -PQRHNQEJTQUGVVG OKV #WHNCIGP   '- ++  $TCWP   UEJYGKIGT -8- 'JTGPFGPMOÒP\G FG 9GNVMTKGIGU OKV $GY·JTWPIUCD\GKEJGP   '- ++  (TQPV   M·ORHGTMTGW\8GTUEJKGFGPG/CVGTKCNKGPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM+++++



)TQ­G FGWVUEJG MTCWU IGP·JVG 1TFGPUUEJPCNNG OKV $QIGPD·PFGTP  OKV \YGK #WU\GKEJPWPIGP     'KUGTPGU -TGW\   -NCUUG OGJTVGKNKIG #WUHÒJTWPI OKV MNGKPGO *CMGPMTGW\   /GFCKNNG \WT   'TKPPGTWPI CP FKG *GKOMGJT FGU /GOGNNCPFGU 5VCTMGT /QVVGPHTC­ KP FGT 4ÒEMUGKVGPCDFGEMWPI CP   0CFGN ++

 45


UNBEKANNTE AUSZEICHNUNGEN

8166

&'765%*.#0&-1081.76' 

#WU\GKEJPWPIUPCEJNCUU GKPGU 8GVGTCPGP FGU 'TUVGP 9GNVMTKGIGU $GUVGJGPF CWU )TQ­G MTCWU   IGP·JVG 1TFGPUUEJPCNNGOKVHÒPH#WU\GKEJPWPIGP 'KUGTPGU-TGW\++-NCUUG 'JTGPMTGW\FGU 9GNVMTKGIGU HÒT (TQPVM·ORHGT   ¤UVGTTGKEJ 9GNVMTKGIU'TKPPGTWPIUOGFCKNNG  OKV   5EJYGTVGTP   7PICTP 9GNVMTKGIU'TKPPGTWPIUOGFCKNNG  OKV 5EJYGTVGTP   $WNICTKGP   9GNVMTKGIU'TKPPGTWPIUOGFCKNNG  HÒT -QODCVVCPVGP CP 0CFGN OKV RCUUGPFGO /KPKCVWTGP   MGVVEJGP RCUUGPFGT 7PKHQTODCPFURCPIG WPF FTGK RCUUGPFGP /KPKCVWTGPPCFGNP &C\W RCVTKQVKUEJGT   #TOTGKH CWU GKPGO )TCPCVTKPI RCVTKQVKUEJG #PUVGEMPCFGN CWU GKPGT 2CVTQPG #PJ·PIGT #75   '+5'40'4 <'+6 /KPKCVWT#PUVGEMPCFGN 5VWFGPVGPXGTDKPFWPIU<KRHGN FCVKGTV  \YGK &TGKGEMU   D·PFGTWPFIGMTGW\VG5EJYGTVGTOKV5RNKPVGP 5VÒEM++

ex 8167











8172



8173

-QPXQNWVOKVFGWVUEJGP#WU\GKEJPWPIGP1TKIKPCNG(·NUEJWPIGPWPF5COONGTCPHGTVKIWPIGP MGKPG )ÌFG-QRKGP XGTUEJKGFGPG/GVCNNG CWEJ5KNDGT VGKNUXGTIQNFGVVGKNUGOCKNNKGTVVGKNUCP0CFGNVGKNU CP$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++



-QPXQNWV XQP  XGTUEJKGFGPGP FGWVUEJGP 'JTGP\GKEJGP &CTWPVGT #PJCNVKUEJGU (TKGFTKEJMTGW\   *CODWTIGT *CPUGCVGPMTGW\ 2TGW­KUEJGU #NNIGOGKPGU 'JTGP\GKEJGP  -NCUUG 2TGW­KUEJG 1HHK\KGTU   &KGPUVCWU\GKEJPWPI HÒT  ,CJTG 5·EJUKUEJGU -TKGIUXGTFKGPUVMTGW\ 5·EJUKUEJG 5KNDGTPG (TKGFTKEJ   #WIWUV/GFCKNNG 1TKIKPCNG WPF 0CEJHGTVKIWPIGP KP XGTUEJKGFGPGP /GVCNNGP KP WPVGTUEJKGFNKEJGP   /GVCNNGPVGKNYGKUGCP$·PFGTP\YGKCP0CFGNP 5VÒEM++++p+++



-QPXQNWV XQP  FGWVUEJGP 'JTGP\GKEJGP #D\GKEJGP WPF /GFCKNNGP 7 C CWU $CFGP $C[GTP   *GUUGP2TGW­GPWPF9ÒTVVGODGTIXGTUEJKGFGPG/GVCNNGHÒPHKP5KNDGTDGKXKGTFKG¤UGGPVHGTPVFTGK OKV$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++++++8



-QPXQNWVXQP8GVGTCPGPWPF-NGKPCD\GKEJGP#PUVGEMPCFGNPGVE7CCWU$C[GTP5CEJUGPWPF 9ÒTVVGODGTI KP XGTUEJKGFGPGP /GVCNNGP VGKNUXGTUKNDGTVVGKNUXGTIQNFGVVGKNUGOCKNNKGTVVGKNUNCEMKGTV KPWPVGTUEJKGFNKEJGP'TJCNVWPIGPCP0CFGNP 5VÒEM++++p+++



-QPXQNWVXQP#WU\GKEJPWPIGPXQTYKGIGPFFGT-CKUGT\GKV7CCWU$CFGP$C[GTP*GUUGP2TGW ­GP5CEJUGP9ÒTVVGODGTIWPFFGO&GWVUEJGP4GKEJKPXGTUEJKGFGPGP/GVCNNGPCWEJ5KNDGTKPWPVGT UEJKGFNKEJGP'TJCNVWPIGPOGKUVCP$·PFGTPGKPGKO'VWK 5VÒEM++



70$'-#006'#75<'+%*070)'0 

 46

7PDGMCPPVG8GTFKGPUVOGFCKNNGOKVGKPGOHTCP\ÌUKUEJGPKVCNKGPKUEJGPQFGTURCPKUEJGP*GT\QIUYCR RGP 5KNDGT XGTIQNFGV OKV +PUEJTKHV ': %10%14&+# ('.+%+6#5 WPVGT FGO 9CRRGP 5KNDGTRWP\G   CWHFGT4ÒEMUGKVG.QTDGGTWPF'KEJGPMTCP\QJPG$CPF ++



7PDGMCPPVGU#TCDKUEJGU/KNKV·TKUEJGU'JTGP\GKEJGP&CVKGTV#* #& $TQP\GVGKNYGKUG XGTUKNDGTVVGKNYGKUGXGTIQNFGVCO$CPF 4++




ALBANIEN

'7412+5%*'56##6'0

8174

8175

8174

#.$#0+'0 (ª456'067/#.$#0+'0   

5EJYCT\GT #FNGT1TFGP )QNFGPG 8GTFKGPUVOGFCKNNG 5KNDGT XGTIQNFGV CO UEJOCNGP MQTTGMVGP $CPF   <'+ 444++



'ZVTGO UGNVGPG /GFCKNNG  &GT 5EJYCT\G #FNGT1TFGP YWTFG \WUCOOGP OKV FGP FC\WIGJÌTKIGP /GFCKNNGP XQP   9KNJGNO (ÒTUVGP XQP #NDCPKGP CWU FGO *CWUG 9KGF  KO ,CJTG  IGUVKHVGV 0CEJ -NKGVOCPP +P -NKGVOCPP   -WTV)GTJCTF WPF 0GWDGEMGT 1VVHTKGF 1TFGPU.GZKMQP $CPF  1JPG 1TVU WPF ,CJTGUCPICDG -CRKVGN ,G   5   YWTFGP KPUIGUCOV PWT    IQNFGPG /GFCKNNGP XGTNKGJGP WPF \YCT CO  #RTKN  CNU UKEJ FGT (ÒTUV   DGTGKVU KP FGT 'OKITCVKQP DGHCPF WPF \YCT CWUUEJNKG­NKEJ CP #PIGUVGNNVG FGT (ÒTUVN 5EJÌPDWTI9CNFGPDWTIKUEJGP   8GTYCNVWPIFKGKP&KGPUVGPFGU(ÒTUVGP9KNJGNOUVCPFGP

81.-54'27$.+-#.$#0+'0   

1TFGP 5MCPFGTDGI =7TFJÀTK K ō5MÀPFGTDGWVŋ? $TWUVUVGTP  -NCUUG XGTUKNDGTV CP 0CFGN KO   QTKIKPCNGP8GTNGKJWPIUGVWK<'+ ++



8176 (1:1)

$'.)+'0-¤0+)4'+%* 

.GQRQNF1TFGP/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV -NGKPQF\WO)TQ­MQT FQPZOO)QNFVGKNYGKUGHGKPUV\KUGNKGTVGOCKNNKGTVIQJPG5EJWNVGTDCPF$#491 <'+ 4+

 47


BELGIEN

8177 (1:1)



.GQRQNF1TFGP  /QFGNN OKV GKPURTCEJKIGT /GFCKNNQPWOUEJTKHV    -QOOCPFGWTMTGW\    Z  OO )QNF VGKNYGKUG HGKPUV \KUGNKGTV GOCKNNKGTV  I KP FGP /GFCKNNQPTKPIGP MCWO   UKEJVDCTGQDGTHN·EJNKEJG'OCKNNGEJKRUWPFURTÒPIGOKVHGKPIGMÌTFGNVGOUVCTTGO#WHJ·PIWPIUTKPICO CNVGP*CNUDCPF$#491<'+ ++  *GTXQTTCIGPFG#PHGTVKIWPICWUFGT/KVVGFGU0GWP\GJPVGP,CJTJWPFGTVUOKVIGYÌNDVGO8QTFGTUGKVGPOGFCKNNQPKP QRVKOCNGT'TJCNVWPIUSWCNKV·V

8178 (1:1)



.GQRQNF1TFGP/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV -QOOCPFGWTMTGW\ Z  OO )QNF VGKNYGKUG HGKPUV \KUGNKGTV GOCKNNKGTV  I KP FGP /GFCKNNQPTKPIGP MCWO UKEJVDCTG   QDGTHN·EJNKEJG 'OCKNNGEJKRU WPF URTÒPIG OKV HGKP IGMÌTFGNVGO UVCTTGO #WHJ·PIWPIUTKPI CO CNVGP   *CNUDCPF$#491<'+ 4++  *GTXQTTCIGPFG #PHGTVKIWPI CWU FGT /KVVG FGU 0GWP\GJPVGP ,CJTJWPFGTVU OKV UVCTM IGYÌNDVGO 8QTFGTUGKVGPOGFCKN   NQPKPQRVKOCNGT'TJCNVWPIUSWCNKV·V

48


BELGIEN

8181 8180

8179



.GQRQNF1TFGP/QFGNN OKV\YGKURTCEJKIGT/GFCKNNQPWOUEJTKHVUGKV -QOOCPFGWTMTGW\OKV 5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVQJPG*CNUDCPF$#491<'+ ++





.GQRQNF1TFGP/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV -QOOCPFGWTMTGW\OKV 5EJYGTVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVQJPG$CPFTKPIWPF*CNUDCPF$#491<'+ ++



.GQRQNF1TFGP/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV #WUHÒJTWPIOKV-TQPG FGU6[RWUCRNCVK EC 8CTKCPVGOKV/QPQITCOO.GQRQNF+CWHFGO4GXGTUOGFCKNNQP1HHK \KGTUMTGW\OKV5EJYGTVGTP)QNFGOCKNNKGTVICWHFGT4ÒEMUGKVGMCWOUKEJVDCTG'OCKNNGTGRCTCVWT COGVYCUCWUIGDNGKEJVGP$CPFOKVCWHIGNGIVGT4QUGVVG$#491<'+ +p++





8182







8183

8184

.GQRQNF1TFGP  /QFGNN OKV HTCP\ÌUKUEJGT /GFCKNNQPWOUEJTKHV  1HHK\KGTUMTGW\ #WUHÒJTWPI OKV   -TQPGFGUV[RGENCUUKSWG  )QNFGOCKNNKGTVOGJTG5EJ·FGPWPF4GRCTCVWTGPKPFGTYGK­GP 'OCKNNGXQP8QTFGTWPF4ÒEMUGKVGCOQTKIKPCNGP$CPFOKV4QUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT (KTOC8XG(*GTGOCPUKP$TÒUUGNOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI.GQRQNF+$#491 <'+ +++



.GQRQNF1TFGP/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV #WUHÒJTWPIOKV-TQPG FGU 6[RWU ENCUUKSWG EC   8CTKCPVG OKV /QPQITCOO .GQRQNF + CWH FGO 4GXGTUOGFCKNNQP   4KVVGTMTGW\5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVCOQTKIKPCNGP$CPF$#491<'+ +p++



.GQRQNF1TFGP/QFGNN OKV\YGKURTCEJKIGT/GFCKNNQPWOUEJTKHVUGKV #WUHÒJTWPIOKV-TQPG FGU6[RWUOCUUKX UGKV 4KVVGTMTGW\OKV#PMGTP$TQP\GXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKN NKGTVCO$CPF$#491<'+ 4+p++

 49


BELGIEN

8185

8187

8186



-TQPGP1TFGP$TWUVUVGTP\WO)TQ­MQTFQP5KNDGTVGKNYGKUGDTKNNCPVKGTVVGKNYGKUGXGTIQNFGVVGKNYGKUG GOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,(QPUQPKP$TÒUUGNCP0CFGNOKV\YGK 5GKVGPJCMGP$#491<'+ ++



-TQPGP1TFGP-QOOCPFGWTFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVGKPOKP#WUDTWEJKPFGTITÒ PGP 'OCKNNG FGT 4ÒEMUGKVG CO QTKIKPCNGP *CNUDCPF KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK   $#491<'+ ++



5GJTUEJYGTG#WUHÒJTWPI



5GJTSWCNKV·VUXQNNGOÌINKEJGTYGKUGHTCP\ÌUKUEJG#PHGTVKIWPIOKVOGJTVGKNKIGP/GFCKNNQPU



-TQPGP1TFGP-QOOCPFGWTFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVGKPOKP#WUDTWEJKPFGTITÒ PGP'OCKNNGFGT8QTFGTUGKVGOKVCNVGOVGKNYGKUGCWUIGDNGKEJVGP*CNUDCPFCDUEJPKVV$#491<'+ ++

5GJTSWCNKV·VUXQNNGOÌINKEJGTYGKUGHTCP\ÌUKUEJG#PHGTVKIWPIOKVOGJTVGKNKIGP/GFCKNNQPU

8188

8189



8190



-TQPGP1TFGP -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV QJPG *CNUDCPF $#491   <'+ ++





-TQPGP1TFGP -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF   $#491<'+ ++





-TQPGP1TFGP -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF   $#491<'+ ++





1TFGP .GQRQNFU ++ .GGTGU FWPMGNDNCWGU 'VWK \WO )TQ­MTGW\UCV\ XQP (QPUQP OKV IQNFHCTDGPGO   /QPQITCOO-ÌPKI.GQRQNF++ ++p



50


BELGIEN

8193

8192 8194

8195



/KNKV·TMTGW\  /QFGNN OKV /QPQITCOO -ÌPKI #NDGTVU CWH FGT 4ÒEMUGKVG    -TGW\ ++   -NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPF$#491D 4++



$GUQPFGTUNWZWTKÌUGUWPFUGNVGPGU'ZGORNCTOKVUGJTRNCUVKUEJIGUVCNVGVGT-TQPG



'JTGP\GKEJGP \WO HÒPH\KIL·JTKIGP $GUVGJGP FGT (·JTXGTDKPFWPI \YKUEJGP 1UVGPFG WPF &QXGT   'JTGP\GKEJGP-NCUUG/GFCKNNG5KNDGTCOQTKIKPCNGP$CPF$#491 4++





)GFGPM'JTGP\GKEJGP\WOL·JTKIGP$GUVGJGPFGUDGNIKUEJGP6GNGITCRJGPYGUGPU8GTIQNFGVWPF GOCKNNKGTVCOQTKIKPCNGP$CPF$#491 4++





-TKGIUGTKPPGTWPIUOGFCKNNG  $TQP\G CO $CPF OKV FTGK $CPFURCPIGP 9#.%*'4'0   +6#.+'WPF%#/2&'*1..#0&'#WHNCIG2#;5$#5WPFIGMTGW\VGP5·DGNP ++



8198 8196

8197



-ÌPKINKEJG 8GTFKGPUVOGFCKNNG HÒT #PIGJÌTKIG HTGOFGT *ÌHG 'TUVGU /QFGNN 2QTVTCKV .GQRQNFU ++     5KNDGTPG/GFCKNNG5KNDGTCOQTKIKPCNGP$CPF 44+p++





-ÌPKINKEJG 8GTFKGPUVOGFCKNNG HÒT #PIGJÌTKIG HTGOFGT *ÌHG <YGKVGU /QFGNN 2QTVTCKV #NDGTVU +     5KNDGTPG/GFCKNNG5KNDGTOGJTGTG4CPFFGNNGPQJPG$CPF ++p+++





'TKPPGTWPIUMTGW\ FGU -ÌPKINKEJGP *CWUGU CP -ÌPKI #NDGTV 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCO$CPF 4++

 51


BELGIEN

8199 (1:2)





)TQ­G 1TFGPUUEJPCNNG OKV UKGDGP #WU\GKEJPWPIGP   -TQPGP1TFGP 4KVVGTFGMQTCVKQP 5KNDGT   VGKNYGKUG GOCKNNKGTV CO $CPF OKV 4QUGVVG   .GQRQNF1TFGP  /QFGNN OKV \YGKURTCEJKIGT   /GFCKNNQPWOUEJTKHV  UGKV   $TQP\G XGTUKNDGTV VGKNYGKUG XGTIQNFGV GOCKNNKGTV   /KNKV·TMTGW\    -NCUUG CO $CPF OKV 4QUGVVG   /GFCKNNG HÒT (TGKYKNNKIG      /GFCKNNG HÒT /KNKV·TKUEJG   -QODCVVCPVGP XQP  DKU    -TKGIUGTKPPGTWPIUOGFCKNNG    /GFCKNNG HÒT   #TDGKVUXGTYGKIGTGT 5VÒEM++



)TQ­G 1TFGPUUEJCNNG OKV XKGT #WU\GKEJPWPIGP   1TFGP .GQRQNF ++  /QFGNN OKV HTCP\ÌUKUEJGT   /GFCKNNQP7OUEJTKHV 4KVVGTMTGW\5KNDGTVGKNYGKUGGOCKNNKGTVCO$CPFOKV.QTDGGT\YGKI #WHNCIG   -TKGIUMTGW\    CO $CPF OKV .QTDGGT\YGKI#WHNCIG   -TKGIUGTKPPGTWPIU   OGFCKNNGCO$CPFOKVXKGTUEJOCNGPUKNDGTHCTDGPGP$CPFURCPIGPFGT$CPFURCPIGHÒTFCU DGNIKUEJG 'ZRGFKVKQPUMQTRU PCEJ 4WUUNCPF    GKPGO TQV GOCKNNKGTVGU -TGW\ HÒT GKPG    8GTYWPFWPI WPF GKPGT -TQPG HÒT -TKGIUHTGKYKNNKIG   +PVGTCNNKKGTVG 5KGIGUOGFCKNNG  #WUICDGHÒT $GNIKGP 5VÒEM++  5GJT KPVGTGUUCPVG 5EJPCNNG DGUQPFGTU JKPUKEJVNKEJ FGT 5RCPIG HÒT FCU $GNIKUEJG 'ZRGFKVKQPUMQTRU KP 4WUUNCPF   

8200 (1:2) ex 8203



-QPXQNWV XQP PGWP XGTUEJKGFGPGP #WU\GKEJPWPIGP &CTWPVGT W C 4KVVGTMTGW\ OKV 5EJYGTVGTP FGU   .GQRQNF1TFGPU 1HHK\KGTUMTGW\ FGU 1TFGPU .GQRQNFU ++ 5KNDGTPGU <KXKNXGTFKGPUVMTGW\ 8GTUEJKGFGPG   /GVCNN CWEJ5KNDGT VGKNUXGTIQNFGVVGKNUGOCKNNKGTVKPFWTEJYGIUIWVGP'TJCNVWPIGPCPFGPMQTTGMVGP 1TKIKPCND·PFGTP 5VÒEM++



-QPXQNWVXQPPGWP#WU\GKEJPWPIGP,GYGKNU$TQP\G\YGKXGTIQNFGVCP$·PFGTP



-QPXQNWVXQPDGNIKUEJGP1TFGPWPF'JTGP\GKEJGP&CTWPVGT4KVVGTMTGW\OKV5EJYGTVGTPFGU.GQ RQNF1TFGPU4KVVGTFGMQTCVKQPFGU-TQPGPQTFGPUWPF1HHK\KGTUMTGW\FGU1TFGPU.GQRQNFU++8GTUEJKG FGPG/GVCNNGVGKNUXGTIQNFGVVGKNUXGTUKNDGTVVGKNUGOCKNNKGTVCPMQTTGMVGP$·PFGTP 5VÒEM++





2T·IGUVGORGNHÒTGKP#D\GKEJGPFGU*QVGNU&GOKFQHHKP.G/GUPKN 2TQXKP\0COWT 'KUGPEC ZECZECEOMICWHFGO4CPFGKPIGUEJNCIGP24#6WPFTQVPWOOGTKGTV ++





2T·IGUVGORGNHÒTGKP#D\GKEJGPFGT#WHUGJGTFGT)ÒVGTFGU/'FG9GTDTQWEM'KUGPECZ ECZECEOMICWHFGO4CPFGKPIGUEJNCIGP24#6WPFTQVPWOOGTKGTV ++



52

5VÒEM++

 


BELGIEN

ex 8206 (1:1)

$'.)+5%*-10)1 

-ÌPKINKEJGT .ÌYGPQTFGP  /QFGNN \YGKURTCEJKIG /GFCKNNQPKPUEJTKHV    )TQ­MQTFQPUGV   DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV VGKNYGKUG   XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC (+$47 (KUEJ KP    $TÒUUGNCP0CFGNOKV\YGK5GKVGPJCMGP$#491<'+ 5VÒEM4++ 

8207



#HTKMCPKUEJGT5VGTPGPQTFGP/QFGNN OKVGKPURTCEJKIGT/GFCKNNQPWOUEJTKHV 4KVVGTFG MQTCVKQP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV MCWO UKEJVDCTGT 'OCKNNGCWUDTWEJ CWH FGT   8QTFGTUGKVGGKPGT-TGW\URKV\GCOQTKIKPCNGP$CPF$#491<'+ 4+p++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPIYQJNCWUFGOGTUVGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVU

53


BULGARIEN

8210

8208 8212

8213

8211

$7.)#4+'0 (ª456'067/   

1TFGP XQO JN #NGZCPFGT  /QFGNN  #WUHÒJTWPI   -TGW\  -NCUUG 5KNDGT   8QTFGTUGKVGP/GFCKNNQPHGNF XGTIQNFGV GVYCU XGTFTGJV  GOCKNNKGTV KP FGT ¤UG OGJTHCEJ RWP\KGTV W C   (4 HÒT (TKGFTKEJ 4QVJG KP 9KGP  CO QTKIKPCNGP CNVGP GVYCU \GTUEJNKUUGPGP &TGKGEMUDCPF $#491   <'+ ++





<KXKN8GTFKGPUVQTFGP.GGTGU'VWKHÒTFCU-TGW\-NCUUGOKVIQNFHCTDGPGOHÒTUVNKEJGP9CRRGP DKU  +p++





1TFGP XQO JN #NGZCPFGT  /QFGNN   -TGW\ FGT  -NCUUG 5KNDGT XGTIQNFGV WPF ITÒP   GOCKNNKGTVQJPG5EJWNVGTDCPF<'+ 4++





#D\GKEJGPFGU$WNICTKUEJGP4QVGP-TGW\GU/QFGNNXGTIQNFGVWPFGOCKNNKGTVCP0CFGN$4#91 ++





<#4'067/  

-¤0+).+%*'(#/+.+'5#%*'0%1$74)70&)16*#810$7.)#4+'0

5'+6 

1TFGP XQO JN #NGZCPFGT  /QFGNN OKV DWNICTKUEJGO .ÌYGP KP FGT /KVVG  HTÒJGUVGPU UGKV     -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T   #PHGTVKIWPI FGT (KTOC %GLCNXQ KP /CFTKF  -ÌPKI 5KOGQP XQP $WNICTKGP XQT GKPKIGP ,CJTG GKPG <GKVNCPI   /KPKUVGTRT·UKFGPVFGT4GRWDNKM$WNICTKGPXGTNGKJVFGP1TFGPKPUGKPGOURCPKUEJGP'ZKNCNU*CWUQTFGPXQTCNNGOHÒT KJORGTUÌPNKEJIGNGKUVGVG&KGPUVG5QGTJKGNVDGKURKGNUYGKUGCWEJFGTKP&·PGOCTMNGDGPFG2TKP\&KOKVTK4QOCPQHH #WVQTGKPKIGTDGFGWVGPFGTRJCNGTKUVKUEJGT9GTMGXQTGKPKIGP,CJTGPFKG-NCUUG

81.-54'27$.+-$7.)#4+'0    54

'JTGPVKVGN *GNF FGT 5Q\KCNKUVKUEJGP #TDGKV <YGKVGZGORNCT FGT &GMQTCVKQP \WO 'JTGPVKVGN $TQP\G   XGTIQNFGVCWHFGT4ÒEMUGKVGRWP\KGTV4CP6TCIGURCPIGOKV$CPFWPF0CFGN +




DÄNEMARK

8214







8215

8216

1TFGP5GRVGODGT-QPXQNWVXQPHÒPHXGTUEJKGFGPGP&GMQTCVKQP -NCUUGOKV5EJYGTVGTP  -NCUUG -NCUUG -NCUUGOKV5EJYGTVGTP -NCUUG$TQP\GXGTIQNFGVWPFGOCKNNKGTV FTGKCP2GPVCIQPCNDCPFURCPIGP\YGKCP5EJTCWDGPOKV5EJTCWDUEJGKDG 5VÒEM++



-QPXQNWV XQP  XGTUEJKGFGPGP DWNICTKUEJGP 1TFGP   1TFGP FGT #TDGKV  /QFGNN     WPF5VWHG 1TFGP5GRVGODGT-NCUUG-NCUUG-NCUUGOKV5EJYGTVGTP   1TFGP 4QVGU $CPPGT   1TFGP 4QVGU $CPPGT FGT #TDGKV   1TFGP (ÒT <KXKNGP /WV WPF   8GTFKGPUV-NCUUG6GKNYGKUGXGTIQNFGVVGKNYGKUGXGTUKNDGTVVGKNYGKUGGOCKNNKGTVLGYGKNUCPMQTTGMVGP 2GPVCIQPCNDCPFURCPIGP 5VÒEM++



-QPXQNWV XQP UGEJU XGTUEJKGFGPGP 1TFGP &CTWPVGT 1TFGP (ÒT 6CRHGTMGKV 1TFGP (ÒT /KNKV·T   XGTFKGPUV  WPF  -NCUUG WPF 1TFGP 8QNMUTGRWDNKM $WNICTKGP  -NCUUG 6GKNU XGTIQNFGV VGKNU   XGTUKNDGTVCNNGGOCKNNKGTVLGYGKNUCP2GPVCIQPCNDCPFURCPIGP 5VÒEM++



8217 (1:1)

&0'/#4--¤0+)4'+%* 

&CPGDTQI1TFGP$TWUVUVGTP\WO)TQ­MTGW\#WHNCIGP)QNFVGKNYGKUGGOCKNNKGTVGKPMNGKPGT'OCKNNG UEJCFGPCP&QRRGNPCFGN<'+ ++p



5GJTUEJÌPG#PHGTVKIWPIYQJNCWUFGONGV\VGP&TKVVGFGU0GWP\GJPVGP,CJTJWPFGTVU  &GT&CPGDTQI1TFGPYWTFGCO1MVQDGTXQP-ÌPKI%JTKUVKCP8KP'TPGWGTWPIGKPGUUEJQPXQP-ÌPKI 9CNFGOCTIGUVKHVGVGP4KVVGTQTGPUGTPGWGTV<WP·EJUVPWTCWUGKPGT-NCUUGDGVGJGPFGTYGKVGTVGKJP-ÌPKI(TGFGTKM8+ CO  ,WPK  \W GKPGO CWU XKGT -NCUUGP )TQ­MQOOCPFGWT  CD  FKG QDGTUVG -NCUUG  )TQ­MTGW\4KVVGT   -QOOCPFGWTWPF4KVVGT DGUVGJGPFGPCNNIGOGKPGP8GTFKGPUVQTFGPCNU·W­GTGU<GKEJGPCPGTMCPPVGT$ÒTIGTRHNKEJVHÒT CNNG 7PVGTVCPGP QJPG 4ÒEMUKEJV CWH 5VCPF QFGT #FGN 1JO*KGTQP[OWUUGP KP *'1 5    YWTFG FKG   -QOOCPFGWTMNCUUG  FKG 4KVVGTMNCUUG KP LGYGKNU \YGK )TCFG WPVGTVJGKNV &GO 1TFGP KUV UGKV  FCU   'JTGP\GKEJGPFGU&CPGDTQI1TFGPU 5KNDGTPGU-TGW\ CPIGUEJNQUUGPWPF PCEJ 4GIKGTWPIUCPVTKVV FGU LGYGKNKIGP 5QWXGT·PU YWTFG FKG )GUVCNVWPI FGT 1TFGPUMTGW\G FWTEJ #PDTKPIWPI FGU   LGYGKNKIGPMÌPKINKEJGP/QPQITCOOUXGT·PFGTV

55


DÄNEMARK

8220

8219 8218







&CPGDTQI1TFGP $TWUVUVGTP \WO -QOOCPFGWT GTUVGP )TCFGU IGUVKEMVG #WUHÒJTWPI )QNFNCCP WPF   5KNDGTRCKNNGVVGPUVKEMGTGKOKVYGK­GO<KGIGPNGFGTJKPVGTMNGDVFCTCWHVGKNYGKUGXGTICPIGPGJCPFUEJTKHVNK EJG#WHUEJTKHVOKV5EJNCWHGP\WO#PP·JGP<'+ ++



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU +:   4KVVGTMTGW\ )QNF   GOCKNNKGTV  I OKP #DRNCV\WPIGP KP FGT TQVGP 'OCKNNG FGT 8QTFGTUGKVG $CPFTKPI RWP\KGTV OKV   -QRGPJCIGPGT,CJTGURWP\GHÒTCO$CPF<'+ ++p



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI (TGFGTKM 8+++   4KVVGTMTGW\ )QNF   GOCKNNKGTVIKO$CPFTKPIOGJTHCEJIGRWP\VCOPGWGP2GPVCIQPCNDCPF<'+ +p++



#NNG+PUKIPKGPOKVFGO/QPQITCOO-ÌPKI(TGFGTKMU8+++UKPFCWHITWPFUGKPGTUGJTMWT\GP4GIKGTWPIU\GKVXQPPWT UGEJU,CJTGPUGNVGP

8224

8221 8223 8222



&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU :   -QOOCPFGWTMTGW\   )QNF GOCKNNKGTV  I CWH FGO $CPFTKPI -QRGPJCIGPGT (GKPIGJCNVURWP\G OKV *CNUDCPF <'+    +p++





&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU :   -QOOCPFGWTMTGW\   5KNDGTXGTIQNFGVWPFGOCKNNKGTV-TQPGWPF$CPFTKPIGVYCUXGTDQIGPQJPG*CNUDCPF ++





&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU :   4KVVGTMTGW\ )QNF   GOCKNNKGTVI OKV$CPFTKPI $CPFTKPICWU$TQP\GGTI·P\VOKVCNVGO$CPF<'+ ++





&CPGDTQI1TFGP  /QFGNN OKV /QPQITCOO -ÌPKI %JTKUVKCPU :   4KVVGTMTGW\ 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVCO$CPFOKV0CFGN<'+ +p++



56


DÄNEMARK

8225 (1:1)



&CPGDTQI1TFGP/QFGNNOKV/QPQITCOO-ÌPKI(TGFGTKM+:  )TQ­MTGW\UGVDGUVGJGPF CWU-NGKPQF)QNF IGRTÒHV GOCKNNKGTVKO6TCIGTKPIOGJTHCEJRWP\KGTVZOOICO QTKIKPCNGPWPFIGVTCIGPGP'KPMPÌRH5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKN NKGTVCWHFGT4ÒEMUGKVGRWP\KGTV#/ZOOCP&QRRGNPCFGNKO1TKIKPCNGVWKFGT(KTOC# /KEJGNUGPKP-QRGPJCIGPOKVIQNFHCTDGPGO&<'+ 5VÒEM+



8228 8226

8227

8229 ca. 1:2



/GFCKNNGHÒTFGP&GWVUEJ&·PKUEJGP-TKGIXQP$TQP\GCOQTKIKPCNGPCNVGP$CPF

++





'JTGP\GKEJGP FGU &·PKUEJGP 4QVGP -TGW\GU HÒT    5KNDGT GOCKNNKGTV CO 2GPVCIQPCNDCPF   KOQTKIKPCNGP8GTNGKJWPIUGVWKXQP#/KEJGNUGPKP-QRGPJCIGPOKVTQVGO-TGW\ ++





/KPKCVWTGPUEJPCNNG OKV \YGK #WU\GKEJPWPIU/KPKCVWTGP   &KGPUVCWU\GKEJPWPIU/GFCKNNG FGT /C   TKPG5KNDGT -TKGIUGTKPPGTWPIUOGFCKNNG$TQP\G 5VÒEM++





2JQVQ XQP % . 5VGKPJCWGT 8QO MIN *QHRJQVQITCRJGP ' *QJNGPDGTI KP -QRGPJCIGP OKV   4KVVGTMTGW\ FGU &CPGDTQI1TFGPU  -NCUUG FGU ÌUVGTTGKEJKUEJGP 1TFGPU FGT 'KUGTPGP -TQPG   4KVVGTMTGW\FGTHTCP\ÌUKUEJGP'JTGPNGIKQP  4KVVGTMTGW\GFGUUEJYGFKUEJGP0QTFUVGTPWPF FGU9CUC1TFGPUWPF-NCUUGFGUTWUUKUEJGP5VCPKUNCWU1TFGPU7O ++

 57


ESTLAND

8230 (1:1)

'56.#0& '456' 4'27$.+-   

1TFGPXQO(TGKJGKVUMTGW\#DVGKNWPI HÒT<KXKNXGTFKGPUVG -TGW\-NCUUG)QNFGOCKNNKGTV IKPFGT¤UGWPFKO$CPFTKPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G,-HÒTFKG(KTOC-KKYGTKP 6CNNKPP  OKV QTKIKPCNGO \GKVIGPÌUUKUEJGO *CNUDCPF KO QTKIKPCNGP DNCWGP 8GTNGKJWPIUGVWK OKV   IQNFHCTDGPGO#WHFTWEM6#//<'+ 44+  'ZGORNCT XQP ITQ­GT 5GNVGPJGKV WPF KP CDUQNWVGT $GUVGTJCNVWPI 0CEJ 9CNVGT KP 9#. 5   YWTFG FKGUG -NCUUG   PWTOCNXGTNKGJGP  )GUVKHVGVCO(GDTWCTCNUFTGKMNCUUKIGT1TFGP KPFTGK#DVGKNWPIGP HÒT8GTFKGPUVGKO7PCDJ·PIKIMGKVUMTKGI IGIGPFKG$QNUEJGYKMGP

8231 (1:1)



1TFGP XQO 9GK­GP 5VGTP  /QFGNN   5GV FGT  -NCUUG DGUVGJGPF CWU -NGKPQF   $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO UR·VGTGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG $TQP\G   XGTIQNFGVWPFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP<'+ 5VÒEM++  9CNVGTPGPPVKP9#. 5 XQPDKUKPUIGUCOV  8GTNGKJWPIGPFGT-NCUUGFCXQPCP'UVGP WPFXKGTCP&GWVUEJG  1DYQJNDGTGKVUIGUVKHVGVMCOFGTHÒPHMNCUUKIG<KXKNWPF/KNKV·T8GTFKGPUVQTFGPGTUVCD\WT8GTNGKJWPI /KVFGT#PPGMVKQP'UVNCPFUFWTEJFKG5QYLGVWPKQPGTNQUEJCWEJFGT1TFGP#O/CKYWTFGGTXQPFGT \YGKVGPGUVPKUEJGP4GRWDNKMYKGFGTKPU.GDGPIGTWHGP

58


ESTLAND

8232 (1:1)



1TFGP XQO 9GK­GP 5VGTP  /QFGNN   5GV FGT  -NCUUG DGUVGJGPF CWU -NGKPQF   $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO UR·VGTGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG $TQP\G   XGTIQNFGVWPFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP<'+ ++  5GVCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPGPQTFCOGTKMCPKUEJG2TKXCVUCOONWPI 0T

8234 (1:1)

8233



1TFGPXQO9GK­GP5VGTP/QFGNN  &GMQTCVKQPFGT-NCUUG$TQP\GXGTIQNFGV WPFGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF&C\WHKPPKUEJG/GFCKNNGPCO$CPF<'+ +p++



1TFGP XQO #FNGTMTGW\  /QFGNN   5GV FGT  -NCUUG DGUVGJGPF CWU -NGKPQF 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVCOPGWGP5EJWNVGTDCPF XGTUEJOWV\VVGKNYGKUGOKV-NGDUVQHH WPF$TWUVUVGTP 5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN OKV \YGK 5GKVGPJCMGP <'+  5VÃ&#x2019;EM++ 



5GVCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPGPQTFCOGTKMCPKUEJG2TKXCVUCOONWPI 0T  .CWV 9CNVGT 9#. 5 H  KUV FKG  -NCUUG FKGUGU 1TFGPU XQP  DKU  KPUIGUCOV PWT  OCN   XGTNKGJGPYQTFGP

59


ESTLAND

8235 (1:1)



1TFGPXQO#FNGTMTGW\/QFGNN  5GVFGT-NCUUGDGUVGJGPFCWU-TGW\FGT-NCUUG $TQP\G XGTIQNFGV 5KNDGT GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV   VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN OKV \YGK 5GKVGPJCMGP KO 1TKIKPCNGVWK FGT (KTOC 4QOCP   6CXCUVKP6CNNKPP<'+ 5VÃ&#x2019;EM+p++  .CWV 9CNVGT 9#. 5 H  KUV FKG  -NCUUG FKGUGU 1TFGPU XQP  DKU  KPUIGUCOV PWT  OCN XGTNKGJGP   YQTFGP

8236 (1:1)



1TFGPXQO#FNGTMTGW\/QFGNN  5GVFGT-NCUUGDGUVGJGPFCWU-TGW\FGT-NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV VGKNYGKUG   XGTIQNFGVWPFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGPKO1TKIKPCNGVWKFGT(KTOC4QOCP6CXCUVKP 6CNNKPP<'+ 5VÃ&#x2019;EM++  5GVCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPGPQTFCOGTKMCPKUEJG2TKXCVUCOONWPI0T

60


FINNLAND

8238

8237 (1:1)



1TFGP XQO 4QVGP -TGW\  /QFGNN   $TWUVUVGTP \WT  MNCUUG 5KNDGT VGKNYGKUG   XGTIQNFGVWPFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP<'+ 4+p++  .CWV 9CNVGT 9#. 5 HH  KUV FKG  -NCUUG FKGUGU 1TFGPU XQP  DKU  CNU #WU\GKEJPWPI FGU 'UVPKUEJGP   4QVGP-TGW\GU PWTOCNWPFXQPDKU CNUUVCCVNKEJGT1TFGP PWTOCNXGTNKGJGPYQTFGP  )GUVKHVGV  CNU GKPMNCUUKIG #WU\GKEJPWPI YWTFG GT  KP GKPGP HÒPHMNCUUKIGP 8GTFKGPUVQTFGP FGU 'UVPKUEJGP   4QVGP-TGW\GUWOIGYCPFGNV#O1MVQDGTYWTFGGTGKPUVCCVNKEJGT1TFGP/KVFGT#PPGMVKQP'UVNCPFUFWTEJ FKG 5QYLGVWPKQP  GTNQUEJ CWEJ FGT 1TFGP #O  /CK  YWTFG GT XQP FGT \YGKVGP GUVPKUEJGP 4GRWDNKM   YKGFGTKPU.GDGPIGTWHGP



9GK­GU -TGW\ CWEJ 5EJWV\MQTRU'JTGP\GKEJGP IGPCPPV  -TGW\  -NCUUG $TQP\G XGTIQNFGV WPF   GOCKNNKGTV CO 1TKIKPCNDCPF \WUCOOGP KO +PVGTKOUUEJPCNNG KO QTKIKPCNGP GVYCU DGUEJ·FKIVGP 8GTNGK   JWPIUGVWKFGT(KTOC4QOCP6CXCUVKP6CNNKPP81.2'5 ++



8239 8240

(+00.#0&4'27$.+- 



1TFGPFGU(TGKJGKVUMTGW\GU/QFGNN OKVFGT,CJTGU\CJN (TGKJGKVUOGFCKNNG-NCUUGOKVFGO 4QVGP -TGW\ 5KNDGT VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG OGJTHCEJ RWP\KGTV WC OKV 5KNDGTRWP\G   *WPF,CJTGURWP\G/HÒT COQTKIKPCNGP$CPF<'+ ++



1TFGPFGT(KPPKUEJGP9GK­GP4QUG(·NUEJWPI  FGU)TQ­MTGW\GU$TQP\GXGTIQNFGVWPFGOCKNNKGTV QJPG2WP\KGTWPICO5EJWNVGTDCPF ++



&KGUGUGKVFGPGT,CJTGPDGMCPPVGP(·NUEJWPIGPUKPFFCTCP\WGTMGPPGPFCUUFGTTGEJVGWPVGTG.ÌYGPCEJNKPMU UVCVV PCEJ TGEJVU CNUQ KP FKG XGTMGJTVG 4KEJVWPI UEJCWV 5GKPGT\GKV YWTFGP FKGUG 'ZGORNCTG QHV CNU HTCP\ÌUKUEJG   #PHGTVKIWPIGP CPIGDQVGP #WEJ JGWVG PQEJ YGTFGP \WYGKNGP UQNEJG 5VÒEMG CWH #WMVKQPGP CNU 1TKIKPCNGZGORNCTG   CPIGDQVGP #O,CPWCTUVKHVGVGFGTPWPOGJTKIG4GKEJUXGTYGUGT%CTN)WUVCX(TGKJGTTXQP/CPPGTJGKOFGPMNCUUKIGP 1TFGP FGO FCU <GKEJGP FGT (KPPKUEJGP 9GKUGP 4QUG UQYKG GKPG FTGKUVWHKIG 8GTFKGPUVOGFCKNNG CPIGUEJNQUUGP KUV    YWTFGP +PUKIPKGP OKV 5EJYGTVGTP HÒT 6CRHGTMGKV KO (GNFG IGUEJCHHGP 8IN -NKGVOCPP -WTV) (KPPNCPF    1TFGPFGT(KPPKUEJGP9GK­GP4QUG+P1TFGPU.GZKMQP$CPF$GTNKPQ, 

61


FINNLAND

8241 8242





1TFGPFGT(KPPKUEJGP9GK­GP4QUG/QFGNN UGKVOKVDTGKVGO$CPFTKPIWPF$TWUVUVGTPCWH \YGK5RKV\GPUVGJGPF -QOOCPFGWTUUGV-NCUUGDGUVGJGPFCWU-QOOCPFGWTMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVKPFGT6TCIGÌUGOGJTHCEJRWP\KGTV WC,CJTURWP\G5HÒT COQTKIKPCNGPWPFIG VTCIGPGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   OGJTHCEJRWP\KGTV WC5KNDGTRWP\G*WPF,CJTGURWP\G5HÒT CPXGTIQNFGVGT0CFGNKO QTKIKPCNGPJGNNDNCWGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC#6KNNCPFGTKP*GNUKPMK<'+ 5VÒEM++



1TFGP FGT (KPPKUEJGP 9GK­GP 4QUG -QOOCPFGWTMTGW\  #WUICDG OKV 5RTWPITKPI  DKU     5KNDGTXGTIQNFGVWPFGOCKNNKGTVFGT5RTWPITKPIOGJTHCEJRWP\KGTV WC8.HÒT8KMVQT.KPFOCPPWPF ,CJTGURWP\G2HÒTOKVCNVGO*CNUDCPFCDUEJPKVV<'+ 4++



'ZGORNCT CWU FGT GTUVGP (GTVKIWPIUUGTKG 0CEJ #WUMWPHV XQP (TCW &T - 6KNNCPFGT)QFGPJKGNO UVGJV FKG 2WP\G   8.HÒT8KMVQT.KPFOCPFGPGTUVGP*GTUVGNNGTFGT1TFGPUKPUKIPKGPFGTFKGUGPQEJXQT6KNNCPFGTJGTIG UVGNNVJCV9TGFG 94'& \WHQNIGYWTFGFKGUGU/QFGNNPWTDKUXGTNKGJGP'TIKDV UWPF5 HÒT FKG,CJTGWPFGKPG<CJNXQP-QOOCPFGWTGP-NCUUGWPF-QOOCPFGWTGP-NCUUGCP

8244

8243 8245







62

1TFGP FGT (KPPKUEJGP 9GK­GP 4QUG -QOOCPFGWTMTGW\  #WUICDG OKV 5RTWPITKPI  DKU     -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVKOFGT¤UGOGJTHCEJRWP\KGTV WC#6HÒTFKG (KTOC#6KNNCPFGTKP*GNUKPMKWPF5KNDGTRWP\G* OKVQTKIKPCNGOIGVTCIGPGP*CNUDCPFCDUEJPKVV \WUCOOGPOKV-PQRHNQEJTQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC6KNNCPFGTOKVMNGKPHQTOCVKIGO IQNFGPGO5VCCVUYCRRGP<'+ ++



1TFGP FGT (KPPKUEJGP 9GK­GP 4QUG -QOOCPFGWTMTGW\  #WUICDG OKV 5RTWPITKPI  DKU     5KNDGTXGTIQNFGVWPFGOCKNNKGTVKOFGT¤UGOGJTHCEJRWP\KGTV WC#6HÒTFKG(KTOC#6KNNCPFGTKP *GNUKPMK WPF 5KNDGTRWP\G *  OKV QTKIKPCNGO IGVTCIGPGP *CNUDCPFCDUEJPKVV \WUCOOGP OKV   -PQRHNQEJTQUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC 6KNNCPFGT OKV ITQ­HQTOCVKIGO IQNFGPGO   5VCCVUYCRRGP<'+ ++



1TFGP FGT (KPPKUEJGP 9GK­GP 4QUG -QOOCPFGWTMTGW\  #WUHÒJTWPI OKV YCCITGEJV CPIGNÌVGVGT   ¤UGUGKV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP\KGTV WC#6HÒTFKG(KTOC # 6KNNCPFGT KP *GNUKPMK  CO QTKIKPCNGP *CNUDCPF OKV /GVCNNUEJNKG­GP KO 1TKIKPCNGVWK FGT (KTOC   6KNNCPFGTOKVIQNFHCTDGPGOHKPPKUEJGP5VCCVUYCRRGP<'+ ++




FINNLAND

8247

8246





1TFGP FGT (KPPKUEJGP 9GK­GP 4QUG -QOOCPFGWTMTGW\  #WUHÒJTWPI OKV YCCITGEJV CPIGNÌVGVGT   ¤UGUGKV 5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP\KGTV WC#6HÒTFKG(KTOC #6KNNCPFGTKP*GNUKPMK COMWT\GP*CNUDCPFCDUEJPKVV<'+ ++



(KPPKUEJGT.ÌYGPQTFGP)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT ¤UGOGJTHCEJRWP\KGTVQJPG5EJWNVGTDCPFWPF$TWUVUVGTP#WUHÒJTWPIOKVUGRCTCVCWHIGNGIVGP5EJWR RGPHGNFGTP \YKUEJGP FGP 5VTCJNGP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   \CJNTGKEJG2WP\GP WC*GTUVGNNGTRWP\GP#6+..#0&'4WPF#6FGT(KTOC6KNNCPFGTKP*GNUKPMK WPF,CJTGURWP\G#HÒT CP0CFGNFKGUGXGTIQNFGVKOQTKIKPCNGPUEJYCT\GPIQNFGPDGFTWEMVGP 8GTNGKJWPIUGVWKFGT(KTOC#6KNNCPFGT<'+ 5VÒEM+p++



#O  5GRVGODGT  UVKHVGVG FGT HKPPKUEJG 2T·UKFGPV 4[UVQ 4[VK FGP HÒPHMNCUUKIGP 1TFGP FGO GKP 8GTFKGPUV   MTGW\ WPF FKG CO  &G\GODGT  IGUVKHVGVG 2TQ (KPNCPFKC /GFCKNNG CPIGUEJNQUUGP KUV (ÒT OKNKV·TKUEJG 8GT   FKGPUVGKP-TKGIU\GKVGPYKTFFGT1TFGPOKV5EJYGTVGTPXGTNKGJGP

8248





8249

(KPPKUEJGT.ÌYGPQTFGP-NGKPQF\WO)TQ­MTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJ RWP\KGTV WC*GTUVGNNGTRWP\G#6FGT(KTOC6KNNCPFGTWPFXGTUEJNCIGPG,CJTGURWP\G QJPG5EJWNVGT DCPF<'+ +p++



(KPPKUEJGT.ÌYGPQTFGP-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGOGJTHCEJRWP \KGTV WC#6HÒTFGP*GTUVGNNGT6KNNCPFGTWPF*HÒTGT5KNDGT CO*CNUDCPFKO1TKIKPCNGVWK FGT(KTOC6KNNCPFGTOKVIQNFHCTDGPGOHKPPKUEJGP.ÌYGP<'+ ++

 63


FINNLAND

8250

8251 8252



(KPPKUEJGT .ÌYGPQTFGP 4KVVGTMTGW\  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV KP FGT ¤UG OGJTHCEJ   RWP\KGTV WC#6HÒTFGP*GTUVGNNGT6KNNCPFGTWPF*HÒTGT5KNDGT CO$CPFOKVCWHIGNGIVGT 4QUGVVG<'+ ++





5RQTV8GTFKGPUVQTFGP 8GTFKGPUVMTGW\ KP 5KNDGT $TQP\G XGTUKNDGTV VGKNYGKUG XGTIQNFGVWPFGOCKNNKGTV CO$CPF<'+ +p++





1N[ORKUEJGU 8GTFKGPUVMTGW\ (KPPNCPFU 1N[ORKUEJG 8GTFKGPUVOGFCKNNG 5KNDGT KO 4CPF OGJTHCEJ   RWP\KGTV WC5KNDGTRWP\G*WPF,CJTGURWP\G;HÒT COGVYCUXGTUEJOWV\VGPQTKIKPCNGP $CPFOKV0CFGN6'66CH 4GKJG <'+ ++



8253

8254

8255

8256

8257



8GTFKGPUVMTGW\FGT<KXKNGP9CEJG'KUGTPGU8GTFKGPUVMTGW\VGKNYGKUGGOCKNNKGTVQJPG$CPFKOQTKIK PCNGP8GTNGKJWPIUGVWK6'66CH 4GKJG  ++





$NCWGU-TGW\FGT(TGKYKNNKIGP8GTVGKFKIWPI$TQP\GGOCKNNKGTVCO$CPF6'66CH 4GKJG  ++





/GFCKNNGHÒTFKG6GKNPGJOGTCPFGT5EJNCEJVWPFFGT'TQDGTWPIXQP*GNUKPMK8GTUKNDGTVCO QTKIKPCNGP$CPF6'66CH 4GKJG  ++





'TKPPGTWPIUOGFCKNNGHÒTFKG6GKNPGJOGTCPFGT5EJNCEJVXQP6CORGTG$TQP\GXGTUKNDGTVCO QTKIKPCNGP$CPF6'66CH 4GKJG  ++





/GFCKNNG HÒT FKG 6GKNPGJOGT CO )GHGEJV XQP #WPWU  $TQP\G CO QTKIKPCNGP $CPF OKV   $CPFURCPIG#70756'66CH 4GKJG  ++



64


FINNLAND

8259 Rs.

8261

8260

8262

ex 8258



-QPXQNWV XQP \YÌNH 9KPVGTMTKGIU6GKNPGJOGT/GFCKNNGP  ,GYGKNU 'KUGP IGUEJY·T\V CP   QTKIKPCNGP $·PFGTP LGYGKNU OKV GKPGT CWHIGNGIVGP $CPFURCPIG 21*,1+5-#4,#.# -16+,17-16   57//# -'066#4/'+,# 4#00+--1271.75675 .##61-#0 -#4,#.# 6#+2#.'   -#+077 +./#271.75675 -#4,#.#0-#00#5571/755#./+WPF61.8#,48+PGWP FCXQP\WU·V\NKEJOKVIGMTGW\VGP5·DGNPCWHFGO$CPF6'66CH 4GKJGWPF  5VÒEM++





9KPVGTMTKGIU6GKNPGJOGT/GFCKNNG  HÒT CWUN·PFKUEJG (TGKYKNNKIG 'KUGP IGUEJY·T\V CO   QTKIKPCNGP$CPFOKV$CPFURCPIG.#22+WPFIGMTGW\VGP5·DGNP6'66CH 4GKJG  ++





9KPVGTMTKGIU6GKNPGJOGT/GFCKNNG  HÒT CWUN·PFKUEJG (TGKYKNNKIG 'KUGP IGUEJY·T\V CO   QTKIKPCNGP$CPFOKV$CPFURCPIG-16+,17-166'66CH 4GKJGXCT  ++





/GFCKNNGHÒT8GTFKGPUVGKPFGT<KXKNGP8GTVGKFKIWPI/GFCKNNG-NCUUG$TQP\GXGTUKNDGTV

GVYCU DGTKGDGP  CWH FGT 4ÒEMUGKVG ITCXKGTV 6'*6#+.+,# -##4.1 9#.610'0 + .71--#   51.,'..#COQTKIKPCNGP$CPFOKV$CPFURCPIG6'66CH 4GKJG  ++



9KPVGTMTKGIU6GKNPGJOGT/GFCKNNG  HÒT CWUN·PFKUEJG (TGKYKNNKIG /GFCKNNG KP 5KNDGT   5KNDGT KO 4CPF OGJTHCEJ RWP\KGTV WC 5KNDGTRWP\G  * WPF ,CJTGURWP\G / HÒT   CO   QTKIKPCNGP$CPF6'66CH 4GKJGXCT  ++





8263

8264

8265

8266



-TGW\ HÒT FKG 6GKNPGJOGT CP FGT 5EJNCEJV XQP -QNNCC  )GUEJY·T\V VGKNYGKUG XGTUKNDGTV   WPFGOCKNNKGTVCO$CPF6'66CH 4GKJG  ++





-TGW\ HÒT 6GKNPGJOGT CP FGT 5EJNCEJV CO /KVVNGTGP +UVJOWU  )GUEJY·T\V VGKNYGKUG   XGTUKNDGTVCOQTKIKPCNGP$CPF QJPG*GNOCWHNCIG 6'66CH 4GKJG  ++





-TGW\ HÒT FKG 6GKNPGJOGT CP FGT 5EJNCEJV XQP 5WOOC  $TQP\G XGTUKNDGTV CWH FGT   4ÒEMUGKVG/CVTKMGNPWOOGTCOQTKIKPCNGP$CPF6'66CH 4GKJG  ++





-TGW\ HÒT FKG 6GKNPGJOGT CP FGT 5EJNCEJV XQP 6CKRCNG  $TQP\G CO QTKIKPCNGP $CPF   6'66CH 4GKJG  ++

 65


FINNLAND

8269

8270

8268

8267



.WHVYCHHGP-TGW\)GUEJY·T\VVGKNYGKUGXGTIQNFGVCOQTKIKPCNGP$CPFOKV\YGK$CPFURCP IGP.'061,17-16WPF8+'56+,17-166'66CH 4GKJG  ++





-TGW\HÃ&#x2019;T/KNKV·TFKGPUVCPFGT*GKOCVHTQPV$TQP\GXGTUKNDGTV GVYCUDGTKGDGP WPFGOCKN NKGTVQOQTKIKPCNGP$CPF6'66CH 4GKJG  ++p





-TGW\ FGT UKGDVGP &KXKUKQP  8GTUKNDGTV VGKNYGKUG IGUEJY·T\V CWH FGT 4Ã&#x2019;EMUGKVG RWP\KGTV   /'4--+-'-575COQTKIKPCNGP$CPF6'66CH 4GKJG  ++





-CTGNKGP-TGW\  $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP $CPF 6'6 6CH   

4GKJG  ++



8271

8272

8273

8274

8275



-TGW\ FGT GNHVGP &KXKUKQP  5KNDGT GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG RWP\KGTV 6'.,'-5'6   570&18+56COQTKIKPCNGP$CPF6'66CH 4GKJG  ++





-TGW\FGT$TKICFG-WWUUCCTK  $TQP\GGOCKNNKGTVCO$CPF6'66CH 4GKJG 





-TGW\ FGT CEJVGP &KXKUKQP  8GTUKNDGTV CWH FGT 4Ã&#x2019;EMUGKVG RWP\KGTV 6'.,'-5'6   570&18+56COQTKIKPCNGP$CPF6'66CH 4GKJG  ++





-TGW\FGTGTUVGP&KXKUKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPF6'66CH  4GKJG  ++





-TGW\HÃ&#x2019;TFKG-Ã&#x2019;UVGP#TVKNNGTKG5KNDGTVGKNYGKUGXGTIQNFGVCOQTKIKPCNGP$CPF6'66CH  4GKJG  ++



66

++


FINNLAND

8276

8277

8278

8279



-TGW\FGTM·ORHGPFGP'KPJGKVFGT1KPQPGP-CXCNNGTKG$TKICFG$TQP\GXGTIQNFGVVGKN YGKUGIGUEJY·T\VCOQTKIKPCNGP$CPF6'66CHN 4GKJG  ++





-TGW\HÃ&#x2019;TFKG8KGTVG&KXKUKQP)GUEJY·T\VCOQTKIKPCNGP$CPF6'66CH 4GKJG  ++





-TGW\ HÃ&#x2019;T FKG HÃ&#x2019;PHVG &KXKUKQP .[PZ  8GTUKNDGTV VGKNYGKUG XGTIQNFGV CO QTKIKPCNGP $CPF   6'66CH 4GKJG  ++





'TKPPGTWPIUMTGW\  HÃ&#x2019;T +PIGPKGWTGKPJGKVGP 'KUGP IGUEJY·T\V VGKNYGKUG XGTIQNFGV CWH FGT   4Ã&#x2019;EMUGKVGRWP\KGTV#4COQTKIKPCNGP$CPF6'66CH 4GKJG  ++



8283

8280









ex 8281

8282

'TKPPGTWPIUMTGW\HÃ&#x2019;T+PIGPKGWTGKPJGKVGP'KUGPIGUEJY·T\VOKP-QTTQUKQPUURWTGPVGKN YGKUGXGTIQNFGVCWHFGT4Ã&#x2019;EMUGKVGRWP\KGTV#4COQTKIKPCNGP$CPF6'66CH 4GKJG  ++



-QPXQNWVXQPHÃ&#x2019;PHXGTUEJKGFGPGP#WU\GKEJPWPIGP7C5RQTV8GTFKGPUVOGFCKNNGKP5KNDGTWPF(TGK JGKVUOGFCKNNG  -NCUUG  XGTUEJKGFGPG /GVCNNG \YGK CWU 5KNDGT  KP QTFGPVNKEJGP 'TJCNVWPIGP   LGYGKNUCPQTKIKPCNGP$·PFGTP 5VÃ&#x2019;EM++



#D\GKEJGP FGT <KXKNGP )CTFG FGT .CPFUEJCHV 8CTUKPCKU5WQOK  'IGPVNKIC (KPPNCPF 5KNDGT   GOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVGOGJTHCEJRWP\KGTV WC5KNDGTRWP\G*WPFWPNGUGTNKEJGT,CJTGURWP\G  CO$CPF ++



#D\GKEJGPGKPGU#TVKNNGTKG4GIKOGPVU5KNDGTGOCKNNKGTVGKPKIG*CCTTKUUGWPF#WUDTWEJKPFGTYGK­GP 'OCKNNGCWHFGT4Ã&#x2019;EMUGKVGITCXKGTV#TVKNNGTK+8CP3WGTPCFGN ++p+++

 67


FRANKREICH

8284 (1:1)

(4#0-4'+%* -¤0+)4'+%*#0%+'04')+/' $+5  

-ÌPKINKEJGT WPF /KNKV·TKUEJGT 1TFGP XQO JN .WFYKI =1TFTG 4Q[CN GV /KNKVCKTG FG 5CKPV .QWKU?   4KVVGTMTGW\GTUVG#WUHÒJTWPI OKVUVCTMIGYÌNDVGP/GFCKNNQPUEC 6[RQJPG-ÒIGNEJGP CP FGP -TGW\CTOGPFGP )QNF GOCKNNKGTV  I FGT \YGKINKGFTKIG $CPFTKPI YWTFG OÌINKEJGTYGKUG   Y·JTGPFFGT<GKVFGU4GIGPVUEJCHVFGU*GT\QIUXQP1TN¾CPU\YKUEJGPWPFQFGT\W$GIKPP FGT4GIKGTWPI-ÌPKI.WFYKI:8  GTI·P\VQJPG$CPF<'+ 444+p++  'ZGORNCTFGT#WMVKQPFGU/CKUQP2NCVVKO&TQWQV4KEJGNKGWKP2CTKUCO#RTKN0T#PHGTVKIWPICWUFGT 5VKHVWPIU\GKVKPGKPGOHÒTFCU#NVGTCDUQNWVWPIGYÌJPNKEJJGTXQTTCIGPFGTJCNVGPGP<WUVCPFXQPCNNGTITÌ­VGT5GNVGP JGKV YKG CWEJ XQP JÌEJUVGT JKUVQTKUEJGT $GFGWVWPI FC FKG GTUVGP 8GTNGKJWPIGP XQP -ÌPKI .WFYKI :+8     RGTUÌPNKEJXQTIGPQOOGPYWTFGP5GJT·JPNKEJG'ZGORNCTGUKPFDGK%QNNKIPQP KP%1..+)5H#DD DKU CDIGDKNFGV  &GT FTGKMNCUUKIG 8GTFKGPUVQTFGP HÒT OKNKV·TKUEJG 6CRHGTMGKV YWTFG CO  #RTKN  XQP -ÌPKI .WFYKI :+8    IGUVKHVGV &WTEJ FKG %QPXGPVKQP 0CVKQPCNG CO  1MVQDGT  CDIGUEJCHHV YWTFG GT XQP .WFYKI :8+++     YKGFGTGTTKEJVGVWOOKVFGT4GXQNWVKQPXQPGPFIÒNVKIWPVGT\WIGJGP

8286 (1:1)

8285 (1:1)



8285 (1:1)

-ÌPKINKEJGT WPF /KNKV·TKUEJGT 1TFGP XQO JN .WFYKI =1TFTG 4Q[CN GV /KNKVCKTG FG 5CKPV .QWKU?   4KVVGTMTGW\#WUHÒJTWPIQJPG-ÒIGNEJGPCPFGP-TGW\CTOURKV\GP)QNFGOCKNNKGTVGKPKIGCNVG*CCTTKUUG KPFGTYGK­GP'OCKNNGXQP8QTFGTWPF4ÒEMUGKVG#DRNCV\WPIGPKPFGT'OCKNNGFGUTÒEMUGKVKIGP/GFCKN NQPTKPIUQJPG2WP\KGTWPICOMCPPGNKGTVGP$CPFTKPICOCNVGP\GKVIGPÌUUKUEJGP$CPFCDUEJPKVV<'+ 4++++p+++ #PHGTVKIWPICWUFGONGV\VGP&TKVVGNFGU#EJV\GJPVGP,CJTJWPFGTVU



/KNKV·T8GTFKGPUVQTFGP=1TFTGFW/¾TKVG/KNKVCKTG?#WUICDG  #WUHÒJTWPIQJPG-Ò IGNEJGP CP FGP -TGW\URKV\GP WPF OKV GKPVGKNKIGP /GFCKNNQPU 4KVVGTMTGW\ )QNF GOCKNNKGTV CO   MCPPGNKGTVGP$CPFTKPICOQTKIKPCNGPCNVGP$CPF<'+ ++  &C FGT OKNKV·TKUEJG 1TFGP XQO JGKNKIGP .WFYKI -CVJQNKMGP XQTDGJCNVGP YCT UVKHVGVG .WFYKI :8  FKG FTGK    MNCUUKIG &GMQTCVKQP /¾TKVG /KNKVCKTG CO DNCWGO $CPFG HÒT CWUN·PFKUEJG RTQVGUVCPVKUEJG 1HHK\KGTG KP HTCP\ÌUKUEJGP   &KGPUVGP&KG'ORH·PIGTYCTGPJCWRVU·EJNKEJ5EJYGK\GT0KGFGTN·PFGTWPF&GWVUEJG5KGJGCWEJ0T

68




FRANKREICH

8287 (1:1)



/KNKV·T8GTFKGPUVQTFGP=1TFTGFW/¾TKVG/KNKVCKTG?#WUICDG  #WUHÒJTWPIOKV-ÒIGN EJGPCPFGP-TGW\URKV\GP4KVVGTMTGW\)QNFGOCKNNKGTV\YGK-TGW\CTOMWIGNPGVYCUXGTDQIGPOGJTGTG OKPKOCNG'OCKNNGCWUDTÒEJGWPF*CCTTKUUGKPFGTYGK­GPUQYKGGKPKIGQDGTHN·EJNKEJGP%JKRUKPFGTTQVGP 'OCKNNGCOUR·VGTGP$CPF<'+ ++p+++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T &GTªDGTNKGHGTWPIPCEJXGTNKGJGPCP*CPU4WFQNHXQP*CTVOCPPKU CWHFGO$KNF CWU2CTRCP )TCWDÒPFGP  KP HTCP\ÌUKUEJGP &KGPUVGP UGKV  /CT¾EJCN FG ECORU  +P PGWGTGT <GKV VTGVGP (·NUEJWPIGP FGU UGNVGPGP 1TFGPU   CWH KPFGO GKP HCNUEJGU <GPVTWO KP GKPGP 5V .WFYKIU1TFGP IGUGV\V YKTF &KGUGU 'ZGORNCT YWTFG  CWU GKPGT   CNVGP 5EJYGK\GT 5COONWPI GTYQTDGP WPF KUV OKV ITÌUUVGT 9CJTUEJGKPNKEJMGKV KO QTKIKPCNGP <WUVCPF 5KEJGTJGKV   MCPPP PKEJV DGUVGJGP FC \WO $GKURKGN GKPG YKEJVKIG QHHK\KGNNG (CDTKMCPVKP FKG 9KVYG 8CNNC[GT FKG -TGW\G KP    MCT·VKIGOFKG<GPVTGPCDGTKPMCT·VKIGO)QNFJGTUVGNNVG7GDGTFKGUHCPFGPCWEJ\GKVIGPÌUUKUEJG7ODCWVGPUVCVV 5QDGCWHVTCIVGFCU-TKGIUOKPKUVGTKWOFGP.KGHGTCPVGP4G[PCWF-QOOCPFGWT-TGW\GFGU/¾TKVG/KNKVCKTGKP UQNEJGFGU5V.WFYKIU1TFGPU\WXGTYCPFGNP UKGJG%NQCTGE#NCKPKP#TV%WTKQUKV¾U0T  5 

8289

8290

8288



'JTGP\GKEJGPFGT<YGK5EJYGTVGT=/¾FCKNNGFGUFGWZ—R¾GU?)TÌ­GTG#WUHÒJTWPIZOO $TQP\GOKV4GUVXGTIQNFWPIOKVCEJV.ÌEJGTP\WO#PP·JGP ++



)GFGPMOGFCKNNGCPFCU(ÌFGTCVKQPUHGUVCO,WNK=/¾FCKNNG%QOO¾OQTCVKXGFGNC(¿VGFGNG (¾F¾TCVKQPCW,WKNNGV?ZOOXGTIQNFGVCOCNVGP$CPF ++



-¤0+)4'+%*-1056+676+10'..'/10#4%*+'   

#O,WNKFGOGTUVGP,CJTGUVCIFGU5VWTOUCWHFKG$CUVKNNGHCPFCWHFGO2CTKUGT/CTUHGNFFCUUQIGPCPPVG (ÌFGTCVKQPUHGUVUVCVVCPFGO-ÌPKI.WFYKI:8+XQT#DIGUCPFVGPCWU&¾RCTVGOGPVU(TCPMTGKEJUGKPGP HGKGTNKEJGP 'KF CWH FKG 8GTHCUUWPI FKG 0CVKQP WPF FCU )GUGV\ NGKUVGVG FGT XQO 8QNM YKGFGTJQNV YWTFG #WHITWPF   FKGUGU(GUVGU WPFPKEJVYKGIGOGKPJKPCPIGPQOOGPYKTFKP'TKPPGTWPIFGU5VWTOUCWHFKG$CUVKNNG DGIGJV (TCPMTGKEJCPFKGUGO&CVWODKUJGWVGUGKPGP0CVKQPCNHGKGTVCI

'456' (4#0<¤5+5%*'4'27$.+-   

/GFCKNNGHÒTFKG/KVINKGFGTFGU/CIKUVTCVUFGT'TUVGP+PUVCP\FGU4GXQNWVKQPU6TKDWPCNU=/¾FCKNNG FW/CIKUVTCVFW6TKDWPCNFG2TGOK½TG+PUVCPEG?#WUICDGZOO$TQP\GXGT IQNFGV GVYCUDGTKGDGP OKV5VGORGNUEJPGKFGTUKIPCVWT/#74+55'6COCNVGP$CPFUVÒEM ++

 69


FRANKREICH

8291

8291 8292 (1:2)



/GFCKNNG HÒT FKG #OVUFKGPGT *CPFGNU9·EJVGT WPF 8QNNUVTGEMWPIUDGCOVGP =/¾FCKNNG FGU   *WKUUKGTU)CTFGUFG%QOOGTEGGVCWVTGU'ZGEWVGWTUFG,WFIGOGPVU?#WUICDG'PFGZ OO$TQP\GXGTIQNFGV GVYCUDGTKGDGP CWHFGT4ÒEMUGKVG5VGORGNUEJPGKFGTUKIPCVWT/#74+55'6 (COCNVGP$CPFUVÒEM ++



'456'5 (4#0<¤5+5%*'5-#+5'44'+%*   

1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?NVGTG5COONGTCPHGTVKIWPIGKPGUIGUVKEMVGP $TWUVUVGTPU\WO)TCPF#KING&WTEJOGUUGTOOIQNFHCTDGPG.CJPWPF2CKNNGVVGP5VKEMGTGK ++



8293 (1:1)



1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?/QFGNN QJPG-TQPG #WU HÒJTWPIOKVITQ­GO-QRH0CRQN¾QPUFKGUGTPCEJTGEJVUIGYGPFGV1HHK\KGTUFGMQTCVKQP)QNFGOCKNNKGTV  I OKV $CPF  OGJTGTG #DRNCV\WPIGP KO TÒEMUGKVKIGP /GFCKNNQPTKPI CO QTKIKPCNGP CNVGP   \GKVIGPÌUUKUEJGP$CPFOKVCWHIGNGIVGT5EJNGKHGOKVGEJVIQNFGPGO-PGDGNWPF5EJNKG­ÌUG  444+p++++p  W­GTUVSWCNKV·VUXQNNG#PHGTVKIWPICWUFGT5VKHVWPIU\GKVFGT1TFGPUFGMQTCVKQPKPGKPGOHÒTFCU#NVGTCDUQNWVWPIG YÌJPNKEJ JGTXQTTCIGPF GTJCNVGPGP <WUVCPF XQP CNNGTITÌ­VGT 5GNVGPJGKV YKG CWEJ XQP JÌEJUVGT JKUVQTKUEJGT $GFGW   VWPIFCFKGGTUVGP8GTNGKJWPIGPPQEJXQP0CRQN¾QPRGTUÌPNKEJXQTIGPQOOGPYQTFGPUKPF'KPPCJG\WKFGPVKUEJGU 'ZGORNCTKUVDGK%QNNKIPQP KP%1..+)5#DD CDIGDKNFGV  &KG'JTGPNGIKQPYWTFGCO/CK (NQT¾CN: XQP0CRQN¾QP$QPCRCTVG'TUVGT-QPUWNFGT(TCP\ÌUUKUEJGP 4GRWDNKM CNU GKPG )GOGKPUEJCHV DGUQPFGTU )GGJTVGT IGITÒPFGV 6TCIDCTG +PUKIPKGP UVKHVGVG FGT PWPOGJT -CKUGT    IGYQTFGPGP 0CRQN¾QP + CO  ,WNK  FGTGP )GUVCNVWPI LGFQEJ Y·JTGPF UGKPGT 4GIKGTWPI OGJTHCEJ IG·PFGTV    YWTFG-ÌPKI.WFYKI:8+++ÒDGTPCJOFGPPWPOGJTHÒPHMNCUUKIGP1TFGPKPXGT·PFGTVGT)GUVCNVWPID\Y 9GKVGTG IGUVCNVGTKUEJG #PRCUUWPIGP FGT +PUKIPKGP KP FGP ,CJTGP    WPF  VTWIGP FGP LGYGKNKIGP    RQNKVKUEJGP 8GT·PFGTWPIGP KP (TCPMTGKEJ 4GEJPWPI /KV &GMTGV XQO  0QXGODGT  ·PFGTVG FGT HTCP\ÌUKUEJG    2T·UKFGPV .QWKU#FQNRJG 6JKGTU   FKG )GUVCNVWPI FGT +PUKIPKGP FKG KP FKGUGT (QTO DKU  XGTNKGJGP    YWTFGP

70


FRANKREICH

8294 8296

8297

8295 (1:1)



1TFGP FGT 'JTGPNGIKQP =1TFTG FG NC .¾IKQP F *QPPGWT?  /QFGNN  #WUICDG

.CWDMTQPG OKV HÒPH $ÒIGNP QJPG -ÒIGNEJGP CP FGP 5RKV\GP  EC   .GIKQP·TU CD    4KVVGT&GMQTCVKQP #WUHÒJTWPI OKV FGO -QRH PCEJ NKPMU 5KNDGT /GFCKNNQPU )QNF   GOCKNNKGTVMNGKPGTG$GUEJ·FKIWPIGPKPFGTYGK­GPWPFDNCWGP'OCKNNGFKGITÒPG'OCKNNGHCUVXQNNUV·PFKI CDIGRNCV\VFCU-TGW\EJGPFGT-TQPGCDIGDTQEJGPCOCNVGP$CPF<'+ +++



-¤0+)4'+%*(4#0-4'+%* <9'+6' 4'56#74#6+10   

-ÌPKINKEJGT WPF /KNKV·TKUEJGT 1TFGP XQO JN .WFYKI =1TFTG 4Q[CN GV /KNKVCKTG FG 5CKPV .QWKU?   #WUHÒJTWPI  IGUVKEMVGT$TWUVUVGTP&WTEJOGUUGTOO)QNFNCJPWPF2CKNNGVVGPUVKEMGTGK <GPVTWO 5KNDGT XGTIQNFGV FKG .KNKGP \YKUEJGP FGP -TGW\CTOGP GVYCU GKPIGFGNNV CP GKPGO -TGW\CTO   HGJNGP \YGK #PP·JUEJNCWHGP CWH FGT4ÒEMUGKVGQTKIKPCNGU#DFGEMRCRKGTOKV*GTUVGNNGTDG\GKEJPWPIFGT (KTOC&KGWKO2CNCKU4Q[CNKP2CTKU<'+ ++  'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  &CXQT GZ #WMVKQP 5RKPM  5QP KP .QPFQP KO /CK   +P #PDGVTCEJV FGU JQJGP #NVGTU JGTXQTTCIGPF   GTJCNVGPGU'ZGORNCT)CDTKGN2KGTTG8KEVQT&KGWKPFGT)CN¾TKG4KEJGNKGW0TKO2CNCKU4Q[CNKP2CTKU,WYG NKGTXQPDKUYCTCD,WNK.KGHGTCPVFGU-TKGIUOKPKUVGTKWOUUQYKG*QHNKGHGTCPVXQP.QWKU2JKN KRRG*GT\QIXQP1TN¾CPUFGOUR·VGTGP$ÒTIGTMÌPKI





-ÌPKINKEJGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 4Q[CN FG NC .¾IKQP F *QPPGWT?  /QFGNN  

8QTFGTUGKVGPOGFCKNNQP OKV 2QTVTCKV *GKPTKEJU +8 4ÒEMUGKVGPOGFCKNNQP OKV FTGK .KNKGP      1HHK\KGTUFGMQTCVKQP )QNF GOCKNNKGTV 'OCKNNGCDRNCV\WPIGP KO -TQPTGKH WPF KO TÒEMUGKVKIGP /GFCKNNQP   TKPI KP FGP 5EJNGKHGPGPFGP FGU .QTDGGT WPF 'KEJGPDNCVVMTCP\GU 2CTKUGT )CTCPVKGRWP\G XQP  DKU    9KFFGTMQRH COMCPPGNKGTVGP$CPFTKPICOCNVGP$CPFOKVCWHIGNGIVGT4QUGVVG<'+ ++



-ÌPKINKEJGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 4Q[CN FG NC .¾IKQP F *QPPGWT?  /QFGNN  

8QTFGTUGKVGPOGFCKNNQP OKV 2QTVTCKV *GKPTKEJU +8 4ÒEMUGKVGPOGFCKNNQP OKV FTGK .KNKGP      4KVVGTFGMQTCVKQP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV OKP QDGTHN·EJNKEJG %JKRU KP FGT YGK­GP WPF   ITÒPGP'OCKNNGCOMCPPGNKGTVGP$CPFTKPICOUR·VGTGPLGFQEJCNVGP$CPF<'+ ++

 71


FRANKREICH

8301 (1:1)

8300 (1:1) 8298 (1:1)





8299

-ÌPKINKEJGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 4Q[CN FG NC .¾IKQP F *QPPGWT?  /QFGNN  

8QTFGTUGKVGPOGFCKNNQP OKV 2QTVTCKV *GKPTKEJU +8 4ÒEMUGKVGPOGFCKNNQP OKV FTGK .KNKGP      4GFWMVKQPFGT4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVGKPKIGMNGKPG$GUEJ·FKIWPIGPKPFGT 'OCKNNGCOMCPPGNKGTVGP$CPFTKPIFKGUGT\YGKHCEJRWP\KGTVCOQTKIKPCNGPCNVGPGVYCUCWUIGDNKEJGPGP $CPFTGUV ++p+++



'JTGP\GKEJGPFGT.KNKGHÒTFKG0CVKQPCNICTFGXQP2CTKUUQIGP1TFGTFGT6TGWG=1TFTGFGNC(K F¾NKV¾? 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV OKP #DRNCV\WPIGP KO XQTFGTUGKVKIGP /GFCKNNQPTKPI CO   MCPPGNKGTVGP4KPICOQTKIKPCNGPCNVGP$CPF&'% ++



'ZGORNCTKPGKPGOUEJÌPGP'TJCNVWPIU\WUVCPF



'JTGP\GKEJGPFGT.KNKG=&¾EQTCVKQPFW.KU?5KNDGTJQJNIGHGTVKIVCOCNVGP$CPFHÒTFCU&¾RCTVGOGPV &TÊOG&'%p ++





/GFCKNNGFGT6TGWG=/¾FCKNNGFGNC(KF¾NKV¾?5KNDGT&WTEJOGUUGTOOQJPG$·PFEJGP



++p

8304 8302

8303

(4#0<¤5+5%*'5-¤0+)4'+%*$ª4)'4-¤0+)67/   





1TFGP FGT 'JTGPNGIKQP =1TFTG FG NC .¾IKQP F *QPPGWT?  /QFGNN  #WUICDG OKV -ÌPKIUMTQPG   QJPG-TGW\ÒDGTFGO4GKEJUCRHGN8QTFGTUGKVGPOGFCKNNQPOKV2QTVTCKV*GKPTKEJU+84ÒEMUGKVGPOGFCKN NQPOKV\YGK6TKMQNQTGP 4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVKO5EJNGK HGPDCPF FGU .QTDGGT WPF 'KEJGPMTCP\GU HTCP\ÌUKUEJG GT 5KNDGTRWP\G XQP  DKU   

9KNFUEJYGKPMQRH COQTKIKPCNGPCNVGP$CPF<'+ ++



1TFGP FGT 'JTGPNGIKQP =1TFTG FG NC .¾IKQP F *QPPGWT?  /QFGNN  #WUICDG OKV -ÌPKIUMTQPG   QJPG-TGW\ÒDGTFGO4GKEJUCRHGN8QTFGTUGKVGPOGFCKNNQPOKV2QTVTCKV*GKPTKEJU+84ÒEMUGKVGPOGFCKN NQPOKV\YGK6TKMQNQTGP 4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTV#WUDTÒEJG XQT CNNGO KP FGT YGK­GP 'OCKNNG CNVG 4GRCTCVWT FGT #WHJ·PIWPI KO 5EJNGKHGPDCPF FGU .QTDGGT WPF   'KEJGPMTCP\GUHTCP\ÌUKUEJGGT5KNDGTRWP\GXQPDKU 9KNFUEJYGKPMQRH COMWT\GPQTKIK PCNGPCNVGP$CPF<'+ +++



-ÌPKINKEJGT WPF /KNKV·TKUEJGT 1TFGP XQO JN .WFYKI =1TFTG 4Q[CN GV /KNKVCKTG FG 5CKPV .QWKU?   4KVVGTMTGW\ #WUHÒJTWPI KP FGT 6TCIGYGKUG XQP  DKU  )QNF GOCKNNKGTV #DRNCV\WPIGP KP FGT   DNCWGP 'OCKNNG FGU XQTFGT WPF 4ÒEMUGKVKIGP /GFCKNNQPTKPIU OKP %JKR KP GKPGT -TGW\CTOURKV\G CO   MCPPGNKGTVGP4KPIOKVCNVGOLGFQEJPKEJV\GKVIGPÌUUKUEJGP$CPF<'+p ++



0CEJ FGT 6JTQPDGUVGKIWPI -ÌPKI .QWKU 2JKNKRRGU YWTFGP FKG CNVGP HTCP\ÌUKUEJGP 1TFGP DKU CWH FGP 1TFGP FGT   'JTGPNGIKQP CWHIGJQDGPWPFXGTDQVGPUKG\WVTCIGP#NNGKPGFKG+PUKIPKGPFGU1TFGPUXQOJGKNKIGP.WFYKIFWTHVGP YGKVGTIGVTCIGPYGTFGPCNNGTFKPIUOWUUVGPFKGDQWTDQPKUEJGP.KNKGPGPVHGTPVYGTFGP

72


FRANKREICH

8305 8306

8306





,WNK-TGW\=%TQKZFG,WKNNGV?#WUICDG &100—2#4.'41+&'(4#0%#+5KO4ÒEMUGKVGPOG FCKNNQP 5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVGKPKIGCNVG#DRNCV\WPIGPKPFGTITÒPGP'OCKNNGUQYKGKP FGTDNCWGP'OCKNNGFGU4GXGTUOGFCKNNQPUCOUR·VGTGP$CPF&'%p# ++p+++



'JTGPOGFCKNNGHÒTVCRHGTGWPFCWHQRHGTWPIUXQNNG6CVGP HÒT.GDGPUTGVVWPI =/¾FCKNNGF *QPPGWT RQWT#EVGUFG%QWTCIGGVFG&GXQWGOGPV?/GFCKNNGFGU+PPGPOKPKUVGTKWOU/QFGNN OKVFGO2QT VTCKV XQP -ÌPKI .QWKU2JKNKRRG    VTCIDCTG 5KNDGTPG /GFCKNNG  -NCUUG &WTEJO  OO   5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT $#44' (V CWH FGT 4ÒEMUGKVG OKV IGRT·IVGT 9KFOWPI   /+0+56–4'  &' . +06—4+'74  # 8#%'.'6  .17+5  %#5+/+4   5'4)'06  #7 '   4—)6&7)—0+'2174.'%174#)''6.'&—817'/'06&106+.#(#+624'78' &#0570+0%'0&+'#44#5 2#5&'%#.#+5 ,#08+'4COCNVGP$CPF ++



8307

8308

8309 (1:1)

8310







'JTGPOGFCKNNGHÒTVCRHGTGWPFCWHQRHGTWPIUXQNNG6CVGP HÒT.GDGPUTGVVWPI =/¾FCKNNGF *QPPGWT RQWT#EVGUFG%QWTCIGGVFG&GXQWGOGPV?/GFCKNNGFGU+PPGPOKPKUVGTKWOU/QFGNN OKVFGO2QT VTCKV XQP -ÌPKI .QWKU2JKNKRRG    VTCIDCTG 5KNDGTPG /GFCKNNG  -NCUUG &WTEJO  OO   5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT $#44' (V CWH FGT 4ÒEMUGKVG OKV IGRT·IVGT 9KFOWPI   /+0+56–4' &' . +06—4+'74  #%6+105  &'&—817'/'06&—%'40—#4+81+4' (4#0%1+5COCNVGPGVYCU\GTUEJNKUUGPGP$CPF ++



'JTGPOGFCKNNGHÒTVCRHGTGWPFCWHQRHGTWPIUXQNNG6CVGP HÒT.GDGPUTGVVWPI =/¾FCKNNGF *QPPGWT RQWT#EVGUFG%QWTCIGGVFG&GXQWGOGPV?/GFCKNNGFGU+PPGPOKPKUVGTKWOU/QFGNN OKVFGO2QT VTCKVXQP-ÌPKI.QWKU2JKNKRRG PKEJVVTCIDCTG$TQP\GPG/GFCKNNG-NCUUG&WTEJO OO 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT $#44' (V CWH FGT 4ÒEMUGKVG OKV IGRT·IVGT 9KFOWPI   /+0+56–4'&'. +06—4+'74#%176#.#0& 2+'44' &'41#00' .1+4' 2174 510&—817'/'06+010&#6+10 ++



'TKPPGTWPIUOGFCKNNG CP FKG 6JTQPDGUVGKIWPI XQP -ÌPKI .QWKU 2JKNKRRG  /KPKCVWT   &WTEJOGUUGTOOCPQTKIKPCNGTCNVGT$CPFUEJNGKHG 4++



<9'+6' (4#0<¤5+5%*'4'27$.+-   

1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?/QFGNN QJPGªDGTJÌJWPI  4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVGKPKIG$GUEJ·FKIWPIGPKPFGT'OCKNNGKO5EJNGK HGPDCPF FGU .QTDGGT WPF 'KEJGPMTCP\GU HTCP\ÌUKUEJG GT 5KNDGTRWP\G XQP  DKU   

9KNFUEJYGKPMQRH COQTKIKPCNGPCNVGPGVYCU\GTUEJNKUUGPGP$CPF<'+ ++p+++

 73


FRANKREICH

8315 8311

8312

8313

8314 8316

<9'+6' (4#0<¤5+5%*'4'27$.+-24—5+&'0%'   

/KNKV·T/GFCKNNG=/¾FCKNNG/KNKVCKTG?/QFGNN FGT#FNGTUVGJVCWHFGO/GFCKNNQPTKPI 5KNDGTVNY XGTIQNFGV WPF GOCKNNKGTV MNGKPG 'OCKNNGUEJ·FGP CWH 8QTFGT WPF 4ÒEMUGKVG CO QTKIKPCNGP CNVGP $CPF   &'%p# 44+++



W­GTUVUGNVGPGUGTUVGU/QFGNN

<9'+6'5 (4#0<¤5+5%*'5-#+5'44'+%*   

1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?1HHK\KGTUFGMQTCVKQPUQIGPVTCPUHQTOKGTVG #WUHÒJTWPI -QTRWU FGU  /QFGNNU  #WUICDG FGU $ÒTIGTMÌPKIVWOU OKV -ÌPKIUMTQPG QJPG -TGW\   ÒDGT FGO 4GKEJUCRHGN  OKV GTPGWGTVGP /GFCKNNQPU FGU \YGKVGP -CKUGTTGKEJGU )QNF GOCKNNKGTV GKPKIG   OKP #WUDTÒEJG KP FGT YGK­GP 'OCKNNG CWH FGT 4ÒEMUGKVG FGU 5EJNGKHGPDCPFGU FGU .QTDGGT WPF   'KEJGPMTCP\GU HTCP\ÌUKUEJG )QNFRWP\G XQP  DKU  #FNGTMQRH  CO MCPPGNKGTVGP $CPFTKPI CO   CNVGPLGFQEJPKEJV\GKVIGPÌUUKUEJGP$CPFOKVCWHIGNGIVGT4QUGVVG<'+XCT ++p+++



#WU )TÒPFGP FGT 5RCTUCOMGKV F J WO UKEJ FGP 'TYGTD GKPGT PGWGP &GMQTCVKQP \W GTURCTGP  YGEJUGNVGP 6T·IGT   DGKGKPGO/QFGNNYGEJUGNQHVPWTFKG/GFCKNNQPUCWUWPFVTWIGPFKGUGUQIGPVTCPUHQTOKGTVGP#WUHÒJTWPIGPYGKVGT



1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?/QFGNN OKVJGTCNFKUEJGTPCRQNGQPKUEJGT -CKUGTMTQPG 1HHK\KGTUFGMQTCVKQP)QNFGOCKNNKGTVCWHFGT8QTFGTUGKVGFGU5EJNGKHGPDCPFGU FGU.QTDGGTWPF'KEJGPMTCP\GUHTCP\ÌUKUEJG)QNFRWP\GXQPDKU #FNGTMQRH COQTKIKPCNGP CNVGP$CPFOKVCWHIGNGIVGT4QUGVVG<'+ +p++



1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?/QFGNN OKVJGTCNFKUEJGTPCRQNGQPKUEJGT -CKUGTMTQPG 1HHK\KGTUFGMQTCVKQP)QNFGOCKNNKGTVCWHFGT8QTFGTUGKVGFGU5EJNGKHGPDCPFGU FGU.QTDGGTWPF'KEJGPMTCP\GUHTCP\ÌUKUEJG)QNFRWP\GXQPDKU #FNGTMQRH COQTKIKPCNGP CNVGP$CPFOKVCWHIGNGIVGT4QUGVVG<'+ +p++



1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?/QFGNN OKVJGTCNFKUEJGTPCRQNGQPKUEJGT -CKUGTMTQPG    4KVVGTFGMQTCVKQP 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV KO TÒEMUGKVKIGP   /GFCKNNQPTKPIMCWOUKEJVDCTG'OCKNNGCDRNCV\WPICOQTKIKPCNGPCNVGP$CPF<'+ +p++



1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?/QFGNN OKVJGTCNFKUEJGTPCRQNGQPKUEJGT -CKUGTMTQPG 4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVGKPKIG$GUEJ·FKIWPIGP KPFGT'OCKNNGCOQTKIKPCNGPCNVGPGVYCU\GTUEJNKUUGPGP$CPF<'+ ++p+++



'ZGORNCTKPUGNVGPIWVGT'TJCNVWPI



'ZGORNCTKPUGNVGPIWVGT'TJCNVWPI





74


FRANKREICH

8317





8318

8320

8319

8321

1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?/QFGNN OKVJGTCNFKUEJGTPCRQNGQPKUEJGT -CKUGTMTQPG 4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNFGOCKNNKGTVGKPKIG$GUEJ·FKIWPIGP KPFGT'OCKNNGCOUR·VGTGP$CPF ++p+++



/KNKV·T/GFCKNNG=/¾FCKNNG/KNKVCKTG?/QFGNN FGT#FNGTUVGJVCWHFGO.QTDGGTMTCP\ 5KNDGTVNY XGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP\GKVIGPÌUUKUEJGP$CPF&'%p$ ++



+PUGNVGPIWVGT'TJCNVWPI



/KNKV·T/GFCKNNG=/¾FCKNNG/KNKVCKTG?/QFGNN FGT#FNGTUVGJVCWHFGO.QTDGGTMTCP\ 5KNDGTVNY XGTIQNFGV WPF GOCKNNKGTV OKP 4GRCTCVWT KO XQTFGTUGKVKIGP /GFCKNNQPTKPI CO UR·VGTGP $CPF &'%   p$ ++





/KNKV·T/GFCKNNG=/¾FCKNNG/KNKVCKTG?/QFGNN FGT#FNGTUVGJVCWHFGO.QTDGGTMTCP\ 5KNDGTVNY XGTIQNFGVWPFGOCKNNKGTVCOCNVGPLGFQEJPKEJV\GKVIGPÌUUKUEJGP$CPF&'%p$ ++





/KNKV·T/GFCKNNG=/¾FCKNNG/KNKVCKTG?/QFGNN FGT#FNGTUVGJVCWHFGO.QTDGGTMTCP\ 5KNDGTVNY XGTIQNFGVWPFGOCKNNKGTVOKPCNVG'OCKNNGTGRCTCVWTGPCOCNVGP\GKVIGPÌUUKUEJGP$CPF&'%p$ ++p



8323 8322

8324

8325



5V*GNGPC/GFCKNNG=/¾FCKNNGFG5CKPV*¾N½PG?$TQP\GRTKXCVXGTIQNFGVCOUR·VGTGP$CPF&'% p ++





5V *GNGPC/GFCKNNG =/¾FCKNNG FG 5CKPV *¾N½PG? 5KNDGT PKEJV XGTUKNDGTV  CO UR·VGTGP $CPF &'%   p 44++



'EJVUKNDGTPG#WUHÒJTWPIGPUKPFGZVTGOUGNVGP\WHKPFGP



5V*GNGPC/GFCKNNG=/¾FCKNNGFG5CKPV*¾N½PG?$TQP\GCOQTKIKPCNGP\GKVIGPÌUUKUEJGP$CPF&'% p ++



#O\GKVIGPÌUUKUEJGPQTKIKPCNGP$CPFPKEJVJ·WHKI\WHKPFGP



5V *GNGPC/GFCKNNG =/¾FCKNNG FG 5CKPV *¾N½PG? $TQP\G CO CNVGP LGFQEJ PKEJV \GKVIGPÌUUKUEJGP   $CPF&'%p ++

 75


FRANKREICH

8326



8327

8328

8329

/GFCKNNG CWH FKG 'KPPCJOG XQP 5GDCUVQRQN CO  5GRVGODGT  0KEJV VTCIDCT -WRHGTIWUU   &WTEJOGUUGT  OO OKV 5VGORGNUEJPGKFGTUKIPCVWT &'5#+& 4137'.#; ( KO 4CPF RWP\KGTV   %7+84'OGJTGTG4CPFGNNGP ++p+++



0CEJHCUVGNHOQPCVKIGT$GNCIGTWPIFWTEJFKG#NNKKGTVGP (TCPMTGKEJ)TQ­DTKVCPPKGP1UOCPKUEJGU4GKEJ5CTFKPKGP  MCRKVWNKGTVG FKG HCUV XÌNNKI \GTUVÌTVG TWUUKUEJG 5EJYCT\OGGT(GUVWPI 5GDCUVQRQN CWH FGT -TKO PCEJFGO FKG (TCP\Q   UGP WPVGT )GPGTCN 2CVTKEG FG /CE/CJQP FCU (QTV /CNCMQHH  5GRVGODGT  GTQDGTV JCVVGP &KGU GPVUEJKGF   RTCMVKUEJ FGP UGKV  FCWGTPFGP -TKOMTKGI #O  /·T\  UEJNQUU 4WUUNCPF UEJNKG­NKEJ OKV UGKPGP -TKGIU   IGIPGTPFGP(TKGFGPXQP2CTKU







/GFCKNNG HÒT FGP +VCNKGP(GNF\WI  =/¾FCKNNG FGNC %CORCIPG F +VCNKG? 0QTOCNG #WUHÒJTWPI   5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT$#44'CWHFGT4ÒEMUGKVGFGT¤UGRWP\KGTVCOQTKIKPCNGPCNVGP GVYCU\GTUEJNKUUGPGP$CPF&'%p ++



/GFCKNNG HÒT FGP +VCNKGP(GNF\WI  =/¾FCKNNG FGNC %CORCIPG F +VCNKG? 0QTOCNG #WUHÒJTWPI   5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT$#44'CWHFGT4ÒEMUGKVGFGT¤UGRWP\KGTVCOQTKIKPCNGPCNVGP GVYCU\GTUEJNKUUGPGP$CPF&'%p ++



/GFCKNNG HÒT FGP +VCNKGP(GNF\WI  =/¾FCKNNG FGNC %CORCIPG F +VCNKG? 0QTOCNG #WUHÒJTWPI   5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT $#44' CWH FGT 4ÒEMUGKVG FGT ¤UG RWP\KGTV CO UR·VGTGP $CPF   &'%p ++



8332

8330

8331



/GFCKNNGHÒTFKG%JKPC'ZRGFKVKQPXQP=/¾FCKNNGFGN 'ZR¾FKVKQPFG%JKPG?#WUICDGOKVªDGT TCPFWPFQJPG5VGORGNUEJPGKFGTUKIPCVWT5KNDGTCOQTKIKPCNGP$CPF&'%p ++





/GFCKNNGHÒTFKG'ZRGFKVKQPPCEJ/GZKMQ=/¾FCKNNGFGN 'ZR¾FKVKQPFW/¾ZKSWG?5KNDGT OKV5VGORGNUEJPGKFGTUKIPCVWT$#44'UVCTMIGVTCIGPCOPGWGPDGUVKEMVGP$CPF&'%p +++



&4+66' (4#0<¤5+5%*'4'27$.+-   

0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 0CVKQPCN FG NC .¾IKQP F *QPPGWT?  /QFGNN OKV FGT   ,CJTGU\CJNKO8QTFGTUGKVGPOGFCKNNQP )TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQFZ OO  I )QNF IGRTÒHV  GOCKNNKGTV OGJTGTG MNGKPG #WUDTÒEJG KP FGT ITÒPGP 'OCKNNG CWH FGT   8QTFGTUGKVG RWP\KGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP &WTEJOGUUGT  OO 5KNDGT   FTGKVGKNKIGU <GPVTWO CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 1WK\KNNG .GOQKPG  .GOQKPG   (KNU5WEEKP2CTKUCP0CFGNOKV\YGK5GKVGPJCMGP<'+ 5VÒEM++p 'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  #WITWPF FGT *GTUVGNNGTDG\GKEJPWPI CWH FGT 4ÒEMUGKVG (KTOC 1WK\KNNG .GOQKPG  .GOQKPG (KNU 5WEE    ,QCKNNKGT FG NC .¾IKQP F *QPPGWT 4WG &WRJQV 0Q  2CTKU  N·UUV UKEJ FKG 'PVUVGJWPI FGU $TWUVUVGTPU CWHXQT FCVKGTGP

76




FRANKREICH

8333





0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 0CVKQPCN FG NC .¾IKQP F *QPPGWT?  /QFGNN OKV FGT   ,CJTGU\CJN  KO /GFCKNNQP    $TWUVUVGTP \WO )TQ­MTGW\ WPF \WO )TQ­QHHK   \KGT #WUHÒJTWPI OKV ITQ­GO OGJTVGKNKI IGHGTVKIVGP /GFCKNNQP 5KNDGT DTKNNCPVKGTV CP 0CFGN FKGUG OKV   *GTUVGNNGT WPF HTCP\ÌUKUEJGT 2WP\G HÒT GT 5KNDGT XQP  DKU  9KNFUEJYGKPMQRH  OKV \YGK   5GKVGPJCMGP<'+ +p++



0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 0CVKQPCN FG NC .¾IKQP F *QPPGWT?  /QFGNN OKV FGT   ,CJTGU\CJN  KO /GFCKNNQP    $TWUVUVGTP \WO )TQ­MTGW\ WPF \WO )TQ­QHHK   \KGT#WUHÒJTWPIOKVOGJTVGKNKIIGHGTVKIVGP/GFCKNNQP5KNDGTDTKNNCPVKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGT RWP\GCP0CFGNFKGUGHTCP\ÌUKUEJGT2WP\GHÒTGT5KNDGTXQPDKU 9KNFUEJYGKPMQRH OKV \YGK5GKVGPJCMGP<'+ +p++



8335







8334

8336

8337

0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 0CVKQPCN FG NC .¾IKQP F *QPPGWT?  /QFGNN OKV FGT   ,CJTGU\CJN  KO 8QTFGTUGKVGPOGFCKNNQP    -QOOCPFGWTFGMQTCVKQP )QNF GOCKNNKGTV   'OCKNNGCWUDTÒEJG CWH FGT 8QTFGTUGKVG FGU QDGTGP #TOU OGJTGTG *CCTTKUUG CO QTKIKPCNGP *CNUDCPF   <'+ ++p+++



0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 0CVKQPCN FG NC .¾IKQP F *QPPGWT?  /QFGNN OKV FGT   ,CJTGU\CJN  KO 8QTFGTUGKVGPOGFCKNNQP    -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV   /GFCKNNQPU)QNFGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ +p



0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 0CVKQPCN FG NC .¾IKQP F *QPPGWT?  /QFGNN OKV FGT   ,CJTGU\CJNKO8QTFGTUGKVGPOGFCKNNQP 1HHK\KGTUFGMQTCVKQP)QNFGOCKNNKGTVCWHFGT 8QTFGTUGKVGFGU5EJNGKHGPDCPFGUFGU.QTDGGTWPF'KEJGPMTCP\GUHTCP\ÌUKUEJG)QNFRWP\GXQPDKU  #FNGTMQRH COQTKIKPCNGPCNVGP$CPFOKVCWHIGNGIVGT4QUGVVG<'+ +p++

 77


FRANKREICH

8338

8339

8340 Rs.

8341 Rs.



0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 0CVKQPCN FG NC .¾IKQP F *QPPGWT?  /QFGNN OKV FGT   ,CJTGU\CJNKO8QTFGTUGKVGPOGFCKNNQP 1HHK\KGTUFGMQTCVKQPKPUQIGP.WZWUCWUHÒJTWPI OKV OGJTVGKNKIGP /GFCKNNQP WPF RNCUVKUEJ CWUIGHÒJTVGP .QTDGGT WPF 'KEJGPDNCVVMT·P\GP 5KNDGT   XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV GKPKIG OKP #WUDTÒEJG KP FGT ITÒPGP 'OCKNNG CO $CPF OKV   CWHIGNGIVGT4QUGVVG<'+ ++p





0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG 0CVKQPCN FG NC .¾IKQP F *QPPGWT?  /QFGNN OKV FGT   ,CJTGU\CJNKO8QTFGTUGKVGPOGFCKNNQP 4KVVGTFGMQTCVKQPKPUQIGP.WZWUCWUHÒJTWPI OKV OGJTVGKNKIGP /GFCKNNQPU WPF RNCUVKUEJ CWUIGHÒJTVGO .QTDGGT WPF 'KEJGPDNCVVMTCP\ KP FGT   ªDGTJÌJWPI5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVGKPKIGOKP#WUDTÒEJGKPFGT'OCKNNGCO $CPF<'+ ++p+++



(4#0<¤5+5%*'456##68+%*;4')+'470)   

-TGW\HÒT-QODCVVCPVGP=%TQKZFW%QODCVVCPV?$TQP\GCWHFGT4ÒEMUGKVGWC RWP\KGTV$4COQTKIKPCNGP$CPF&'%p ++





-TGW\HÒT-QODCVVCPVGP=%TQKZFW%QODCVVCPV?$TQP\GCWHFGT4ÒEMUGKVGWC RWP\KGTV$4COQTKIKPCNGP$CPF&'%p ++



8342

8+'46' (4#0<¤5+5%*'4'27$.+-   

0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTG0CVKQPCNFGNC.¾IKQPF *QPPGWT?/QFGNN   OKV GKPGO 5VGTP UVCVV  CWH FGO 8QTFGTUGKVGP/GFCKNNQP FGT 1TFGPUFGMQTCVKQP  )TQ­MTGW\UGV   DGUVGJGPF CWU -NGKPQF  Z  OO 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 8QTFGTUGKVG FGT   5EJNGKHG FGU .QTDGGTMTCP\GU HTCP\ÌUKUEJG GT 5KNDGTRWP\G XQP  DKU  9KNFUEJYGKPMQRH    GKPKIG 5EJ·FGP KP FGP 5RKV\GP WPF KO TÒEMUGKVKIGP /GFCKNNQPTKPI CO QTKIKPCNGP 5EJWNVGTDCPF WPF   $TWUVUVGTP 5KNDGT VGKNYGKUG DTKNNCPVKGTV FTGKVGKNKIGU <GPVTWO CP 0CFGN FKGUG OKV \YGK 2WP\GP  

HTCP\ÌUKUEJG GT 5KNDGTRWP\G XQP  DKU  9KNFUEJYGKPMQRH WPF *GTUVGNNGTRWP\G FGT (KTOC   #TVJWU$GTVTCPFKP2CTKU OKV\YGK5GKVGPJCMGP\WUCOOGPOKV-PQRHNQEJTQUGVVGKO1TKIKPCNGVWKFGT (KTOC#TVJWU$GTVTCPF<'+ 5VÒEM++p++++

&KG)TQ­MTGW\KPUKIPKGPFKGUGU/QFGNNUUKPFUGNVGP\WHKPFGPFCFGT1TFGPKPFKGUGT(QTOPWTEC,CJTGNCPI DKU   XGTNKGJGP YQTFGP KUV /KV &GMTGV XQO  (GDTWCT  ·PFGTVG 5VCCVURT·UKFGPV 8KPEGPV #WTKQN     FKG +PUKIPKGP FWTEJ 'PVHGTPWPI FGT ,CJTGU\CJN  &KG )TQ­MTGW\UVGTPG FGU  WPF FGU  /QFGNN UGKV     WPVGTUEJGKFGPUKEJFCFWTEJFCUUNGV\VGTGIQNFHCTDGP XGTIQNFGV UKPF

78




FRANKREICH

8343 8344

8345 8346

(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6  

0CVKQPCNGT 1TFGP FGT 'JTGPNGIKQP =1TFTG FG NC .¾IKQP F *QPPGWT?  /QFGNN UGKV   OKV   IQNFHCTDGPGO )TQ­MTGW\UVGTP CWH FGO 4ÒEMUGKVGPOGFCKNNQP FGT &GMQTCVKQP  (.14'#. #0 :    $TWUVUVGTP\WO)TQ­MTGW\5KNDGTVGKNYGKUGDTKNNCPVKGTVXGTIQNFGV/GFCKNNQPOGJTVGKNKICP0CFGNOKV HTCP\ÌUKUEJGT *GTUVGNNGTRWP\G WPF  2WP\G HÒT GT 5KNDGT UGKV  -TCDDGPRWP\G  OKV \YGK   5GKVGPJCMGP<'+p +



0CVKQPCNGT1TFGPFGT'JTGPNGIKQP=1TFTGFGNC.¾IKQPF *QPPGWT?/QFGNN UGKVCWHFGO 4ÒEMUGKVGPOGFCKNNQPFGT&GMQTCVKQP(.14'#.#0: 4KVVGTFGMQTCVKQP5KNDGTVGKNYGKUGXGTIQNFGV GOCKNNKGTV'OCKNNGCWUDTWEJCWHFGT8QTFGTUGKVGGKPGU#TOUCO$CPF<'+p 4+++++



0CVKQPCNGT 8GTFKGPUVQTFGP =1TFTG 0CVKQPCN FW /¾TKVG? -QOOCPFGWTUFGMQTCVKQP 5KNDGT XGTIQNFGV   WPF VGKNYGKUG GOCKNNKGTV 'OCKNNGCWUDTWEJ CWH FGT 8QTFGTUGKVG GKPGU #TOU CO QTKIKPCNGP *CNUDCPF   <'+ ++p+++



&KG )TQ­MTGW\UVGTPG FGU  WPF FGU  /QFGNN UGKV   WPVGTUEJGKFGP UKEJ FCFWTEJ FCUU NGV\VGTG IQNFHCTDGP  

XGTIQNFGV 





&GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG XQP 5VCCVURT·UKFGPV %JCTNGU FG )CWNNG CO  &G\GODGT    IGUVKHVGV WPF GTUGV\VG FKG OGKUVGP FGT DKU FCJKP GZKUVKGTGPFGP OKPKUVGTKGNNGP 8GTFKGPUVQTFGP 'T WPVGTUVGJV GDGPHCNNU   FGT)TQ­MCP\NGKFGT'JTGPNGIKQP



0CVKQPCNGT8GTFKGPUVQTFGP=1TFTG0CVKQPCNFW/¾TKVG?1HHK\KGTUFGMQTCVKQP#WUHÒJTWPIOKVOGJTVGK NKIGP/GFCKNNQPU5KNDGTXGTIQNFGVGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG<'+ +

8347

8348



8349

&4+66'8+'46'70&(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6 14&'0 

1TFGPFGT$GHTGKWPI=1TFTGFGNC.KD¾TCVKQP?1TFGPUFGMQTCVKQP·NVGTG#WUHÒJTWPI$TQP\GVGKNYGKUG GOCKNNKGTV  CO$CPFFGU6[RU<'+ 4++





1TFGPFGT$GHTGKWPI=1TFTGFGNC.KD¾TCVKQP?1TFGPUFGMQTCVKQP$TQP\GVGKNYGKUGNCEMKGTVCO$CPF FGU6[RU<'+ ++





1TFGPFGT$GHTGKWPI=1TFTGFGNC.KD¾TCVKQP?1TFGPUFGMQTCVKQP$TQP\GVGKNYGKUGNCEMKGTVCO$CPF FGU6[RU<'+ ++

 79


FRANKREICH

ex 8351

8355

8354

8350



8353 8356

#MCFGOKUEJG 2CNOGP =2CNOGU #ECF¾OKSWGU?  /QFGNN   'JTGP\GKEJGP GKPGU 1HHK\KGTU   FGT#MCFGOKG UQIGP5KNDGTPG#MCFGOKUEJG2CNOGP 5KNDGTVGKNYGKUGGOCKNNKGTVFKG¤UGDGUGV\VOKV GKPGO$TKNNCPV CWH'EJVJGKVIGRTÒHV CO$CPFKOGVYCUDGUEJ·FKIVGP1TKIKPCNGVWK<'+ ++



)GUVKHVGV XQP -CKUGT 0CRQN¾QP + CO  /·T\  CNU GKPMNCUUKIG 7PKXGTUKV·VUCWU\GKEJPWPI FKG 2T·UKFGPV .QWKU   0CRQN¾QP  KP \YGK -NCUUGP WPVGTVGKNVG &WTEJ -CKUGT 0CRQN¾QP +++ YWTFGP  FKG #WUHÒJTWPI KP /GVCNN   GKPIGHÒJTVFKGCWEJXQPFGT&TKVVGP4GRWDNKMCDÒDGTPQOOGPYWTFG#O1MVQDGTYWTFGUEJNKG­NKEJ FGT FTGKMNCUUKIG -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  1TFGP FGT #MCFGOKUEJGP 2CNOGP IGUVKHVGV FGT FGO 7PVGT   TKEJVU/KPKUVGTKWOWPVGTUVGJVWPFDKUJGWVGXGTNKGJGPYKTF







#MCFGOKUEJG2CNOGP=2CNOGU#ECF¾OKSWGU?/QFGNN  GKP'JTGP\GKEJGPGKPGU1HHK\KGTU FGT8QNMUGT\KGJWPI UQIGP)QNFGPG#MCFGOKUEJG2CNOGP DGUQPFGTG#WUHÒJTWPI5KNDGTDTKNNCPVKGTV WPF XGTIQNFGV 8GTIQNFWPI VGKNYGKUG DGTKGDGP VGKNYGKUG GOCKNNKGTV CO 1TKIKPCNDCPF OKV 4QUGVVG WPF   \YGK 'JTGP\GKEJGP GKPGU 1HHK\KGTU FGT #MCFGOKG UQIGP 5KNDGTPG #MCFGOKUEJG 2CNOGP  5KNDGT   VGKNYGKUGGOCKNNKGTOKP'OCKNNGCWUDTÒEJGCP1TKIKPCND·PFGTP<'+ 5VÒEM++



1TFGPFGT#MCFGOKUEJGP2CNOGP=1TFTGUFGU2CNOGU#ECF¾OKSWGU?/QFGNN UGKV -QO OCPFGWTFGMQTCVKQP $TQP\G XGTIQNFGV WPF DGKFUGKVKI GOCKNNKGTV ¤UG CP FGT ªDGTJÌJWPI CDIGDTQEJGP   COQTKIKPCNGP*CNUDCPF<'+ +8



1TFGPHÒT8GTFKGPUVGWOFKG.CPFYKTVUEJCHV=1TFTGFW/¾TKVG#ITKEQNG?-QOOCPFGWTUFGMQTCVKQP $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV 'OCKNNGUEJ·FGP CWH 8QTFGT WPF 4ÒEMUGKVG CO QTKIKPCNGP   *CNUDCPF<'+ +++



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO,WNK IGUVKHVGVWPFWPVGTUVGJVFGO.CPFYKTVUEJCHVU/KPKUVGTKWO'TYKTFCWEJJGWVGPQEJXGTNKGJGP





1TFGP HÒT 8GTFKGPUVG WO FKG .CPFYKTVUEJCHV =1TFTG FW /¾TKVG #ITKEQNG? 1HHK\KGTUFGMQTCVKQP   5KNDGT VGKNYGKUG XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV OKP #WUDTÒEJG KP FGP 5RKV\GP CO $CPF OKV   CWHIGNGIVGT4QUGVVG<'+ ++



/CTKPG8GTFKGPUVQTFGP=1TFTGFW/¾TKVG/CTKVKOG?/QFGNN OKVTÒEMUGKVKIGT/GFCKNNQPWOUEJTKHV /CTKPG/CTEJCPFG?1HHK\KGTUFGMQTCVKQP$TQP\GXGTIQNFGVVGKNYGKUGXGTUKNDGTVGOCKNNKGTVCO$CPFOKV CWHIGNGIVGT4QUGVVG<'+ +



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO(GDTWCT IGUVKHVGVWPFWPVGTUVGJVFGO/KPKUVGTKWOHÒTFKG*CPFGNUOCTKPG'TYKTFCWEJJGWVGPQEJXGTNKGJGP



1TFGP HÒT 5Q\KCNXGTFKGPUVG =1TFTG FW /¾TKVG5QEKCN?-QOOCPFGWTUFGMQTCVKQP5KNDGT  XGTIQNFGV WPFVGKNYGKUGGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ +p++ &GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO1MVQDGT  IGUVKHVGV WPF WPVGTUVCPF FGO #TDGKVU/KPKUVGTKWO 0CEJ FGT 5VKHVWPI FGU 0CVKQPCNGP 8GTFKGPUVQTFGPU CO   &G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV

80




FRANKREICH

8358



8359

8357

1TFGPHÒT8GTFKGPUVGWOFKG8QNMUIGUWPFJGKV=1TFTGFGNC5CPV¾2WDNKSWG?-QOOCPFGWTUFGMQTC VKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP#WUDTÒEJGKOXQTFGTUGKVKIGPWPFITÌ­GTG#WUDTÒEJGKOTÒEM UGKVKIGP/GFCKNNQPTKPICOQTKIKPCNGP*CNUDCPF<'+ ++p



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO(GDTWCT  IGUVKHVGV WPF WPVGTUVCPF FGO )GUWPFJGKVU/KPKUVGTKWO 0CEJ FGT 5VKHVWPI FGU 0CVKQPCNGP 8GTFKGPUVQTFGPU CO   &G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV



1TFGP HÒT 8GTFKGPUVG WO FKG 8QNMUIGUWPFJGKV =1TFTG FG NC 5CPV¾ 2WDNKSWG? 1HHK\KGTUFGMQTCVKQP   $TQP\GXGTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG<'+ ++





1TFGP HÒT 8GTFKGPUVG WO FGP *CPFGN =1TFTG FW /¾TKVG %QOOGTEKCN? -QOOCPFGWTUFGMQTCVKQP   5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ ++



&GT FTGKMNCUUKIG -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  UQIGPCPPVG OKPKUVGTKGNNG 8GTFKGPUVQTFGP YWTFG CO  /CK    IGUVKHVGV WPF WPVGTUVCPF FGO /KPKUVGTKWO HÒT *CPFGN WPF +PFWUVTKG 0CEJ FGT 5VKHVWPI FGU 0CVKQPCNGP 8GT   FKGPUVQTFGPUCO&G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV

8362

8361 8360



8363

1TFGPHÒT8GTFKGPUVGWOFGP6QWTKUOWU=1TFTGFW/¾TKVG6QWTKUVKSWG?-QOOCPFGWTUFGMQTCVKQP 5KNDGT  XGTIQNFGVCOQTKIKPCNGP*CNUDCPF<'+ ++



&GT FTGKMNCUUKIG -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  UQIGPCPPVG OKPKUVGTKGNNG 8GTFKGPUVQTFGP YWTFG CO  /CK    IGUVKHVGV WPF WPVGTUVCPF FGO /KPKUVGTKWO HÒT ¤HHGPVNKEJG #TDGKVGP 0CEJ FGT 5VKHVWPI FGU 0CVKQPCNGP 8GT   FKGPUVQTFGPUCO&G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV



1TFGP HÒT 8GTFKGPUVG WO FGP 6QWTKUOWU =1TFTG FW /¾TKVG 6QWTKUVKSWG? 4KVVGTFGMQTCVKQP 5KNDGT  

 CO$CPF<'+ +p++





1TFGPHÒT-QODCVVCPVGP8GTFKGPUV=1TFTGFW/¾TKVG%QODCVVCPV?-QOOCPFGWTUFGMQTCVKQP5KNDGT XGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ +



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO5GRVGO DGT  IGUVKHVGV WPF WPVGTUVCPF FGO /KPKUVGTKWO HÒT CNVG (TQPVM·ORHGT 0CEJ FGT 5VKHVWPI FGU 0CVKQPCNGP 8GT   FKGPUVQTFGPUCO&G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV



1TFGPHÒT-QODCVVCPVGP8GTFKGPUV=1TFTGFW/¾TKVG%QODCVVCPV?1HHK\KGTUFGMQTCVKQP5KNDGTXGT IQNFGVVGKNYGKUGGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG<'+ ++

 81


FRANKREICH

8365

8364



8366

1TFGPHÃ&#x2019;T8GTFKGPUVGWOFKG2QUV=1TFTGFW/¾TKVG2QUVCN?-QOOCPFGWTUFGMQTCVKQP5KNDGTXGTIQN FGVWPFVGKNYGKUGGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ ++



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO0QXGO DGT  IGUVKHVGV WPF WPVGTUVCPF FGO /KPKUVGTKWO HÃ&#x2019;T FCU 2QUV 6GNGRJQP WPF 6GNGITCRJGPYGUGP 0CEJ FGT   5VKHVWPI FGU 0CVKQPCNGP 8GTFKGPUVQTFGPU CO  &G\GODGT  YWTFGP FKG 8GTNGKJWPIGP FGU 1TFGPU CD  ,CPWCT   GKPIGUVGNNV



1TFGP HÃ&#x2019;T 8GTFKGPUVG WO FKG 0CVKQPCNG 9KTVUEJCHV =1TFTG FG N Â&#x2014;EQPQOKG 0CVKQPCNG?   -QOOCPFGWTUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ +



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO,CPWCT  IGUVKHVGV WPF WPVGTUVCPF FGO (KPCP\/KPKUVGTKWO 0CEJ FGT 5VKHVWPI FGU 0CVKQPCNGP 8GTFKGPUVQTFGPU CO    &G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV



/KNKV·T8GTFKGPUVQTFGP =1TFTG FW /¾TKVG /KNKVCKTG? 1HHK\KGTUMTGW\ 5KNDGT   XGTIQNFGV CO $CPF   OKVCWHIGNGIVGT4QUGVVG<'+ ++



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO/·T\ IGUVKHVGVWPFWPVGTUVCPFFGO8GTVGKFKIWPIU/KPKUVGTKWO0CEJFGT5VKHVWPIFGU0CVKQPCNGP8GTFKGPUVQTFGPUCO &G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV'TKUVUQOKVPWTUGEJU,CJTG NCPIXGTNKGJGPYQTFGP

8367



8368

8369

1TFGPHÃ&#x2019;T8GTFKGPUVGWOFGP5RQTV=1TFTGFW/¾TKVG5RQTVKH?-QOOCPFGWTUFGMQTCVKQP5KNDGT   XGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ +



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO,WNK IGUVKHVGV WPF WPVGTUVCPF FGO /KPKUVGTKWO HÃ&#x2019;T 0CVKQPCNG 'T\KGJWPI 0CEJ FGT 5VKHVWPI FGU 0CVKQPCNGP 8GTFKGPUVQT   FGPUCO&G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV



1TFGPHÃ&#x2019;T8GTFKGPUVGWOFGP5RQTV=1TFTGFW/¾TKVG5RQTVKH?4KVVGTFGMQTCVKQP$TQP\GXGTIQNFGV CO$CPF<'+ +





1TFGP HÃ&#x2019;T 8GTFKGPUVG WO -WPUV WPF .KVGTCVWT =1TFTG FGU #TVU GV .GVVTGU? 1HHK\KGTUFGMQTCVKQP   5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG<'+ +



&GTFTGKMNCUUKIG -QOOCPFGWT1HHK\KGTWPF4KVVGT UQIGPCPPVGOKPKUVGTKGNNG8GTFKGPUVQTFGPYWTFGCO/CK IGUVKHVGVWPFWPVGTUVGJVFGO-WNVWU/KPKUVGTKWO'TYKTFCWEJJGWVGPQEJXGTNKGJGP'TKUVCWHITWPFXQP8GTNGKJWP IGPCPKPVGTPCVKQPCNDGMCPPVGCWUN·PFKUEJG(KNOUEJCWURKGNGTUGJTDGMCPPVIGYQTFGP

82


FRANKREICH

8374 8370

8373

ex 8372



5CJCTC8GTFKGPUVQTFGP =1TFTG FW /¾TKVG 5CJCTKGP? 1HHK\KGTUFGMQTCVKQP 5KNDGT   XGTIQNFGV CO   $CPFOKVCWHIGNGIVGT4QUGVVG<'+ +



&GT FTGKMNCUUKIG -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  UQIGPCPPVG OKPKUVGTKGNNG 8GTFKGPUVQTFGP YWTFG CO  #RTKN    IGUVKHVGV WPF WPVGTUVCPF FGO 5CJCTC/KPKUVGTKWO 0CEJ FGT 5VKHVWPI FGU 0CVKQPCNGP 8GTFKGPUVQTFGPU CO   &G\GODGTYWTFGPFKG8GTNGKJWPIGPFGU1TFGPUCD,CPWCTGKPIGUVGNNV'TKUVUQOKVPWTGVYCUÃ&#x2019;DGTXKGT ,CJTGNCPIXGTNKGJGPYQTFGPWPFFKG+PUKIPKGPUKPFFGOGPVURTGEJGPFUGNVGP\WHKPFGP





-QPXQNWV XQP \YGK 1TFGP   1TFGP FGT 'JTGPNGIKQP  /QFGNN OKV FGT ,CJTGU\CJN  KO   8QTFGTUGKVGPOGFCKNNQP    4KVVGTFGMQTCVKQP   .CPFYKTVUEJCHVU8GTFKGPUVQTFGP   1HHK\KGTUFGMQTCVKQP$GKFG5KNDGTD\Y5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVCO$CPFNGV\VGTG OKVCWHIGNGIVGT4QUGVVG 5VÃ&#x2019;EM++



-QPXQNWV XQP FTGK 1TFGP \YGK 4KVVGTFGMQTCVKQPGP FGT 'JTGPNGIKQP FCXQP GKPGU UQI #WUHÃ&#x2019;JTWPI ¯   HKNGVUWPFGKPG4KVVGTFGMQTCVKQPFGU1TFGPUHÃ&#x2019;T8GTFKGPUVGWOFKG.CPFYKTVUEJCHV5KNDGT\YGKOKVGEJV IQNFGPGP/GFCKNNQPUGOCKNNKGTVVGKNUOKVOKP'OCKNNGDGUEJ·FKIWPIGPCP$·PFGTP 5VÃ&#x2019;EM++++p+++



&4+66'8+'46'70&(ª0(6' (4#0<¤5+5%*'4'27$.+- 5'+6  '*4'0<'+%*'0 



/KNKV·T/GFCKNNG =/¾FCKNNG /KNKVCKTG?  /QFGNN OKV FGT ,CJTGU\CJN    #WUHÃ&#x2019;JTWPI OKV   TÃ&#x2019;EMUGKVKI CWUIGRT·IVGT 6TQRJ·G WPF $GHGUVKIWPI CP FGT ¤UG  5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV   4GRCTCVWTGPKOTÃ&#x2019;EMUGKVKIGP/GFCKNNQPTKPICO$CPF&'%p() ++



/KNKV·T/GFCKNNG =/¾FCKNNG /KNKVCKTG?  /QFGNN OKV FGT ,CJTGU\CJN    #WUHÃ&#x2019;JTWPI OKV   TÃ&#x2019;EMUGKVKI CWUIGRT·IVGT 6TQRJ·G WPF $GHGUVKIWPI CP FGT ¤UG  5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV   MCWO UKEJVDCTGT 'OCKNNG#WUDTWEJ KO XQTFGTUGKVKIGP /GFCKNNQPTKPI CO $CPF &'% p()   4++



8375



8376

8377

/GFCKNNG HÃ&#x2019;T /KNKV·TKUEJG 6CRHGTMGKV =/¾FCKNNG FG NC 8CNGWT /KNKVCKTG? $TQP\G CWH FGT 4Ã&#x2019;EMUGKVG   5VGORGNUEJPGKFGTUKIPCVWT,%#4.+'4&'.65%*7&+0574CO$CPF&'%p +



&KG/GFCKNNGYWTFGCO#RTKNIGUVKHVGVCDGTDGTGKVUCO1MVQDGTFWTEJFCUPGWIGUEJCHHGPG-TGW\ HÃ&#x2019;T/KNKV·TKUEJG6CRHGTMGKVGTUGV\V



/GFCKNNGHÃ&#x2019;T/KNKV·TKUEJG6CRHGTMGKV=/¾FCKNNGFGNC8CNGWT/KNKVCKTG?2TQDG#WUICDG$TQP\GCWH FGT4Ã&#x2019;EMUGKVG5VGORGNUEJPGKFGTUKIPCVWT,%#4.+'4&'.$465%*7&+0574CO$CPF&'% p 4+





/GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG.WHVHCJTV=/¾FCKNNGFGN #¾TQPCWVKSWG?$TQP\GXGTIQNFGVWPFGOCKN NKGTVCO$CPF&'%p ++





/GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG.WHVHCJTV=/¾FCKNNGFGN #¾TQPCWVKSWG?$TQP\GXGTIQNFGVWPFGOCKN NKGTVOKP'OCKNNGCWUDTWEJCO$CPF&'%p ++p+++

 83


FRANKREICH

ex 8379

8380

8381 Rs.

8384

8385 Rs.



'JTGPOGFCKNNGHÒTVCRHGTGWPFCWHQRHGTWPIUXQNNG6CVGP HÒT.GDGPUTGVVWPI =/¾FCKNNGF *QPPGWT RQWT #EVGU FG %QWTCIG GV FG &GXQWGOGPV? #WUICDG OKV FGO 2QTVTCKV 0CRQN¾QPU +++ /GFCKNNG   -NCUUG WPF  #WUICDGP /GFCKNNG  -NCUUG FGT  4GRWDNKM CNNG KP 5KNDGT LGYGKNU OKV   5VGORGNUEJPGKFGTUKIPCVWT $#44' WPF OKVIGRT·IVGP 6T·IGTPCOGP UQYKG /GFCKNNG HÒT #WHQRHGTWPI   WPF-NCUUGFGU+PPGPOKPKUVGTKWOU5KNDGTXGTIQNFGVD\YVGKNYGKUGXGTIQNFGVCNNGCPMQTTGMVGP $·PFGTP\YGKOKVCWHIGNGIVGT4QUGVVG 5VÒEM++



6QPMKP/GFCKNNG=/¾FCKNNGFW6QPMKP?#WUICDGOKV1NKXGP¤UG5KNDGTOKV5VGORGNUEJPGKFGTUK IPCVWT&#0+'.&727+5CO$CPF&'%p ++





6QPMKP/GFCKNNG=/¾FCKNNGFW6QPMKP?#WUICDGOKV-WIGNÌUG5KNDGTOKV5VGORGNUEJPGKFGTUK IPCVWT&#0+'.&727+5KO4CPFWPNGUGTNKEJRWP\KGTVCO$CPF&'%p +p++





6QPMKP/GFCKNNG=/¾FCKNNGFW6QPMKP?#WUICDGOKV-WIGNÌUG5KNDGTOKV5VGORGNUEJPGKFGTUK IPCVWT&#0+'.&727+5CO$CPF&'%p ++





6QPMKP/GFCKNNG=/¾FCKNNGFW6QPMKP?#WUICDGOKV-WIGNÌUG5KNDGTOKV5VGORGNUEJPGKFGTUK IPCVWT&#0+'.&727+5CO$CPF&'%p ++





&CJQOG[/GFCKNNG=/¾FCKNNGFW&CJQOG[?#WUICDGOKV1NKXGP¤UG5KNDGTOKV5VGORGNUEJPGK FGTUKIPCVWT&#0+'.&727+5COQTKIKPCNGPCNVGP$CPF&'%p ++





&CJQOG[/GFCKNNG=/¾FCKNNGFW&CJQOG[?#WUICDGOKV1NKXGP¤UG5KNDGTOKV5VGORGNUEJPGK FGTUKIPCVWT&#0+'.&727+5CO$CPF&'%p ++





8391

8390

8386 Rs.

8387

8388 Rs.



&CJQOG[/GFCKNNG=/¾FCKNNGFW&CJQOG[?#WUICDGOKV-WIGNÌUG5KNDGTOKV5VGORGNUEJPGKFGT UKIPCVWT&#0+'.&727+5CO$CPF&'%p ++





'TKPPGTWPIUOGFCKNNGCPFKGGTUVG/CFCICUMCT'ZRGFKVKQP=/¾FCKNNG%QOO¾OQTCVKXGFG NC½TGGZR¾FKVKQPFG/CFCICUECT?#WUICDGOKV1NKXGP¤UG5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT &#0+'.&727+5CO$CPF&'%p ++



'TKPPGTWPIUOGFCKNNGCPFKGGTUVG/CFCICUMCT'ZRGFKVKQP=/¾FCKNNG%QOO¾OQTCVKXGFG NC ½TG GZR¾FKVKQP FG /CFCICUECT? #WUICDG OKV -WIGNÌUG 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT   &#0+'.&727+5CO$CPF&'%p +p++



'TKPPGTWPIUOGFCKNNGCPFKGGTUVG/CFCICUMCT'ZRGFKVKQP=/¾FCKNNG%QOO¾OQTCVKXGFG NC ½TG GZR¾FKVKQP FG /CFCICUECT? #WUICDG OKV -WIGNÌUG 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT   &#0+'.&727+5CO$CPF&'%p +p++



'TKPPGTWPIUOGFCKNNG CP FKG \YGKVG /CFCICUMCT'ZRGFKVKQP  =/¾FCKNNG %QOO¾OQTCVKXG FG NC   GGZR¾FKVKQPFG/CFCICUECT?#WUICDGOKV1NKXGP¤UG5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT14QV[ CO$CPFOKV$CPFURCPIG&'%p ++



'TKPPGTWPIUOGFCKNNG CP FKG \YGKVG /CFCICUMCT'ZRGFKVKQP  =/¾FCKNNG %QOO¾OQTCVKXG FG NC   G GZR¾FKVKQP FG /CFCICUECT? #WUICDG OKV -WIGNÌUG 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT 14QV[   CO$CPFOKV$CPFURCPIG&'%p +p++











84


FRANKREICH

ex 8394

8393 8392









'TKPPGTWPIUOGFCKNNG HÃ&#x2019;T %JKPC    UQIGP $QZGTMTKGI  =/¾FCKNNG %QOO¾OQTCVKXG FG   %JKPG   ? 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT )'14)'5 .'/#+4' KO 4CPF RWP\KGTV   #4)'06COQTKIKPCNGPCNVGP$CPFOKV$CPFURCPIG%*+0'&'%p ++



'TKPPGTWPIUOGFCKNNG HÃ&#x2019;T %JKPC    UQIGP $QZGTMTKGI  =/¾FCKNNG %QOO¾OQTCVKXG FG   %JKPG   ? 5KNDGT OKV 5VGORGNUEJPGKFGTUKIPCVWT )'14)'5 .'/#+4' KO 4CPF RWP\KGTV   #4)'06COQTKIKPCNGPCNVGP$CPFOKV$CPFURCPIG%*+0'&'%p ++



/CTQMMQ'TKPPGTWPIUOGFCKNNG =/¾FCKNNG %QOO¾OQTCVKXG FW /CTQE? (Ã&#x2019;PH #WUICDGP 5KNDGT OKV   KPUIGUCOVCEJV$CPFURCPIGP/#41% Z 17&+&#%#5#$.#0%# Z WPF*#76)7+4&'% p 5VÃ&#x2019;EM++



/CTQMMQ'TKPPGTWPIUOGFCKNNG =/¾FCKNNG %QOO¾OQTCVKXG FW /CTQE? <YGK #WUICDGP 5KNDGT CP   $·PFGTPGKPGOKVFTGK5RCPIGP/#41%%#5#$.#0%#WPF*#76)7+4GKPGOKV%#5#$.#0%#&'%p  5VÃ&#x2019;EM++



ex 8396









8397

/GFCKNNGHÃ&#x2019;T5[TKGP%KNKEKGPWPFFKG.GXCPVG=/¾FCKNNGFG5[TKG%KNKEKGGVFW.GXCPV?8KGT#WUIC DGP FCTWPVGT CWEJ FKGLGPKIG FGT .QPFQPGT 'ZKNTGIKGTWPI $TQP\G CP MQTTGMVGP $·PFGTP FTGK OKV   $CPFURCPIGP.'8#065;4+'%+.+%+'.'8#06&'%p 5VÃ&#x2019;EM++



/GFCKNNG HÃ&#x2019;T 5[TKGP%KNKEKGP WPF FKG .GXCPVG =/¾FCKNNG FG 5[TKG%KNKEKG GV FW .GXCPV? )TQ­G   #WUHÃ&#x2019;JTWPI&WTEJOGUUGTOO$TQP\GOKV5VGORGNUEJPGKFGTUKIPCVWT)'14)'5.'/#+4'CO $CPFOKV$CPFURCPIG.'8#06&'%p ++



-QPXQNWVXQPUGEJUXGTUEJKGFGPGP(GNF\WIU/GFCKNNGP/KVVNGTGT1UVGP=/Q[GP1TKGPV?1TKGPV+PFQ EJKPC &CTFCPGNNGP -QTGC WPF 0QTFCHTKMC =#HTKSWG FW 0QTF? LGYGKNU $TQP\G CP MQTTGMVGP $·PFGTP   FTGKOKVGKPGTWPFGKPOKVFTGK$CPFURCPIGP 5VÃ&#x2019;EM++



-QPXQNWV XQP HÃ&#x2019;PH XGTUEJKGFGPGP (GNF\WIU/GFCKNNGP 1TKGPV &CTFCPGNNGP -QTGC 5[TKGP%[NKEKGP   WPF 0QTFCHTKMC =#HTKSWG FW 0QTF? LGYGKNU $TQP\G CP MQTTGMVGP $·PFGTP \YGK OKV $CPFURCPIG   #.)'4+'D\Y.'8#06 5VÃ&#x2019;EM++

 85


FRANKREICH

ex 8402

8400

8401

ex 8403









86

-QNQPKCN/GFCKNNG=/¾FCKNNG%QNQPKCNG?5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT)'14)'5.'/#+4' CO $CPF OKV  $CPFURCPIGP 5;4+'  .+$;' #(4+37' 1%%+&'06#.' (4#0%#+5'   #(4+37'+0&1%*+0'610-+0 LGYGKNUUKNDGTHCTDGP /#41%/#41%/#41% /#41%/#41%/#41% LGYGKNUIQNFHCTDGP  ++



-QNQPKCN D\Y ªDGTUGG/GFCKNNG =/¾FCKNNG %QNQPKCNG F 1WVTG/GT?  XGTUEJKGFGPG UKNDGTHCTDGPG   $CPFURCPIGP610-+05;4+'+0&1%*+0'.+$;'#(4+37'/#41%/#41%  #(4+37' 1%%+&'06#.' (4#0%#+5' #(4+37' '37#614+#.' (4#0%#+5' %¢6'   & +81+4'WPF/#&#)#5%#4WPFUKGDGPXGTUEJKGFGPGIQNFHCTDGPG$CPFURCPIGP/#41%/#41% /#41%/#41%/#41%/#41%/#41%CWHIG\QIGP CWHNCPIGO1TKIKPCNDCPFUVÒEM 5VÒEM++



-QNQPKCND\YªDGTUGG/GFCKNNG=/¾FCKNNG%QNQPKCNGF 1WVTG/GT?0GWP#WUICDGPKPXGTUEJKGFG PGP #WUHÒJTWPIGP WPF )TÌ­GP ITÌ­VGPVGKNU 5KNDGT CP MQTTGMVGP $·PFGTP OKV KPUIGUCOV UGEJ\GJP   $CPFURCPIGP #(4+37' #(4+37' 1%%+&'06#.' (4#0%#+5' Z  #(4+37' (4#0%#+5'   .+$4' Z  5#*#4# /#41% Z  #.)—4+' 670+5+' RWP\KGTV  670+5+'  -17(4#   .'8#06/#&#)#5%#4%'064'#(4+%#+070&&'. #6.#06+37'#.#/'4417)'

FKGNGV\VGPDGKFGPXGTIQNFGV &'%p 5VÒEM++



-QNQPKCND\YªDGTUGG/GFCKNNG=/¾FCKNNG%QNQPKCNGF 1WVTG/GT?5KGDGP#WUICDGPKPXGTUEJKGFG PGP#WUHÒJTWPIGPWPF)TÌ­GPITÌ­VGPVGKNU5KNDGTCPMQTTGMVGP$·PFGTPOKVKPUIGUCOV\GJPXGTUEJKG FGPGP$CPFURCPIGP.+$;'/#41%('<<#0#(4+37'1%%+&'06#.'(4#0%#+5'0155+ $' +.'5 /#437+5'5 +.'5 &' .# 51%+'6' <#+4' 6%*#& FKG NGV\VGP DGKFGP XGTIQNFGV    &'%p 5VÒEM++




FRANKREICH

ex 8406

ex 8407

8404

8405 ex 8408











-QNQPKCN D\Y ªDGTUGG/GFCKNNG =/¾FCKNNG %QNQPKCNG F 1WVTG/GT?  XGTUEJKGFGPG UKNDGTHCTDGPG   $CPFURCPIGP#(4+37'(4#0%#+5'.+$4'+.'5/#437+5'5'ZVTGOG14+'06+0&1%*+0' .+$;' /#41%  5#*#4# /#74+6#0+' /#41% 6%*#& %'064' #(4+%#+0   '4;6*4'' /#&#)#5%#4 5'0')#.  517&#0 64+21.+6#+0' #.)'4+' 0NNG   %#.'&10+'670+5+'$+4*#%*'+/%1%*+0%*+0'#(4+37''37#614+#.' (4#0%#+5'WPF#(4+37'1%%+&'06#.'(4#0%#+5'XKGTCWHFGT4ÒEMUGKVGRWP\KGTVCWHIG\Q IGPCWHNCPIGO1TKIKPCNDCPFUVÒEM 5VÒEM++



-QNQPKCN D\Y ªDGTUGG/GFCKNNG =/¾FCKNNG %QNQPKCNG F 1WVTG/GT?  XGTUEJKGFGPG UKNDGTHCTDGPG   $CPFURCPIGP5#*#4#$+4*#%*'+/670+5+'610-+0)7+0—'(4#0%#+5' %10)1 /#&#)5%#4 670+5+' %16' &'5 51/#.+5 #(4+37' %16' & +81+4'   #.)—4+' 670+5+' /1;'014+'06 ':64˜/' 14+'06/#74+6#0+'WPF5#*#4#WPF UGEJU XGTUEJKGFGPG IQNFHCTDGPG $CPFURCPIGP .+$#0 <#+4' /#74+6#0+' 6%*#&   %'064#(4+37' 70& -17(4# FCXQP \YGK CWH FGT 4ÒEMUGKVG RWP\KGTV CWHIG\QIGP CWH NCPIGO   1TKIKPCNDCPFUVÒEM 5VÒEM++



-QPXQNWV XQP UGEJU XGTUEJKGFGPGP #WU\GKEJPWPIGP \WO FGWVUEJHTCP\ÌUKUEJGP -TKGI    &CTWPVGT -TKGIUGTKPPGTWPIUOGFCKNNG KP MNGKPGT WPF ITQ­GT #WUHÒJTWPI LGYGKNU $TQP\G CP MQTTGMVGP   $·PFGTP 5VÒEM++



-QPXQNWV XQP  XGTUEJKGFGPGP #WU\GKEJPWPIGP FGU'TUVGP9GNVMTKGIU&CTWPVGT/KNKV·T/GFCKNNG XKGT XGTUEJKGFGPG -TKGIUMTGW\G KPQHHK\KGNNG #WUICDG FGT +PVGTCNNKKGTVGP 5KGIGUOGFCKNNG  FTGK XGT   UEJKGFGPG 8GTFWP/GFCKNNGP /CTPG 4JGKPNCPF WPF 4WJT 5QOOG/GFCKNNGP -TGW\ HÒT HTGKYKNNKIG   -·ORHGT  $TQP\G GKPG 5KNDGT CNNG CPMQTTGMVGP$·PFGTPFTGKOKV$CPFCWHNCIGP\YGKOKV $CPFURCPIGP ++



-QPXQNWVXQPXGTUEJKGFGPGP#WU\GKEJPWPIGPFGU'TUVGP9GNVMTKGIU&CTWPVGTXKGTXGTUEJKGFGPG -TKGIUMTGW\G KPQHHK\KGNNG #WUICDG FGT +PVGTCNNKKGTVGP 5KGIGUOGFCKNNG  -TGW\ HÒT HTGKYKNNKIG   -·ORHGT$TQP\GCNNGCPMQTTGMVGP$·PFGTPVGKNUOKV$CPFCWHNCIGP 5VÒEM++

 87


FRANKREICH

8410

ex 8409

ex 8414

ex 8411

8415

ex 8412



ex 8413

-QPXQNWV XQP HÒPH XGTUEJKGFGPGP KPQHHK\KGNNGP #WU\GKEJPWPIGP FGU 'TUVGP 9GNVMTKGIU /CTPG   4JGKPNCPF WPF 4WJT 5QOOG 5V /KJKGN 8GTFWP ,GYGKNU $TQP\G CP MQTTGMVGP $·PFGTP GKPGU OKV   $CPFURCPIG 5VÒEM++





+PVGTCNNKKGTVG5KGIGUOGFCKNNG=/¾FCKNNG+PVGTCNNK¾FGNC8KEVQKTG?+PQHHK\KGNNG2CWVQV/CVVGK #WUICDG$TQP\GOKVFGP5VGORGNUEJPGKFGTUKIPCVWTGP/2#7616WPF.1/CVVGKOKV-WIGNÌUGCO QTKIKPCNGPCNVGP$CPF&'%p$ 4++





8GTFWP/GFCKNNG=/¾FCKNNGFG8GTFWP?-QPXQNWVXQPCEJVXGTUEJKGFGPGP#WUICDGP247&*1//'

Z OKV \YGK XGTUEJKGFGPGP ¤UGP  8'40+'4 Z OKV \YGK XGTUEJKGFGPGP ¤UGP  4'8+..10   CPQP[O 100'2#55'2#5 FKGUGOKV/KPKCVWTWPF4'0',GYGKNU$TQP\GCP$·PFGTP\YGKOKV $CPFURCPIGP&'%p$%&'( 5VÒEM++





8GTFWP/GFCKNNG =/¾FCKNNG FG 8GTFWP? -QPXQNWV XQP HÒPH XGTUEJKGFGPGP #WUICDGP 8'40+'4   #7)+'44'8+..10CPQP[O 100'2#55'2#5 WPF4'0',GYGKNU$TQP\GCP$·PFGTP\YGK OKV$CPFURCPIGP&'%p$%&'( 5VÒEM++





-QPXQNWV XQP  XGTUEJKGFGPGP #WU\GKEJPWPIGP FGU <YGKVGP 9GNVMTKGIU &CTWPVGT 4JGKP&QPCW   /GFCKNNG =%CORCIPG 4JKP&CPWDG? XKGT XGTUEJKGFGPG -TKGIUMTGW\G =%TQKZ FG )WGTTG? 9KGFGTUVCPFU   /GFCKNNG=4¾UKUVCPEG?8GTUEJKGFGPG/GVCNNGCPMQTTGMVGP$·PFGTP\YGKOKVCWHIGNGIVGT4QUGVVGFTGK OKV$CPFURCPIGPXKGTOKV$CPFCWHNCIGP 5VÒEM++





-QPXQNWV XQP  XGTUEJKGFGPGP #WU\GKEJPWPIGP FGU <YGKVGP 9GNVMTKGIU &CTWPVGT 4¾UKUVCPEG/G   FCKNNGWPF-TGW\FGT#NVGP-·ORHGTDGKFGCO$CPFOKVCWHIGNGIVGT4QUGVVG8GTUEJKGFGPG/GVCNNGCP MQTTGMVGP$·PFGTPGKPGOKV$CPFURCPIG ++



'TKPPGTWPIUOGFCKNNGCPFGP-TKGIXQPDKU=/¾FCKNNG%QOO¾OQTCVKXGFGNC)WGTTGFG ?XGTUEJKGFGPGUKNDGTHCTDGPG$CPFURCPIGP%#/2#)0'& +6#.+'TQVGOCKNNKGTVGT5VGTP .+$—4#6+10 #..'/#)0' (4#0%' /—&+6'44#0—' ':64˜/'14+'06 #(4+37'   0148–)' /'4 &7 014& /#0%*' )4#0&' $4'6#)0' #6.#06+37' 7455   +6#.+' '0)#)— 81.106#+4' &—('05' 2#55+8' WPF 670+5+'  CWHIG\QIGP CWH   NCPIGO1TKIKPCNDCPFUVÒEM 5VÒEM++





88


FRANKREICH

ex 8416 (1:2)

ex 8419 (1:2)

ex 8424

ex 8420 (1:2)

ex 8425

ex 8423



-TGW\ HÒT HTGKYKNNKIGP /KNKV·TFKGPUV =%TQKZ FGU 5GTXKEGU /KNKVCKTGU 8QNQPVKGTU? #WUICDG HÒT FKG    .WHVYCHHG   WPF  -NCUUG WPF 0QTOCNCWUICDG   WPF  -NCUUG XGTIQNFGV D\Y XGTUKNDGTV    D\YDTQP\GHCTDGPCPMQTTGMVGP$·PFGTPFCXQP\YGKOKVCWHIGNGIVGT$CPFTQUGVVG&'%p  5VÒEM++





/GFCKNNGFGT0CVKQPCNGP8GTVGKFKIWPI=/¾FCKNNGFGNC&¾HGPUG0CVKQPCNG?XGTUEJKGFGPGUKNDGTHCT DGPG$CPFURCPIGPCWHIG\QIGPCWH\YGKNCPIGP1TKIKPCNUDCPFUVÒEMGP 5VÒEM++





-QPXQNWV XQP  /GFCKNNGP HÒT VTGWG #TDGKV =/¾FCKNNG FW 6TCXCKN? #WUICDGP XQP XGTUEJKGFGPGP   /KPKUVGTKGP W C -TKGIUOKPKUVGTKWO =)WGTTG? +PPGPOKPKUVGTKWO =+PV¾TKGWT? *CPFGNU WPF +PFWUVTKG   /KPKUVGTKWO =%QOOGTEG GV +PFWUVTKG? 8GTVGKFKIWPIUOKPKUVGTKWO =&¾HGPUG? #TDGKVUOKPKUVGTKWO   =6TCXCKN? CEJV )QNFOGFCKNNGP 5KNDGT XGTIQNFGV   5KNDGTOGFCKNNGP  $TQP\GOGFCKNNGP UQYKG \YGK   5KNDGTOGFCKNNGP 1%641+ FGU +PPGPOKPKUVGTKWOU VGKNU OKV GKPIGRT·IVGP QFGT ITCXKGTVGP 6T·IGTPCOGP   XQTYKGIGPFCP$·PFGTP 5VÒEM++



-QPXQNWV XQP  XGTUEJKGFGPGP #WU\GKEJPWPIGP FGU HTCP\ÌUKUEJGP 4QVGP -TGW\GU 8GTUEJKGFGPG   /GVCNNG FCTWPVGT XKGT KP 5KNDGT GKPG GOCKNNKGTV OKV 'OCKNNGEJKR  OGKUV CP $·PFGTP OKV FGO TQVGP   -TGW\FC\WGKP#PUVGEMCD\GKEJGP 5VÒEM++++p+++



-QPXQNWVXQPCEJVXGTUEJKGFGPGP#WU\GKEJPWPIGPFGUHTCP\ÌUKUEJGP4QVGP-TGW\GU'KPGFQRRGNV LGFQEJOKVWPVGTUEJKGFNKEJGP6T·IGTITCXWTGPXGTUEJKGFGPG/GVCNNGFCTWPVGTXKGTKP5KNDGTLGYGKNUCP QTKIKPCNGP$·PFGTPOKVFGOTQVGP-TGW\ 5VÒEM++++p+++



-QPXQNWVXQPXGTUEJKGFGPGPOKNKV·TKUEJGP#WU\GKEJPWPIGP&CTWPVGTFKG/KNKV·TOGFCKNNG KP\YGK XGTUEJKGFGPGP #WUHÒJTWPIGP  UKGDGP XGTUEJKGFGPG -TKGIUMTGW\G XGTUEJKGFGPG #WUICDGP FGT /GFCKNNG   FGT0CVKQPCNGP8GTVGKFKIWPIXGTUEJKGFGPG/GVCNNGVGKNUXGTIQNFGVVGKNUXGTUKNDGTVGKPKIGGOCKNNKGTVCP MQTTGMVGP$·PFGTPGKPKIGOKV$CPFURCPIGPQFGT#WHNCIGP 5VÒEM++





-QPXQNWVXQPXGTUEJKGFGPGP#WU\GKEJPWPIGP8GTUEJKGFGPG/GVCNNGCWEJ5KNDGTVGKNUXGTIQNFGV VGKNUXGTUKNDGTVCPMQTTGMVGP$·PFGTPGKPKIGOKV$CPFURCPIGPQFGT#WHNCIGP 5VÒEM++





-QPXQNWVOKVHTCP\ÌUKUEJGP1TFGPWPF'JTGP\GKEJGP7PVGTUEJKGFNKEJG/GVCNNG CWEJ5KNDGT VGKNU XGTIQNFGV VGKNU GOCKNNKGTV KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP ITÌ­VGPVGKNU CP $·PFGTP &C\W FTGK #WU   \GKEJPWPIUOKPKCVWTGPCP$·PFEJGP 5VÒEM++



-QPXQNWV XQP XKGT \KXKNGP 'JTGPOGFCKNNGP KP 1TKIKPCNGVWK   'JTGPOGFCKNNG FGT (QTUVXGTYCNVWPI   =(QT¿V?   'JTGPOGFCKNNG FGT <QNNXGTYCNVWPI =&QWCPGU?   'JTGPOGFCKNNG FGT 2QUV WPF 6GNGITCRJGP   8GTYCNVWPI =2QUVGU GV 6¾N¾ITCRJGU?   'JTGPOGFCKNNG FGT (TCP\ÌUKUEJGP 'KUGPDCJPGP HÒT FKG   9CKUGPMKPFGT(ÒTUQTIGOKV/KPKCVWT=1TRJ¾NKPCVFGU%JGOKPUFG(GT?\YGKKP5KNDGT\YGKKP$TQP\G LGYGKNUCPMQTTGMVGP$·PFGTPKPQTKIKPCNGPIQNFDGFTWEMVGP8GTNGKJWPIUGVWKU 5VÒEM++



-QPXQNWVXQPXGTUEJKGFGPGPXQTYKGIGPFOKPKUVGTKGNNGP'JTGP\GKEJGPWPVGTUEJKGFNKEJGP#NVGTU&CTWPVGT 8GTFKGPUVOGFCKNNGHÒT$GTICTDGKVGT=/KPGU?FGT9CUUGTWPF(QTUVXGTYCNVWPI='CWZGV(QT¿VU?HÒT-QOOWPCN DGCOVG='ORNQ[¾U%QOOWPCWZ?FGT<QNNXGTYCNVWPI=&QWCPGU?FGT(ÒTUQTIG=2TGXQ[CPEG5QEKCNG?HÒTÌHHGPV NKEJG#TDGKV=6TCXCWZ2WDNKEU?FGT(GWGTYGJT=5CRGWTU2QORKGTU?HÒTFKGÌTVNKEJG2QNK\GK=2QNKEG/WPK EKRCNG GV 4WTCNG? FGT 2QUV WPF 6GNGITCRJGPXGTYCNVWPI =2QUVGU GV 6¾N¾ITCRJGU? FGU 8GTUKEJGTWPIU   YGUGPU =#UUWTCPEGU? QHV KP FGT  WPF  -NCUUG 8GTUEJKGFGPG /GVCNNG CWEJ 5KNDGT VGKNUXGTUKNDGTV VGKNU XGTIQNFGV VGKNU OKV OKVIGRT·IVGP QFGT ITCXKGTVGP 6T·IGTPCOGP CP MQTTGMVGP $·PFGTP VGKNU OKV   CWHIGNGIVGP4QUGVVGP 5VÒEM+p++++













89


FRANKREICH

8427 8428 8429



-QPXQNWV XQP KPUIGUCOV  $CPFURCPIGP \WT -QNQPKCNOGFCKNNG WPF FGP XGTUEJKGFGPGP (GNF\WIU   WPF -TKGIUGTKPPGTWPIUOGFCKNNGP &CXQP CEJV IQNFHCTDGP  UKNDGTHCTDGP WPF GKPG DTQP\GHCTDGP   5VÒEM++



/KPKCVWTGPMGVVEJGPOKVHÒPH#WU\GKEJPWPIUOKPKCVWTGP 4KVVGTFGMQTCVKQPFGU0CVKQPCNGP8GTFKGPUV QTFGPU 4KVVGTFGMQTCVKQPFGU1TFGPUHÒT8GTFKGPUVGWOFGP6QWTKUOWU )QNFGPG#TDGKVUOGFCKNNG FGU *CPFGNU WPF +PFWUVTKG/KPKUVGTKWOU   4KVVGTFGMQTCVKQP FGU 1TFGPU HÒT 5Q\KCNXGTFKGPUVG    )QNFGPG'JTGPOGFCKNNGFGU*CPFGNUWPF+PFWUVTKG/KPKUVGTKWOU 5VÒEM+p++





#D\GKEJGP FGT /KVINKGFGT FGT &GRWVKGTVGP-COOGT 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV OKP   'OCKNNGUEJCFGPCP6TCIGMNCOOGT ++p





/KNKV·TKUEJGU2KNQVGPCD\GKEJGP$TQP\GVGKNYGKUGXGTUKNDGTVCWHFGT4ÒEMUGKVG*GTUVGNNGT\GKEJGP$WPF /CVTKMGNPWOOGTOKVQTKIKPCNGT$GHGUVKIWPIUTCJG ++





ex 8430

8431 8432



8433

-QPXQNWV XQP  XGTUEJKGFGPGP UQIGP +PUKIPGU 6GKNU XGTUKNDGTV VGKNU XGTIQNFGV ITÌ­VGPVGKNU   GOCKNNKGTVOKV$GHGUVKIWPIUXQTTKEJVWPIGP 5VÒEM++



(4#0-4'+%*-1.10+#.'#75<'+%*070)'0 

1TFGPFGU5EJYCT\GP5VGTPUXQP$¾PKP=1TFTGFGN —VQKNG0QKTFW$¾PKP?-QOOCPFGWTMTGW\GKP UGKVKIG#WUHÒJTWPI$TQP\GXGTIQNFGVWPFGOCKNNKGTVFGTUEJYCT\G5VGTPKO<GPVTWOHGJNVQJPG*CNU DCPF1#0 +++





1TFGP FGU 5EJYCT\GP 5VGTPU XQP $¾PKP =1TFTG FG N —VQKNG 0QKT FW $¾PKP? 1HHK\KGTUMTGW\ 5KNDGT   XGTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG1#0 +p++





1TFGP FGU 5EJYCT\GP 5VGTPU XQP $¾PKP =1TFTG FG N —VQKNG 0QKT FW $¾PKP? 1HHK\KGTUMTGW\ 5KNDGT   XGTIQNFGVVGKNYGKUGGOCKNNKGTVOKP#WUDTÒEJGKPFGTITÒPGP'OCKNNGCO$CPFOKVCWHIGNGIVGT4QUGVVG 1#0 ++



&GTHÒPHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGCO&G\GODGTXQP-ÌPKI6QHHCXQP2QTVQ0QXQUR·VGT -ÌPKI XQP &CJQOG[ IGUVKHVGV &WTEJ &GMTGV XQO  /CK  YWTFG GT CNU HTCP\ÌUKUEJGT -QNQPKCNQTFGP FGT   )TQ­MCP\NGK FGT 'JTGPNGIKQP WPVGTUVGNNV /KV &GMTGV XQP 5VCCVURT·UKFGPV %JCTNGU FG )CWNNG XQP  &G\GODGT    YWTFGFKG8GTNGKJWPIFGU1TFGPU\WO,CPWCTGKPIGUVGNNV

90


FRANKREICH

8436 8434



8435

8437

0KEJCPGN#PQWCT1TFGP=1TFTGFW0KEJCPGN#PQWCT?1HHK\KGTUFGMQTCVKQP5KNDGTVGKNYGKUGDTKNNCP VKGTVVGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG1#0 +



&GT HÒPHMNCUUKIG 1TFGP YWTFG  XQP 5WNVCP *COGFDGP/QJCOGF XQP 6CFLQWTCJ KO UR·VGTGP (TCP\ÌUKUEJ   5QOCNKCIGUVKHVGVWPFFWTEJ&GMTGVGXQOWPF/CKCNUHTCP\ÌUKUEJGT-QNQPKCNQTFGPFGT)TQ­MCP\NGKFGT 'JTGPNGIKQP WPVGTUVGNNV /KV &GMTGV XQP 5VCCVURT·UKFGPV %JCTNGU FG )CWNNG XQP  &G\GODGT  YWTFG FKG    8GTNGKJWPIFGU1TFGPU\WO,CPWCTGKPIGUVGNNV



-ÌPKINKEJGT DKU   1TFGP FGU 5VGTPU XQP #PLQWCP =1TFTG 4Q[CN  FG N 'VQKNG F #PLQWCP?   /QFGNN OKV41;#.KPFGT$G\GKEJPWPIWPFJGNNDNCWGO$CPFOKV\YGKQTCPIGHCTDGPGP5GKVGPUVTGKHGP    1HHK\KGTUFGMQTCVKQP $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP $CPF OKV   CWHIGNGIVGT4QUGVVG1#0 +



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI OKV OGJTVGKNKIGO /GFCKNNQP  5WNVCP 5CKFK #DFCNNCJ +++  DKP 5CNKO XQP #PLQWCP   

EC   GKPGT +PUGN FGU #TEJKRGNU FGT -QOQTGP UVKHVGVG FGP \WP·EJUV XKGTMNCUUKIGP )TQ­MTGW\    -QOOCPFGWT OKV WPF QJPG 5VGTP 1HHK\KGT  CNNIGOGKPGP 8GTFKGPUVQTFGP KO ,CJT  FGT CO  ,WPK  XQP    5WNVCP 5CKFK 1OCT DKP 5CKFK *CUCP TGQTICPKUKGTV YWTFG 0CEJFGO FKG -QOQTGP UEJQP CO  ,CPWCT  \WO    HTCP\ÌUKUEJGP 2TQVGMVQTCV IGYQTFGP YCTGP YWTFG GT PWPOGJT HÒPHMNCUUKI 4KVVGT  OKV &GMTGV FGU HTCP\ÌUKUEJGP    /KPKUVGTTCVGU XQO  5GRVGODGT  \WO HTCP\ÌUKUEJGP -QNQPKCNQTFGP OKV FGP HTCP\ÌUKUEJGP    -NCUUGPDG\GKEJPWPIGP  FGT PWPOGJT XQO )TQ­MCP\NGT FGT 'JTGPNGIKQP D\Y XQP FGTGP )TQ­MCP\NGK XGTYCNVGV    YWTFG  YWTFG GKP PGWGU 1TFGPUDCPF GKPIGHÒJTV  /QFGNN   YWTFG FCU 9QTV 4Q[CN -ÌPKINKEJ  KO    0COGP IGUVTKEJGP WPF FKG +PUKIPKGP FGOGPVURTGEJGPF IG·PFGTV  /QFGNN    IGY·JTVG 2T·UKFGPV %JCTNGU FG    )CWNNG   FGP -QOQTGP FKG KPPGTG #WVQPQOKG WPF  GTM·TVG UKEJ FGT 5VCCV WPCDJ·PIKI /KV &GMTGV    XQP 2T·UKFGPV FG )CWNNG XQO  &G\GODGT  YWTFG FGT 1TFGP FCTCWHJKP YKG CNNG -QNQPKCNQTFGP CWHIGJQDGP    2T·UKFGPV 5CÅF /QJCOGF&LQJCT FGT+UNCOKUEJGP$WPFGUTGRWDNKMFGT-QOQTGPUVKHVGVGFGP1TFGP OKV&GMTGV0T24PGW /QFGNN 



-ÌPKINKEJGT DKU 1TFGPXQP-CODQFUEJC=1TFTG 4Q[CN FW%CODQFIG?/QFGNN  UQIG PCPPVG /GVTQRQNKVCPG #WUHÒJTWPI   OKV -TQPG  &GMQTCVKQP  -NCUUG $TQP\G DTKNNCPVKGTV   WPFXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCOPKEJVMQTTGMVGP$CPF1#05H ++



&GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG CO  (GDTWCT  XQP -ÌPKI 0QTQFQO +   XQP   -CODQFUEJC IGUVKHVGV WPF CO  ,CPWCT  YWTFGP FKG 5VCVWVGP XGTÌHHGPVNKEJV <W GKPGO WPDGMCPPVGP UR·VGTGP   <GKVRWPMV XQT   YWTFGP FKG 1TFGPUFGMQTCVKQPGP XQP GKPGT YGUVNKEJ IGUVCNVGPGP -TQPG ÒDGTJÌJV /KV &GMTGV   XQO  /CK  ÒDGTVTWI FGT HTCP\ÌUKUEJG 5VCCVURT·UKFGPV (GNKZ (CWTG   FKG 8GTYCNVWPI FGU 1TFGPU   PWPOGJTQJPGFKG$G\GKEJPWPITQ[CNCPFKG)TQ­MCP\NGKFGT'JTGPNGIKQPKP2CTKUYQFWTEJGTGKPHTCP\ÌUKUEJGT -QNQPKCNQTFGPYWTFG/KV&GMTGVXQO&G\GODGTYWTFGHÒTFKGFWTEJFGPHTCP\ÌUKUEJGP5VCCVURT·UKFGPVGP CWUIGURTQEJGPGP 8GTNGKJWPIGP GKP PGWGU 1TFGPUDCPF YGK­ OKV QTCPIGP 5GKVGPUVTGKHGP  GKPIGHÒJTV &KG FWTEJ FGP   -ÌPKI XQP -CODQFUEJC CWUIGURTQEJGPGP 8GTNGKJWPIGP YWTFGP YGKVGTJKP CO DKUJGTKIGP TQVGP $CPF OKV ITÒPGP   5GKVGPUVTGKHGP XGTNKGJGP /KV &GMTGV XQO  #WIWUV  YWTFG WPVGT -ÌPKI 0QTQFQO 5KJCPQWM IGD   FKG   8GTYCNVWPIYKGFGTPCEJ-CODQFUEJC\WTÒEMÒDGTVTCIGPFGT1TFGPUQOKVYKGFGTGKPTGKPMCODQFUEJCPKUEJGT1TFGP &KG4GIKGTWPIFGU&GOQMTCVKUEJGP-CODQFUEJCJCVFGP1TFGPCDIGUEJCHHV+P(QNIGFGT4ÒEMMGJT0QTQFQO 5KJCPQWMUPCEJ-CODQFUEJCCNU-ÌPKIYWTFGFGT1TFGPOKVMÌPKINKEJGO&GMTGV0TXQO1MVQDGT YKGFGTGTTKEJVGVYQDGKFKG+PUKIPKGPPWPOGJTXQPFGTMCODQFUEJCPKUEJGP-ÌPKIUMTQPGÒDGTJÌJVUKPF



1TFGPFGU&TCEJGPUXQP#PPCO=1TFTGFW&TCIQPF #PPCO?1HHK\KGTUFGMQTCVKQPUQIGPCPPVG/G VTQRQNKVCPG#WUHÒJTWPI OKVTQVGO$CPFOKVIGNDGP4CPFUVTGKHGP $TQP\GDTKNNCPVKGTVWPF XGTIQNFGV VGKNYGKUG GOCKNNKGTV 'OCKNNGCWUDTWEJ KO /GFCKNNQPTKPI CO $CPF OKV CWHIGNGIVGT 4QUGVVG   1#0 ++



&GTHÒPHMNCUUKIG<KXKNWPF/KNKV·T8GTFKGPUVQTFGPYWTFGCO/·T\XQP-CKUGT&QPI-JCPJIGUVKHVGVWPF CO  /CK  GKP HTCP\ÌUKUEJGT \KXKNGT WPF OKNKV·TKUEJGT -QNQPKCNXGTFKGPUVQTFGP FGT HQTVCP XQO HTCP\ÌKUEJGP   2T·UKFGPVGPCWH8QTUEJNCIFGU-QNQPKCNOKPKUVGTUXGTNKGJGPYWTFGYWTFGPFKG8GTNGKJWPIGPFWTEJFKG(TCP\Q UGPGKPIGUVGNNV 8INCWEJ5[NXGUVGT,T,QJP6JG1TFGTUCPF/GFCNUQH(TGPEJ+PFQEJKPC4CNGKIJ5HH 

91


GRIECHENLAND

8438

8440

8439

)4+'%*'0.#0& -¤0+)4'+%*4')+'470)-¤0+)16615   

'TNÌUGT1TFGP/QFGNN OKVFGO-QRH-ÌPKI1VVQU )QNFGPGU-TGW\ 1HHK\KGTUMTGW\  HTÒJG MNGKPGTG #WUHÒJTWPI OKV MNGKPGT -TQPG )QNF GOCKNNKGTV CO \GKVIGPÌUUKUEJGP QTKIKPCNGP $CPF   <'+ 44+

5GJTSWCNKVCVKXG#PHGTVKIWPIXQPXQTKP#PDGVTCEJVFGU#NVGTUÒDGTTCIGPFGT'TJCNVWPI







<9'+6'5 -¤0+)4'+%*  

'TNÌUGT1TFGP/QFGNN WPF )QNFGPGU-TGW\ 1HHK\KGTUMTGW\ )QNFGOCKN NKGTV  I HGKPUVG 'OCKNNGOCNGTGK -TQPG OKP GKPIGFTÒEMV CO CNVGP $CPF KP TWO·PKUEJGT 0·JCTV   <'+ ++



'TNÌUGT1TFGP/QFGNN WPF )QNFGPGU-TGW\ 1HHK\KGTUMTGW\ )QNFGOCKN NKGTV  I HGKPUVG 'OCKNNGOCNGTGK KO $CPFTKPI HTCP\ÌUKUEJG 'KPHWJTRWP\G UGKV  7JW  QJPG   $CPF<'+ +p++



8442

8441

&4+66'5 -¤0+)4'+%*   



'TNÌUGT1TFGP/QFGNN WPF )QNFGPGU-TGW\ 1HHK\KGTUMTGW\ 5KNDGTXGTIQN FGV /GFCKNNQPU )QNF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK 'OCKNNGCWUDTWEJ CWH FGT 8QTFGT WPF   4ÒEMUGKVGGKPGU-TGW\CTOUCO$CPFOKVCWHIGNGIVGT4QUGVVG<'+ ++p+++



2JÌPKZ1TFGP/QFGNN OKV-TQPGWPFQJPG$WEJUVCDGPCWHFGO-TGW\ )TQ­MQOOCP FGWTUUGV DGUVGJGPF CWU )TQ­MQOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP   *CNUDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC 5RKPM  5QP KP .QPFQP KO QTKIKPCNGP UEJYCT\GP IQNFDGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC   5RKPM<'+ 5VÒEM+p++



)GUVKHVGV XQP FGT ITKGEJKUEJGP 4GRWDNKM CO  /CK  CNU HÒPHMNCUUKIGT CNNIGOGKPGT 8GTFKGPUVQTFGP YCT GT   \WP·EJUV #WUN·PFGTP XQTDGJCNVGP 0CEJ 9KGFGTGKPHÒJTWPI FGT /QPCTEJKG YWTFG GT CO  ,CPWCT  KP GKPGP   CWEJ HÒT )TKGEJGP \WI·PINKEJGTP 8GTFKGPUVQTFGP WOIGHQTOV +P  WPF  CDIG·PFGTVGT (QTO DGUVGJV FGT   1TFGPPQEJJGWVG

92


GROSSBRITANNIEN

8444

8443

8+'46' 4'27$.+- 5'+6  

2JÌPKZ1TFGP  /QFGNN UGKV   )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVCP0CFGNFKGUGOKV *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -GNCKFGU OKV \YGK 5GKVGPJCMGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT   (KTOC-GNCKFGUOKVIQNFHCTDGPGO2JÌPKZ<'+ 5VÒEM+p++



)4155$4+6#00+'070&8'4'+0+)6'5-¤0+)4'+%* 14&'0 

&GT5GJT'JTGPYGTVG$CVJ1TFGP/QFGNN UGKV OKNKV·TKUEJG#DVGKNWPI-TGW\FGT)GHQNIU NGWVG %QORCPKQP  %$   #WUHÒJTWPI 5KNDGT XGTIQNFGV CO $TWUVDCPF    5KNDGT   XGTIQNFGVWPFGOCKNNKGTVGKPKIGMCWOUKEJVDCTG%JKRUKPFGTITÒPGP'OCKNNGCWH8QTFGTWPF4ÒEMUGKVG CWH8QTFGTWPF4ÒEMUGKVGFGT#ITCHHGOGJTHCEJRWP\KGTV WC.QPFQPGT,CJTGURWP\GCHÒT CO $CPFOKV6TCIGURCPIG/;$<'+ ++



8445 (1:1)



&GT UGJT #WUIG\GKEJPGVG 1TFGP XQO JN /KEJCGN WPF XQO JN )GQTI *CNUFGMQTCVKQP GKPGU 4KVVGT   -QOOCPFGWTU -PKIJV %QOOCPFGT  -%/)  )QNF IGRTÒHV   I GOCKNNKGTV 'OCKNNGOCNGTGK   MCWO UKEJVDCTG 'OCKNNGMTCV\GT KO /GFCKNNQPTKPI QJPG 2WP\KGTWPI CO QTKIKPCNGP CNVGP NCPIGP   *CNUDCPF<'+ +p++  #PHGTVKIWPICWUFGONGV\VGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

93


GROSSBRITANNIEN

8446



&GT UGJT #WUIG\GKEJPGVG 1TFGP XQO JN /KEJCGN WPF XQO JN )GQTI $TWUVUVGTP GKPGU 4KVVGT   -QOOCPFGWTU -PKIJV %QOOCPFGT  -%/)  5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP )QNF   HGKPUV ITCXKGTV WPF \KUGNKGTV VGKNYGKUG GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK MCWO UKEJVDCTG 'OCKNNG   CDRNCV\WPIKO<GPVTWOQJPG*GTUVGNNGTDG\GKEJPWPICPGEJVIQNFGPGT0CFGN<'+ 44+p++



(TÒJGT $TWUVUVGTP CWU FGT GTUVGP *·NHVG FGU 0GWP\GJPVGP ,CJTJWPFGTVU OKV HGKPUV ITCXKGTVGO WPF \KUGNKGTVGO /G   FCKNNQPTKPIWPFRNCUVKUEJCWUIGHÒJTVGT'PIGNUWPF6GWHGNUITWRRG

8447

8448 8449





&GT UGJT $GFGWVGPFG 1TFGP FGU +PFKUEJGP 'ORKTG &GMQTCVKQP FGT )GHQNIUNGWVG %QORCPKQP    %+' /QFGNN CO*CNUDCPF )QNFGOCKNNKGTVICOQTKIKPCNGP*CNUDCPF<'+  ++



&GT5GJT$GFGWVGPFG1TFGPUFGU$TKVKUEJGP'ORKTGU/QFGNN OKV$TKVCPPKCKO/GFCKNNQP  <KXKNG#DVGKNWPI-QOOCPFGWTMTGW\ %$' 5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKV*CNUDCPFWPF *CNUDCPFCDUEJPKVVKOQTKIKPCNGPFWPMGNXKQNGVVGPIQNFGPDG\GKEJPGVGP8GTNGKJWPIUGVWKFGT(KTOC)CTTCTF %QKP.QPFQP/;$<'+ +p++



&GT5GJT$GFGWVGPFG1TFGPUFGU$TKVKUEJGP'ORKTGU/QFGNN OKV2QTVTCKV-ÌPKI)GQTI8WPF 3WGGP/CT[ UKO/GFCKNNQPUGKV <KXKN#DVGKNWPI-TGW\FGT+PJCDGT /$' 5KNDGTCO$CPF OKV 0CFGN \WUCOOGP OKV -CTVG DGVTGHHGPFG FKG 6TCIGYGKUG KO QTKIKPCNGP UEJYCT\GP IQNFGP   DG\GKEJPGVGP8GTNGKJWPIUGVWKFGT-ÌPKINKEJGP/ÒP\GKP.QPFQP/;$<'+ ++



&GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG CO  ,WPK  XQP -ÌPKI )GQTI 8 IGUVKHVGV FKG )GUVCNVWPI   UGKPGT +PUKIPKGP FWTEJ -ÌPKI )GQTI 8+  GVYCU XGT·PFGTV 8QP #PHCPI CP YWTFGP CWEJ (TCWGP KP FGP 1TFGP   CWHIGPQOOGP &KG $GNGKJWPI OKV FGP DGKFGP JÌEJUVGP -NCUUGP HÒJTV JGWVG PWT PQEJ HÒT $TKVGP HTÒJGT CWEJ HÒT   -CPCFKGT#WUVTCNKGT0GWUGGN·PFGTGVE FKG#WHPCJOGKPFKG4KVVGTUEJCHVOKVUKEJOKVFGO4GEJVFKG#PTGFG5KT QFGT &COG \W HÒJTGP &GO 1TFGP CHHKNKKGTV KUV FKG /GFCKNNG FGU $TKVKUEJGP 'ORKTGU 8IN CWEJ )CNNQYC[ 2GVGT   6JG1TFGTQHVJG$TKVKUJ'ORKTG.QPFQP



94


GROSSBRITANNIEN

8450 (1:1)



-ÌPKINKEJGT 8KMVQTKC1TFGP 5GV FGT 4KVVGT FGU )TQ­MTGW\GU -PKIJV )TCPF %TQUU  )%81    DGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG6T·IGTPWOOGTQJPG 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT TGRGTEKGTV VGKNYGKUG XGTIQNFGV -TQPG )QNF IGRTÒHV  GOCKNNKGTV   CWH FGT 4ÒEMUGKVG 6T·IGTPWOOGT  &WTEJO  OO CP GEJV IQNFGPGT 0CFGN KO QTKIKPCNGP   DQTFGCWZTQVGP8GTNGKJWPIUGVWKFGT(KTOC%QNNKPIYQQF%QKP.QPFQP$74-'5HH/;$ 1#081.2'5<'+/;$<'+ 5VÒEM+p++  )GUVKHVGVXQP-ÌPKIKP8KMVQTKCCO#RTKNCNUHÒPHMNCUUKIGT1TFGP\WT$GNQJPWPIHÒTFGO5QWXGT·PRGTUÌP NKEJ IGNGKUVGVG &KGPUVG #NU TGKPGT *CWUQTFGP KUV GT PGDGP FGT -ÌPKINKEJGP 8KMVQTKC-GVVG 4Q[CN 8KEVQTKCP %JCKP    FKGUVCVWCTKUEJPKEJVOKVFGO-ÌPKINKEJGP8KMVQTKC1TFGPXGTDWPFGPKUVFGTGKP\KIGDTKVKUEJG1TFGPFGTCNNGKPXQO DTKVKUEJGP /QPCTEJGP QJPG 'KPHNW­PCJOG FGT 4GIKGTWPI XGTNKGJGP YKTF (TCWGP YGTFGP UGKV  KP FGP 1TFGP   CWHIGPQOOGP &KG $GNGKJWPI OKV FGP DGKFGP JÌEJUVGP -NCUUGP HÒJTV HÒT 7PVGTVCPGP $TKVGP -CPCFKGT #WUVTCNKGT   0GWUGGN·PFGTGVE FKG#WHPCJOGKPFKG4KVVGTUEJCHVOKVUKEJOKVFGO4GEJVFKG#PTGFG5KTQFGT&COG\WHÒJTGP &GO 1TFGP CHKNKKGTV KUV FKG 8KMVQTKC/GFCKNNG FKG KP FTGK 5VWHGP XGTNKGJGP YKTF 8IN CWEJ )CNNQYC[ 2GVGT   5VCPNG[ &CXKF WPF /CTVKP 5VCPNG[ 4Q[CN 5GTXKEG  8QNWOG + .QPFQP  7PF -NKGVOCPP-WTV) )TQ­DTK   VCPPKGP-ÌPKINKEJGT8KEVQTKC1TFGP+P1TFGPU.GZKMQP$CPF$GTNKPQ, 

8451



8453

-ÌPKINKEJGT 8KMVQTKC1TFGP -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   /CVTKMGNPWOOGT%CO*CNUDCPFKODQTFGCWZTQVNGFGTPGP8GTNGKJWPIUGVWKFGT(KTOC%QNNKPIYQQF KP.QPFQPOKVITÒPGT5COVGKPNCIGOKVIQNFHCTDGPGT#WHUEJTKHV%81<'+ ++





-ÌPKINKEJGT8KMVQTKC1TFGP'VWKFGT(KTOC%QNNKPIYQQFKP.QPFQP\WO-QOOCPFGWTMTGW\FWPMGN TQVGU.GFGTKOKVCVOKVITÒPGT5COVGKPNCIGOKVIQNFHCTDGPGT#WHUEJTKHV%81 +p++





&GT'JTYÒTFKIG1TFGPXQP5V,QJP$TWUVMTGW\FGT4GEJVUTKVVGT/QFGNN UGKV &WTEJOGUUGT OO$TQP\GXGTIQNFGVWPFGOCKNNKGTVCP0CFGN/;$<'+ ++



+O,CJTGYWTFGFWTEJFCU)GPGTCNMCRKVGNDGUEJNQUUGPFKG+PUKIPKGPFGU1TFGPUMÒPHVKIPKEJVOGJTCWU5KNDGT JGTUVGNNGP\WNCUUGP#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVU



&GT'JTYÒTFKIG1TFGPXQP5V,QJP.GGTGU'VWK\WO5GVFGT4GEJVUTKVVGTFGU1TFGPU OKV*CNUMTGW\ WPFITQ­GO$TWUVUVGTP  ++

 95


GROSSBRITANNIEN

8455

8458

8456



&GT'JTYÒTFKIG1TFGPXQP5V,QJP5GVFGT)PCFGPTKVVGTDGUVGJGPFCWU*CNUMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVPCJG\WWPUKEJVDCTG'OCKNNGTGRCTCVWT4ÒEMUGKVGGKPGT-TGW\URKV\G&WTEJOOOCO NCPIGP *CNUDCPF WPF $TWUVMTGW\ 5KNDGT GOCKNNKGTV &WTEJO  OO CP GEJV IQNFGPGT 0CFGN KO   QTKIKPCNGP8GTNGKJWPIUGVWKFGU1TFGPU<'+ 5VÒEM+p++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T 5GJTSWCNKV·VUXQNNG(GTVKIWPIXQT+PFKGUGO,CJTYWTFGNCWV6Q\GT 61<5 XQO)GPGTCNMCRKVGNFGU 1TFGPUDGUVKOOVFKG+PUKIPKGPFGT)PCFGPTKVVGTPWTPQEJCWUWPGFNGO/GVCNNHGTVKIGP\WNCUUGP

'*4'0<'+%*'0 

/KNKV·T-TGW\ =/KNKVCT[ %TQUU?  /QFGNN  #WUICDG OKV /QPQITCOO -ÌPKI )GQTIU 8      5KNDGTCOQTKIKPCNGP$CPF/;$ ++





/KNKV·TMTGW\=/KNKVCT[%TQUU?(·NUEJWPI  GKPGU-TGW\GUFGU/QFGNN OKVFGO/QPQITCOO)4+ -ÌPKI )GQTI 8    FKG 4ÒEMUGKVG DGUEJNKHHGP WPF WPUCEJIGO·­ GKPITCXKGTV .6 ( .   %.#4-'CO$CPF +++++



/GFCKNNGHÒTJGTXQTTCIGPFG(ÒJTWPI=&KUVKPIWKUJGF%QFWEV/GFCN?/QFGNN OKV2QTVTCKV-ÌPKI )GQTI8KP#FOKTCNU7PKHQTO 5KNDGTQJPG4CPFPCOGPCOQTKIKPCNGP$CPF/;$ ++





'ZGORNCTG QJPG 4CPFPCOGP YWTFGP Y·JTGPF FGU 'TUVGP 9GNVMTKGIU CP CWUN·PFKUEJG OGKUV HTCP\ÌUKUEJG 5QNFCVGP   XGTNKGJGP

8459





8460

8461

6CRHGTMGKVU/GFCKNNG FGU -ÌPKIU KO (TGKJGKVUMCORH =-KPI U /GFCN HQT %QWTCIG KP VJG %CWUG QH   (TGGFQO? 5KNDGT CWH FGT 4ÒEMUGKVG 5VGORGNUEJPGKFGT\GKEJGP 9) CO QTKIKPCNGP $CPF OKV   6TCIGURCPIG KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT -ÌPKINKEJGP /ÒP\G OKV IQNFHCTDGPGT #WHUEJTKHV   /;$ ++



+ORGTKCNG&KGPUV/GFCKNNG'TUVGU/QFGNN UVGTPHÌTOKI #WUHÒJTWPI OKVFGO/QPQITCOO-ÌPKI 'FWCTF8++ $TQP\G#WHNCIG5KNDGTVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG6T·IGTITCXWT ,1*0'#22.';#4&CO$CPFOKV6TCIGURCPIG\WUCOOGPOKV+PVGTKOUURCPIGPDCPFKOQTKIKPCNGP FWPMGNITÒPGP IQNFGP DG\GKEJPGVGP 8GTNGKJWPIUGVWK FGT (KTOC 'NMKPIVQP  %Q KP .QPFQP /;$   <'+ ++



/;$ 5 IKDVEC8GTNGKJWPIGPFKGUGT#WUHÒJTWPICP



+ORGTKCNG&KGPUV/GFCKNNG'TUVGU/QFGNN UVGTPHÌTOKI #WUHÒJTWPI OKVFGO/QPQITCOO-ÌPKI 'FWCTF8++ $TQP\G#WHNCIG5KNDGTVGKNYGKUGGOCKNNKGTVCO$CPFOKV6TCIGURCPIGOKV *GTUVGNNGTDG\GKEJPWPI(KTOC'NMKPIVQP%QKP.QPFQP/;$<'+ ++ /;$ 5 IKDVEC8GTNGKJWPIGPFKGUGT#WUHÒJTWPICP

96




GROSSBRITANNIEN

8462



8465

8464

8463 Rs.

+PFKUEJG #NNIGOGKPG (GNF\WIU/GFCKNNG  5KNDGT OKV 4CPFITCXWT  2VG * 5RGPEGT F $P   .GKE4OKV)GHGEJVUURCPIG$74/#CO$CPF/;$ ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV



-TKO-TKGIU/GFCKNNG =%TKOGC /GFCN? 5KNDGT QJPG 6T·IGTPCOGP CO $CPF OKV $CPFURCPIG   5'$#56121./;$ ++



'ZGORNCTGQJPG4CPFPCOGPYWTFGPCPCWUN·PFKUEJGOGKUVHTCP\ÌUKUEJG5QNFCVGPXGTNKGJGP



-TKO-TKGIU/GFCKNNG =%TKOGC /GFCN? 5KNDGT QJPG 6T·IGTPCOGP CO $CPF OKV $CPFURCPIG   5'$#56121./;$ ++



'ZGORNCTGQJPG4CPFPCOGPYWTFGPCPCWUN·PFKUEJGOGKUVHTCP\ÌUKUEJG5QNFCVGPXGTNKGJGP



/GFCKNNGHÒTFKG6GKNPGJOGTCO\YGKVGP%JKPC-TKGI5KNDGTKO4CPF6T·IGTPCOG 2VG'&9#4& %100145 UV (116 OKV )GHGEJVUURCPIG 6#-7 (1465  QJPG $CPF   /;$X ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV

8466 Rs.



8467

8468

0GWUGGNCPF/GFCKNNG#WUICDGOKVFGP,CJTGU\CJNGPVQ5KNDGTKO4CPF6T·IGTPCOG ,CU$76.'4PF$PVJ4[N+4+5*4')VQJPG$CPF/;$ZZKKK ++p



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU MCPP MGKPG )GY·JT ÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ   CWHFKG)GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



#NNIGOGKPG(GNF\WIU/GFCKNNG=)GPGTCN5GTXKEG/GFCN?5KNDGTOKV6T·IGTPCOG26' +54)4';01.&52#;0' #5* CO $CPF OKV FTGK )GHGEJVUURCPIGP 5176* #4#$+#   /#.#;2'0+57.#WPF5176*#4#$+#/;$ ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV



#HIJCPKUVCP/GFCKNNG    5KNDGT KO 4CPF OKV 6T·IGTPCOGP $ 2VG ,)4#; PF   *+)*TUOKV\YGK)GHGEJVUURCPIGP%*#4#5+#WPF-#$7.CO$CPF/;$ ++p



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV

97


GROSSBRITANNIEN

8470 8469



8471

#HIJCPKUVCP/GFCKNNG    5KNDGT KO 4CPF OKV 6T·IGTPCOGP %#2**19'.. UV   270,+0(QJPG)GHGEJVUURCPIGPCOQTKIKPCNGP$CPFOKV6TCIGURCPIG/;$K +p++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU MCPP MGKPG )GY·JT ÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ   CWHFKG)GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



#HIJCPKUVCP/GFCKNNG    5KNDGT OKV 6T·IGTITCXWT CWH FGO 4CPF $2VG   *2'8'4'66 VJ 4')V OKV DGHGUVKIVGO 5V·PFGT 5KNDGT CWH FGT 4ÒEMUGKVG 9KFOWPIUITCXWT   ,'/HTQO#'%WPF$KTOKPIJCOGT5KNDGTRWP\GWPF,CJTGURWP\G:HÒT/;$ ++



-WTKQUG#WHOCEJWPICNURGTUÌPNKEJG'TKPPGTWPIUICDG



5ÒF#HTKMC/GFCKNNG  =5QWVJ #HTKEC /GFCN? 5KNDGT 6T·IGTPCOG CWUIGUEJNKHHGP CO $CPF   /;$ ++

8472



8473

8474



8475

/GFCKNNG HÒT FGP -TKGI KP %JKPC  UQIGP $QZGT#WHUVCPF  5KNDGT KO 4CPF OKV 6T·IGTPCOG   %QTRN*$TQQMGT56%QTRUQJPG)GHGEJVUURCPIGQJPG$CPF/;$ ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU MCPP MGKPG )GY·JT ÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ   CWHFKG)GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



5ÒFCHTKMC/GFCKNNGFGT-ÌPKIKP5KNDGTKO4CPFOKV6T·IGTPCOGP2VG,4'00+'  5'# *+)*45 OKV HÒPH )GHGEJVUURCPIGP %#2' %1.10; 2##4&'$'4)  &4+'(106'+0   ,1*#00'5$74)5176*#(4+%#CO$CPF/;$ ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV



5ÒFCHTKMC/GFCKNNG FGT -ÌPKIKP  5KNDGT KO 4CPF OKV 6T·IGTPCOGP  2VG   9&#8+&510 - 1 5%16 $14& OKV \YGK )GHGEJVUURCPIGP %#2' %1.10; WPF   2##4&'$'4)CO$CPF/;$ ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV



5ÒFCHTKMC/GFCKNNG FGU -ÌPKIU  5KNDGT KO 4CPF OKV 6T·IGTPCOGP  .%2. , /E 6   *'04; 2 1( 9.+ *145' OKV \YGK )GHGEJVUURCPIGP 5176* #(4+%#  WPF 5176*   #(4+%#CO$CPF/;$ ++ (ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV

98




GROSSBRITANNIEN

8477

8476



8478

8480

8479

8481

'OFGP/GFCKNNG ='OFGP /GFCN? 5KNDGT CWH FGT 4ÒEMUGKVG FGT 6TCIGOQPVWT *GTUVGNNGTDG\GKEJPWPI   FGT(KTOC9-GTTKP5[FPG[CP6TCIGTCJGCO$CPFFGT#NNIGOGKPGP(GNF\WIU/GFCKNNGFGT/CTKPG OKV#FNGT#WHNCIG/;$7$ 4++



-WT\ PCEJ #WUDTWEJ FGU 'TUVGP 9GNVMTKGIGU DTCEJVG FGT #WUVTCNKUEJG -TGW\GT */5 5[FPG[ PCEJ GKPGO MWT\GP   )GHGEJVDGKFGP%QEQU+PUGNPFGPFGWVUEJGPNGKEJVGP-TGW\GT5/5'OFGPCWH#WHFGOGTQDGTVGP5EJKHHYWTFGP GKPG ITÌ­GTG #P\CJN /GZKMCPKUEJGT 5KNDGT2GUQU IGHWPFGP FKG XQP FGP #WUVTCNKGTP DGUEJNCIPCJOV YWTFGP &KG   (KTOC 9 -GTT KP 5[FPG[ YWTFG KP FGT (QNIG FCOKV DGCWHVTCIV FKG 2GUQU KP #PJ·PIGT WO\WCTDGKVGP FKG CP FKG   /CPPUEJCHV FGT */5 5[FPG[ CNU 'TKPPGTWPIU\GKEJGP IGIGDGP YWTFGP 0CEJFGO -CKUGT 9KNJGNO ++ XQP FGO   )GHGEJV-GPPVPKUGTNCPIVJCVVGIGUVCVVGVGGTCNNGP$GUCV\WPIUOKVINKGFGTPFGT5/5'OFGPKJTGO0CEJPCOGPFGP DNGKDGPFGPWPFXGTGTDDCTGP<WUCV\'OFGPJKP\W\WHÒIGP



-TKGIUOGFCKNNGFGT6GTTKVQTKCN(QTEG=6GTTKVQTKCN(QTEG9CT/GFCN?$TQP\GOKV6T·IGT PCOGP26'(').18'451/.+CO$CPF/;$ ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU MCPP MGKPG )GY·JT ÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ   CWHFKG)GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



#NNIGOGKPG (GNF\WIU/GFCKNNG  =)GPGTCN 5GTXKEG /GFCN?  #WUICDG OKV 2QTVTCKV -ÌPKI   )GQTI8+WPF(+&&'( 5KNDGTKO4CPF6T·IGTPCOG26''/E)+$$10 /#0%*CO$CPFOKV)GHGEJVUURCPIG/#.#;#/;$ZKK ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV



#NNIGOGKPG(GNF\WIU/GFCKNNG=)GPGTCN5GTXKEG/GFCN?#WUICDG OKV2QTVTCKV-ÌPKIKP 'NKUCDGVJU ++ WPF &+' )4#6+#    5KNDGT KO 4CPF 6T·IGTPCOG  26' - ,   /'.8+0.1;#.5CO$CPFOKV)GHGEJVUURCPIG/#.#;#/;$ZKKK ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV



#NNIGOGKPG (GNF\WIU/GFCKNNG  =)GPGTCN 5GTXKEG /GFCN? 5KNDGT OKV 6T·IGTPCOG    -)5/2,9;00-+0)5CO$CPFOKV)GHGEJVUURCPIG0146*'40+4'.#0&/;$XK ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV



#NNIGOGKPG(GNF\WIU/GFCKNNG=)GPGTCN5GTXKEG/GFCN?5KNDGTOKV6T·IGTPCOG26' ) /E (#4.#0' .#04 298  CO $CPF OKV )GHGEJVUURCPIG 5176* #4#$+# /;$   KKK ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU WPF FKG <WIGJÌTKIMGKV FGT )GHGEJVUURCPIG P  MCPP MGKPG )GY·JT ÒDGTPQO   OGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT   #WMVKQPCWHOGTMUCOIGOCEJV

99


GROSSBRITANNIEN

8484

8482 8483



#NNIGOGKPG (GNF\WIU/GFCKNNG  =)GPGTCN 5GTXKEG /GFCN? 5KNDGT OKV 6T·IGTPCOG    4(05#0$#*#&74)*#.')4CO$CPFOKV)GHGEJVUURCPIG$140'1CP6TCIGURCPIG /;$ ++



(ÒTFKG#WVJGPVK\KV·VFGU4CPFPCOGPUWPFFKG<WIGJÌTKIMGKVFGT)GHGEJVUURCPIG P MCPPMGKPG)GY·JTÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT #WMVKQP   CWHOGTMUCOIGOCEJV



5EJÒV\GPCD\GKEJGP5KNDGTZOOHGKPITCXKGTVOKV+PUEJTKHV50#25*116+0)OKV\YGK.Ì EJGTP\WO$GHGUVKIGP ++





&KGPUVCWU\GKEJPWPIU/GFCKNNGHÒTFKG8QNWPVGGT(QTEG=8QNWPVGGT.QPI5GTXKEGCPF)QQF%QPFWEV /GFCN?#WUICDG OKV2QTVTCKV-ÌPKIKP8KMVQTKCU HÒT)TQ­DTKVCPPKGP5KNDGTKO4CPF6T·IGTPCOG 3/5)6#42'#-''55':8#CO$CPF/;$ ++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU MCPP MGKPG )GY·JT ÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ   CWHFKG)GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV

8486

8485



8GTFKGPUVMTGW\ FGT 'WTQRGCP )CU %QORCP[ 8GTFKGPUVMTGW\ KP $TQP\G $TQP\G CWH FGT 4ÒEMUGKVG   9KFOWPIUITCXWT'7412'#0)#5%1/2#0;&—%'40—'ˆ+5+&14'%#)0;2174 5'48+%'5':%'26+100'.5.10&10COQTKIKPCNGP$CPFOKV6TCIGUEJPCNNG 4++



-WTKQUGU8GTFKGPUVMTGW\GKPGTDTKVKUEJGP(KTOCOKV9KFOWPIKPHTCP\ÌUKUEJGT5RTCEJG



)TWRRGXQPHÒPH'JTGP\GKEJGPFGU1DGTUVNGWVPCPVU*#%COGTQP 5WFCP/GFCKNNGFGT-ÌPKIKP =3WGGP U 5WFCP/GFCN? 5KNDGT KO 4CPF 6T·IGTITCXWT .V * # %#/'410 4 '   $TKVKUEJG   -TKGIUOGFCKNNG  5KNDGT KO 4CPF 6T·IGTITCXWT .6 %1. * # %#/'410       +PVGTCNNKKGTVG 5KGIGUOGFCKNNG  KO 4CPF 6T·IGTITCXWT .6 %1. * # %#/'410     5KNDGTPG &GNJK &WTDCT/GFCKNNG  5KNDGT   5WFCP/GFCKNNG FGU -JGFKXGP =-JGFKXG U 5WFCP   /GFCN?5KNDGTKO4CPF6T·IGTITCXWT.V*#%#/'4104' ++ (ÒT FKG #WVJGPVK\KV·V FGT 4CPFPCOGP MCPP MGKPG )GY·JT ÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ   CWHFKG)GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV

100




GROSSBRITANNIEN

8487 (1:2)



8488 (1:2)

1TFGPUUEJPCNNGOKVHÒPH#WU\GKEJPWPIGP 5VGTP #VNCPVKM5VGTP #HTKMC5VGTPOKV $CPFURCPIG 0146* #(4+%#    +VCNKGP5VGTP   -TKGIUOGFCKNNG  OKV 'KEJGP   DNCVVURCPIG 5VÒEM++



(ÒTFKG1TKIKPCNKV·VFGT$CPFURCPIGPMCPPMGKPG)GY·JTÒDGTPQOOGPYGTFGP



1TFGPUUEJPCNNGOKVXKGT#WU\GKEJPWPIGP -TGW\OKV$CPFURCPIGVJ#7)PF018 OKV6T·IGTPCOGP$0&5/0#(1706#+0)14&*KIJTU $TKVKUEJG-TKGIUOGFCKNNG  5KNDGT OKV 6T·IGTPCOGP  26' # (1706#+0 )14&*+)*45   +PVGTCNNKKGTVG   5KGIGUOGFCKNNG  OKV 6T·IGTPCOGP  26' # (1706#+0 )14&*+)*45   #TOGG   &KGPUVCWU\GKEJPWPIUOGFCKNNG #WUICDG OKV FGO 2QTVTCKV -ÌPKI )GQTI 8 KP #FOKTCNU7PHQTO 5KNDGT   OKV 6T·IGTPCOGP  $0&5/0#(1706#+0 )14&*KIJTU IGP·JV KO UQIGP EQWTVUV[NG   5VÒEM++ (ÒTFKG#WVJGPVK\KV·VFGT4CPFPCOGPWPFFKG<WIGJÌTKIMGKVFGT)GHGEJVUURCPIG P MCPPMGKPG)GY·JTÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT #WMVKQP   CWHOGTMUCOIGOCEJV

8491 (1:2) 8489 (1:2)









ex 8490 (1:2)



ex 8493 (1:2)

1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   8GTVGKFKIWPIU/GFCKNNG MCPCFKUEJG #WUICDG   /G   FCKNNG HÒT FKG -CPCFKUEJGP (TGKYKNNKIGP OKV #JQTPDNCVVURCPIG   -TKGIU/GFCKNNG    MCPCFKUEJG#WUICDG#NNGFTGK/GFCKNNGP5KNDGT 5VÒEM++



)TWRRGXQP\YGK#WU\GKEJPWPIGPHÒTFGP$GCOVGPFGT/GVTQRQNKVCP2QNKEG#$CIIQVV /GFCKNNG \WO)QNFGPGP4GIKGTWPIULWDKN·WO-ÌPKIKP8KMVQTKCUOKV$CPFURCPIG /GFCKNNG\WT-TÌ PWPI -ÌPKI 'FWCTF 8++  $GKFG /GFCKNNGP $TQP\G LGYGKNU OKV 4CPFITCXWT 2% # $#))16   ;&+8CPPGWPGP$·PFGTP 5VÒEM++



/KPKCVWTGPUEJPCNNG OKV UKGDGP #WU\GKEJPWPIUOKPKCVWTGP   1TFGP HÒT JGTXQTTCIGPFGP &KGPUV  

&KUVKPIWKUJGF 5GTXKEG 1TFGT   /QFGNN OKV /QPQITCOO )84  )QNF   /KNKV·TMTGW\ /KNKVCT[   %TQUU OKV/QPQITCOO)4+5KNDGT 5VGTP $TKVKUEJG-TKGIUOGFCKNNG5KNDGT  +PVGTCNNKKGTVG5KGIGUOGFCKNNGCWHFGO$CPF'KEJGP\YGKICWHNCIG ,WDKN·WOUOGFCKNNG ,WDKNGG /GFCN   5KNDGT   -TÌPWPIUOGFCKNNG %QTQPCVKQP /GFCN   5KNDGT #P 0CFGN KO 'VWK FGT   (KTOC5RKPM5QPKP.QPFQP 5VÒEM++



-QPXQNWVXQPXGTUEJKGFGPGPDTKVKUEJGP#WU\GKEJPWPIGP+PXGTUEJKGFGPGP/GVCNNGPFCTWPVGTPGWP KP5KNDGTGKPKIGOKV6T·IGTPCOGPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPLGYGKNUCP$·PFGTP  5VÒEM++++p++++++



(ÒTFKG1TKIKPCNKV·VFGT5VÒEMGWPF#WVJGPVK\KV·VFGT0COGPMCPPMGKPG)GY·JTÒDGTPQOOGPYGTFGP&GT+PVGTGU UGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT #WMVKQP CWHOGTMUCO IG   OCEJV



-QPXQNWVXQPXGTUEJKGFGPGPDTKVKUEJGP'JTGP\GKEJGPFGU'TUVGPWPF<YGKVGP9GNVMTKGIGU&CT WPVGTUKGDGPXGTUEJKGFGPG-TKGIU5VGTPGFGU<YGKVGP9GNVMTKGIGUXGTUEJKGFGPG/GVCNNGXKGTFCXQPKP 5KNDGTGKPKIGOKV6T·IGTPCOGPLGYGKNUCP$·PFGTP 5VÒEM++



(ÒTFKG1TKIKPCNKV·VFGT5VÒEMGWPF#WVJGPVK\KV·VFGT0COGPMCPPMGKPG)GY·JTÒDGTPQOOGPYGTFGP&GT+PVGTGU UGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT FGT #WMVKQP CWHOGTMUCO IG   OCEJV

101


INTERNATIONALE UND GESELLSCHAFTS-ORDEN 



-QPXQNWV XQP  XGTUEJKGFGPGP OKNKV·TKUEJGP 'JTGP\GKEJGP FGU 'TUVGP WPF <YGKVGP 9GNVMTKGIU   &C\W-TÌPWPIUOGFCKNNGWPF\YGK-QRKGP8GTUEJKGFGPG/GVCNNG CWEJ5KNDGT CPMQTTGMVGP$·P FGTP 5VÒEM++



-QPXQNWVXQPFTGKXGTUEJKGFGPGP#WU\GKEJPWPIGP &KGPUVCWU\GKEJPWPIU/GFCKNNGFGT/CTKPG/Q FGNNWPVGT-ÌPKIKP'NKUCDGVJ++#WUHÒJTWPI QJPG$41/0UGKV 5KNDGTOKV4CPFRT·IWPI /:#%'8#055$2140**#5.#4 &KGPUVCWU\GKEJPWPIU/GFCKNNGFGT-ÌPKINK EJGP /CTKPG4GUGTXG 5KNDGT OKV 4CPFRT·IWPI  % ) $'.. 5/0 404 CO $CPF FGT   &KGPUVCWU\GKEJPWPIU/GFCKNNG FGT -ÌPKINKEJGP (NQVVGP4GUGTXG   +ORGTKCNG &KGPUV/GFCKNNG /QFGNN   WPVGT-ÌPKI)GQTI8+#WUHÒJTWPI OKV+0&+#'+/25KNDGTOKV4CPFRT·IWPI*'04;911& CO$CPFOKV6TCIGURCPIG 5VÒEM++



(ÒT FKG #WVJGPVK\KV·V FGT 4CPFPCOGP MCPP MGKPG )GY·JT ÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ   CWHFKG)GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV

8498 8497

8496

+06'40#6+10#.'70&)'5'..5%*#(6514&'0 

1TFGP FGT 'TNÌUWPI -NGKPQF FGT )TQ­MTGW\G 5KNDGT XGTIQNFGV /GFCKNNQPU )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGK \YGK MCWO UKEJVDCTG QDGTHN·EJNKEJG %JKRU KP FGT YGK­GP 'OCKNNG QJPG 5EJWNVGTDCPF   6#//81.2'5 44++



'ZGORNCT XQP JGTXQTTCIGPFGT #PHGTVKIWPIUSWCNKV·V CWU FGT /KVVG FGU 0GWP\GJPVGP ,CJTJWPFGTVU 'U JCPFGNV UKEJ   JKGTDGK WO GKP 'ZGORNCT KP PQEJ DGUUGTGO 'TJCNVWPIU\WUVCPF CNU FCU KP FGT #WMVKQP  1TFGP CWU CNNGT 9GNV    5COONWPI6COOCPPFGT7$5#)KP$CUGNCOWPF0QXGODGTCPIGDQVGPG 0T   &GTIGITÒPFGVG1TFGPFGT*GT\ÌIGXQP/CPVWCGTNQUEJOKVFGO#WUUVGTDGPFGUTGIKGTGPFGP*CWUGUKO,CJTG   'KP 2QNG FGT WPVGT FGO 0COGP ŋ)TCH /[T\KPQYUMKŌ  KP 5VWVVICTV CWHVCWEJVG GTTGIVG FQTV /KUUHCNNGP   WPF\QIPCEJ2CTKUYGKVGT&QTVPCPPVGGTUKEJŋ#NGZCPFGT)QP\CIC*GT\QIXQP/CPVWCŌ0KEJVPWTYKGFG TGTYGEMVG GT CO  /·T\  FGP 1TFGP FGT 'TNÌUWPI UQPFGTP ITÒPFGVG CWEJ INGKEJ FTGK YGKVGTG OCPVWCUEJG   1TFGP 2CTCNNGN FC\W HÒJTVG GT CWEJ FGP 1TFGP FGT 8KGT -CKUGT 'T JCVVG CWEJ GPIG $G\KGJWPIGP \W   CPFGTGPQTFGPUCMVKXGP2GTUQPGPYKGFGP(ÒTUVGP\W5CNO-[TDWTI UKGJG0T WPFFGP)TCHGP)CTFGPFG5CKPV #PIG &CU #PPWCKTG FG NC 0QDNGUUG FG (TCPEG RWDNK\KGTVG  <YGKHGN CP FGT 'EJVJGKV FGU   *GT\QIU FGT -NCIG GTJQD &GT 2TQ\GUU \QI UKEJ KP FKG .·PIG YGKN FGT *GT\QI KP\YKUEJGP DGK FGO 2T·UKFGPVGP   $QPCRCTVGXGTMGJTVG&GT2TQ\GUUGPFGVGGTUVOKVFGT8GTWTVGKNWPIFGU*GT\QIUFWTEJFCU6TKDWPCNFG%QTTGEVKQPFG 2CTKUKO,WNK\WFTGK,CJTGP<WEJVJCWUYGIGP*QEJUVCRGNGKWPF1TFGPUUEJYKPFGNU0CEJ8GTDÒ­WPIFGT5VTCHG YCT UGKPG #MVKXKV·V WPIGDTQEJGP GT YWTFG WPVGT CPFGTGO XKGN KP FGWVUEJGP $·FGTP IGUGJGP DKU GT UEJNKG­NKEJ CO   KP'PINCPFUVCTD5GKPG1TFGPYWTFGPXQPUGKPGOCPIGDNKEJGP5QJP(TCP¼QKU#PVQKPG)QP\CICPQEJGKPG <GKVNCPIYGKVGTIGHÒJTV=8INCWEJ8KNNCOQTC/CTSWKU#NGZCPFTGFG0QVKEG*KUVQTKSWGFGU1TFTGUFG%JGXCNGTKG CRRCTVGPCPV ¯ NC /CKUQP 4Q[CNG FGU 2TKPEGU )QP\CIC &WEU FG /CPVQWG /CTUGKNNG  #WHNCIG  OKV   0COGPUXGT\GKEJPKU  7PF #PQP[O 'USWKUUG DKQITCRJKSWG FG 5QP #NVGUUG 5¾T¾PKUUKOG NG 2TKPEG #NGZCPFTG FG   )QP\CIC2CTKU RJCPVCUKGXQNN ?



/GNWUKPGP1TFGP4KVVGTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKOKP4GRCTCVWTKPFGT YGK­GP'OCKNNGGKPGU-TGW\EJGPUCOCNVGPLGFQEJPKEJVMQTTGMVGP&TGKGEMUDCPF1#0 ++





1TFGP FGT #\VGMGPMTQPG 4KVVGTMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV QJPG $CPFTKPI OKV $CPFCD   UEJPKVVOKVGOCKNNKGTVGO4GXGTUCD\GKEJGPKP5EJCEJVGN ++



102


ISLAND

8500

ex 8499



8501

1TFGPFGTJN$TKIKVVGXQP5EJYGFGP4KVVGTMTGW\CONCPIGP*CNUDCPF$TQP\GXGTIQNFGVWPFGOCKN NKGTV\WUCOOGPOKV/KPKCVWT$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPWPF-PQRHNQEJTQUGVVGOKV #WHNCIGKP5EJCEJVGN 5VÒEM+p++



5RCPKUEJG#PHGTVKIWPIYQJNFGTGT,CJTG



1TFGPFGT&QTPGPMTQPG-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV\YGKMNGKPG'OCKNNGTGRC TCVWTGPWPFGKPKIG*CCTTKUUGKPFGTYGK­GP'OCKNNGCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\G6(5VCFVRWP\G XQP$KTOKPIJCOWPF,CJTGURWP\G$HÒTCO*CNUDCPF ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T



7PDGMCPPVGT,QJCPPKVGTQFGT/CNVGUGTQTFGP*CNUMTGW\$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO*CNU DCPF ++



8502 (1:1)

+5.#0& 4'27$.+-+5.#0& 5'+6  

+UN·PFKUEJGT (CNMGPQTFGP  /QFGNN UGKV   )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT   XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCWHFGT4ÒEMUGKVGRWP\KGTV5WPF-#CP&QRRGNPCFGNKOYGK­GP1TKIKPCNGVWKFGT(KTOC -LCTVCPŠUOWPFUUQPKP4G[MLCXÃM<'+ 5VÒEM+p++  #O  ,WNK  JCV -ÌPKI %JTKUVKCP : XQP &·PGOCTM WPF +UNCPF FGP FTGKMNCUUKIGP CNNIGOGKPGP 8GTFKGPUVQTFGP   IGUVKHVGV YQDGK FKG  -NCUUG KP \YGK 5VWHGP WPVGTVGKNV YCT 0CEJFGO FCU .CPF  UGKPG XÌNNKIG 7PCDJ·PIKIMGKV   GTNCPIV WPF UKEJ \WT 4GRWDNKM GTMN·TV JCVVG GTJKGNV FGT 1TFGP CO  ,WNK FGU INGKEJGP ,CJTGU PGWG 5VCVWVGP &KG   8GTNGKJWPI FGU 1TFGPU GTHQNIV PQTOCNGTYGKUG CWH 8QTUEJNCI GKPGU HÒPHMÌRHKIGP 1TFGPUTCVGU FKG +PKVKCVKXG MCPP   LGFQEJCWEJXQO2T·UKFGPVGPD\YFGT2T·UKFGPVKPCWUIGJGP+PFKGUGTJÌEJUVGP-NCUUGFGU1TFGPUUGJTUGNVGPFC HÒT CNNG +PUKIPKGP FGU 1TFGPU GKPG UVTGPI IGJCPFJCDVG 4ÒEMICDGRHNKEJV DGUVGJV 8IN ,QTIGPUGP 2GVGT , &GP   +UNCPFUMG (CNMGQTFGP QI FG +UNCPFUMG /GFCNLGT -QRGPJCIGP  7PF 6JQTNCEKWU $KTIKT ›UNGPUM *GKFWTU   OGTMK*±UMÉNCÐVI±HCP7PF-NKGVOCPP-WTV)+UNCPF+UN·PFKUEJGT(CNMGPQTFGP+P1TFGPU.GZKMQP$CPF $GTNKPQ, 

103


ISLAND

8503 (1:1)



+UN·PFKUEJGT (CNMGPQTFGP  /QFGNN UGKV   )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT   XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 'KPMPÌRH5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG   XGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGRWP\KGTV5WPF-#CP&QRRGNPCFGN<'+ 5VÒEM+p++ 

8504 (1:1)



104

+UN·PFKUEJGT (CNMGPQTFGP  /QFGNN UGKV   QJPG -ÌPKIUMTQPG  -TGW\ FGT )TQ­TKVVGT   

-QOOCPFGWT 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF<'+ ++ 


ITALIEN

8505 8506 (1:1)

8506 (1:1)

+6#.+'0 +6#.+'0*'4<1)67//1&'0# $+5  

/GFCKNNG HÒT FKG VTGW IGDNKGDGPGP /KNKV·TU WPF $GCOVGP  $TQP\G QJPG $CPF $4# 5    *';+6 ++



+6#.+'0 0#21.'10+5%*'5 -¤0+)4'+%*0'#2'.   

'JTGP\GKEJGP'JTGWPF6TGWG'JTGP\GKEJGP-NCUUGKP)QNFKPGKPGTXCTKCPVGP#WUHÒJTWPI)QNF VGKNYGKUGIGIQUUGPVGKNYGKUGGOCKNNKGTVQJPG$CPFKOCNVGPPKEJVFC\WIGJÌTKIGP'VWK$4#5 XCT*';+6XCT 444++  )CTCPVKGTV \GKVIGPÌUUKUEJ IGHGTVKIVGU 'ZGORNCT XQP CNNGTITÌ­VGT 5GNVGPJGKV  'Z 5COONWPI ,WNKWU (TCP\ÌUKUEJG   4GXQNWVKQP  0CRQN¾QP + WPF UGKPG <GKV  ++ 6GKN  0T  8QTOCNU 5COONWPI 0G[ 2TKPEG FG NC   /QUMXC1DGUUKEJUQOKVWOGKPGDGUQPFGTG#WUHÒJTWPIHÒTFGP/CTUEJCNN0G[QFGTWOGKP8QTNCIG'ZGORNCT CWU#PNCUUFGT5VKHVWPIFGU'JTGP\GKEJGPUJCPFGNVN·UUVUKEJNGKFGTPKEJVHGUVUVGNNGP&CU'JTGP\GKEJGPYWTFGCO 0QXGODGTXQP,QCEJKO/WTCV-ÌPKIXQP0GCRGNIGUVKHVGVWPFCO&G\GODGTCPFKGKJOVTGWIGDNKGD PGP 9ÒTFGPVT·IGT WPF $GCOVGP CWUIGIGDGP YQDGK FKG /KPKUVGT JÌEJUVGP *QHDGCOVGP)GPGTCNG'T\DKUEJÌHGWPF $KUEJÌHGFCU'JTGP\GKEJGPKP)QNFGTJKGNVGPPKGFTKIGTG%JCTIGPKPXGTIQNFGVGO5KNDGT

8507

8509

8508

+6#.+'0-¤0+)4'+%*2+'/1065#4&+0+'0 





/KNKV·TKUEJG6CRHGTMGKVUOGFCKNNG#N8CNQTG/KNKVCTG#WUICDGHÒTHTCP\ÌUKUEJG6GKNPGJOGTCO-TKGI KP+VCNKGP=OKVHTCP\ÌUKUEJGT+PUEJTKHV)7'44'& +6#.+'5KNDGTPG/GFCKNNG5KNDGTOKV -WIGNÌUG FKGUG OKV HTCP\ÌUKUEJGT )CTCPVKGRWP\G XQP  DKU  HÒT GT 5KNDGT 9KNFUEJYGKP   MQRH COCNVGP$CPF$4#5 +p++



/KNKV·TKUEJG6CRHGTMGKVUOGFCKNNG#N8CNQTG/KNKVCTG#WUICDGHÒTHTCP\ÌUKUEJG6GKNPGJOGTCO-TKGI KP +VCNKGP  =OKV HTCP\ÌUKUEJGT +PUEJTKHV )7'44' & +6#.+'   4GFWMVKQP FGT 5KNDGTPGP   /GFCKNNG&WTEJOGUUGTOO5KNDGTOKV-WIGNÌUGFKGUGOKVHTCP\ÌUKUEJGT)CTCPVKGRWP\GXQP DKUHÒTGT5KNDGT 9KNFUEJYGKPMQRH COCNVGP$CPF ++



'TKPPGTWPIUOGFCKNNGFGU'TUVGP5CTFKUEJGP)TGPCFKGT4GIKOGPVUCPFCU(GUVFGT)TGPCFKGTGCO  0QXGODGT FGO 6CI FGT JGKNKIGP $CTDCTC 5KNDGT OKV 5VGORGNUEJPGKFGT\GKEJGP 5+ QJPG $CPF   *';+6 ++

 105


ITALIEN

8511 8510

8510

+6#.+'0-¤0+)4'+%*$'+&'45+<+.+'0 

1TFGP (TCPEGUEQU +  5COONGTCPHGTVKIWPI FGU -NGKPQFU \WO )TQ­MTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV KP FGT ¤UG 5KNDGTRWP\G  GKPG YGKVGTG XGTUEJNCIGPG 2WP\G UQYKG HTCP\ÌUKUEJG   'KPHWJTRWP\GXQPDKU 5EJYCPGPRWP\G QJPG5EJWNVGTDCPF ++



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI FGT (KTOC 4QVJG KP 9KGP CWU FGP GT ,CJTGP *GTXQTTCIGPFGU 'TUCV\GZGORNCT   HÒTGKPPWT·W­GTUVUEJYGTGTJ·NVNKEJGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCTKPGEJV)QNF



1TFGP(TCPEGUEQU+5COONGTCPHGTVKIWPIFGU$TWUVUVGTPU\WO)TQ­MTGW\5KNDGTDTKNNCPVKGTVVGKNYGKUG XGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGOKV*GTUVGNNGTDG\GKEJPWPI%(416*'WPF9+'0UQYKG HTCP\ÌUKUEJG'KPHWJTRWP\GXQPDKU 5EJYCPGPRWP\G  ++



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI FGT (KTOC 4QVJG KP 9KGP CWU FGP GT ,CJTGP *GTXQTTCIGPFGU 'TUCV\GZGORNCT   HÒTGKPPWT·W­GTUVUEJYGTGTJ·NVNKEJGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCTOKVGEJVIQNFGPGP#WHNCIGP

8512 8513



/KNKV·T&KGPUVCWU\GKEJPWPI/GFCKNNGHÒT&KGPUVLCJTG$TQP\GQJPG$CPF*';+6

4++



+6#.+'0-¤0+).+%*'(#/+.+'$174$10$'+&'5+<+.+'0 5'+6  5'+6+6#.+'0 

/KNKV·TKUEJGT -QPUVCPVKPKUEJGT 1TFGP XQO JGKNKIGP )GQTI 5GV FGT )PCFGPTKVVGT DGUVGJGPF CWU   4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV GKPKIG MNGKPG 'OCKNNGCWUDTÒEJG CO MWT\GP   *CNUDCPFCDUEJPKVVWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV \YGKOKP'OCKNNGTGRCTCVWTGPCP0CFGNOKV\YGK5GKVGPJCMGP 5VÒEM++p+++ 3WCNKV·VUXQNNG#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVU

106




ITALIEN

8514

8515

+6#.+'0)4155*'4<1)67/615-#0#  

1TFGPXQOJGKNKIGP,QUGRJ5COONGTCPHGTVKIWPIFGU)TQ­MTGW\GU5KNDGTXGTIQNFGVWPFGOCKNNKGTV

1TFGPXQOJGKNKIGP,QUGRJ'KPHCEJG5COONGTCPHGTVKIWPIFGU$TWUVUVGTPU\WO)TQ­MTGW\$TQP\GIWUU XGTUKNDGTVCP0CFGN ++

8517 8516





++

5GJT SWCNKV·VUXQNNG #PHGTVKIWPI FGT (KTOC 4QVJG KP 9KGP CWU FGP GT ,CJTGP *GTXQTTCIGPFGU 'TUCV\GZGORNCT   HÒTGKPPWT·W­GTUVUEJYGTGTJ·NVNKEJGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCTKPGEJV)QNF





8516

/KNKV·T8GTFKGPUVQTFGP(·NUEJWPI  GKPGU$TWUVUVGTPU\WO)TQ­MTGW\5KNDGTCWHFGT4ÒEMUGKVG(4 HÒT (TKGFTKEJ 4QVJG KP 9KGP WPF 5KNDGTRWP\G XQP  DKU X HÒT GT 5KNDGT &KCPCMQRH KO   5GEJUGEM CP0CFGNFKGUGGDGPHCNNURWP\KGTOKVFTGK#2WP\GPWPF(4HÒT(TKGFTKEJ4QVJG ++



-¤0+)4'+%*+6#.+'0  

5V /CWTKVKWU WPF 5V .C\CTWU1TFGP )TQ­MTGW\ )QNF GOCKNNKGTV  I MCWO UKEJVDCTGT *CCTKUU   WPF OKP QDGTHN·EJNKEJGT 'OCKNNGEJKR KP FGT YGK­GP 'OCKNNG CO QTKIKPCNGP CNVGP VGKNYGKUG GVYCU   CWUIGDNGKEJVGP5EJWNVGTDCPF +p++



#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVUKPUGJTUEJÌPGT'TJCNVWPI



5V /CWTKVKWU WPF 5V .C\CTWU1TFGP .GGTGU 'VWK FGT (KTOC 4CXKQNK  )CTFKPQ 5WEEGUUQTK &   %TCXCP\QNCKP4QO\WO-QOOCPFGWTMTGW\OKV/QPQITCOO-ÌPKI8KMVQT'OCPWGNU+++ TGI DKU OKVGKPNKGIGPFGOWPIGVTCIGPGP*CNUDCPF FCU-TGW\UGNDUVHGJNV  ++



'VWKYQJNCWUFGO\YGKVGP8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVU

107


ITALIEN

8521 (1:1) 8520

8519



5V /CWTKVKWU WPF 5V .C\CTWU1TFGP 4KVVGTMTGW\ )QNF GOCKNNKGTV  I KO 4KPI HTCP\ÌUKUEJG   'KPHWJTRWP\GUGKV 7JW QJPG$CPF<'+ +p++



'ZGORNCTKPUGNVGPUEJÌPGP'TJCNVWPIU\WUVCPF



/KNKV·TQTFGPXQP5CXQ[GP/QFGNN  1HHK\KGTUMTGW\#WUHÒJTWPIOKVGKPVGKNKIGP#XGTU WPF4GXGTUOGFCKNNQPU)QNFGOCKNNKGTVCOQTKIKPCNGP\GKVIGPÌUUKUEJGP$CPF<'+ 4+p++



)GUVKHVGV CO  #WIWUV  XQP -ÌPKI 8KMVQT 'OOCPWGN + YWTFG GT OKV &GMTGV XQO  5GRVGODGT  XQP   -ÌPKI8KMVQT'OOCPWGN++UQYQJNKP)GUVCNVWPIFGT+PUKIPKGPYKGCWEJKPUGKPGT-NCUUGPGKPVGKNWPI PWPOGJTXKGT -NCUUGP YQDGK FKG -QOOCPFGWTMNCUUG KP \YGK 5VWHGP WPVGTVGKNV KUV  WOIGUVCNVGV /KV &GMTGV FGU RTQXKUQTKUEJGP   5VCCVUQDGTJCWRVGU 'PTKEQ &G 0KEQNC   XQO  ,CPWCT  YWTFG FGT 1TFGP WPVGT FGO PGWGP 0COGP   /KNKV·TQTFGPXQP+VCNKGPDGUV·VKIV



/KNKV·TQTFGPXQP5CXQ[GP/QFGNN  /KPKCVWTFGU1HHK\KGTMTGW\GU)QNFGOCKNNKGTV8QT FGT WPF 4ÒEMUGKVGPOGFCKNNQPU XGTVCWUEJV KO 4KPI HTCP\ÌUKUEJG )CTCPVKGRWP\G UGKV  #FNGTMQRH    +p++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T

8523

8522

8524



/KNKV·TQTFGPXQP5CXQ[GP/QFGNN  4KVVGTMTGW\#WUHÒJTWPIOKV\YGKVGKNKIGO4GXGTU OGFCKNNQP)QNFGOCKNNKGTVCOQTKIKPCNGP\GKVIGPÌUUKUEJGP$CPF<'+ +p++





/KNKV·TQTFGP XQP 5CXQ[GP  /QFGNN   #WUHÒJTWPI OKV \YGKVGKNKIGO 4GXGTUOGFCKNNQP   4KVVGTMTGW\ )QNF GOCKNNKGTV CP FGP 4·PFGTP GKPKIG YKP\KIG 'OCKNNGEJKRU WPF CWH FGT 4ÒEMUGKVG GKPGU   -TGW\CTOUMCWOUKEJVDCTG'OCKNNGTGRCTCVWTCO1TKIKPCNDCPF<'+ ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T



108

1TFGPFGT-TQPGXQP+VCNKGP)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF#WUHÒJTWPIOKVNCPIGO$CPFTKPI )QNF IGRTÒHV  GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG DTKNNCPVKGTV   #WHNCIGP 4QV WPF )GNDIQNF CWH FGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC&%TCXCP\QNC5WEE (NNK $QTCPK KP 4QO CP 0CFGN KO TQVGP 1TKIKPCNGVWK FGT (KTOC &EQ %TCXCP\QNC OKV /QPQITCOO   -ÌPKI8KMVQT'OCPWGNU+++ TGIDKU OKVDGUEJ·FKIVGO8GTUEJNW­<'+ +




ITALIEN 'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T   )GUVKHVGV XQP -ÌPKI 8KMVQT 'OCPWGN ++ CO  (GDTWCT  CWU #PNCUU FGT *QEJ\GKV FGU -TQPRTKP\GP   *WODGTVOKV2TKP\GUUKP/CTIGTKVCXQP5CXQ[GP)GPWCCNUHÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGP0CEJ#DUEJCH HWPIFGT/QPCTEJKGXQO5VCCVPKEJVOGJTXGTNKGJGPYWTFGGTLGFQEJGTUVOKV)GUGV\0TXQO/·T\ FGO 5VKHVWPIUIGUGV\ \WO 8GTFKGPUVQTFGP FGT +VCNKGPKUEJGP 4GRWDNKM GTNCUUGP XQP 2T·UKFGPV .WKIK 'KPCWFK     HQTOGNNCDIGUEJCHHV#NNGTFKPIUJCVKJPFGTGZKNKGTVG-ÌPKI*WODGTV++XQP+VCNKGP  DKU\WUGKPGO 6QFGHÒTKJORGTUÌPNKEJIGNGKUVGVG&KGPUVGXGTNKGJGP

8525 8526





1TFGPFGT-TQPGXQP+VCNKGP)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF#WUHÒJTWPIOKVNCPIGO$CPFTKPI )QNFGOCKNNKGTVUVCTMRCVKPKGTVCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGDTKNNCPVKGTV #WHNCIGP 4QV WPF )GNDIQNF OKP #DRNCV\WPI KO #FNGTYCRRGP CWH FGT 4ÒEMUGKVG *GTUVGNNGT   DG\GKEJPWPIFGT')CTFKPQ5WEE%TCXCP\QNCCP0CFGN<'+ 5VÒEM++



1TFGPFGT-TQPGXQP+VCNKGP$TWUVUVGTP\WO)TQ­MTGW\5KNDGTVGKNYGKUGDTKNNCPVKGTV#WHNCIGP4QV WPF)GNDIQNFGKP'OCKNNGUVGKPFGT-TQPGCWUIGDTQEJGPCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT (KTOC&%TCXCP\QNC5WEE(NNK$QTCPKKP4QOCP0CFGN<'+ ++



8527





8528

1TFGP FGT -TQPG XQP +VCNKGP )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ )QNF GOCKNNKGTV    I CO *CNUDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV #WHNCIG FTGJDCT  )QNF GOCKNNKGTV CWH FGT   4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC&%TCXCP\QNC5WEE(NNK$QTCPKKP4QOCP0CFGN<'+  5VÒEM++



1TFGPFGT-TQPGXQP+VCNKGP$TWUVUVGTP\WO)TQ­QHHK\KGT5KNDGTDTKNNCPVKGTV#WHNCIG)QNFGOCKNNKGTV QJPGTÒEMUGKVKIG*GTUVGNNGTDG\GKEJPWPICP0CFGN<'+ ++



NVGTG#WUHÒJTWPIOKVDTGKVTCPFKIGT#WHNCIG

109


ITALIEN

8529



1TFGPFGT-TQPGXQP+VCNKGP$TWUVUVGTP\WO)TQ­QHHK\KGT5KNDGTDTKNNCPVKGTV#WHNCIG)QNFGOCKNNKGTV CP0CFGNCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC&%TCXCP\QNU5WEEK(NNK$QTCPKKP4QO CP0CFGNOKV\YGK5GKVGPJCMGP<'+ ++



#PHGTVKIWPIWO

8530

8531

8532

8533



1TFGPFGT-TQPGXQP+VCNKGP-QOOCPFGWTMTGW\HTÒJG#WUHÒJTWPIOKVJGNNDNCWGO/GFCKNNQP)QNF GOCKNNKGTVICOQTKIKPCNGP*CNUDCPF<'+ 4++





1TFGPFGT-TQPGXQP+VCNKGP-QOOCPFGWTMTGW\)QNFGOCKNNKGTVIKPFGT¤UGHTCP\ÌUKUEJG'KP HWJTRWP\GUGKV 7JW OKVGTI·P\VGO$CPFTKPICWUXGTIQNFGVGO5KNDGTQJPG*CNUDCPF<'+ ++





1TFGPFGT-TQPGXQP+VCNKGP-QOOCPFGWTMTGW\)QNFGOCKNNKGTVCOMWT\GP*CNUDCPFCDUEJPKVV<'+  +p++





1TFGPFGT-TQPGXQP+VCNKGP-QOOCPFGWTMTGW\)QNFGOCKNNKGTVIKO8QTFGTUGKVGPOGFCKNNQP *CCTTKUU WPF CWH FGT 4ÒEMUGKVG GKPGU #TOU 'OCKNNGURTWPI CO MWT\GP *CNUDCPFCDUEJPKVV <'+    ++



110


ITALIEN

8535

8534

8536

8537

8538



1TFGPFGT-TQPGXQP+VCNKGP-QOOCPFGWTMTGW\)QNFGOCKNNKGTVICO*CNUDCPF<'+ +p++



1TFGP FGT -TQPG XQP +VCNKGP 1HHK\KGTUMTGW\ )QNF GOCKNNKGTV CO 1TKIKPCNDCPF OKV CWHIGNGIVGT   4QUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC 5 ,QJPUQP KP 4QO OKV CWHIGNGIVGO OGVCNNGPGP   /QPQITCOO-ÌPKI8KMVQT'OCPWGNU+++<'+ +p++



1TFGP FGT -TQPG XQP +VCNKGP 1HHK\KGTUMTGW\ )QNF GOCKNNKGTV  I KO 4KPI HTCP\ÌUKUEJG   'KPHWJTRWP\G UGKV  7JW  CO QTKIKPCNGP $CPF OKV CWHIGNGIVGT LGFQEJ DGUEJ·FKIVGT 4QUGVVG <'+    ++





1TFGP FGT -TQPG XQP +VCNKGP 1HHK\KGTUMTGW\ )QNF GOCKNNKGTV CO 1TKIKPCNDCPF OKV CWHIGNGIVGT   4QUGVVG<'+ +p++





1TFGP FGT -TQPG XQP +VCNKGP 4KVVGTMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF <'+    4+p++





5GJTUGNVGPG#PHGTVKIWPICWUXGTIQNFGVGT$TQP\GYGKVCWUUGNVGPGTCNUFKGGEJVIQNFGPGP#WUHÒJTWPIGP

8539



8541 8540



<KXKN8GTFKGPUVQTFGP XQP 5CXQ[GP 1TFGPUMTGW\ #WUHÒJTWPI OKV OGJTVGKNKIGP /GFCKNNQPU )QNF   GOCKNNKGTVIKO4KPI12WP\GQJPG$CPF<'+ 44+p++





/KNKV·TKUEJG 6CRHGTMGKVUOGFCKNNG #N 8CNQTG /KNKVCTG <YGKVRT·IWPI FGT 5KNDGTPGP /GFCKNNG 5KNDGT   CWHFGT4ÒEMUGKVG*GTUVGNNGTWPFGT5KNDGTRWP\GCO$CPF ++





/KNKV·TKUEJG6CRHGTMGKVUOGFCKNNG#N8CNQTG/KNKVCTG$TQP\GOGFCKNNG$TQP\GQJPG5VGORGNUEJPGKFGT \GKEJGPCOCWH-CTVQPCWHIGMNGDVGO$CPFUVÒEMCWHFGT4ÒEMUGKVGOKVJCPFUEJTKHVNKEJGT$G\GKEJPWPIKP FGWVUEJGT5RTCEJG$+0+5$4#5 ++



'ZGORNCT CWU FGT 5COONWPIXQP*GTOCPPX*G[FGPOKVJCPFUEJTKHVNKEJGT$G\GKEJPWPIKPFGTV[RKUEJGP#TVYKG GTUKGHÒTFKGOGKUVGP5VÒEMGUGKPGT5COONWPICPDTCEJVG&KGUGU'ZGORNCTFKGPVGCNU$GNGIDGKFGT'TUVGNNWPIUGKPGU $WEJGU ÒDGT FKG KVCNKGPKUEJGP 'JTGP\GKEJGP FGU GTUVGP U[UVGOCVKUEJGP 9GTMGU \W FKGUGO 6JGOC ÒDGTJCWRV =X   *G[FGP*GTOCPP'JTGP\GKEJGPKO-ÌPKITGKEJ+VCNKGPWPFKPUGKPGPGTNQUEJGPGP5VCCVGP5GIPKF QPQTGFGN4GIPQ F +VCNKCGFGINKGZ5VCVKKVCNKCPK9KGUDCFGP?+PVGTGUUCPVGU'ZGORNCTOKVPCEJYGKUNKEJGT2TQXGPKGP\CWUGKPGT NGIGPF·TGP5COONWPI

111


ITALIEN

8543

8542



/GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG8QNMU'T\KGJWPI/QFGNN OKV2QTVTCKV7ODGTVQU+  $TQP\GOGFCKNNG$TQP\GOKV5VGORGNUEJPGKFGT\GKEJGP5,COCWH-CTVQPCWHIGMNGDVGO$CPFUVÃ&#x2019;EMCWH FGT 4Ã&#x2019;EMUGKVG OKV JCPFUEJTKHVNKEJGT $G\GKEJPWPI KP FGWVUEJGT 5RTCEJG $+0+ 5  $4# 5    *';+6 ++



/GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG8QNMUIGUWPFJGKV/QFGNN OKV2QTVTCKV7ODGTVQU+  #WUHÃ&#x2019;JTWPIOKVNCVGKPKUEJGT4Ã&#x2019;EMUGKVGPWOUEJTKHV$TQP\GOGFCKNNG$TQP\GOKV5VGORGNUEJPGKFGT\GKEJGP 5, CO CWH -CTVQP CWHIGMNGDVGO $CPFUVÃ&#x2019;EM CWH FGT 4Ã&#x2019;EMUGKVG OKV JCPFUEJTKHVNKEJGT $G\GKEJPWPI KP   FGWVUEJGT5RTCEJG$+0+5$4#5*';+6 ++



'ZGORNCT CWU FGT 5COONWPIXQP*GTOCPPX*G[FGPOKVJCPFUEJTKHVNKEJGT$G\GKEJPWPIKPFGTV[RKUEJGP#TVYKG GT UKG HÃ&#x2019;T FKG OGKUVGP 5VÃ&#x2019;EMG UGKPGT 5COONWPI CPDTCEJVG  +PVGTGUUCPVGU 'ZGORNCT OKV PCEJYGKUNKEJGT 2TQXGPKGP\   CWUGKPGTNGIGPF·TGP5COONWPI



'ZGORNCT CWU FGT 5COONWPIXQP*GTOCPPX*G[FGPOKVJCPFUEJTKHVNKEJGT$G\GKEJPWPIKPFGTV[RKUEJGP#TVYKG GT UKG HÃ&#x2019;T FKG OGKUVGP 5VÃ&#x2019;EMG UGKPGT 5COONWPI CPDTCEJVG  +PVGTGUUCPVGU 'ZGORNCT OKV PCEJYGKUNKEJGT 2TQXGPKGP\   CWUGKPGTNGIGPF·TGP5COONWPI

8546

8544 8545



'TKPPGTWPIUOGFCKNNGCWHFKG'KPJGKV+VCNKGPU5KNDGT#WUHÃ&#x2019;JTWPIOKV5VGORGNUEJPGKFGTUK IPCVWT.)+14)+(COCWH-CTVQPCWHIGMNGDVGO$CPFUVÃ&#x2019;EMCWHFGT4Ã&#x2019;EMUGKVGOKVJCPFUEJTKHVNKEJGT $G\GKEJPWPIKPFGWVUEJGT5RTCEJG$+0+5$4#5*';+6 ++





'TKPPGTWPIUOGFCKNNG\WOL·JTKIGP,WDKN·WOFGT$GTUCINKGTK5KNDGTPG/GFCKNNG5KNDGTOKV 5VGORGNUEJPGKFGTUKIPCVWT.)+14)+(QJPG$CPF$4#5*';+6 ++





/GFCKNNGHÃ&#x2019;TFKG(GNF\Ã&#x2019;IGKP#HTKMC#WUHÃ&#x2019;JTWPIOKV5VGORGNUEJPGKFGTUKIPCVWT52'4#0<#COCWH -CTVQPCWHIGMNGDVGO$CPFUVÃ&#x2019;EMCWHFGT4Ã&#x2019;EMUGKVGOKVJCPFUEJTKHVNKEJGT$G\GKEJPWPIKPFGWVUEJGT5RTC EJG$+0+5$4#5*';+6 ++



'ZGORNCT CWU FGT 5COONWPIXQP*GTOCPPX*G[FGPOKVJCPFUEJTKHVNKEJGT$G\GKEJPWPIKPFGTV[RKUEJGP#TVYKG GT UKG HÃ&#x2019;T FKG OGKUVGP 5VÃ&#x2019;EMG UGKPGT 5COONWPI CPDTCEJVG  +PVGTGUUCPVGU 'ZGORNCT OKV PCEJYGKUNKEJGT 2TQXGPKGP\   CWUGKPGTNGIGPF·TGP5COONWPI

'ZGORNCT CWU FGT 5COONWPIXQP*GTOCPPX*G[FGPOKVJCPFUEJTKHVNKEJGT$G\GKEJPWPIKPFGTV[RKUEJGP#TVYKG GT UKG HÃ&#x2019;T FKG OGKUVGP 5VÃ&#x2019;EMG UGKPGT 5COONWPI CPDTCEJVG  +PVGTGUUCPVGU 'ZGORNCT OKV PCEJYGKUNKEJGT 2TQXGPKGP\   CWUGKPGTNGIGPF·TGP5COONWPI

112


ITALIEN

8547



8548

/GFCKNNG HÒT FKG 'JTGPYCEJG FGT 8GVGTCPGP CO )TCD -ÌPKI 8KMVQT 'OCPWGNU ++  /QFGNN OKV   2QTVTCKV-ÌPKI7ODGTVQU+ #WUHÒJTWPIOKVITQ­GO-QRHWPF5VGORGNUEJPGKFGTUKIPCVWT )+18)+#0+5KNDGTCOCWH-CTVQPCWHIGMNGDVGO$CPFUVÒEMCWHFGT4ÒEMUGKVGOKVJCPFUEJTKHVNKEJGT $G\GKEJPWPIKPFGWVUEJGT5RTCEJG$+0+$4#5*';+6 ++



'ZGORNCT CWU FGT 5COONWPIXQP*GTOCPPX*G[FGPOKVJCPFUEJTKHVNKEJGT$G\GKEJPWPIKPFGTV[RKUEJGP#TVYKG GT UKG HÒT FKG OGKUVGP 5VÒEMG UGKPGT 5COONWPI CPDTCEJVG  +PVGTGUUCPVGU 'ZGORNCT OKV PCEJYGKUNKEJGT 2TQXGPKGP\   CWUGKPGTNGIGPF·TGP5COONWPI



)GF·EJVPKUOGFCKNNGCPFCU-CNCDTKUEJ5K\KNKCPKUEJG'TFDGDGPXQO&G\GODGT5KNDGTCWH FGT8QTFGTUGKVG5VGORGNUEJPGKFGTPCOG.)+14)+OGJTGTGMNGKPG4CPFFGNNGPCOQTKIKPCNGP$CPFKO QTKIKPCNGP8GTNGKJWPIUGVWK$4#5 ++



+OQTKIKPCNGP8GTNGKJWPIUGVWKPWTUGJTUGNVGP\WHKPFGP)GUVKHVGVXQP-ÌPKI8KMVQT#OOCPWGN+++CO(GDTWCT OKVMÌPKINKEJGO&GMTGV0TPQ&CUWTURTÒPINKEJDNCWYGK­G$CPFYWTFGCO,WNKOKV MÌPKINKEJGO&GMTGVPQKPFCUXQTNKGIGPFGYGK­ITÒPG$CPFWOIG·PFGTV

8549 8551 ex 8554 8550



/GFCKNNG\WT'TKPPGTWPICPFCUMCNCDTKUEJUK\KNKCPUKEJG'TFDGDGPXQO&G\GODGT5KNDGT OKV5VGORGNUEJPGKFGTUKIPCVWT.)+14)+COQTKIKPCNGP$CPF$+0+5$4#5 ++





)GF·EJVPKUOGFCKNNGCPFCU-CNCDTKUEJ5K\KNKCPKUEJG'TFDGDGPXQO&G\GODGT5KNDGTCWH FGT8QTFGTUGKVG5VGORGNUEJPGKFGTPCOG.)+14)+COCNVGP&TGKGEMUDCPF$4#5 ++





'TKPPGTWPIUOGFCKNNGHÒTFKG6GKNPGJOGTCO(GNF\WIKP#NDCPKGP/QFGNN OKV.KMVQTGPDÒPFGNCWH FGT4ÒEMUGKVG $TQP\GCO$CPF$+0+5$4#5 ++





-QPXQNWV XQP  #WU\GKEJPWPIGP XQTYKGIGPF FGU -ÌPKITGKEJGU &CTWPVGT \YGK .KD[GP/GFCKNNGP   GKPGDTQP\GPG6CRHGTMGKVUOGFCKNNGGKPG/GFCKNNGHÒTFGPKVCNKGPKUEJVÒTMKUEJGP-TKGIWPFGKPG/GFCKNNG CWH FKG 'KPJGKV +VCNKGPU  8GTUEJKGFGPG /GVCNNG FCTWPVGT HÒPH KP 5KNDGT XQTYKGIGPF CP   $·PFGTP 5VÒEM+p++++++p+++





-QPXQNWV XQP PGWP XGTUEJKGFGPGP 'JTGP\GKEJGP +P XGTUEJKGFGPGP /GVCNNGP XKGT FCXQP KP 5KNDGT   LGYGKNUCP$·PFGTPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++





-QPXQNWVXQPXGTUEJKGFGPGP0GWCPHGTVKIWPIGPXQP6·VKIMGKVUCD\GKEJGPFGTMÌPKINKEJGPKVCNKGPK UEJGP/CTKPG,GUGEJU#D\GKEJGPKP)QNF5KNDGTWPF$TQP\GUVWHGXGTIQNFGVD\YXGTUKNDGTVD\YKP $TQP\GCNNGCP0CFGNP 5VÒEM+p++

 113


ITALIEN

8555

+6#.+'0+5%*'4'27$.+- 5'+6  

8GTFKGPUVQTFGP FGT +VCNKGPKUEJGP 4GRWDNKM  /QFGNN   )TQ­MTGW\UGV DGUVGJGPF CWU   -NGKPQF5KNDGTXGTIQNFGV5VGTPCWHNCIG)QNF IGRTÒHV GOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUV UVGTP5KNDGTDTKNNCPVKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT (KTOC')CTFKPQ5WEE%TCXCP\QNCKP4QOCP0CFGN\WUCOOGPOKV7PKHQTO$CPFUEJPCNNGPDCPFOKV #WHNCIGP KO 1TKIKPCNGVWK FGT (KTOC %TCXCP\QNC 5WEE ' )CTFKPQ OKV IQNFIGFTWEMVGO 5VCCVUYCRRGP   <'+ 5VÒEM+p++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T   #WHITWPF FGU 7PKHQTODCPFUEJPCNNGP$CPFGU KUV FCXQP CWU\WIGJGP FCUU FKGUGT 5GV CP GKPGP PKEJVKVCNKGPK   UEJGP )GPGTCN XGTNKGJGP YQTFGP KUV  )GUVKHVGV CO  /·T\  XQO KVCNKGPKUEJGP 5VCCVURT·UKFGPVGP 'KPCWFK CNU   UGEJUMNCUUKIGT CNNIGOGKPGT 8GTFKGPUVQTFGP 7PVGT 5VCCVURT·UKFGPV %QUUKIC GTHWJT GT  GKPG IGUVCNVGTKUEJG PWP   OGJTGVYCUVTCFKVKQPGNNGTG)GUVCNVWPI KP#PNGJPWPICPFGPDKUDGUVGJGPFGP1TFGPFGT-TQPGXQP+VCNKGP 

8556



8GTFKGPUVQTFGP FGT +VCNKGPKUEJGP 4GRWDNKM  /QFGNN   )TQ­QHHK\KGTUUGV DGUVGJGPF CWU   )TQ­QHHK\KGTUMTGW\5KNDGTXGTIQNFGVGOCKNNKGTVCOQTKIKPCNGP*CNUDCPFWPF$TWUVUVGTP5KNDGTDTKNNCP VKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5,QJPUQP KP/CKNCPFWPF4QOCP0CFGN\WUCOOGPOKV/KPKCVWTUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV CO $·PFEJGP WPF -PQRHNQEJTQUGVVG KO 1TKIKPCNGVWK FGT (KTOC ,QJPUQP OKV CWHIGNGIVGO OGVCNNGPGP   5VCCVUYCRRGP<'+ 5VÒEM+p++ #WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU

114




ITALIEN

8557

8558

8559



8GTFKGPUVQTFGPFGT+VCNKGPKUEJGP4GRWDNKM/QFGNN  -QOOCPFGWTMTGW\5KNDGTXGTIQN FGV5VGTPCWHNCIG)QNF IGRTÃ&#x2019;HV GOCKNNKGTVCOQTKIKPCNGP*CNUDCPF\WUCOOGPOKV-PQRHNQEJTQUGVVGKO 1TKIKPCNGVWKFGT(KTOC#TVWTQ2Q\\KKP4QOOKVOGVCNNGPGO5VCCVUYCRRGP<WUCOOGPOKVQTKIKPCNGT#PPCJ OGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÃ&#x2019;T FGP /KPKUVGTKCNTCV KO $WPFGURT·UKFKCNCOV   *GNOWV/Ã&#x2019;NNGTFCVKGTV$QPPCO,CPWCTWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGP WPFCP/Ã&#x2019;NNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT<'+ +p++





8GTFKGPUVQTFGPFGT+VCNKGPKUEJGP4GRWDNKM/QFGNN  -QOOCPFGWTMTGW\5KNDGTXGTIQN FGV5VGTPCWHNCIG)QNF IGRTÃ&#x2019;HV GOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ +p++





8GTFKGPUVQTFGP FGT +VCNKGPKUEJGP 4GRWDNKM  /QFGNN   4KVVGTMTGW\ 5KNDGT XGTIQNFGV   5VGTPCWHNCIG)QNF IGRTÃ&#x2019;HV GOCKNNKGTVCO$CPF\WUCOOGPOKV-PQRHNQEJTQUGVVGKO1TKIKPCNGVWKFGT5 ,QJPUQPKP/CKNCPFWPF4QOOKVOGVCNNGPGO5VCCVUYCRRGP<'+ +p++



8562 8560 8561



/KNKV·T1TFGP XQP +VCNKGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP $CPF <'+    +p++





1TFGPFGU5VGTPUFGT+VCNKGPKUEJGP5QNKFCTKV·V/QFGNN  &GMQTCVKQP-NCUUG 4KVVGT  $TQP\GXGTIQNFGVGVYCUDGTKGDGPCOQTKIKPCNGP$CPF<'+ ++





8GTFKGPUVOGFCKNNG FGT +VCNKGPKUEJGP 8GTGKPKIWPI FGT HTGKYKNNKIGP $NWVURGPFGT #8+5  )QNFGPG   8GTFKGPUVOGFCKNNG)QNFICWHFGT4Ã&#x2019;EMUGKVGOGJTHCEJRWP\KGTV WC(GKPIGJCNVURWP\G QJPG $CPF +p++

 115


KROATIEN

8563 8565

8566

8564

-41#6+'0 -¤0+)4'+%*70& '456' 4'27$.+--41#6+'0   

-NGKPG 5COONWPI XQP  XGTUEJKGFGPGP   (GNFUEJPCNNGP$·PFGTP ,GYGKNU KP FGT UEJOCNGP  

FGWVUEJGP  #WUHÒJTWPI FCXQP  OKV #WHNCIGP W C  Z 1TFGP FGT -TQPG -ÌPKI <XQPKOKTU  Z   1TFGP FGU 'KUGTPGP &TGKDNCVVGU  Z 8GTFKGPUVQTFGP #WUICDG HÒT %JTKUVGP WPF HÒT /QUNGOU CWH   /GVCNNWPVGTNCIGPOKV$GHGUVKIWPIUURNKPVGP 5VÒEM44++



5GJT UGNVGPG 5COONWPI \W FGP GKP\GNPGP #WHNCIGP KJTG $GFGWVWPI WPF $GYGTVWPI XGTINGKEJG $CTCE $QTPQ WPF   2QICEKE 5KPKUC 1FNKMQXCPLC K <PCMQXNLG 0G\CXKUPG &T\CXG *TXCVUMG     (ÒJTGT HÒT MTQCVKUEJG #WU   \GKEJPWPIGP/GFCKNNGPWPF#D\GKEJGP<CITGD



-NGKPG 5COONWPI XQP  XGTUEJKGFGPGP   (GNFUEJPCNNGP$·PFGTP ,GYGKNU KP FGT DTGKVGP  

ÌUVGTTGKEJKUEJGP #WUHÒJTWPIFCXQPOKV#WHNCIGPWCZ1TFGPFGT-TQPG-ÌPKI<XQPKOKTU  Z /GFCKNNG FGU 1TFGPU FGT -TQPG -ÌPKI <XQPKOKTU  Z 1TFGP FGU 'KUGTPGP &TGKDNCVVGU  Z   8GTFKGPUVQTFGP#WUICDGHÒT/QUNGOUWPFOCN#PVG2CXGNKE6CRHGTMGKVU/GFCKNNGFKG#WHNCIGPVGKNU XGTUKNDGTVVGKNUXGTIQNFGVVGKNUNCEMKGTVLGYGKNUKP(ÒPHGT4GKJGPCWH-CTVQP PKEJVCWHIGMNGDV   5VÒEM44++



(CNNUEJKTOURTKPIGT#D\GKEJGP8GTUKNDGTVVGKNYGKUGGOCKNNKGTV0CFGNU[UVGOCDIGDTQEJGP$#491 4+++



5GJT UGNVGPG 5COONWPI \W FGP GKP\GNPGP #WHNCIGP KJTG $GFGWVWPI WPF $GYGTVWPI XGTINGKEJG $CTCE $QTPQ WPF   2QICEKE 5KPKUC 1FNKMQXCPLC K <PCMQXNLG 0G\CXKUPG &T\CXG *TXCVUMG     (ÒJTGT HÒT MTQCVKUEJG #WU   \GKEJPWPIGP/GFCKNNGPWPF#D\GKEJGP<CITGD



(ÒT FKG 1TKIKPCNKV·V FGU 'ZGORNCTU MCPP MGKPG )GY·JT IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG   )GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



#D\GKEJGP HÒT OQVQTKUKGTVG 'KPJGKVGP FGT .WHVYCHHG 5KNDGTPGU #D\GKEJGP $TQP\G VGKNYGKUG   XGTUKNDGTVVGKNYGKUGNCEMKGTVCP0CFGNFKGUGOKV5KEJGTWPIUU[UVGO$#491XCT 4++ (ÒT FKG 1TKIKPCNKV·V FGU 'ZGORNCTU MCPP MGKPG )GY·JT IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG   )GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV

116




LETTLAND

8567 8568

8570

8569



#D\GKEJGPFGT-TQCVKUEJGP.WHVHCJTV.GIKQP8GTUKNDGTVVGKNYGKUGNCEMKGTVCP0CFGN$#491 ++





#D\GKEJGP FGT -TQCVKUEJGP /CTKPG.GIKQP  /QFGNN $TQP\G XGTUKNDGTV VGKNYGKUG GOCKNNKGTV CP   0CFGN$#491 ++



(ÒT FKG 1TKIKPCNKV·V FGU 'ZGORNCTU MCPP MGKPG )GY·JT IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG   )GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



#D\GKEJGP HÒT $QTFHWPMGT FGT MTQCVKUEJGP .WHVYCHHG $TQP\G XGTUKNDGTV VGKNYGKUG NCEMKGTV CP   3WGTPCFGNWPVGPOKV\WU·V\NKEJGO$GHGUVKIWPIUJCMGP$#491 ++



(ÒT FKG 1TKIKPCNKV·V FGU 'ZGORNCTU MCPP MGKPG )GY·JT IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG   )GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



-TQCVKUEJGU 2KNQVGPCD\GKEJGP  /QFGNN )QNFGPGU #D\GKEJGP XGTIQNFGV VGKNYGKUG XGTUKNDGTV   GOCKNNKGTVOKP'OCKNNGDGUEJ·FKIWPIGPCP0CFGN$#491 44++p



(ÒT FKG 1TKIKPCNKV·V FGU 'ZGORNCTU MCPP MGKPG )GY·JT IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG   )GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV

8571

8572

'456' 4'27$.+-.'66.#0&   

1TFGP FGT &TGK 5VGTPG  /QFGNN   5GV FGT  -NCUUG DGUVGJGPF CWU -NGKPQF 5KNDGT   XGTIQNFGV WPF GOCKNNKGTV FKG FTGK 5VGTPG )QNF CWH FGT 4ÒEMUGKVG FGT #WHJ·PIWPI OGJTHCEJ RWP\KGTV   CO QTKIKPCNGP 'KPMPÌRH5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV FKG   FTGK5VGTPG)QNFCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC9(/ÒNNGTKP4KICCP0CFGN FKGUGRWP\KGTVOKV\YGK5GKVGPJCMGPKO1TKIKPCNGVWKOKVIQNFHCTDGPGO5VCCVUYCRRGP<'+ ++



1TFGPFGT&TGK5VGTPG/QFGNN  -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG FTGK5VGTPG)QNFCWHFGT8QTFGTUGKVGFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G(/HÒT FKG (KTOC 9 ( /ÒNNGT KP 4KIC WPF GT 5KNDGTRWP\G  CO QTKIKPCNGP IGP·JVGP *CNUDCPF KO   QTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO5VCCVUYCRRGP<'+ ++



#NU UGEJUMNCUUKIGT 5QPFGTMNCUUG  DKU  -NCUUG  CNNIGOGKPGT 8GTFKGPUVQTFGP OKV CHHKNKKGTVGT FTGKUVWHKIGT 8GT   FKGPUVOGFCKNNG YWTFG GT XQO NGVVKUEJGP 2CTNCOGPV CO  /·T\  IGUVKHVGV WPF DKU \WT #PPGZKQP FWTEJ FKG   5QYLGVWPKQPXGTNKGJGP#O1MVQDGTYWTFGGTGTPGWGTV



117


LETTLAND

8575 8573

8574

8576









1TFGP FGT &TGK 5VGTPG  /QFGNN   5GV FGT  -NCUUG DGUVGJGPF CWU -TGW\  -NCUUG   5KNDGT XGTIQNFGV WPF GOCKNNKGTV FKG FTGK 5VGTPG )QNF CWH FGT 8QTFGTUGKVG FGT #WHJ·PIWPI WPF KO   $CPFTKPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G(/FGT(KTOC9(/ÒNNGTKP4KICWPFNGVVKUEJG 5KNDGTRWP\GOKVQTKIKPCNGO\GKVIGPÌUUKUEJGP*CNUDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVVGKNYGKUG XGTIQNFGV WPF GOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC#TVJWU$GTVTCPFKP2CTKU CP0CFGNFKGUGRWP\KGTVOKV\YGK5GKVGPJCMGPKO1TKIKPCNGVWKOKVIQNFHCTDGPGO5VCCVUYCRRGP<'+  +p++



1TFGP FGT &TGK 5VGTPG  /QFGNN   5GV FGT  -NCUUG DGUVGJGPF CWU -TGW\  -NCUUG   5KNDGT XGTIQNFGV WPF GOCKNNKGTV FKG FTGK 5VGTPG )QNF CWH FGT 4ÒEMUGKVG FGT #WHJ·PIWPI WPF KO   $CPFTKPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G(/FGT(KTOC9(/ÒNNGTKP4KICWPFNGVVKUEJG 5KNDGTRWP\GOKVQTKIKPCNGO\GKVIGPÌUUKUEJGP*CNUDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVVGKNYGKUG XGTIQNFGV WPF GOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC#TVJWU$GTVTCPFKP2CTKU CP0CFGNFKGUGRWP\KGTVOKV\YGK5GKVGPJCMGPKO1TKIKPCNGVWKOKVIQNFHCTDGPGO5VCCVUYCRRGP<'+  +p++



1TFGPFGT&TGK5VGTPG/QFGNN  -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG FTGK5VGTPG)QNFCWHFGT4ÒEMUGKVGFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G(/HÒT FKG (KTOC 9 ( /ÒNNGT KP 4KIC WPF GT 5KNDGTRWP\G  CO QTKIKPCNGP IGP·JVGP *CNUDCPF KO   QTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO5VCCVUYCRRGP<'+ +p++



1TFGPFGT&TGK5VGTPG/QFGNN  -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG FTGK5VGTPG)QNFCWHFGT4ÒEMUGKVGFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G(/HÒT FKG(KTOC9(/ÒNNGTKP4KICWPFGT5KNDGTRWP\G COQTKIKPCNGPIGP·JVGP*CNUDCPF<'+ ++



'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTFCOGTKMCPKUEJG 2TKXCV   UCOONWPI0T

118


LETTLAND

8578 8579

8577



8580

1TFGPFGT&TGK5VGTPG/QFGNN  -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG FTGK5VGTPG)QNFCWHFGT8QTFGTUGKVGFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G(/HÃ&#x2019;T FKG (KTOC 9 ( /Ã&#x2019;NNGT KP 4KIC WPF GT 5KNDGTRWP\G  CO QTKIKPCNGP MWT\GP *CNUDCPFCDUEJPKVV   <'+ ++



1TFGPFGT&TGK5VGTPG/QFGNN  -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG FTGK5VGTPG)QNFCWHFGT8QTFGTUGKVGFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G(/HÃ&#x2019;T FKG (KTOC 9 ( /Ã&#x2019;NNGTKP4KICWPFGT5KNDGTRWP\G COQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGO 5VCCVUYCRRGP   <'+ +p++





1TFGPFGT&TGK5VGTPG/QFGNN  -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO IGP·JVGP$QIGPDCPFOKVCWHIGNGIVGT4QUGVVGCP6TCIGURCPIG<'+ ++





1TFGPFGT&TGK5VGTPG/QFGNN  -TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVFKG FTGK5VGTPG)QNFCWHFGT8QTFGTUGKVGFGT#WHJ·PIWPIOGJTHCEJRWP\KGTV WC*GTUVGNNGTRWP\G(/HÃ&#x2019;T FKG(KTOC9(/Ã&#x2019;NNGTKP4KICWPFGT5KNDGTRWP\G COQTKIKPCNGP$CPF<'+ +p++





8582 (1:2,5)

8581



8GTFKGPUVQTFGPXQO4QVGP-TGW\-TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOYQJNUR·VGTGP *CNUDCPF<'+ ++



'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTFCOGTKMCPKUEJG 2TKXCV   UCOONWPI0T



-QPXQNWVXQP#D\GKEJGPWPF#WU\GKEJPWPIGP8GTUEJKGFGPG/GVCNNGVGKNUXGTUKNDGTVVGKNUXGTIQN FGV VGKNU GOCKNNKGTV VGKNYGKUG OKV 'OCKNNGTGRCTCVWTGP CEJV CP 5EJTCWDGP OKV 5EJTCWDUEJGKDGP FCXQP   FTGKOKV*GTUVGNNGTDG\GKEJPWPIXQP5$GTQUKP4KICKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÃ&#x2019;EM++



#WHITWPF GZKUVKGTGPFGP ITQ­GP (·NUEJWPIURTQDNGOCVKM MCPP HÃ&#x2019;T FKGUG 'ZGORNCTG NGKFGT MGKPG )GY·JT HÃ&#x2019;T 1TKIKPC   NKV·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÃ&#x2019;EMNKEJ CWH FKG )GNGIGPJGKV\WTCWUHÃ&#x2019;JTNKEJGP8QTDGUKEJVKIWPIXQT FGT#WMVKQPCWHOGTMUCOIGOCEJV

119


LIECHTENSTEIN

8583 (1:1)

8584

.+'%*6'056'+0(ª456'067/ 

(Ã&#x2019;TUVNKEJ NKGEJVGPUVGKPKUEJGT 8GTFKGPUVQTFGP  #WUHÃ&#x2019;JTWPI CO $CPF INGKEJ DTGKV TQV WPF DNCW   IGUVTGKHV    )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO   QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT #WHNCIGP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN   FKGUGOKV5KNDGTRWP\GWPF*GTUVGNNGTRWP\G#4FGT(KTOC4GKVVGTGTKP9KGP<'+ 5VÃ&#x2019;EM+  )GUVKHVGV CO  ,WNK  OKV (Ã&#x2019;TUVNKEJGP *CPFUEJTGKDGP XQP (Ã&#x2019;TUV (TCP\ ,QUGRJ ++ XQP WPF \W .KGEJVGPUVGKP CNU   \WP·EJUVHÃ&#x2019;PHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGP/KV(Ã&#x2019;TUVNKEJGO*CPFUEJTGKDGPXQO5GRVGODGTYWTFG CNUYGKVGTG-NCUUGFKGFGU)TQ­MTGW\GUOKV$TKNNCPVGPIGUEJCHHGP



(Ã&#x2019;TUVNKEJ NKGEJVGPUVGKPKUEJGT 8GTFKGPUVQTFGP  #WUHÃ&#x2019;JTWPI TQVGU $CPF OKV DNCWGP 5GKVGPUVTGKHGP    UGKV -QOOCPFGWTMTGW\$TQP\GXXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP*CNUDCPF<'+ +p++



.+6#7'0 '456' 4'27$.+-   

120

1TFGP8[VCWVCUFGU)TQ­GP'VWKFGT(KTOC*WIWGPKP(T½TGUKP.G.QENG 5EJYGK\ \WT-NCUUGYGK ­GU.GFGTKOKVCVOKVDNCWGT5COVGKPNCIGOKVIQNFHCTDGPGT#WHUEJTKHV8;6#76#5&+&;5+5+ ++




LUXEMBURG

8586 (1:1)



1TFGP FGU )TQ­HÒTUVGP )GFKOKPCU  /QFGNN OKV GOCKNNKGTVGT 4ÒEMUGKVG    5GV FGT   -NCUUGDGUVGJGPFCWU&GMQTCVKQP-NCUUGZOO5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP &WTEJO  OO 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCP0CFGN<'+ 5VÒEM++  &GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG CO  (GDTWCT  XQP 2T·UKFGPV 5OGVQPC IGUVKHVGV &CU   \YGKVG/QFGNNWPVGTUEJGKFGVUKEJXQOGTUVGPWCFCTKPFCUUJKGTDGKFGP+PUKIPKGPFKG4ÒEMUGKVGGOCKNNKGTVKUV/KV FGT#PPGMVKQP.KVCWGPUFWTEJFKG5QYLGVWPKQPJÌTVGFGT1TFGPCWH\WDGUVGJGP/KV)GUGV\XQO5GRVGO DGTYWTFGGTXQPVJGNKVCWKUEJGP4GIKGTWPIYKGFGTKPU.GDGPIGTWHGP

8590

8588 8587



8589

1TFGP FGU )TQ­HÒTUVGP )GFKOKPCU  /QFGNN OKV GOCKNNKGTVGT 4ÒEMUGKVG    &GMQTCVKQP   FGT-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFKOGVYCUTGRCTKGTVGP1TKIKPCNGVWK FGT(KTOC*WIWGPKP(T½TGU%QKP.G.QENGOKVIQNFIGFTWEMVGO5VCCVUYCRRGP<'+ +p++



0CEJ8-CXCNKCWUMCU KP-#8 KUVFGT1TFGPXQP'PFGDKUPWTOCNKPFGT-NCUUGXGTNKGJGPYQTFGP



/GFCKNNGHÒTFKG(TGKYKNNKIGP)TÒPFGTFGT#TOGG$TQP\GCO$CPF

++



.7:'/$74))4155*'4<1)67/ 

1TFGPFGT'KEJGPMTQPG-QOOCPFGWTMTGW\#WUHÒJTWPIOKVGKPVGKNKIGO/GFCKNNQPITWPF)QNFGOCKN NKGTVICOQTKIKPCNGP*CNUDCPF<'+ +p



&GT 1TFGP YWTFG CO  &G\GODGT  XQP 9KNJGNO ++  -ÌPKI FGT 0KGFGTNCPFG WPF )TQ­JGT\QIXQP.WZGO DWTICNUXKGTMNCUUKIGT )TQ­MTGW\G4KVVGTXQO5VGTP-QOOCPFGWTGWPF4KVVGT CNNIGOGKPGT8GTFKGPUVQTFGPHÒTFCU )TQ­JGT\QIVWO.WZGODWTIIGUVKHVGVMCOGPFKG1HHK\KGTUMNCUUGWPFFKGCHHKNKKGTVGFTGKUVWHKIG/GFCKNNGJKP\W



1TFGPFGT'KEJGPMTQPG1HHK\KGTUMTGW\ CD #WUHÒJTWPIOKVGKPVGKNKIGO/GFCKNNQPITWPF)QNF HGKPUVITCXKGTVWPF\KUGNKGTVGOCKNNKGTVICOQTKIKPCNGPCNVGP$CPF<'+ ++

 121


MALTESER ORDEN

8591

8594 (1:1)

8596

8592

8593

5178'40'4/#.6'5'44+66'414&'0 5178'40'44+66'4 70&*152+6#.14&'081/*.,1*#00'5<7,'475#.'/ 

1TFGPUKPUKIPKGP 1TFGPUMTGW\  Z  OO 5KNDGT FKG #TOG OKV GKPIGNGIVGO 2GTNOWVV KP FGT   /KVVGITÒPGT)NCUUVGKPQJPG$CPF ++





1TFGPUKPUKIPKGP+PVGTPCVKQPCNG(QTO#WUHÒJTWPI  )TQ­MTGW\HÒT$CKNNKUEC OKV 6TQRJ·G  Z  OO GTUVG #WUHÒJTWPI QJPG .KNKGP \YKUEJGP FGP -TGW\CTOGP  5KNDGT XGTIQNFGV   VGKNYGKUGGOCKNNKGTVOKP'OCKNNGEJKRUKO-TGW\\GPVTWO 8QTFGTWPF4ÒEMUGKVG UQYKGKO-TGW\EJGP CWHFGO$TWUVRCP\GTFGT6TQRJ·G$ÒIGNCWHFGT4ÒEMUGKVGFGT6TQRJ·GIGDTQEJGPCWHFGT4ÒEMUGKVG FGT #ITCHHG WPNGUGTNKEJG 2WP\G UQYKG GT 5KNDGTRWP\G CWH FGT 4ÒEMUGKVG FGT 6TQRJ·G QJPG   5EJWNVGTDCPF 44++





1TFGPUKPUKIPKGP +PVGTPCVKQPCNG (QTO OKV .KNKGP \YKUEJGP FGP -TGW\CTOGP   #WUHÒJTWPI      -TGW\ FGT )PCFGP WPF /CIKUVTCN4KVVGT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF <'+    ++





1TFGPUKPUKIPKGP +PVGTPCVKQPCNG (QTO OKV .KNKGP \YKUEJGP FGP -TGW\CTOGP   WPF  #WUHÒJTWPI  

UGKV /KPKCVWTFGU-TGW\GUFGT&GXQVKQPU&QPCVGPGTUVGT-NCUUGD\Y UGKV FGT&GXQVKQPU &QPCVGP$TQP\GXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO$·PFEJGP ++





8GTFKGPUVQTFGP/QFGNNNGGTGU'VWK\WGKPGO8GTFKGPUVMTGW\CO&TGKGEMUDCPFOKVIQNFHCTDGPGO /CNVGUGTMTGW\ ++p+++





8GTFKGPUVQTFGP/QFGNN  8GTFKGPUVMTGW\-NCUUG$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO &TGKGEMUDCPFOKVCWHIGNGIVGOGOCKNNKGTVGP1TFGPUYCRRGPOKV0CFGNKOPKEJVMQTTGMVGP'VWK47) ++



1DGUUKEJJKGTDGKVCVU·EJNKEJWOGKP'ZGORNCTCWUFGO5KGD\GJPVGP,CJTJWPFGTVQFGTGKPG#PHGTVKIWPICWUFGT<GKV FGU *KUVQTKUOWU 'PFG 0GWP\GJPVGU ,CJTJWPFGTV  KO 5VKN FGU 5KGD\GJPVGP ,CJTJWPFGTVU JCPFGNV MQPPVG NGKFGT PKEJV   HGUVIGUVGNNVYGTFGP

122


MONACO

8599

8603

8600

8597

8598 (1:1)

8601

8602

8604 (1:2)



8GTFKGPUVQTFGP/QFGNN CWHFGT4Ã&#x2019;EMUGKVGYGK­GU/CNVGUGTMTGW\ 8GTFKGPUVMTGW\OKV FGT-TQPG 1HHK\KGTUMTGW\ 5KNDGTGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG +p++





8GTFKGPUVQTFGP  /QFGNN UGKV   /KPKCVWT FGU $TWUVUVGTPU \WT 5QPFGTUVWHG FGU )TQ­MTGW\GU   5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCO$·PFEJGP 4++





8GTFKGPUVQTFGP  /QFGNN CWH FGT 4Ã&#x2019;EMUGKVG #& /%/::  UGKV   -QOOCPFGWTMTGW\ OKV   5EJYGTVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFCDUEJPKVV<'+ +p++





8GTFKGPUVQTFGP/QFGNN CWHFGT4Ã&#x2019;EMUGKVG#&/%/::UGKV 8GTFKGPUVMTGW\OKV9CRRGP D\Y1HHK\KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$CPFOKVCWHIGNGIVGO9CRRGP\WUCOOGPOKV /KPKCVWT5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPWPF-PQRHNQEJTQUGVVGKOQTKIKPCNGPIQNFGPDG FTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC6CPHCPKWPF$GTVCTGNNKKP4QO<WUCOOGPOKVQTKIKPCNGT#PPCJOG IGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÃ&#x2019;TFGP1DGTTGIKGTWPIUTCVKO$WPFGURT·UKFKCNCOV*GN OWV /Ã&#x2019;NNGT FCVKGTV $QPP CO  1MVQDGT  WPF 2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP   WPFCP/Ã&#x2019;NNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT<'+ +p++





8GTFKGPUVQTFGP/QFGNN CWHFGT4Ã&#x2019;EMUGKVG#&/%/::UGKV 4KVVGTMTGW\OKV5EJYGTVGTP 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$CPF<'+ ++





'TKPPGTWPIUOGFCKNNG*KNHGHÃ&#x2019;T7PICTP$TQP\GGVYCUMQTTQFKGTVCOQTKIKPCNGP$CPFOKVKO1TKIKPC NGVWKFGT(KTOC5,QJPUQPKP/CKNCPFOKVYGK­GO/CNVGUGTMTGW\/#.66CHGN241 +p++





1TFGP FGU JN -CTN  #WUHÃ&#x2019;JTWPI OKV FTGK 5VGTPGP KO /GFCKNNQPTKPI  UGKV   1HHK\KGTUMTGW\   )QNFGOCKNNKGTVCOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG<'+ +p++





-WNVWT8GTFKGPUVQTFGP-QOOCPFGWTFGMQTCVKQP$TQP\GXGTIQNFGVCO*CNUDCPFCDUEJPKVV<'+ +p++





-WNVWT8GTFKGPUVQTFGP-QOOCPFGWTFGMQTCVKQP$TQP\GXGTIQNFGVCO*CNUDCPFCDUEJPKVV<'+ +p++





-WNVWT8GTFKGPUVQTFGP -QOOCPFGWTFGMQTCVKQP $TQP\G XGTIQNFGV CO MWT\GP *CNUDCPFCDUEJPKVV   <'+ +p++



/10#%1(ª456'067/ &GT 1TFGP YWTFG XQP (Ã&#x2019;TUV %JCTNGU +++ FWTEJ 1TFQPPCP\ 0T  XQO  /·T\  CNU \WP·EJUV FTGKMNCUUKIGT   CNNIGOGKPGT8GTFKGPUVQTFGPIGUVKHVGV&WTEJ1TFQPCP\XQO,CPWCTYWTFGGTCWHHÃ&#x2019;PH-NCUUGPGTYGKVGTV+P FKGUGT(QTOYKTFGTCWEJJGWVGPQEJXGTNKGJGP

123


MONTENEGRO

8607 (1:1)

/106'0')41(ª456'067/70&-¤0+)4'+%*   

1TFGP &CPKNQU +   /QFGNN   #WUHÒJTWPI OKV FGT /GFCKNNQPWOUEJTKHV "ÇÀ ÍÅÇÀÂÈÑ   ÈÌÎÑÒÚ ÖÐÍÅÃÎÐÅ (ÒT FKG 7PCDJ·PIKIMGKV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG DGKFGT   +PUKIPKGP 5GV FGT  -NCUUG DGUVGJGPF CWU -NGKPQF 5KNDGT GOCKNNKGTV 6GKNG FGT #WHNCIGP WPF FKG   ªDGTJÌJWPI)QNFMCWOUKEJVDCTGT'OCKNNGEJKRRKO/GFCKNNQPHGNFCOQTKIKPCNGPCNVGP5EJWNVGTDCPFGPF OKV CWHIGNGIVGT 4QUGVVGWPF$TWUVUVGTP&WTEJOGUUGTOO5KNDGTVNYDTKNNCPVKGTVWPFTGRGTEKGTV VNY GOCKNNKGTV 6GKNG FGT #WHNCIGP )QNF CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 8KPE   /C[GT U5ÌJPGKP9KGPCP0CFGNFKGUGOKV&QRRGN#2WP\G 5VÒEM+p++  &GT1TFGPKUVKO,CJTGXQP(ÒTUV&CPKNQ+CNU6UEJGTPQIQTKUEJGT7PCDJ·PIKIMGKVU1TFGPIGUVKHVGVYQTFGPWPF DGUVCPF PWT CWU GKPGO UKNDGTPGP PKEJV GOCKNNKGTVGP -TGW\ CP GKPGO &TGKGEMUDCPF  KUV FGT 1TFGP XQP (ÒTUV   0KMQNCWU+FGO0CEJHQNIGT&CPKNQU+XQNNMQOOGPWOIGUVCNVGVYQTFGP5QGTJKGNVGTPWPOGJTFGP0COGP1TFGP &CPKNQU+YWTFGCWHFTGK-NCUUGPGTYGKVGTVWPFCWEJFKG)GUVCNVWPIFGT+PUKIPKGPYWTFGGKPGTYGUGPVNKEJGPPFG TWPI WPVGTYQTHGP #NNGTFKPIU JCDGP FKG 5VCVWVGP XQP  PKEJV FGHKPKVKX HGUVIGNGIV YGNEJG 7OUEJTKHV FCU XQTFGT   UGKVKIG /GFCKNNQP FGU 1TFGPUMTGW\GU YKG CWEJ FGU $TWUVUVGTPU VTCIGP 5Q MQOOGP CD FKGUGO HTÒJGP <GKVRWPMV   UQYQJN +PUKIPKGP OKV FGT +PUEJTKHV "ÇÀ ÍÅÇÀÂÈÑÈÌÎÑÒÚ ÖÐÍÅÃÎÐÅ (ÒT FKG 7PCDJ·PIKIMGKV XQP   /QPVGPGITQ  YKG CWEJ OKV "ÊÍßÇÚ ÖÐÍÎÃÎÐÑÊIÈ (ÒTUV XQP /QPVGPGITQ  XQT WPF CWEJ GKPG /KUEJWPI   DGKFGT8CTKCPVGPKUVOÌINKEJ YKGFKGUGTGKPFGWVKI\WUCOOGPIJÌTKIG5GV\GKIV 'TUVDGKFGT'TYGKVGTWPIFGU1TFGPU KO ,CJTG  KUV FKG +PUEJTKHV FGU 8QTFGTUGKVGPOGFCKNNQPU XQP -TGW\ WPF 5VGTP KP FGP 5VCVWVGP OKV "ÊÍßÇÚ   ÖÐÍÎÃÎÐÑÊIÈ (ÒTUV XQP /QPVGPGITQ  HGUVIGUEJTKGDGP WPF CD FKGUGO <GKV YQJN CWEJ UQ XGTNKGJGP YQTFGP   +PUQHGTP KUV FKG /GFCKNNQPWOUEJTKHV GTUV DGK 5VÒEMGP PCEJ  =PWOGJT ITWPFU·V\NKEJ OKV "ÊÍßÇÚ   ÖÐÍÎÃÎÐÑÊIÈ (ÒTUV XQP /QPVGPGITQ ? CNU 7PVGTUEJGKFWPIUOGTMOCN FGU  WPF FGT UR·VGTGP /QFGNNG \W   DGVTCEJVGP 'U UVGJV CNNGTFKPIU \W XGTOWVGP FC­ CWHITWPF FGT \CJNTGKEJGP XGTUEJKGFGPGP .KGHGTCPVGP FGT +PUKIPKGP   5VÒEMGOKV"ÇÀ ÍÅÇÀÂÈÑÈÌÎÑÒÚ ÖÐÍÅÃÎÐÅ (ÒTFKG7PCDJ·PIKIMGKVXQP/QPVGPGITQ CWEJPCEJ\WT 8GTNGKJWPIIGNCPIVUKPF

124


MONTENEGRO

8609 (1:1)

8608



1TFGP &CPKNQU +   /QFGNN   #WUHÒJTWPI OKV FGT /GFCKNNQPWOUEJTKHV "ÇÀ    ÍÅÇÀÂÈÑÈÌÎÑÒÚ ÖÐÍÅÃÎÐÅ (ÒT FKG 7PCDJ·PIKIMGKV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG   DGKFGT +PUKIPKGP -NGKPQF FGT  -NCUUG 5KNDGT GOCKNNKGTV ªDGTJÌJWPI 5KNDGT XGTIQNFGV 6GKNG FGT   #WHNCIGP )QNF MCWO UKEJVDCTGT 'OCKNNGEJKR KO /GFCKNNQPHGNF CO UR·VGTGP 5EJWNVGTDCPFGPF   <'+ +p++ 



1TFGP &CPKNQU +   WPF  /QFGNN EC   #WUHÒJTWPI OKV FGT /GFCKNNQPWOUEJTKHV   "ÊÍßÇÚ ÖÐÍÎÃÎÐÑÊ+È (ÒTUV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG DGKFGT +PUKIPKGP 5GV   FGT-NCUUGDGUVGJGPFCWU-NGKPQF5KNDGTGOCKNNKGTV6GKNGFGT#WHNCIGPWPFFKGªDGTJÌJWPI)QNF MCWOUKEJVDCTGT'OCKNNGURTWPIKO/GFCKNNQPHGNFKO6TCIGTKPIRWP\KGTVQJPG5EJWNVGTDCPFWPF$TWUV UVGTP&WTEJOGUUGTOO5KNDGTVGKNYGKUGDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGGOCKNNKGTV6GKNGFGT #WHNCIGP )QNF CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 8KPE /C[GT U 5ÌJPG KP 9KGP CP   0CFGNFKGUGOKV&QRRGN#2WP\G<'+ 5VÒEM+p++  9WPFGTUEJÌPGTHTÒJGT5GVKPJGTXQTTCIGPFGT'TJCNVWPI

125


MONTENEGRO

8610 (1:1)



1TFGP&CPKNQU+WPF/QFGNN EC -NGKPQFFGT-NCUUG#WUHÒJTWPIOKVFGT/G FCKNNQPWOUEJTKHV "ÊÍßÇÚ ÖÐÍÎÃÎÐÑÊ+È (ÒTUV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG 5KNDGT   GOCKNNKGTV 6GKNG FGT #WHNCIGP WPF FKG ªDGTJÌJWPI )QNF KO 6TCIGTKPI RWP\KGTV CO QTKIKPCNGP CNVGP   5EJWNVGTDCPFOKVCWHIGNGIVGT4QUGVVG<'+ + 

8613

8612

8611 (1:1)



1TFGP&CPKNQU+WPF/QFGNN EC $TWUVUVGTP\WT-NCUUG#WUHÒJTWPIOKVFGT/G FCKNNQPWOUEJTKHV"ÊÍßÇÚ ÖÐÍÎÃÎÐÑÊ+È (ÒTUVXQP/QPVGPGITQ CWHFGT8QTFGTUGKVG&WTEJOGUUGT  OO 5KNDGT VGKNYGKUG DTKNNCPVKGTV VGKNYGKUG GOCKNNKGTV 6GKNG FGT #WHNCIGP )QNF CP 0CFGN   <'+ +p++ 



1TFGP &CPKNQU +   WPF  /QFGNN EC   -TGW\  D\Y  -NCUUG #WUHÒJTWPI OKV FGT   /GFCKNNQPWOUEJTKHV "ÊÍßÇÚ ÖÐÍÎÃÎÐÑÊ+È (ÒTUV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG 5KNDGT   GOCKNNKGTV6GKNGFGT#WHNCIGPWPFFKGªDGTJÌJWPI)QNFKO6TCIGTKPIOGJTHCEJRWP\KGTVCOQTKIKPCNGP CNVGP&TGKGEMUDCPF<'+ +p++



1TFGP &CPKNQU +   WPF  /QFGNN EC   -TGW\  D\Y  -NCUUG #WUHÒJTWPI OKV FGT   /GFCKNNQPWOUEJTKHV "ÊÍßÇÚ ÖÐÍÎÃÎÐÑÊ+È (ÒTUV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG 5KNDGT   GOCKNNKGTVFKGªDGTJÌJWPI5KNDGTXGTIQNFGVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF<'+ +p++





126


MONTENEGRO

8614 8615



1TFGP &CPKNQU +   WPF  /QFGNN EC   -TGW\  D\Y  -NCUUG 5KNDGT /GFCKNNQPU   )QNFGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF<'+ +p++





1TFGP&CPKNQU+/QFGNN EC $TWUVUVGTP\WT-NCUUG#WUHÒJTWPIOKVFGT/GFCKNNQP WOUEJTKHV "ÇÀ ÍÅÇÀÂÈÑÈÌÎÑÒÚ ÖÐÍÅÃÎÐÅ (ÒT FKG 7PCDJ·PIKIMGKV XQP /QPVGPGITQ    &WTEJOGUUGT  OO 5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDGV\GKEJPWPIFGT(KTOC,)QFGVWPF5QJPKP$GTNKPCP0CFGN<'+ ++



5GNVGPG*GTUVGNNGTXCTKCPVG

8616 (1:1)



1TFGP &CPKNQU +   /QFGNN EC   #WUHÒJTWPI OKV FGT /GFCKNNQPWOUEJTKHV "ÊÍßÇÚ   ÖÐÍÎÃÎÐÑÊ+È (ÒTUV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG DGKFGT +PUKIPKGP 5GV FGT  -NCUUG   DGUVGJGPF CWU -NGKPQF 5KNDGT GOCKNNKGTV 6GKNG FGT #WHNCIGP WPF FKG ªDGTJÌJWPI )QNF MCWO   UKEJVDCTGT QDGTHN·EJNKEJGT 'OCKNNGEJKR CWH FGT 4ÒEMUGKVG GKPGU -TGW\CTOU KO 6TCIGTKPI RWP\KGTV CO   QTKIKPCNGP*CNUDCPFWPF$TWUVUVGTP&WTEJOGUUGTOO5KNDGTVGKNYGKUGDTKNNCPVKGTVWPFTGRGTEKGTV VGKNYGKUGGOCKNNKGTV6GKNGFGT#WHNCIGP)QNFCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC8KPE /C[GT U5ÌJPGKP9KGPCP0CFGNFKGUGOKV&QRRGN#2WP\GKOQTKIKPCNGPOKVIQNFHCTDGPGO9CRRGP DGFTWEMVGPQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC8KPE/C[GT U5ÌJPG<'+ +p++  9WPFGTUEJÌPGTHTÒJGT5GVKPJGTXQTTCIGPFGT'TJCNVWPI

127


MONTENEGRO

8617

8618



8618

1TFGP &CPKNQU +   /QFGNN EC   $TWUVUVGTP FGT  -NCUUG OKV FGT /GFCKNNQPKPUEJTKHV   "ÇÀ ÍÅÇÀÂÈÑÈÌÎÑÒÚ ÖÐÍÅÃÎÐÅ (ÒTFKG7PCDJ·PIKIMGKVXQP/QPVGPGITQ CWHFGO/GFCKNNQP &WTEJOGUUGTOO5KNDGTDTKNNCPVKGTV#WHNCIGPFGU/GFCKNNQPU)QNFCP0CFGN<'+ ++



 YWTFG FKG DKUJGTKIG  -NCUUG \WT  -QOOCPFGWT  WPF FKG PGWG  -NCUUG )TQ­QHHK\KGT  GTJKGNV GKPGP   $TWUVUVGTP KO(QTOCVGVYCUMNGKPGTCNUDGKO)TQ­MTGW\ 



1TFGP &CPKNQU +   /QFGNN EC   -TGW\  -NCUUG #WUHÒJTWPI OKV FGT /GFCKNNQP   WOUEJTKHV "ÊÍßÇÚ ÖÐÍÎÃÎÐÑÊ+È (ÒTUV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG 5KNDGT GOCKNNKGTV   ªDGTJÌJWPI 5KNDGT XGTIQNFGV 6GKNG FGT #WHNCIGP )QNF CO QTKIKPCNGP \GKVIGPÌUUKUEJGP *CNUDCPF    <'+ ++ 



1TFGP&CPKNQU+.GGTGU'VWKHÒTFCU-TGW\-NCUUG *CNUMTGW\ FGT(KTOC#TVJWU$GTVTCPFKP2CTKU ++

8620 (1:1)

8623 8621





8622

8624

1TFGP &CPKNQU +  /KPKCVWT FGU 1TFGPUMTGW\GU #WUHÒJTWPI OKV FGT /GFCKNNQPWOUEJTKHV "ÊÍßÇÚ   ÖÐÍÎÃÎÐÑÊ+È (ÒTUV XQP /QPVGPGITQ  CWH FGT 8QTFGTUGKVG 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV   QJPG$·PFEJGP ++





1TFGPFGT$GHTGKWPI/QPVGPGITQU1TFGPUFGMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP &TGKGEMUDCPF<'+ +p++





1TFGPFGT$GHTGKWPI/QPVGPGITQU1TFGPUFGMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP &TGKGEMUDCPF<'+ +p++





/KNKV·TKUEJG6CRHGTMGKVUOGFCKNNG5KNDGTCOQTKIKPCNGP&TGKGEMUDCPFOKVFWTEJIGUEJNCIGPGT/GVCNNÌUG \WO#WHJ·PIGP41/1 4+p++



+PUGNVGPIWVGT'TJCNVWPI

 128

/KNQUJ1DKNKEJ/GFCKNNG#WUICDG OKVFGT,CJTGU\CJN $TQP\GXGTIQNFGVCOQTKIKPCNGPCNVGP GVYCUCWUIGDNGKEJVGP&TGKGEMUDCPF41/1 ++




NIEDERLANDE

8625

8626

8627 8628



/GFCKNNG\WT'TKPPGTWPICPFKG5EJNCEJVXQP)TCJQXCEJ-WRHGT0KEMGN.GIKGTWPICOCNVGP&TGK GEMUDCPF41/1 ++





/GFCKNNGHÒTFGP-TKGIXQPDKU$TQP\GCOQTKIKPCNGP&TGKGEMUDCPFOKVFWTEJIGUEJNCIGPGT /GVCNNÌUG\WO#WHJ·PIGP41/1 +p++



+PUGNVGPIWVGT'TJCNVWPI



/GFCKNNGHÒT'KHGT)QNFGPG/GFCKNNG5KNDGTXGTIQNFGV#WUHÒJTWPIQJPG5VGORGNUEJPGKFGT\GKEJGPCO QTKIKPCNGPCNVGPGVYCUCWUIGDNKEJGPGP$CPF ++





/GFCKNNG HÒT 'KHGT 5KNDGTPG /GFCKNNG 5KNDGT #WUHÒJTWPI OKV FWTEJ 5EJCTPKGT DGHGUVKIVG DTGKVG ¤UG   COQTKIKPCNGP$CPF41/1 ++



8630

8631



8629

8631

/GFCKNNG\WO)QNFGPGP4GIKGTWPIULWDKN·WO)QNFGPG/GFCKNNG$TQP\GXGTIQNFGVOKV5VGORGN UEJPGKFGTUKIPCVWT565%*9#46<COUR·VGTGPLGFQEJMQTTGMVGP&TGKGEMUDCPF +p++



0+'&'4.#0&'-¤0+)4'+%* 

<KXKN8GTFKGPUVQTFGP XQO 0KGFGTN·PFKUEJGP .ÌYGP D\Y 1TFGP XQO 0KGFGTN·PFKUEJGP .ÌYGP   $TWUVUVGTP \WO )TQ­MTGW\ #WUHÒJTWPI OKV FGO $WEJUVCDGP 9 KP FGP -TGW\CTOYKPMGNP 5KNDGT   VGKNYGKUG DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC,/,XCP9KGNKMKP&GP*CCICP0CFGNFKGUGOGJTHCEJRWP\KGTV WCOKV5KNDGTRWP\G  OKV\YGK5GKVGPJCMGP<'+ +p++



<KXKN8GTFKGPUVQTFGP XQO 0KGFGTN·PFKUEJGP .ÌYGP D\Y 1TFGP XQO 0KGFGTN·PFKUEJGP .ÌYGP   -QOOCPFGWTMTGW\ LÒPIGTG #WUHÒJTWPI OKV OGJTVGKNKIGP GOCKNNKGTVGP #XGTU WPF 4GXGTU/GFCKNNQPU   )QNFGOCKNNKGTVKO8GTDKPFWPIUUVGI\WT-TQPGRWP\KGTVOKVQTKIKPCNGO*CNUDCPF<'+ 4+p++



&GT FTGKMNCUUKIG <KXKN8GTFKGPUVQTFGP YWTFG CO  5GRVGODGT  XQP -ÌPKI 9KNJGNO + IGUVKHVGV 'T YKTF HÒT   CWHQRHGTPFG 6CVGP HÒT FCU 8CVGTNCPF DGUQPFGTGP 'KHGT WPF 6TGWG KP FGT 'THÒNNWPI FGT $ÒTIGTRHNKEJV WPF CW­GTQT   FGPVNKEJG.GKUVWPIGPCWHFGO)GDKGVGFGT9KUUGPUEJCHVWPF-WPUVKPDGUQPFGTGP(·NNGPCW­GTFGO/KNKV·TRGTUQPGP WPF#WUN·PFGTPXGTNKGJGP



129


NIEDERLANDE

8633

8632



8634

<KXKN8GTFKGPUVQTFGPXQO0KGFGTN·PFKUEJGP.ÌYGPD\Y1TFGPXQO0KGFGTN·PFKUEJGP.ÌYGP4KV VGTMTGW\ ·NVGTG #WUHÒJTWPI OKV GKPVGKNKIGP <GPVTGP WPF PKEJV GOCKNNKGTVGO 4GXGTU\GPVTWO )QNF   VGKNYGKUGHGKPUV\KUGNKGTVGOCKNNKGTVICOMWT\GPUR·VGTGP$CPF<'+ +p++



#PHGTVKIWPICWUFGONGV\VGP&TKVVGFGU0GWP\GJPVGP,CJTJWPFGTVU



/KNKV·T9KNJGNO1TFGP4KVVGTMTGW\-NCUUG)QNFGOCKNNKGTVCOCNVGP$CPFOKVCWHIGNGIVGT4QUGVVG <'+ ++



#PHGTVKIWPIWOEC



/KNKV·T9KNJGNO1TFGP 4KVVGTMTGW\  -NCUUG 5KNDGT 8QTFGTUGKVGP\GPVTWO )QNF GOCKNNKGTV UVCTMG   $GUEJ·FKIWPIGPKPFGTYGK­GP'OCKNNGFGT8QTFGTUGKVG4ÒEMUGKVGPOGFCKNNQPHGJNVCOCNVGP$CPF<'+  ++



#PHGTVKIWPIWOEC

8638 8635



8636

8637

1TCPKGP0CUUCW1TFGP-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO$CPFTKPIRWP\KGTVCO *CNUDCPF\WUCOOGPOKV-PQRHNQEJTQUGVVGKOFWPMGNDNCWGP1TKIKPCNGVWKFGT-CPUGNCTKLFGT0GFGTNCPFUG 1TFGPKP U)TCXGPJCIGOKVIQNFHCTDGPGT-ÌPKIUMTQPG<'+ ++





1TCPKGP0CUUCW1TFGP-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO$CPFTKPIRWP\KGTVCO *CNUDCPFKOJGNNDNCWGP1TKIKPCNGVWKOKVIQNFHCTDGPGT-ÌPKIUMTQPG<'+ ++





1TCPKGP0CUUCW1TFGP1HHK\KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4Q UGVVG<'+ ++





1TCPKGP0CUUCW1TFGP5KNDGTPG8GTFKGPUVOGFCKNNG5KNDGTQJPG$CPFKOQTKIKPCNGP8GTNGKJWPIUGVWK FGT(KTOC,/,XCP9KGNKMKP&GP*CCIOKVIQNFHCTDGPGT-TQPG<'+ +p++



130


NIEDERLANDE

8639 (1:1)



*CWUQTFGPXQP1TCPKGP/QFGNN UGKV )TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP WPF IGVTCIGPGP 'KPMPÌRH5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG   XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -QPKPMNKLMG $GIGGT KP   8QQTUEJQVGP CP 0CFGN \WUCOOGP OKV \YGK +PVGTKOUEJPCNNGP KO 1TKIKPCNGVWK FGT -QPKPMNKLMG $GIGGT   OKVIQNFHCTDGPGO#WHFTWEM<'+ 5VÒEM4++ 

8640



8641

*CWUQTFGP XQP 1TCPKGP  /QFGNN UGKV   1HHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CP   0CFGN\WUCOOGPOKV-PQRHNQEJTQUGVVGKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT-QPKPMNKLMG $GIGGTKP8QQTUEJQVGP<'+ 4+p++



-QOOGPFGFGU1TFGPUXQOJN,QJCPPGU  D\Y UGKV FGU,QJCPPKVGTQTFGPUKPFGP 0KGFGTNCPFGP-TGW\FGT4GEJVUTKVVGTHÒT&COGP&WTEJOGUUGTOO$TQP\GXGTIQNFGVWPFGOCKN NKGTVCP&COGPUEJNGKHG<'+p 44++



5GNVGP.CWV/GKLGT/WNFGTWPF9CIGPCCT 0'& YWTFGPDGKURKGNUYGKUGXQPDKUPWT1HHK\KGTUMTGW\G XGTNKGJGP



/KV MÌPKINKEJGO &GMTGV XQO  #RTKN  YWTFG  CWH +PKVKCVKXG XQP 2TKP\IGOCJN *GPTKM FGT 0KGFGTNCPFG GKPG   PKGFGTN·PFKUEJG -QOOGPFG FGU ,QJCPPKVGTQTFGPU GTTKEJVGV FKG CNU +PUKIPKGP FKGLGPKIGP FGT $CNNGK $TCPFGPDWTI   HÒJTVG 0CEJ FGO <YGKVGP 9GNVMTKGI YWTFG  FKG $KPFWPI CP FKG $CNNGK CWHIGJQDGP WPF GKP WPCDJ·PIKIGT   ,QJCPPKVGTQTFGPKPFGP0KGFGTNCPFGPOKVGKIGPGP1TFGPUKPUKIPKGPIGUVKHVGV -ÌPKINKEJGT$GHGJN0TXQO/·T\   5GKV  MÌPPGP CWEJ &COGP KP FGP 1TFGP CWHIGPQOOGP YGTFGP FGTGP +PUKIPKGP XQP TGFW\KGTVGT )TÌ­G   UKPF/KV-ÌPKINKEJGO$GHGJN0TXQO5GRVGODGTPCJOGTUGKPGPJGWVKIGP0COGPCP

131


NORWEGEN

8642







8644

8643

-QOOGPFGFGU1TFGPUXQOJN,QJCPPGU  D\Y UGKV FGU,QJCPPKVGTQTFGPUKPFGP 0KGFGTNCPFGP -TGW\ FGT 'JTGPTKVVGT HÒT *GTTGP &WTEJOGUUGT  OO $TQP\G XGTIQNFGV WPF   GOCKNNKGTVCO*CNDCJPFCDUEJPKVV<'+ ++



-QOOGPFGFGU1TFGPUXQOJN,QJCPPGU  D\Y UGKV FGU,QJCPPKVGTQTFGPUKPFGP 0KGFGTNCPFGP -TGW\ FGT 'JTGPTKVVGT HÒT *GTTGP &WTEJOGUUGT  OO $TQP\G XGTIQNFGV WPF   GOCKNNKGTVCO*CNUDCPF<'+ ++



-QOOGPFGFGU1TFGPUXQOJN,QJCPPGU  D\Y UGKV FGU,QJCPPKVGTQTFGPUKPFGP 0KGFGTNCPFGP-TGW\FGT'JTGPTKVVGTHÒT&COGP&WTEJOGUUGTOO$TQP\GXGTIQNFGVWPFGOCKNNKGTV CP&COGPUEJNGKHG<'+p 4++



8645

8646 (1:1)



8646 (1:1)

/GFCKNNGHÒT6TGWGP&KGPUVKPFGT#TOGG/QFGNNOKV/QPQITCOO9CWHFGT4ÒEMUGKVG    -NGKPG  )QNFGPG /GFCKNNG HÒT  &KGPUVLCJTG QFGT  &KGPUVLCJTG KP FGP -QNQPKGP    &WTEJOGUUGTOO)QNFIKO4CPFRWP\KGTV\YGK4CPFFGNNGPWPFGKP2TÒHURWTKO4CPFCO QTKIKPCNGP$CPF ++



0149')'0 -¤0+)4'+%*2'4510#.70+10/+65%*9'&'0 $+5  

-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGP/QFGNN  -NGKPQF\WO)TQ­MTGW\)QNF GOCKNNKGTVIQJPG5EJWNVGTDCPF<'+ +p++  &GT\WP·EJUVFTGKMNCUUKIG1TFGPYWTFGCO#WIWUVXQP-ÌPKI1UECT+HÒTFCUOKV5EJYGFGPKP2GTUQPCN WPKQPXGTDWPFGPG-ÌPKITGKEJ0QTYGIGPIGUVKHVGV$KUECYCTGPFKGXGTNKGJGPGP$TWUVUVGTPGYKGKP5EJYGFGP IGUVKEMV  YWTFG GT CWH XKGT -QOOCPFGWT  WPF  -NCUUG   CWH HÒPH -NCUUGP 4KVVGTWPF-NCUUG  GTYGKVGTV PCEJFGO DGTGKVU  FKG -QNNCPG GKPIGHÒJTV YQTFGP YCT 'U DGUVCPF UVTGPIG 4ÒEMICDGRHNKEJV FGT +PUK   IPKGP

132


NORWEGEN

8647 (1:1)



-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGP/QFGNN  -QOOCPFGWTMTGW\OKV5EJYGT VGTP)QNFGOCKNNKGTVICWHFGO$CPFTKPIRWP\KGTV,6OKVQTKIKPCNGO\GKVIGPÌUUKUEJGP*CNU DCPFCDUEJPKVVKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC,6QUVTWRKP-TKUVKCPKC<'+ 4+



8648

5'.$56560&+)'5 -¤0+)4'+%* 5'+6  

-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP  /QFGNN   OKV GKPGO .ÌYGP ÒDGT FGT   -TQPG 4KVVGTMTGW\-NCUUGOKV5EJYGTVGTP)QNFGOCKNNKGTVCO1TKIKPCNDCPF<'+ ++



0CEJ FGT #WHNÌUWPI FGT 2GTUQPCNWPKQP OKV 5EJYGFGP DGUV·VKIVG FGT PGW IGY·JNVG -ÌPKI *CCMQP 8++ CO  ,WPK     FGP 1TFGP KP GVYCU XGT·PFGTVGT )GUVCNVWPI YQDGK FCU DKUJGTKIG -NCUUGPU[UVGO GTJCNVGP DNKGD  XGT   UEJYCPF UEJNKG­NKEJ FGT MNGKPG .ÌYG ÒDGT FGO -TGW\ FGT -TQPG YQOKV FGT 1TFGP UGKPG JGWVKIG )GUVCNV GTJKGNV    #NNG -NCUUGP FGU 1TFGPU MÌPPGP CWEJ OKV 5EJYGTVGTP XGTNKGJGP YGTFGP FKG LGFQEJ PWT CWH FGP 1TFGPUMTGW\GP    PKEJV CWH FGP $TWUVUVGTPGP CPIGDTCEJV YGTFGP #NU DGUQPFGTU JQJG #WU\GKEJPWPI MCPP FGT 1TFGP KP $TKNNCPVGP    XGTNKGJGPYGTFGP#NNG+PUKIPKGPFGU1TFGPUCW­GTFKGLGPKIGPOKV$TKNNCPVGPUKPFUVTGPITÒEMICDGRHNKEJVKI

133


NORWEGEN

8649 (1:1)



-ÌPKINKEJ 0QTYGIKUEJGT 5CPMV 1NCXU1TFGP  /QFGNN QJPG .ÌYG ÒDGT FGT -TQPG  UGKV     )TQ­MTGW\UGVDGUVGJGPFCWU)TQ­MTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCN5EJWNVGTDCPFWPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 6QUVTWR KP 1UNQ CP 0CFGN \WUCOOGP OKV -PQRHNQEJTQUGVVG KO   1TKIKPCNGVWK FGT (KTOC 6QUVTWR <WUCOOGP OKV FGT QTKIKPCN 8GTNGKJWPIUWTMWPFG HÒT FGP KVCNKGPKUEJGP   -CDKPGVVUEJGH %CTNQ /CTEJKQTK FCVKGTV  #RTKN  OKV 2CRKGTUKGIGN WPF OKP XGTYKUEJVGT    1TKIKPCNWPVGTUEJTKHV-ÌPKI1NCX8<'+ 4+p++  5GJT UGNVGPGU 'PUGODNG &KG 7TMWPFGP UKPF PCJG\W PKEJVKO*CPFGN\WHKPFGP'ZGORNCTCWUWPUGTGT#WMVKQP CO,WPK 0T %CTNQ/CTEJKQTKKVCNKGPKUEJGT2QNKVKMGTFGT&GOQETC\KC%TKUVKCPC KVCN%JTKUVFGOQ MTCVGP YCTWC-CDKPGVVUEJGHFGT4GIKGTWPIXQP#NFQ/QTQ DKU FGUUGJTRQRWN·TGP WPFUR·VGTXQPFGP4QVGP$TKICFGPGTOQTFGVGP/KPKUVGTRT·UKFGPVGP

134


NORWEGEN

8651

8650 (1:1)



-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGPWPF/QFGNN UGKV $TWUVUVGTP\WO-QOOCP FGWTOKV5VGTP5KNDGTDTKNNCPVKGTVVGKNYGKUGXGTIQNFGV/GFCKNNQP)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GT UVGNNGTDG\GKEJPWPI FGT (KTOC 6QUVTWR KP 1UNQ CP 0CFGN KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC   6QUVTWR<'+ +p++



-ÌPKINKEJ0QTYGIKUEJGT5CPMV1NCXU1TFGP/QFGNN QJPG.ÌYGÒDGTFGT-TQPGUGKV 4KV VGTMTGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFOKV0CFGNKOQTKIKPCNGPIQNFGP DGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC6QUVTWR<'+ +p++





5CPMV1NCXU/GFCKNNG/QFGNN OKVFGO2QTVTCKV-ÌPKI*CCMQPU8++ 5KNDGTCO$CPF 44++





-TKGIUMTGW\$TQP\GCOQTKIKPCNGP$CPF



++



++



8652 8654

8655



-TKGIUMTGW\$TQP\GCOQTKIKPCNGP$CPF



6CRHGTMGKVU-TGW\  /QFGNN   -TGW\  -NCUUG $TQP\G VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCOQTKIKPCNGP$CPFOKV6TCIGURCPIG 4++

0149')'04')+'470)&'40#5,10#.5#/.+0)  



135


ÖSTERREICH

8658 8657

8660 8656

8659

¤56'44'+%* -#+5'44'+%*   

1TFGPXQO)QNFGPGP8NKGU5COONGTCPHGTVKIWPIFGT*CNUFGMQTCVKQP5KNDGTVGKNYGKUGITCXKGTVWPFXGT IQNFGVVGKNYGKUGGOCKNNKGTVCO*CNUDCPFOKV%QWNCPV5KNDGTVGKNYGKUGITCXKGTVWPFXGTIQNFGVVGKNYGKUG GOCKNNKGTV ++



/KNKV·T/CTKC6JGTGUKGP1TFGP5COONGTCPHGTVKIWPIFGU-QOVWTMTGW\GU5KNDGTXGTIQNFGVWPFGOCKN NKGTVCO*CNUDCPFCDUEJPKVV +p++



#PHGTVKIWPI CWU FGT <YGKVGP *·NHVG FGU  ,CJTJWPFGTVU *GTXQTTCIGPFGU 'TUCV\UVÒEM HÒT GKP PWT TGEJV UEJYGT \W   DGMQOOGPFGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCT



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI FGT (KTOC 4QVJG KP 9KGP CWU FGP GT ,CJTGP *GTXQTTCIGPFGU 'TUCV\GZGORNCT   HÒTGKPPWT·W­GTUVUEJYGTGTJ·NVNKEJGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCTKPGEJV)QNF





-CKUGTNKEJ¤UVGTTGKEJKUEJGT .GQRQNF1TFGP 5COONGTCPHGTVKIWPI FGU 4KVVGTMTGW\GU OKV FGT   -TKGIUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVKPFGT¤UGRWP\KGTV%(4HÒTFKG(KTOC4QVJGWPF 5KNDGTRWP\GCO&TGKGEMUDCPF ++



-CKUGTNKEJ¤UVGTTGKEJKUEJGT .GQRQNF1TFGP 5COONGTCPHGTVKIWPI FGU -QOVWTMTGW\GU OKV FGT   -TKGIUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFCDUEJPKVV +p++



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI FGT (KTOC 4QVJG KP 9KGP CWU FGP GT ,CJTGP *GTXQTTCIGPFGU 'TUCV\GZGORNCT   HÒTGKPPWT·W­GTUVUEJYGTGTJ·NVNKEJGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCT



-CKUGTNKEJ¤UVGTTGKEJKUEJGT.GQRQNF1TFGP5COONGTCPHGTVKIWPIFGU4KVVGTMTGW\GUKPFGTGTUVGP#WU HÒJTWPI)QNFGOCKNNKGTVICO$CPF + 5GJTHGKPGWPFJQEJYGTVKIG#PHGTVKIWPICWUFGT\YGKVGP*·NHVGFGU<YCP\KIUVGP,CJTJWPFGTVU

136




Ã&#x2013;STERREICH

8661 Rs.



¤UVGTTGKEJKUEJ-CKUGTNKEJGT1TFGPFGT'KUGTPGP-TQPG5COONGTCPHGTVKIWPIFGT1TFGPUMQNNCPGDGUVG JGPF CWU  /QPQITCOO  -TQPGP  -TCP\ GKPGO 6TCIG WPF GKPGO 8GTUEJNWUUINKGF 5KNDGT   XGTIQNFGVHGKPUVITCXKGTVVGKNYGKUGGOCKNNKGTVOKV-NGKPQF5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVOKV 'KUGPTKPIKPPGTJCNDFGT'KUGTPGP-TQPGKO6TCIGTKPIRWP\KGTV%(4WPF ++  *GTXQTTCIGPFGT'TUCV\ITQ­CTVKIGT#PHGTVKIWPIUSWCNKV·VHÃ&#x2019;TGKPKOQTKIKPCNPCJG\WWPDGUEJCHHDCTGU'ZGORNCT

8663







8662

8664

¤UVGTTGKEJKUEJ-CKUGTNKEJGT 1TFGP FGT 'KUGTPGP -TQPG 5COONGTCPHGTVKIWPI GKPGU $TWUVUVGTPU FGT   -NCUUG5KNDGTVGKNYGKUGITCXKGTVWPFXGTIQNFGVGOCKNNKGTVCP0CFGNFKGUGOKV*GTUVGNNGTDG\GKEJPWPI FGT(KTOC4QVJGKP9KGPWPF5KNDGTRWP\G ++



¤UVGTTGKEJKUEJ-CKUGTNKEJGT 1TFGP FGT 'KUGTPGP -TQPG &GMQTCVKQP FGT  -NCUUG )QNF VGKNYGKUG   GOCKNNKGTVKPPGTJCNDFGT-TQPG'KUGPTKPICWHFGT4Ã&#x2019;EMUGKVGFGT-TQPGPRGPFKNKGP*GTUVGNNGTDG\GKEJPWPI FGT(KTOC4QVGKP9KGPCO$CPFKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC4QVJG 0GHHGKP9KGP$#491<'+ +p++



¤UVGTTGKEJKUEJ-CKUGTNKEJGT1TFGPFGT'KUGTPGP-TQPG&GMQTCVKQPFGT-NCUUGOKVFGT-TKGIUFGMQ TCVKQP $TQP\G XGTIQNFGV VGKNYGKUG GOCKNNKGTV KPPGTJCND FGT -TQPG 'KUGPTKPI FKGUGT GVYCU MQTTQFKGTV   KOQHHGPGP4KPIRWP\KGTV(4HÃ&#x2019;TFKG(KTOC4QVJGKP9KGPQJPG$CPF$#491<'+ ++

 137


ÖSTERREICH

8665 (1:1)





-CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP$TWUVUVGTP\WO-QOVWTMTGW\ OKV5VGTP /QFGNN

 5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGP)QNFGOCKNNKGTV'OCKNNGXQPFTGK-TGW\CTOGP HCUVXQNNUV·PFKI\GTUVÌTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC)GDT4GUEJKP9KGPGKPG 5EJTCWDGPOWVVGT\WT$GHGUVKIWPIFGT-TGW\CWHNCIGHGJNVCP0CFGNFKGUGOKV2WP\GHÒTGT5KNDGTXQP  DKU  &KCPCMQRH KO 5GEJUGEM  WPF HTCP\ÌUKUEJG 'KPHWJTRWP\G XQP  DKU   

5EJYCPGPRWP\G $#491/#4-C<'+ ++++8 -CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP$TWUVUVGTP\WO-QOVWTMTGW\ OKV5VGTP /QFGNN

 5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGP)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG \GKEJPWPIFGT(KTOC8KPE/C[GT U5ÌJPGKP9KGPCP0CFGNFKGUGOKV&QRRGN#2WP\GKOQTKIKPCNGP IQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK$#491/#4-E<'+ +

8667





138

8666 (1:1)





8668

-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\ ,QUGRJ1TFGP -QOVWTMTGW\ )QNF GOCKNNKGTV  I /GFCKNNQP   CWH FGT 4ÒEMUGKVG \W ÌHHPGP KO 6TCIGTKPI 2WP\G 8/ FGT (KTOC 8KPE /C[GT U 5ÌJPG KP 9KGP   )GOUMQRHRWP\G HÒT GT )QNF   CO QTKIKPCNGP *CNUDCPF $#491  /#4- E   <'+ +p++



-CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP-QOVWTMTGW\)QNFGOCKNNKGTVIPCJG\WXQNN UV·PFKIGT'OCKNNGCWUDTWEJCWHFGT8QTFGTUGKVGFGUWPVGTGP-TGW\CTOGU/GFCKNNQPCWHFGT4ÒEMUGKVG\W ÌHHPGPFTGJDCT-TGW\EJGPFGT-TQPGCDIGDTQEJGPKO6TCIGTKPI2WP\G)4HÒT)GDTÒFGT4GUEJ )GOUMQRHRWP\GHÒTGT)QNF  WPFHTCP\ÌUKUEJG'KPHWJTRWP\GUGKV 7JW OKV*CNU DCPFCDUEJPKVV$#491/#4-E<'+ +++




ÖSTERREICH

8671

8673

8674

8669

8672

8679

8675 8677



8678

-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\ ,QUGRJ1TFGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV /GFCKNNQPU )QNF   GOCKNNKGTVKPFGT¤UGHTCP\ÌUKUEJGGT5KNDGTRWP\GXQPDKU 9KNFUEJYGKPMQRH COPGWGP $CPF<'+ 4++



-CKUGTNKEJ¤UVGTTGKEJKUEJGT(TCP\,QUGRJ1TFGP)TQ­G8GTNGKJWPIUWTMWPFG\WO4KVVGTMTGW\HÒTFGP 1DGTXGTYCNVGT  -NCUUG WPF 9KTVUEJCHVUTCV FGT MCKUGTNKEJGP 2TKXCV WPF (COKNKGPHQPF KP 6GPE  

6CEJNQYKE 4QUCO9GP\GNFCVKGTV9KGPCO/CKOKVITQ­GO2T·IGUKGIGNWPF7PVGTUEJTKHV -CKUGT (TCP\ ,QUGRJU OGJTHCEJ IGHCNVGV WPF VGKNYGKUG CP FGP (CNVWPIUMTGW\WPIGP GVYCU GKPIGTKUUGP   ++p





-CKUGTNKEJ¤UVGTTGKEJKUEJGT (TCP\ ,QUGRJ1TFGP /KPKCVWTGPMGVVEJGP \WO 4KVVGTMTGW\ )QNF   VGKNYGKUGGOCKNNKGTVI +p++





*QEJCFGNKIGT 5VGTPMTGW\1TFGP 5COONGTCPHGTVKIWPI FGT 1TFGPUFGMQTCVKQP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVGKPKIGQDGTHN·EJNKEJG%JKRUKPFGTDNCWGP'OCKNNGCP&COGPUEJNGKHG ++p



/KNKV·T8GTFKGPUVMTGW\ -TGW\  -NCUUG QJPG -TKGIUFGMQTCVKQP  5KNDGT GOCKNNKGTV KP FGT ¤UG   OGJTHCEJ RWP\KGTV W C OKV 8/ HÒT FKG (KTOC 8KPE /C[GT U 5ÌJPG KP 9KGP  CO CNVGP &TGK   GEMUDCPF ++



/KNKV·T8GTFKGPUVMTGW\ -TGW\  -NCUUG QJPG -TKGIUFGMQTCVKQP 5KNDGTPKEJVRWP\KGTV  GOCKNNKGTV QDGTHN·EJNKEJGT 'OCKNNGEJKR KO /GFCKNNQPTKPI CWH FGT 4ÒEMUGKVG 9KFOWPIUITCXWT &'/   -#/'4#&'0&#51((+<+'45-1425&'5-W-+0(#06'4+'4')+/'065)4#(XQP.#%; 0Q014&)4722'QJPG$CPF 4++



*KGTDGKJCPFGNVGUUKEJWOGKPGUGNVGPG·W­GTUVSWCNKV·VUXQNNGHTCP\ÌUKUEJG#PHGTVKIWPIXQPXQT



+ORQUCPVG7TMWPFG

5GJTUEJÌPG#PHGTVKIWPICWUFGT<YGKVGP*·NHVGFGU<YCP\KIUVGP,CJTJWPFGTVU







/KNKV·T8GTFKGPUVMTGW\-TGW\-NCUUGOKVFGT-TKGIUFGMQTCVKQP5KNDGT-TKGIUFGMQTCVKQP)QNFRNCV VKGTVGOCKNNKGTVCWHFGT4ÒEMUGKVG/GFCKNNQPOKVITCXKGTVGO/ÒPEJPGT-KPFNQJPG$CPF 4++p





/KNKV·T8GTFKGPUVMTGW\ <YGK NGGTG 'VWKU \WO -TGW\  -NCUUG OKV FGT -TKGIUFGMQTCVKQP DGKFG XQP   4QVJGWPF0GHHGKP9KGPLGYGKNUOKVIQNFHCTDGPGT9KFOWPIUCWHUEJTKHV+JTGO-COGTCFGPFKG1HHK\KGTG FGT.WHVHCJTVTWRRGPWPF8QO1HHK\KGTUMQTRUFGUMWM+PHCPVGTKGTGIKOGPVU0TQ 5VÒEM++





'JTGP\GKEJGP XQO 4QVGP -TGW\ 'JTGP\GKEJGP  -NCUUG OKV -TKGIUFGMQTCVKQP 5KNDGT KP FGT ¤UG   OGJTHCEJRWP\KGTVQJPG$CPF/#4- ++





#TOGG-TGW\UQIGP-CPQPGPMTGW\$TQP\GXGTIQNFGVFWPMGNITÒPNCEMKGTVCOCNVGPLG FQEJPKEJV\GKVIGPÌUUKUEJGP$CPF p++





#TOGG-TGW\UQIGP-CPQPGPMTGW\$TQP\GXGTIQNFGVFWPMGNITÒPNCEMKGTVCOQTKIKPCNGP CNVGPWPF\GKVIGPÌUUKUEJGP$CPF 4+p++



1TKIKPCNGUWPFYQJNPKEJVPCEJNCEMKGTVGU'ZGORNCTKPUGNVGPIWVGT'TJCNVWPI

139


ÖSTERREICH

8682 (1:2)

8681

8680 (1:2)



6CRHGTMGKVUOGFCKNNG  /QFGNN OKV FGO 2QTVTCKV -CKUGT -CTNU    5KNDGTPG /GFCKNNG HÒT   1HHK\KGTG5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT-#765%*KO4CPFRWP\KGTV#CO&TGKGEMUDCPFOKV CWHIGNGIVGO- ++





/KNKV·TFKGPUV\GKEJGP HÒT 1HHK\KGTG  /QFGNN   -TGW\  -NCUUG HÒT  CD  HÒT    &KGPUVLCJTG $TQP\GXGTIQNFGVVGKNYGKUGGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF/#4- ++





-COOGTJGTTGP5EJNÒUUGN /QFGNN FGT 4GIKGTWPIU\GKV -CKUGT (TCP\ + QFGT -CKUGT (GTFKPCPFU +   $TQP\GITCXKGTVWPFXGTIQNFGV ++



8683 (1:2)











140

8684 (1:2)

)TQ­G 1TFGPUUEJPCNNG OKV CEJV #WU\GKEJPWPIGP   5KIPWO .CWFKU KP $TQP\G CO -TKGIUDCPF     5KIPWO.CWFKUKP$TQP\GCO(TKGFGPUDCPF -CTNU6TWRRGPMTGW\ -TKGIUOGFCKNNG 5KIPWO /GOQTKCG ,WDKN·WOUMTGW\HÒTFKG$GYCHHPGVG/CEJV /QDKNKUCVKQPUMTGW\ #WUHÒJTWPIOKVGTJCDGPGP,CJTGU\CJNGP$CPF\GTUEJNKUUGP 1HHK\KGTU&KGPUVCWU\GKEJPWPI/QFGNN

 -TGW\-NCUUGHÒT&KGPUVLCJTGCOWPMQTTGMVGP$CPF#WHFGT4ÒEMUGKVG\YGK*CMGP \WO'KPJ·PIGP 5VÒEM++++p+++



)TQ­G ÌUVGTTGKEJKUEJG 1TFGPUUEJPCNNG OKV CEJV #WU\GKEJPWPIGP   6CRHGTMGKVUOGFCKNNG  /QFGNN  

OKVFGO2QTVTCKV-CKUGT-CTNU  )TQ­G 5KNDGTPG/GFCKNNG-NCUUG-TKGIUOGVCNNQJPG 5VGORGNUEJPGKFGT 8GTUKNDGTWPI XGTICPIGP CO PKEJV QTKIKPCNGP &TGKGEMUDCPF   6CRHGTMGKVUOGFCKNNG    /QFGNN OKV FGO 2QTVTCKV -CKUGT -CTNU    5KNDGTPG /GFCKNNG 5KNDGT OKV 5VGORGN   UEJPGKFGTUKIPCVWT -#765%*   2TGW­GP 'KUGTPGU -TGW\   -NCUUG   6CRHGTMGKVUOGFCKNNG    /QFGNN OKV FGO 2QTVTCKV -CKUGT -CTNU    $TQP\GPG /GFCKNNG $TQP\G OKV 5VGORGN   UEJPGKFGTUKIPCVWT -#765%*   8GTYWPFGVGPOGFCKNNG CO $CPF HÒT GKPG 8GTYWPFWPI   -CTNU   6TWRRGPMTGW\   9GNVMTKGIU'TKPPGTWPIUOGFCKNNG  OKV 5EJYGTVGTP   7PICTP 7PICTKUEJG    9GNVMTKGIU'TKPPGTWPIUOGFCKNNGOKV*GNOWPF5EJYGTVGTP#P0CFGN 5VÒEM++



-QPXQNWV XQP  MCKUGTNKEJGP #WU\GKEJPWPIGP &CTWPVGT GKP /KNKV·T8GTFKGPUVMTGW\  -NCUUG OKV   -TKGIUFGMQTCVKQP GKP 5KNDGTPGU8GTFKGPUVMTGW\FTGKITQ­GWPFHÒPHMNGKPG6CRHGTMGKVUOGFCKNNGP\YGK UKNDGTPGWPF\YGKDTQP\GPG5KIPWO.CWFKUKPXGTUEJKGFGPGP/GVCNNGPPGWPKP5KNDGTKPWPVGTUEJKGFNK EJGP'TJCNVWPIGPITÌ­VGPVGKNUCP&TGKGEMUD·PFGTPGKPG#WU\GKEJPWPIKO'VWK 5VÒEM++++p+++



-QPXQNWV XQP UKGDGP #WU\GKEJPWPIGP 7 C \YGK /KNKV·T8GTFKGPUVMTGW\G  -NCUUG OKV FGT   -TKGIUFGMQTCVKQP LGYGKNU KP 'VWKU  8GTUEJKGFGPG /GVCNNG VGKNU XGTIQNFGV VGKNU GOCKNNKGTV VGKNU CP   $·PFGTP&C\WGKPYGKVGTGUNGGTGU'VWKWPFXKGT-NGKPVGKNG 5VÒEM++



-QPXQNWV XQP HÒPH XGTUEJKGFGPGP 'JTGP\GKEJGP &CTWPVGT /KNKV·T8GTFKGPUVMTGW\  -NCUUG OKV   -TKGIUFGMQTCVKQPWPF5EJYGTVGTPWPF'JTGP\GKEJGPXQO4QVGP-TGW\-NCUUGOKV-TKGIUFGMQTCVKQP +P WPVGTUEJKGFNKEJGP /GVCNNGP FCXQP FTGK KP 5KNDGT VGKNU GOCKNNKGTV CP $·PFGTP &C\W (·NUEJWPI     FGT /KNKV·T8GTFKGPUVOGFCKNNG FGU 5V·PFGUVCCVGU WPF WPICTKUEJGU 5KIPWO .CWFKU CP &TGKGEMUD·PFGTP   5VÒEM++




ÖSTERREICH

8688 (1:1)

'456' 4'27$.+-   

'JTGP\GKEJGP HÒT 8GTFKGPUVG WO FKG 4GRWDNKM ¤UVGTTGKEJ   D\Y ¤UVGTTGKEJKUEJGT 8GT   FKGPUVQTFGP   'TUVGU /QFGNN  DKU  D\Y   5GV FGU )TQ­GP )QNFGPGP   'JTGP\GKEJGPU CO $CPFG D\Y FGU )TQ­MTGW\GU  -NCUUG DGUVGJGPF CWU -NGKPQF $TQP\G XGTIQNFGV   WPF TQV GOCKNNKGTV QJPG 5EJWNVGTDCPF WPF $TWUVUVGTP  /QFGNN   5KNDGT DTKNNCPVKGTV WPF   TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF TQV GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   %(4QVJG0GHHGKP9KGPCP0CFGN<'+ 5VÒEM+p++  &KGUG5VWHGKUVNCWV5EJOKFV KP5%*/45HH KPFKGUGT(QTOOCNCP¤UVGTTGKEJGTWPFECOCNCP#WU N·PFGTXGTNKGJGPYQTFGP   0CEJFGO OKV )GUGV\ XQO  #RTKN  XGTÌHHGPVNKEJV KO 5VCCVU)GUGV\DNCVV 0T   CNNG YGNVNKEJGP 4KVVGT WPF   &COGPQTFGP FGU -CKUGTTGKEJU  CWHIGJQDGP YQTFGP YCTGP YWTFG FCU 'JTGP\GKEJGP CO  0QXGODGT  XQO   ¤UVGTTGKEJKUEJGP 0CVKQPCNTCV RGT )GUGV\ XGTÌHHGPVNKEJV KO $WPFGUIGUGV\DNCVV 0T  XQP   IGUVKHVGV FCU 5VCVWV   XQO(GDTWCTYWTFGKO$WPFGUIGUGV\DNCVV0TXQPXGTÌHHGPVNKEJV#O/·T\GTNKG­FKG ÌUVGTTGKEJKUEJG $WPFGUTGIKGTWPI GKPG 8GTQTFPWPI ÒDGT GKP PGWGU 5VCVWV XGTÌHHGPVNKEJV KO $WPFGUIGUGV\DNCVV 0T    XQP   &KGUGO \WHQNIG YWTFG FCU 'JTGP\GKEJGP KP  )TCFGP )TQ­UVGTP )TQ­GU )QNFGPGU 'JTGP\GKEJGP CO   $CPFG )TQ­GU )QNFGPGU 'JTGP\GKEJGP OKV FGO 5VGTP )TQ­GU )QNFGPGU 'JTGP\GKEJGP )TQ­GU 5KNDGTPGU    'JTGP\GKEJGP )QNFGPGU 'JTGP\GKEJGP 5KNDGTPGU 'JTGP\GKEJGP )QNFGPG /GFCKNNG )TQ­G 5KNDGTPG /GFCKNNG WPF   5KNDGTPG /GFCKNNG  XGTNKGJGP /KV 8GTQTFPWPI FGT $WPFGUTGIKGTWPI XQO  #RTKN  XGTÌHHGPVNKEJV KO   $WPFGUIGUGV\DNCVV 0T  XQP   YWTFG FGP $TWUVUVGTPGP GKPG PGWG OGJT VTCFKVKQPGNNGTG (QTO IGIGDGP    #WUICDG WPFOKV8GTQTFPWPIFGU$WPFGUTGIKGTWPIXQO1MVQDGT XGTÌHHGPVNKEJVKO$WPFGUIGUGV\DNCVV0T  XQP   GTJKGNV CWEJ FCU )TQ­G 5KNDGTPG 'JTGP\GKEJGP GKPG PGWG )GUVCNVWPI  #WUICDG  /KV 8GTQTFPWPI   FGT $WPFGUTGIKGTWPI XQO  /CK  XGTÌHHGPVNKEJV KO $WPFGUIGUGV\DNCVV 0T  XQP   YWTFGP FTGK   YGKVGTG)TCFGIGUEJCHHGP )TQ­GU'JTGP\GKEJGPCO$CPFG)TQ­GU'JTGP\GKEJGPOKVFGO5VGTPWPFITQ­GU5KNDGT PGU 'JTGP\GKEJGP  YQDGK FCU DKUJGTKIG )TQ­G 'JTGP\GKEJGP CNUQ FKG 5VGEMFGMQTCVKQP  KP )TQ­GU 5KNDGTPGU 'JTGP   \GKEJGP WODGPCPPV YWTFG WPF FGUUGP $G\GKEJPWPI GKPGO PGWGP )TCF IGIGDGP YWTFG /KV 8GTQTFPWPI XQO    ,WPK  XGTÌHHGPVNKEJV KO $WPFGUIGUGV\DNCVV 0T  XQP   UEJWH FKG $WPFGUTGIKGTWPI YGKVGTG FTGK )TCFG  

)QNFGPGU 8GTFKGPUV\GKEJGP 5KNDGTPGU 8GTFKGPUV\GKEJGP WPF FKG $TQP\GPG /GFCKNNG  /KV 8GTQTFPWPI FGT $WPFGU   TGIKGTWPI XQO  /·T\  XGTÌHHGPVNKEJV KO $WPFGUIGUGV\DNCVV 0T  XQP   YWTFGP PWP CNNG FKGUG 'TI·P   \WPIGP \W GKPGO PGWGP 5VCVWV \WUCOOGPIGHC­V 0CEJFGO OKV FGT PGWGP 8GTHCUUWPI XQO  /CK  ¤UVGTTGKEJ   \WO$WPFGUUVCCV CWEJCNUō5V·PFGUVCCVŋDG\GKEJPGV IGYQTFGPYCTUVKHVGVGFKG$WPFGUTGIKGTWPICO5GRVGODGT  FGP ¤UVGTTGKEJKUEJGP 8GTFKGPUVQTFGP UQYKG FKG FKGUGO CHHKNKKGTVGP ¤UVGTTGKEJKUEJGP 8GTFKGPUVMTGW\G WPF   ¤UVGTTGKEJKUEJGP8GTFKGPUVOGFCKNNGPWPVGT#WHJGDWPIFGUDKUJGTKIGP'JTGP\GKEJGPUHÒT8GTFKGPUVWOFKG4GRWDNKM ¤UVGTTGKEJ &GT PGWG 1TFGP JCVVG KPUIGUCOV  -NCUUGP )TQ­UVGTP )TQ­MTGW\ + -NCUUG WPF )TQ­MTGW\ -QOVWT   MTGW\OKVFGO5VGTPWPF-QOVWTMTGW\OKVFGO5VGTP-QOVWTMTGW\+-NCUUGWPF-QOVWTMTGW\1HHK\KGTUMTGW\ 4KVVGTMTGW\ + -NCUUG WPF 4KVVGTMTGW\  FCU 8GTFKGPUV\GKEJGP \YGK )QNFGPGU WPF 5KNDGTPGU 8GTFKGPUV\GKEJGP  WPF   FKG 8GTFKGPUVOGFCKNNG XKGT -NCUUGP )QNFGPG )TQ­G 5KNDGTPG 5KNDGTPG WPF $TQP\GPG 8GTFKGPUVOGFCKNNG  &KG   )GUVCNVWPI FGT +PUKIPKGP FGU PGWGP 1TFGPU GPVURTCEJ FGT FGU DKUJGTKIGP 'JTGP\GKEJGPU /KV 8GTQTFPWPI FGT $WP   FGUTGIKGTWPI XQO  #WIWUV  XGTÌHHGPVNKEJVKO$WPFGUIGUGV\DNCVV0TXQP YWTFGUEJNKG­NKEJPQEJ ÒDGT FGO )TQ­MTGW\ + -NCUUG FKG -NCUUG FGU )TQ­MTGW\GU + -NCUUG OKV FGO #FNGT GKPIGHÒIV /KV FGO UQIGP   #PUEJNW­ ¤UVGTTGKEJU CP FCU &GWVUEJG 4GKEJ CO  /·T\  YWTFGP FKG 8GTNGKJWPIGP FGU ¤UVGTTGKEJKUEJGP   8GTFKGPUVQTFGPU FGU ¤UVGTTGKEJKUEJGP 8GTFKGPUVMTGW\GU WPF FGT ¤UVGTTGKEJKUEJGP 8GTFKGPUVOGFCKNNG GKPIGUVGNNV +O   PGWGPō)TQ­FGWVUEJGP4GKEJŋYCTFCU6TCIGPU·OVNKEJGT+PUKIPKGPUQYQJNFGU'JTGP\GKEJGPUHÒT8GTFKGPUVGWOFKG 4GRWDNKM¤UVGTTGKEJYKGCWEJFGU¤UVGTTGKEJKUEJGP8GTFKGPUVQTFGPFGU¤UVGTTGKEJKUEJGP8GTFKGPUV\GKEJGPUWPFFGT ¤UVGTTGKEJKUEJGP8GTFKGPUVOGFCKNNGIGPGTGNNXGTDQVGP

141


ÖSTERREICH

8689



8690

8691

8689

'JTGP\GKEJGPHÒT8GTFKGPUVGWOFKG4GRWDNKM¤UVGTTGKEJ  D\Y¤UVGTTGKEJKUEJGT8GTFKGPUV QTFGP  'TUVGU/QFGNN DKUD\Y )TQ­GU5KNDGTPGU'JTGP\GKEJGP #WU ICDG 5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN/#4-<'+ ++

&KGUGKP5COONGTMTGKUGPQHVGKPYGPKITGURGMVNQUCNU2CNOYGFGNDG\GKEJPGVG5VGEMFGMQTCVKQPKUVXQPITQ­GT5GNVGP JGKV/KV8GTQTFPWPIFGU$WPFGUTGIKGTWPIXQO1MVQDGT XGTÌHHGPVNKEJVKO$WPFGUIGUGV\DNCVV0TXQP  GTJKGNVFCU)TQ­G5KNDGTPG'JTGP\GKEJGPGKPGPGWG)GUVCNVWPI #WUICDG 





'JTGP\GKEJGP HÒT 8GTFKGPUVG WO FKG 4GRWDNKM ¤UVGTTGKEJ   D\Y ¤UVGTTGKEJKUEJGT 8GT   FKGPUVQTFGP   'TUVGU /QFGNN  DKU  D\Y )QNFGPGU'JTGP\GKEJGPHÒT8GT FKGPUVG   D\Y 4KVVGTMTGW\  -NCUUG   $TQP\G XGTIQNFGV WPF TQV GOCKNNKGTV CO   QTKIKPCNGPGVYCUXGTUEJOWV\VGP&TGKGEMUDCPF<'+ ++ 'JTGP\GKEJGP HÒT 8GTFKGPUVG WO FKG 4GRWDNKM ¤UVGTTGKEJ   D\Y ¤UVGTTGKEJKUEJGT 8GT   FKGPUVQTFGP   'TUVGU /QFGNN  DKU  D\Y )QNFGPGU'JTGP\GKEJGPHÒT8GT FKGPUVG   D\Y 4KVVGTMTGW\  -NCUUG   $TQP\G XGTIQNFGV WPF TQV GOCKNNKGTV CO   QTKIKPCNGP&TGKGEMUDCPF<'+ ++







8692

8693

560&'56##6   

*GKOYGJT'JTGP\GKEJGP UQIGP5VCTJGODGTIXQIGN $TQP\GXGTUKNDGTVCO$CPFOKVFGT,W NKURCPIG ++



<9'+6' 4'27$.+- 5'+6  

'JTGP\GKEJGPHÒT8GTFKGPUVGWOFKG4GRWDNKM¤UVGTTGKEJ/QFGNN UGKV 5GVFGU)TQ­GP)QN FGPGP 'JTGP\GKEJGPU CO $CPFG DGUVGJGPF CWU -NGKPQF XGTIQNFGV WPF DGKFUGKVKI GOCKNNKGTV CO QTKIK   PCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI FGT (KTOC #PVQP 4GKVVGTGT KP 9KGP CP 0CFGN FKGUG OGJTHCEJ RWP\KGTV W C 5KNDGTRWP\G  WPF   *GTUVGNNGTRWP\G #4  \WUCOOGP OKV -PQRHNQEJTQUGVVG WPF OCUEJKPGPIGUEJTKGDGPGP 0QVK\\GVVGN OKV   'TUVGT *QHOCTUEJCNN 9'66'4 KO QTKIKPCNGP XQTPG CDIGTWPFGVGP 8GTNGKJWPIUGVWK FGT (KTOC 4GKVVGTGT   OKVIQNFHCTDGPGO9CRRGP<'+ 5VÒEM+ 5XGP 'TKM 9GVVGT 'TUVGT *QHOCTUEJCNN WPF #FLWVCPV -ÌPKI )WUVCX 8+ #FQNH XQP 5EJYGFGP JCV NCWV 5EJOKFV KP   5%*/45 FCU)TQ­G)QNFGPG'JTGP\GKEJGPCO$CPFCO/·T\XGTNKGJGPDGMQOOGP  #O#RTKNUVKHVGVGFGT¤UVGTTGKEJKUEJG0CVKQPCNTCVOKV)GUGV\FCU'JTGP\GKEJGPPCEJFGO8QTDKNFFGT'TUVGP 4GRWDNKM 'U WOHCUUV KPUIGUCOV  5VWHGP GKPUEJNKG­NKEJ GKPGU \YGKUVWHKIGP 8GTFKGPUV\GKEJGPU WPF GKPGT    FTGKUVWHKIGP/GFCKNNG 

142




Ã&#x2013;STERREICH

8695

8694





'JTGP\GKEJGPHÃ&#x2019;T8GTFKGPUVGWOFKG4GRWDNKM¤UVGTTGKEJ/QFGNN UGKV 5GVFGU)TQ­GP)QN FGPGP 'JTGP\GKEJGPU CO $CPFG DGUVGJGPF CWU -NGKPQF XGTIQNFGV WPF DGKFUGKVKI GOCKNNKGTV CO   QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC#PVQP4GKVVGTGTKP9KGPCP0CFGN\WUCOOGPOKV-PQRHNQEJTQUGVVGKO QTKIKPCNGP TGEJVGEMKIGP 8GTNGKJWPIUGVWK FGT (KTOC 4GKVVGTGT OKV IQNFHCTDGPGO 9CRRGP <'+     5VÃ&#x2019;EM+



¤UVGTTGKEJKUEJGU'JTGP\GKEJGPHÃ&#x2019;T-WPUVWPF9KUUGPUEJCHV$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT 4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC#4GKVVGTGTKP9KGPCO*CNUDCPFCDUEJPKVV5%*/4 <'+ 4++



.CWV1JO*KGTQP[OWUUGPKP*'1KUVFCU'JTGP\GKEJGP'KIGPVWOFGU5VCCVGUWPFOWUUPCEJFGO6QFFGU$GNKGJG PGP \WTÃ&#x2019;EMIGIGDGP YGTFGP 5EJOKFV IKDV KP 5%*/4 DKU 'PFG  GKP 8GTNGKJWPIU\CJN XQP KPUIGUCOV PWT    8GTNGKJWPIGPFCXQPCP#WUN·PFGTCP

8696

8698 8697







¤UVGTTGKEJKUEJGU 'JTGPMTGW\ HÃ&#x2019;T -WPUV WPF 9KUUGPUEJCHV 'JTGPMTGW\  -NCUUG $TQP\G XGTIQNFGV   WPF GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC # 4GKVVGTGT KP 9KGP CP 0CFGN   5%*/4<'+ 4+p++



'JTGP\GKEJGP HÃ&#x2019;T 8GTFKGPUVG WO FKG 4GRWDNKM ¤UVGTTGKEJ  /QFGNN UGKV   )TQ­GU 5KNDGTPGU   'JTGP\GKEJGP XGTUKNDGTV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF \WUCOOGP OKV -PQRHNQEJTQUGVVG KO   QTKIKPCNGP XQTPG CDIGTWPFGVGP 8GTNGKJWPIUGVWK FGT (KTOC #PVQP 4GKVVGTGT KP 9KGP OKV IQNFHCTDGPGO   9CRRGP <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÃ&#x2019;T FGP   1DGTTGIKGTWPIUTCVKO$WPFGURT·UKFKCNCOV*GNOWV/Ã&#x2019;NNGTFCVKGTV$QPPCO/·T\WPF2JQVQMQ RKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /Ã&#x2019;NNGT XGTNKGJGPGP 1TFGP OKV LGYGKNKIGO   8GTNGKJWPIULCJT<'+ ++



'JTGP\GKEJGP HÃ&#x2019;T 8GTFKGPUVG WO FKG 4GRWDNKM ¤UVGTTGKEJ )TQ­GU 'JTGP\GKEJGP $TWUVUVGEMMTGW\    XGTUKNDGTVGVYCUDGTKGDGPGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC#4GKVVGTGTKP 9KGPCP0CFGN<'+ ++

 143


POLEN

8701 8699

¤56'44'+%*$70&'5.#0&0+'&'4¤56'44'+%* 

'JTGP\GKEJGPHÒT8GTFKGPUVGWOFCU$WPFGUNCPF0KGFGTÌUVGTTGKEJ)QNFGPGU-QOVWTMTGW\$TQP\G XGTIQNFGVVGKNYGKUGGOCKNNKGTVCO*CNUDCPFCDUEJPKVV5%*/4<'+ ++



)GUVKHVGVOKV.CPFGUIGUGV\XQO/·T\XGTÌHHGPVNKEJVKO.)$N0TWPF8GTQTFPWPIXQO#RTKN  XGTÌHHGPVNKEJV KO .)$N 0T  CNU \WP·EJUV PGWPUVWHKIGU GKPUEJNKG­NKEJ FGT FTGKUVWHKIGP /GFCKNNG    'JTGP\GKEJGP 'TYGKVGTV CWH KPUIGUCOV  5VWHGP )QNF D\Y 5KND -QOVWTMTGW\ OKV 5VGTP )QNF D\Y 5KND   -QOVWTMTGW\)TQ­GU)QNFD\Y5KND'JTGP\GKEJGP)QNFD\Y5KNDD\Y$TQP\'JTGP\GKEJGPWPF)QNFD\Y 5KNDD\Y$TQP\GPG/GFCKNNG OKV8GTQTFPWPIXQO/CKXGTÌHHGPVNKEJVKO.)$N0T

21.'0 

2T·IGUVGORGNHÒTGKP#D\GKEJGPFGT,CIFCWHUGJGTFGU)TCHGP2TWEJPKEMK'KUGPECZEC ZECEOECMICWHFGO4CPFGKPIGUEJNCIGP24#6 ++



'456' 4'27$.+-   

1TFGP2QNQPKC4GUVKVWVC/QFGNN CWHFGT4ÒEMUGKVGWPFJKPVGPCDIGTWPFGVG-TGW\CTOG   )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGT   DCPFWPF$TWUVUVGTP$TQP\GXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<'+ 5VÒEM++

8703



8702



8703

1TFGP2QNQPKC4GUVKVWVC/QFGNN  $TWUVUVGTP\WO)TQ­QHHK\KGT5KNDGTVGKNYGKUGXGTIQN FGV WPF GOCKNNKGTV MCWO UKEJVDCTGT 5RTWPI KP FGT DNCWGP 'OCKNNG CWH FGT 4ÒEMUGKVG 5KNDGTRWP\G HÒT   GT 5KNDGT WPF *GTUVGNNGTRWP\G )9 CP 0CFGN FKGU GDGPHCNNU OKV *GTUVGNNGTRWP\G )9 WPF GKPG   YGKVGTGWPNGUGTNKEJG2WP\GOKV\YGK5GKVGPJCMGP<'+ ++



&GT $TWUVUVGTP \WO )TQ­QHHK\KGT JCV GKPGP UKNDGTHCTDGPGP /GFCKNNQPTKPI FGT $TWUVUVGTP \WO )TQ­MTGW\ JKPIGIGP   GKPGPIQNFHCTDGPGP



144

1TFGP2QNQPKC4GUVKVWVC/QFGNN CWHFGT4ÒEMUGKVGWPFJKPVGPCDIGTWPFGVG-TGW\CTOG   -QOOCPFGWTMTGW\ 5KNDGT   XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF KO QTKIKPCNGP   IQNFDGFTWEMVGP8GTNGKJWPIUGVWK<'+ ++




PORTUGAL

8704 8705 8706

8708



6CRHGTMGKVUMTGW\ FGU )GPGTCNU $WNCM$CNCEJQYKVUEJ 1TKIKPCNCWUHÒJTWPI 5KNDGT GOCKNNKGTV CWH FGT   4ÒEMUGKVGPWOOGTKGTVCOQTKIKPCNGP$CPF56'.#5HH9'5XCT ++





6CRHGTMGKVUMTGW\ FGU )GPGTCNU $WNCM$CNCEJQYKVUEJ 5R·VGTG #WUHÒJTWPI $TQP\G XGTUKNDGTV WPF   GOCKNNKGTVOKP'OCKNNGEJKRCO4CPFFGUWPVGTGP-TGW\CTOGUCOWPMQTTGMVGPUR·VGTGP$CPF56'.# 5HH9'5XCT ++ 'JTGPMTGW\<C9UMT\GU\GPKG/QPCTEJKK$TQP\GJQJNIGRT·IVGOCKNNKGTVCO$CPF ++

 

-QPXQNWV XQP  XGTUEJKGFGPGP 4GIKOGPVU WPF UQPUVKIGP #D\GKEJGP 8GTUEJKGFGPG /GVCNNG VGKNU   GOCKNNKGTVITÌ­VGPVGKNUCP5EJTCWDGPOKV5EJTCWDUEJGKDGPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP  5VÒEM++++p+++



 

#WHITWPF GZKUVKGTGPFGP ITQ­GP (·NUEJWPIURTQDNGOCVKM MCPP HÒT FKGUG 'ZGORNCTG NGKFGT MGKPG )GY·JT HÒT 1TKIKPC   NKV·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQT FGT#WMVKQPCWHOGTMUCOIGOCEJV

81.-54'27$.+-  



1TFGP FGT 'TDCWGT FGT 8QNMUTGRWDNKM 2QNGP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP $CPF   <'+ ++





-QPXQNWVXQP#D\GKEJGPXGTUEJKGFGPG/GVCNNGITÌ­VGPVGKNUGOCKNNKGTVKPWPVGTUEJKGFNKEJGP'TJCN VWPIGPITÌ­VGPVGKNUCP5EJTCWDGPWPF5EJTCWDUEJGKDG 5VÒEM++



8710 8711 (1:2)

&4+66' 4'27$.+- 5'+6  

1TFGPXQO9GK­GP#FNGT/QFGNN UGKV 1TFGPUUGVDGUVGJGPFCWU-NGKPQF$TQP\GXGTIQNFGV WPF GOCKNNKGTV 'OCKNNGUEJ·FGP CWH \YGK -TGW\CTOGP CO 5EJWNVGTDCPF WPF $TWUVUVGTP $TQP\G   XGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<'+XIN 5VÒEM++

-¤0+)4'+%* $+5  



21467)#.

/KNKV·TKUEJGT 1TFGPXQO6WTOWPF5EJYGTV/QFGNN  (·NUEJWPI  FGU$TWUVUVGTPU \WO)TQ­MTGW\5KNDGTITCXKGTVVGKNYGKUGXGTIQNFGVCWHFGT4ÒEMUGKVGITCXKGTVOKV¤UGP\WO #PP·JGPCPFGP5RKV\GP ++

&KGUG CNU 6TKIWGKTQU(·NUEJWPIGP DGMCPPV IGYQTFGPGP 5VÒEMG YWTFGP KP FGP GT ,CJTGP XQP FGO GJGOCNKIGP   &KTGMVQT FGT UVCCVNKEJGP /ÒP\G KP .KUUCDQP #PVÉPKQ / 6TKIWGKTQU JGTIGUVGNNV WPF VGKNYGKUG WPVGT TCHHKPKGTVGO   /KUUDTCWEJ FGU 8GTVTCWGPU OGJTGTGT DGFGWVGPFGT 5COONGT WPF 2JCNGTKUVKMGT YGNVYGKV XGTVTKGDGP 0CEJFGO Y·J   TGPF GKPGT ,CJTGUXGTUCOONWPI %QPXGPVKQP  FGT 1TFGTU CPF /GFCNU 5QEKGV[ QH #OGTKEC 1/5#  FKG (·NUEJWPIGP   CNU UQNEJG GTMCPPV YQTFGP UKPF KUV 6TKGIWGKTQU YGIGP WPYÒTFKIGO 8GTJCNVGPU CWU FGO 8GTGKP CWUIGUEJNQUUGP   YQTFGP



145


PORTUGAL

8712 8713





/KNKV·TKUEJGT1TFGPXQO6WTOWPF5EJYGTV  D\YFGT5GJT#NVGWPF5GJT'FNGT1TFGP XQO6WTOWPF5EJYGTVHÒT6CRHGTMGKV6TGWGWPF8GTFKGPUV  D\Y1TFGPXQO6WTO WPF 5EJYGTV UGKV    /QFGNN   -NGKPQF \WT -QNNCPG FGT 4KVVGT  Z  OO   5KNDGT /GFCKNNQPU #WHJ·PIWPI WPF 4KPI )QNF GOCKNNKGTV KO TÒEMUGKVKIGP /GFCKNNQPTKPI \YGK MNGKPG   'OCKNNGCWUDTÒEJG +++p



/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUW%JTKUVWU DKU D\Y%JTKUVWU1TFGP/QFGNN    $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP VNY )QNF GOCKNNKGTV   HGKPUVG'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVG*GTUVGNNGTITCXWT*WPV4QUMGNNNCVG5VQTT/QTVKOGTCPF *WPV,GYGNNGTUVQVJG3WGGP0GY$QPF5VTGGV.QPFQPWPF2WP\G90CPGEJVIQNFGPGT 0CFGN 44+



W­GTUVSWCNKV·VUXQNNGDTKVKUEJG#PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU&KG(KTOC*WPV 4QUMGNN\QIIGO·­,CEQD KP,#%1$5WPF ECKPFKG0GY$QPF5VTGGVWPFHGTVKIVGFQTVDKU CNUFKG(KTOCXQP,9$GPUQPÒDGTPQOOGPYWTFG

8714



8715

/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUW%JTKUVWU DKU D\Y%JTKUVWU1TFGP/QFGNN    -QOOCPFGWTMTGW\ )QNF GOCKNNKGTV OKP MCWO UKEJVDCTG QDGTHN·EJNKEJG 'OCKNNGEJKRU CWH FGT   8QTFGTUGKVG ITÌ­GTGT QDGTHN·EJNKEJGT 'OCKNNGEJKR CWH FGT 4ÒEMUGKVG CO PGWGP NCPIGP VGKNU XGTMNGDVGP   $CPFCDUEJPKVV<'+ ++++p+++



/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUW%JTKUVWU DKU D\Y%JTKUVWU1TFGP/QFGNN   -QOOCPFGWTMTGW\KPFGTUQIGPCPPVGPOKNKV·TKUEJGP#WUHÒJTWPIZOO5KNDGTXGTIQN FGV <GPVTGP )QNF VGKNYGKUG GOCKNNKGTV GKPKIG OKP %JKRU WPF 4GRCTCVWTGPKPFGTYGK­GP'OCKNNGKO 4KPIÌUVGTTGKEJKUEJG9KGPGT+ORQTVRWP\GXQPDKUCOYQJNGVYCUUR·VGTGP*CNUDCPF<'+  ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T FCXQTGZ5COONWPI4QDGTV/E0COCTC%NGXGNCPF  .CWV 6TKIWGKTQU WPF 6COOCPP KP 64+)  JCPFGNV GU UKEJ JKGTDGK WO KPQHHK\KGNNG #WUHÒJTWPIGP HÒT    /KNKV·TCPIGJÌTKIGFKGCPFKGUGT)GUVCNVWPIOGJT)GHCNNGPIGHWPFGP\WJCDGPUEJGKPGPCNUCPFGTVTCFKVKQPGNNGPWPF UKEJFKGUGYQJNCWHGKIGPG4GEJPWPIDGUEJCHHVJ·VVGP,GFGPHCNNUYCTFKGUG(QTOFKGHÒTCNNG-NCUUGPXQTMQOOV\W MGKPGO <GKVRWPMV QHHK\KGNN FGPP YGFGT KP FGP 5VCVWVGP PQEJ KP FGP #TEJKXGP JCDGP UKEJ KTIGPFYGNEJG *KPYGKUG    FCHÒTHKPFGPNCUUGP

146


PORTUGAL

8718 (1:1)





8719

8717

8716

/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUW%JTKUVWU DKU D\Y%JTKUVWU1TFGP/QFGNN    4KVVGTMTGW\ OKV -TQPG CD   )QNF ITCXKGTV WPF GOCKNNKGTV FKG -TQPG 5KNDGT XGTIQNFGV CO   CNVGP1TKIKPCND·PFEJGP<'+ 44++



/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUW%JTKUVWU DKU D\Y%JTKUVWU1TFGP/QFGNN    4KVVGTMTGW\ KP FGT UQIGPCPPVGP OKNKV·TKUEJGP #WUHÒJTWPI 5KNDGT /GFCKNNQPU )QNF GOCKNNKGTV   OGJTGTGOKP'OCKNNGTGRCTCVWTGPCWH8QTFGTWPF4ÒEMUGKVGCOCNVGP$CPF<'+ ++p+++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  FCXQT GZ #WMVKQP 5VWMGT KP $GTP CO  0QXGODGT  0T    'U JCPFGNV UKEJ JKGTDGK WO GKPG UGJT   UGNVGPG8CTKCPVGKP5KNDGT WPFPKEJVKP5KNDGTXGTIQNFGV 





/KNKV·TKUEJGT1TFGPFGUJGKNKIGP,CMQDWUXQO5EJYGTV DKU D\Y1TFGPFGUJN,CMQDWUHÒT 8GTFKGPUVKP9KUUGPUEJCHV.KVGTCVWTWPF-WPUV/QFGNN  /KPKCVWTFGU4KVVGTMTGW\GU )QNFGOCKNNKGTVIOKPQDGTHN·EJNKEJG'OCKNNGEJKRUKPFGT5RKV\GCWHFGT4ÒEMUGKVGWPFOKV GKPGO2GPVCITCOORWP\KGTVCO$·PFEJGP 4++



1TFGPFGT'ORH·PIPKU7PUGTGT.KGDGP(TCWXQP8KEQUC4KVVGTFGMQTCVKQP5KNDGT/GFCKNNQPU)QNF

OGJTVGKNKI GOCKNNKGTVCOQTKIKPCNGPGVYCUCWIGDNGKEJVGP$CPF<'+ +p++



8720 8721 8722



7PDGMCPPVGU 1TFGPUMTGW\ +P )GUVCNV FGU -TGW\GU FGU 1TFGPU FGU JN $GPGFKMV XQP #XKU 5KNDGT   XGTIQNFGVLGFQEJTQVGOCKNNKGTV$CPFTKPIOKVHTCP\ÌUKUEJGT)CTCPVKGRWP\GXQPDKUHÒTGT 5KNDGT 9KNFUEJYGKPMQRH COPGWGP*CNUDCPFCDUEJPKVV ++



4'27$.+- 5'+6  

/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUW%JTKUVWU DKU D\Y%JTKUVWU1TFGP$TWUVUVGTP\WO )TQ­MTGW\WPF\WO)TQ­QHHK\KGT5KNDGTXGTIQNFGV-TGW\EJGP)QNFGOCKNNKGTVQDGTHN·EJNKEJG%JKRUKP FGT TQVGP 'OCKNNG CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC (TGFGTKEQ % FC %QUVC KP   .KUUCDQPCP0CFGN<'+ ++p



#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVU



/KNKV·TKUEJGT1TFGP7PUGTGU*GTTP,GUW%JTKUVWU DKU D\Y%JTKUVWU1TFGP/QFGNN UGKV  -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPF DGKFUGKVKI GOCKNNKGTVGKPG-TGW\CTOURKV\GOKPXGTDQ IGPMCWOUKEJVDCTG*CCTTKUUGKPFGTYGK­GP'OCKNNGFGT4ÒEMUGKVGCOMWT\GP*CNUDCPFCDUEJPKVV<'+  ++

 147


PORTUGAL

8723



8724

/KNKV·TKUEJGT1TFGPFGUJN$GPGFKMVXQP#XK\ DKU D\Y/KNKV·TKUEJGT#XK\1TFGP/QFGNN

UGKV )TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP5EJWN VGTDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV XGTIQNFGV VGKNYGKUG GOCKNNKGTV MNGKPGT 'OCKNNGCWUDTWEJ KO   -TGW\EJGP \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP WPF   -PQRHNQEJTQUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK XQP (TGFGTKEQ %QUVC KP .KUUCDQP OKV IQNFHCTDGPGO   5VCCVUYCRRGP<WUCOOGPOKVFGTQTKIKPCNGP8GTNGKJWPIUWTMWPFGHÒTFGP)GPGTCN/KEJGN/CTVKP.¾QP (QWTSWGVFCVKGTV5GRVGODGTOKV2T·IGUKGIGNWPF7PVGTUEJTKHVFGU1TFGPUMCP\NGTU<'+  5VÒEM44++++p+++ /KV8GTNGKJWPIUWTMWPFGPWTUGJTUGNVGP\WHKPFGP )GPGTCN(QWTSWGV  YCTXQPDKU)GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKVMT·HVG







/KNKV·TKUEJGT1TFGPFGUJN$GPGFKMVXQP#XK\ DKU D\Y/KNKV·TKUEJGT#XK\1TFGP/QFGNN

UGKV   -QOOCPFGWTMTGW\ #WUHÒJTWPI OKV DTGKV CWUIGHÒJTVGO $CPFTKPI 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCWHFGT4ÒEMUGKVGOKP'OCKNNGCDRNCV\WPICOQTKIKPCNGP*CNUDCPF<'+ ++++p+++



8726 8725 (1:1)

 

/KNKV·TKUEJGT1TFGPFGUJGKNKIGP,CMQDWUXQO5EJYGTV DKU D\Y1TFGPFGUJN,CMQDWUHÒT 8GTFKGPUV KP 9KUUGPUEJCHV .KVGTCVWT WPF -WPUV  /QFGNN UGKV   /KPKCVWT FGU -NGKPQFU FGT   )TQ­MQNNCPG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP 44+p++ 1TFGPFGU+PHCPVGP&QO*GPTKSWG=1TFGOFQ+PHCPVG&QO*GPTKSWG?-QOOCPFGWTUUGVDGUVGJGPF CWU -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV KP FGT ¤UG RWP\KGTV CO QTKIKPCNGP   WPIGVTCIGPGP *CNUDCPF WPF $TWUVUVGTP  /QFGNN QJPG GOCKNNKGTVG 5VTCJNGP  UGKV   5KNDGT   /GFCKNNQPXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGRWP\KGTV\WUCOOGPOKV/KPKCVWT5KNDGTXGTIQNFGV WPFGOCKNNKGTVCO$·PFEJGPKOQTKIKPCNGPDTCWPGP8GTNGKJWPIUGVWKFGT(KTOC(TGFGTKEQ%QUVC.FCKP .KUUCDQP<'+ 5VÒEM+p++ $GK FKGUGO 1TFGP YKTF KP FGT -QOOCPFGWTMNCUUG GDGPHCNNU GKP $TWUVUVGTP IGVTCIGP FGT $TWUVUVGTP \WT )TQ­QHHK   \KGTUMNCUUGKUVXQNNUV·PFKIXGTIQNFGVWPFGPVURTKEJVUQOKVFGOFGT)TQ­MTGW\MNCUUG    #WU #PNCUU FGU HÒPHJWPFGTVUVGP 6QFGUVCIGU XQP 2TKP\ *GKPTKEJ IGPCPPV FGT 5GGHCJTGT   UVKHVGVG    2T·UKFGPV#O¾TKEQ6QO±U  CO,WPKFGPUGEJUMNCUUKIGP )TQ­MQNNCPG)TQ­MTGW\)TQ­QHHK\KGT -QOOCPFGWT 1HHK\KGT WPF 4KVVGT D\Y &COG  ōPCVKQPCNŋ MCVGIQTKUKGTVGP 1TFGP OKV CHHKNKKGTVGT \YGKUVWHKIGT    /GFCKNNG 'T YKTF HÒT 8GTFKGPUVG WO 2QTVWICN WPF KP FGT 8GTDTGKVWPI FGT RQTVWIKGUKUEJGP -WNVWT )GUEJKEJVG WPF    9GTVG XGTNKGJGP 0KEJVMQOOGT\KGNNG +PUVKVWVKQPGP MÌPPGP 'JTGPOKVINKGFGT FGU 1TFGPU YGTFGP &KG 1TFGPUUVCVWVGP     GTHWJTGPWPFPFGTWPIGP

148






PORTUGAL

8727



1TFGPFGU+PHCPVGP&QO*GPTKSWG=1TFGOFQ+PHCPVG&QO*GPTKSWG?-QOOCPFGWTUUGVDGUVGJGPF CWU-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFCDUEJPKVVWPF$TWUVUVGTP#WU HÒJTWPI QJPG GOCKNNKGTVG 5VTCJNGP  5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV KO 0CFGNDQEM   *GTUVGNNGTDG\GKEJPWPI FGT (KTOC (TGFGTKEQ %QUVC .FC KP .KUUCDQP CP 0CFGN <'+     5VÒEM+p++



8729 (1:1)

8730

8728



.CPFYKTVUEJCHVU8GTFKGPUVQTFGP/QFGNN UGKV -QOOCPFGWTFGMQTCVKQP5KNDGTXGTIQNFGVWPF GOCKNNKGTVOKP'OCKNNGCDURNKVVGTWPIGPKO.QTDGGTMTCP\QJPG*CNUDCPF<'+ ++





+ORGTKWOU1TFGP/KPKCVWTFGU1TFGPUMTGW\GU)QNFGOCKNNKGTVIGKPKIG$GUEJ·FKIWPIGPKPFGT TQVGP'OCKNNGQJPG$·PFEJGP 4+++





+PVGTCNNKKGTVG 5KGIGUOGFCKNNG  #WUICDG QJPG 5VGORGNUEJPGKFGTPCOGP $TQP\G OKV -WIGNÌUG CO   UR·VGTGP$CPF ++

 149


RUMÄNIEN

8731

47/0+'0 -¤0+)4'+%*   

1TFGP%CTQN+(·NUEJWPI  FGT-QNNCPGOKV-NGKPQFDGUVGJGPFCWU-QNNCPGOKV/QPQITCOO 9CRRGP FCXQPGKPGUOKV'OCKNNGCWUDTWEJ GKPGO6TCIGWPFGKPGO8GTUEJNWUUINKGF5KNDGTITÌ­VGP VGKNU XGTIQNFGV VGKNYGKUG GOCKNNKGTV FCU 8GTUEJNWUUINKGF OKV HTCP\ÌUKUEJGT 'KPHWJTRWP\G XQP  DKU    5EJYCPGPRWP\G WPF-NGKPQF5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVKOCNVGP'VWKOKVCWHIG NGIVGO/GVCNNOQPQITCOO/WPFHTCP\ÌUKUEJGT*GT\QIUMTQPG ++ &GT 1TFGP YWTFG CO  /CK  CWU #PNCUU FGU L·JTKIGP 4GIKGTWPIULWDKN·WOU -ÌPKI %CTQNU + \WP·EJUV CNU   XKGTMNCUUKIGT CD  PWT PQEJ GKPMNCUUKI  WPF JÌEJUVGT 1TFGP FGU .CPFGU IGUVKHVGV .CWV -NKGVOCPP KP -.+47    YCT FKG #P\CJN FGT TWO·PKUEJGP $GNKGJGPGP UVCVWVGPIGO·­ DKU  CWH HÒPH -QNNCPGP FCPCEJ CWH  -QNNCPGP   DGITGP\V 1TKIKPCNGZGORNCTG UKPF UQOKV XQP CNNGTITÌ­VGT 5GNVGPJGKV 8IN CWEJ 2CPMG[ %* 6JG 4Q[CN 4QOC   PKCP 1TFGT QH %CTQN + +P 6JG ,QWTPCN QH VJG 1TFGT CPF /GFCNU 5QEKGV[ QH #OGTKEC    0T  5    7PF9GDGT9KNJGNO&CUTWO·PKUEJG1TFGPUYGUGPWPFUGKPG\YGKTCPIJÌEJUVGP1TFGP+P1TFGPWPF'JTGP\GK EJGP  0T5   $GK FGP \YGKHGNNQU CNVGP 'VWK FÒTHVG GU UKEJ WO GKP CNVGU ,WYGNKGTUGVWK HÒT GKP -QNNKGT GKPGT *GT\QIKP IGJCPFGNV     JCDGPFGOGKPGPGWG'KPNCIGHÒTFKG-QNNCPGGKPIGHÒIVYQTFGPKUV

150




RUMÄNIEN

8732



1TFGP %CTQN + (·NUEJWPI FGT -QNNCPG OKV -NGKPQF DGUVGJGPF CWU -QNNCPG OKV  /QPQITCOO   9CRRGPGKPGO6TCIGWPFGKPGO8GTUEJNWUUINKGF5KNDGTITÌ­VGPVGKNUXGTIQNFGVVGKNYGKUGGOCKNNKGTV FCU8GTUEJNWUUINKGFOKV*GTUVGNNGTDG\GKEJPWPI4'5%*2WP\GP/4WPFFCU-TGW\EJGPFGT-TQPG FGU6TCIGINKGFGUCDIGDTQEJGPWPF-NGKPQF5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T &CXQTYWTFGFKG-QNNCPGYWTFGCO0QXGODGTCWHGKPGTUÒFFGWVUEJGP#WMVKQPGTYQTDGP'UJCPFGNV UKEJJKGTDGKWOGKPGUGKVFGPGT,CJTGPJ·WHKIGTXQTMQOOGPFG(·NUEJWPI\WO5EJCFGPFGT5COONGT

8733



/KNKV·T1TFGP/KEJCGNFGT6CRHGTG/QFGNN OKV,CJTGU\CJN -TGW\-NCUUG$TQP\GXGTIQN FGV WPF GOCKNNKGTV CO QTKIKPCNGP CNVGP $CPF TWO·PKUEJGT 0·JCTV KO QTKIKPCNGP FWPMGNDNCWGP 8GTNGK   JWPIUGVWKOKVIQNFHCTDGPGT$G\GKEJPWPIWPF/QPQITCOO-ÌPKI/KJCKNU+<'+ ++



'UJCPFGNVUKEJJKGTDGKCWEJVTQV\FGTGVYCUGKPHCEJGP#WUHÒJTWPIWOGKPGGKPYCPFHTGKGU\GKVIGPÌUUKUEJGU1TKIKPC NGZGORNCTFCUYQJNXQTFGT/QFGNN·PFGTWPIKO1MVQDGTFGU,CJTGU OKVMÌPKINKEJGP&GMTGVGP0T: XQO1MVQDGTWPF0T:XQO1MVQDGT XQPFGT/ÒP\GKP$WMCTGUVJGTIGUVGNNV YQTFGPKUV

151


RUMÄNIEN

8735

8734

8734

8736





1TFGP5VGTP4WO·PKGPU CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  )TQ­MTGW\ HÒT/KNKV·TXGTFKGPUVKP(TKGFGPU\GKVGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGO4CPFFGUWPVGTGP-TGW \CTOGU*GTUVGNNGTDG\GKEJPWPIFGU(KTOC4GUEJKP$WMCTGUVCOQTKIKPCNGPGVYCUCWUIGDNKEJGPGP5EJWN VGTDCPFGPFG<'+ +p++



1TFGP5VGTP4WO·PKGPU CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  $TWUVUVGTP OKV5EJYGTVGTP5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGXGTIQNFGVWPFGOCKNNKGTVGVYCUXGTUEJOWV\V CWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-TGVN[KP2CTKU 2CNCKU4Q[CN0Q CP0CFGN ++



W­GTUVSWCNKV·VUXQNNG#PHGTVKIWPIFGTDGFGWVGPFGP2CTKUGT1TFGPU/CPWHCMVWT



1TFGP5VGTP4WO·PKGPU CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  $TWUVUVGTP \WO)TQ­QHHK\KGTQFGT\WO)TQ­MTGW\HÒT/KNKV·TXGTFKGPUVKP(TKGFGPU\GKVGPQFGTKP-TKGIU\GKVGP#WU HÒJTWPI OKV UKNDGTHCTDGPGP 5EJYGTVGTP WPF /GFCKNNQPTCPF &WTEJOGUUGT  OO 5KNDGT DTKNNCPVKGTV   WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV OKP #DRNCV\WPIGP KP FGT ITÒPGP 'OCKNNG CWH FGT   4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-T½VN[KP2CTKUCP0CFGNOKV\YGK5GKVGPJCMGP<'+ XCT 44++ $GOGTMGPUYGTVG #WUHÒJTWPI CWU FGO NGV\VGP &TKVVGN FGU0GWP\GJPVGP,CJTJWPFGTVU&KG$TWUVUVGTPG\WO)TQ­QHHK \KGTWPF\WO)TQ­MTGW\YCTGPXQPINGKEJGT)TÌ­GWPFCWEJ\WFGP-TGW\GPHÒT/KNKV·TXGTFKGPUVKP(TKGFGPU\GKVGP

OKV 5EJYGTVGTP ÒDGT FGO -TGW\  YWTFGP $TWUVUVGTPG OKV 5EJYGTVGTP FWTEJ FKG /KVVG IGVTCIGP /ÌINKEJGTYGKUG   JCPFGNV GU UKEJ DGK FKGUGO HTÒJGP 5VGTP WO GKPGP HÒT /KNKV·TXGTFKGPUV KP (TKGFGPU\GKVGP FGUJCND UKNDGTHCTDGPG   5EJYGTVGT WPF WO GKPGP 5VGTP \WO )TQ­QHHK\KGT FGUJCND UKNDGTHCTDGPGU /GFCKNNQP /GTMOCNG FKG OCP DCNF PCEJ   'KPHÒJTWPI FGT +PUKIPKGP HÒT /KNKV·TXGTFKGPUV KP (TKGFGPU\GKVGP OKV &GMTGV 0T  ++  XQO  (GDTWCT    YKGFGTHCNNGPIGNCUUGPJCDGPFÒTHVG&GUJCNDFÒTHVGGUUKEJJKGTDGKWOGKPGPGZVTGOUGNVGPGPWPFHTÒJGP5VGTPJCPFGNP

152




RUMÄNIEN

8738 8737

8739



8740

8741

1TFGP5VGTP4WO·PKGPU CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  -QOOCP FGWTMTGW\HÒT<KXKNXGTFKGPUV5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGPCNVGP*CNUDCPF<'+ +p++





1TFGP 5VGTP 4WO·PKGPU CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP   /QFGNN   1HHK   \KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFOKV4QUGVVG<'+ ++





1TFGP 5VGTP 4WO·PKGPU CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP   /QFGNN     4KVVGTMTGW\ 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP $CPF TWO·PKUEJGT 0·JCTV KO   QTKIKPCNGP NGFGTPGP 8GTNGKJWPIUGVWK FGT (KTOC ,QUGRJ 4GUEJ (KNU KP $WMCTGUV OKV /QPQITCOO -ÌPKI   %CTQNU+<'+ +p



-TGW\$CPFWPF'VWKKPUGNVGPIWVGT'TJCNVWPI





1TFGP 5VGTP 4WO·PKGPU CWEJ 1TFGP FGU 5VGTPU XQP 4WO·PKGP   /QFGNN     #WUHÒJTWPI HÒT -TKGIU\GKVGP IGUVKHVGV  D\Y   OKV 5EJYGTVGTP FWTEJ FCU /GFCKNNQP    )TQ­QHHK\KGTUUGVDGUVGJGPFCWU)TQ­QHHK\KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGO6TCIGTKPI OGJTHCEJRWP\KGTV WCOKVFGT*GTUVGNNGTRWP\G%(<FGT(KTOC%(<KOOGTOCPPKP2HQT\JGKOFGT ,CJTGURWP\GHÒTWPFFGT/CVTKMGNPWOOGT OKV*CNUDCPFHÒT6CRHGTMGKVWPF$TWUVUVGTP #WUHÒJTWPI OKV -TQPG 5KNDGT TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV #DRNCV\WPI KO   /GFCKNNQPTKPICP0CFGNFKGUGOGJTHCEJRWP\KGTV WCOKVFGT*GTUVGNNGTRWP\G%(<FGT,CJTGURWP\G HÒTWPFFGT/CVTKMGNPWOOGT <'+ ++++p+++



1TFGP5VGTP4WO·PKGPU CWEJ1TFGPFGU5VGTPUXQP4WO·PKGP /QFGNN  -QOOCP FGWTMTGW\HÒT<KXKNXGTFKGPUV5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKVCNVGOQTKIKPCNGP$CPFCDUEJPKVV<'+  +p++

 153


RUMÄNIEN

8742 (1:1)



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPIOKV-TQPGKP'KUGP)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTV-TQPG 'KUGPCOQTKIKPCNGPCNVGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGV-TQPG'KUGPCWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ,QUGRJ 4GUEJ  5QJP KP $WMCTGUV CP 0CFGN KO   QTKIKPCNGPFWPMGNDNCWNGFGTPGP8GTNGKJWPIUGVWKFGT(KTOC4GUEJOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI %CTQNU+<'+ 5VÒEM+ 

8743



154

1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPIOKV-TQPGKP5KNDGT)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTV-TQPG 5KNDGTCOQTKIKPCNGPCNVGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVCWHFGT4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPIFGT(KTOC2CWN6GNIGKP$GTNKPWPFGT5KNDGTRWP\GCP0CFGNKOQTKIKPCNGP TQVNGFGTPGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI%CTQNU+<'+  5VÒEM+




RUMÄNIEN

8745

8744





1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPIOKV-TQPGKP5KNDGT$TWUVUVGTP\WO)TQ­MTGW\5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC2CWN6GNIGKP$GTNKP0CFGNDQEMHCEJIGTGEJVWPFMCWOUKEJV DCTTGRCTKGTVCP0CFGN<'+ ++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI OKV -TQPG KP 'KUGP )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV -TQPG 'KUGP CO QTKIKPCNGP CNVGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV   -TQPG'KUGPCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,QUGRJ4GUEJ5QJPKP$WMCTGUVCP 0CFGN KO QTKIKPCNGP FWPMGNDNCWGP 8GTNGKJWPIUGVWK FGT (KTOC 4GUEJ OKV IQNFHCTDGPGO /QPQITCOO   -ÌPKI(GTFKPCPFU<'+ 5VÒEM+p++



8746 8747





1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI OKV -TQPG KP 5KNDGT )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV -TQPG 5KNDGT CWH FGO $CPFTKPI RWP\KGTV ,4( #4) HÒT ,QUGRJ 4GUEJ (KNU #TIGPV  CO   QTKIKPCNGPCNVGP*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGV-TQPG5KNDGTCWHFGT4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ,QUGRJ 4GUEJ  5QJP KP $WMCTGUV CP 0CFGN KO QTKIKPCNGP   FWPMGNDNCWGP8GTNGKJWPIUGVWKFGT(KTOC4GUEJOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI(GTFKPCPFU<'+  5VÒEM++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPIOKV-TQPGKP'KUGP-QOOCPFGWTMTGW\5KNDGTGOCKNNKGTVKPFGT¤UGRWP\KGTV#:COQTKIKPCNGP CNVGP WPIGVTCIGPGP *CNUDCPF KO TQVNGFGTPGP QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC ,QUGRJ 4GUEJ WPF   5QJPKP$WMCTGUVOKVIQNFHCTDGPGO/QPQITCOO-ÌPKI%CTQNU+<'+ +p++

 155


RUMÄNIEN

8748







8749

8750

1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI OKV -TQPG KP 'KUGP -QOOCPFGWTMTGW\ 5KNDGT GOCKNNKGTV KP FGT ¤UG OGJTHCEJ RWP\KGTV CO   QTKIKPCNGPCNVGP*CNUDCPF<'+ +p++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPIOKV-TQPGKP5KNDGT-QOOCPFGWTMTGW\5KNDGTGOCKNNKGTVKO$CPFTKPIRWP\KGTV#4),4( HÒT #TIGPV,QUGRJ4GUEJ(KNUCOQTKIKPCNGPCNVGP*CNUDCPF<'+ +p++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI OKV -TQPG KP 5KNDGT -QOOCPFGWTMTGW\ 5KNDGT GOCKNNKGTV GKPG -TGW\URKV\G OKP DGUEJ·FKIV KO   $CPFTKPIRWP\KGTV#4),4( HÒT#TIGPV,QUGRJ4GUEJ(KNUOKV*CNUDCPFCDUEJPKVV<'+ +p++



8753

8751







8752

1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI OKV -TQPG KP 'KUGP 1HHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV #DRNCV\WPI KP FGT TQVGP   'OCKNNGFGT4ÒEMUGKVGGKPGU-TGW\CTOUKO4KPIWCRWP\KGTV-(COQTKIKPCNGP$CPFTWO·PKUEJGT 0·JCTVOKVCWHIGNGIVGT4QUGVVG<'+ ++++p+++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPIOKV-TQPGKP5KNDGT1HHK\KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVKO4KPIRWP\KGTV,4(HÒTFKG (KTOC,QUGRJ4GUEJ(KNUKP$WMCTGUV#4)HÒT5KNDGTWPFHTCP\ÌUKUEJGT'KPHWJTRWP\GXQPDKU

5EJYCPGPRWP\G COQTKIKPCNGP$CPFTWO·PKUEJGT0·JCTVOKVCWHIGNGIVGT4QUGVVG<'+ ++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI HÒT <KXKNXGTFKGPUVG $TWUVUVGTP \WO )TQ­QHHK\KGT MNGKPG #WUHÒJTWPI 5KNDGT VGKNYGKUG XGTIQNFGV   WPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,QUGRJ4GUEJ5QJPKP$WMCTGUVCP JQTK\QPVCNCPIGDTCEJVGT0CFGN UVKOOKIOKVFGT*GTUVGNNGTDG\GKEJPWPI FKGUGOGJTHCEJRWP\KGTV WC OKV,CJTGURWP\GHÒT/CVTKMGNPWOOGTWPF#4)HÒT5KNDGT<'+XCT 44+p++



/KV\KGONKEJGT5KEJGTJGKVJCPFGNVGUUKEJJKGTDGKWOGKPGPFGTGZVTGOUGNVGPGP$TWUVUVGTPGHÒT&COGPFCGDGPPKEJV PWTFCU/GFCKNNQPWO)TCF\WT0CFGNIGFTGJVKUVUQPFGTPINGKEJHCNNUFKGTÒEMUGKVKIG*GTUVGNNGTDG\GKEJPWPIWPF GKPUQNEJGTFQRRGNVGT*GTUVGNNWPIUHGJNGTFQEJCNU·W­GTUVWPYCJTUEJGKPNKEJCP\WUGJGPKUV

156


RUMÄNIEN

8755

8754









8756 8757

1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI HÒT <KXKNXGTFKGPUVG $TWUVUVGTP \WO )TQ­QHHK\KGT MNGKPG #WUHÒJTWPI 5KNDGT VGKNYGKUG XGTIQNFGV   WPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,QUGRJ4GUEJ5QJPKP$WMCTGUVCP 0CFGNFKGUGOGJTHCEJRWP\KGTV WCOKV,CJTGURWP\GHÒT/CVTKMGNPWOOGTWPF#4)HÒT 5KNDGT<'+ +p++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI HÒT <KXKNXGTFKGPUV -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV KO 6TCIGTKPI OGJTHCEJ   RWP\KGTV WPVGT CPFGTGO OKV FGT ,CJTGURWP\G  HÒT  WPF /CVTKMGNPWOOGT   OKV NCPIGO   *CNUDCPFCDUEJPKVV<'+ +p++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPIHÒT/KNKV·TXGTFKGPUVKP(TKGFGPU\GKVGP OKV-TQPG -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKN NKGTV KO 6TCIGTKPI OGJTHCEJ RWP\KGTV WPVGT CPFGTGO OKV FGT ,CJTGURWP\G  HÒT  WPF   /CVTKMGNPWOOGT   CO *CNUDCPFCDUEJPKVV HÒT 8GTFKGPUVG KP -TKGIU\GKVGP OKV IQNFHCTDGPGP   4·PFGTP <'+ +p++



1TFGP-TQPG4WO·PKGPU CWEJ1TFGPFGT-TQPGXQP4WO·PKGP /QFGNN  #WUHÒJ TWPI  1HHK\KGTUMTGW\ HÒT /KNKV·TXGTFKGPUV KP -TKGIU\GKVGP $TQP\G   XGTIQNFGV WPF   GOCKNNKGTVCO$CPFHÒT-TKGIU\GKVGPQJPG4QUGVVG<'+XCT 4++



$GKFGOXQTNKGIGPFGP-QOOCPFGWTMTGW\JCPFGNVGUUKEJWOGKPKPCNNGP6GKNGPQTKIKPCNGU'ZGORNCTFCU\YKUEJGP  WPF  XQP FGT /ÒP\G KP $WMCTGUV CWU $TQP\G IGHGTVKIV WPF XGTNKGJGP YQTFGP KUV 5QNEJG 'ZGORNCTG UKPF   YGKVCWUUGNVGPGT\WHKPFGPCNUFKG5KNDGTXGTIQNFGVGP'ZGORNCTG

8758

8760 8759

8761



1TFGPFGT.CPFGUYCEJV-TGW\++-NCUUGXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVHGKPG'OCKNNGOCNGTGKCP 0CFGN 4++





/GFCKNNG$GPG/GTGPVK/GFCKNNG-NCUUG5KNDGTXGTIQNFGVCOQTKIKPCNGP$CPFTWO·PKUEJGT0·JCTV KOQTKIKPCNGP8GTNGKJWPIUGVWKOKVFGOIQNFHCTDGPGP/QPQITCOO-ÌPKI%CTQNU+ 4++





/GFCKNNG.CPFYKTVUEJCHVU8GTFKGPUV /GFCKNNGHÒT8GTFKGPUVGWOFKG.CPFYKTVUEJCHV /QFGNN

OKV /QPQITCOO -ÌPKI %CTQNU ++    /GFCKNNG  -NCUUG $TQP\G XGTUKNDGTV QJPG $CPF   -.+47 ++



+PVGTCNNKKGTVG 5KGIGUOGFCKNNG  1HHK\KGNNG #WUICDG $TQP\G OKV 5VGORGNUEJPGKFGTUKIPCVWT   -TKUVGUMQOKV-WIGNÌUGCOUR·VGTGP$CPF ++



&KG \YGKMNCUUKIG /GFCKNNG .CPFYKTVUEJCHVU8GTFKGPUV YWTFG XQP -ÌPKI %CTQN ++ OKV )GUGV\ XQO  #RTKN    \WUCOOGPOKVFGO1TFGP.CPFYKTVUEJCHVU8GTFKGPUVIGUVKHVGVKUVCDGTFKGUGOPKEJVCHHKNKKGTV



157


RUMÄNIEN

8762

8764

8763

8767

8766

8769



8765

8768

8770

-QPXQNWVXQPHÒPHXGTUEJKGFGPGP#WU\GKEJPWPIGP8GTUEJKGFGPG/GVCNNG CWEJ5KNDGT CP$·PFGTP 5VÒEM++



51<+#.+56+5%*'4'27$.+-   

1TFGP 5KGI FGU 5Q\KCNKUOWU $TWUVUVGTP XGTEJTQOV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN   5%*/+47<'+ 4++





1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454   $TWUVUVGTP  -NCUUG $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV OKV 5KOKNKUVGKPGP DGUGV\V CP   0CFGN5%*/+47<'+ +p++



1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454   $TWUVUVGTP  -NCUUG $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV OKV 5KOKNKUVGKPGP DGUGV\V CP   0CFGN5%*/+47<'+ +p++



1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454  $TWUVUVGTP-NCUUG$TQP\GXGT IGND IQNFGVWPFVGKNYGKUGGOCKNNKGTVOKV5KOKNKUVGKPGPDGUGV\V CP0CFGN5%*/+47<'+ +p++



1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454  $TWUVUVGTP-NCUUG$TQP\GXGT TQV IQNFGVWPFVGKNYGKUGGOCKNNKGTVOKV5KOKNKUVGKPGPDGUGV\V CP0CFGN5%*/+47<'+ +p++





1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454   #WUHÒJTWPI KP 5KNDGT $TWUVUVGTP  -NCUUG 5KNDGT IGRTÒHV  $TQP\G XGTIQNFGV WPF VGKNYGKUG   GOCKNNKGTVOKV5KOKNKUVGKPGPDGUGV\VCP0CFGN5%*/+47<'+ +p++





1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454  $TWUVUVGTP-NCUUG$TQP\GXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKV5KOKNKUVGKPGPDG UGV\VCP0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWK5%*/+47<'+ +p++









#WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU



158

1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454  $TWUVUVGTP-NCUUG$TQP\GXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKV5KOKNKUVGKPGPDG UGV\VCP0CFGN5%*/+47<'+ +p++




RUMÃ&#x201E;NIEN

ex 8772

8771 ex 8773

ex 8774

ex 8776



















8775

ex 8777

ex 8778

1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454   $TWUVUVGTPG  WPF  -NCUUG LGYGKNU $TQP\G XGTEJTQOV VGKNYGKUG GOCKNNKGTV CP 0CFGNP   5%*/+47<'+ +p++



1TFGP5VGTPFGT5Q\KCNKUVKUEJGP4GRWDNKM4WO·PKGP/QFGNN 9CRRGPOKV+PUEJTKHV454   $TWUVUVGTPG  WPF  -NCUUG LGYGKNU $TQP\G XGTEJTQOV VGKNYGKUG GOCKNNKGTV CP 0CFGNP   5%*/+47<'+ 5VÃ&#x2019;EM+p++



1TFGP6WFQT8NCFKOKTGUEW8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUGWPFFGTDGKFGP/GFCKNNGP XGTIQNFGVD\YXGTEJTQOVD\YDTQP\GHCTDGPVGKNUGOCKNNKGTVFKG-NCUUGDGUGV\V¯LQWTOKV5KOK NKUVGKPGPLGYGKNUCP0CFGNPD\YFKGDGKFGP/GFCKNNGPCP$·PFGTPTWO·PKUEJGT0·JCTVOKV#WHNCIGP 5%*/+47<'+pp5VÃ&#x2019;EM+p++



1TFGP6WFQT8NCFKOKTGUEW-QPXQNWVXQPFTGKXGTUEJKGFGPGP1TFGPUUVGTPGP 5VGTP-NCUUGXGT IQNFGVOKV5KOKNKUVGKPGPDGUGV\VCP3WGTPCFGN 5VGTP-NCUUGXGTEJTQOV<GPVTWOITÃ&#x2019;PGOCKN NKGTVCP3WGTPCFGN 5VGTP-NCUUGXGTUKNDGTV<GPVTWOTQVGOCKNNKGTVCP3WGTPCFGN 5VÃ&#x2019;EM++



1TFGP 6WFQT 8NCFKOKTGUEW 5VGTP  -NCUUG $TQP\G XGTUKNDGTV PKEJV XGTEJTQOV  /GFCKNNQP ITÃ&#x2019;P   GOCKNNKGTVCP0CFGN\WUCOOGPOKV+PVGTKOUUEJPCNNGKOQTKIKPCNGPIQNFGPDG\GKEJPGVGP8GTNGKJWPIUGVWK OKVIGRT·IVGO5VCCVUYCRRGP5%/+47<'+ +p++



1TFGP FGT #TDGKV  /QFGNN   XQNNUV·PFKIGT 5CV\ FGT &GMQTCVKQPGP  DKU  -NCUUG    -NCUUG 5KNDGT IGRTÃ&#x2019;HV  VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV  WPF  -NCUUG $TQP\G VGKNU VGKNYGKUG   XGTUKNDGTV D\Y DTQP\GHCTDGP LGYGKNU VGKNY GOCKNNKGTV  -NCUUG OKV JGNNIGNDGT 5QPPG  CP 0CFGNP   5%*/+47<'+ 5VÃ&#x2019;EM+p++



1TFGP9KUUGPUEJCHVU8GTFKGPUV8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUG$TQP\GXGTIQNFGV D\Y XGTUKNDGTV D\Y DTQP\GHCTDGP LGYGKNU GOCKNNKGTV CP 0CFGNP 5%*/+47    <'+    5VÃ&#x2019;EM+p++



1TFGP-WNVWT8GTFKGPUV8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUG$TQP\GXGTIQNFGVD\Y XGTUKNDGTVD\YVGKNYGKUGXGTUKNDGTVD\YXGTEJTQOVLGYGKNUGOCKNNKGTVCP0CFGNP5%*/+47 <'+ 5VÃ&#x2019;EM+p++



1TFGP-WNVWT8GTFKGPUV8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUG$TQP\GXGTIQNFGVD\Y XGTUKNDGTVD\YVGKNYGKUGXGTUKNDGTVD\YXGTEJTQOVLGYGKNUGOCKNNKGTVCP0CFGNP5%*/+47 <'+ +p++

 159


RUSSLAND

ex 8780







ex 8781

ex 8782

1TFGP5CPKV·VU8GTFKGPUV8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUG$TQP\GXGTIQNFGVD\Y XGTUKNDGTVD\YDTQP\GHCTDGPLGYGKNUGOCKNNKGTVLGYGKNUDGUGV\V¯LQWTOKV5KOKNKUVGKPGPCP0CFGNP 5%*/+47<'+ 5VÒEM+p++



1TFGP.CPFYKTVUEJCHVU8GTFKGPUV8QNNUV·PFKIGT5CV\FGT$TWUVUVGTPGDKU-NCUUG$TQP\GXGTIQN FGVD\YXGTUKNDGTVD\YVGKNYGKUGXGTUKNDGTVD\YXGTEJTQOVD\YDQP\GHCTDGPLGYGKNUGOCKNNKGTVCP 0CFGNP 5VÒEM+p++



-QPXQNWV XQP XKGT XGTUEJKGFGPGP OKNKV·TKUEJGP 1TFGP 1TFGP 8GTVGKFKIWPI FGU 8CVGTNCPFGU   /QFGNN OKV454CWHFGO9CRRGP WPF-NCUUGWPF1TFGP/KNKV·TXGTFKGPUV  /QFGN OKV 454 CWH FGO 9CRRGP    $TQP\G VGKNU VGKNYGKUG XGTIQNFGV VGKNU VGKNYGKUG   XGTUKNDGTVLGYGKNUVGKNYGKUGGOCKNNKGTVGKPGCP0CFGNFTGKCP2GPVCIQPCNDCPFURCPIG5%*/+47 <'+ 5VÒEM+p++



8783 (1:1)

4755.#0& 

<#4'067/ $+5 

1TFGP FGU #RQUVGNINGKEJGP JGKNKIGP (ÒTUVGP 9NCFKOKT $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV   /GFCKNNQP )QNF VGKNYGKUG HGKPUV \KUGNKGTV GOCKNNKGTV OKP 'OCKNNGEJKR KO UEJYCT\GP /GFCKNNQPHGNF   QJPG4ÒEMUGKVGPCDFGEMWPICP0CFGNOKV\YGK5GKVGPJCMGP ++  *KGTDGKJCPFGNVGUUKEJWOGKPGPKEJVTWUUKUEJG#PHGTVKIWPIWPVGT8GTYGPFWPIGKPGUGKPHCEJIGHGTVKIVGP5VGTPMQTRWU WPFGKPGU·NVGTGP/GFCKNNQPUXQPCNNGTJÌEJUVGT#PHGTVKIWPIUSWCNKV·VYQJNCWUFGT/KVVGFGU0GWP\GJPVGP,CJTJWPFGTVU

160


RUSSLAND

8784 (1:1)

8784 (1:1)



8785

1TFGP FGU #RQUVGNINGKEJGP JGKNKIGP (ÒTUVGP 9NCFKOKT -TGW\  -NCUUG HÒT  &KGPUVLCJTG )QNF   GOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGWPVGTFGT'OCKNNG*GTUVGNNGTRWP\G#-HÒT#NDGTV -GKDGNWPF#FNGTFGT*QHNKGHGTCPVGPKPFGT¤UG<QNQVPKMK-QMQUJPKM)QNFRWP\GXQPDKU QJPG6TCIGTKPIWPFQJPG$CPF<'+ 4++  8QP  DKU  JCVVG #NDGTV -GKDGN   5QJP WPF 0CEJHQNIGT ,WNKWU -GKDGNU CNU QHHK\KGNNGT 1TFGPULW   YGNKGTGKPGP'ZMNWUKXXGTVTCIOKVFGO1TFGPUMCRKVGN&CFGT8GTVTCIXQP#NDGTV-GKDGNOKVFGO1TFGPUMCRKVGN PKEJVGTPGWGTVYWTFGNKGHGTVGGTFQTVJKPPWTDKU5QOKVN·UUVUKEJFKG'PVUVGJWPIU\GKVFGU-TGW\GUCWHFKG,CJTG \YKUEJGPWPFGKPITGP\GP



)TQ­G TWUUKUEJG 1TFGPUUEJPCNNG OKV FTGK #WU\GKEJPWPIGP   1TFGP FGU #RQUVGNINGKEJGP JGKNKIGP   (ÒTUVGP9NCFKOKT-TGW\-NCUUGHÒT&KGPUVLCJTG)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCWHFGT 4ÒEMUGKVGRWP\KGTV"ÈË" GKPGUDKUJGTWPKFGPVKHK\KGTVGP/GKUVGTFGT(KTOC'FWCTFWPF"ÝÄÓÀÐÄÚ" HÒT FKG (KTOC 'FWCTF KP 5V 2GVGTUDWTI KP FGT ¤UG -QMQUJPKM)QNFRWP\G  <QNQVPKMK XQP  DKU    CWH FGT 4ÒEMUGKVG \YGK 'OCKNNGEJKRU WPF ITQ­G GKPHCEJG 'OCKNNGTGRCTCVWT CWH FGO QDGTGP   -TGW\CTO /GFCKNNGHÒT'KHGT/QFGNNOKVFGO2QTVTCKV<CT#NGZCPFGT++#WUICDG )GUKEJVFGU <CTGP PCEJ TGEJVU    -NGKPG 5KNDGTPG /GFCKNNG 5KNDGT   'TKPPGTWPIUOGFCKNNG CWH FKG   4GIKGTWPI<CT#NGZCPFGTU+++5KNDGT 5VÒEM+++++++



#NVG5EJPCNNGOKVQTKIKPCNGPCNVGP$·PFGTP

8786



1TFGP FGT JGKNKIGP #PPC  /QFGNN EC   $TWUVUVGTP 5KNDGTIWUU   VGKNYGKUG XGTIQNFGV   VGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG/GKUVGTOCTMG$4GKPGUDKUJGTPKEJVKFGPVKHK\KGTVGP/GKUVGTUCWU 5V 2GVGTUDWTI WPF 5KNDGTRWP\G  CP 0CFGN FKGUG GDGPHCNNU OKV 5KNDGTRWP\G  WPF PKEJV   KFGPVKHK\KGTDCTGT4WPFRWP\G ++  1DGUUKEJJKGTDGKWOGKPGHTÒJGYGPPCWEJGKPHCEJG(GTVKIWPIXQPXQT CNU/GVCNNUVGTPG\YCTIGDT·WEJNKEJ CDGT PQEJ KPQHHK\KGN YCTGP  QFGT WO GKPG PGW\GKVNKEJG (·NUEJWPI JCPFGNV MQPPVG NGKFGT PKEJV GKPFGWVKI IGMN·TV   YGTFGPYGUJCNDHÒTFKGUGU'ZGORNCTMGKPG)GY·JTHÒTFKG1TKIKPCNKV·VÒDGTPQOOGPYGTFGPMCPP  &GTGKPMNCUUKIG1TFGPFGTJN#PPCYWTFGXQP-CTN(TKGFTKEJ*GT\QIXQP*QNUVGKP)QVVQTR\WO)GFGPMGPCP UGKPGXGTUVQTDGPG)GOCJNKP#PPC2GVTQXPCGKPGT6QEJVGT<CT2GVGTUFGU)TQ­GPIGUVKHVGVÒDGTPCJOKJPUGKP 5QJP WPF 0CEJHQNIGT FGT KP\YKUEJGP TWUUKUEJGT <CT 2GVGT +++  IGYQTFGPG *GT\QI %CTN 2GVGT (TKGFTKEJ PCEJ    4W­NCPFYQGTCWEJPCEJFGO8GT\KEJV-CVJCTKPCU++CWHFCU*GT\QIVWO*QNUVGKP)QVVQTRUXGTDNKGD'TUVOKVFGT -TÌPWPI XQP FGTGP 5QJP 2CWN + \WO <CTGP CO  #RTKN  YWTFG FGT PWPOGJT FTGKMNCUUKIG 1TFGP KP FCU   TWUUKUEJGT 1TFGPUU[UVGO KPVGITKGTV  YWTFG FKG DKUJGTKIG  -NCUUG FGT 5V #PPGP5·DGN  KP FKG  -NCUUG    WOIGYCPFGNVWPFGKP-TGW\-NCUUGIGUVKHVGV&KG-NCUUGUGV\VGFGP:++6UEJKP 4CPIMNCUUG FKGFGP+: 6UEJKP WPF FKG  FGP +8 6UEJKP XQTCWU #NNG -NCUUGP DTCEJVGP FGP 'TDCFGN CDGT PCEJ  DTCEJVGP FKG  DKU    -NCUUGPPWTPQEJFGPRGTUÌPNKEJGP#FGN7OECYWTFGFKG)GUVCNVWPIFGT+PUKIPKGPXGT·PFGTVGTKGNV FKGFTKVVG-NCUUGHÒT/KNKV·TXGTFKGPUVGKPGCWHFGO$CPFCPIGDTCEJVG5EJNGKHGYWTFGPFKG5EJYGTVGTIGUVKHVGV <YCT JÌTVG OKV FGO 7PVGTICPI FGU <CTGPVWOU  CWEJ FGT 1TFGP CWH \W DGUVGJGP YWTFG CDGT Y·JTGPF FGU    $ÒTIGTMTKGIGUXQPGKPKIGP)GPGT·NGPFGTUQIGPCPPVGP9GK­GP#TOGGDKUKPFKGHTÒJGPGT,CJTGYGKVGTXGTNKGJGP

161


RUSSLAND

8787 (1:1)

8788 (1:1)

8788 (1:1)



1TFGPFGTJGKNKIGP#PPC/QFGNN  -TGW\-NCUUG)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVG WPVGTFGT'OCKNNG*GTUVGNNGTRWP\G#-HÒT#NDGTV-GKDGNWPF#FNGTFGT*QHNKGHGTCPVGPKPFGT¤UG <QNQVPKMK5V2GVGTUDWTIGT)QNFRWP\GXQPDKUCOCNVGP$QIGPDCPF<'+ +p++



8QP  DKU  JCVVG #NDGTV -GKDGN   5QJP WPF 0CEJHQNIGT ,WNKWU -GKDGNU CNU QHHK\KGNNGT 1TFGPULW   YGNKGT GKPGP 'ZMNWUKXXGTVTCI OKV FGO 1TFGPUMCRKVGN 5QOKV N·UUV UKEJ FKG 'PVUVGJWPIU\GKV FGU -TGW\GU CWH FGP   <GKVTCWO\YKUEJGPWPFDGITGP\GP



1TFGPFGTJGKNKIGP#PPC/QFGNN  -TGW\-NCUUG)QNFGOCKNNKGTVCWHFGT4ÒEMUGKVG WPVGTFGT'OCKNNG*GTUVGNNGTRWP\G#-HÒT#NDGTV-GKDGNWPF#FNGTFGT*QHNKGHGTCPVGPKPFGT¤UG <QNQVPKMK-QMQUJPKM)QNFRWP\GXQPDKUCOQTKIKPCNGPCNVGP*CNUDCPF<'+ +p++



&CFGT'ZMNWUKXXGTVTCIXQP#NDGTV-GKDGNOKVFGO1TFGPUMCRKVGNPKEJVGTPGWGTVYWTFGNKGHGTVGGTFQTVJKPPWT DKU5QOKVN·UUVUKEJFKG'PVUVGJWPIU\GKVFGU-TGW\GUCWHFKG,CJTG\YKUEJGPWPFGKPITGP\GP

8789





8790 (1:1)

8789

-CKUGTNKEJGT WPF MÌPKINKEJGT 1TFGP XQO JGKNKIGP 5VCPKUNCWU (TCIOGPV GKPGU HTÒJGP -TGW\GU    -NCUUG &WTEJOGUUGT OO YQJN )QNF QJPG )GY·JT  JQJN IGHGTVKIV GOCKNNKGTV  I   'OCKNNGOCNGTGKUVCTMDGUEJ·FKIV +8 -CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\-NCUUG)QNFGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGRWP\KGTV+-HÒTFKG(KTOC,WNKWU -GKDGNKP5V2GVGTUDWTIWPF<CTGPCFNGTFGT*QHNKGHGTCPVGPKPFGT¤UG5V2GVGTUDWTIGT<QNQVPKMK )QNFRWP\GXQPDKUCOUGJTMWT\GP*CNUDCPF<'+ +p++ #WHITWPFFGT-QODKPCVKQPFGT+-2WP\GOKVFGT5V2GVGTUDWTIGT)QNFRWP\GN·UUVUKEJFKG'PVUVGJWPIFKGUGU-TGW \GUCWHFGP<GKVTCWO\YKUEJGPWPF 6QFGULCJT,WNKWU-GKDGNU GKPITGP\GP

162






RUSSLAND

8791 (1:1)



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\-NCUUG)QNFGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGRWP\KGTV"ÈË" GKPGUDKUJGTWPKFGP VKHK\KGTVGP/GKUVGTFGT(KTOC'FWCTFWPF"ÝÄÓÀÐÄÚ" HÒTFKG(KTOC'FWCTFKP5V2GVGTUDWTIKPFGT ¤UG C-QMQUJPKM5KNDGTRWP\G  <QNQVPKMK XQP  DKU  KO $CPFTKPI TWPFG -QMQUJPKM   2WP\G OKV -QRH PCEJ TGEJVU OKV NCPIGO *CNUDCPFCDUEJPKVV KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV   TWUUKUEJGO<CTGPCFNGT<'+ +p++  &KG(KTOC'FWCTFYWTFGWOXQP'FWCTF(GTPCPFQYKEJ&KGVYCNFIGITÒPFGV#DYCTGTQHHK\GNNGT.KGHG TCPVFGU1TFGPUMCRKVGNUWPFNKGHGTVGFGPITÌ­VGP#PVGKNTWUUKUEJGT1TFGP0CEJUGKPGO6QFHÒJTVGUGKPG9KVYG 8CXCTC &KGVYCNF FKG (KTOC YQJN DKU   YGKVGT QDYQJN & 1UKRQY WPF # #FNGT *CWRVCMVKQP·TG IGYQTFGP   YCTGP &KG /GKUVGTOCTMG "ÈË" KUV NCWV 6COOCPP KP 6#/472 5   GKPGO DKUJGT PKEJV KFGPVKHK\KGTVGP 9GTMU   OGKUVGTFGT(KTOC'FWCTF\W\WQTFPGPWPFXQPDKUPCEJYGKUDCT  &GT  XQP -ÌPKI 5VCPKUNCY ++ #WIWUV 2QPKCVQYUMK IGUVKHVGVG MÌPKINKEJ RQNPKUEJG 1TFGP XQO JN 5VCPKUNCWU    YWTFGFWTEJFKG5VCVWVGPXQO,WPKWPVGTFKGMCKUGTNKEJTWUUKUEJGP1TFGPCWHIGPQOOGP&KGWTURTÒPINKEJG -NCUUGYWTFGCDIGUEJCHV+PFGP,CJTGPJCVVGFGT1TFGPPWTFKG-NCUUG+PFGT*KGTCTEJKGFGT TWUUKUEJGP1TFGPUVCPFGTCPWPVGTUVGT5VGNNGCDGTUGKPG-NCUUG +:6UEJKP TCPIKGTVGJÌJGTCNUFKG-NCUUGFGU 5V#PPC1TFGPUWPFUGKPG-NCUUG +86UEJKP JÌJGTCNUFKG-NCUUGFGU5V#PPC1TFGPUWPFFKG-NCUUGFGU 5V9NCFKOKT1TFGPU#NUDGUQPFGTGT)PCFGPGTYGKUMQPPVGPFKGWPF-NCUUGXQPDKUOKVMCKUGTNKEJGT -TQPGXGTNKGJGPYGTFGP

8792 (1:1)



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\  -NCUUG )QNF GOCKNNKGTV 'OCKNNGOCNGTGK OGJTGTG #DRNCV\WPIGP FGT ITÒPGP 'OCKNNG FGU   /GFCKNNQPTKPIU CWH FGT 4ÒEMUGKVG RWP\KGTV "ÈË" GKPGU DKUJGT WPKFGPVKHK\KGTVGP /GKUVGT FGT (KTOC   'FWCTF WPF "ÝÄÓÀÐÄÚ" HÒT FKG (KTOC 'FWCTF KP 5V 2GVGTUDWTI KP FGT ¤UG C-QMQUJPKM   )QNFRWP\G<QNQVPKMKXQPDKUKO$CPFTKPITWPFG-QMQUJPKM2WP\GOKV-QRHPCEJ TGEJVUCOIGVTCIGPGP*CNUDCPF<'+ ++  163


RUSSLAND

8794 8793



8793

-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\-NCUUG)QNFGOCKNNKGTV'OCKNNGOCNGTGKFKGUGGVYCUDGTKGDGPOKP#DRNCV\WPIGPFGTITÒPGP 'OCKNNG FGU /GFCKNNQPTKPIU CWH FGT 4ÒEMUGKVG RWP\KGTV "ÂÄ" HÒT 8CTXCTC 2GVTQXPC &KGVYCNF WPF   "ÝÄÓÀÐÄÚ" HÒT FKG (KTOC 'FWCTF KP 5V 2GVGTUDWTI KP FGT ¤UG -QMQUJPKM)QNFRWP\G  <QNQV   PKMKXQPDKUKO$CPFTKPITWPFG-QMQUJPKM2WP\GOKV-QRHPCEJTGEJVUCOCNVGP*CNU DCPFCDUEJPKVV<'+ ++



#WHITWPF FGT 2WP\G "ÂÄ" N·UUV UKEJ FKG *GTUVGNNWPIU\GKV FGU 5VÒEMGU CWH  DKU  GKPITGP\GP  6COOCPP   HÒJTV KP 6#/472 5   CWU FCUU 8CTXCTC 2GVTQXPC &KGVYCNF 9KVYG XQP 'FWCTF (GTPCPFQYKEJ &KGVYCNF FKG   (KTOC PCEJ FGUUGP 6QF  ÒDGTPQOOGP JCV 0CEJ 7OYCPFNWPI FGT (KTOC KP GKPG #MVKGPIGUGNNUEJCHV ÒDGTPCJO   &KOKVTK+XCPQXKEJ1UKRQXFKG/CLQTKV·VFGT(KTOCFKGCDGTYGKVGTJKPWPVGTFGO0COGP'FWCTFHKTOKGTVG



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\-NCUUG)QNFGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGRWP\KGTV+-HÒTFKG(KTOC,WNKWU -GKDGNKP5V2GVGTUDWTIWPF<CTGPCFNGTKPFGT¤UG<QNQVPKMK)QNFRWP\GWPF,CJTGURWP\GOKV $CPFCDUEJPKVV4147<'+ ++



(TÒJGU 'ZGORNCT KP JGTXQTTCIGPFGT 'TJCNVWPI  /KV 1VVQ 5COWGN -GKDGN   DGVTCV NCWV 6COOCPP KP   6#/4725HH FCUGTUVG/KVINKGFGKPGTICP\GP)QNFUEJOKGFG&[PCUVKGFKGTWUUKUEJG$ÒJPGFGTUGNDUVCDGTPQEJ MGKPG1TFGPHGTVKIVG5GKP0GHHG,QJCPP9KNJGNO  GTJKGNVKP0CEJHQNIGXQP'OOCPWGN)GQTIXQP 2CPPCUEJ \WUCOOGP OKV 9KNJGNO -·OOGTGT XQO 1TFGPUMCRKVGN FGP #WHVTCI \WT *GTUVGNNWPI CNNGT TWUUKUEJGP   1TFGP5GKP5QJP,WNKWU +XCP 'FWCTF-GKDGN  NGTPVGDGKUGKPGO8CVGTWPFYWTFG/GKUVGT0CEJ FGUUGP 6QF  ÒDGTPCJO GT UEJNKG­NKEJ FKG (KTOC ,WNKWU +XCP  'FWCTF -GKDGN   NGTPVG DGK UGKPGO   8CVGT ,QJCPP 9KNJGNO -GKDGN   WPF YWTFG  /GKUVGT  ÒDGTPCJO GT PCEJ FGO #DNGDGP UGKPGU   8CVGTUFKG.GKVWPIFGT(KTOCFKGGTDKU\WGKPGOGKIGPGP6QFKPPGJCVVG'TYCTXQPDKUQHHK\KGNNGT WPFGKP\KIGT.KGHGTCPVFGU1TFGPUMCRKVGNU

8795



8796

-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\-NCUUG)QNFGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGRWP\KGTV+-HÒTFKG(KTOC,WNKWU -GKDGNKP5V2GVGTUDWTIWPF<CTGPCFNGTHÒTFKG*QHNKGHGTCPVGPCP0CFGN ++



#PHGTVKIWPI \YKUEJGP  DKU  &WTEJ HCEJIGTGEJVG 'PVHGTPWPI FGT ¤UG WPF #PDTKPIWPI GKPGT TÒEMUGKVKIGP   $TQUEJKGTWPIKPGKPG$TQUEJGWOIGCTDGKVGV



-CKUGTNKEJGTWPFMÌPKINKEJGT1TFGPXQOJGKNKIGP5VCPKUNCWU/QFGNN#WUICDG EC  -TGW\  -NCUUG OKV 5EJYGTVGTP )QNF GOCKNNKGTV 'OCKNNGOCNGTGK FKGUG DGTKGDGP OKP #DRNCV\WPIGP   FGT ITÒPGP 'OCKNNG FGU /GFCKNNQPTKPIU CWH FGT 4ÒEMUGKVG RWP\KGTV "Ä1" HÒT FKG (KTOC &KOKVTK   +XCPQXKEJ1UKRQXKP5V2GVGTUDWTIKPFGT¤UGWPNGUGTNKEJG2WP\GKO$CPFTKPITWPFG-QMQUJPKM2WP\G OKV -QRH PCEJ TGEJVU OKV MWT\GO CNVGP $CPFUVÒEM KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK   <'+ ++ .CWV6COOCPP KP6#/4725 KUVFKG(KTOC&+1UKRQXXQTIGITÒPFGVYQTFGPWPFCTDGKVGVGYQJNDKU \WO'PFGFGU'TUVGP9GNVMTKGIGU

164




RUSSLAND

8799

8797 8798



5V)GQTIU5QNFCVGPMTGW\FGU1TFGPUXQOJN)GQTI'KPMNCUUKIG#WUICDG5KNDGTCWHFGT4ÒEMUGKVG ITCXKGTV OKV 6T·IGTPCOG WPF 8GTNGKJWPIULCJT "Þíêåðö / Çÿêèíö / Ïàâëó / 1856 ë." KP FGT ¤UG   WPNGUGTNKEJRWP\KGTVQJPG$CPF 44++p+++



'KPY·JTGPFFGU-TKOMTKGIGUXGTNKGJGPGU'ZGORNCT



5V )GQTIU5QNFCVGPMTGW\ FGU 1TFGPU XQO JN )GQTI -TGW\  -NCUUG XGTIQNFGV QJPG 6T·IGT   PWOOGTQJPG$CPF ++





5V)GQTIU5QNFCVGPMTGW\FGU1TFGPUXQOJN)GQTI-TGW\-NCUUG5KNDGTCWHFGT4ÒEMUGKVG6T· IGTPWOOGT0QCPPGWGTUQYLGVKUEJGT2GPVCIQPCN$CPFURCPIG4147 ++p+++



8800

8801

8803

8802



5V)GQTIU5QNFCVGPMTGW\FGU1TFGPUXQOJN)GQTI-TGW\-NCUUG5KNDGTCWHFGT4ÒEMUGKVGPWO OGTKGTVQJPG$CPF ++p





5V)GQTIU5QNFCVGPMTGW\FGU1TFGPUXQOJN)GQTI-TGW\-NCUUG5KNDGTCWHFGT4ÒEMUGKVG6T· IGTPWOOGTCPCNVGT2GPVCIQPCNDCPFURCPIGOKVPGWGO$CPF4147 ++





5V)GQTIU5QNFCVGPMTGW\FGU1TFGPUXQOJN)GQTI#WUICDG-TGW\-NCUUG9GK­OG VCNNCWHFGT4ÒEMUGKVG<GKEJGP"Á / /" HÒT9GK­OGVCNNWPF0WOOGT/QJPG$CPF ++ #PHGTVKIWPIWPF8GTNGKJWPICWUFGO,CJT



5V )GQTIU5QNFCVGPMTGW\ FGU 1TFGPU XQO JN )GQTI -TGW\  -NCUUG /GUUKPI QJPG 6T·IGT   PWOOGTQJPG$CPF ++p+++





ex 8804



8806

8805

5V )GQTIU/GFCKNNG HÒT 6CRHGTMGKV  /QFGNN OKV 2QTVTCKV XQP <CT 0KMQNCWU ++      #WUHÒJTWPI QJPG -NCUUGPGKPVGKNWPI -WRHGT0KEMGN QJPG 6T·IGTPWOOGT CO PGWGP $CPF &C\W   HTCP\ÌUKUEJG/GFCKNNGHÒT8GTFKGPVGWOFKG&WTEJHÒJTWPIFGT8QNMUCDUVKOOWPIKP1DGTUEJNGUKGP CO$CPF 5VÒEM++





5CPMV )GQTIU/GFCKNNG HÒT 6CRHGTMGKV /GFCKNNG  -NCUUG 5KNDGT CWH FGT 4ÒEMUGKVG 6T·IGTPWOOGT   0QCPPGWGTUQYLGVKUEJGT2GPVCIQPCN$CPFURCPIG4147 ++





/GFCKNNG HÒT 'KHGT  /QFGNN OKV FGO 2QTVTCKV <CT #NGZCPFGT ++ )WUUH·NUEJWPI   FGT ITQ­GP   5KNDGTPGP/GFCKNNG&WTEJOGUUGTOOOKV$CPFCDUEJPKVV ++

 165


RUSSLAND

8807

8809

8808



/GFCKNNGHÒT'KHGT/QFGNNOKVFGO2QTVTCKV<CT0KMQNCWU++  -NGKPG5KNDGTPG/GFCKNNG 5KNDGTCPCNVGT2GPVCIQPCNDCPFURCPIGOKVPGWGO$CPF4147# ++





/GFCKNNG HÒT 'KHGT  /QFGNN OKV FGO 2QTVTCKV <CT 0KMQNCWU ++    -NGKPG 5KNDGTPG   /GFCKNNG5KNDGTCO$CPFFGU5V5VCPKUNCWU1TFGPUCPHTCP\ÌUKUEJGT-WIGNTCJG4147# ++



/WVOC­NKEJCPGKPGPHTCP\ÌUKUEJGP5QNFCVGPXGTNKGJGP



/GFCKNNGHÒT.GDGPUTGVVWPI#WUICDGOKVFGO2QTVTCKV<CT#NGZCPFGTU+FCVKGTV)WUUH·NUEJWPI

  FGT ITQ­GP UKNDGTPGP /GFCKNNG &WTEJOGUUGT  OO KO *CNUCPUCV\ OKV 5VGORGNUEJPGKFGTUKIPCVWT   OKV$CPFCDUEJPKVV +p++

8810





8812



8813

4QOCPQY'JTGP\GKEJGPHÒT#TDGKVKPFGT.CPFYKTVUEJCHV'JTGP\GKEJGP-NCUUG5KNDGTVGKNYGKUG GOCKNNKGTVCWHFGT4ÒEMUGKVG/GKUVGTRWP\G"ÊÔ" HÒT-CTN(CDGTI¾(KTOGPDG\GKEJPWPI"ÔÀÁÅÐÆÅ" FGT (KTOC (CDGTI¾ WPF "α"--QMQUJPKM5KNDGTRWP\G  <QNQVPKMK XQP  DKU  CWH FGT   4ÒEMUGKVG FGU 'KEJGPMTCP\GU GDGPHCNNU (KTOGPDG\GKEJPWPI "ÔÀÁÅÐÆÅ" /GKUVGTRWP\G "ÊÔ"   5KNDGTRWP\G  WPF MNGKPG -QMQUJPKM2WP\G CO QTKIKPCNGP $CPF KO CNVGP LGFQEJ PKEJV RCUUGPFGP   'VWK 44++



/GFCKNNG HÒT FGP -TKGI XQP  $TQP\GOGFCKNNG HÒT <KXKNKUVGP $TQP\G OKV 4GUVGP FGT QTKIKPCNGP   5EJY·T\WPICOQTKIKPCNGPCNVGPWPF\GKVIGPÌUUKUEJGP$CPFFGU5V8NCFKOKT1TFGPU 4++



&KG /GFCKNNG YWTFG CO  (GDTWCT  XQP <CT #NGZCPFGT + IGUVKHVGV FKG $TQP\GUVWHG CO  #WIWUV  &C   FKG$TQP\GOGFCKNNGCPFGTCNUDGK9'4.DGUEJTKGDGPPWTCP\KXKNG#FNKIGWPF-CWHNGWVGXGTNKGJGPYQTFGPKUVFKG \WO -TKGI DGKIGVTCIGP JCDGP KUV UKG YGUGPVNKEJ UGNVGPGT CNU FKG 5KNDGTPG /GFCKNNG FKG CP /KNKV·TCPIGJÌTKIG QJPG   7PVGTUEJKGFFGU4CPIGUXGTNKGJGPYWTFG



/GFCKNNG HÒT FGP 4WUUKUEJ6ÒTMKUEJGP -TKGI  *GNNG $TQP\GOGFCKNNG $TQP\G UVCTM   IGVTCIGPCPUQYLGVKUEJGT2GPVCIQPCN$CPFURCPIGOKVPGWGO$CPF +++





'JTGP\GKEJGP FGU 4QVGP -TGW\GU HÒT FGP 4WUUKUEJ6ÒTMKUEJGP -TKGI  #WUHÒJTWPI HÒT   %JTKUVGP5KNDGTVGKNYGKUGGOCKNNKGTVCWHFGP8QTFGTUGKVGPFGT$CPFGPFGP/GKUVGT\GKEJGP"ÈÕ"WPF5KN DGTRWP\GKO1TKIKPCNGVWKFGT(KTOC"ÕËÜÁÍÈÊÎÂÚ" -JNGDPKMQX 2#$1 ++



&KG(KTOC+YCP2GVTQXKEJ-JGNDPKMQXYWTFGCNU)QNFWPF5KNDGTYCTGPHKTOCKP5V2GVGTUDWTIIGITÒPFGVWPF  PCEJ /QUMCW XGTNGIV YQ UKG UKEJ \W GKPGT FGT YKEJVKIUVGP ICP\ 4WUUNCPFU GPVYKEMGNVG #NU *QHNKGHGTCPV DG   UEJ·HVKIVG UKG  EC  DKU  /GKUVGT WPF *CPFYGTMGT WPF GTYKTVUEJCHVGVG GKPGP ,CJTGUWOUCV\ XQP    4WDGN

166


RUSSLAND

8814 8815

8816



/GFCKNNG HÒT FGP 4WUUKUEJ,CRCPKUEJGP -TKGI  5KNDGTPG /GFCKNNG 5KNDGT CP UQYLGVKUEJGT   2GPVCIQPCN$CPFURCPIG4147 4++



&KG UKNDGTPG /GFCKNNG YWTFG CP CNNG /KNKV·TCPIGJÌTKIG WPF <KXKNKUVGP XGTNKGJGP FKG KP 2QTV #TVJWT Y·JTGPF FGT   $GNCIGTWPIXQP/CKDKU&G\GODGTUVCVKQPKGTVYCTGP



'TKPPGTWPIUOGFCKNNG\WT'KPJWPFGTVLCJTHGKGTFGU-TKGIGUXQP$TQP\GCPUQYLGVKUEJGT2GPVC IQPCN$CPFURCPIGOKVPGWGO$CPF ++





'JTGP\GKEJGPFGT)GUGNNUEJCHV\WT9KGFGTJGTUVGNNWPIFGU%JTKUVGPVWOUKO-CWMCUWU'JTGP\GKEJGP -NCUUG5KNDGTKPFGT¤UGWCRWP\KGTV#2COYQJNUR·VGTGP$CPFUVÒEM ++





-QPXQNWVXQP\YGK'JTGP\GKEJGP /GFCKNNGHÒTFGP4WUUKUEJ,CRCPKUEJGP-TKGI/GFCKNNG CWUFWPMNGT$TQP\G HÒT#PIGJÌTKIGXQP#ODWNCP\WPF-NGTWU  /GFCKNNG\WOL·JTKIGP,WDKN·WO FGU-TKGIUXQP$TQP\GDGKFG/GFCKNNGPCPPGWIGHGTVKIVGP2GPVCIQPCNDCPFURCPIGP 5VÒEM++



8819 8818

8821 8820

8822

<#4'067/#$<'+%*'0 

7PDGMCPPVGU ,WDKN·WOUCD\GKEJGP  GKPGU 4GIKOGPVU $TQP\G CP 5EJTCWDG OKV 5EJTCWD   UEJGKDGFCTCWH*GTUVGNNGTDG\GKEJPWPIFGT(KTOC'FWCTF ++



#WHITWPFGZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÒTFKGUGU'ZGORNCTNGKFGTMGKPG)GY·JTHÒT1TKIKPCNK V·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT   FGT#WMVKQPCWHOGTMUCOIGOCEJV





,GVQP CWU #PNCUU FGT -TÌPWPI FGU TWUUKUEJGP <CTGPRCCTGU 0KMQNCWU WPF #NGZCPFTC CO  /CK    5KNDGT XGTIQNFGV GVYCU DGTKGDGP  WPF GOCKNNKGTV KO 4KPI TWUUKUEJG 5KNDGTRWP\G  <QNQVPKMK   WPF/GKUVGT\GKEJGP"ÃÁ" ++



&QMVQTCPFGP#D\GKEJGP HÒT /GFK\KPKUEJG 1HHK\KGTG 'KPHCEJG #WUHÒJTWPI /GUUKPIDNGEJ XGTUKNDGTV   CP5EJTCWDGOKV5EJTCWDUEJGKDG ++



#WHITWPFGZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÒTFKGUGU'ZGORNCTNGKFGTMGKPG)GY·JTHÒT1TKIKPCNK V·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT   FGT#WMVKQPCWHOGTMUCOIGOCEJV



-TGW\HÒTFKG8GTVGKFKIGTXQP2QTV#TVJWT5KNDGT'OCKNNGOCNGTGKCP5EJTCWDGOKV5EJTCWDUEJGKDG FKGUGRWP\KGTV +p++



#WHITWPFGZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÒTFKGUGU'ZGORNCTNGKFGTMGKPG)GY·JTHÒT1TKIKPCNK V·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT   FGT#WMVKQPCWHOGTMUCOIGOCEJV



)TCFWKGTWPIU#D\GKEJGP FGT 0KMQNCGXUM[ 5EJWNG HÒT +PIGPKGWTG KP 5V 2GVGTDWTI &WTEJ   #PDTKPIWPI GKPGT ¤UG OKV 4KPI WOIGCTDGKVGV KP GKPGP #PJ·PIGT FKG TÒEMUGKVKIG 5EJTCWDG GPVHGTPV   5KNDGTGOCKNNKGTV)QNFCWHFGT4ÒEMUGKVG/GKUVGTRWP\G#2-QMQUJPKM5KNDGTRWP\G<QNQVPKMKXQP DKUWPFMNGKPG-QMQUPKM2WP\G2#$1 ++

 167


RUSSLAND

8824

8823 8825



7PDGMCPPVGU #D\GKEJGP GKPGU -KTEJGPHCJPGPVT·IGTU FGT 4WUUKUEJ1TVJQFQZGP -KTEJG 8GTUKNDGTV   VGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTV0CFGNCDIGDTQEJGP ++



#WHITWPFGZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÃ&#x2019;TFKGUGU'ZGORNCTNGKFGTMGKPG)GY·JTHÃ&#x2019;T1TKIKPCNK V·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÃ&#x2019;EMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÃ&#x2019;JTNKEJGP 8QTDGUKEJVKIWPI XQT   FGT#WMVKQPCWHOGTMUCOIGOCEJV



7PDGMCPPVGT,GVQP5KNDGTJQJNIGHGTVKIVZOO

+++



9CRRGPUEJKNFZOO$TQP\GXGTIQNFGVVGKNYGKUGGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT4Ã&#x2019;EMUGKVG HÃ&#x2019;PH*CMGP\WODGHGUVKIGP ++

 

8826 (1:2) 8827 (1:2)



2CCT1HHK\KGTU5EJWNVGTUVÃ&#x2019;EMG

5VÃ&#x2019;EM++





2CCT5EJWRRGP'RCWNGVVGP

5VÃ&#x2019;EM++



168


RUSSLAND

8828

8829

4755+5%*'4$ª4)'4-4+')   

1TFGP FGT JGKNKIGP #PPC -TGW\  -NCUUG OKV 5EJYGTVGTP $TQP\G XGTIQNFGV WPF GOCKNNKGTV   'OCKNNGOCNGTGKQJPG2WP\KGTWPIGPOKV·NVGTGO*CNUDCPFCDUEJPKVV ++



)TQ­G 1TFGPUUEJPCNNG OKV \YGK #WU\GKEJPWPIGP   -TGW\ HÒT FKG )GHGEJVG KP FGP 5VGRRGP 5KNDGT   CWHFGT4ÒEMUGKVGPWOOGTKGTV 5V)GQTIU/GFCKNNGHÒT6CRHGTMGKV/QFGNN OKV2QTVTCKV<CT 0KMQNCWU ++    /GFCKNNG  5VWHG 5KNDGT CWH FGT 4ÒEMUGKVG 6T·IGTPWOOGT  CP   QTKIKPCNGT\GKVIGPÌUUKUEJIGHGTVKIVGT<YGKGT2GPVCIQPCNURCPIG9'4.5 44++



/WVOC­NKEJ FGWVUEJG #PHGTVKIWPI CWU FGP HTÒJGP <YCP\KIGT ,CJTGP  &GT 1DGTDGHGJNUJCDGT FGT (TGKYKNNKIGP   4WUUKUEJGP 9GUVCTOGG 1DGTUV (ÒTUV #YCNQHH$GTOQPFV JCV CP GKPG 4GKJG FGT KJO WPVGTUVGNNVGP (TGKMQTRUM·ORHGT  

UQ W C CP /KVINKGFGT FGU (TGKMQTRU 4Q­DCEJ  \CTKUVKUEJG 1TFGP XGTNKGJGP UQ W C FGP 5V 5VCPKUNCWU1TFGP WPF   FGP 5V #PPGP1TFGP LGYGKNU OKV 5EJYGTVGTP $GK FKGUGP 8GTNGKJWPIGP YWTFGP LGFQEJ PWT 8GTNGKJWPIUFQMWOGPVG   ÒDGTIGDGPFKGLGYGKNKIGP+PUKIPKGPOWUUVGPUKEJFKG$GNKGJGPGPPCEJFGO'KPUCV\UGNDUVDGUEJCHHGP



&CU -TGW\ YWTFG CP FKG &QP-QUUCEMGP HÒTFKG6GKNPCJOGCPFGP·W­GTUVDNWVKIGP)GHGEJVGPKPFGP5VGRRGPXQO (GDTWCTDKU/CKXGTNKGJGP

8830

8831

8832

8833

':+. 

1TFGP FGU JN 0KMQNCWU FGU 9WPFGTV·VKIGP 1TFGPUMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO   2GPVCIQPCNDCPF ++



70+10&'451<+#.+56+5%*'0519,'64'27$.+-'0 519,'670+10  



.GPKPQTFGP/QFGNN CD )QNFVGKNYGKUGGOCKNNKGTVIOKV2NCVKPCWHNCIGCWHFGT4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGU .GPKPITCFGT /ÒP\JQHU OKV 6T·IGTPWOOGT QJPG 2GPVCIQPCNDCPFURCPIG   *'4(<'+ ++



5WYQTQY1TFGP  /QFGNN 5VGTP  -NCUUG 5KNDGT CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGU   /ÒP\JQHU KP /QUMCW WPF PKGFTKIG XKGTUVGNNKIG 6T·IGTPWOOGT CP 5EJTCWDG OKV 5EJTCWDUEJGKDG <'+    ++



#WHITWPFGZKUVKGTGPFGPITQ­GP(·NUEJWPIURTQDNGOCVKMMCPPHÒTFKGUGU'ZGORNCTNGKFGTMGKPG)GY·JTHÒT1TKIKPCNK V·V IGIGDGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÒJTNKEJGP 8QTDGUKEJVKIWPI XQT   FGT#WMVKQPCWHOGTMUCOIGOCEJV



/GFCKNNGHÒT6CRHGTMGKV#WUHÒJTWPI5KNDGTCWHFGT4ÒEMUGKVGPKGFTKIGHÒPHUVGNNKIG6T·IGTPWOOGT CPPGWGT2GPVCIQPCNDCPFURCPIG ++

 169


SAN MARINO

8834



)TQ­G1TFGPUUEJPCNNGOKVHÃ&#x2019;PH#WU\GKEJPWPIGP .GPKP1TFGP/QFGNN)QNF2NCVKPVGKNYGKUG GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG *GTUVGNNGTDG\GKEJPWPI FGU /Ã&#x2019;P\JQHU KP /QUMCW WPF 6T·IGTPWOOGT     4QVDCPPGTQTFGP  /QFGNN 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV OKP 'OCKNNGEJKR CWH FGT   4Ã&#x2019;EMUGKVG *GTUVGNNGTDG\GKEJPWPI FGU /Ã&#x2019;P\JQHU KP /QUMCW WPF 6T·IGTPWOOGT   4QVDCPPGTQTFGP    /QFGNN 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV OKP 'OCKNNGEJKR CWH FGT 4Ã&#x2019;EMUGKVG   *GTUVGNNGTDG\GKEJPWPI FGU /Ã&#x2019;P\JQHU KP /QUMCW WPF 6T·IGTPWOOGT   /GFCKNNG (Ã&#x2019;T FGP 5KGI Ã&#x2019;DGT   &GWVUEJNCPF   /GFCKNNG (Ã&#x2019;T FGP 5KGI Ã&#x2019;DGT ,CRCP <WUCOOGP OKV CNVGO #WU\GKEJPWPIUDÃ&#x2019;EJNGKP OKV   PWOOGTPINGKEJGP'KPVTCIWPIGPFGTGTUVGPFTGK#WU\GKEJPWPIGP ++



-QPXQNWV XQP  #WU\GKEJPWPIGP WPF #D\GKEJGP &CTWPVGT  5V·FVGOGFCKNNGP XQP  WPF GKP   4QVDCPPGTQTFGPXGTUEJKGFGPG/GVCNNGCWEJ5KNDGTVGKNUXGTIQNFGVVGKNUGOCKNNKGTVVGKNUCP2GPVCIQPCN DCPFURCPIGPVGKNUCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÃ&#x2019;EM++++p+++



(Ã&#x2019;T FKG #WVJGPVK\KV·V FGT 6T·IGTPWOOGTP WPF FGT 'KPVTCIWPIGP MCPP MGKPG )GY·JT Ã&#x2019;DGTPQOOGP YGTFGP &GT   +PVGTGUUGPV YKTF CWUFTÃ&#x2019;EMNKEJ CWH FKG )GNGIGPJGKV \WT CWUHÃ&#x2019;JTNKEJGP 8QTDGUKEJVKIWPI XQT FGT #WMVKQP CWHOGTMUCO   IGOCEJV



8836

5#0/#4+014'27$.+- 

<KXKN WPF /KNKV·TXGTFKGPUVQTFGP XQO JGKNKIGP /CTKPWU  /QFGNN OKV +PUEJTKHV %+8+.' '   /+.+6#4'  )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNGOCNGTGK   OKP#WUDTWEJKOXQTFGTUGKVKIGP/GFCKNNQPTKPIQJPG5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV OKP 'OCKNNGUEJ·FGP KO /GFCKNNQP CWH FGT 4Ã&#x2019;EMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC5VGHCPQ,QJPUQPKP/CKNCPFWPF4QOCP0CFGN1#0 <'+ 5VÃ&#x2019;EM++p+++ )GUVKHVGV YWTFG FGT HÃ&#x2019;PHMNCUUKIG 1TFGP OKV &GMTGV XQO  /·T\  FWTEJ FKG DGKFGP %CRKVCPK 4GIIGPVK FGT   4GRWDNKM  YWTFG FKG )TQ­OGKUVGT&GMQTCVKQP WPF FCOKV FKG #OVUKPUKIPKG FGT CNU 5VCCVUQDGTJ·WRVGT HWPIKG   TGPFGP%CRKVCPK4GIIGPVK WPFCO#RTKNFKG1TFGPUMQNNCPGGKPIGHÃ&#x2019;JTV 8INCWEJ#WVGPITWDGT/KEJCGN &KG1TFGPWPF'JTGP\GKEJGPFGT4GRWDNKM5CP/CTKPQ+P+PVGTPCVKQPCNGU/KNKVCTKC/CIC\KP0T  5HH 

170




SCHWEDEN

8840

8837

8839 8838



<KXKN WPF /KNKV·TXGTFKGPUVQTFGP XQO JGKNKIGP /CTKPWU  /QFGNN OKV +PUEJTKHV %+8+.' '   /+.+6#4' 1HHK\KGTUMTGW\)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCO$CPFOKVCWHIGNGIVGT4QUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC 4CXKQNQ  )CTFKPQ 5WEE & %TCXCP\QNC OKV CWHIGFTWEMVGO   IQNFHCTDGPGP5VCCVUYCRRGP<'+ 4+p++





4KVVGTQTFGPFGTJGKNKIGP#ICVJC-QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGK GKPGMNGKPG#DRNCV\WPIKPFGTITÒPGP'OCKNNGQJPG*CNUDCPF<'+ ++





4KVVGTQTFGPFGTJGKNKIGP#ICVJC1HHK\KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKCO $CPFOKVCWHIGNGIVGT4QUGVVG\WUCOOGPOKV-PQRHNQEJTQUGVVGKO1TKIKPCNGVWKFGT(KTOC#NDGTVKKP/CK NCPF<'+ ++



8GTFKGPUVOGFCKNNG$TQP\GPG8GTFKGPUVOGFCKNNG/'4+61$TQP\GCO$CPF



&CU\YGKVG/QFGNNKUVKPGEJV)QNFPKEJVJ·WHKI\WHKPFGP



++

8841 (1:1)

5%*9'&'0-¤0+)4'+%* 14&'0 

-ÌPKINKEJGT5GTCRJKPGP1TFGP5COONGTCPHGTVKIWPIFGT1TFGPUMQNNCPGDGUVGJGPFCWU5GTCRJKPWPF  2CVTKCTEJGPMTGW\)NKGFGTP $TQP\G XGTIQNFGV OGJTGTG )NKGFGT \GKIGP CWH 8QTFGT WPFQFGT   4ÒEMUGKVG NGKEJVG 1Z[FCVKQPUURWTGP CWH FKG -TGW\INKGFGT $TQP\G XGTIQNFGV WPF GOCKNNKGTV OGJTG   )NKGFGTOKVQDGTHN·EJNKEJGP'OCKNNGEJKRUGKPG-GVVGPXGTDKPFWPIHGJNVOKV8GTUEJNWUUJCMGP 4++p+++  'KP F·PKUEJGT 5COONGT JCV KP FGO GT ,CJGP WPVGT 8QTNCIG GKPGT 1TKIKPCNMQNNCPG XKGT FKGUGT QTKIKPCN WPF   FGVCKNIGVTGWGP5COONGTCPHGTVKIWPIGPJGTUVGNNGPNCUUGP'KP8GTINGKEJOKVFGOKO/WUGWOFGT'JTGPNGIKQPWPFFGT 4KVVGTQTFGP KP 2CTKU CWUIGUVGNNVGP 1TKIKPCNGZGORNCT GTICD GKPG PCJG\W XQNNUV·PFKIG ªDGTGKPUVKOOWPI DGKFGT    -QNNCPGP DKU JKP \W FGP 8GTUEJNWUUJCMGP  'KPG GKPOCNKIG )GNGIGPJGKV GKPG UQNEJG OWUGCNG WPF CWEJ CNU    5COONGTCPHGTVKIWPI GZVTGO UGNVGPG -QNNCPG \W GTYGTDGP CNU 'TUCV\UVÒEM HÒT GKP KO 1TKIKPCN CDUQNWV WPGTJ·NVNKEJGU    'ZGORNCT

171


SCHWEDEN

8842 (1:1)



-ÌPKINKEJGT5GTCRJKPGP1TFGP1TFGPUUGVDGUVGJGPFCWU-NGKPQF)QNFGOCKNNKGTVI\YGKMCWO UKEJVDCTGQDGTHN·EJNKEJG'OCKNNGEJKRUWPFGKPG*CCTTKUUKPFGP-TGW\CTOGPCOQTKIKPCNGP5EJWNVGTDCPF WPF$TWUVUVGTP#WUICDG OKV2CVTKCTEJGPMTGW\GPCWHFGP-TGW\CTOGP 5KNDGTVGKNYGKUG TGRGTEKGTVVGKNYGKUGXGTIQNFGV/GFCKNNQP\GPVTWOGOCKNNKGTV*CCTTKUUGWPFFCFWTEJDGFKPIVFWPMNG(NGE MGPKO/GFCKNNQPHGNF<GPVTWOU#WHNCIGP)QNFFKG#WHNCIGPCEJVHCEJXGTUEJTCWDVCWHFGT4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPIFGT(KTOC%(%CTNOCPKP5VQEMJQNOCP0CFGN<'+ ++  #O  (GDTWCT  UVKHVGVG -ÌPKI (TGFGTKEM + XQP 5EJYGFGP CWU FGO *CWUG *QNUVGKP)QVVQTR  KP 'TKPPGTWPI   GKPGU ·NVGTGP 5GTCRJKPGPQTFGPU FGT \YGKVGP *·NHVG FGU 5GEJ\GJPVGP ,CJTJWPFGTVU FGP GKPMNCUUKIGP 1TFGP 'PVURTG   EJGPF GKPGT 'TMN·TWPI FGU 5EJYGFKUEJGP 4GKEJUVCIGU XQO  ,WPK  FWTHVG GT CD  ,CPWCT  CWUUEJNKG­NKEJ   #WUN·PFGTP XGTNKGJGP YGTFGP 5GKV  FÒTHGP YKGFGT /KVINKGFGT FGT UEJYGFKUEJGP MÌPKINKEJGP (COKNKG KP FGP   1TFGPCWHIGPQOOGPYGTFGP



-ÌPKINKEJGT5GTCRJKPGP1TFGP*CNUDCPF\WO#D\GKEJGPHÒTFKG*CNUFGMQTCVKQPFGT1TFGPDGCOVGPQFGT FGU4GKEJUJGTQNFUOKV/GVCNNUEJNKG­GP 4++

&KGUG$CPFMCPPCWEJHÒTFKGITQ­G-ÌPKIU/GFCKNNGXGTYGPFGVYGTFGP



8844 (1:1)



-ÌPKINKEJGT 5GTCRJKPGP1TFGP -NGKPGU -TGW\ FGT 1TFGPUDGCOVGP )QNF GOCKNNKGTV  I CO   QTKIKPCNGP$CPF<'+ 444+  W­GTUV SWCNKVCVKXG #PHGTVKIWPI FGT GZVTGO UGNVGPGP &GMQTCVKQP CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWP   FGTVUCWUFGT4GIKGTWPIU\GKV-ÌPKI1UMCTU++FGTXQPDKUTGIKGTVJCV8GTINGKEJG014&'085

172


SCHWEDEN

8847 8845

8845



-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN FGU 1TFGPU UGKV   -NGKPQF \WO )TQ­MTGW\ )QNF HGKPUV   \KUGNKGTV WPF GOCKNNKGTV  I CWH FGO $CPFTKPI HTCP\ÌUKUEJG +ORQTVRWP\G HÒT )QNF UGKV    7JWRWP\GOKVECONCPIGOQTKIKPCNGPCNVGP5EJWNVGTDCPFCDUEJPKVV<'+ +p++ 



-ÌPKINKEJGT5EJYGTV1TFGP.GGTGU'VWK\WO$TWUVUVGTPFGU-QOOCPFGWTU-NCUUGFGU*GTUVGNNGTU %(%CTNOCPKP5VQEMJQNOOKVIQNFHCTDGPGT#WHUEJTKHV-51-+-4#5%*#0 ++



'VWKCWUFGOGTUVGP8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVU



-ÌPKINKEJGT5EJYGTV1TFGP/QFGNNFGU1TFGPU UGKV $TWUVUVGTP\WO-QOOCPFGWT-NCUUG #WUICDG OKVINCVVGP-TGW\CTOHGNFGTPUGKV ZOO5KNDGTVGKNYGKUGXGTIQNFGVVGKNYGKUG GOCKNNKGTVCWHFGO0CFGNDQEMOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCPKP5VQEMJQNO WPF,CJTGURWP\G3HÒT CP0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%(%CTNOCP#$ <'+ +p++



8848



-ÌPKINKEJGT5EJYGTV1TFGP/QFGNNFGU1TFGPU UGKV -QOOCPFGWTMTGW\ZOO )QNFGOCKNNKGTVI OKV*CNUDCPF CWHFGT8QTFGTUGKVG\YGKMNGKPGQDGTHN·EJNKEJG'OCKNNGEJKRUWPF OKP*CCTTKUUGCWHGKPGO-TGW\CTOUQYKGOKP#DRNCV\WPIGPKPFGTDNCWGP'OCKNNGFGT4ÒEMUGKVGFGT 5EJYGTVGTCOQTKIKPCNGPCNVGPOODTGKVGP*CNUDCPF<'+ 44++  'ZVTGOUGNVGPGHTÒJG#PHGTVKIWPICWUFGOGTUVGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVUKPGKPGTHÒTFCUJQJG#NVGT FGU'ZGORNCTUGTUVCWPNKEJGP'TJCNVWPI

173


SCHWEDEN

8850

8849



8849

-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN FGU 1TFGPU UGKV   -QOOCPFGWTMTGW\ )QNF GOCKNNKGTV   IKO8QTFGTUGKVGP/GFCKNNQPMNGKPGT'OCKNNGEJKRQJPG*CNUDCPF<'+ 4++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVUKPUGJTUEJÌPGT'TJCNVWPI



-ÌPKINKEJGT5EJYGTV1TFGP/QFGNN UGKV -QOOCPFGWTMTGW\)QNFGOCKNNKGTVICWH FGO4CPFFGUNKPMGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCP-HÒT EVQJPG,CJTGURWP\G COIGP·JVGP*CNUDCPFKOQTKIKPCNG8GTNGKJWPIUGVWKFGT(KTOC%(%CTNOCPKP 5VQEMJQNO<'+ +p++



8852

8852 8851 Rs.





-ÌPKINKEJGT5EJYGTV1TFGP/QFGNN UGKV -QOOCPFGWTMTGW\)QNFGOCKNNKGTVICWH FGO4CPFFGUNKPMGPQDGTGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCP- HÒTEVQJPG,CJTGURWP\G OKVQTKIKPCNGO\GKVIGPÌUUKUEJGPIGVTCIGPGP*CNUDCPFCDUEJPKVVKO'VWKFGU *QHLWYGNKGTU5CO2GVVGTUUQPKP0[MÌRKPI<'+ +p++



-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   4KVVGTMTGW\  #WUHÒJTWPI QJPG -ÒIGNEJGP CP   FGP -TGW\CTOGPFGP  )QNF GOCKNNKGTV  I \YGK OKP #WUDTÒEJG KP FGT 'OCKNNG FGT 5EJYGTVGT   ITQ­GT %JKR KO /GFCKNNQP FGT 4ÒEMUGKVG OKV UVCTTGT ¤UG WPF GKPIGJ·PIVGO $CPFTKPI CO UR·VGTGP   $CPF<'+ +p++



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGO GTUVGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU KP VTQV\ FGU #NVGTU JGTXQTTC   IGPFGT'TJCNVWPI

174


SCHWEDEN

8855

8853

8856

8858

8854 8857



-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   4KVVGTMTGW\  #WUHÒJTWPI QJPG -ÒIGNEJGP CP   FGP-TGW\CTOGPFGP )QNFGOCKNNKGTVIMCWOUKEJVDCTGOKP*CCTTKUUGKPFGTYGK­GP'OCKNNGOKV UVCTTGT¤UGWPFGKPIGJ·PIVGO$CPFTKPI<'+ 44+p++



-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   4KVVGTMTGW\  #WUHÒJTWPI QJPG -ÒIGNEJGP CP   FGP-TGW\CTOGPFGP )QNFGOCKNNKGTVIMCWOUKEJVDCTGOKP*CCTTKUUGWPF-TCV\GTKPFGTYGK­GP 'OCKNNGOKVIGUEJNQUUGPGO$CPFTKPIFWTEJFGP4GKEJUCRHGNFGT-TQPGCOQTKIKPCNGPCNVGP\GKVIGPÌUUK UEJGP$CPF<'+ 4+p++



-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   4KVVGTMTGW\  #WUHÒJTWPI QJPG -ÒIGNEJGP CP   FGP-TGW\CTOGPFGP )QNFGOCKNNKGTVICWHFGT4ÒEMUGKVGMCWOUKEJVDCTGOKP*CCTTKUUGKPFGT YGK­GP'OCKNNGCOQTKIKPCNGPCNVGP\GKVIGPÌUUKUEJGP$CPF<'+ 4+p++



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGO GTUVGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU KP VTQV\ FGU #NVGTU JGTXQTTC   IGPFGT'TJCNVWPI



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGO \YGKVGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU KP VTQV\ FGU #NVGTU JGTXQT   TCIGPFGT'TJCNVWPI



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU







-ÌPKINKEJGT5EJYGTV1TFGP/QFGNN UGKV 4KVVGTMTGW\ CD4KVVGTMTGW\-NCUUG )QNF GOCKNNKGTVICNVG4GRCTCVWTUVGNNGDGKFGTTGEJVGP5EJYGTVMNKPIGCWHFGO4CPFFGUNKPMGPWPVGTP -TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCP-HÒTEVQJPG,CJTGURWP\G  QJPG$CPFKO1TKIKPCNGVWKFGU*QHLWYGNKGTU%(%CTNOCPKP5VQEMJQNO<'+ +p++



-ÌPKINKEJGT5EJYGTV1TFGP/QFGNN UGKV 4KVVGTMTGW\ CD4KVVGTMTGW\-NCUUG )QNF GOCKNNKGTVI OKV$CPF CWHFGO4CPFFGUNKPMGPWPVGTP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(% HÒTFGP*GTUVGNNGT%CTNOCP-HÒTEVQJPG,CJTGURWP\G COIGP·JVGP$QIGPDCPFKO1TKIKPCNGVWK FGU*QHLWYGNKGTU%(%CTNOCPKP5VQEMJQNO<'+ +p++



-ÌPKINKEJGT5EJYGTV1TFGP/QFGNN UGKV 4KVVGTMTGW\ CD4KVVGTMTGW\-NCUUG )QNF GOCKNNKGTVI*CCTTKUUKPFGTYGK­GP'OCKNNGFGT4ÒEMUGKVGGKPGU#TOUUQYKGOKP#WUDTWEJKP FGTDNCWGPDCWGP'OCKNNGFGT4ÒEMUGKVGQJPG2WP\KGTWPICO$CPFKO1TKIKPCNGVWKFGU*QHLWYGNKGTU %(%CTNOCPKP5VQEMJQNO<'+ ++p

 175


SCHWEDEN

8859 8860



8861

8862

-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV 5EJYGTVGTP UGKV      #WUHÒJTWPI OKV UKNDGTPGO 8QTFGTUGKVGPOGFCKNNQP  5KNDGT 8QTFGTUGKVGPOGFCKNNQP 5KNDGT GOCKNNKGTV   QJPG2WP\KGTWPICO$CPF<'+ +p++



'UFÒTHVGUKEJJKGTDGKWOGKPG#PHGTVKIWPICWUFGT\YGKVGP*·NHVGFGU0GWP\GJPVGP,CJTJWPFGTVUJCPFGNP







-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV 5EJYGTVGTP UGKV     #WUICDG OKVIQNFGPGO8QTFGTUGKVGPOGFCKNNQP 5KNDGT8QTFGTUGKVGPOGFCKNNQP)QNFGOCKNNKGTVQJPG 2WP\KGTWPICO$CPF<'+ +p++



-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV 5EJYGTVGTP UGKV     #WUICDG OKVIQNFGPGO8QTFGTUGKVGPOGFCKNNQP 5KNDGT8QTFGTUGKVGPOGFCKNNQP)QNFGOCKNNKGTVCWHFGT 4ÒEMUGKVGFGT#MCPVJWU#ITCHHGOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCP5HÒT5KNDGT  CO$CPF<'+ +p++



-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV 5EJYGTVGTP UGKV     #WUHÒJTWPI OKVIQNFGPGO8QTFGTUGKVGPOGFCKNNQP 5KNDGT8QTFGTUGKVGPOGFCKNNQP)QNFGOCKNNKGTVCWH FGT4ÒEMUGKVGFGT#MCPVJWU#ITCHHGOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCP5HÒT 5KNDGT CO$CPF<'+ +p++



8865 8863





8866

8867 8864

-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV 5EJYGTVGTP UGKV      #WUHÒJTWPI OKV IQNFGPGO 8QTFGTUGKVGPOGFCKNNQP  5KNDGT 8QTFGTUGKVGPOGFCKNNQP )QNF GOCKNNKGTV   QJPG2WP\KGTWPICOIGP·JVGP$QIGPDCPF<'+ +p++



-ÌPKINKEJGT 5EJYGTV1TFGP  /QFGNN UGKV   5EJYGTVGTMTGW\ OKV 5EJYGTVGTP UGKV     #WUHÒJTWPI OKVIQNFGPGO8QTFGTUGKVGPOGFCKNNQP 5KNDGT8QTFGTUGKVGPOGFCKNNQP)QNFGOCKNNKGTVCWH FGT4ÒEMUGKVGFGT#MCPVJWU#ITCHHGOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCP5HÒT 5KNDGT CO$CPFOKV0CFGN<'+ +p++





-ÌPKINKEJGT5EJYGTV1TFGP5KNDGTPG5EJYGTVOGFCKNNG·NVGTG#WUHÒJTWPIOKVMNGKPGTOKVVGNU5EJCTPKGT DGHGUVKIVGT-ÌPKIUMTQPG5KNDGTCOCNVGPQTKIKPCNGP$CPF<'+ 4++





-ÌPKINKEJGT 5EJYGTV1TFGP 5KNDGTPG 5EJYGTVOGFCKNNG·NVGTG#WUHÒJTWPIOKVMNGKPGTGT-ÌPKIUMTQPG 5KNDGTCOCNVGPQTKIKPCNGP$CPF<'+ ++





-ÌPKINKEJGT 5EJYGTV1TFGP 5KNDGTPG 5EJYGTVOGFCKNNG·NVGTG#WUHÒJTWPIOKVMNGKPGTGT-ÌPKIUMTQPG 5KNDGTCOCNVGPQTKIKPCNGP$CPF<'+ ++



176


SCHWEDEN

8869

8870

8868



-ÌPKINKEJGT 0QTFUVGTP1TFGP -NGKPQF \WO )TQ­MTGW\ )QNF GOCKNNKGTV  I QJPG 2WP\KGTWPI   QJPG5EJWNVGTDCPF<'+ +p++





-ÌPKINKEJGT 0QTFUVGTP1TFGP $TWUVUVGTP \WO )TQ­MTGW\  #WUICDG KPQHHK\KGNNG #WUHÒJTWPI KP   /GVCNN DKU    Z  OO 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV CWH FGT 4ÒEMUGKVG XGTIQNFGV CP   0CFGN<'+ 4+p++



*KGTDGK JCPFGNV GU UKEJ WO GKPG KPQHHK\KGNNG CNUQ PKEJV XGTNKGJGPG UQPFGTP RTKXCV DGUEJCHHVG #WUHÒJTWPI KP GKPGT   #PHGTVKIWPI CWU FGO FTKVVGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU &C DKU  FCU )TQ­MTGW\ QHHK\KGNN OKV IG   UVKEMVGP$TWUVUVGTPGPXGTNKGJGPYQTFGPKUVYCTFKGRTKXCVG$GUEJCHHWPIXQP/GVCNNUVGTPGPWPWOI·PINKEJ



-ÌPKINKEJGT0QTFUVGTP1TFGP$TWUVUVGTP\WO)TQ­MTGW\#WUICDG OKVINCVVGP-TGW\CTOHGNFGTP UGKV    Z  OO 5KNDGT CWH FGO 0CFGNDQEM OGJTHCEJ RWP\KGTV W C %(% HÒT FGP   *GTUVGNNGT%CTNOCPKP5VQEMJQNOWPF,CJTGURWP\G+HÒT CP0CFGN<'+ +p++



8871 8872



-ÌPKINKEJGT0QTFUVGTP1TFGP$TWUVUVGTP\WO-QOOCPFGWT-NCUUG#WUICDG OKVDTKNNCPVKGTVGP -TGW\CTOGP ITÌ­GTG#WUHÒJTWPI CDEC ZOO5KNDGTDTKNNCPVKGTV WPFTGRGTEKGTVQJPG2WP\KGTWPICP0CFGN<'+ ++



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



-ÌPKINKEJGT0QTFUVGTP1TFGP$TWUVUVGTP\WO-QOOCPFGWT-NCUUG#WUICDG OKVINCVVGP-TGW \CTOHGNFGTPUGKV 5KNDGTCWHFGO0CFGNDQEMOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT %CTNOCP5HÒT5KNDGTWPF,CJTGURWP\G3HÒT CP0CFGNKO1TKIKPCNGVWKFGU*QHLWYGNKGTU%( %CTNOCPKP5VQEMJQNO<'+ +p++

 177


SCHWEDEN

8873





8874

-ÌPKINKEJGT0QTFUVGTP1TFGP-QOOCPFGWTMTGW\)QNFGOCKNNKGTVICWHFGO4CPFFGUWPVGTGP -TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCP-HÒTFGP(GKPIQNFIGJCNVWPF ,CJTGURWP\G$HÒT COUEJYCT\GPIGP·JVGP*CNUDCPFOKV/GVCNNUEJNKG­GPKO1TKIKPCNGVWKFGU *QHLWYGNKGTU%(%CTNOCPKP5VQEMJQNO<'+ +p++



-ÌPKINKEJGT 0QTFUVGTP1TFGP -QOOCPFGWTMTGW\ )QNF GOCKNNKGTV  I QJPG 2WP\KGTWPI CO   QTKIKPCNGPUEJYCT\GPGVYCUXGTHNGEMVGP*CNUDCPFOKV/GVCNNUEJNKG­GP<'+ +p++



8875

8876 8877







178

-ÌPKINKEJGT 0QTFUVGTP1TFGP 4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV  I  

OKV $CPF  CWH FGO 4CPF FGU WPVGTGP -TGW\CTOU OGJTHCEJ RWP\KGTV W C %(% HÒT FGP *GTUVGNNGT   %CTNOCP - HÒT  EV WPF ,CJTGURWP\G /HÒT COUEJYCT\GP$CPFKO1TKIKPCNGVWKFGU *QHLWYGNKGTU%(%CTNOCPKP5VQEMJQNO<'+ +p++



-ÌPKINKEJGT 0QTFUVGTP1TFGP 4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV  I  

QJPG $CPFTKPI  CWH FGO 4CPF FGU WPVGTGP -TGW\CTOU OGJTHCEJ RWP\KGTV W C %(% HÒT FGP   *GTUVGNNGT%CTNOCP-HÒTEVWPF,CJTGURWP\G0HÒT COUEJYCT\GP$CPFOKV0CFGN <'+ +p++



-ÌPKINKEJGT 0QTFUVGTP1TFGP 4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV  I  

OKV$CPF QJPG2WP\KGTWPICWHFGT4ÒEMUGKVGGKPGU-TGW\CTOU'OCKNNGUEJCFGPCOUEJYCT\GP$CPF <'+ +p+++++




SCHWEDEN

8881 (1:1)

8878

8879

8882 8880 (1:1)





-ÌPKINKEJGT 0QTFUVGTP1TFGP 4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF GOCKNNKGTV  I  

QJPG $CPFTKPI  CWH FGT 4ÒEMUGKVG MCWO UKEJVDCTGT *CCTTKUU KP GKPGO -TGW\CTO QJPG 2WP\KGTWPI   QJPG$CPFTKPIWPFQJPG$CPF<'+ +p++



-ÌPKINKEJGT0QTFUVGTP1TFGP4KVVGTMTGW\ UGKV4KVVGTMTGW\-NCUUG 5KNDGTXGTIQNFGV/GFCKN NQPU )QNF GOCKNNKGTV GKPG 2GTNG FGT -TQPGPTÒEMUGKVG GVYCU DGUEJ·FKIV QJPG 2WP\KGTWPI CO DNCWGP   $CPFOKVUEJOCNGPIGNDGP4CPFUVTGKHGP UGKV <'+ 4+p++



&KG4KVVGTMTGW\G-NCUUGKPXGTIQNFGVGO5KNDGTUKPFYGKVCWUUGNVGPGT\WHKPFGPCNUFKGGEJVIQNFGPGP'ZGORNCTG



-ÌPKINKEJGT 0QTFUVGTP1TFGP /KPKCVWT FGU 1TFGPUMTGW\GU  Z  OO  )QNF GOCKNNKGTV CO   $·PFEJGPCWHFGT4ÒEMUGKVG6TCIGMPQRH ++





-ÌPKINKEJGT 0QTFUVGTP1TFGP /KPKCVWT FGU 1TFGPUMTGW\GU  Z  OO  )QNF GOCKNNKGTV CO   $·PFEJGPCWHFGT4ÒEMUGKVG6TCIGMPQRH ++





-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV $TWUVUVGTP\WO-QOOCPFGWT-NCUUG#WUICDG

OKV DTKNNCPVKGTVGP -TGW\CTOGP     ITÌ­GTG #WUHÒJTWPI  Z  OO  OKV MNGKPGTGT   -QTPICTDG EC   5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV QJPG2WP\KGTWPICP0CFGN<'+ ++



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

8884





8883

8884

-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV $TWUVUVGTP\WO-QOOCPFGWT-NCUUG#WUICDG

OKV DTKNNCPVKGTVGP -TGW\CTOGP     ITÌ­GTG #WUHÒJTWPI  Z  OO  OKV ITÌ­GTGT   -QTPICTDG EC   5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV QJPG 2WP\KGTWPI CP &QRRGNPCFGN   $74-'5HH1#0581.2'5<'+<'+ ++



-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV -QOOCPFGWTMTGW\)QNFGOCKNNKGTVICWHFGO 4CPFFGUWPVGTGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT%CTNOCP-HÒTEV WPF,CJTGURWP\G+HÒT COIGP·JVGP*CNUDCPFKO1TKIKPCNGVWKFGU*QHLWYGNKGTU%(%CTNOCP KP5VQEMJQNO<'+ +p++

 179


SCHWEDEN

8887

8886 8885







-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTV CWH FGO 4CPF FGU NKPMGP -TGW\CTOU OGJTHCEJ RWP\KGTV W C %(% HÒT FGP *GTUVGNNGT   %CTNOCP - HÒT  EV ,CJTGURWP\G # HÒT   CO $CPF OKV 0CFGN KO 1TKIKPCNGVWK FGU   *QHLWYGNKGTU%(%CTNOCPKP5VQEMJQNO<'+ +p++



-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVICWHFGO4CPFFGUNKPMGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(%HÒTFGP*GTUVGNNGT %CTNOCP-HÒTEV,CJTGURWP\G;HÒT OKV$CPFUVÒEMKO1TKIKPCNGVWKFGU*QHLWYGNKGTU% (%CTNOCPKP5VQEMJQNO<'+ +p++



-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVI QJPG$CPFTKPI CWHFGO4CPFFGUNKPMGP-TGW\CTOUOGJTHCEJRWP\KGTV WC%(% HÒTFGP*GTUVGNNGT%CTNOCP-HÒTEV,CJTGURWP\G;HÒT CO$CPFOKV0CFGN\WUCOOGP OKV $CPFUVÒEM WPF /KPKCVWT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP OKV 4GXGTUMPQRH KO   1TKIKPCNGVWKFGU*QHLWYGNKGTU%(%CTNOCPKP5VQEMJQNO<'+ +p++



8890 8888

8889

8891



-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVI OKV$CPF QJPG2WP\KGTWPIGPCO$CPF<'+ +p++





-ÌPKINKEJGT 9CUC1TFGP  /QFGNN UGKV   4KVVGTMTGW\ UGKV  4KVVGTMTGW\  -NCUUG  )QNF   GOCKNNKGTVIQJPG2WP\KGTWPIQJPG$CPF<'+ +p++





-ÌPKINKEJGT9CUC1TFGP/QFGNN UGKV 4KVVGTMTGW\ UGKV4KVVGTMTGW\-NCUUG 5KNDGT XGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVOGJTGTG'OCKNNGEJKRUCWH8QTFGTWPF4ÒEMUGKVGGKPG2GTNGFGT -TQPGDGUEJ·FKIVQJPG2WP\KGTWPICO$CPF<'+ ++p+++



&KG4KVVGTMTGW\G-NCUUGKPXGTIQNFGVGO5KNDGTUKPFYGKVCWUUGNVGPGT\WHKPFGPCNUFKGGEJVIQNFGPGP'ZGORNCTG



180

-ÌPKINKEJGT 9CUC1TFGP )TQ­G )QNFGPG 9CUC/GFCKNNG )TÌ­G   &WTEJOGUUGT  OO )QNF    I QJPG $CPFTKPI  OKV 5VGORGNUEJPGKFGT\GKEJGP .# KO 4CPF RWP\KGTV /,8 )7.&   

-ÌPKINKEJG/ÒP\GKP5VQEMJQNO OKV4CPFFGNNGCO$CPFOKV0CFGNKO'VWKFGU*QHLWYGNKGTU%( %CTNOCPKP5VQEMJQNO<'+ 4++




SCHWEDEN

8892 8893 (1:1)

8893 (1:1)



-ÌPKINKEJGT 9CUC1TFGP -NGKPG )QNFGPG 9CUC/GFCKNNG )TÌ­G   &WTEJOGUUGT  OO )QNF   I QJPG$CPFTKPI QJPG2WP\KGTWPICO$CPF<'+ ++



.QXKUC7NTKMC'JTGP\GKEJGPFGU#FNKIGP,WPIHTCWGPUVKHVGU\W8CFUVGPCNVGTG#WUHÒJTWPIOKVTQV YGK­GP (NCOOGP \YKUEJGP FGP -TGW\CTOGP )QNF GOCKNNKGTV  I OKV 5EJNGKHG  HGKPG   'OCKNNGOCNGTGK OGJTGTG MCWO UKEJVDCTG 'OCKNNGEJKRU KP FGT FWPMGNDNCWGP 'OCKNNG FGU 8QTFGT WPF   4ÒEMUGKVGPOGFCKNNQPUCPCNVGT&COGPUEJNGKHG ++ 



*GTXQTTCIGPFG#PHGTVKIWPIYQJNCWUFGT\YGKVGP*·NHVGFGU,CJTJWPFGTVU  #O  /CK  GTJKGNVGP FKG GTUVGP 5VKHVUHT·WNGKP FGU DGTGKVU  IGITÒPFGVGP CDGT PQEJ PKEJV GTTKEJVGVGP    ,WPIHTCWGPUVKHVGU 1VVKNKCPC )T·HKP .CIGTDGTI IGD 8GNNKPIM CNU GTUVG DVKUUKP IGUV   %JCTNQVVC *COKNVQP CH    *CIGD[WPF/CTKC(CNMGPDGTICH6T[UVQTRCWUFGT*CPFXQP-ÌPKIKP.QXKUC7NTKMCXQP5EJYGFGP  FGT IGDQTGPGP 2TKP\GUUKP .QWKUG 7NTKMG XQP $TCPFGPDWTI2TGW­GP WPF 5EJYGUVGT (TKGFTKEJU FGU )TQ­GP FKG PGW    IGUVKHVGVGP+PUKIPKGP&CU$CPFKUVPQTOCNGTYGKUGYGK­OKVJKOOGNDNCWGP4CPFUVTGKHGPDGKDGUQPFGTGP8GTFKGPUVGP MQPPVGFCU-TGW\CWEJCP*GTTGPXGTNKGJGPYGTFGPFKGGUFCPPGKPGO$CPFKPWOIGMGJTVGT(CTDHQNIG JKOOGNDNCW OKVYGK­GP4CPFUVTGKHGP CO*CNUGVTWIGP(ÒTIKDV)TKV\PGTKP-.2*GKPG<CJNXQP5VKHVUHT·WNGKPCP

8894

8895 (1:1)



8895 (1:1)

.QXKUC7NTKMC'JTGP\GKEJGPFGU#FNKIGP,WPIHTCWGPUVKHVGU\W8CFUVGPCNVGTG#WUHÒJTWPIOKVTQV YGK­GP (NCOOGP \YKUEJGP FGP -TGW\CTOGP )QNF GOCKNNKGTV HGKPG 'OCKNNGOCNGTGK OGJTGTG MNGKPG   'OCKNNGUEJ·FGPCWH8QTFGTWPF4ÒEMUGKVGQJPG$CPF-ª0-.2*5HH6CH:+8 +++ #PHGTVKIWPIYQJNCWUFGT\YGKVGP*·NHVGFGU,CJTJWPFGTVU





.QXKUC7NTKMC'JTGP\GKEJGP FGU #FNKIGP ,WPIHTCWGPUVKHVGU \W 8CFUVGPC ,ÒPIGTG #WUHÒJTWPI OKV   IQNFYGK­GP (NCOOGP \YKUEJGP FGP -TGW\CTOGP )QNF GOCKNNKGTV  I HGKPG 'OCKNNGOCNGTGK CO   CNVGP*CNUDCPF 4+p++  *GTXQTTCIGPFG #PHGTVKIWPI YQJN WO  &KG UR·VGTGP #WUHÒJTWPIGP UKPF YGKVCWU UGNVGPGT \W HKPFGP CNU FKG   ·NVGTGP

181


SCHWEDEN

8897

8896



8899

8900

#OCTCPVJGP1TFGP )TQ­GU 1TFGPUMTGW\ HÒT *GTTGP $TQP\G XGTIQNFGV CO YGK­GP 5EJWNVGTDCPF HÒT   *GTTGPOKVJGNNDNCWGP5GKVGPUVTGKHGP ++



&GT JCNDQHHK\KGNNG XQP -ÌPKIKP %JTKUVKPG 9CUC  IGUVKHVGVG 1TFGP YKTF CWEJ JGWVG PQEJ XGTNKGJGP 5Q JCV KJP   -TQPRTKP\GUUKP 8KEVQTKC \W KJTGO  )GDWTVUVCI GTJCNVGP DGXQT UKG CP KJTGO  )GDWTVUVCI 'TNCPIWPI KJTGT   8QNNL·JTKIMGKV KPFGP5GTCRJKPGP1TFGPCWHIGPQOOGPYQTFGPKUV  &KG \CJNTGKEJGP 5VWHGP FGU 1TFGPU YGTFGP UQYQJN FWTEJ FKG )TÌ­G FGT 1TFGPUMTGW\G YKG CWEJ FWTEJ FKG    WPVGTUEJKGFNKEJGP(CTDGPFGT$·PFGTCWUIGFTÒEMV



#OCTCPVJGP1TFGP )TQ­GU 1TFGPUMTGW\ HÒT &COGP $TQP\G XGTIQNFGVCOYGK­GP5EJWNVGTDCPFHÒT &COGPOKVJGNNDNCWGP5GKVGPUVTGKHGP ++





.GGTGU 'VWK HÒT GKP -QOOCPFGWTMTGW\ OKV 2NCV\ HÒT GKP $TWUVUVGEMMTGW\ XQP % ( %CTNOCP KP   5VQEMJQNO  4++



'U JCPFGNV UKEJ JKGTDGK XKGNNGKEJV WO GKP 'VWK HÒT GKPGP 5GV FGU 1TFGPU %CTNU :+++ QFGT FGT 5EJYGFKUEJGP )GPQU   UGPUEJCHVFGU,QJCPPKVGTQTFGPU

'*4'0<'+%*'070&/'&#+..'0 

)GF·EJVPKU'JTGP\GKEJGP\WO)GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK$TQP\GXGTIQNFGV WPFGOCKNNKGTVCO1TKIKPCNDCPF-ª0.¤9)TWRRG%6*145H ++



6JQTPKVIKDVKP6*14GKPG8GTNGKJWPIU\CJNXQPCP



)GF·EJVPKU'JTGP\GKEJGP \WO  )GDWTVUVCI -ÌPKI )WUVCXU 8 CO  ,WPK  )GF·EJVPKU   'JTGP\GKEJGP \WO  )GDWTVUVCI -ÌPKI )WUVCXU 8 CO  ,WPK  5KNDGT XGTIQNFGV CWH FGT   4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QHÒTFGP*GTUVGNNGT5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G: HÒT   CO GVYCU \GTUEJNKUUGPGP 1TKIKPCNDCPF KO IQNFGP DGFTWEMVGP 1TKIKPCNGVWK FGT (KTOC   %%5RQTTQPI%QKP5VQEMJQNO-ª0.¤9)TWRRG%6*145H ++



6JQTPKVIKDVKP6*14GKPG8GTNGKJWPIU\CJNXQPCP

8901



8902

)GF·EJVPKU'JTGP\GKEJGP \WO  )GDWTVUVCI -ÌPKI )WUVCXU 8+ #FQNH CO  0QXGODGT    5KNDGTOKV5VGORGNUEJPGKFGT\GKEJGP.*KO4CPFOGJTHCEJRWP\KGTV /,8HÒTFKG-ÌPKINKEJG/ÒP\GKP 5VQEMJQNO5+.8'4WPF CP&COGPUEJNGKHGOKV0CFGNKO'VWK-ª0.¤9)TWRRG% ++



6JQTPKVIKDVKP6*14GKPG8GTNGKJWPIU\CJNXQPCP



182

/GFCKNNG HÒT 'KHGT WPF 4GFNKEJMGKV KO 4GKEJUFKGPUV /QFGNN OKV 2QTVTCKV -ÌPKI )WUVCXU 8     5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJGKFGT\GKEJGP#. HÒT#.KPFGPDGTI KO*CNUCDUEJPKVV KO 4CPF RWP\KGTV 5+.8'4  CWH FGT 4ÒEMUGKVG 6T·IGTITCXWT 6+.. &#8+& 9+.*'./   0;564¤/CO$CPFOKV0CFGNKOQTKIKPCNGP8GTNGKJWPIUGVWK.¤9)TWRRG+ ++




SCHWEDEN

8903 8905

8904



8907

2TKP\'WIGP/GFCKNNGHÒT8GTFKGPUVGWOFCU-WPUVJCPFYGTM)QNFGPG/GFCKNNG)QNFIKO 4CPF RWP\KGTV /,8 )7.& -ÌPKINKEJG /ÒP\G KP 5VQEMJQNO  WPF  UQYKG OKV 6T·IGTITCXWT   '0,1*#05106*14CO$CPFOKV0CFGN.¤95 44+p++



+PGEJV)QNFDGUQPFGTUUGNVGP



1N[ORKUEJG/GFCKNNG-ÌPKI)WUVCX8  5KNDGTOKV5VGORGNUEJPGKFGTPCOGP#.+0&'0$'4) COIGP·JVGP$QIGPDCPF.¤9)TWRRG* ++





'TKPPGTWPIUOGFCKNNGFKG.KPIKCFGKP5VQEMJQNO5KNDGTXGTIQNFGVOKV5VGORGNUEJPGKFGT\GKEJGP 9$CWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC9GUVKPUKP5VQEMJQNOOGJTHCEJRWP\KGTV WC 5HÒT5KNDGTWPF,CJTGURWP\G0HÒT CO$CPF.¤9)TWRRG- ++



8GTFKGPUVOGFCKNNG FGT *GKOYGJT /QFGNN OKV FGO 2QTVTCKV -ÌPKI )WUVCXU 8+ #FQNH     )QNFGPG/GFCKNNG5KNDGTXGTIQNFGVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC 5RQTTQPI 5 HÒT 5KNDGT WPF ,CJTGURWP\G . HÒT   CO $CPF &C\W 8GTFKGPUVOGFCKNNG FGU   5EJYGFKUEJGP <GPVTCNXGTDCPFGU HÒT 1HHK\KGTUCWUDKNFWPI /QFGNN OKV FGO 2QTVTCKV -ÌPKI )WUVCXU 8+   #FQNH  5KNDGTPG/GFCKNNGCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC 5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G2HÒT CO$CPF7PF5KNDGTPGU'JTGP\GKEJGPFGU 4GKEJU.WHVUEJWV\8GTDCPFGU5KNDGTCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC 5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G3HÒT CP&COGPUEJNGKHG 5VÒEM++



/GFCKNNGHÒT8GTFKGPUVGWOFCU(TGKYKNNKIG/QVQTDQQV-QTRU/QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCX 8 DKU )QNFGPG8GTFKGPUVOGFCKNNG5KNDGTXGTIQNFGVKO4CPFOGJTHCEJRWP\KGTV WC5%QHÒTFKG (KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G+HÒT CO$CPF ++







8910 8908









8909

ex 8911

8GTFKGPUVOGFCKNNGFGU4GKEJU5EJYKOOXGTDCPFGU/QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCXU8+#FQNH

 5KNDGTPG/GFCKNNG5KNDGTCWHFGT4ÒEMUGKVGOKV6T·IGTPCOGP+0)#’-'4.70& WPFOGJTGP2WP\GP WC5%QHÒTFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G6HÒT CO $CPF ++



8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4GKEJUXGTDCPFGUFGT(GWGTYGJTGP)QNFGPG8GTFKGPUVOGFCKNNG 5KNDGT XGTIQNFGV CWH FGT 4ÒEMUGKVG 6T·IGTITCXWT 41.#0& #&1.'5510   WPF OGJTGTG   2WP\GP WC5%QHÒTFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G(HÒT CO$CPF 4++

 

'JTGP#D\GKEJGP FGU 5EJYGFKUEJGP 4QVGP -TGW\GU 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV   TÒEMUGKVKI OKV *GTUVGNNGTDG\GKEJPWPI FGT (KTOC /ÌNNGPDQTI KP 5VQEMJQNO WPF 2WP\KGTWPI CP 0CFGN   CWH $CPFMTGW\ CWHIGNGIV KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGU -ÌPKINKEJGP *QHLWYGNKGTU )WUVCH   /ÌNNGPDQTIKP5VQEMJQNO-ª0 ++



'JTGP\GKEJGPFGU5EJYGFKUEJGP4QVGP-TGW\GU5KNDGTKO4CPFRWP\KGTV5+.8'4WPF6T·IGTPCOG 0*#05'0WPFCO$CPF&C\WGKPYGKVGTGU'ZGORNCT5KNDGTKO4CPFRWP\KGTV/,85+.8'4

-ÌPKINKEJG/ÒP\GKP5VQEMJQNO CO$CPFOKV0CFGN.¤9)TWRRG. 5VÒEM++

 183


SCHWEDEN

8912 8913









8915

8914

8GTFKGPUVOGFCKNNG FGU 5EJYGFKUEJGP 4QVGP -TGW\GU HÒT (TGKYKNNKIG -TCPMGPRHNGIG /QFGNN OKV   2QTVTCKV -ÌPKI )WUVCXU 8   5KNDGTPG /GFCKNNG 5KNDGT OKV 5VGORGNUEJGKFGTPCOGP   # .+0&'0$'4) KO 4CPF RWP\KGTV 5+.8'4  CWH FGT 4ÒEMUGKVG OKV 6T·IGTITCXWT   '8-+..#0&'4CO$CPF-ª0XCT.¤9)TWRRG- ++



8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4QVGP-TGW\GUHÒT(TGKYKNNKIG-TCPMGPRHNGIG/QFGNNOKV2QT VTCKV -ÌPKI )WUVCXU 8   5KNDGTPG /GFCKNNG 5KNDGT OKV 5VGORGNUEJGKFGTPCOGP #   .+0&'0$'4)KO4CPFRWP\KGTV5+.8'4CWHFGT4ÒEMUGKVGOKV6T·IGTITCXWT0014$'%-  CP &COGPUEJNGKHG \WUCOOGP OKV /KPKCVWT 5KNDGT CP &COGPUEJNGKHG KO QTKIKPCNGP   8GTNGKJWPIUGVWKFGT(KTOC5%5RQTTQPI%QKP5VQEMJQNO-ª0XCT.¤9)TWRRG- ++



8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4QVGP-TGW\GUHÒT(TGKYKNNKIG-TCPMGPRHNGIG/QFGNNOKV2QT VTCKV -ÌPKI )WUVCXU 8   $TQP\GPG /GFCKNNG $TQP\G OKV 5VGORGNUEJGKFGTPCOGP   # .+0&'0$'4) KO 4CPF RWP\KGTV $410<'  QJPG 6T·IGTITCXWT CO UGJT MWT\GP $CPF   .¤9)TWRRG- ++



8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4QVGP-TGW\GUHÒT(TGKYKNNKIG-TCPMGPRHNGIG/QFGNNOKV2QT VTCKV-ÌPKI%CTNU:8+)WUVCX UGKV 5KNDGTPG/GFCKNNG5KNDGTOKV5VGORGNUEJPGKFGT\GKEJGP.* CWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC5RQTTQPI5WPFHÒTGT5KNDGT WPF,CJTGURWP\G/HÒT WPF6T·IGTITCXWT.QWKUG-LGNNDGTICO$CPFKO1TKIKPCNGVWKFGT (KTOC%%5RQTTQPI%QKP5VQEMJQNO-ª0.¤9)TWRRG- ++



&KG/GFCKNNGPOKVFGO2QTVTCKVFGUFGT\GKVKIGP-ÌPKIUUKPFPKEJVJ·WHKIKO*CPFGN\WHKPFGP

8917 8916





8918

$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP)GUGNNUEJCHV2412#64+##WUICDGOKV2QTVTCKV-ÌPKI1UMCTU ++/QFGNN OKV0144DKU -NGKPG5KNDGTPG/GFCKNNG&WTEJOGUUGTOO5KNDGTOKV 5VGORGNUEJPGKFGTPCOG#.+0&$'4)CWHFGO4CPFITCXKGTVGT6T·IGTPCOG/CVJKNFC&CPKGNUUQP QJPG$CPF.¤9)TWRRG- ++



$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP)GUGNNUEJCHV2412#64+##WUICDGOKV2QTVTCKV-ÌPKI1UMCTU ++/QFGNN QJPG0144 )TQ­G5KNDGTPG/GFCKNNG&WTEJOGUUGTOO5KNDGTOKV 5VGORGNUEJPGKFGTPCOG#.+0&$'4)CWHFGO4CPFITCXKGTVGT6T·IGTPCOG)WUVCX#NHTGF(QTUU CO*CNUDCPF.¤9)TWRRG- ++



&KGUGU/QFGNNYWTFGCWHITWPFFGUDGTGKVUGTHQNIVGP6QFGUXQP-ÌPKI1UMCT++PWTGVYCUN·PIGTCNUGKP,CJT XGTNKGJGP



184

$GNQJPWPIUOGFCKNNG FGT -ÌPKINKEJGP )GUGNNUEJCHV 241 2#64+# #WUICDG OKV 2QTVTCKV -ÌPKI   )WUVCXU8  -NGKPG5KNDGTPG/GFCKNNG&WTEJOGUUGTOO5KNDGTOKV5VGORGNUEJPGKFGT PCOG#.+0&$'4)KO4CPFRWP\KGTV5+.8'4CWHFGO4CPFITCXKGTVGT6T·IGTPCOG#OCPFC -TKUVKPC 5ÌFGTUVTÌO  CO $CPF KO 1TKIKPCNGVWK FGU *QHLWYGNKGTU % ( %CTNOCP KP 5VQEMJQNO   .¤9)TWRRG- ++




SCHWEDEN

8920

8919





8921

$GNQJPWPIUOGFCKNNG FGT -ÌPKINKEJGP )GUGNNUEJCHV 241 2#64+# #WUICDG OKV 2QTVTCKV -ÌPKI   )WUVCXU8+#FQNH  )TQ­G5KNDGTPG/GFCKNNG&WTEJOGUUGTOO5KNDGTCWHFGO4CPF ITCXKGTVGT6T·IGTPCOG'&8#4&5¤&'4/#0CO*CNUDCPFKO1TKIKPCNGVWKFGU*QHLWYGNKGTU %(%CTNOCPKP5VQEMJQNO.¤9)TWRRG- ++



$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP)GUGNNUEJCHV2412#64+##WUICDGOKV2QTVTCKV-ÌPKI%CTNU :8+)WUVCX UGKV /QFGNN OKVFGOLÒPIGTGP2QTVTCKV )TQ­G5KNDGTPG/GFCKNNG&WTEJOGUUGT OO5KNDGTOKV5VGORGNUEJPGKFGT\GKEJGP.*CWHFGO4CPFOGJTHCEJRWP\KGTV WC/85WPF HÒTGT5KNDGTWPF,CJTGURWP\G8HÒT QJPG*CNUDCPF.¤9)TWRRG- +p++



&KG/GFCKNNGPOKVFGO2QTVTCKVFGUFGT\GKVKIGP-ÌPKIUUKPFPKEJVJ·WHKIKO*CPFGN\WHKPFGP



$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP)GUGNNUEJCHV2412#64+##WUICDGOKV2QTVTCKV-ÌPKI%CTNU :8+)WUVCX UGKV /QFGNN OKVFGOLÒPIGTGP2QTVTCKV -NGKPG5KNDGTPG/GFCKNNG&WTEJOGUUGT OO5KNDGTOKV5VGORGNUEJPGKFGT\GKEJGP.*CWHFGO4CPFOGJTHCEJRWP\KGTV WC/85WPF HÒTGT5KNDGTWPF,CJTGURWP\G8HÒT QJPG$CPF.¤9)TWRRG- +p++



&KG/GFCKNNGPOKVFGO2QTVTCKVFGUFGT\GKVKIGP-ÌPKIUUKPFPKEJVJ·WHKIKO*CPFGN\WHKPFGP

8922



8923

8924

8925

$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP)GUGNNUEJCHV2412#64+##WUICDGOKV2QTVTCKV-ÌPKI%CTNU :8+)WUVCX UGKV /QFGNN OKVFGO·NVGTGP2QTVTCKV -NGKPG5KNDGTPG/GFCKNNG&WTEJOGUUGT OO5KNDGTOKV5VGORGNUEJPGKFGT\GKEJGP'0CWHFGO4CPFOGJTHCEJRWP\KGTV WC/85WPF HÒTGT5KNDGT CO$CPFOKV8GTNGKJWPIUGVWK.¤9)TWRRG- +p++



&KG /GFCKNNGP OKV FGO ·NVGTGP 2QTVTCKV FGU FGT\GKVKIGP -ÌPKIU YGTFGP GTUV UGKV YGPKIGP ,CJTGP XGTNKGJGP WPF UKPF   JÌEJUVUGNVGP







$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP2CVTKQVKUEJGP)GUGNNUEJCHV#WUICDGOKV2QTVTCKV-ÌPKI1UMCTU ++/QFGNN OKV0144 5KNDGTPG/GFCKNNG-NCUUG&WTEJOGUUGTOO5KNDGTCP &COGPUEJNGKHG.¤9)TWRRG- ++



$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP2CVTKQVKUEJGP)GUGNNUEJCHV#WUICDGOKV2QTVTCKV-ÌPKI)WUVCXU 8  5KNDGTPG/GFCKNNG-NCUUG&WTEJOGUUGTOO5KNDGTOKV5VGORGNUEJPGKFGT\GK EJGP #. HÒT # .KPFDGTI  KO *CNUCDUEJPKVV KO 4CPF RWP\KGTV 5+.8'4  CWH FGT 4ÒEMUGKVG   ITCXKGTVGT 6T·IGTPCOG $4+6# 2'66'4510 CO *CNUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK .¤9   )TWRRG- ++



$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP2CVTKQVKUEJGP)GUGNNUEJCHV#WUICDGOKV2QTVTCKV-ÌPKI)WUVCXU 8  5KNDGTPG/GFCKNNG-NCUUG&WTEJOGUUGTOO5KNDGTOKV5VGORGNUEJPGKFGT\GK EJGP#. HÒT#.KPFDGTI KO*CNUCDUEJPKVVKO4CPFRWP\KGTV/,85+.8'4 -ÌPKINKEJG/ÒP\G KP 5VQEMJQNO  CWH FGT 4ÒEMUGKVG ITCXKGTVGT 6T·IGTPCOG 4#)0# -,'..$'4) CO *CNUDCPF KO   QTKIKPCNGP8GTNGKJWPIUGVWK.¤9)TWRRG- ++

 185


SCHWEDEN

8926





8927 8929

$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP2CVTKQVKUEJGP)GUGNNUEJCHV#WUICDGOKV2QTVTCKV-ÌPKI)WUVCXU 8   5KNDGTPG /GFCKNNG  -NCUUG &WTEJOGUUGT  OO 5KNDGT OKV 5VGORGNUEJPGKFGT   PCOG#.+0&$'4)CP&COGPUEJNGKHG.¤9)TWRRG- ++



/GFCKNNGHÒTTÒJONKEJGYGKDNKEJG*CPFHGTVKIMGKVDGKO5RKPPGP5KNDGTPG/GFCKNNG5KNDGTOKV5VGO RGNUEJPGKFGT\GKEJGP%()KO4CPFRWP\KGTV/,85+.8'4 -ÌPKINKEJG/ÒP\GKP5VQEMJQNO CP &COGPUEJNGKHG 4++



4GKEJUXGTDWPFFGT5EJYGFKUEJGP1TEJGUVGTXGTD·PFG /QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCXU8

DKU )QNFGPGP/GFCKNNG5KNDGTXGTIQNFGVCO$CPF  /QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCXU 8+#FQNH  )QNFGPGP/GFCKNNG5KNDGTXGTIQNFGVCO$CPF 5VÒEM++



5V 'TKMU/GFCKNNG HÒT 8GTFKGPUVG WO FKG 5VCFV 5VQEMJQNO 5KNDGT XGTIQNFGV TÒEMUGKVKI 9KFOWPI   6+..0+.50+.5510CO$CPFKO1TKIKPCNGVWKFGT-ÌPKINKEJGP/ÒP\GXQP5VQEMJQNO ++



&KG /GFCKNNG YWTFG DGTGKVU KO ,CJT  XQP -ÌPKI (TGFGTKM   IGUVKHVGV WPF DKU PCEJ FGO <YGKVGP    9GNVMTKGIXGTNKGJGP





8930

ex 8931 (1:1) 8932



$TQUEJG OKV FGO UEJYGFKUEJGP 9CRRGP $TQP\G XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC5RQTTQPI%QCP0CFGN ++



-QPXQNWVXQPPGWPUEJYGFKUEJGP/KPKCVWTGP&CTWPVGT\YGK4KVVGTMTGW\G-NCUUGFGU-ÌPKINKEJGP 9CUC1TFGPU GKPGU FCXQP KP )QNF FKG CPFGTGP CNNG KP 5KNDGT QFGT 5KNDGT XGTIQNFGV LGYGKNU CP   $·PFEJGP&C\W/KPKCVWTMTGW\FGU-ÌPKINKEJGP9CUC1TFGPCP-PQRHNQEJUEJNGKHG 5VÒEM++



'UJCPFGNVUKEJJKGTDGKOÌINKEJGTYGKUGWOGKPG$TQUEJGHÒT/KVINKGFGTFGT-ÌPKINKEJGP2CVTKQVKUEJGP)GUGNNUEJCHV





186

5%*9'&'014&'055%*0#..'0

)TQ­G1TFGPUUEJPCNNGXQP*¹MCP'MOCPCWU)ÌVGDQTIOKVUKGDGPXQPWTURTÒPINKEJCEJV#WU\GKEJ PWPIGP $GUVGJGPF CWU   8GTFKGPUVOGFCKNNG FGU 4GKEJU.WHVUEJWV\8GTDCPFGU /QFGNN OKV 2QTVTCKV   -ÌPKI)WUVCXU8 DKU 5KNDGTPG8GTFKGPUVOGFCKNNG5KNDGTCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV

WC5%QHÒTFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G2HÒT WPF6T·IGTITCXWT *'-/#0 8GTFKGPUVOGFCKNNGFGT-ÌPKINKEJGP5GINGTIGUGNNUEJCHV\W)ÌVGDQTI/QFGNN OKV 2QTVTCKV -ÌPKI )WUVCXU 8 DKU   5KNDGTPG 8GTFKGPUVOGFCKNNG 5KNDGT CWH FGT 4ÒEMUGKVG   OGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G+HÒT WPF 6T·IGTITCXWT*’-#0'-/#0 9KGXQT/QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCXU8+#FQNH   )QNFGPG8GTFKGPUVOGFCKNNG5KNDGTXGTIQNFGVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%Q HÒT FKG (KTOC 5RQTTQPI 5 HÒT 5KNDGT WPF ,CJTGURWP\G 2 HÒT   WPF 6T·IGTITCXWT *’-#0   '-/#0    (GJNUVGNNG   )QNFGPGU 'JTGP\GKEJGP FGU 4GKEJU.WHVUEJWV\8GTDCPFGU 5KNDGT   XGTIQNFGVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF ,CJTGURWP\G2HÒT  )QNFGPG8GTFKGPUVOGFCKNNGFGU5EJÒV\GPXGTDCPFGU\W)ÌVGDQTI5KNDGT XGTIQNFGVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5HÒT5KNDGTWPF,CJTGURWP\G:HÒT WPF 6T·IGTITCXWT (14 0+6 1%* 6,056'4 *’-#0 '-/#0   )QNFGPG 8GTFKGPUVOGFCKNNG FGU   1HHK\KGTUCWUDKNFWPIU8GTDCPFGU\W)ÌVGDQTI5KNDGTXGTIQNFGV ¤UVGTTGKEJ-TKGIUGTKPPGTWPIUOGFCKNNG CP0CFGN 5VÒEM++




SCHWEDEN

8935 8933

8934







)TQ­G 1TFGPUUEJPCNNG OKV HÒPH #WU\GKEJPWPIGP $GUVGJGPF CWU   )GF·EJVPKU'JTGP\GKEJGP \WO   )GDWTVUVCI-ÌPKI)WUVCXU8CO,WPK$TQP\GXGTIQNFGVWPFGOCKNNKGTV 8GTFKGPUVOGFCKNNG FGU4GKEJUXGTDCPFGUFGT9GKDNKEJGP8GTVGKFKIWPIUJGNHGTKPPGP/QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCXU8 5KNDGTPG/GFCKNNG5KNDGTCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC%%5RQT TQPI WPF %Q 5 HÒT 5KNDGT WPF ,CJTGURWP\G ; HÒT     (KPPNCPF 1TFGP FGT (KPPKUEJGP   9GK­GP 4QUG 4KVVGTMTGW\  -NCUUG <YGKVG #WUHÒJTWPI OKV JQTK\QPVCN CPIGDTCEJVGT ¤UG FKGUG   OGJTHCEJ RWP\KGTV $CPF OKV CWHIGNGIVGT 4QUGVVG   (TCPMTGKEJ .CPFYKTVUEJCHVU8GTFKGPUVQTFGP   4KVVGTFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTV ¤UVGTTGKEJ<KXKNGU,WDKN·WOUMTGW\CP0CFGN 5VÒEM++



)TQ­G1TFGPUUEJPCNNGXQP-#/GNKPOKVXKGTXQPWTURTÒPINKEJHÒPH#WU\GKEJPWPIGP$GUVGJGPF CWU $CPFFGT$GNQJPWPIUOGFCKNNGFGT-ÌPKINKEJGP2CVTKQVKUEJGP)GUGNNUEJCHV FKGFCTCPWTURTÒPINKEJ DGHGUVKIVG )QNFGPG /GFCKNNG FGT #WUHÒJTWPI OKV FGO 2QTVTCKV XQP -ÌPKI )WUVCX 8+ #FQNH HGJNV     8GTFKGPUVOGFCKNNGFGU5EJYGFKUEJGP4QVGP-TGW\GUHÒT(TGKYKNNKIG-TCPMGPRHNGIG/QFGNNOKV2QTVTCKV -ÌPKI %CTNU :8+ )WUVCX UGKV   5KNDGTPG /GFCKNNG 5KNDGT OKV5VGORGNUEJPGKFGT\GKEJGP.*KO 4CPFOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G#HÒT  WPF6T·IGTITCXWT-#/GNKP 'JTGP\GKEJGPFGU5EJYGFKUEJGP4QVGP-TGW\GU5KNDGT KO 4CPF RWP\KGTV /,8 5+.8'4  -ÌPKINKEJG /ÒP\G KP 5VQEMJQNO    (TCPMTGKEJ 1TFGP FGT   #MCFGOKUEJGP 2CNOGP /QFGNN UGKV  4KVVGTFGMQTCVKQP 5KNDGT GOCKNNKGTV   0KGFGTNCPFG   8GTFKGPUVOGFCKNNG 241 /'4+61FGU0KGFGTN·PFKUEJGP4QVGP-TGW\GU5KNDGTVGKNYGKUGGOCKNNKGTVCP 0CFGN<WUCOOGPOKVRCUUGPFGT/KPKCVWTGPURCPIGOKV/KPKCVWTGPOKV4GXGTUMPQRH 5VÒEM++



/KPKCVWTGPUEJPCNNG OKVHÒPH#WU\GKEJPWPIUOKPKCVWTGP$GUVGJGPFCWU -ÌPKINKEJGT9CUC1TFGP 4KVVGTMTGW\-NCUUG)QNFVGKNYGKUGGOCKNNKGTV /GFCKNNGHÒT8GTFKGPUVGWOFCU(TGKYKNNKIG/QVQTDQQV -QTRU/QFGNNOKVFGO2QTVTCKV-ÌPKI)WUVCX8 DKU )QNFGPG8GTFKGPUVOGFCKNNG5KNDGTXGTIQN FGVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G 0HÒT  'TKPPGTWPIUOGFCKNNGFKG.KPIKCFGKP5VQEMJQNO5KNDGTXGTIQNFGVCWHFGT4ÒEM UGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC9GUVKPUKP5VQEMJQNOOGJTHCEJRWP\KGTV WC5HÒT5KNDGTWPF ,CJTGURWP\G0HÒT  )QNFGPG8GTFKGPUVOGFCKNNGFGT5GGHCJTVUHNQVKNNGKP-CTNUMTQPC5KNDGTXGT IQNFGVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTG URWP\G3HÒT  )QNFGPG2*.KPI/GFCKNNGFGU5EJYGFKUEJGP-[OPCUVKM8GTDCPFGU5KNDGT XGTIQNFGVKO4CPFOGJTHCEJRWP\KGTV WC5%QHÒTFKG(KTOC5RQTTQPI5HÒT5KNDGTWPF,CJTGURWP\G+ HÒT CP4GXGTUMPQRH 5VÒEM++

 187


SCHWEIZ

8937 8938

8936

5%*9'+< 

8GTFKGPUVOGFCKNNG64'7'70&'*4'/&%%%:8 CWEJ/GFCKNNGXQP;XGTFQPIGPCPPV #WU HÒJTWPIOKVITQ­GO.QTDGGTMTCP\2GTNTCPFWPF*GPMGNXQP%JTKUVKCP(WGVGT&WTEJOGUUGTOO 5KNDGTCOUR·VGTGPTQVGP$CPFOKVYGK­GO/KVVGNUVTGKHGPWPFYGK­GP-CPVGP 4++



8GTFKGPUVOGFCKNNG64'7'70&'*4'/&%%%:8 CWEJ/GFCKNNGXQP;XGTFQPIGPCPPV 4G FWMVKQPFGT#WUHÒJTWPIOKVMNGKPGO.QTDGGTMTCP\WPF)KTNCPFGPTCPF&WTEJOGUUGTOO5KNDGT COQTKIKPCNGPCNVGP$·PFEJGP 4++



8GTFKGPUVOGFCKNNG64'7'70&'*4'/&%%%:8 CWEJ/GFCKNNGXQP;XGTFQPIGPCPPV 'KPHC EJGGKPUGKVKIG'KUGPIWUUMQRKG&WTEJOGUUGTOOCOPGWGPWPMQTTGMVGP$·PFEJGP +++



&KG/GFCKNNGYWTFGXQPFGT5EJYGK\GTKUEJGP6CIUCV\WPICO#RTKNIGUVKHVGV\W'JTGPFGTKPHTCP\ÌUKUEJGO 5QNF UVGJGPFGP 5EJYGK\GT 4GIKOGPVGT FKG Y·JTGPF FGT /·T\VCIG  .WFYKI :8+++ VTGW IGDNKGDGP YCTGP 'U   YWTFGP  /GFCKNNGP XGTNKGJGP 8IN )TWPCW )WUVCX 6TGWG WPF 'JTG  <YGK UEJYGK\GTKUEJG OKNKV·TKUEJG   8GTFKGPUV/GFCKNNGP+P4GXWG5WKUUGFG0WOKUOCVKSWG$CPF*GHV





8941

8939



8940

8GTFKGPUVOGFCKNNG64'7'70&'*4':#7)756/&%%:%++XQP%JTKUVKCP(WGVGT&WTEJOGU UGTOO'KUGPMGTPOKV5KNDGT\CTIGFKGUGQJPG)TCXWTCOQTKIKPCNGPCNVGP$CPFOKVGKPIGYGDVGO 5EJYGK\GTMTGW\ 4++



&KG /GFCKNNG YWTFGXQPFGT5EJYGK\GTKUEJGP6CIUCV\WPICO#WIWUVIGUVKHVGV\W'JTGPFGT/KVINKGFGTFGU 5EJYGK\GT)CTFG4GIKOGPVUFKGDGKFGT8GTVGKFKIWPIFGT6WKNNGTKGPCO#WIWUVÒDGTNGDVGP8IN)TWPCW )WUVCX 6TGWG WPF 'JTG  <YGK UEJYGK\GTKUEJG OKNKV·TKUEJG 8GTFKGPUV/GFCKNNGP +P 4GXWG 5WKUUG FG 0WOKUOCVK   SWG$CPF*GHV7PF



8GTFKGPUVOGFCKNNG64'7'70&'*4':#7)756/&%%:%++XQP%JTKUVKCP(WGVGT&WTEJOGU UGT  OO 'KUGPMGTP FKG <CTIG 5KNDGT OKV 4CPFITCXWT ,1* .'10* +/*1(( 810   /145%*#%*COCNVGPTQVGP$CPFGKPIGYGDVGO5EJYGK\GTMTGW\ 4++



2T·OKGPOGFCKNNG FGT )GPGTCNUVCDUCDVGKNWPI FGU 5EJYGK\ /KNKV·TFGRCTVGOGPVU HÒT FGP 9GVVHNWI   5KNDGTITCXKGTVOKVGTI·P\VGO6TCIGDÒIGNQJPG$CPFKOQTKIKPCNGP8GTNGKJWPIUGVWK 44++



(ÒT FKG #WVJGPVK\KV·V FGU 4CPFPCOGPU MCPP MGKPG )GY·JT ÒDGTPQOOGP YGTFGP &GT +PVGTGUUGPV YKTF CWUFTÒEMNKEJ   CWHFKG)GNGIGPJGKV\WTCWUHÒJTNKEJGP8QTDGUKEJVKIWPIXQTFGT#WMVKQPCWHOGTMUCOIGOCEJV



'KPGFGTUGNVGPGPUEJYGK\GTKUEJGPVTCIDCTGP/KNKV·T#WU\GKEJPWPIGP

188


SERBIEN UND JUGOSLAWIEN

8943

8942

ex 8944



/GFCKNNGFGT5EJYGK\GTKUEJGP0CVKQPCNURGPFGXQPHÒTFKG5QNFCVGPWPFKJTG(COKNKGP5KNDGT ZOOCWHFGT4ÒEMUGKVGRWP\KGTVCOPGWGP$CPF ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T 





'TKPPGTWPIUOGFCKNNGHÒTFKGUEJYGK\GTKUEJGP(TGKYKNNKIGPWPF.GIKQP·TGKPFGTHTCP\ÌUKUEJGP#T OGGKO'TUVGP9GNVMTKGI=/¾FCKNNGRQWTNGU8QNQPVCKTG5WKUUGUGV#PEKGPU .¾IKQPCKTGU CW 5GTXKEG FG NC (TCPEG? $TQP\G OKV 5VGORGNUEJPGKFGTUKIPCVWT )247&*1//' CO   $CPF 4++



-QPXQNWV XQP \YGK ·NVGTGP UEJYGK\GTKUEJGP 5EJÒV\GPCWU\GKEJPWPIGP #WU )GPH WPF .CWUCPPG   LGYGKNU5KNDGTGKPGVGKNYGKUGGOCKNNKGTVGKPGTOKV6T·IGTITCXWTCP$·PFGTP&C\W$TQP\GOGFCKNNG\W 'TKPPGTWPICPFKG8GTGKPKIWPI$GKFGT$CUGNQJPG$CPF 5VÒEM++



8945

8946 8948

0'7'0$74)70&8#.#0)+0(ª456'067/ 

2TGW­KUEJG 0GWHEJ³VGNGT 'TKPPGTWPIUOGFCKNNG 5KNDGT CO QTKIKPCNGP CNVGP \GKVIGPÌUUKUEJGP $CPF   1'-24- +p++



2TGW­KUEJG 0GWHEJ³VGNGT 'TKPPGTWPIUOGFCKNNG 5KNDGT CO QTKIKPCNGP CNVGP \GKVIGPÌUUKUEJGP $CPF   1'-24- +p++



'ZGORNCTKPJGTXQTTCIGPFGT'TJCNVWPI



'ZGORNCTKPJGTXQTTCIGPFGT'TJCNVWPIOKVUEJÌPGTFWPMNGT2CVKPC



2TGW­KUEJG0GWHEJ³VGNGT'TKPPGTWPIUOGFCKNNG5KNDGTQJPG$CPF1'-24-

+++



5'4$+'070&,7)15.#9+'0 

(ª456'067/70&-¤0+)4'+%*5'4$+'0  

1TFGPFGU-TGW\GUXQP6CMQXQ/QFGNN OKV/QPQITCOO(ÒTUV/KJCKNQU+++PCEJ  $TWUVUVGTP \WT  -NCUUG  Z  OO 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCPXGTIQNFGVGT0CFGN<'+ +p++



&GT 1TFGP KUV XQP (ÒTUV /KJCKNQ +++  IGUVKHVGV YQTFGP FGT LGFQEJ DGTGKVU  IGUVQTDGP KUV 1D FCU /QPQ   ITCOOWPOKVVGNDCTPCEJFGT6JTQPDGUVGKIWPIUGKPGU0CEJHQNIGTUFGU(ÒTUVGP/KNCP+8 CD-ÌPKI/KNCP+  QFGT GTUV GKPKIG <GKV UR·VGT IG·PFGTV YQTFGP KUV MQPPVG DKUJGT PQEJ PKEJV GTOKVVGNV YGTFGP ,GFGPHCNNU UKPF FKG   +PUKIPKGPOKVFGO/QPQITCOO/KJCKNQU+++YGKVCWUUGNVGPGT\WHKPFGPCNUFKGLGPKIGPOKVFGO/QPQITCOO/KNCPU +8KUVFGT1TFGPXQP-ÌPKI2GVGT+-CTCIGQTIGXKEJCWHIGJQDGPYQTFGP

189


SERBIEN UND JUGOSLAWIEN

8950

8949



1TFGP FGU -TGW\GU XQP 6CMQXQ  /QFGNN OKV /QPQITCOO (ÒTUV /KNCPU +8  PCEJ     -NGKPQF\WT-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPF<'+ ++





1TFGPFGU-TGW\GUXQP6CMQXQ/QFGNN=OKV/QPQITCOO(ÒTUV/KNCPU+8 TGI ?XGT NKGJGPDKU$TWUVUVGTP\WT-NCUUG5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGPPKEJV  XGTIQNFGV VGKNYGKUGGOCKNNKGTV'OCKNNKGTWPIFGU/GFCKNNQPHGNFGUWPFTKPIGUHGJNV UEJGKPVPKGGOCKNNKGTVIGYGUGP \W UGKP  CP 0CFGN FKGUG OKV *GTUVGNNGTD\GKEJPWPI FGT (KTOC % ( 4QVJG KP 9KGP QJPG YGKVGTG   2WP\GP<'+XCT ++



#NVGUWPFKPUGKPGTDGUQPFGTGP)GUVCNVWPIUGJTKPVGTGUUCPVGUWPFDKUJGTPQEJWPGTHQTUEJVGU5VÒEM

8953 8951







8952

1TFGP FGU -TGW\GU XQP 6CMQXQ  /QFGNN OKV /QPQITCOO (ÒTUV /KNCPU +8  PCEJ     $TWUVUVGTP \WT  -NCUUG  Z  OO 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTV CP 0CFGN FKGUG OKV *GTUVGNNGTDG\GKEJPWPI FGT (KTOC % ( 4QVJG KP 9KGP QJPG YGKVGTG   2WP\GP<'+ +p++



1TFGP FGU -TGW\GU XQP 6CMQXQ  /QFGNN OKV /QPQITCOO (ÒTUV /KNCPU +8  PCEJ     -TGW\  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP &TGKGEMUDCPF KO QTKIKPCNGP OKV   IQNFHCTDGPGO9CRRGPDGFTWEMVGP8GTNGKJWPIUGVWKGKPGT$GNITCFGT(KTOC<'+ ++



1TFGPXQO9GK­GP#FNGT/QFGNN CWHFGT4ÒEMUGKVG/QPQITCOO-ÌPKI/KNCPU+  &GMQTCVKQP-NCUUG5KNDGT)QNFGOCKNNKGTVCOQTKIKPCNGPCNVGP&TGKGEMDCPF<'+ 44++



)GUVKHVGV XQP -ÌPKI /KNCP + 1DTGPQYKEJ CO  ,CPWCT  RGT )GUGV\ 7PVGT -ÌPKI 2GVGT + -CTCIGQTIGYKEJ   YWTFG FKG )GUVCNVWPI FGU 1TFGPU\GKEJGPU FWTEJ #WUVCWUEJ FGU 5VKHVGTOQPQITCOOU OKV FGT ,CJTGU\CJN  XGT·P   FGTV 0CEJ FGT 'TTKEJVWPI FGU -ÌPKITGKEJU FGT 5GTDGP -TQCVGP WPF 5NQYGPGP  YWTFG FGT 1TFGP XQP -ÌPKI   2GVGT+-CTCIGQTIGYKEJCWHIGJQDGP

190


SERBIEN UND JUGOSLAWIEN

8954 (1:1)

8955

8956



1TFGPXQO9GK­GP#FNGT/QFGNN OKVFGT,CJTGU\CJNCWHFGT4Ã&#x2019;EMUGKVGUGKV 5GVFGT  -NCUUG DGUVGJGPF CWU -NGKPQF 5KNDGTXGTIQNFGVWPFGOCKNNKGTVQDGTHN·EJNKEJGT'OCKNNGEJKRKPGKPGT -TQPGPRGPFKNKG CO QTKIKPCNGP CNVGP 5EJWNVGTDCPF WPF $TWUVUVGTP  Z  OO 5KNDGT TGRGTEKGTV   XGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCP0CFGN<'+ 5VÃ&#x2019;EM+p++ 



1TFGP XQO 9GK­GP #FNGT  /QFGNN OKV FGT ,CJTGU\CJN  CWH FGT 4Ã&#x2019;EMUGKVG  UGKV     &GMQTCVKQP  -NCUUG OKV 5EJYGTVGTP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNGTGRCTCVWTGP KP FGP   -TQPGPRGPFKNKGPCOQTKIKPCNGPCNVGP*CNUDCPF<'+ ++p



1TFGP XQO 9GK­GP #FNGT  /QFGNN OKV FGT ,CJTGU\CJN  CWH FGT 4Ã&#x2019;EMUGKVG  UGKV     &GMQTCVKQP-NCUUGOKV5EJYGTVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVGFGT -TQPGPRGPFKNKGP'OCKNNGCDRNCV\WPIGPCOGVYCUDGUEJ·FKIVGP&TGKGEMUDCPF<'+ ++





191


SERBIEN UND JUGOSLAWIEN

8957



8958

1TFGP FGU JGKNKIGP 5CXC  /QFGNN OKV /QPQITCOO -ÌPKI /KNCPU + KO 4GXGTUOGFCKNNQP       -NGKPQF \WT  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK QDGTHN·EJNKEJGT   MCWOUKEJVDCTGT'OCKNNGEJKRKOXQTFGTUGKVKIGP/GFCKNNQPTKPIQJPG5EJWNVGTDCPF<'+ 4+p++



&GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG XQP -ÌPKI /KNCP + 1DTGPQXKEJ CO  ,CPWCT  IGUVKHVGV   GTUGV\VG-ÌPKI2GVGT+-CTCIGQTIGXKEJFCU/QPQITCOO-ÌPKI/KNCPUCWHFGT4ÒEMUGKVGFWTEJFCU5VKHVWPIU LCJTYWTFGFKG(CTDGFGU/CPVGNUFGUJN5CXCKO8QTFGTUGKVGPOGFCKNNQPXQPTQVKPITÒPIG·PFGTV&GT 1TFGPYWTFGCWEJPCEJFGT)TÒPFWPIFGU-ÌPKITGKEJUFGT5GTDGP-TQCVGPWPF5NQYGPGPWPFPCEJFGUUGP7ODG PGPPWPIKP,WIQUNCYKGPQHHK\KGNNGDKU\WO'PFGFGT/QPCTEJKGYGKVGTXGTNKGJGP-ÌPKI2GVGT++XGTNKGJKJPCNU *CWUQTFGPCWEJKO'ZKNYGKVGT



1TFGP FGU JGKNKIGP 5CXC  /QFGNN CWH FGT 4ÒEMUGKVG /QPQITCOO -ÌPKI /KNCPU +      -TGW\  -NCUUG 5KNDGT ITCXKGTV WPF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK CO QTKIKPCNGP &TGKGEMUDCPF   <'+ 4++

8959 (1:1)





192



8960

1TFGPFGUJGKNKIGP5CXCWPF/QFGNN FGT*GKNKIGKOTQVGP)GYCPF $TWUVUVGTP\WT  -NCUUG  Z  OO 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV HGKPG   'OCKNNGOCNGTGK CP GVYCU XGTDQIGPGT 0CFGN FCTCWH *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ) # 5EJGKF KP   9KGP<'+D\Y +p++



1TFGP FGU JGKNKIGP 5CXC  /QFGNN FGT *GKNKIG KO TQVGP )GYCPF CWH FGT 4ÒEMUGKVG        -TGW\  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK MCWO UKEJVDCTG   'OCKNNGTGRCTCVWTGPOGJTGTGP-TGW\URKV\GPCO*CNUDCPFCDUEJPKVV<'+ ++p+++




SERBIEN UND JUGOSLAWIEN

8961 (1:1)



1TFGP FGU JGKNKIGP 5CXC  /QFGNN FGT *GKNKIG KO ITÃ&#x2019;PGP )GYCPF  UGKV   5GV FGT  -NCUUG   DGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVGMCWOUKEJVDCTG4GRCTCVWTKO <GPVTWO CO 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP   0CFGN<'+ 5VÃ&#x2019;EM++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T

8962 (1:1)



1TFGP FGU JGKNKIGP 5CXC  /QFGNN FGT *GKNKIG KO ITÃ&#x2019;PGP )GYCPF  UGKV   5GV FGT  -NCUUG   DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO CNVGP GVYCU \GTUEJNKUUGPGP 5EJWNVGTDCPF   WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN <'+    5VÃ&#x2019;EM++

 193


SERBIEN UND JUGOSLAWIEN

8963



1TFGP FGU JGKNKIGP 5CXC  /QFGNN FGT *GKNKIG KO ITÒPGP )GYCPF  UGKV   5GV FGT  -NCUUG   DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO UR·VGTGP 5EJWNVGTDCPF WPF $TWUVUVGTP   5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN KP GKPGO PGW   CPIGHGTVKIVGP'VWK<'+ ++



8964 8965





1TFGP FGU JGKNKIGP 5CXC  /QFGNN FGT *GKNKIG KO ITÒPGP )GYCPF  UGKV   5GV FGT  -NCUUG   DGUVGJGPFCWU-TGW\-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCOQTKIKPCNGP GVYCUXGTHNGEMVGP*CNUDCPFWPF$TWUVUVGTPZOO5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUG XGTIQNFGVWPFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCP0CFGN<'+ +p++



1TFGP FGU JGKNKIGP 5CXC  /QFGNN FGT *GKNKIG KO ITÒPGP )GYCPF  UGKV   $TWUVUVGTP \WT   -NCUUGZOO5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVHGKPUVG 'OCKNNGOCNGTGKCP0CFGN<'+ +p++



7PIGYÌJPNKEJHNCEJG#WUHÒJTWPIOKVUGJTHGKPGT'OCKNOCNGTGK

 194

1TFGPFGUJGKNKIGP5CXC.GGTGU'VWK\WT-NCUUGFGT(KTOC5EJCLFKP$GNITCFOÌINKEJGTYGKUG\WO /QFGNNIGJÌTKI ++




SERBIEN UND JUGOSLAWIEN

8968 8970

8967

8969



1TFGP FGU JGKNKIGP 5CXC  /QFGNN FGT *GKNKIG KO ITÒPGP )GYCPF  UGKV   -TGW\  -NCUUG   5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCOPKEJVMQTTGMVGP$CPF<'+ ++





1TFGP /KNQUEJU FGU )TQ­GP &GMQTCVKQP  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGKCOYQJNUR·VGTGPLGFQEJMQTTGMVGP&TGKGEMUDCPF<'+ 44+p++



#WUHÒJTWPIOKVXCTKCPVGT/GFCKNNQPOCNGTGK+PCNNGPUGKPGP-NCUUGPUGJTUGNVGPGT1TFGPFGTPWT,CJTGNCPIXQP  DKU \WO 'PFG FGT 1DTGPQXKEJ&[PCUVKG 'OQTFWPI -ÌPKI #NGZCPFGTU +  KO ,CJTG  XGTNKGJGP YWTFG   #NGZCPFGT+JCVFGP1TFGPUVGVURGTUÌPNKEJHÒTFGO*CWU1DTGPQXKEJIGNGKUVGVG&KGPUVGXGTNKGJGP



1TFGPFGU5VGTPUXQP-CTCIGQTIG&GMQTCVKQP-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGTGRC TCVWTKOXQTFGTUGKVKIGP/GFCKNNQPTKPICOUR·VGTGPLGFQEJMQTTGMVGP&TGKGEMUDCPF<'+ 4++





'JTGP\GKEJGP FGT -ÌPKIKP 0CVCNKC #WUICDG OKV M[TKNNKUEJGO /QPQITCOO )QNFGPGU 'JTGP\GKEJGP   5KNDGTVGKNYGKUGXGTIQNFGVCP&COGPUEJNGKHG415' ++



8973 8971

8974

8972

8976

8975



'JTGP\GKEJGPFGU5GTDKUEJGP4QVGP-TGW\GU/QFGNN  5KNDGTGOCKNNKGTVCOCNVGP$CPF 415' ++





'JTGP\GKEJGPXQO5GTDKUEJGP4QVGP-TGW\/QFGNN OKV-ÌPKIUMTQPGCD 5KNDGTVGKNYGKUG GOCKNNKGTVCOQTKIKPCNGPCNVGP&TGKGEMUDCPFKOQTKIKPCNGPYGK­GPTQVDGFTWEMVGP8GTNGKJWPIUGVWK ++





6CRHGTMGKVUOGFCKNNG5KNDGTPG/GFCKNNG5KNDGTQJPG$CPF415'





,WDKN·WOUOGFCKNNG \WO XKGT\KIL·JTKIGP $GUVGJGP FGT 5V #PFTGCU8GTUCOONWPI  5KNDGTPG   /GFCKNNG5KNDGTCO&TGKGEMUDCPF415' ++





/GFCKNNG \WT 'TKPPGTWPI CP FKG 6JTQPDGUVGKIWPI -ÌPKI 2GVGTU +  5KNDGTPG /GFCKNNG 5KNDGT KO   4CPFOGJTHCEJRWP\KGTVWCOKV,%COCNVGP&TGKGEMUDCPF415' ++





6CRHGTMGKVUOGFCKNNGXQP)QNFGPG/GFCKNNGXGTIQNFGVCOQTKIKPCNGPCNVGP&TGKGEMUDCPF415' +p++



++p+++

195


SERBIEN UND JUGOSLAWIEN

8977



)TQ­G 1TFGPUUEJPCNNG GKPGU UGTDKUEJGP 1HHK\KGTU OKV  1TFGP WPF 'JTGP\GKEJGP   1TFGP XQO   9GK­GP #FNGT  /QFGNN 4KVVGTFGMQTCVKQP   )QNFGPG /KNQUJ 1DKNKEJ/GFCKNNG HÒT 6CRHGTMGKV     1TFGP FGU JN 5CXC  /QFGNN 1HHK\KGTUMTGW\   1TFGP FGU -TGW\GU XQP 6CMQXQ  /QFGNN   &GMQTCVKQP-NCUUG (TCPMTGKEJ1TFGPFGT'JTGPNGIKQP1HHK\KGTUFGMQTCVKQP)QNF )GFGPMMTGW\ HÒT FGP -TKGI FGT $GHTGKWPI WPF FGT 'KPJGKV    'TKPPGTWPIUOGFCKNNG HÒT      'JTGP\GKEJGP XQO 5GTDKUEJGP 4QVGP -TGW\  /QFGNN   'TKPPGTWPIUOGFCKNNG CP FGP -TKGI XQP    'TKPPGTWPIUMTGW\HÒT 6CRHGTMGKVUOGFCKNNG/KP'OCKNNGEJKRUCPGKPKIGP 5VÒEMGPUQPUVIWVGT<WUVCPFCP0CFGN 5VÒEM++++p



8978 (1:1)

-¤0+)4'+%*&'45'4$'0-41#6'07055.19'0'0$<9 -¤0+)4'+%*,7)15.#9+'0   

1TFGP FGT -TQPG XQP ,WIQUNCYKGP 5GV FGT  -NCUUG DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP0CFGN OKV\YGK5GKVGPJCMGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC*WIWGPKP(T½TGUKP.G.QENG 5EJYGK\  <'+ 5VÒEM+ &GTHÒPHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGCO#RTKNXQP-ÌPKI#NGZCPFGT+IGUVKHVGVWPFDKU\WO 'PFGFGT/QPCTEJKGKP,WIQUNCYKGPXGTNKGJGP

196




SERBIEN UND JUGOSLAWIEN

8979





8980

1TFGPFGT-TQPGXQP,WIQUNCYKGP5GVFGT-NCUUGDGUVGJGPFCWU*CNUMTGW\5KNDGTXGTIQNFGVWPF GOCKNNKGTV\YGKMCWOUKEJVDCTGQDGTHN·EJNKEJG%JKRUKPFGTYGK­GP'OCKNNGFGT8QTFGTUGKVGFGUQDGTGP -TGW\CTOU 4Ã&#x2019;EMUGKVG GVYCU XGTUEJOWV\V CO QTKIKPCNGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV   VGKNYGKUGGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP<'+ 5VÃ&#x2019;EM++



1TFGPFGT-TQPGXQP,WIQUNCYKGP$TWUVUVGTPFGT-NCUUG5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP 0CFGNOKV\YGK5GKVGPJCMGP<'+ ++



8983

8981

8982

8984

ex 8985



1TFGP FGT -TQPG XQP ,WIQUNCYKGP -TGW\  -NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKP 'OCKNNGEJKRCWHFGT4Ã&#x2019;EMUGKVGGKPGU-TGW\CTOUCOCNVGP*CNUDCPFCDUEJPKVV<'+ ++





1TFGP FGT -TQPG XQP ,WIQUNCYKGP -TGW\  -NCUUG 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV FTGK   4GRCTCVWTGPKPFGTYGK­GP'OCKNNGCOQTKIKPCNGPCNVGP&TGKGEMUDCPF<'+ ++p





#D\GKEJGP HÃ&#x2019;T FCU 2GTUQPCN FGT ,WIQUNCYKUEJGP 5VCCVUDCJPGP CWH FGP 'KUGPDCJP(·JTUEJKHHGP   $TQP\GVGKNYGKUGXGTUKNDGTVVGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVGFGT-TQPG*GT UVGNNGTDG\GKEJPWPIFGT(KTOC)TKGUDCEJ-PCWUKP<CITGDCP0CFGN 44++





#D\GKEJGP OKV FGO 2QTVTCKV XQP 2TKP\GUUKP <QTMC XQP ,WIQUNCYKGP 8GTIQNFGV WPF GOCKNNKGTV OKV   (CTDRQTVTCKV CWH FGT 4Ã&#x2019;EMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC *WIWGPKP (T½TGU KP .G .QENG KP FGT   5EJYGK\CP0CFGN ++



-QPXQNWV XQP PGWP XGTUEJKGFGPGP UGTDKUEJGP WPF LWIQUNCYKUEJGP #WU\GKEJPWPIGP &CTWPVGT FKG   UGTDKUEJGP /GFCKNNGP HÃ&#x2019;T /KNKV·TKUEJG 6WIGPF HÃ&#x2019;T 'KHTKIGP &KGPUV  /KNQUJ 1DKNKEJ/GFCKNNG HÃ&#x2019;T   6CRHGTMGKV*CWUJCNVUOGFCKNNG#NGZCPFGT+KPXGTUEJKGFGPGP/GVCNNGPVGKNUXGTUKNDGTVVGKNUXGTIQNFGV KPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNYGKUGCP$·PFGTP 5VÃ&#x2019;EM+p++++++p+++





197


SERBIEN UND JUGOSLAWIEN

8986 (1:1)

8987 (1:1)

(¤&'4#.+56+5%*'81.-54'27$.+-,7)15.#9+'0  70& 51<+#.+56+5%*'(¤&'4#.',7)15.#9+'0   

1TFGPFGT-TKGIUHNCIIG=1TFGP4CVPG<CUVCXG?$TWUVUVGTPFGT-NCUUG)QNF IGRTÒHV JQJNIGCTDGK VGV 5KNDGT VGKNYGKUG GOCKNNKGTV ¯ LQWT DGUGV\V OKV \CJNTGKEJGP YGK­GP WPF TQVGP 5KOKNKUVGKPGP CP   UKNDGTPGT0CFGN<'+ 444++  'ZVTGOUGNVGPGT1TFGPDGUQPFGTUKPGEJVIQNFGPGT#WUHÒJTWPI&GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGP YKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



,WIQUNCYKUEJGT)TQ­GT5VGTPGPQTFGP=1TFGP,WIQUNQXGPUMG8GNKMG<XG\FG?/QFGNN   $TWUVUVGTP5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGXGTIQNFGVDGUGV\VOKVTQVGPWPFYGK­GP5KOKNKUVGK PGPCP0CFGN<'+ 444++



#PHGTVKIWPI CWU FGP GT QFGT GT ,CJTGP XQP CNNGTITÌ­VGT 5GNVGPJGKV  )GUVKHVGV CO  (GDTWCT  XQP   /CTUEJCNN ,QUKR $TQ\ 6KVQ KUV FGT GKPMNCUUKIG 1TFGP CNU JÌEJUVG LWIQUNCYKUEJG #WU\GKEJPWPI CWUN·PFKUEJGP 5VCCVQ   DGTJ·WRVGTXQTDGJCNVGP

8988



,WIQUNCYKUEJGT5VGTPGPQTFGP=1TFGP,WIQUNQXGPUMG<XG\FG?/QFGNN  5GVFGT-NCUUG DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV 5VGTP )QNF GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF   $TWUVUVGTP 5KNDGT DTKNNCPVKGTV VNY XGTIQNFGV WPF GOCKNNKGTV FGT 5VGTP DGUGV\V OKV  5KOKNKUVGKPGP CP   0CFGN\WUCOOGPOKVFTGK+PVGTKOUUEJPCNNGPOKV#WHNCIGP<'+ 5VÒEM44++ #PHGTVKIWPICWUFGPGT,CJTGPXQPITQ­GT5GNVGPJGKV  )GUVKHVGVCO(GDTWCTXQP/CTUEJCNN,QUKR$TQ\6KVQCNUFTGKMNCUUKIG1TFGPHÒTWPIGYÌJPNKEJGPMWNVWTGNNGP RQNKVKUEJGPQFGTYKUUGPUEJCHVNKEJGP'KPUCV\WPFHÒT8GTFKGPUVGWOFKG'PVYKEMNWPIFGTHTKGFNKEJGP<WUCOOGPCTDGKV WPFFGTHTGWPFUEJCHVNKEJGP8GTDKPFWPIGP\YKUEJGP,WIQUNCYKGPWPFCPFGTGP.·PFGTP

198




SERBIEN UND JUGOSLAWIEN

8989



8991

8990

,WIQUNCYKUEJGT5VGTPGPQTFGP=1TFGP,WIQUNQXGPUMG<XG\FG?/QFGNN  $TWUVUVGTP\WT -NCUUG5KNDGTDTKNNCPVKGTV#WHNCIG$TQP\GXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<'+ 4++



#PHGTVKIWPICWUFGPGT,CJTGP5GNVGP



,WIQUNCYKUEJGT5VGTPGPQTFGP=1TFGP,WIQUNQXGPUMG<XG\FG?/QFGNN  $TWUVUVGTP\WT -NCUUG5KNDGTDTKNNCPVKGTV#WHNCIG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<'+ ++



#PHGTVKIWPICWUFGPGT,CJTGPUGNVGP



,WIQUNCYKUEJGT 5VGTPGPQTFGP =1TFGP ,WIQUNQXGPUMG <XG\FG?  /QFGNN   &GMQTCVKQP   -NCUUG5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVDGUGV\VOKVTQVGP5KOKNKUVGKPGPCOQTKIKPCNGP*CNU DCPF\WUCOOGPOKVFTGK$CPFUEJPCNNGPKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGKJWPIUGVWK<'+  4+p++ #WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU



8992



1TFGP FGT LWIQUNCYKUEJGP (CJPG =1TFGP ,WIQUNQXGPUMG <CUVCXG? 5GV FGT  -NCUUG DGUVGJGPF CWU   -NGKPQF5KNDGTXGTIQNFGVOKV5RNKPVGPCWHFGT4ÒEMUGKVGCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP 5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJRWP\KGTVCP0CFGN\WUCOOGPOKV +PVGTKOUUEJPCNNGOKV#WHNCIGKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVIQNFHCTDGPGT$G\GKEJPWPI<'+  5VÒEM+p++



&GT MNCUUKIG 1TFGP HÒT 8GTFKGPUVG WO FKG 'PVYKEMNWPI WPF 5V·TMWPI FGT HTKGFNKEJGP <WUCOOGPCTDGKV WPF FGT   HTGWPFUEJCHVNKEJGP 8GTDKPFWPI \YKUEJGP ,WIQUNCYKGP WPF CPFGTGP .·PFGTP YWTFG CO  0QXGODGT  XQP   /CTUEJCNN,QUKR$TQ\6KVQIGUVKHVGV

199


SERBIEN UND JUGOSLAWIEN

8993



1TFGP FGT LWIQUNCYKUEJGP (CJPG =1TFGP ,WIQUNQXGPUMG <CUVCXG? 5GV FGT  -NCUUG DGUVGJGPF CWU   -NGKPQF 5KNDGT XGTIQNFGV OKV 5RNKPVGP CWH FGT 4Ã&#x2019;EMUGKVG QJPG 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT   VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG OGJTHCEJ RWP\KGTV CP 0CFGN <'+     5VÃ&#x2019;EM++



8996

8995

8994 8997



1TFGPFGTLWIQUNCYKUEJGP(CJPG=1TFGP,WIQUNQXGPUMG<CUVCXG?&GMQTCVKQP-NCUUG5KNDGTVGKN YGKUGXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFKOPKEJVQTKIKPCNGP'VWK<'+ +p++





1TFGPFGT4GRWDNKM/QFGNN  $TWUVUVGTPFGT-NCUUG5KNDGTXGTIQNFGVWPFVGKNYGKUG 'OCKNNKGTVDGUGV\VVGKNYGKUG¯LQWTOKVYGK­GPWPFTQVGP5KOKNKUVGKPGPCWHFGT4Ã&#x2019;EMUGKVGRWP\KGTVCP 3WGTPCFGN<'+ 44++



&GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



1TFGPFGT$TÃ&#x2019;FGTNKEJMGKVWPFFGT'KPJGKV$TWUVUVGTPFGT-NCUUG5KNDGTVGKNYGKUGXGTIQNFGV/G FCKNNQPTKPITQVGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVGOGJTHCEJRWP\KGTVOKV6T·IGTPWOOGTCP5EJTCWDG OKV 5EJTCWDGUEJGKDG FKGUG OKV *GTUVGNNGTDG\GKEJPWPI FGT (KTOC +MQOKP<CITGD\WUCOOGPOKV\YGK +PVGTKOUEJPCNNGPKOQTKIKPCNGPGVYCUDGUEJ·FKIVGP8GTNGKJWPIUGVWK<'+ ++



&GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



1TFGPFGT$TÃ&#x2019;FGTNKEJMGKVWPFFGT'KPJGKV$TWUVUVGTPFGT-NCUUG5KNDGTVGKNYGKUGXGTIQNFGV/G FCKNNQPTKPIYGK­GGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVGOGJTHCEJRWP\KGTVOKV6T·IGTPWOOGTCP5EJTCWDG OKV5EJTCWDGUEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC+MQOKP<CITGD<'+ ++ &GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP

200




SERBIEN UND JUGOSLAWIEN

8999

9000 8998



/KNKV·T8GTFKGPUVQTFGP  /QFGNN   $TWUVUVGTP FGT  -NCUUG 5KNDGT VGKNYGKUG XGTIQNFGV   WPFGOCKNNKGTVCP0CFGN<'+ +p++

&GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



1TFGPFGT#TDGKV&GMQTCVKQP-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<'+

++



1TFGPFGT#TDGKV&GMQTCVKQP-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGOGJTHCEJ RWP\KGTVCP0CFGN<'+ ++

NVGTG#PHGTVKIWPI&KG&GMQTCVKQPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPXGTNKGJGPWPFIGVTCIGP

0GWGTG#PHGTVKIWPI&KG&GMQTCVKQPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPXGTNKGJGPWPFIGVTCIGP

 



9001 9003

9004

9005

9002



1TFGP FGU 2CTVKUCPGPUVGTPU $TWUVUVGTP  -NCUUG 5KNDGT GOCKNNKGTV CWH FGT 4ÒEMUGKVG GKPIGRT·IV   4'&#WPFITCXKGTVCP5EJTCWDGOKV5EJTCWDUEJGKDGUQYLGVKUEJGT#TVRWP\KGTV/'6#.  ++



6CRHGTMGKVU1TFGP1TFGPUFGMQTCVKQP /QUMCWGT /QFGNN$TQP\GXGTIQNFGVCWHFGT4ÒEMUGKVGPWO OGTKGTVQJPG2GPVCIQPCNDCPFURCPIG<'+ ++



8QNMU8GTFKGPUVQTFGP&GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVCWHFGT4ÒEMUGKVGITCXKGTV++ WPF&GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVCWHFGT4ÒEMUGKVGITCXKGTV+++DGKFG CP5EJTCWDGPOKV5EJTCWDUEJGKDGPFKGUGOKVUGTDKUEJGP$G\GKEJPWPIGP<'+ 5VÒEM++



1TFGP FGT 8QNMUDGHTGKWPI $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 5EJTCWDG OKV   5EJTCWDUEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC+MQOKP<CITGD<'+ 44++



1TFGP HÒT CW­GTIGYÌJPNKEJG 8GTFKGPUVG KP FGT 0CVKQPCNGP (TQPV ,WIQUNCYKGPU 1TFGPUFGMQTCVKQP   $TQP\GXGTIQNFGV5KNDGTGOCKNNKGTVCWHFGT4ÒEMUGKVG6T·IGTPWOOGTCP5EJTCWDGOKV5EJTCWD UEJGKDGFKGUGOKV*GTUVGNNGTDG\GKEJPWPIFGT(KTOC+MQOKP<CITGD ++



&GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



&GT 1TFGP KUV CO  #WIWUV  IGUVKHVGV WPF FKG 1TFGPUFGMQTCVKQPGP FGU  /QFGNNU UKPF KP /QUMCW IGHGTVKIV   YQTFGP





&GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



(TÒJG#WUHÒJTWPIFKGUGUIGUVKHVGVGP1TFGPU

201


SLOWAKISCHE REPUBLIK

9006 (verkleinert)



5COONWPI XQP  XGTUEJKGFGPGP /KPKCVWTGP XQP LWIQUNCYKUEJGP 1TFGP WPF 'JTGP\GKEJGP   &CTWPVGTFGU,WIQUNCYKUEJGP)TQ­GP5VGTPGPQTFGPUFGU(TGKJGKVUQTFGPUFGU1TFGPUFGU8QNMUJGNFGP FGU 1TFGPU FGU *GNFGP FGT 5Q\KCNKUVKUEJGP #TDGKV FGU 1TFGPU FGT 8QNMUDGHTGKWPI FGU 1TFGPU FGT   -TKGIUHCJPG FGU 6CRHGTMGKVU1TFGPU CNNGT -NCUUGP FGU ,WIQUNCYKUEJGP 5VGTPGPQTFGPU FGU   ,WIQUNCYKUEJGP (CJPGPQTFGPU FGU 1TFGPU FGU 2CTVKUCPGPUVGTPU FGU 1TFGPU FGT 4GRWDNKM WUY   VGKNYGKUGXGTUKNDGTVVGKNYGKUGXGTIQNFGVITÌ­VGPVGKNUNCEMKGTVCP$CPFVTCIGURCPIGP 5VÒEM+p++



9007 1:1,5

5.19#-+5%*'4'27$.+-

'456' 5.19#-+5%*'4'27$.+-   

1TFGPFGU(ÒTUVGP2TKDKPC(·NUEJWPI  FGU$TWUVUVGTPU5KNDGTXQNNUV·PFKIXGTIQNFGVVGKNYGKUGGOCKN NKGTVQJPGLGINKEJG2WP\KGTWPICP0CFGN ++ #PHGTVKIWPICWUFGPGT,CJTGP&GT$TWUVUVGTPMQOOVKPFKGUGT(QTOÒDGTJCWRVPKEJVXQT8QNNUV·PFKIXGTIQN FGVG 'ZGORNCTG IKDV GU PKEJV FCU /GFCKNNQPHGNF KUV IGPGTGNN UKNDGTHCTDGP WPF DGK 'ZGORNCTGP OKV IQNFHCTDGPGP   5VTCJNGPY·TGPFKGUEJTCHHKGTVGP(GNFGT\YKUEJGPFGP5VTCJNGPITÒPGOCKNNKGTV

202




SPANIEN

52'<+#.5#//.70)52#0+5%*'5)1.& #75<9'+,#*4*70&'46'0

9008 (1:1)

-¤0+)4'+%* #0%+'04—)+/'$+5  

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    D\Y  /QFGNN      $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT /CFQPPC KO /GFCKNNQP )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG ITÒPG .GFGTCWHNCIG OKV FGT IQNFHCTDGPGP *GTUVGNNGTDG\GKEJPWPI   $+'00#+5 14(—84'&'. '/2'4'74'641+#2#4+5OKVUV·JNGTPGO0CFGNU[UVGOWPF\YGK 5GKVGPJCMGP2')7<'+ 444++  $GFGWVGPFGT HTÒJGT $TWUVUVGTP KP GZ\GNNGPVGT *GTUVGNNWPIUSWCNKV·V FGU DGXQT\WIVGP ,WYGNKGTU 0QRQN¾QPU + KP VTQV\   FGU JQJGP #NVGTU ÒDGTTCIGPFGT 'TJCNVWPI WPF XQP CNNGTITÌ­VGT 5GNVGPJGKV &KG *GTUVGNNWPIU\GKV N·­V UKEJ CWH FGP   <GKVTCWO\YKUEJGP=CDFCHÒJTV0CRQN¾QPFGP6KVGN'ORGTGWTGV4QK-CKUGTWPF-ÌPKI XQP+VCNKGP WPF FCVKGTGP =FGPP KO ,WNK  YWTFG 0CRQN¾QPU $TWFGT ,QUGRJ -ÌPKI XQP 5RCPKGP WPF FKGUGT UEJWH FKG CNVGP URCPK   UEJGP 1TFGP CW­GT FGO 1TFGP XQO )QNFGPGP 8NKGU  \W )WPUVGP FGU PGWGP -ÌPKINKEJGP 1TFGPU XQP 5RCPKGP CD?   &C 5RCPKGP CD  CNU HGKPFNKEJG /CEJV (TCPMTGKEJU \W DGVTCEJVGP YCT FÒTHVG GU UEJYGT OÌINKEJ IGYGUGP UGKP   FC­PQEJ\YKUEJGPWPFGKP$TWUVUVGTPGKPGUURCPKUEJDQTDQPKUEJGP1TFGPUDGKO*QHLWYGNKGT0CRN¾QPUKP 2CTKU JGTIGUVGNNV YWTFG 7PF PCEJ  Y·TG CWH FGT 4ÒEMUGKVG PKEJV OGJT FKG $G\GKEJPWPI    14(—84' &'   . '/2'4'74'641+GTUEJKGPGP  &GT \WP·EJUV XKGTMNCUUKIG 1TFGP YWTFG XQP -ÌPKI -CTN +++   OKV 7TMWPFG XQO  5GRVGODGT    IGUVKHVGV /QFGNN XQP-ÌPKI-CTN+8  OKV-ÌPKINKEJGO&GMTGVXQO,WPK /QFGNN WPF XQP -ÌPKI (GFKPCPF 8++   OKV &GMTGV XQO  #RTKN  XGT·PFGTV 'KPG 8GT·PFGTWPI FGT +PUKIPKGP   UQYKGGKPG'TYGKVGTWPIYWTFGFWTEJ&GMTGVG-ÌPKIKP+UCDGNNCU++  XQO,WNKWPF8GTQTFPWPI XQO  5GRVGODGT  FWTEJIGHÒJTV  /QFGNN  &KG RTQXKUQTKUEJG 4GIKGTWPI WPVGT 4GIGPV (TCPEKUEQ 5GTTCPQ   &QOÃPIWG\ XGTNKGJ FGP 1TFGP OKV GPVHGTPVGP DQWTDQPKUEJGP .KNKGP DKU \WO 'PFG FGT 4GIGPVUEJCHV YGKVGT  /Q   FGNN -ÌPKI#OCFGQ  YKGCWEJFKG'TUVG5RCPKUEJG4GRWDNKMXGTNKGJGPFGP1TFGPPKEJV-ÌPKI#NHQPU :++   PCJO PCEJ UGKPGT 6JTQPDGUVGKIWPI CO  &G\GODGT  HQTONQU FKG 8GTNGKJWPIGP FGU1TFGPU CDYKGFGTCWH /QFGNN /KV&GMTGVXQO,CPWCT XGTÌHHGPVNKEJVKPFGT)CEGVCFG/CFTKFXQO ,CPWCT  YWTFG FGT 1TFGP WPVGT -ÌPKI #NHQPU :+++   CDGTOCNU XGT·PFGTV WO PCEJ FGT #WUTWHWPI FGT   4GRWDNKM CO  #RTKN   CWHIGJQDGP \W YGTFGP 5VCCVUEJGH )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG     GTPGWGTVGFGP1TFGPOKV&GMTGVXQO/CKXGTÌHHGPVNKEJVKO$1'XQO#WIWUV /QFGNN &KG NGV\VGP 'TYGKVGTWPIGP YWTFGP XQP -ÌPKI ,WCP %CTNQU + IGD   OKV &GMTGV  XQO  #WIWUV   

XGTÌHHGPVNKEJVKO$1'XQO#WIWUV 8GTQTFPWPIXQO1MVQDGT XGTÌHHGPVNKEJVKO$1'XQO1MVQ DGT WPF8GTQTFPWPIXQO/CK XGTÌHHGPVNKEJVKO$1'XQO/CK FWTEJIGHÒJTV

203


SPANIEN

9009 (1:1)



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN  -TGW\ GKPGU4KVVGTUXQP0WOOGT  )QNFGOCKNNKGTVGKPKIGMNGKPG'OCKNNGEJKRUCWH8QTFGTWPF4ÒEMUGKVGCP GOCKNNKGTVGT 6TCIGURCPIG KPUIGUCOV  I OKV \GKVIGPÌUUKUEJGO QTKIKPCNGP $CPF 2')7  XCT   <'+ 44+++  5GJT UGNVGPG #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU #EJV\GJPVGP ,CJTJWPFGTVU FKG 6TCIGURCPIG OÌINKEJGT YGKUG   CWUFGOGTUVGP(ÒPHVGNFGU0GWP\GJPVGP,CJTJWPFGTVU'Z#WMVKQPFGT%CUCF #UVG5CP)KQTIKQKP)GPWCXQO 1MVQDGT  0T   &CU -TGW\ FGU 4KVVGTU XQP 0WOOGT YWTFG CO $TWUVDCPF IGVTCIGP KO )GIGPUCV\ \WO   -TGW\FGURGPUKQPUDGTGEJVKIVGP4KVVGTUFCUCO*CNUDCPFIGVTCIGPYWTFG

9010 (1:1)

9010 (1:1) 1,5:1



#D\GKEJGPFGT*N+PSWKUKVKQPKP5RCPKGPZOO)QNFVGKNYGKUGGOCKNNKGTVIGKPKIG MNGKPG'OCKNNGCWUDTÒEJGQJPG$CPFQFGT-QTFGN2')7p 44++ 'ZVTGO UGNVGPGU #D\GKEJGP  $GK FGO UEJYCT\YGK­GP .KNKGPMTGW\ JCPFGNV GU UKEJ WO FCU 1TFGPUMTGW\FGU&QOK PKMCPGT1TFGPU 1TFQ 2TCGFKECVQTWO  FGO FKG +PSWKUKVKQP KP 5RCPKGP CPXGTVTCWV YCT &KGUGU #D\GKEJGP KUV CNU   8QTN·WHGT FGU XQP -ÌPKI (GTFKPCPF 8++ CO  /·T\  IGUVKHVGVGP #D\GKEJGPU FGU JN 2GVTWU /CTV[T HÒT FKG   /KVINKGFGTFGT+PSWKUKVKQP H·NUEJNKEJGTYGKUGQHVCNU1TFGPXQOJN2GVTWU/CTV[TDG\GKEJPGV \WDGVTCEJVGP

204




SPANIEN

9011

&4+66'5 -¤0+)4'+%*4'56#74#6+10('4&+0#0&58++   

1TFGPXQO)QNFGPGP8NKGU-NGKPQF)QNFHGKPUV\KUGNKGTVWPFVGKNYGKUGGOCKNNKGTVCP5VGNNGFGU(GWGT UVGKPU GKP #SWCOCTKP ¯ LQWT IGUGV\V  I GKPKIG MCWO UKEJVDCTG 'OCKNNGEJKRU CO QTKIKPCNGP   *CNUDCPF OKV %QWNCPV )QNF HGKPUV \KUGNKGTV VGKNYGKUG GOCKNNKGTV KO QTKIKPCNGP \GKVIGPÌUUKUEJGP   8GTNGKJWPIUGVWK 444++  'ZGORNCT CWU FGT  #WMVKQP FGU &QTQVJGWO KP 9KGP CO  &G\GODGT  FQTV CNU #PHGTVKIWPI WO    DGUEJTKGDGP 0CEJHQTUEJWPIGP JCDGP GTIGDGP FCUU FCU 'ZGORNCT UGKPGT\GKV XQP GKPGO RTKXCVGP 'KPNKGHGTGT CWU   .CP\GPMKTEJGP KP 0KGFGTÌUVGTTGKEJ KPU &QTQVJGWO \WT 8GTUVGKIGTWPI GKPIGDTCEJV YQTFGP YCT +P .CP\GPMKTEJGP   DGHKPFGVUKEJ5EJNQUU(TQJUFQTHKPFGODKU\WUGKPGO6QFFGT)TCHXQP%JCODQTFHTCP\ÌUKUEJGT6JTQPRT·VGPFGPV FGT.GIKVKOKUVGPTGUKFKGTVG8QPKJOKUVOGJTHCEJDGMCPPVIGYQTFGPFCUUGTIGIGP'PFGUGKPGU.GDGPUKJOHTÒJGT XGTNKGJGPG1TFGPUKPUKIPKGPCPXGTUEJKGFGP2GTUQPGPXGTUEJGPMVGFCGTUGNDUVCNUNGV\VGTUGKPGU)GUEJNGEJVGUMKPFGTNQU YCT#WHFKGUGO9GIGKUVFKGUGDGFGWVGPFG&GMQTCVKQPKO'TDYGIGCPFGPUGKPGT\GKVKIGP'KPNKGHGTGTIGMQOOGP  *GPTK 8  %JCTNGU (GTFKPCPF /CTKG &KGWFQPP¾ XQP #TVQKU   *GT\QI XQP $QTFGCWZ WPF )TCH XQP   %JCODQTFYCTFGT'PMGN-ÌPKI-CTNU:XQP(TCPMTGKEJ  (QTOGNNYCTGTPCEJFGT#DFCPMWPI-ÌPKI -CTNU : XQO  DKU \WO  #WIWUV  CNUQ FGT 6JTQDGUVGKIWPI FGU $ÒTIGMÌPKI .QWKU 2JKNKRRG XQP 1TN¾CPU  

  -ÌPKI XQP (TCPMTGKEJ 0CEJ FGO (CNN FGU <YGKVGP (TCP\ÌUKUEJGP -CKUGTTGKEJGU  WPF FGO (TKG   FGPUXGTVTCI XQP (TCPMHWTV XQO  /CK  YWTFG FGO )TCHGP XQP %JCODQTF XQP FGP .GIKVKOKUVGP WPF FGP   1TN¾CPKUVGP IGOGKPUCO FKG -TQPG (TCPMTGKEJU CPIGVTCIGP &GT HTCP\ÌUKUEJG 2T·UKFGPV 2CVTKEG FG /CE /CJQP  

  DCV KJP XQT FKG 0CVKQPCNXGTUCOONWPI YQ GT FWTEJ #MMNCOCVKQP FGT &GRWVKGTVGP \WO -ÌPKI XQP   (TCPMTGKEJ GTJQDGP YGTFGP UQNNVG &GT )TCH XQP %JCODQTF CPVYQTVGVG LGFQEJ CO  1MVQDGT  OKV FGT 9KG   FGTJQNWPIUGKPGU/CPKHGUVUFGT9GK­GP(CJPGXQO,WNKIGO·­FGOGUKJOWPOÌINKEJUGKCWHFKGMÌPKI NKEJGYGK­G(CJPGUGKPGTDQWTDQPKUEJGP8QTHCJTGP\W)WPUVGPFGTHTCP\ÌUKUEJGP6TKMQNQTGFGU'TDGUFGTHTCP\ÌUK UEJGP 4GXQNWVKQP \W XGT\KEJVGP &KGU OCEJVG CNNG *QHHPWPIGP CWH GKPG 9KGFGTGTTKEJVWPI FGT DQWTDQPKUEJGP /QP   CTEJKG \WPKEJVG FC GKPG #DUEJCHHWPI FGT 6TKMQNQTG \W )WPUVGP FGT CNVGP YGK­GP $QWTDQPGPHNCIIG RQNKVKUEJ PKEJV   FWTEJ\WUGV\GP YCT 'U UVCTD XGTGKPUCOV KP UGKPGO 'ZKN KP (QJUFQTH CO  #WIWUV  OÌINKEJGTYGKUG FWTEJ   8GTIKHVWPI   &GT)TCHXQP%JCODQTFKUVXQP-ÌPKI(GTFKPCPF8++  CO0QXGODGT IGTCFGFTGKL·JTKI CNU  4KVVGT CWHIGPQOOGP YQTFGP &C GT UR·VGT HÒT FKG %CTNKUVGP 2CTVGK GTITKHH YWTFG GT  XQP FGT 4GIGPVKP   -ÌPKIKPOWVVGT/CTKC%JTKUVKPCXQP5RCPKGP  CWUFGO1TFGPCWUIGUEJNQUUGP  $GFGWVGPFGU 1DLGMV OKV MÌPKINKEJGT 2TQXGPKGP\ XQP JQJGO URCPKUEJGP YKG CWEJ HTCP\ÌUKUEJGP JKUVQTKUEJGP +PVGT   GUUG KP JGTXQTTCIGPFGT #PHGTVKIWPIUSWCNKV·V CWU FGO GTUVGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU WPF KP #PDG   VTCEJVFGUJQJGP#NVGTUQRVKOCNGT'TJCNVWPI  &GT YQJN DGFGWVGPFUVG F[PCUVKUEJG 1TFGP YWTFG CO  ,CPWCT  XQP 2JKNKRR +++ FGO )WVGP *GT\QI XQP   $WTIWPF  IGUVKHVGVWPFIKPICWHFGO'TDYGIGÒDGT-CKUGT/CZKOKNCP+  CPFCU*CWU*CDU DWTI/KVFGT#WHVGKNWPIFGUJCDUDWTIKUEJGP$GUKV\GUCPGKPGÌUVGTTGKEJKUEJGWPFCPGKPGURCPKUEJG.KPKG 2JKNKRR++  IKPIFCU*GT\QIVWO$WTIWPFWPFFCOKVCWEJFGT1TFGPXQO)QNFGPGP8NKGUCPFKGNGV\VGTG/KVFGO 6QF -ÌPKI -CTNU ++ XQP 5RCPKGP   GTNQUEJ FKG .KPKG FGT URCPKUEJGP *CDUDWTIGT YCU PCEJ FGO   5RCPKUEJGP'TDHQNIGMTKGI\WGKPGT DKUJGWVGGZKUVKGTGPFGP #WHVGKNWPIFGU1TFGPUKPGKPGPURCPKUEJGP<YGKIWPVGT -ÌPKI 2JKNKRR 8   CWU FGO *CWU $QWTDQP WPF GKPGO ÌUVGTTGKEJKUEJGP <YGKI WPVGT -CKUGT -CTN 8+  

 HÒJTVG&GT1TFGPYWTFGWPFYKTFXQPFGPURCPKUEJGP$QWTDQPGPDKUJGWVGCNUF[PCUVKUEJGTWPFJÌEJ UVGTURCPKUEJGT1TFGPYGKVGTXGTNKGJGP

205


SPANIEN

9012 (1:1)



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   -TGW\GKPGU4KVVGTUXQP0WOOGT  OKV5VGKPGP5KNDGT)QNFDGUGV\VOKVECYGK­GPWPFDNCWGP 5KOKNKUVGKPGPCP6TCIGUEJPCNNG5KNDGT)QNFDGUGV\VOKVECYGK­GP5KOKNKUVGKPGPKPUIGUCOVI COCNVGP$CPFCDUEJPKVV2')7XCT<'+ 444+  'ZVTGOUGNVGPG#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

9013 (1:1)



9014 (1:1)

9013 (1:1)

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   -NGKPQF \WO )TQ­MTGW\ )QNF HGKPUV \KUGNKGTV WPF GOCKNNKGTV  I HGKPG 'OCKNNGOCNGTGK OKV   MCPPGNKGTVGO $CPFTKPI OKV QTKIKPCNGO CNVGP \GKVIGPÌUUKUEJGP 5EJWNVGTDCPF 2')7  <'+    4++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPIWOKP2TCEJVGTJCNVWPI



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   $TWUVUVGTP\WO)TQ­MTGW\5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV/GFCKNNQP)QNFGOCKNNKGTVHGKPUVG'OCKNNG OCNGTGKTÒEMUGKVKIG/GFCKNNQPCDFGEMWPIHGJNVQJPG0CFGNU[UVGO2')7<'+ 4++  (TÒJGU 'ZGORNCT CWU FGO GTUVGP &TKVVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU QJPG 0CFGNU[UVGO \WO#WHP·JGPCWHFGP 4QEM'Z#WMVKQPFGT%CUCF #UVG5CP)KQTIKQKP)GPWCXQO1MVQDGT0T

206


SPANIEN

9015 (1:1)



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   -TGW\GKPGURGPUKQPUDGTGEJVKIVGP4KVVGTU)QNFGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGKGKPKIGMCWO UKEJVDCTG'OCKNNGEJKRUCWHDGKFGP5GKVGPCOMCPPGNKGTVGP$CPFTKPICOQTKIKPCNGPCNVGP\GKVIGPÌUUKUEJGP *CNUDCPF2')7XCT<'+XCT 44++  &KGRGPUKQPUDGTGEJVKIVGP4KVVGTVTWIGPFCU4KVVGTMTGW\COUEJOCNGP$CPFCO*CNU

9016 (1:1)



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU -TGW\ HÒT )GPGT·NG )QNF OCUUKX GOCKNNKGTV  I OKV $CPF  #DRNCV\WPIGP KP FGT ITÒPGP   'OCKNNGWPFKOXQTFGTUGKVKIGP/GFCKNNQP\GPVTWOCOUR·VGTGP$CPF2')7<'+p 444++p+++  /CUUKX IGCTDGKVGVGU \GKVIGPÌUUKUEJGU 1TKIKPCNGZGORNCT FGU GTUVGP /QFGNNU CWU FGT <GKV FGT PCRQNGQPKUEJGP 2GPKP   UWNC-TKGIGPXQPCNNGTITÌ­VGT5GNVGPJGKVKPHÒTFCU#NVGTFGU5VÒEMGUÒDGTTCIGPFGT'TJCNVWPIUSWCNKV·V  &GT KP UGKPGT 'PVYKEMNWPI YKG CWEJ WPVGTUEJKGFNKEJGT )NKGFGTWPI MQORNK\KGTVGUVG URCPKUEJG 1TFGP &KG ,WPVC   5WRTGOC%GPVTCN)WDCTPCVKXCUVKHVGVGOKV&GMTGV0T.:::8+++XQO#WIWUVFGPHÒPHMNCUUKIGP )TQ­MTGW\ )QNFGPGU-TGW\OKVWPFQJPG.QTDGGT5KNDGTPGU-TGW\OKVWPFQJPG.QTDGGT PCVKQPCNGP1TFGPHÒT6CRHGTMGKV  /QFGNN FGTXQP-ÌPKI(GTFKPCPF8++  OKV&GMTGVXQO,CPWCTCNUMÌPKINKEJGT1TFGPDGUV·VKIV YWTFG /QFGNN #O,WNKYWTFGGKPPGWGU4GIQNCOGPVQOKVPGWGP-NCUUGPDG\GKEJPWPIGP )TQ­MTGW\ DKU  -NCUUG  GTNCUUGP &WTEJ )GUGV\ XQO  ,WPK  QTFPGVG -ÌPKI WPVGT FGT $G\GKEJPWPI 0CVKQPCN CNU GKP   MNCUUKIGP1TFGP -QNNCPG PGW /QFGNN ,GFQEJUEJQPOKV&GMTGVXQO1MVQDGTUVGNNVG(GTFKPCPF8++FKG 1TFPWPIFGU1TFGPUXQPYKGFGTJGT /QFGNN /KV-ÌPKINKEJGO&GMTGVXQO,WNKOKVMÌPKINKEJGT 8GTQTFPWPI XQO  #WIWUV  WPF UEJNKG­NKEJ OKV )GUGV\ XQO  /CK  XGTÌHHGPVNKEJV KP FGT )CEGVVC FG   /CFTKF XQO /CK QFPGVG-ÌPKIKP+UCDGNNC++  FKG+PUKIPKGPFGU1TFGPUPGWYQDGKFKG-NCUUGPDG \GKEJPWPIGP  -NCUUG  GTJCNVGP DNKGDGP  /QFGNN  9·JTGPF FGT 'TUVGP 4GRWDNKM YWTFG FGT 1TFGP PKEJV   XGTNKGJGP 9GKVGTG 'TI·P\WPIGP PCJOGP #NHQPU :++   OKV -ÌPKINKEJGT 8GTQTFPWPI XQO  0QXGODGT   WPF#NHQPU:+++  OKV)GUGV\XQO/·T\XQT.GV\GTGTTGQTICPKUKGTVGFGPOKV-ÌPKI NKEJGO &GMTGV XQO  ,WNK  XQNNMQOOGP PGW )TQ­MTGW\ -TGW\ OKV .QTDGGT  /QFGNN  +P FKGUGT (QTO   LGFQEJQJPGOQPCTEJKUEJG5[ODQNGYWTFGGTOKV4WPFXGTQTFPWPIXQO0QXGODGTCWEJXQPFGT<YGKVGP 4GRWDNKMÒDGTPQOOGP /QFGNN /KV)GUGV\XQO/·T\XGTÌHHGPVNKEJVKO$1'XQO/C[DGUV·VKIVG 5VCCVUEJGH )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG   FGP 1TFGP CWH FGT $CUKU XQP   /QFGNN    .GV\VG #PRCUUWPIGP YWTFGP OKV )GUGV\XQO#WIWUV XGTÌHHGPVNKEJVKO$1'0TXQO#W IWUV  OKV 8GTQTFPWPI XQO  ,WNK  OKV &GMTGV XQO  0QXGODGT  WPF UEJNKG­NKEJ FWTEJ MÌPKINKEJGU   &GMTGV0T-ÌPKI,WCP%CTNQU+XGTÌHHGPVNKEJVKO$1'0TXQO5GRVGODGTXQTIGPQOOGP

207


SPANIEN

9018

9017



9019

0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU -TGW\ FGT  WPF  -NCUUG OKV .QTDGGT HÒT 1HHK\KGTG HTÒJG #WUHÒJTWPI OKV QXCNGO   .QTDGGTMTCP\)QNFGOCKNNKGTVIOKP'OCKNNGEJKRUCWHFGT4ÒEMUGKVGOKVMCPPGNKGTVGO$CPFTKPI COQTKIKPCNGPCNVGP$CPF2')7<'+ ++



5GJTHGKPG#PHGTVKIWPIWO



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  4G FWMVKQP FGU )QNFGPGP -TGW\GU FGT  WPF  -NCUUG OKV .QTDGGT HÒT 1HHK\KGTG HTÒJG #WUHÒJTWPI OKV   QXCNGO .QTDGGTMTCP\ )QNF GOCKNNKGTV  I OKV MCPPGNKGTVGO $CPFTKPI CO $·PFEJGP 2')7    <'+ ++



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\FGTWPF-NCUUGOKV.QTDGGTHÒT1HHK\KGTG)QNFGOCKNNKGTVIOKP#DRNCV\WPIGP KPFGP/GFCKNNQPTKPIGPOKVMCPPGNKGTVGO$CPFTKPICOQTKIKPCNGPCNVGP$CPFOKVCWHIGNGIVGT5EJNGKHG 2')7<'+ ++



5GJTHGKPG#PHGTVKIWPIWO



5GJTHGKPG#PHGTVKIWPIWO

9020



9021

0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\FGTWPF-NCUUGOKV.QTDGGTHÒT1HHK\KGTG8CTKCPVG#WUHÒJTWPIOKVIGOCNVGT4ÒEMUGK VGPKPUEJTKHV'.4';;.#2#64+#KPFGT/KVVG)QNFGOCKNNKGTVIOKP#DRNCV\WPIGPKPFGP /GFCKNNQPTKPIGPWPFKPFGP.QTDGGTDN·VVEJGPOKVMCPPGNKGTVGO$CPFTKPICOQTKIKPCNGPCNVGP$CPFOKV CWHIGNGIVGT5EJNGKHG2')7XCT<'+ 44++



5GJTHGKPG#PHGTVKIWPIWO



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\FGTWPF-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVI OKV$CPF OKP'OCKNNGCDRNCV \WPIGPCWHDGKFGP5GKVGPOKVMCPPGNKGTVGO$CPFTKPICOQTKIKPCNGPCNVGP$CPFOKVCWHIGNGIVGT5EJNGKHG 2')7XCT<'+ ++p+++ #PHGTVKIWPIWO

208




SPANIEN

9022



9023

0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\FGTWPF-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVIMNGKPG'OCKNNGUEJ·FGPCWHDGKFGP 5GKVGPOKVMCPPGNKGTVGO$CPFTKPIQJPG$CPF2')7XCT<'+ ++p+++



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\FGTWPF-NCUUGOKV.QTDGGTHÒTFKGHTCP\ÌUKUEJGP1HHK\KGTGFGT'ZRGFKVKQPXQP )QNF GOCKNNKGTV  I OKV $CPF  OKP MCWO UKEJVDCTG 'OCKNNGTGRCTCVWTGP WPF URTÒPIG OKV   MCPPGNKGTVGO$CPFTKPICOUR·VGTGP$CPF2')7<'+ ++



#PHGTVKIWPIWO



&KGUGU-TGW\WPVGTUEJGKFGVUKEJXQOPQTOCNGP)QNFGPGP-TGW\WPF-NCUUGFCUUFKG$N·VVGTFGUWOFCU-TGW\ IGNGIVGP.QTDGGTMTCP\GUPCEJWPVGP\GKIGP  7OFGTUGKVY·JTGPFGPNCPFGUYGKVGPNKDGTCNGP4GXQNWVKQPWPVGT4CHCGNFG4KGIQ[0WPG\  *GTT\W YGTFGPJCVVG-ÌPKI(GTFKPCPF8++FKGUQIGPCPPVGō*GKNKIG#NNKCP\ŋ $ÒPFPKUFGTGWTQR·KUEJGPMQPUGTXCVKXGPWPF TGCMVKQPUQTKGPVKGTVGP (ÒTUVGP WPVGT FGT (ÒJTWPI FGU ÌUVGTTGKEJKUEJGP 5VCCVUMCP\NGT (ÒTUV /GVVGTPKEJ  WO *KNHG   IGDGVGP &KGUG UCPFVGP  GKPG HTCP\ÌUKUEJG #TOGG FKG UQIGPCPPVGP ō*WPFGTVVCWUGPF 5ÌJPG FGU JN .WFYKIŋ   PCEJ5RCPKGPFGTGUUEJNKG­NKEJIGNCPIFKGNKDGTCNG$GYGIWPIPKGFGT\WYGTHGP

9024



9025

0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\FGTWPF-NCUUGOKV.QTDGGTHÒTFKGHTCP\ÌUKUEJGP1HHK\KGTGFGT'ZRGFKVKQPXQP )QNFGOCKNNKGTVIMCWOUKEJVDCTG'OCKNNGTGRCTCVWTGPWPFURTÒPIGCWH8QTFGTWPF4ÒEMUGKVGOKV MCPPGNKGTVGO$CPFTKPICOQTKIKPCNGPCNVGP$CPFOKVCWHIGNGIVGT4QUGVVG2')7<'+ ++p



'Z #WMVKQP FGT %CUC F #UVG 5CP )KQTIKQ KP )GPWC XQO  1MVQDGT0T'ZGORNCTFGT5COONWPI&T #PVQPKQ 5RCFC KP $TGUEKC XGTÌHHGPVNKEJV KP 5RCFC #PVQPKQ 1PQTK G )NQTKC  5QXTCPQ /KNKVCTG 1TFKPG FK /CNVC   5RCIPC)TCP$TGVCIPC2QTVQICNNQ$TCUKNG$TGUEKC50T



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\FGTWPF-NCUUGOKV.QTDGGTHÒTFKGHTCP\ÌUKUEJGP1HHK\KGTGFGT'ZRGFKVKQPXQP )QNF GOCKNNKGTV  I 'OCKNNGUEJ·FGP CWH 8QTFGT WPF 4ÒEMUGKVG OKV MCPPGNKGTVGO $CPFTKPI QJPG   $CPF2')7<'+ +++p+8

 209


SPANIEN

9026 (1:1)



9027 (1:1)

-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

 WPF   -NGKPQF \WO )TQ­MTGW\ )QNF GOCKNNKGTV  I OKV QTKIKPCNGO CNVGP   5EJWNVGTDCPF2')7<'+ 4++  #PHGTVKIWPICWUFGOGTUVGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU  &GT FTGKMNCUUKIG )TQ­MTGW\ 5VGTP WPF -TGW\  /KNKV·T8GTFKGPUVQTFGP YWTFG OKV MÌPKINKEJGO &GMTGV XQO   0QXODGTXQP-ÌPKI(GTFKPCPF8++  IGUVKHVGVFCU4GIQNCOGPVQFCVKGTVXQO,WNK/KV -ÌPKINKEJGO&GMTGVXQO,CPWCTGTJKGNVFCU$CPFPGWG(CTDGPWPFPQEJGKPOCNFWTEJ-ÌPKI#NHQPU:++

 OKV-ÌPKINKEJGO&GMTGVXQO,WPK /QFGNN &KG<YGKVG4GRWDNKMÒDGTPCJOKO*GTDUV FGP 1TFGP GTUGV\VG LGFQEJ FKG -ÌPKIUMTQPG FWTEJ GKPG /CWGTMTQPG WPF GPVHGTPVG FCU 5VKHVGTOQPQITCOO CWH FGT   4ÒEMUGKVG FGU /GFCKNNQPU  /QFGNN  5VCCVUEJGH )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG   ÒDGTPCJO   FGP1TFGP\WP·EJUVOKVFGTUQIGPCPPVGPKORGTKCNGP-TQPGFGTMCVJQNKUEJGP-ÌPKIGGTUGV\VGFKGULGFQEJOKV&GMTGV XQO  /CK  XGTÌHHGPVNKEJV KO $1' 0T  XQO  ,WPK  FWTEJ FKG WTURTÒPINKEJG -ÌPKIUMTQPG /KV   MÌPKINKEJGO &GMTGV  XQO  (GDTWCT XGTÌHHGPVNKEJVKP$1'0TXQO(GDTWCT HÒIVG-ÌPKI ,WCP %CTNQU + WPVGTJCND FGU 5VGTPU =2NCEEC? GKPG -QOOCPFGWTUMNCUUG GKP 0GWG 5VCVWVGP YWTFGP UEJNKG­NKEJ OKV   -ÌPKINKEJGO&GMTGVXQO,WPKGTNCUUGP



-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

WPF 4KVVGTMTGW\)QNFVGKNYGKUGGOCKNNKGTVFKG-TGW\CTOHN·EJGPCWU'NHGPDGKP FCXQPGKPGTDGUEJ·FKIVIQJPG$CPFTKPIWPFQJPG$CPF2')7XCT<'+ 44++  $GFGWVGPFGUHTÒJGU'ZGORNCTWO'Z#WMVKQPFGT%CUCF #UVG5CP)KQTIKQKP)GPWCXQO1MVQDGT 0T

9029 (1:1) 9028 (1:1)



9028 (1:1)

-TGW\HÒTFKG5EJNCEJVXQP6CNCXGTCFGNC4GKPC CO,WNK )TQ­G#WUHÒJTWPIZOO )QNF GOCKNNKGTV  I HGKUVG )QNFUEJTKHV \YGK CNVG MCWO UKEJVDCTG 'OCKNNGTGRCTCVWTGP CWH FGT   4ÒEMUGKVG FGU WPVGTGP -TGW\CTOGU KP FGT ¤UG RWP\KGTV OKV QTKIKPCNGO CNVGP $CPF OKV IQNFGPGT   5RCPIG2')7 44++  &CU-TGW\KUVCO&G\GODGTOKV-ÌPKINKEJGT8GTQTFPWPIXQP(GTFKPCPF8++IGUVKHVGVYQTFGP



-TGW\ HÒT FKG 8GTVGKFKIGT XQP 5CTCIQUUC Y·JTGPF FGT <YGKVGP $GNCIGTWPI   Z  OO   )QNF VGKNYGKUG HGKPUV ITCXKGTV GOCKNNKGTV  I CO PKEJV MQTTGMVGP $CPF 2')7  6#//    4++  'ZGORNCT CWU FGT #WMVKQP  1TFGP CWU CNNGT 9GNV  5COONWPI 6COOCPP FGT 7$5 #) KP $CUGN CO  WPF    0QXGODGT  0T   &CU -TGW\ KUV CO  #WIWUV  OKV -ÌPKINKEJGT 8GTQTFPWPI XQP (GTFKPCPF 8++   IGUVKHVGVYQTFGP

210


SPANIEN

9030 (1:1) 9031 (1:1)



9031 (1:1)

-TGW\HÒTFKG5EJNCEJVXQP%JKENCPCZOO)QNFGOCKNNKGTVIMN'OCKNNGCWUDTWEJCWH FGOQDGTGP-TGW\CTOQJPG$·PFEJGP2')7 ++p



&CU-TGW\KUVCO(GDTWCTOKV-ÌPKINKEJGT8GTQTFPWPIXQP(GTFKPCPF8++IGUVKHVGVYQTFGP



-TGW\HÒTFKG5EJNCEJVXQP#NDWJGTTCZOO)QNFGOCKNNKGTVI OKV$CPF COCNVGP $CPF2')7 44+p++



&CU-TGW\KUVCO/·T\OKV-ÌPKINKEJGT8GTQTFPWPIXQP(GTFKPCPF8++IGUVKHVGVYQTFGP

9033 (1:1)



9032 (1:1)

9034 (1:1)

-TGW\ FGT <YGKVGP #TOGG QFGT FGT #TOGG XQP /WTEKC  Z  OO )QNF GOCKNNKGTV  I   OGJTGTGMNGKPGCNVGTUDGFKPIVG'OCKNNGUEJ·FGPQJPG$CPF2')7 44+++  &CU-TGW\KUVCO/·T\OKV-ÌPKINKEJGT8GTQTFPWPIXQP(GTFKPCPF8++IGUVKHVGVYQTFGP



-TGW\ FGT &TKVVGP #TOGG  #WUHÒJTWPI /QPQITCOO -ÌPKI (GTFKPCPFU 8++ CWH FGO 4GXGTU   OGFCKNNQPWPFOKVDGYGINKEJGO.QTDGGTMTCP\OOZOO)QNFGOCKNNKGTVI OKV$CPF WPF5RCPIG HGKPUVG'OCKNNGOCNGTGKCOQTKIKPCNGP$CPFOKVGEJVIQNFGPGT6TCIGURCPIG2')7 44+p++  'ZGORNCTFGT5COONWPI&T#PVQPKQ5RCFCKP$TGUEKCXGTÌHHGPVNKEJVKP5RCFC#PVQPKQ1PQTKG)NQTKC5QXTCPQ /KNKVCTG1TFKPGFK/CNVC5RCIPC)TCP$TGVCIPC2QTVQICNNQ$TCUKNG$TGUEKC5H0T&CU-TGW\KUV CO/·T\OKV-ÌPKINKEJGT8GTQTFPWPIXQP(GTFKPCPF8++IGUVKHVGVYQTFGP



-TGW\FGT&TKVVGP#TOGG#WUHÒJTWPIOKV6'4%'4','4%+61CWHFGO4GXGTUOGFCKNNQPWPFUVCTT DGHGUVKIVGO.QTDGGTMTCP\OOZOO)QNFGOCKNNKGTVI OKV$CPF COQTKIKPCNGP$CPF OKVGEJVIQNFGPGT6TCIGURCPIG2')7 44++

 211


SPANIEN

9035 (1:1)

&4+66'5 -¤0+)4'+%*4')+'470)+5#$'..#5++   

1TFGPXQO)QNFGPGP8NKGU-NGKPQF)QNFHGKPUV\KUGNKGTVWPFGOCKNNKGTVCP5VGNNGFGU(GWGTUVGKPUGKP #SWCOCTKPICOQTKIKPCNGP*CNUDCPF 44+  'ZGORNCT CWU FGO $GUKV\ XQP -ÌPKI )GQTI 8 XQP *CPPQXGT   FGT CO  /CK  XQP -ÌPKIKP +UC   DGNNC ++ XQP 5RCPKGP CNU  4KVVGT KP FGP 1TFGP CWHIGPQOOGP YWTFG &KGUGU 'ZGORNCT GPVURTKEJV KP CNNGP &G   VCKNUFGOLGPKIGPFGT5COONWPIXQP&T#PVQPKQ5RCFCKP$TGUEKCXGTÌHHGPVNKEJVKP5RCFC#PVQPKQ1PQTKG)NQTKC  5QXTCPQ /KNKVCTG 1TFKPG FK /CNVC 5RCIPC )TCP $TGVCIPC 2QTVQICNNQ $TCUKNG $TGUEKC  5  WPF FQTV   -ÌPKI UR·VGT-CKUGT 9KNJGNO+XQP2TGW­GP  \WIGUEJTKGDGP&KGUGTYWTFGCO/·T\CNU 4KVVGT UGKP 5QJP (TKGFTKEJ UR·VGT -CKUGT (TKGFTKEJ +++  CO  ,CPWCT  CNU  4KVVGT WPF 2TKP\ -CTN XQP   2TGW­GP*GTTGPOGKUVGTFGU,QJCPPKVGTQTFGPUCO/CKCNU4KVVGTCWHIGPQOOGPUQFC­FWTEJCWUFKG /ÌINKEJMGKV DGUVGJV FC­ FKG DGK 5RCFC CDIGDKNFGVG &GMQTCVKQP W 7 PKEJV GTUVGTGO UQPFGTP GKPGO FGT DGKFGP   .GV\VGTGP IGJÌTVG  $GFGWVGPFGU UEJYGTGU -NGKPQF XQP WPXGTINGKEJNKEJGT ,WYGNKGTUCTDGKV WPF CWU MÌPKINKUEJGO   $GUKV\

212


SPANIEN

9036 (1:1)



9037 (1:1)

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV \YGK OKP   5RTÒPIG KO /GFCKNNQPHGNF HGKPUVG 'OCKNNGOCNGTGK CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   );TCDWTQKP/CFTKFCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ ++  5GJT HGKPG #PHGTVKIWPI WO  'Z #WMVKQP FGT %CUC F #UVG 5CP )KQTIKQ KP )GPWC XQO  1MVQDGT  0T   



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   $TWUVUVGTP\WO)TQ­MTGW\5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV/GFCKNNQP)QNFGOCKNNKGTVHGKPUVG'OCKNNG OCNGTGKCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ ++  5GJTHGKPG#PHGTVKIWPIWO'Z#WMVKQPFGT%CUCF #UVG5CP)KQTIKQKP)GPWCXQO1MVQDGT0T

9039



9038 (1:1)

9039

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   $TWUVUVGTP \WO )TQ­MTGW\ #WUHÒJTWPI OKV IGUEJWRRVGP -TGW\CTOHN·EJGP 5KNDGT /GFCKNNQP )QNF   GOCKNNKGTVCP0CFGNFKGUGRWP\KGTV2')7<'+ ++  /WVOC­NKEJHTCP\ÌUKUEJG#PHGTVKIWPIWO'Z#WMVKQPFGT%CUCF #UVG5CP)KQTIKQKP)GPWCXQO1MVQ DGT0T



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   -TGW\GKPGU4KVVGTUXQP0WOOGT)QNFGOCKNNKGTVIOGJTGTG'OCKNNGTGRCTCVWTGPCWH8QTFGTWPF 4ÒEMUGKVGCOMCPPGNKGTVGP$CPFTKPICOUR·VGTGP$CPF2')7<'+ ++p



#PHGTVKIWPIWO

213


SPANIEN

9042 Rs. (1:1)

9040 9041



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   -TGW\ GKPGU 4KVVGTU XQP 0WOOGT KP TGFW\KGTVGT #WUHÒJTWPI )QNF GOCKNNKGTV  I CO MCPPGNKGTVGP   $CPFTKPICOCNVGPLGFQEJPKEJVRCUUGPFGP$CPF2')7XCT<'+XCT 4+p++



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   -TGW\GKPGU4KVVGTUXQP0WOOGT)QNFGOCKNNKGTVIOKP'OCKNNGCDURNKVVGTWPIGPKOXQTFGTUGKVKIGP /GFCKNNQPTKPICOMCPPGNKGTVGP$CPFTKPICOUR·VGTGP$CPF2')7<'+ ++p



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU 8GTFKGPUVXQNNGT1TFGP-CTNU+++ WPFUGKV /QFGNN   /KPKCVWT FGU 1TFGPUMTGW\GU OKV 5VGKPGP )QNF GOCKNNKGTV -TGW\ OKV &KCOCPVTQUGP DGUGV\V CO CNVGP   $·PFEJGP 4++



#PHGTVKIWPIWO



#PHGTVKIWPICWUFGT/KVVGFGU0GWP\GJPVGP,CJTJWPFGTVU



9043 (1:1)



9044 (1:1) 9043 (1:1)

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -NGKPQF KP-QOOCPFGWTMTGW\ITÌ­G \WO)TQ­MTGW\)QNFHGKPUV\KUGNKGTVWPFGOCKNNKGTVIHGKPG 'OCKNNGOCNGTGKOKVQTKIKPCNGOCNVGP\GKVIGPÌUUKUEJGP5EJWNVGTDCPF2')7<'+ 4+p++  5GJT SWCNKV·VUXQNNG #PHGTVKIWPI WO  OKV UVCTT CPIGDTCEJVGO .QTDGGTMTCP\ ÒDGT FGO -TGW\ 'Z #WMVKQP FGT   %CUCF #UVG5CP)KQTIKQKP)GPWCXQO1MVQDGT0T



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV /GFCKNNQP )QNF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK   /GFCKNNQPTKPI OKV  5KOKNKUVGKPGP DGUGV\ CP0CFGNOKV\YGK5GKVGPJCMGP2')7XCT<'+ XCT 44++ 

/WVOC­NKEJ UGJT HGKPG PGCRQNKVCPKUEJG #PHGTVKIWPI WO  'Z #WMVKQP FGT %CUC F #UVG 5CP )KQTIKQ KP )GPWC   XQO  1MVQDGT  0T  'ZGORNCT FGT 5COONWPI &T #PVQPKQ 5RCFC KP $TGUEKC XGTÌHHGPVNKEJV KP 5RCFC   #PVQPKQ 1PQTK G )NQTKC  5QXTCPQ /KNKVCTG 1TFKPG FK /CNVC 5RCIPC )TCP $TGVCIPC 2QTVQICNNQ $TCUKNG $TGUEKC   50T&CXQTKO$GUKV\FGTMÌPKINKEJGP(COKNKGFGT$QWTDQPGP$GKFGT5K\KNKGP

214


SPANIEN

9045 (1:1)

9046



9047

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV FKG #WHNCIGP )QNF   GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC %CUVGNNU KP $CTEGNQPC XGTUEJKGFGPG   1Z[FCVKQPUURWTGPCP0CFGNOKV\YGK5GKVGPJCMGP2')7XCT<'+XCT 44++  5GJT UGNVGPG #PHGTVKIWPI CWU FGT /KVVG FGU 0GWP\GJPVGP ,CJTJWPFGTVU &KG5VGTPGFGT-QOOCPFGWTGXQP0WOOGT YWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV FKG #WHNCIGP )QNF   GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ) ;TCDWTQ KP /CFTKF OKP   'OCKNNGURTÒPIGKPGKPGT-TGW\CTOHN·EJGCP0CFGN2')7<'+ ++



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  $TWUVUVGTP \WO )TQ­MTGW\ 5VGTPMQTRWU 5KNDGT XGTIQNFGV #WHNCIGP )QNF IGRTÒHV  GOCKNNKGTV ITÌ­GTG   'OCKNNGTGRCTCVWTGP CWH FGO WPVGTGP -TGW\CTO WPF KO /GFCKNNQP CP 0CFGN OKV \YGK 5GKVGPJCMGP   2')7<'+ 4++p



#PHGTVKIWPIWO&KG5VGTPGFGT-QOOCPFGWTGXQP0WOOGTYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNU QFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV 0T  &GT WTURTÒPINKEJ FTGKMNCUUKIG )TQ­MTGW\ -QOOCPFGWT WPF 4KVVGT  1TFGP HÒT 8GTFKGPUVG KP FGP COGTKMCPKUEJGP   -QNQPKGP YWTFG OKV -ÌPKINKEJGT 8GTQTFPWPI XQO  /·T\  XGTÌHHGPVNKEJV KP FGT )CEGVC FG /CFTKF  XQP   -ÌPKI(GTFKPCPF8++  IGUVKHVGV /QFGNN -ÌPKIKP+UCDGNNC++  GTYGKVGTVGFGP1TFGPWO FKG -NCUUG FGT WPVGTJCND FGU )TQ­MTGW\GU CPIGUKFGNVGP -QOOCPFGWTG XQP 0WOOGT WPF XGT·PFGTVG FKG )GUVCNVWPI   FGT+PUKIPKGPOKV-ÌPKINKEJGO&GMTGVXQO,WNKD\YOKV8GTQTFPWPIXQO5GRVGODGT /QFGNN 0CEJ UGKPGT 6JTQPDGUVGKIWPI CO  0QXGODGT  XGTNKGJ -ÌPKI #NHQPU :++   FGP 1TFGP YKGFGT KP FGT   DKUJGTKIGP )GUVCNVWPI LGFQEJ PWPOGJT OKV /QPQITCOO -ÌPKI (GTFKPCPF 8++  /QFGNN  /KV -ÌPKINKEJGO   &GMTGV XQO  #RTKN  YWTFG FGT COGTKMCPKUEJG $G\WI KO 0COGP FGU 1TFGPU IGUVTKEJGP OKV -ÌPKINKEJGO   &GMTGV XQO  /·T\  GKP UKNDGTPGU -TGW\ WPF OKV -ÌPKINKEJGO &GMTGV XQO  #TKN  GKPG /GFCKNNG KP   5KNDGT WPF $TQP\G GKPIGHÒJTV -ÌPKI #NHQPU :+++   GTYGKVGTVG OKV -ÌPKINKEJGO &GMTGV  XQO    ,WPK  WO -QNNCPG UQYKG 5EJNGKHG WPF $CPF HÒT &COGP &KG <YGKVG 4GRWDNKM ÒDGTPCJO FGP 1TFGP OKV   &GMTGV XQO  1MVQDGT  XGTÌHHGPVNKEJV KP FGT )CEGVC FG /CFTKF XQO  1VQDGT  GPVHGTPVG FKG OQPCTEJK   UEJGP5[ODQNGCWUFGP+PUKIPKGPFKGVGKNYGKUGFWTEJGKP5GIGMNUEJKHHGTUGV\VYWTFGPWPFHÒTVG\WT-QNNCPGIGUQP FGTVG 5EJWNVGTDCPF+PUKIPKGP GKP  /QFGNN  9GKVGTG 8GT·PFGTWPIGP GTHQNIVGP OKV &GMTGV XQO  &G\GODGT

XGTÌHHGPVNKEJV KP FGT )CEGVC FG /CFTKF XQO  &G\GODGT  )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG     ÒDGTPCJOFGPPWPOGJTCEJVMNCUUKIGP KPMNWUKXGFGT/GFCKNNGP 1TFGPOKV&GMTGVXQO,WPK XGTÌHHGPVNKEJV KP$1'0TXQO5GRVGODGT WPFGTNKG­OKV&GMTGVXQO5GRVGODGT XGTÌHHGPVNKEJVKP$1'0T XQO1MVQDGT GKPPGWGU4GIQNCOGPVQ /QFGNN 9GKVGTG8GT·PFGTWPIGPYWTFGPOKV&GMTGVXQO ,WPK  XGTÌHHGPVNKEJV KP $1' 0T  XQO  ,WPK  FWTEJIGHÒJTV 0CEJ FGT 6JTQPDGUVGKIWPI XQP -ÌPKI ,WCP   %CTNQU + YWTFG FKG UQIGP KORGTKCNG -TQPG FGT MCVJQNKUEJGP -ÌPKIG CWH FGP $TWUVUVGTPGP FWTEJ GKPG -ÌPKIUMTQPG   GTUGV\V /QFGNN &KGNGV\VG8GT·PFGTWPIGTHQNIVGOKV-ÌPKINKEJGO&GMTGV0TXQO0QXGODGT

XGTÌHHGPVNKEJVKP$1'0TXQO0QXGODGT 

215


SPANIEN

9049

9048



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  $TWUVUVGTP\WO-QOOCPFGWTXQP0WOOGT5KNDGTXGTIQNFGV#WHNCIGP)QNFGOCKNNKGTVHGKPUVG'OCKNNG OCNGTGKCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC(C[QNNG$TKSWGVKP2CTKUCP0CFGNOKV\YGK 5GKVGPJCMGP2')7XCT<'+ 4+p++



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  $TWUVUVGTP\WO-QOOCPFGWTXQP0WOOGT5KNDGTXGTIQNFGV#WHNCIGP)QNFGOCKNNKGTVHGKPUVG'OCKNNG OCNGTGK ITÌ­GTGT QDGTHN·EJNKEJGT 'OCKNNGEJKR CWH FGO QDGTGP -TGW\CTO CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPI FGT (KTOC .GOCKVTG KP 2CTKU CP 0CFGN OKV \YGK 5GKVGPJCMGP 2')7  XCT   <'+ ++p+++



&KG 5VGTPG FGT -QOOCPFGWTG XQP 0WOOGT YWTFGP CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG *CNU QFGT $TWUVMTGW\ XGT   NKGJGPWPFIGVTCIGP



&KG 5VGTPG FGT -QOOCPFGWTG XQP 0WOOGT YWTFGP CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG *CNU QFGT $TWUVMTGW\ XGT   NKGJGPWPFIGVTCIGP

9050 (1:1)



216

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  -QOOCPFGWTMTGW\HTÒJG#WUHÒJTWPIOKVQXCNGO.QTDGGTMTCP\)QNFOCUUKXGOCKNNKGTVIHGKPUVG 'OCKNNGOCNGTGKCO*CNUDCPFCDUEJPKVV2')7XCT<'+ 4+p++ 


SPANIEN

9054









9053

9052

9051

9054

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  -QOOCPFGWTMTGW\ )QNF JQJN IGCTDGKVGV GOCKNNKGTV  I CO *CNUDCPFCDUEJPKVV 2')7  <'+    ++



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  -QOOCPFGWTMTGW\)QNFJQJNIGCTDGKVGVGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK.QTDGGTMTCP\OKP XGTDQIGPWPFOKVGKPKIGPOKP'OCKNNGEJKRUCO*CNUDCPFCDUEJPKVV2')7<'+ ++p



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  -QOOCPFGWTMTGW\)QNFJQJNIGCTDGKVGVGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK.QTDGGTMTCP\OKP XGTDQIGPCOQTKIKPCNGP*CNUDCPF2')7<'+ ++p



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  4KVVGTMTGW\ HTÒJG #WUICDG OKV QXCNGO .QTDGGTMTCP\ )QNF OCUUKX GOCKNNKGTV  I &WTEJOGUUGT   OOQJPG$CPF2')7<'+ 44++



(TÒJG#WUHÒJTWPICWUFGT/KVVGFGU0GWP\GJPVGP,CJTJWPFGTVU

217


SPANIEN

9055





9056

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  4KVVGTMTGW\ )QNF JQJN IGCTDGKVGV GOCKNNKGTVI OKV$CPF COQTKIKPCNGPCNVGP$CPF2')7 <'+ ++



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  4KVVGTMTGW\)QNFJQJNIGCTDGKVGVGOCKNNKGTVOKV$CPFWPF6TCIGTCJGHGKPUVG'OCKNNGOCNGTGKOKP 'OCKNNGCWUDTÒEJGKPFGPXQTFGTWPFTÒEMUGKVKIGP/GFCKNNQPTKPIGPCOCNVGPQTKIKPCNGP$CPFOKVHTCP\Ì UKUEJGT6TCIGURCPIG2')7<'+ ++p



9057



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN     $TWUVUVGTP  -NCUUG HÒT 1HHK\KGTG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV MCWO   UKEJVDCTG#DURNKVVGTWPIKO5EJYGTVGTMTGW\CP0CFGN2')7<'+ 4++  W­GTUVSWCNKV·VUXQNNG#PHGTVKIWPIWOCWUFGT5VKHVWPIU\GKVFKGUGU5VGTPGU

9058



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN     $TWUVUVGTPFGTWPF-NCUUG5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGP)QNFGOCKNNKGTVCP0CFGN OKV\YGK5GKVGPJCMGP2')7<'+ 44+p++  W­GTUV SWCNKV·VUXQNNG #PHGTVKIWPI WO  FKG GEJV IQNFGPGP #WHNCIGP HGKP XGTPKGVGV 'ZGORNCT CWU WPUGTGT    #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG 5COONWPI CWU CNVGO #FGNUDGUKV\ 0T   5GJT   UGNVGPG-NCUUGFKGIGO·­FGP5VCVWGPPWT)GPGTCN1DGTDGHGJNUJCDGTPWPF)GPGT·NGPXQTDGJCNVGPYCT

218


SPANIEN

9061 (1:1) 9060



9059 (1:1)

0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN     $TWUVUVGTP FGT  WPF  -NCUUG 5KNDGT DTKNNCPVKGTVWPFTGRGTEKGTV/GFCKNNQP FKGUGUWOuXGTFTGJV  WPF.QTDGGT\YGKIG)QNFGOCKNNKGTVOGJTGTGOKP'OCKNNGEJKRUCP0CFGN2')7<'+ ++ 

#PHGTVKIWPICWUFGT'PF\GKVFGT4GIKGTWPI-ÌPKIKP+UCDGNNCU++'Z#WMVKQPFGT%CUCF #UVG5CP)KQTIKQKP)GPWC XQO  1MVQDGT  0T  'ZGORNCT FGT 5COONWPI &T #PVQPKQ 5RCFC KP $TGUEKC XGTÌHHGPVNKEJV KP 5RCFC   #PVQPKQ 1PQTK G )NQTKC  5QXTCPQ /KNKVCTG 1TFKPG FK /CNVC 5RCIPC )TCP $TGVCIPC 2QTVQICNNQ $TCUKNG $TGUEKC   50T



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN    

5EJYGTVGT -TGW\FGFKCTKQ-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVI&WTEJOGUUGTOOCP 0CFGN2')7<'+ 44+p++ 5GJT HGKPG OGJTVGKNKIG #PHGTVKIWPI WO  'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF   'JTGP\GKEJGP'KPG5COONWPICWUCNVGO#FGNUDGUKV\0T





0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN    

5EJYGTVGT -TGW\FGFKCTKQ-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVI\CJNTGKEJGMNGKPG'OCKNNGCD URNKVVGTWPIGP&WTEJOGUUGTOOCP0CFGN0CFGNJCMGPXGTDQIGP2')7<'+ 44+++  #PHGTVKIWPIWO

9064

9062 9063 (1:1)



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\FGTWPF-NCUUGOKV.QTDGGTHÒT1HHK\KGTG)QNFGOCKNNKGTVIOKP#DRNCV\WPIGP KPFGP/GFCKNNQPTKPIGPOKVMCPPGNKGTVGO$CPFTKPIQJPG$CPF2')7<'+ ++



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  4G FWMVKQP FGU )QNFGPGP -TGW\GU  WPF  -NCUUG HÒT 1HHK\KGTG )QNF GOCKNNKGTV  I CO $·PFEJGP   6#// ++



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU -TGW\  WPF  -NCUUG HÒT 1HHK\KGTG )QNF GOCKNNKGTV  I OKP 'OCKNNGCWUDTWEJ KO   XQTFGTUGKVKIGP/GFCKNNQPTKPICOQTKIKPCNGPCNVGP$CPF2')7<'+ ++



5GJTHGKPG#PHGTVKIWPIWO



#PHGTVKIWPIWO'ZGORNCTCWUFGT#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5#)KP $CUGNCOWPF0QXGODGT0T



#PHGTVKIWPIWO

219


SPANIEN

9065 (1:1)

9065 (1:1) 9066 (1:1)



-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

WPF -NGKPQF\WO)TQ­MTGW\)QNFGOCKNNKGTVI\YGKMCWOUKEJVDCTGOKP 'OCKNNGTGRCTCVWTGP KO XQTFGTUGKVKIGP /GFCKNNQPTKPI OKV MCPPGNKGTVGO $CPFTKPI OKV QTKIKPCNGO CNVGP   5EJWNVGTDCPFOKVNQUGT5EJNGKHG2')7<'+ 4++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPIWOFKG/KVVGFGU0GWP\GJPVGP,CJTJWPFGTVU



-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

WPF $TWUVUVGTP\WO)TQ­MTGW\)QNFVGKNYGKUGGOCKNNKGTV5KNDGTDTKNNCPVKGTVWPF TGRGTEKGTV  I CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ) ;CTCDWTQ KP /CFTKF CP   0CFGNOKV\YGK5GKVGPJCMGP2')76#//<'+ 4++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPIWOOKV-TGW\MQTRWUKPOCUUKX)QNF'ZGORNCTCWUFGT#WMVKQP1TFGPCWU CNNGT9GNV5COONWPI6COOCPPFGT7$5#)KP$CUGNCOWPF0QXGODGT0TFQTVLGFQEJCNU UR·VGTGU5VÒEMDGUEJTKGDGP&KG)TQ­MTGW\UVGTPGWPVGTUEJGKFGPUKEJXQPFGP5VGTPGPFGT\YGKVGP-NCUUGFCFWTEJ FCUUDGKGTUVGTGPÒDGTFGO/GFCKNNQPGKPG-TQPGCPIGDTCEJVKUV

9067 (1:1)



9068 (1:1)

-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

WPF 4KVVGTMTGW\ KPTGFW\KGTVGT#WUHÒJTWPI )QNFGOCKNNKGTVI OKV$CPF WPF 5RCPIG  OKV MCPPGNKGTVGO $CPFTKPI OKV PGWGO $CPF LGFQEJ OKV CNVGT 6TCIGURCPIG CWU )QNF   2')7<'+ 4++



#PHGTVKIWPI WO EC  9KG CWH \GKVIGPÌUUKUEJGP )GO·NFGP FGU ¤HVGTGP HGUV\WUVGNNGP KUV YWTFGP Y·JTGPF FGT   4GIKGTWPIU\GKV-ÌPKIKP+UCDGNNCU++FKG1TFGPUKPUKIPKGPKPTGFW\KGTVGT)TÌ­GXGTNKGJGP'UJCPFGNVUKEJJKGTDGKCNUQ WO5VÒEMGKP1TKIKPCNITÌ­GWPFPKEJVWO4GFWMVKQPGPCNUQ<YGKVUVÒEMG



-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

WPF 4KVVGTMTGW\ KPTGFW\KGTVGT#WUHÒJTWPI )QNFGOCKNNKGTVICOCNVGP 1TKIKPCNDCPF2')7<'+ 4++ #PHGTVKIWPIWOEC

220




SPANIEN

9069 (1:1)



-ÌPKINKEJGT 1TFGP FGT 'FNGP &COGP FGT -ÌPKIKP /CTKC .WKUC 1TFGPUMTGW\ #WUHÒJTWPI OKV   UVCTTGO.QTDGGTMTCP\WPFKPFCU-TGW\GKPIGCTDGKVGVGT-GVVG)QNFHGKPUV\KUGNKGTVWPFGOCKNNKGTVI

OKV 5EJNGKHG WPF 5EJWNVGTDCPF  HGKPUVG 'OCKNNGOCNGTGK CO QTKIKPCNGP CNVGP WPF \GKVIGPÌUUKUEJGP   5EJWNVGTDCPF2')7p<'+ 44+  5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGT/KVVGFGU0GWP\GJPVGP,CJTJWPFGTVU  &GT CWUUEJNKG­NKEJ &COGP XQTDGJCNVGPG \WP·EJUV GKPMNCUUKIG 1TFGP CO 5EJWNVGTDCPF $CPFC IGPCPPV  YWTFG XQP   -ÌPKI -CTN +8   XQP 5RCPKGP CWH +PKVKCVKXG UGKPGT )GOCJNKP /CTKC .WKUC   OKV -ÌPKINKEJGO   &GMTGV XQO  #RTKN  IGUVKHVGV FKG 5VCVWVGP CO  /·T\  XGTCDUEJKGFGV /KV -ÌPKINKEJGO &GMTGV XQO    0QXGODGT  UVKHVGVG #NHQPU :++   FKG CN -TGW\ =%TW\? DG\GKEJPGVG WPVGTG -NCUUG FKG CP GKPGT   5EJNGKHGCPFGT$TWUVIGVTCIGPYWTFG&GT1TFGPFGTDKUJGWVGGZKUVKGTVYCTUVGVUCPFKG2GTUQPFGU DQWTDQPKUEJGP  -ÌPKIU D\Y FGU 6JTQPRT·VGPFGPVGP IGDWPFGP WPF YWTFG YGFGT XQP FGT 2TQXKUQTKUEJGP 4GIKGTWPI PQEJ KP FGP   DGKFGP4GRWDNKMGPPQEJXQP-ÌPKI#OCFGQQFGT5VCCVUEJGH(TCPEQXGTNKGJGP

9070 (1:1)



-ÌPKINKEJGT 1TFGP FGT 'FNGP &COGP FGT -ÌPKIKP /CTKC .WKUC 1TFGPUMTGW\ #WUHÒJTWPI OKV   UVCTTGO.QTDGGTMTCP\WPFKPFCU-TGW\GKPIGCTDGKVGVGT-GVVG)QNFHGKPUV\KUGNKGTVWPFGOCKNNKGTVI

OKV 5EJNGKHG  HGKPUVG 'OCKNNGOCNGTGK GKPKIG MNGKPG 'OCKNNGEJKRU CWH 8QTFGT WPF 4ÒEMUGKVG CP   QTKIKPCNGTCNVGT\GKVIGPÌUUKUEJGT&COGPUEJNGKHGOKVQTKIKPCNGPCNVGPWPF\GKVIGPÌUUKUEJGP5EJWNVGTDCPF 2')7p<'+ 44++p+++  'ZGORNCT CWU FGO $GUKV\ FGT -ÌPKIKP /CTKG XQP *CPPQXGT   FKG GU XQT  XQP -ÌPKIKP +UCDGNNC ++   XGTNKGJGPDGMQOOGPJCV

221


SPANIEN

9071 (1:1)



/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV /QPQITCOO -ÌPKIKP +UCDGNNCU ++ CWH FGT 4ÒEMUGKVG       YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF )QNF   GOCKNNKGTV OKV QTKIKPCNGO \GKVIGPÌUUKUEJGP CNVGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV WPF   FWTEJDTQEJGP IGCTDGKVGV VGKNYGKUG XGTIQNFGV #WHNCIGP VGKNYGKUG )QNF GOCKNNKGTV CP 0CFGN OKV \YGK   5GKVGPJCMGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%GLCNXQKP/CFTKF2')7<'+  44++  5GJTUGNVGPGT5GVKPGKPGT#PHGTVKIWPICWUFGT'PF\GKVFGT4GIKGTWPIXQP-ÌPKIKP+UCDGNNC++&GT$TWUVUVGTP\WO )TQ­MTGW\WPFFGT5VGTPFGT-NCUUGWPVGTUEJGKFGPUKEJPWTFWTEJFKG(CTDGFGU/GVCNNRN·VVEJGPUCWHFGOQDGTGP -TGW\CTOFCUDGKOGTUVGTGPUKNDGTHCTDGP  WPFDGKONGV\VGTGPIQNFHCTDGP  KUV  &KGUGT CWHITWPF UGKPGT JKUVQTKUEJGP 'PVYKEMNWPI YQJN XCTKCPVGPTGKEJUVG URCPKUEJG 1TFGP YWTFG XQP -ÌPKIKP   +UCDGNNC ++   OKV -ÌPKINKEJGO &GMTGV XQO  #WIWUV  KP XKGT -NCUUGP )TQ­MTGW\    -NCUUG    IGUVKHVGVFKG4GINCOGPVQUFCVKGTGPXQO5GRVGODGT /QFGNN /KV-ÌPKINKEJGO&GMTGVXQO/CK GTJKGNVFGT1TFGPGKPPGWGU$CPFUQYKGCNUWPVGTUVG-NCUUGFCU5KNDGTPG-TGW\+O5GRVGODGTPCEJFGT(NWEJV -ÌPKIKP+UCDGNNCU++YWTFGXQPFGTRTQXKUKQTKUEJGP4GIKGTWPIGKPG8GTQTFPWPIGTNCUUGPIGO·­FGT1TFGPMÒPHVKI MGKPG .KNKGP FCU 5[ODQN FGT $QWTDQPGP OGJT VTCIGP FWTHVGP #WEJ U·OVNKEJG /QPQITCOOG +UCDGNNCU YCTGP CD   UQHQTVGTUCV\NQU\WGPVHGTPGP /QFGNN 'TUVCO&G\GODGTFGUINGKEJGP,CJTGUYWTFGFCPPGKPG8GTQTFWPI GTNCUUGPGP IGO·­ FGT FGT /KNKV·T8GTFKGPUVQTFGP MÒPHVKI FCU /QPQITCOO ō//ŋ HÒT /GTKVQ /KNKVCT  CWH FGT   4ÒEMUGKVG \W \GKIGP JCVVG  /QFGNN  0CEJ FGT 6JTQPDGUVGKIWPI -ÌPKI #OCFGQU +   YWTFG CWHITWPF   FGT-ÌPKINKEJGP8GTQTFPWPIGPXQO/CKWPFXQO1MVQDGTFCU5CXQ[GT9CRRGP YGK­GU-TGW\KPTQV  KP FCU 9CRRGP GKPIGHÒIV  /QFGNN  /KV 8GTQTFPWPI XQO  1MVQDGT  FGT 'TUVGP 4GRWDNKM YWTFGP CNNG   OQPCTEJKUEJGP5[ODQNGCWUFGP&GMQTCVKQPGPGPVHGTPV /QFGNN 0CEJUGKPGT6JTQPDGUVGKIWPICO&G\GODGT PCJO-ÌPKI#NHQPU:++  FKG8GTNGKJWPIGPFGU1TFGPUKPUGKPGTWTURTÒPINKEJGP(QTOYKGFGTCWH LGFQEJ OKV FGO /QPQITCOO // CWH FGO 4GXGTUOGFCKNNQP FGT -TGW\G  /QFGNN  9GKVGTG 8GT·PFGTWPIGP   GTHQNIVGPOKV-ÌPKINKEJGP8GTQTFPWPIGPXQO/CKWPFXQO,WNKUQYKGOKV)GUGV\XQO,WPK  -ÌPKI #NHQPU :+++   TGQTICPKUGTVG FGP 1TFGP OKV FGP -ÌPKINKEJGP &GMTGVGP XQO  /·T\    WPF XQO  #RTKN  YQFWTEJ FKG $KEQNQT#DVGKNWPI GKPIGHÒJTV YWTFG  /QFGNN  9·JTGPF FGT <YGKVGP   4GRWDNKMYWTFGPFKG+PUKIPKGPFGU1TFGPUOGJTHCEJXGT·PFGTV\WP·EJUVYWTFGFCU/KVVGNUEJKNF OKVFGP.KNKGP FGU 9CRRGPUÒDGTFGEMVWPFFKG.KNKGPGPVHGTPV /QFGNN FCPPYWTFGFGT/KVVGNUEJKNFICP\GPVHGTPVG /QFGNN WPF UEJNKG­NKEJ GKP ICP\ PGWGU 9CRRGP GKPIGHÒIV  /QFGNN  )GPGTCN (TCPEKUEQ (TCPEQ [ $CJCOQPFG     ÒDGTPCJO  FGP 1TFGP WPF RNCV\KGTVG ÒDGT FGO -TGW\ FKG UQIGP KORGTKCNG -TQPG FGT MCVJQNKUEJGP -ÌPKIG   UQYKG .ÌYGP WPF 6ÒTOG CP FGT 5VGNNGT FGT 5VGTPG YQ UKEJ HTÒJG FKG .KNKGP DGHCPFGP  /QFGNN  /KV &GMTGV    XQO  /·T\  XGTÌHHGPVNKEJV KP $1' 0T  XQO  /CK  GTJKGNVGP FKG +PUKIPKGP YKGFGT GKPG   -ÌPKIUMTQPGWPFFGT1TFGPGKPPGWGU4GINCOGPVQ /QFGNN 5GKVJGTDGUVGJVGTCWU)TQ­MTGW\-TGW\-NCUUG

$TWUVUVGTP -TGW\DKU-NCUUG -TGW\GCO$CPF 

222


SPANIEN

9073

9072



/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV /QPQITCOO -ÌPKIKP +UCDGNNCU ++ CWH FGT 4ÒEMUGKVG      YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP-TGW\-NCUUG)QNFGOCKNNKGTVI OKV $CPF COCNVGP\GKVIGPÌUUKUEJGP1TKIKPCNDCPF2')7<'+ 44+p++



'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPG5COONWPICWUCNVGO#FGNUDG UKV\0T



/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV /QPQITCOO -ÌPKIKP +UCDGNNCU ++ CWH FGT 4ÒEMUGKVG       YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP -TGW\  -NCUUG KP GVYCU TGFW\KGTVGT   #WUHÒJTWPI )QNF GOCKNNKGTV  I OKV $CPF WPF 6TCIGURCPIG  CO  CNVGP \GKVIGPÌUUKUEJGP   1TKIKPCNDCPFOKV6TCIGURCPIG2')7<'+ 44+p++

9075



9075 9074



/CTKPG8GTFKGPUVQTFGP  /QFGNN   YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP   5VGTP FGT  -NCUUG 5KNDGT DTKNNCPVKGTV WPF FWTEJDTQEJGP IGCTDGKVGV #WHNCIGP )QNF GOCKNNKGTV MNGKPGT   'OCKNNGUEJCFGPKO#PMGTCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ 4++



#PHGTVKIWPI XQP JGTXQTTCIGPFGT 3WCNKV·V &KG <WIGJÌTKIMGKV \WO GTUVGP /QFGNN KUV CP FGT DGUQPFGTGP (QTO FGT   -TQPG 6[RWUFGT4GIKGTWPI+UCDGNNCU++ \WGTMGPPGP  )GUVKHVGV XQP -ÌPKIKP +UCDGNNC ++   OKV -ÌPKINKEJGO &GMTGV XQO  #WIWUV  KP XKGT -NCUUGP  

)TQ­MTGW\-NCUUG IGUVKHVGV /QFGNN 'TYGKVGTWPIGPGTHQNIVGPFWTEJ&GMTGVFGU/CTKPGOKPKUVGTKWOUFGT 2TQXKUQTKUEJGP4GIKGTWPIXQO/·T\ /QFGNN /KV8GTQTFPWPI'TUVGP4GRWDNKMYWTFGPCNNGOQPCTEJK UEJGP 5[ODQNG CWU FGP &GMQTCVKQPGP GPVHGTPV  /QFGNN  0CEJ UGKPGT 6JTQPDGUVGKIWPI CO  &G\GODGT    PCJO -ÌPKI #NHQPU :++   FKG 8GTNGKJWPIGP FGU 1TFGPU KP FGT (QTO XQP  YKGFGT CWH  /QFGNN    9GKVGTG8GT·PFGTWPIGPGTHQNIVGPOKV-ÌPKINKEJGT8GTQTFPWPIGPXQO#RTKN XGTÌHHGPVNKEJVKPFGT)CEGVCFG /CFTKF XQO  #RTKN  -ÌPKI #NHQPU :+++   TGQTICPKUGTVG FGP 1TFGP OKV -ÌPKINKEJGO &GMTGV XQO    /·T\YQFWTEJFKG$KEQNQT#DVGKNWPIGKPIGHÒJTVYWTFG /QFGNN 9·JTGPFFGT<YGKVGP4GRWDNKMYWTFGP YKGFGT CNNG OQPCTEJKUEJGP 5[ODQNG GPVHGTPV WPF FCU $CPF IG·PFGTV  /QFGNN  )GPGTCN (TCPEKUEQ (TCPEQ [ $C   JCOQPFG   ÒDGTPCJO OKV 8GTQTFPWPI XQO  #WIWUV  XGTÌHHGPVNKEJV KP $1' XQO  #WIWUV  FGP   1TFGPWPFRNCV\KGTVGÒDGTFGO-TGW\FKGUQIGPKORGTKCNG-TQPGFGTMCVJQNKUEJGP-ÌPKIG /QFGNN /KV&GMTGV  XQO  /·T\  XGTÌHHGPVNKEJV KP $1' 0T  XQO  /CK  GTJKGNVGP FKG +PUKIPKGP YKGFGT GKPG   -ÌPKIUMTQPG WPF FGT 1TFGP GKP PGWGU 4GINCOGPVQ  /QFGNN  5GKVJGT DGUVGJV GT CWU )TQ­MTGW\ -TGW\ -NCUUG

$TWUVUVGTP -TGW\DKU-NCUUG -TGW\GCO$CPF 



1TFGP XQP /CTKC +UCDGNNC .WKUC )QNFGPGU -TGW\  /QFGNN   )QNF HGKPUV ITCXKGTV   GOCKNNKGTVI OKV$CPF COCNVGP\GKVIGPÌUUKUEJGPLGFQEJPKEJVMQTTGMVGP$CPF 44+

 223


SPANIEN

9077 (1:1) 9076 (1:1)



9076 (1:1)

&GMQTCVKQPFGT*QHFCOGPFGT-ÌPKIKPZOO)QNFGOCKNNKGTVIQJPG$CPF2')7p ++



'ZVTGO UGNVGPG *QHFCOGPFGMQTCVKQP 'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GK   EJGP'KPG5COONWPICWUCNVGO#FGNUDGUKV\0TFQTVDGUEJTKGDGPCNUWPDGMCPPVGU$TWFGTUEJCHVUMTGW\GKPGT $TWFGTUEJCHVFGU/·TV[TGTU&COCUWU



/KNKV·TKUEJGT1TFGPXQOJGKNKIGP,CMQDWU1TFGPUOGFCKNNQP)QNFGOCKNNKGTVI OKV5EJNGKHG CP UR·VGTGT5EJNGKHGOKV0CFGN 4+



#PHGTVKIWPICWUFGO\YGKVGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

9078 (1:1)

9078 (1:1) 9079 (1:1)



/KNKV·TKUEJGT 1TFGP XQO JGKNKIGP ,CMQDWU $TWUVMTGW\  Z  OO )QNF GOCKNNKGTV  I   MNGKPGT'OCKNNGCWUDTWEJKO<GPVTWOCP0CFGNOKV\YGK5GKVGPJCMGP 4++p  #WHYGPFKIGOGJTVGKNKIG#PHGTVKIWPICWUFGO\YGKVGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



-ÌPKINKEJG/GKUVGTGKFGT4KVVGTUEJCHVXQP4QPFC$TWUVUVGTP)QNF OCUUKX GOCKNNKGTVIHGKPUVG 'OCKNNGOCNGTGKOKP'OCKNNGCWUDTWEJWPFQDGTHN·EJNKEJGT'OCKNNGEJKRCWHLGGKPGO-TGW\CTOCWHFGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC (GTPCPFG\ ¾ *KLQ KP /CFTKF CP 0CFGN OKV \YGK   5GKVGPJCMGP2')7 44++  +PGEJV)QNFXQPCNNGTITÌ­VGT5GNVGPJGKV

224


SPANIEN

9081 (1:1)

9080 (1:1)

9080 (1:1)

9082



-ÌPKINKEJG /GKUVGTGK FGT 4KVVGTUEJCHV XQP 5GXKNNC $TWUVCD\GKEJGP ·NVGTGU /QFGNN  )QNF GOCKNNKGTV   HGKPUVG 'OCKNNGOCNGTGK 'OCKNNGTGRCTCVWTGP WPF DGUEJ·FKIWPIGP CWH FGT 4ÒEMUGKVG *GTUVGNNGT   DG\GKEJPWPIFGT(KTOC%JQDKNNQPKP2CTKUCP0CFGNKOQTKIKPCNGP'VWKOKV#WUURCTWPIHÒTGKPYGKVGTGU #D\GKEJGP2')7p 444++p+++  'ZVTGOUGNVGPKPFKGUGTHTÒJGPWPFKPFGTDKUJGTKIGP.KVGTCVWTPKEJVPCEJIGYKGUGPGP#WUHÒJTWPI



$TWUVUVGTPFGTQDGTUVGP/KNKV·TTKEJVGTFGU-ÌPKITGKEJGU)QNFOCUUKXFWTEJDTQEJGPIGCTDGKVGVVNY GOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK\YGKMNGKPG4GRCTCVWTGPKPFGTDNCWGP'OCKNNGCWHFGT4ÒEM UGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC ) ;CTCDWTQ KP /CFTKF CP UKNDGTPGT 0CFGN OKV \YGK   5GKVGPJCMGP 44++ 



#D\GKEJGP HÒT 1DGTUVG 4KEJVGT FGU -ÌPKITGKEJGU )QNF OCUUKX GOCKNNKGTV  I HGKPUVG   'OCKNNGOCNGTGKCPIQNFHCTDGPGT-QTFGNOKV%QWNCPV)QNFGOCKNNKGTV 44+  #D\GKEJGPXQPCNNGTITÌ­VGT5GNVGPJGKV

225


SPANIEN

9084 (1:1)



9084 (1:1)

9083 (1:1)

7PDGMCPPVGU'JTGP\GKEJGPHÒT8GTFKGPUVGWOFKG,WUVK\ZOO)QNFOCUUKXI OKV $CPF CWHFGT4ÒEMUGKVG)TCXWT,WUICFQFGC+PUVCFGNC%CRKVFG2WPQ/C[QFGCOCNVGP \GKVIGPÌUUKUEJGP$CPF 44++



'KPFTWEMUXQNNGUWPFUEJYGTGU'JTGP\GKEJGP



#WU\GKEJPWPIUMTGW\ HÒT FKG $GHTGKGT DGK FGT FTKVVGP $GNCIGTWPI XQP $KNDCQ   Z  OO   )QNF GOCKNNKGTV  I OKV $CPF  )TCPCVG FGU TGEJVGP -TGW\CTOU TGRCTKGTV 'OCKNNGEJKRU OKV   MCPPGNKGTVGO$CPFTKPICOQTKIKPCNGP\GKVIGPÌUUKUEJGP$CPF2')7 44++p+++  &CU-TGW\KUVCO,CPWCTOKV-ÌPKINKEJGT8QTQTFPWPIXQP+UCDGNNC++IGUVKHVGVYQTFGP

9085 (1:1)

9086 (1:1)



9086 (1:1)

#WU\GKEJPWPIUMTGW\HÒTFGP(GNF\WIKP,QNÉ CWHFGP2JKNKRRKPGP ZOO)QNFGOCKNNKGTV IGKPKIGMCWOUKEJVDCTG*CCTTKUUGKPFGTYGK­GP'OCKNNGQJPG$CPF2')7 +



&CU-TGW\KUVCO#WIWUVOKV-ÌPKINKEJGT8GTQTFPWPIXQP+UCDGNNC++IGUVKHVGVYQTFGP



-TGW\ HÒT 9KUUGPUEJCHVNKEJGP 9GVVGKHGT  Z  OO )QNF GOCKNNKGTV  I OKV $CPF WPF   5RCPIG COQTKIKPCNGP\GKVIGPÌUUKUEJGP$CPFOKV6TCIGURCPIG2')7 44+  &CU-TGW\KUVCO#RTKNOKV-ÌPKINKEJGT8GTQTFPWPIXQP+UCDGNNC++IGUVKHVGVYQTFGP

226


SPANIEN

9088 (1:1)



9088 (1:1)

9087 (1:1)

#WU\GKEJPWPIUOGFCKNNG HÒT FKG 4GKUG +JTGT /CLGUV·VGP KP FKG .GXCPVG )QNFGPG /GFCKNNG OKV   &KCOCPVGPZOO)QNFVGKNYGKUGGOCKNNKGTV/QPQITCOOCWHFGT8QTFGTUGKVGDGUGV\VOKV &KCOCPVTQUGP CWH'EJVJGKVIGRTÒHV COCNVGPLGFQEJPKEJVMQTTGMVGP$CPF2')7E 444+  &KG HÒPHUVWHKIG )QNF OKV &KCOCPVGP )QNF 5KNDGT $TQP\G WPF 0KEMGN  /GFCKNNG KUV CO  5GRVGODGT  OKV   -ÌPKINKEJGT 8GTQTFPWPI XQP +UCDGNNC ++ IGUVKHVGV WPF HÒT 8GTFKGPUVG WO FKG 4GKUG YQTFGP .CWV 2GTG\ )WGTTC KP   2')75UKPFXQPFKGUGT/GFCKNNGPWT'ZGORNCTGXGTNKGJGPYQTFGP

8+'46'5 -¤0+)4'+%*4')+'470)#/#&'15+   

<KXKNGT1TFGPXQP/CTKC8KEVQTKC-TGW\-NCUUGHÒT8GTFKGPUVGKPFGT2JKNQUQRJKG-WPUVWPF.KVG TCVWT5KNDGTXGTIQNFGV/GFCKNNQPU)QNFGOCKNNKGTVCOQTKIKPCNGP\GKVIGPÌUUKUEJGPJGNNDNCWGP$CPF HÒT 8GTFKGPUVGKPFGT2JKNQUQRJKG-WPUVWPF.KVGTCVWT 2')7<'+ 4++



'Z#WMVKQPFGT%CUCF #UVG5CP)KQTIKQKP)GPWCXQO1MVQDGT0T  &GT FTGKMNCUUKIG )TQ­MTGW\ -TGW\  WPF  -NCUUG  1TFGP YWTFG XQP #OGFGQ + *GT\QI XQP 5CXQ[GP#QUVC  

 -ÌPKIXQP5RCPKGPHÒT8GTFKGPUVGWO-WPUVWPF9KUUGPUEJCHVKP\YÌNHXGTUEJKGFGPGP&KU\KRNK PGP OKV LGYGKNU WPVGTUEJKGFNKEJGP $·PFGTP  XGTNKGJGP &KG 4GIKGTWPI FGT 'TUVGP 5RCPKUEJGP 4GRWDNKM JQD FGP   1TFGPYKGFGTCWH#WHITWPFFGT·W­GTUVMWT\GP8GTNGKJWPIU\GKVXQPYGPKIGTCNUFTGK,CJTGPUKPFCNNG+PUKIPKGP FKGUGU1TFGPUXQPITQ­GT5GNVGPJGKV

9089 (1:1)

9090

9091

%#4.+56'0 

-TGW\HÒTFKG0QTF#TOGG/KPKCVWTFGU-TGW\GUZOO)QNFGOCKNNKGTVOKP'OCKN NGEJKRKO<GPVTWOHGKPUVG+PUEJTKHVOCNGTGKCOUR·VGTGP$·PFEJGP 4++



'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTFCOGTKMCPKUEJG 2TKXCV   UCOONWPI0T

2418+514+5%*'52#0+5%*'4')+'470)   



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN    

5EJYGTVGT -TGW\FGFKCTKQ-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVI&WTEJOGUUGTOOCP 0CFGN2')7<'+ ++



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN EC     4KVVGTMTGW\ )QNF GOCKNNKGTV  I CO MCPPGNKGTVGP $CPFTKPI CO UR·VGTGP $CPF 2')7  XCT   <'+XCT 44+p++



&KG RTQXKUQTKUEJG 4GIKGTWPI WPVGT 4GIGPV (TCPEKUEQ 5GTTCPQ &QOÃPIWG\ XGTNKGJ FGP 1TFGP OKV GPVHGTPVGP DQWTDQ   PKUEJGP.KNKGPDKU\WO'PFGFGT4GIGPVUEJCHVYGKVGT

227


SPANIEN

9092 (1:1)



-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

WPF $TWUVUVGTP FGT-NCUUG )QNF5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV/GFCKN NQP)QNFGOCKNNKGTVICWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC$)WVKGTTG\KP*CDCPC

-WDC CP0CFGNOKV\YGK5GKVGPJCMGP2'*7<'+ 44++  5GJTSWCNKV·VUXQNNGMWDCPKUEJG#PHGTVKIWPIWOOKV-TGW\MQTRWUKPOCUUKX)QNF

9093



9094

/KNKV·T8GTFKGPUVQTFGP/QFGNN OKVNGGTGO4ÒEMUGKVGPOGFCKNNQP5GRVGODGTDKU&G\GODGT  YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP-TGW\-NCUUG)QNFGOCKNNKGTVIQJPG$CPF 2')7p<'+p 444++



+O 5GRVGODGT  PCEJ FGT (NWEJV -ÌPKIKP +UCDGNNCU ++ YWTFG XQP FGT RTQXKUQTKUEJGP 4GIKGTWPI GKPG 8GTQTF   PWPIGTNCUUGPIGO·­FGT1TFGPMÒPHVKIMGKPG.KNKGPFCU5[ODQNFGT$QWTDQPGPOGJTVTCIGPFWTHVGP#WEJU·OV NKEJG /QPQITCOOG +UCDGNNCU YCTGP CD UQHQTV  GTUCV\NQU  \W GPVHGTPGP 'TUV CO  &G\GODGT FGU INGKEJGP ,CJTGU   YWTFGFCPPGKPG8GTQTFPWPIGTNCUUGPGPIGO·­FGTFGT/KNKV·T8GTFKGPUVQTFGPMÒPHVKIFCU/QPQITCOOō//ŋ HÒT /GTKVQ/KNKVCT CWHFGT4ÒEMUGKVG\W\GKIGPJCVVG#WHITWPFFGTPWTECXKGTOQPCVKIGP8GTNGKJWPIU\GKVGZVTGOUGNVGP WPFDKUJGTPKEJVFQMWOGPVKGTV



/KNKV·T8GTFKGPUVQTFGP/QFGNN OKVNGGTGO4ÒEMUGKVGPOGFCKNNQP5GRVGODGTDKU&G\GODGT  YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP-TGW\-NCUUGKPGVYCUTGFW\KGTVGT#WUHÒJTWPI)QNF GOCKNNKGTV  I OKV $CPF  CO CNVGP \GKVIGPÌUUKUEJGP GVYCU \GTUEJNKUUGPGP 1TKIKPCNDCPF 2')7 p   <'+p 444++ 'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPG5COONWPICWUCNVGO#FGNUDG UKV\0T

228




SPANIEN

9095



/CTKPG8GTFKGPUVQTFGP  /QFGNN   YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP   -TGW\-NCUUG)QNFOCUUKXHGKPUV\KUGNKGTVWPFGOCKNNKGTVICOPGWGP$CPF2')7<'+  44+



#PHGTVKIWPICWUFGT<GKVFGT2TQXKUQTKUEJGP4GIKGTWPID\YFGT4GIKGTWPI-ÌPKI#OCFGQU+  

9096 (1:1)

(ª0(6'5 -¤0+)4'+%*   

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -QTFQPUGV\WT-QNNCPG UGKV DGUVGJGPFCWU-NGKPQF)QNFOCUUKXGOCKNNKGTVCOQTKIKPCNGPCNVGP 5EJWNVGTDCPF KP FGT #WUHÒJTWPI HÒT +PJCDGT FGT -QNNCPG OKV IGNÌUVGT 5EJNGKHG WPF $TWUVUVGTP 5KNDGT   DTKNNCPVKGTV WPF TGRGTEKGTV FKG 4ÒEMUGKVG HGKPUV ITCXKGTV WPF XGTIQNFGV /GFCKNNQP )QNF VNY GOCKNNKGTV   HGKPUVG 'OCKNNGOCNGTGK CP 0CFGN OKV \YGK 5GKVGPJCMGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC   %GLCNXQKP/CFTKFOKVCWHIGFTWEMVGOIQNFHCTDGPGO9CRRGP2')7p<'+p 444+  'ZVTGO UGNVGPGT 5GV XQP JGTXQTTCIGPFGT *GTUVGNNWPIUSWCNKV·V WO  KP CDUQNWVGT $GUVGTJCNVWPI CWU XQTOCNU   JQEJCFGNKIGO $GUKV\ 'T UVCOOV CWU FGT DTKVKUEJGP MÌPKINKEJGP (COKNKG WPF IGNCPIVG KO PCEJYGKUDCTGP  #WHVTCI   XQP2TKP\/KEJCGNXQP-GPV IGD CO,WPKDGK/QTVQP'FGPKP.QPFQPKPFGTGP#WMVKQPWPVGT FGT0T\WT8GTUVGKIGTWPIFQTVLGFQEJDGUEJTKGDGPCNUGKPHCEJGT)TQ­MTGW\UCV\$GOGTMGPUYGTVKUVFC­YGFGT 2TKP\ /KEJCGN PQEJ FGUUGP 8CVGT FGT *GT\QI XQP -GPV   YKG CWEJ FGUUGP MKPFGTNQUGT $TWFGT FGT   *GT\QIXQP9KPFUQT GJGOCNU-ÌPKI'FYCTF8+++ NCWV8KEMGTU 8KEMGTU*WIK4Q[CN1TFGTU6JG *QPQWTUCPFVJG*QPQWTGF.QPFQP +PJCDGTFGT-QNNCPGFGU1TFGPU-CTNU+++YCTGP&GTGVYCU·NVGTGCNUQ HTÒJGT XGTNKGJGPG 5GV CWU FGO $GUKV\ -ÌPKI )GQTIU 8   DGHKPFGV UKEJ KP FGT 4Q[CN %QNNGEVKQP -ÌPKIKP   'NKUCDGVJU ++ CWH 5EJNQ­ 9KPFUQT WPF KUV DGK 2CVVGTUQP 2CVVGTUQP 5VGRJGP 4Q[CN +PUKIPKC  $TKVKUJ CPF (QTGKIP   1TFGTU QH %JKXCNT[ HTQO VJG 4Q[CN %QNNGEVKQP .QPFQP   CDIGDKNFGV 9GKVGTG CNU WTURTÒPINKEJ $GNKGJGPG KP   (TCIG MQOOGPFG /KVINKGFGT FGT DTKVKUEJGP MÌPKINKEJGP (COKNKG JCDGP UKEJ DKUJGT CWHITWPF FGT UEJYKGTKI \W GTWKG   TGPFGP3WGNNGPNCIGPQEJPKEJVGTOKVVGNPNCUUGP  /KV-ÌPKINKEJGO&GMTGVXQO5GRVGODGTUVKHVGVG-ÌPKI#NHQPU:++  GTI·P\VFWTEJ&GMTGVXQO ,WNK XGTÌHHGPVNKEJKPFGT)CEGVCFG/CFTKFXQO1MVQDGT \WFGTDGTGKVUUGKVGZKUVKGTGPFGP-QNNCPG FGU1TFGPUDGUQPFGTG+PUKIPKGPFKG\WUCOOGPOKVFKGUGTXGTNKGJGPYWTFGP&GTYGUGPVNKEJG7PVGTUEJKGFDGUVCPFKP FGT(CTDGFGU5EJWNVGTDCPFGU JGNNDNCWOKV\YGKUEJOCNGPYGK­GP5GKVGPUVTGKHGPUVCVVFTGKINGKEJDTGKVGP5VTGKHGPKP JGNNDNCWYGK­JGNNDNCWYKGDGKOPQTOCNGP)TQ­MTGW\ WPFKPFGPIQNFHCTDGPGP.KNKGP\YKUEJGPFGP-TGW\CTOGP FGU$TWUVUVGTPU UVCVVFGPUKNDGTHCTDGPGPDGKO$TWUVUVGTPFGUPQTOCNGP)TQ­MTGW\GU 

229


SPANIEN

9097 (1:1)



9097 (1:1)

9097 (1:1)

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF )QNF GOCKNNKGTV FKG .KNKGP 5KNDGT XGTIQNFGV CO QTKIKPCNGP   5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTV/GFCKNNQP)QNFVGKNYGKUGGOCKNNKGTVCP0CFGNOKV\YGK 5GKVGPJCMGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC %GLCNXQ KP /CFTKF OKV CWHIGFTWEMVGO   IQNFHCTDGPGO9CRRGP 5VÒEM4+  'Z\GNNGPVGT 5GV CWU FGO GTUVGP 8KGTVGN FGU <YCP\KIUVGP ,CJTJWPFGTVU KP JGTXQTTCIGPFGT 'TJCNVWPI WPF KP )QNF   UGNVGPIGYQTFGP

9098 (1:1)



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -NGKPQF KP-QOOCPFGWTMTGW\ITÌ­G \WO)TQ­MTGW\)QNFHGKPUV\KUGNKGTVWPFGOCKNNKGTVIHGKPG 'OCKNNGOCNGTGKOKVQTKIKPCNGOCNVGP\GKVIGPÌUUKUEJGP5EJWNVGTDCPF2')7<'+ +p++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

230


SPANIEN

9099



9100

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGKCP0CFGNOKV\YGK5GKVGPJCMGP2')76#//<'+ ++  5GJTHGKPG#PHGTVKIWPIWO'ZGORNCTCWUFGT#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT 7$5#)KP$CUGNCOWPF0QXGODGT0T



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGK MCWO UKEJVDCTG %JKRU KO 5EJTKHVDCPF CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC*CNNG[KP2CTKUCP0CFGNFKGUGOKV*GTUVGNNGTRWP\GWPFHTCP\ÌUKUEJGT)CTCPVKGRWP\GXQP DKU 9KNFUEJYGKPMQRH OKV\YGK5GKVGPJCMGP2')7<'+ +p++ 5GJTHGKPG#PHGTVKIWPIWO

9101





9102

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC$CSWGXKNNGKP2CTKUCP0CFGNFKGUG OKV *GTUVGNNGTRWP\G WPF HTCP\ÌUKUEJGT )CTCPVKGRWP\G XQP  DKU  9KNFUEJYGKPMQRH  OKV \YGK   5GKVGPJCMGP2')7<'+ +p++



5GJTHGKPG#PHGTVKIWPIWO



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV 4ÒEMUGKVG XGTIQNFGV /GFCKNNQP )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGKCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ +p++



#PHGTVKIWPICWUFGTGTUVGP&GMCFGFGU<YCP\KIUVGP,CJTJWPFGTVU

231


SPANIEN

9103



9104

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGK \YGK MCWO UKEJVDCTG 'OCKNNGEJKRU KO 5EJTKHVDCPF CWH FGT 4ÒEMUGKVG *GTUVGNNGT   DG\GKEJPWPIFGT(KTOC.GOCKVTGKP2CTKUCP0CFGNOKV\YGK5GKVGPJCMGPÒDGT\QIGPOKVICP\HGKPGO WPFMCWOUKEJVDCTGP<CRQPNCEMIGIGP1Z[FCVKQP2')7<'+ +p++



$GOGTMGPUYGTVGU 'ZGORNCT OKV UGRCTCV CWHIGUGV\VGP -TGW\CTOHGNFGTP 5GJT HGKPG #PHGTVKIWPI CWU FGO GTUVGP   8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVU



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV FKG #WHNCIGP )QNF   GOCKNNKGTVOGJTGTG'OCKNNKGTTGRCTCVWTGPCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ ++ #PHGTVKIWPIWO&KG5VGTPGFGT-QOOCPFGWTGXQP0WOOGTYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNU QFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP

9105





9106

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV FKG #WHNCIGP )QNF   GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -T½VN[ KP 2CTKU CP 0CFGN OKV \YGK   5GKVGPJCMGP2')7<'+ +p++



#PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU  &KG 5VGTPG FGT -QOOCPFGWTG XQP 0WOOGT   YWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV FKG #WHNCIGP )QNF   GOCKNNKGTV 'OCKNNKGTTGRCTCVWTGP KP FGP XKGT -TGW\CTOHN·EJGP CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI   FGT(KTOC-T½VN[KP2CTKUCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ ++ #PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK 1TFGPWPF'JTGP\GKEJGP'KPGPQTFCOGTKMCPKUEJG2TKXCVUCOONWPI0T&KG5VGTPGFGT-QOOCPFGWTG XQP0WOOGTYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP

232




SPANIEN

9107



9108

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV FKG #WHNCIGP )QNF   GOCKNNKGTV CP 0CFGN FKGUG OKV HTCP\ÌUKUEJGT )CTCPVKGRWP\G XQP  DKU  HÒT GT 5KNDGT  

9KNFUEJYGKPMQRH OKV\YGK5GKVGPJCMGP2')7<'+ +



*GTXQTTCIGPFG HTCP\ÌUKUEJG #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU  &KG 5VGTPG FGT   -QOOCPFGWTGXQP0WOOGTYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG GOCKNNKGTV CWH   FGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC*CNNG[KP2CTKUCP0CFGNFKGUGRWP\KGTVOKVGKPGOXQP WTURTÒPINKEJ \YGK 5GKVGPJCMGP ÒDGT\QIGP OKV ICP\ HGKPGO WPF MCWO UKEJVDCTGP <CRQPNCEM IGIGP   1Z[FCVKQP2')7<'+ ++



5GNVGPGDGUQPFGTG#WUHÒJTWPIOKVUKNDGTHCTDGPGP WPFPKEJVIQNFHCTDGPGP #WHNCIGP &KG5VGTPGFGT-QOOCPFGWTG XQP0WOOGTYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP

9109



9110

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -QOOCPFGWTMTGW\ )QNF HGKPUV \KUGNKGTV WPF GOCKNNKGTV  I HGKPUVG 'OCKNNGOCNGTGK CO QTKIKPCNGP   CNVGP\GKVIGPÌUUKUEJGP*CNUDCPF2')76#//<'+ +



5GJT SWCNKV·VUXQNNG #PPHGTVKIWPI WO  OKV UVCTT CPIGDTCEJVGO .QTDGGTMTCP\ ÒDGT FGO -TGW\ WPF GOCKNNKGTVGO   $CPFTKPI 'ZGORNCT CWU FGT #WMVKQP  1TFGP CWU CNNGT 9GNV  5COONWPI 6COOCPP FGT 7$5 #) KP $CUGN CO   WPF0QXGODGT0TFQTVLGFQEJCNU)TQ­MTGW\DGUEJTKGDGP



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -QOOCPFGWTMTGW\ )QNF HGKPUV \KUGNKGTV WPF GOCKNNKGTV  I HGKPUVG 'OCKNNGOCNGTGK FTGK CNVG   'OCKNNGTGRCTCVWTGP CWH 8QTFGT WPF 4ÒEMUGKVGP OKV CNVGO NCPIGP *CNUDCPFCDUEJPKVV 2')7  <'+    ++p+++



5GJT SWCNKV·VUXQNNG #PPHGTVKIWPI WO  OKV UVCTT CPIGDTCEJVGO .QTDGGTMTCP\ ÒDGT FGO -TGW\ WPF GOCKNNKGTVGO   $CPFTKPI'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPGPQTFCOGTKMCPKUEJG 2TKXCVUCOONWPI0T

233


SPANIEN

9112

9111



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -QOOCPFGWTMTGW\ )QNF HGKPUV \KUGNKGTV WPF GOCKNNKGTV  I HGKPUVG 'OCKNNGOCNGTGK OKV CNVGO   NCPIGP*CNUDCPFCDUEJPKVV2')7<'+ +



5GJT SWCNKV·VUXQNNG #PPHGTVKIWPI WO  OKV UVCTT CPIGDTCEJVGO .QTDGGTMTCP\ ÒDGT FGO -TGW\ WPF GOCKNNKGTVGO   $CPFTKPI



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -QOOCPFGWTMTGW\ )QNF HGKPUV \KUGNKGTV WPF GOCKNNKGTV  I HGKPUVG 'OCKNNGOCNGTGK MNGKPG   'OCKNNGUEJ·FGPCWH8QTFGTWPF4ÒEMUGKVGFGUWPVGTGP-TGW\CTOGU2')7<'+ ++



5GJT SWCNKV·VUXQNNG #PPHGTVKIWPI WO  OKV UVCTT CPIGDTCEJVGO .QTDGGTMTCP\ ÒDGT FGO -TGW\ WPF GKPHCEJGO   $CPFTKPI

9113 9114



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -QOOCPFGWTMTGW\)QNFGOCKNNKGTVIHGKPG'OCKNNGOCNGTGKOGJTGTG'OCKNNGEJKRUKPFGPDGKFGP /GFCKNNQPTKPIGP OKV QTKIKPCNGP \GKVIGPÌUUKUEJGP GVYCU \GTUEJNKUUGPGP *CNUDCPF 2')7  <'+    ++p+++



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV 4ÒEMUGKVGPOGFCKNNQPU WPF /CFQPPCHKIWT FGU 8QTFGTUGKVGP   OGFCKNNQPU)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCOQTKIKPCNGP*CNUDCPF2')7<'+ +p++



#PHGTVKIWPIWO'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPGPQTF COGTKMCPKUEJG2TKXCVUCOONWPI0T



#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVU

234


SPANIEN

9115

9116 9117



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     4KVVGTMTGW\KPNGKEJVTGFW\KGTVGT#WUHÒJTWPI)QNFGOCKNNKGTVI OKV$CPF HGKPUVG'OCKNNGOCNGTGK COCNVGPLGFQEJGVYCUXCTKCPVGP$CPF2')7<'+ +p++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPIWOOKVUVCTTCPIGDTCEJVGO.QTDGGTMTCP\ÒDGTFGO-TGW\



-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV    /QFGNN     4KVVGTMTGW\ )QNF GOCKNNKGTV  I OKV $CPF  HGKPUVG 'OCKNNGOCNGTGK CO QTKIKPCNGP CNVGP $CPF   2')7<'+ +p++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU'Z#WMVKQPFGT%CUCF #UVG 5CP)KQTIKQKP)GPWCXQO1MVQDGT0T



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO(41  -NGKPQF \WO )TQ­MTGW\ )QNF GOCKNNKGTV OGJTGTG OKP #WUDTÒEJG KP FGP /GFCKNNQPTKPIGP HGKPUVG   'OCKNNGOCNGTGKCOQTKIKPCNGPCNVGP5EJWNVGTDCPF2')7p<'+ ++p

9118







9119

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO(41  $TWUVUVGTP \WO )TQ­MTGW\ 5KNDGT XGTIQNFGV #WHNCIGP )QNF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK MCWO   UKEJVDCTG 'OCKNNGDGUEJ·FKIWPI KP \YGK .QTDGGTDN·VVEJGP CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC *CNNG[ KP 2CTKU GKPGU FGT XKGT MNGKPGP #DFGEMN·RREJGP HGJNV CP 0CFGN OKV GKPGO XQP   WTURTÒPINKEJ\YGK5GKVGPJCMGP ++



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO(41  $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT )QNF OCUUKX  I GOCKNNKGTV CP 5VCJNPCFGN OKV \YGK   5GKVGPJCMGP2')7<'+ 44+p++  *GTXQTTCIGPFIGCTDGKVGVGU'ZGORNCTWO-QOOCPFGWTUVGTPGKPOCUUKX)QNFUKPFUGJTUGNVGP\WHKPFGP&KG 5VGTPG FGT -QOOCPFGWTG XQP 0WOOGT YWTFGP CNNGKPG QJPG YGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGP WPFIGVTCIGP

235


SPANIEN

9121

9120



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO(41  $TWUVUVGTP\WO-QOOCPFGWTXQP0WOOGT5KNDGTXGTIQNFGV#WHNCIGP)QNFGOCKNNKGTVCP0CFGNOKV \YGK5GKVGPJCMGP2')7<'+ ++



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  $TWUVUVGTP\WO-QOOCPFGWTXQP0WOOGT5KNDGTXGTIQNFGV#WHNCIGP)QNFGOCKNNKGTV'OCKNNGUEJ·FGP CWH \YGK -TGW\CTOGP HGKPUVG 'OCKNNGOCNGTGK -TQPG ÒDGT FGO /GFCKNNQP DGUEJ·FKIV CP 0CFGN OKV   \YGK5GKVGPJCMGP2')7XCT<'+ ++p+++



&KG 5VGTPG FGT -QOOCPFGWTG XQP 0WOOGT YWTFGP CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG *CNU QFGT $TWUVMTGW\ XGT   NKGJGPWPFIGVTCIGP



&KG 5VGTPG FGT -QOOCPFGWTG XQP 0WOOGT YWTFGP CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG *CNU QFGT $TWUVMTGW\ XGT   NKGJGPWPFIGVTCIGP

9123 9122



9122

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO(41  -QOOCPFGWTMTGW\ #WUHÒJTWPI OKV GOCKNNKGTVGO $CPFTKPI )QNF OCUUKX GOCKNNKGTV  I HGKPUVG   'OCKNNGOCNGTGK GKPKIG MCWO UKEJVDCTG 'OCKNNGEJKRU KO .QTDGGTMTCP\ CO MWT\GP *CNUDCPFCDUEJPKVV   2')7<'+ ++



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN     $TWUVUVGTP  -NCUUG HÒT 1HHK\KGTG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV CP   0CFGN2')7<'+ ++ #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU 'Z #WMVKQP FGT %CUC F #UVG 5CP )KQTIKQ KP   )GPWC XQO  1MVQDGT  0T  'ZGORNCT FGT 5COONWPI &T #PVQPKQ 5RCFC KP $TGUEKC XGTÌHHGPVNKEJV KP   5RCFC #PVQPKQ 1PQTK G )NQTKC  5QXTCPQ /KNKVCTG 1TFKPG FK /CNVC 5RCIPC )TCP $TGVCIPC 2QTVQICNNQ $TCUKNG   $TGUEKC50T

236




SPANIEN

9124

9125

9126



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN     $TWUVUVGTP  -NCUUG HÒT 1HHK\KGTG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV FKG   -WIGNP CP FGP -TGW\URKV\GPFGP WPF FKG 4ÒEMUGKVG XGTIQNFGV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI   FGT(KTOC,2FG#TGNNCPQPKP/CFTKFUCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ ++



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK 1TFGPWPF'JTGP\GKEJGP'KPGPQTFCOGTKMCPKUEJG2TKXCVUCOONWPI0T



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN     $TWUVUVGTP  -NCUUG HÒT 1HHK\KGTG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF GOCKNNKGTV FKG   -WIGNPCPFGP-TGW\URKV\GPFGP)QNFRNCVVKGTVCP0CFGN2')7<'+ ++



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN     $TWUVUVGTP FGT  WPF  -NCUUG 5KNDGT DTKNNCPVKGTV /GFCKNNQP )QNF HGKPUV \KUGNKGTV WPF VGKNYGKUG   GOCKNNKGTVMCWOUKEJVDCTG#DRNCV\WPIGPKPFGT*GKNKIGPHKIWTUQYKGKPGKPKIGP.QTDGGTDN·VVEJGPCWHFGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC,WCP/GFKPCKP$CTEGNQPCCP0CFGNOKV\YGK5GKVGPJCMGP 2')7<'+ 4++  5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU OKV UGRCTCV GKPIGNGIVGP   -TGW\CTOGP'Z#WMVKQPFGT%CUCF #UVG5CP)KQTIKQKP)GPWCXQO1MVQDGT0T

9127 9128



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPF UGKV   D\Y /KNKV·TKUEJGT   1TFGP FGU JN (GTFKPCPF  /QFGNN    

5EJYGTVGT -TGW\FGFKCTKQ-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVI&WTEJOGUUGTOO \YGKOKP'OCKNNGCWUDTÒEJGCWHFGT4ÒEMUGKVG)TCXWT'''/#07'.6*'*#4&21465'CP 0CFGN2')7<'+ ++



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU-TGW\WPF-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGKOKP'OCKN NGEJKRUCWH8QTFGTWPF4ÒEMUGKVGFGUQDGTGP-TGW\CTOGUQJPG$CPF2')76#//<'+  ++



#PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU 'Z #WMVKQP FGT %CUC F #UVG 5CP )KQTIKQ KP   )GPWCXQO1MVQDGT0T



5GJTHGKPG#PHGTVKIWPIWO'ZGORNCTCWUFGT#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT 7$5#)KP$CUGNCOWPF0QXGODGT0T

237


SPANIEN

9129 (1:1)



0CVKQPCNGT  WPF   D\Y -ÌPKINKEJGT WPF /KNKV·TKUEJGT     WPFUGKV D\Y/KNKV·TKUEJGT  1TFGPFGUJN(GTFKPCPF/QFGNN  )QN FGPGU -TGW\  WPF  -NCUUG HÒT 1HHK\KGTG )QNF GOCKNNKGTV  I HGKPUVG 'OCKNNGOCNGTGK ITÌ­GTGT   'OCKNNGUEJCFGP CWH FGT 8QTFGTUGKVG FGU QDGTGP -TGW\CTOU OKP 'OCKNNGEJKRU CWH 8QTFGT WPF   4ÒEMUGKVGQJPG$CPF2')7<'+ ++p+++



(GKPG#PHGTVKIWPIWO

9130 (1:1)



9131 (1:1)

-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

WPF $TWUVUVGTP\WO)TQ­MTGW\5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGXGT IQNFGV /GFCKNNQP WPF -TQPG )QNF GOCKNNKGTV CP 0CFGN OKV \YGK 5GKVGPJCMGP 2')7  6#//   <'+ ++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU'ZGORNCTCWUFGT#WMVKQP 1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5#)KP$CUGNCOWPF0QXGODGT0TFQTV LGFQEJCNUUR·VGTGU5VÒEMDGUEJTKGDGP



-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

WPF $TWUVUVGTP FGT-NCUUG 5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGXGT IQNFGV/GFCKNNQP)QNFGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ ++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

238


SPANIEN

9132 9133 (1:1)

9133 (1:1)



-ÌPKINKEJGT WPF  WPF UGKV   /KNKV·TKUEJGT 1TFGP FGU JN *GTOGPGIKNFQ  /QFGNN  

 WPF   $TWUVUVGTP FGT  -NCUUG  5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV   /GFCKNNQP )QNF GOCKNNKGTV GKPKIG 'OCKNNGCDRNCV\WPIGP WPFQDGTHN·EJNKEJG'OCKNNGEJKRUCP0CFGNOKV \YGK5GKVGPJCMGPFCXQPGKPGTTGRCTKGTV2'*7<'+ ++p+++



#PHGTVKIWPIWO'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP'KPGPQTF COGTKMCPKUEJG2TKXCVUCOONWPI0T



-ÌPKINKEJGT 1TFGP FGT 'FNGP &COGP FGT -ÌPKIKP /CTKC .WKUC 1TFGPUMTGW\ #WUHÒJTWPI OKV   UVCTTGO.QTDGGTMTCP\WPFDGYGINKEJGT-GVVG)QNFHGKPUV\KUGNKGTVWPFGOCKNNKGTVI OKV5EJNGKHG  HGKPUVG 'OCKNNGOCNGTGK CP QTKIKPCNGT CNVGT \GKVIGPÌUUKUEJGT &COGPUEJNGKHG OKV QTKIKPCNGP CNVGO WPF   \GKVIGPÌUUKUEJGO5EJWNVGTDCPFKOQTKIKPCNGP8GTNGKJWPIUGVWKOKVFGOIQNFHCTDGPGP/QPQITCOO-ÌPKI #NHQPU:++2')7p<'+ +  'ZGORNCT CWU FGO $GUKV\ FGT )TQ­JGT\QIKP .WKUG XQP $CFGP   FKG GU XQP -ÌPKI #NHQPU :++KPUGKPGT 4GIKGTWPIU\GKV\YKUEJGPWPFGTJCNVGPJCV

9134 (1:1)



-ÌPKINKEJGT 1TFGP FGT 'FNGP &COGP FGT -ÌPKIKP /CTKC .WKUC 1TFGPUMTGW\ #WUHÒJTWPI OKV   UVCTTGO .QTDGGTMTCP\ WPF DGYGINKEJGT -GVVG )QNF HGKPUV \KUGNKGTV WPF GOCKNNKGTV  I HGKPUVG   'OCKNNGOCNGTGKQJPG5EJWNVGTDCPF2')7p<'+ ++  #PHGTVKIWPICWUFGT4GIKGTWPIU\GKV-ÌPKI#NHQPU:++FGTXQPDKUTGIKGTVJCV

239


SPANIEN

9135 (1:1)

9135 (1:1)

9136 (1:1)



-ÌPKINKEJGT1TFGPFGT'FNGP&COGPFGT-ÌPKIKP/CTKC.WKUC1TFGPUMTGW\ZOO#WU HÒJTWPI OKV UVCTTGO .QTDGGTMTCP\ WPF DGYGINKEJGT -GVVG )QNF HGKPUV \KUGNKGTV WPF GOCKNNKGTV  I  

OKV 5EJNGKHG  HGKPUVG 'OCKNNGOCNGTGK CP QTKIKPCNGT CNVGT \GKVIGPÌUUKUEJGT &COGPUEJNGKHG 2')7 p   6#//<'+ +p++  #PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU'ZGORNCTCWUFGT#WMVKQP1TFGPCWUCNNGT 9GNV5COONWPI6COOCPPFGT7$5#)KP$CUGNCOWPF0QXGODGT0T



/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKO<GPVTWO YGK­G#DVGKNWPI HÒT8GTFKGPUVKP(TKGFGPU\GKVGP5VGTP\WO)TQ­MTGW\)QNFOCUUKXDTKNNCPVKGTVWPFFWTEJDTQEJGPIGCT DGKVGVVGKNYGKUGGOCKNNKGTV#WHNCIGPVGKNYGKUG5KNDGTICWHFGO2N·VVEJGPFGUQDGTGP-TGW\CTOU )TCXWT,7.+1CWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC(GTPCPFG\¾*KLQKP/CFTKF CP0CFGNFKGUGRWP\KGTVWPF\YGK5GKVGPJCMGP2')7<'+ 44++

W­GTUV SWCNKV·VUXQNNG *GTUVGNNWPI OKV OCUUKX IQNFGPGP 5VGTPMQTRWU KP VCFGNNQUGT 'TJCNVWPI &GT $TWUVUVGTP \WO   )TQ­MTGW\WPFFGT5VGTPFGT-NCUUGWPVGTUEJGKFGPUKEJPWTFWTEJFKG(CTDGFGU/GVCNNRN·VVEJGPUCWHFGOQDGTGP -TGW\CTOFCUDGKOGTUVGTGPUKNDGTHCTDGP  WPFDGKONGV\VGTGPIQNFHCTDGP  KUV

9137



9138

/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKO<GPVTWO YGK­G#DVGKNWPI HÒT8GTFKGPUVKP(TKGFGPU\GKVGP5VGTP-NCUUG5KNDGTDTKNNCPVKGTVWPFFWTEJDTQEJGPIGCTDGKVGVWPFXGT IQNFGV #WHNCIGP )QNF GOCKNNKGTV VGKNYGKUG 5KNDGT MNGKPGT 'OCKNNGUEJCFGP KO /GFCKNNQP TÒEMUGKVKIG   /GFCKNNQPCDFGEMWPI HGJNV CP 0CFGN OKV \YGK 5GKVGPJCMGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC   ,QU¾ (GTPCPFG\ /C[QT KP /CFTKF OKV IQNFHCTDGPGO /QPQITCOO -ÌPKI #NHQPU :+++ 2')7    <'+ ++p



/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKO<GPVTWO YGK­G#DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP 5VGTP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF FWTEJDTQEJGP IGCTDGKVGV   #WHNCIGP )QNF GOCKNNKGTV CP 0CFGN OKV \YGK 5GKVGPJCMGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC   ,5C\KP/CFTKF2')7<'+ +



#PHGTVKIWPI CWU FGO GTUVGP 8KGTVGN FGU <YCP\KIUVGP ,CJTJWPFGTVU &KG 5VGTPG FGT  WPF -NCUUGYWTFGPCNNGKPG QJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



#PHGTVKIWPIWO

240




SPANIEN

9140

9139



/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKO<GPVTWO YGK­G#DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP 5VGTP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF FWTEJDTQEJGP IGCTDGKVGV   #WHNCIGP )QNF GOCKNNKGTV CP 0CFGN OKV \YGK 5GKVGPJCMGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC   /GFKPCKP$CTEGNQPCWPF/CFTKF2')7<'+ +



#PHGTVKIWPIWO



/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKO<GPVTWO YGK­G#DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP 5VGTP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF FWTEJDTQEJGP IGCTDGKVGV   #WHNCIGP )QNF GOCKNNKGTV CP 0CFGN OKV \YGK 5GKVGPJCMGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC   ,QU¾ (GTPCPFG\ /C[QT KP /CFTKF OKV IQNFHCTDGPGO /QPQITCOO -ÌPKI #NHQPU :+++ 2')7    6#//<'+ +



#PHGTVKIWPI CWU FGT GTUVGP &GMCFG FGU <YCP\KIUVGP ,CJTJWPFGTVU 'ZGORNCT CWU FGT #WMVKQP  1TFGP CWU CNNGT   9GNV5COONWPI6COOCPPFGT7$5#)KP$CUGNCOWPF0QXGODGT0TFQTVLGFQEJCNUUR·VGTGU 5VÒEM DGUEJTKGDGP  &KG 5VGTPG FGT  WPF  -NCUUG YWTFGP CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG *CNU QFGT $TWUV   MTGW\XGTNKGJGPWPFIGVTCIGP

9142

9143

9141



/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKPFGT/KVVGWPF//CWHFGO4GXGTUOG FCKNNQP YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP-TGW\-NCUUG)QNFGOCKNNKGTV I OKV$CPF CO$QIGPDCPFUEJYGFKUEJGT0·JCTV2')7<'+ ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU,CJTJWPFGTVU



/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKPFGT/KVVGWPF//CWHFGO4GXGTUOG FCKNNQP YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP-TGW\-NCUUG)QNFGOCKNNKGTV I OKV$CPFWPF6TCIGURCPIG COQTKIKPCNGP$CPFOKV6TCIGURCPIG2')7<'+ ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU,CJTJWPFGTVU'ZGORNCTCWUWPUGTGT#WMVKQPCO ,WPK1TFGPWPF'JTGP\GKEJGP'KPGPQTFCOGTKMCPKUEJG2TKXCVUCOONWPI0T



/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKPFGT/KVVGWPF//CWHFGO4GXGTUOG FCKNNQP YGK­G#DVGKNWPIHÒT8GTFKGPUVKP(TKGFGPU\GKVGP-TGW\-NCUUGKPGVYCUTGFW \KGTVGT#WUHÒJTWPI)QNFGOCKNNKGTVIQJPG$CPF2')7<'+ 4++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP3WCTVCNFGU,CJTJWPFGTVU

241


SPANIEN

9145 9144



/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV $QWTDQPGPYCRRGP KO <GPVTWO    TQVG #DVGKNWPI   HÒT 8GTFKGPUV KP -TKGIU\GKVGP 5VGTP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF FWTEJDTQEJGP IGCTDGKVGV WPF   XGTIQNFGV #WHNCIGP )QNF GOCKNNKGTV VGKNYGKUG 5KNDGT CP 0CFGN OKV \YGK 5GKVGPJCMGP KO QTKIKPCNGP   8GTNGKJWPIUGVWK FGT (KTOC ,QU¾ (GTPCPFG\ /C[QT KP /CFTKF OKV IQNFHCTDGPGO /QPQITCOO -ÌPKI   #NHQPU:+++2')7<'+ 44+p++



#PHGTVKIWPI CWU FGO GTUVGP 8KGTVGN FGU <YCP\KIUVGP ,CJTJWPFGTVU &KG +PUKIPKGP FGT TQVGP #DVGKNWPI UKPF KP CNNGP   -NCUUGP YGKVCWU UGNVGPGT \W HKPFGP CNU FKG FGT YGK­GP #DVGKNWPI&KG5VGTPGFGTWPF-NCUUGYWTFGPCNNGKPG QJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV $QWTDQPGPYCRRGP KO <GPVTWO    TQVG #DVGKNWPI   HÒT 8GTFKGPUV KP -TKGIU\GKVGP 5VGTP  -NCUUG 5KNDGT OCUUKX DTKNNCPVKGTV #WHNCIGP )QNF GOCKNNKGTV   MCWO UKEJVDCTG 'OCKNNGTGRCTCVWT KO /GFCKNNQP CP 0CFGN OKV \YGK 5GKVGPJCMGP 2')7    <'+ ++



#PHGTVKIWPICWUFGOGTUVGP8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVU

9147

9147 9146



/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV $QWTDQPGPYCRRGP KO <GPVTWO    TQVG #DVGKNWPI   HÒT8GTFKGPUVKP-TKGIU\GKVGP5VGTP-NCUUG5KNDGTDTKNNCPVKGTVWPFFWTEJDTQEJGPIGCTDGKVGV#WHNCIGP )QNF GOCKNNKGTV TÒEMUGKVKIG /GFCKNNQPCDFGEMWPI HGJNV CP 0CFGN OKV \YGK 5GKVGPJCMGP 2')7    <'+ ++



#PHGTVKIWPICWUFGOGTUVGP8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVU'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTFCOGTKMCPKUEJG 2TKXCVUCOONWPI 0T   &KG 5VGTPG FGT  WPF    -NCUUGYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



/KNKV·T8GTFKGPUVQTFGP  /QFGNN OKV$QWTDQPGPYCRRGPKPFGT/KVVGWPF//CWHFGO4GXGTUOG FCKNNQP    TQVG #DVGKNWPI HÒT 8GTFKGPUV KP -TKGIU\GKVGP -TGW\  -NCUUG )QNF GOCKNNKGTV    I OKV $CPF  ÒDGT\QIGP OKV MCWO UKEJVDCTGP <CRQPNCEM CO QTKIKPCNGP CNVGP $CPF 2')7    <'+ ++ #PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

242




SPANIEN

9148 (1:1)



/CTKPG8GTFKGPUVQTFGP  /QFGNN   YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP   )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF )QNF GOCKNNKGTV OKV QTKIKPCNGO CNVGP \GKVIGPÌUUKUEJGP   5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV WPF XGTIQNFGV #WHNCIGP )QNF GOCKNNKGTV 5KNDGT CP   0CFGN OKV  5GKVGPJCMGP KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC / %GLCNXQ KP /CFTKF OKV   IQNFHCTDGPGO9CRRGP2')7<'+ 4++  5GNVGPGT5GVKPGKPGT#PHGTVKIWPIWO&GT$TWUVUVGTP\WO)TQ­MTGW\WPFFGT5VGTPFGT-NCUUGWPVGTUEJGK FGPUKEJPWTFWTEJFKG(CTDGFGU/GVCNNRN·VVEJGPUCWHFGOQDGTGP-TGW\CTOFCUDGKOGTUVGTGPUKNDGTHCTDGP  WPF DGKONGV\VGTGPIQNFHCTDGP  KUV

9149



9150

/CTKPG8GTFKGPUVQTFGP  /QFGNN   YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP   5VGTPFGT-NCUUG5KNDGTDTKNNCPVKGTV#WHNCIGP)QNFGOCKNNKGTVMNGKPGT'OCKNNGUEJCFGPKO#PMGTCP 0CFGNOKV\YGK5GKVGPJCMGP2')76#//<'+ ++



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGO NGV\VGP 3WCTVCN FGU 0GWP\GJPVGP ,CJTJWPFGTVU 'ZGORNCT CWU FGT #WMVKQP   1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5#)KP$CUGNCOWPF0QXGODGT0TFQTV LGFQEJCNUUR·VGTGU5VÒEMDGUEJTKGDGP&KG5VGTPGFGTWPF-NCUUGYWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG *CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



/CTKPG8GTFKGPUVQTFGP  /QFGNN   TQVG #DVGKNWPI HÒT 8GTFKGPUV KP -TKGIU\GKVGP 5VGTP   FGT-NCUUG5KNDGTDTKNNCPVKGTVWPFFWTEJDTQEJGPIGCTDGKVGV#WHNCIGP)QNFGOCKNNKGTVCP0CFGNOKV \YGK5GKVGPJCMGP2')7<'+ 4+p++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU&KG5VGTPGFGTWPF-NCUUG YWTFGPCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP

243


SPANIEN

9151 (1:1)

9151 (1:1) 9152 (1:1)



/CTKPG8GTFKGPUVQTFGP  /QFGNN   TQVG #DVGKNWPI HÒT 8GTFKGPUV KP -TKGIU\GKVGP -TGW\   -NCUUG)QNFGOCKNNKGTVIQJPG$CPF2')7<'+ 4+  5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU &KG +PUKIPKGP FGT TQVGP   #DVGKNWPIUKPFKPCNNGP-NCUUGPYGKVCWUUGNVGPGT\WHKPFGPCNUFKGFGTYGK­GP#DVGKNWPI



<KXKNGT1TFGP#NHQPU :++-NGKPQFOKV5VGKPGP\WO)TQ­MTGW\)QNFGOCKNNKGTV5VTCJNGPÒDGTFGO #FNGT WPF $WEJUVCDGP OKV &KCOCPVTQUGP IGRTÒHV  DGUGV\V FCXQP GKPKIG XGTNQTGP IGICPIGP CO   QTKIKPCNGP5EJWNVGTDCPF2')7XCT6#//<'+XCT 44++  W­GTUVNWZWTKÌUG#PHGTVKIWPI'ZGORNCTCWUFGT#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5 #) KP $CUGN CO  WPF  0QXGODGT  0T   &GT XKGTMNCUUKIG <KXKN8GTFKGPUVQTFGP YWTFGOKV-ÌPKINK EJGO&GMTGVXQO/CKIGUVKHVGVWPFKO*GTDUVXQPFGT<YGKVGP4GRWDNKMCWHIGJQDGP

9153 (1:1)



<KXKNGT1TFGP#NHQPU :++$TWUVUVGTP)QNFGOCKNNKGTVI#WHNCIGPVGKNYGKUG5KNDGTGOCKNNKGTV OKP'OCKNNGEJKRCWHFGONKPMGP-TGW\CTOCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ 44++  +P GEJV )QNF UGJT UGNVGP 'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG   PQTFCOGTKMCPKUEJG2TKXCVUCOONWPI0TFQTVCNU6GKNGKPGU)TQ­MTGW\UGVUWPFOKVHCNUEJGT/CVGTKCNDGUEJTGK DWPI 5KNDGTXGTIQNFGV CPIGDQVGP

244


SPANIEN

9155

9154



<KXKNGT 1TFGP #NHQPU  :++  $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT VGKNYGKUG XGTIQNFGV   VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC %GLCNXQ KP /CFTKF CP 0CFGN   OKV\YGK5GKVGPJCMGP2')7<'+ ++



'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTFCOGTKMCPKUEJG 2TKXCV   UCOONWPI0T



<KXKNGT 1TFGP #NHQPU  :++  $TWUVUVGTP \WO -QOOCPFGWT XQP 0WOOGT 5KNDGT VGKNYGKUG XGTIQNFGV   VGKNYGKUGGOCKNNKGTVOKP'OCKNNGEJKRKPFGT-TQPGCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC %GLCNXQKP/CFTKFCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ ++



'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTFCOGTKMCPKUEJG 2TKXCV   UCOONWPI0T

9156 (1:1)



1TFGPHÒT9QJNV·VKIMGKV/QFGNN WPF -NGKPQF\WO)TQ­MTGW\)QNFGOCKN NKGTVI\WUCOOGPOKVECONCPIGO5VÒEMQTKIKPCNGOWPF\GKVIGPÌUUKUEJGPYGK­GP5EJWNVGTDCPF OKVUEJYCT\GP5GKVGPUVTGKHGP2')7<'+ 44+



'EJVIQNFGPG+PUKIPKGPFKGUGU1TFGPUUKPFXQPCNNGTITÌ­VGT5GNVGPJGKV  &GT WTURTÒPINKEJ FTGKMNCUUKIG 1TFGP YWTFG OKV -ÌPKINKEJGO &GMTGV +UCDGNNCU ++   XQO  /CK   

XGTÌHHGPVNKEJV KP FGT )CEGVC FG /CFTKF XQO /CK GTI·P\VFWTEJ-ÌPKINKEJGU&GMTGVXQO&G\GODGT IGUVKHVGV /QFGNN <YKUEJGPWPFYWTFGGTPKEJVXGTNKGJGP/KV-ÌPKINKEJGO&GMTGVXQO,WNK

XGTÌHHGPVNKEJV KP FGT )CEGVC FG /CFTKF XQO  ,WNK   TGQTICPKUKGTVG KJP -ÌPKI #NHQPU :+++     XQNNMQOOGP PGW PWPOGJT XKGT #DVGKNWPIGP OKV LGYGKNU  -NCUUGP  WPF ICD FGP +PUKIPKGP GKPG XQNNMQOOGP PGWG   )GUVCNVWPI8QPFGT<YGKVGP4GRWDNKMCWHIGJQDGPYWTFGGTXQP5VCCVUEJGH)GPGTCN(TCPEKUEQ(TCPEQ[$CJCOQPFG

 WPXGT·PFGTVGTPGWGTV-ÌPKI,WCP%CTNQU+JQDOKV-ÌPKINKEJGO&GMTGVXQO#RTKN

XGTÌHHGPVNKEJVKO$1'XQP FGP1TFGP\W)WPUVGPFGUPGWIGUVKHVGVGP<KXKNGP1TFGPUFGT5Q\KCNGP5QNK FCTKV·VCWH

245


SPANIEN

9157



-ÌPKINKEJGTWPF DKU /KNKV·TKUEJGT1TFGPXQP/CTKC%JTKUVKPC/QFGNN  $TWUV UVGTP  -NCUUG &WTEJOGUUGT  OO 5KNDGT #WHNCIGP $TQP\G WPF )QNF IGRTÒHV  VGKNYGKUG   GOCKNNKGTVHGKPG'OCKNOCNGTGKCWHFGOQDGTGP-TGW\CTO)QNFUEJKNFEJGPOKVFGT)TCXWT/#$7;#CP 0CFGNOKV\YGK5GKVGPJCMGP2')7C6#//<'+ 44++  5GJTSWCNKV·VUXQNNG#PHGTVKIWPIWO'ZGORNCTCWUFGT#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPP FGT7$5#)KP$CUGNCOWPF0QXGODGT0T#NNG+PUKIPKGPFKGUGU1TFGPUUKPFXQPCNNGTITÌ­VGT 5GNVGPJGKV#NNGTFKPIUYGTFGPFKGCWHITWPFKJTGTUGJT·JPNKEJGP)GUVCNVWPIQHVOKVFGO-TKGIUMTGW\XGTYGEJUGNV  &GTHÒPHMNCUUKIG1TFGP )TQ­MTGW\5VGTPWPF-NCUUG5KNDGTPGU-TGW\ YWTFGCO,CPWCTXQPFGT 4GIGPVKP-ÌPKIKPOWVVGT/CTKC%JTKUVKPCXQP5RCPKGP  IGUVKHVGV /QFGNN &KG<YGKVG4GRWDNKMÒDGT PCJO OKV 4WPFUEJTGKDGP XQO  0QXGODGT  FGP 1TFGP PWPOGJT KP \YGK NCUUGP )TQ­MTGW\ WPF 5KNDGTPGU   -TGW\ WPFWPVGT'PVHGTPWPICNNGTOQPCTEJKUEJGT5[ODQNG /QFGNN 

9158



-QODKPKGTVG1TFGPUFGMQTCVKQP$GUVGJGPFCWUFGO$TWUVUVGTP\WT-QNNCPGFGU1TFGPU-CTNU+++FGO $TWUVMTGW\FGU/KNKV·TKUEJGP1TFGPUXQOJN,CMQDWUXQO$TWUVMTGW\FGT-ÌPKINKEJGP-ÌTRGTUEJCHVFGT *KLQUFCNIQ4KVVGTFGU#FNGUXQP/CFTKFWPFFGT-ÌPKINKEJGP/GKUVGTGKFGT4KVVGTUEJCHVXQP5CTCIQUUC 5KNDGT XGTIQNFGV )QNF GOCKNNKGTV CWH FGT 4ÒEMUGKVG VGKNYGKUG XGTFGEMVG *GTUVGNNGTDG\GKEJPWPI GKPGT   (KTOCKP/CFTKFKOQTKIKPCNGP5EJ·EJVGNEJGPOKVMÌPKINKEJGO/QPQITCOO#OKVIGPCWGTOCUEJKPGP UEJTKHVNKEJGT$G\GKEJPWPI<WUCOOGPOKVQTKIKPCNGO-CDKPGVVURJQVQFGU6T·IGTU2TKP\#NHQPUXQP$C[ GTP \WUCOOGPOKVUGKPGT)GOCJNKP.QWKUG8KEVQKTG FCVKGTVCWHFGOGTFKGUG1TFGPUFGMQTCVKQP VT·IVUQYKG1TKIKPCN6GNGITCOOOKV6TCIIGPGJOKIWPI-ÌPKI#NHQPU:+++HÒTFKGUG-QODKPCVKQPCWU .QPFQPMQOOGPFXQO,WNKOKVGKIGPJ·PFKIGTJCPFUEJTKHVNKEJGT'TN·WVGTWPIFGU2TKP\GPOKV 7PVGTUEJTKHV 444+  $GFGWVGPFGU'ZGORNCTCWUFGO$GUKV\XQP2TKP\#NHQPUXQP$C[GTP  FGTGUPCJG\WUV·PFKICWHUGKPGT 7PKHQTO VTWI \WUCOOGP OKV RJQVQITCRJKUEJGO WPF JCPFUEJTKHVNKEJGO 0CEJYGKU FGT 2TQXGPKGP\  'KP ·JPNKEJGU   'ZGORNCT LGFQEJ OKV 5VGKPGP DGUGV\V DGHKPFGV UKEJ KP FGT 5COONWPI XQP &T #PVQPKQ 5RCFC $TGUEKC WPF KUV KO   #WUUVGNNWPIUMCVCNQI*QPPGWTGV)NQKTG.GUVT¾UQTUFGNCEQNNGEVKQP5RCFC\WTINGKEJPCOKIGP#WUUVGNNWPIKO/WU¾G PCVKQPCNFGNC.¾IKQPF *QPPGWTGVFGUQTFTGUFGEJGXCNGTKGKP2CTKUKO*GTDUVWPFKO(TÒJLCJTCWH5GKVG RWDNK\KGTV

246


SPANIEN

9159 9160



9161

/KNKV·TKUEJGT1TFGPXQOJGKNKIGP,CMQDWU$TWUVFGMQTCVKQP)QNF¯LQWTDGUGV\VOKV4WDKPGPCO $·PFEJGP 44+



5GJT NWZWTKÌUG #WUHÒJTWPI CWU FGO GTUVGP &TKVVGN FGU<YCP\KIUVGP,CJTJWPFGTVUXQPJQJGT#PHGTVKIWPIUSWCNKV·V &GTOKNKV·TKUEJG4KVVGTQTFGPYWTFGXQP-ÌPKI4COKTQIGUVKHVGVWPFCO#WIWUVXQP2CRUV#NGZCPFGT+++ DGUV·VKIV



/KNKV·TKUEJGT 1TFGP XQO JGKNKIGP ,CMQDWU $TWUVMTGW\  Z  OO )QNF GOCKNNKGTV  I   MCWOUKEJVDCTG'OCKNNGTGRCTCVWTCP0CFGNOKV\YGK5GKVGPJCMGP 4++  #WUHÒJTWPIGPKPGEJV)QNFUKPFUGNVGP\WHKPFGP



/KNKV·TKUEJGT1TFGP7PUGTGT.KGDGP(TCWXQP/QPVGUC1TFGPUFGMQTCVKQP·NVGTG#WUHÒJTWPI5KNDGT XGTIQNFGVWPF)QNFGOCKNNKGTVCO$CPF 4+



5GNVGPG #WUHÒJTWPI CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU  &GT OKNKV·TKUEJG 4KVVGTQTFGP YWTFG   XQP-ÌPKI,CKOG++XQP#TCIQPKGPIGUVKHVGVWPFFWTEJR·RUVNKEJG$WNNGXQO,WPKDGUV·VKIV

9162 (1:1)



-ÌPKINKEJG /GKUVGTGK FGT 4KVVGTUEJCHV XQP 5CTCIQUUC  /QFGNN &COGPFGMQTCVKQP OKV $TKNNCPVGP   )GNDIQNFWPF9GK­IQNFVGKNYGKUGGOCKNNKGTV¯LQWTDGUGV\VOKV\CJNTGKEJGP$TKNNCPVGPCPFGTQTKIKPCNGP \GKVIGPÌUUKUEJGP&COGPUEJNGKHGCP0CFGN2')7XCT 444+  'KP\KICTVKIGU1DLGMVCWUMÌPKINKEJURCPKUEJGO$GUKV\KPGFGNUVGT#PHGTVKIWPIUSWCNKV·VWPFOKVNÒEMGPNQUGO2TQXG PKGP\0CEJYGKU'ZGORNCTCWUFGO$GUKV\-ÌPKIKP8KEVQTKC'WIGPKCUXQP5RCPKGP  IGD2TKP\GUUKPXQP $CVVGPDGTI)GOCJNKP-ÌPKI#NHQPU:+++XQP5RCPKGP  WPF)TQ­OWVVGTFGULGV\KIGP-ÌPKIU,WCP%CTNQU + 0CEJ FGO 6QF FGT -ÌPKIKP MCO GU CWH FGO 'TDYGI KP FGP $GUKV\ KJTGU 5QJPGU &QP ,CKOG XQP $QWTDQP *GT   \QIUXQP5GIQXKC  FGUUGP9KVYGGUUEJNKG­NKEJKO#RTKNÒDGTFGP0QVCT.QWKU%JQRCTFKP)GPH XGT·W­GTVG&CPCEJIGNCPIVGGUKPFKG5COONWPI4QDGTV/QTGCWKP&KLQPXQPFQTVCP2CVTKEG4GDQWNKP2CTKUXQPFGO GUFGT'KPNKGHGTGTUEJNKG­NKEJGTYQTDGPJCV$GKIGHÒIVKUVFKGQTKIKPCNG$GUV·VKIWPIFGU/CKUQP%KXKNGFGT*GT\QIKP XQP5GIQXKCÒDGTFGP'TDYGIWPFFGP8GTMCWHFGU5VÒEMGUWPFGKPG8GTMCWHUDGUV·VKIWPIXQP4QDGTV/QTGCW  &KG#FGNUMQPITGICVKQPYWTFGXQP-ÌPKI(GTFKPCPF8++OKV-ÌPKINKEJGT8GTQTFPWPIXQO1MVQDGTIGUVKHVGV

247


SPANIEN

9163 (1:1)



-ÌPKINKEJG /GKUVGTGK FGT 4KVVGTUEJCHV XQP 4QPFC &COGPFGMQTCVKQP OKV $TKNNCPVGP )GNDIQNF WPF   9GK­IQNFVGKNYGKUGGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGK¯LQWTDGUGV\VOKV\CJNTGKEJGP$TKNNCPVGPCPFGT QTKIKPCNGP\GKVIGPÌUUKUEJGP&COGPUEJNGKHGCP0CFGN2')7XCT 444+  'KP\KICTVKIGU1DLGMVCWUMÌPKINKEJURCPKUEJGO$GUKV\KPGFGNUVGT#PHGTVKIWPIUSWCNKV·VWPFOKVNÒEMGPNQUGO2TQXG PKGP\0CEJYGKU'ZGORNCTCWUFGO$GUKV\-ÌPKIKP8KEVQTKC'WIGPKCUXQP5RCPKGP  IGD2TKP\GUUKPXQP $CVVGPDGTI)GOCJNKP-ÌPKI#NHQPU:+++XQP5RCPKGP  WPF)TQ­OWVVGTFGULGV\KIGP-ÌPKIU,WCP%CTNQU +0CEJFGO6QFFGT-ÌPKIKPMCOGUCWHFGO'TDYGIKPFGP$GUKV\KJTGU5QJPGU&QP,CKOGXQP$QWTDQP*GT \QIUXQP5GIQXKC  FGUUGP9KVYGGUUEJNKG­NKEJKO#RTKNÒDGTFGP0QVCT.QWKU%JQRCTFKP)GPH XGT·W­GTVG&CPCEJIGNCPIVGGUKPFKG5COONWPI4QDGTV/QTGCWKP&KLQPXQPFQTVCP2CVTKEG4GDQWNKP2CTKUXQP FGO GU FGT 'KPNKGHGTGT UEJNKG­NKEJ GTYQTDGP JCV  $GKIGHÒIV KUV GKPG 2JQVQMQRKG FGT QTKIKPCNGP $GUV·VKIWPI FGU   /CKUQP %KXKNG FGT *GT\QIKP XQP 5GIQXKC ÒDGTFGP'TDYGIWPFFGP8GTMCWHFGU5VÒEMGUWPFGKPG2JQVQMQRKGFGT 8GTMCWHUDGUV·VKIWPIXQP4QDGTV/QTGCW  &KG#FGNUMQPITGICVKQPYWTFGXQP-ÌPKI2JKNKRR++  OKV-ÌPKINKEJGT7TMWPFGXQO5GRVGODGT IGUVKHVGVFKG5VCVWVGPFCVKGTGPXQO(GDTWCT

9165 (1:1) 9164 (1:1)



-ÌPKINKEJG /GKUVGTGK FGT 4KVVGTUEJCHV XQP )TCPCFC $TWUVUVGTP 5KNDGT DTKNNCPVKGTV VGKNYGKUG   GOCKNNKGTV#WHNCIGPVGKNYGKUG)QNFGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKCP0CFGNOKV\YGK5GKVGPJCMGP 2')7 44+p++  &KG +PUKIPKGP FKGUGT /GKUVGTGK UKPF UGJT UGNVGP DGUQPFGTU KP FGT #WUHÒJTWPI OKV GEJV IQNFGPGP #WHNCIGP  &KG   #FGNUMQPITGICVKQPYWTFGCO,CPWCTIGUVKHVGVFKG5VCVWVGPFCVKGTGPXQO



-ÌPKINKEJG /GKUVGTGK FGT 4KVVGTUEJCHV XQP 5GXKNNC $TWUVUVGTP 5KNDGT DTKNNCPVKGTV WPF FWTEJDTQEJGP   IGCTDGKVGV 4ÒEMUGKVG XGTIQNFGV #WHNCIGP )QNF GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK MCWO UKEJVDCTGT   'OCKNNGURTWPI CP 0CFGN OKV \YGK 5GKVGPJCMGP KO 1TKIKPCNGVWK FGT (KTOC /GFKPC KP $CTEGNQPC WPF   /CFTKFHÒTGKPGP5GVOKV*CNUFGMQTCVKQP FKGUGHGJNVLGFQEJ  4+p  +PFGT#WUHÒJTWPIOKVGEJVIQNFGPGP#WHNCIGPUGNVGP&KG#FGNUMQPITGICVKQPYWTFGIGUVKHVGV

248


SPANIEN

9166 (1:1)

9167



-ÌPKINKEJGU -CRKVGN FGT 'JTGPMCRN·PG 5GV FGT +PUKIPKGP FGT 'JTGPMCRN·PG DGUVGJGPF CWU -NGKPQF   )QNF GOCKNNKGTV HGKPG 'OCKNNGOCNGTGK CO NCPIGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV WPF   FWTEJDTQEJGP IGCTDGKVGV #WHNCIGP )QNF GOCKNNKGTV OKV HGKPGT 'OCKNNGOCNGTGK CP 0CFGN OKV \YGK   5GKVGPJCMGPKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%GLCNXQ[)CTEKCKP/CFTKF2')7 ++  5GJT SWCNKV·VUXQNNG #PHGTVKIWPI CWU FGO NGV\VGP 8KGTVGN FGU 0GWP\GJPVGP ,CJTJWPFGTVU WPF CNU MQORNGVVGT WPF CWEJ   \WUCOOGPIGJÌTKIGT5GVXQPCNNGTITÌ­VGT5GNVGPJGKV5GVCWUFGTFGT#WMVKQP8GTUVGKIGTWPIUGNVGPG1TFGP/ÒPEJGP FGT/CTU/GTMWT)OD*WPFFGT*GTOCPP*KUVQTKECQ*)0T



5EJPCNNGOKVFTGK#WU\GKEJPWPIGP /GFCKNNGHÒTFGP'KPUCV\XQP)TC$TQP\GXGTIQNFGVWPFGOCKN NKGTVOKVMCPPGNKGTVGO$CPFTKPI -ÌPKINKEJGTWPF/KNKV·TKUEJGT1TFGPFGUJN(GTFKPCPF/QFGNN

 4GFWMVKQPFGU)QNFGPGP-TGW\GUFGTWPF-NCUUGHÒT1HHK\KGTG)QNFGOCKNNKGTVOKV MCPPGNKGTVGO $CPFTKPI   #WU\GKEJPWPIUMTGW\ HÒT )WKRÐ\EQC 'KUGP 5KNDGT )QNF CWH FGT 4ÒEMUGKVG   +PUEJTKHV#.#5(+'.'56412#;/+.0#%1%67$#PGEJVIQNFGPGT6TCIGUEJPCNNG2')7 XCT 5VÒEM44++



5GJT UEJÌPG WPF UGNVGPG #WU\GKEJPWPIUITWRRG GKPGU 1HHK\KGTU FGT 4GIKGTWPIUVTWRRGP CWU FGP GTUVGP -CTNKUVGPMTKG   IGP $GK FGP DGKFGP (GNF\WIU#WU\GKEJPWPIGP FÒTHVG GU UKEJ VTQV\ KJTGT IGTKPIGP )TÌ­G WO FKG 1TKIKPCNITÌ­G   JCPFGNPFC\CJNTGKEJG(GNF\WIUCWU\GKEJPWPIGPFGT4GUVCWTCVKQPWPFFGT4GIKGTWPI+UCDGNNCU++XQPUQNEJGTIGTKP IGT)TÌ­GYCTGP  &KG /GFCKNNG HÒT FGP 'KPUCV\ XQP )TC YWTFG CO  ,WPK  XQP FGT 4GIGPVGP-ÌPKIKPOWVVGT /CTKC %JTKUVKPC   IGUVKHVGV FCU #WU\GKEJPWPIUMTGW\ HÒT )WKRÐ\EQC CO  0QXGODGT  GDGPHCNNU XQP 4GIGPVGP-ÌPKIKPOWVVGT   /CTKC%JTKUVKPC.GV\VGTGUWPVGTUEJGKFGVUKEJXQPFGOPCJG\WKFGPVKUEJIGUVCNVGVGP#WU\GKEJPWPIUMTGW\HÒT%CUVKNNC FWTEJGKPGCPFGTG/QPCVUCPICDGCWHFGT4ÒEMUGKVG

249


SPANIEN

9168 (1:1) 9169 (1:1)



9169 (1:1)

#D\GKEJGPFGT5GPCVQTGPFGU-ÌPKITGKEJU)QNFGOCKNNKGTVGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGK QJPG6TCIGMQTFGN 44+



#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU8QPITQ­GT5GNVGPJGKV



#D\GKEJGPHÒTFKG/KVINKGFGTFGT-ÌPKINKEJGP-QOOKUUKQPHÒTFKG)GUWPFJGKV)QNFOCUUKXGOCKN NKGTVIHGKPUVG'OCKNNGOCNGTGKCPIQNFHCTDGPGT-QTFGNOKV%QWNCPV)QNFGOCKNNKGTVKOQTKIKPCNGP 8GTNGKJWPIUGVWKOKVIQNFHCTDGPGT$G\GKEJPWPI%5 44+



#D\GKEJGPXQPCNNGTITÌ­VGT5GNVGPJGKV'ZGORNCTFGT#WMVKQP8GTUVGKIGTWPIUGNVGPG1TFGP/ÒPEJGPFGT /CTU/GTMWT)OD*WPFFGT*GTOCPP*KUVQTKECQ*)0T

9170 (1:1)



#D\GKEJGPFGT0CVKQPCNGP#MCFGOKGHÒT/GFK\KP)QNFGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGKCWH FGT4ÒEMUGKVGOKVITCXKGTVGT/CVTKMGNPWOOGTQJPG-QTFGN 44+ #D\GKEJGPXQPCNNGTITÌ­VGT5GNVGPJGKV

250




SPANIEN

9172

9171 (1:1)



9171 (1:1)

#D\GKEJGP HÒT /KVINKGFGT FGT ¤HHGPVNKEJGP +PUVKVWVKQP +UCDGNNCU ++ )QNF OCUUKX GOCKNNKGTV  I  

OKV -QTFGN  HGKPUVG 'OCKNNGOCNGTGK CP IQNFHCTDGPGT -QTFGN OKV %QWNCPV 5KNDGT XGTIQNFGV KO   QTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC,QU¾(GTPCPFG\/C[QTKP/CFTKF 44+  #D\GKEJGPKPGEJV)QNFXQPCNNGTITÌ­VGT5GNVGPJGKV

52#0+5%*'456##64')+'470)810(4#0%+5%1(4#0%1   

<KXKNGT1TFGPHÒT8GTFKGPUVGWOFKG.CPFYKTVUEJCHV/QFGNN OKVUQIGPKORGTKCNGT-TQPG   $TWUVUVGTP \WO )TQ­MTGW\ &WTEJOGUUGT  OO )QNF FGT 5VGTPMÌTRGT DGUGV\V ¯ LQWT OKV   WP\·JNKIGP6WTOCNKPGPFKG#WHNCIG)QNFVGKNYGKUGHGKPUV\KUGNKGTVVGKNYGKUGGOCKNNKGTV5KNDGTDGUGV\V ¯LQWTOKV$TKNNCPVGPKPWPVGTUEJKGFNKEJGT)TÌ­G CWH'EJVJGKVIGRTÒHV \YGKTQVGP6WTOCNKPGPWPF FTGKITÒPGP6WTOCNKPGP)GUCOVIGYKEJVICP0CFGNOKV\YGK5GKVGPJCMGP2')7XCT<'+ XCT 444+  'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP 0T   #W­GTQTFGPVNKEJ   RTCEJVXQNNG #PHGTVKIWPI FGT (KTOC %GLCNXQ KP /CFTKF XQP CNNGTJÌEJUVGT 3WCNKV·V WPF DGUVGEJGPFGT 5EJÌPJGKV OKV   GKP\KICTVKIGT NWZWTKÌUGT #WUUEJOÒEMWPI WPF KP GKPGO CDUQNWV RGTHGMVGO 'TJCNVWPIU\WUVCPF 'U FÒTHVG UKEJ DGK   FKGUGO'ZGORNCTWOGKPYKTMNKEJGU7PKMCVJCPFGNP  &GTCEJVMNCUUKIG )TQ­MTGW\$CPFHÒT&COGP-QOOCPFGWTXQP0WOOGT-QOOCPFGWT1HHK\KGT4KVVGT5EJNGKHG HÒT&COGPWPF/GFCKNNG YWTFGXQP-ÌPKI#NHQPU:+++  OKV&GMTGVXQO&G\GODGT )CEGVCFG /CFTKFXQO&G\GODGT IGUVKHVGV /QFGNN FKG4GINCOGPVQUFCVKGTGPXQO(GDTWCT )CEGVCFG/CFTKF XQO  WPF  (GDTWCT  &KG <YGKVG 4GRWDNKM JCV FGP 1TFGP KO *GTDUV  CWHIGJQDGP 5VCCVUEJGH )GPGTCN   (TCPEKUEQ (TCPEQ [ $CJCOQPFG   GTPGWGTVG FGP 1TFGP OKV FGP &GMTGVGP XQO  1MVQDGT   

XGTÌHHGPVNKEJV KO $1' XQO  0QXGODGT  WPF XQO  &G\GODGT  XGTÌHHGPVNKEJV KO $1' XQO  &G\GO   DGT WPVGT8GTYGPFWPIFGTUQIGPKORGTKCNGP-TQPGFGTMCVJQNKUEJGP-ÌPKIG /QFGNN /KV8GTQTFPWPI-ÌPKI ,WCP%CTNQU +XQO/CK XGTÌHHGPVNKEJVKP$1'XQO,WPK GTJKGNVFGT1TFGPFKG-ÌPKINKEJG-TQPG\WTÒEM

/QFGNN /KV-ÌPKINKEJGO&GMTGVXQO&G\GODGT XGTÌHHGPVNKEJVKP$1'XQO(GDTWCT  YWTFGGTKPFGO1TFGPHÒT8GTFKGPUVWO.CPFYKTVUEJCHV(KUEJGTGKWPF'TP·JTWPIOKVFTGK#DVGKNWPIGPWO

251


SPANIEN

9174

9173



/CTKPG8GTFKGPUVQTFGP  /QFGNN OKV UQIGP KORGTKCNGT -TQPG    YGK­G #DVGKNWPI HÒT   8GTFKGPUV KP (TKGFGPU\GKVGP $TWUVUVGTP  -NCUUG )QNF OCUUKX WPF FWTEJDTQEJGP IGCTDGKVGV VGKNYGKUG   GOCKNNKGTV5KNDGTICP0CFGNOKV\YGK5GKVGPJCMGP2')7XCT<'+XCT 44+



'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP0T2TCEJVXQNNG#PHGTVKIWPI FGT(KTOC%GLCNXQKP/CFTKFXQPCNNGTJÌEJUVGT3WCNKV·VWPFKPGKPGOCDUQNWVRGTHGMVGO'TJCNVWPIU\WUVCPF'ZGO RNCTG KP GEJV IQNFGPGT #WUHÒJTWPI UKPF DGUQPFGTU UGNVGP  &KGUGT 5VGTP YWTFG CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG   *CNUQFGT$TWUVMTGW\GXGTNKGJGPWPFIGVTCIGP



1TFGPHÒT9QJNV·VKIMGKV/QFGNN WPF YGK­UEJYCT\G#DVGKNWPI5VGTPFGT  -NCUUG )QNF VGKNYGKUG GOCKNNKGTV 5KNDGT 'OCKNNGOCNGTGK  I CP 0CFGN OKV \YGK 5GKVGPJCMGP   \WUCOOGP OKV -PQRHNQEJOKPKCVWT )QNF VGKNYGKUG GOCKNNKGTV 5KNDGT 'OCKNNGOCNGTGK WPF \YGK   -PQRHNQEJTQUGVVGP KO 1TKIKPCNGVWK FGT (KTOC % ,QTFCPC KP /CFTKF 2')7  6#//  <'+    44+  'EJVIQNFGPG+PUKIPKGPFKGUGU1TFGPUUKPFXQPCNNGTITÌ­VGT5GNVGPJGKV'ZGORNCTCWUFGT#WMVKQP1TFGPCWUCNNGT 9GNV5COONWPI6COOCPPFGT7$5#)KP$CUGNCOWPF0QXGODGT0TFQTVH·NUEJNKEJGTYGKUG CNUXKQNGVVYGK­G#DVGKNWPIDGUEJTKGDGP

9175 9176 (1:1)



9176 (1:1)

%KUPGTQU1TFGP&COGPMTGW\OKV5EJNGKHG .C\Q 5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP'OCKNNGURTWPI CWHGKPGO-TGW\CTOFKG-WIGNPCPFGP-TGW\CTOURKV\GP¯LQWTOKVCEJV&KCOCPV4QUGP CWH'EJVJGKV IGRTÒHV DGUGV\VCPCNVGTQTKIKPCN&COGPUEJNGKHG 4++



'Z-ÒPMGT#WMVKQPCO,WPK 0T &KG&COGPMTGW\GOKV5EJNGKHGFKGUGU1TFGPUUKPFCW­GTQT FGPVNKEJUGNVGPKPUDGUQPFGTGKPFKGUGTSWCNKVCVKXUGJTJQEJYGTVKIGP#WUHÒJTWPIOKVGEJVGP5VGKPGP  &GTUGEJUMNCUUKIG -QNNCPG)TQ­MTGW\-QOOCPFGWTOKVWPFQJPG5VGTP4KVVGTWPF)QNFGPG/GFCKNNG YWTFGOKV &GMTGVXQO/·T\ XGTÌHHGPVNKEJVKP$1'XQO/·T\ XQP5VCCVUEJGH)GPGTCN(TCPEKUEQ(TCPEQ[$CJC OQPFG  IGUVKHVGVFCU4GINCOGPVQFCVKGTVXQO,CPWCT XGTÌHHGPVNKEJVKP$1'XQO,CPWCT 



1TFGP HÒT 5Q\KCNXGTFKGPUVG KO )GHCPIGPGPYGUGP /GFCKNNG KP )QNF )QNF )GUCOVIGYKEJV  I   VGKNYGKUGGOCKNNKGTVOKVHGKPUVGT'OCKNNGOCNGTGKFKG-TGW\CTOG¯LQWTOKV6ÒTMKUGPDGUGV\V-TQPG WPF$CPFTKPI¯LQWTOKV$TKNNCPVGP CWH'EJVJGKVIGRTÒHV UQYKGUGEJU4WDKPGPWPFFTGK5OCTCIFGP DGUGV\VCO$CPFOKVGEJVIQNFGPGT6TCIGURCPIG2')7XCT<'+p 444++  'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP 0T   #W­GTQTFGPVNKEJ   RTCEJVXQNNG #PHGTVKIWPI XQP CNNGTJÌEJUVGT 3WCNKV·V WPF DGUVGEJGPFGT 5EJÌPJGKV OKV GKP\KICTVKIGT NWZWTKÌUGT #WU   UEJOÒEMWPIWPFKPGKPGOCDUQNWVRGTHGMVGO'TJCNVWPIU\WUVCPF'UFÒTHVGUKEJDGKFKGUGO'ZGORNCTWOGKPYKTMNK EJGU7PKMCVJCPFGNP  )GUVKHVGV XQP -ÌPKI #NHQPU :+++ FWTEJ &GMTGV XQO  #RTKN  GTPGWGTV XQP 5VCCVUEJGH )GPGTCN (TCPEKUEQ    (TCPEQ[$CJCOQPFG  OKV&GMTGVXQO/·T\

252


SPANIEN

9179 (1:1)

9177 (1:1)

9178 (1:1)



9180 (1:1)

/KNKV·TKUEJGT 1TFGP XQP #NE±PVCTC #D\GKEJGP FGT 1TFGPUTKVVGT  Z  OO )QNF GOCKNNKGTV   IGOCKNNKGTVHGKPG'OCKNNGOCNGTGKCP&QRRGNPCFGNCWU5VCJN2')7p<'+p 4+



'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP0T5GJTSWCNKV·VUXQNNG#P HGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVUKO5VKNFGUHTÒJGP0GWP\GJPVGP,CJTJWPFGTVU&GT /KNKV·TKUEJG4KVVGTQTFGPYWTFGXQP-ÌPKI(GTFKPCPF++XQP.¾QPIGUVKHVGV



/KNKV·TKUEJGT1TFGP7PUGTGT.KGDGP(TCWXQP/QPVGUC/KPKCVWTFGU1TFGPUCD\GKEJGPU)QNFHGKPUV GOCKNNKGTVCO$·PFEJGP +



/GFCKNNG HÒT 8GTFKGPUVG WO FKG .WHVHCJTV  /QFGNN   /GFCKNNG OKV $TKNNCPVGP 5KNDGT   #WHNCIG)QNF4KPICWU$TKNNCPVGP CWH'EJVJGKVIGRTÒHV WOFCU/KVVGNOGFCKNNQPIGNGIVCO$CPFOKV 6TCIGURCPIG)GUCOVIGYKEJV OKV$CPFWPF5RCPIG IOKV\WIGJÌTKIGT4GXGTUFGMQTCVKQP5KNDGT GDGPHCNNUOKV4KPICWU$TKNNCPVGP CWH'EJVJGKVIGRTÒHV WOFCU/KVVGNOGFCKNNQPIGNGIVFGTTÒEMUGKVKIG -PQRH)QNF2')7XCT 444+ 



'ZGORNCT CWU WPUGTGT  #WMVKQP CO  ,WPK  1TFGP WPF 'JTGP\GKEJGP 0T   #W­GTQTFGPVNKEJ   RTCEJVXQNNG #PHGTVKIWPI XQP CNNGTJÌEJUVGT 3WCNKV·V WPF DGUVGEJGPFGT 5EJÌPJGKV OKV GKP\KICTVKIGT NWZWTKÌUGT #WU   UEJOÒEMWPIWPFKPGKPGOCDUQNWVRGTHGMVGO'TJCNVWPIU\WUVCPF'UFÒTHVGUKEJDGKFKGUGO'ZGORNCTWOGKPYKTMNK EJGU7PKMCVJCPFGNP'KPGOCWHFGT4ÒEMUGKVGFGU$CPFGUCWHIGMNGDVGO'VKMGVV\WHQNIGUVCOOVFKGUGUYQJNGKPOC NKIG 'JTGP\GKEJGP CWU FGO $GUKV\ XQP 4COQP (TCPEQ [ $CJCOQPFG FGO $TWFGT FGU URCPKUEJGP 5VCCVEJGHU (TCP   EKUEQ(TCPEQ[$CJCOQPFGFGTGUHÒTGKPGªDGTSWGTWPIFGU#VNCPVKMUOKVFGO(NWI\GWIGTJCNVGPJCV  &KG /GFCKNNG YWTFG XQP -ÌPKI #NHQPU :+++   OKV -ÌPKINKEJGO &GMTGV XQO  #RTKN  IGUVKHVGV  

/QFGNN FCU4GINCOGPVQFCVKGTVXQO#RTKN XGTÌHHGPVNKEJVKPFGT)CEGVCFG/CFTKFXQO#RTKN /KV 4WPF8GTQTFPWPI XQO  0QXGODGT  YWTFG FKG /GFCKNNG OKV TGRWDNKMCPKUEJGP 5[ODQNGP XQP FGT <YGKVGP   4GRWDNKM ÒDGTPQOOGP  /QFGNN  /KV &GMTGV XQO  0QXGODGT  GTPGWGTVG 5VCCVUEJGH )GPGTCN (TCPEKUEQ   (TCPEQ [ $CJCOQPFG   FKG /GFCKNNG  /QFGNN  WPF -ÌPKI ,WCP %CTNQU + DGUV·VKIVG UKG UEJNKG­NKEJ   YKGFGTOKVMÌPKINKEJGP5[ODQNGPOKV&GMTGVXQO/·T\ XGTÌHHGPVNKEJVKP$1'0TXQO/CK 



'JTGP\GKEJGP FGT +PFWUVTKG WPF *CPFGNUMCOOGT XQP %QTFQDC )TQ­GU )QNFGPGU 'JTGP\GKEJGP   )QNF\KUGNKGTVVGKNYGKUGGOCKNNKGTVICP6TCIGMQTFGN ++



'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP0T

253


SPANIEN

9181



'JTGP\GKEJGP FGU /CIKUVTCVU FGT 5VCFV 4GWU 'JTGP\GKEJGP KP )QNF )QNF  Z  OO   )GUCOVIGYKEJV  I VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG 9KFOWPIUITCXWT #. ':%/1 54   &10'04+37'(106#0#%1&+0#/KPKUVTQFG%QOGTEKQ4'75CP0CFGN +



'ZGORNCTCWUWPUGTGT#WMVKQPCO,WPK1TFGPWPF'JTGP\GKEJGP0T.WZWTKÌUCWUIGUVCVVGVG MQOOWPCNG #WU\GKEJPWPI CWU FGO $GUKV\ GKPGU -CDKPGVVU/KVINKGFU FGT 'PF\GKV FGT 4GIKGTWPI (TCPEKUEQ (TCPEQU   'UFÒTHVGUKEJDGKFKGUGO'ZGORNCTUEJQPCWHITWPFFGUJQJGP/CVGTKCNYGTVGUWOGKP7PKMCVJCPFGNP

9182 (1:1)

9182 (1:1)

9182 (1:1)

5'%*56'5 -¤0+)4'+%* 5'+6  

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN CWHFGT4ÒEMUGKVGFGU-NGKPQFU/QPQ ITCOO(A;$TWUVUVGTPOKV-ÌPKIMTQPGÒDGTFGO/GFCKNNQPUGKV )TQ­MTGW\5GVDGUVGJGPF CWU-NGKPQF)QNFOCUUKXVGKNYGKUGGOCKNNKGTVFKG-TGW\CTOGWPFFGT.QTDGGTMTCP\¯LQWTOKV5VGKPGP DGUGV\V  I OKV QTKIKPCNGO 5EJWNVGTDCPF WPF $TWUVUVGTP )QNF OCUUKX VGKNYGKUG DTKNNCPVKGTV   VGKNYGKUGGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKFKG-TGW\CTOGWPFFKG-TGW\CTOMWIGNP¯LQWTOKV5VGKPGP DGUGV\VIOKV0CFGNWPF\YGK5GKVGPJCMGP2')7p<'+p 444+  'TNGUGPGT5GVXQPJGTXQTTCIGPFGT#PHGTVKIWPIUSWCNKV·VWPFKPOCUUKX)QNFOKV5VGKPGPXQPCNNGTITÌ­VGT5GNVGPJGKV

254


SPANIEN

9183

9184



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN UGKV $TWUVUVGTP\WO)TQ­MTGW\ )QNF OCUUKX VGKNYGKUG DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG GOCKNNKGTV HGKPUVG 'OCKNNGOCNGTGK CP \YGK   5VGNNGPMCWOUKEJVDCTG'OCKNNGTGRCTCVWTGPGKPG-TGW\URKV\GTGRCTKGTVYGKVGTGMCWOUKEJVDCTG.ÌVUVGNNG FKG-TQPGÒDGTFGO/GFCKNNQPHGJNVICP0CFGNOKV\YGK5GKVGPJCMGP2')7p<'+p 4++p+++ 



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN UGKV $TWUVUVGTP\WO)TQ­MTGW\ )QNFOCUUKXVGKNYGKUGDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGGOCKNNKGTVHGKPUVG'OCKNNGOCNGTGKICP 0CFGNFKGUGOKV-NGGDNCVVRWP\GOKV\YGK5GKVGPJCMGP2')7p<'+p ++ 

9185

9186

&4+66'5 -¤0+)4'+%*4')+'470)+5#$'..#5++   

-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV JQJN IGHGTVKIV GOCKNNKGTV OKP #DRNCV\WPIGP KP FGT ITÒPGP   'OCKNNGCO*CNUDCPF2')7XCT<'+ ++



'UJCPFGNVUKEJJKGTDGKOÌINKEJGTYGKUGWOGKPGHTCP\ÌUKUEJG#PHGTVKIWPICWUFGT<GKVPCEJ



-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT     1TFGP+UCDGNNCUFGT-CVJQNKUEJGP UGKV /QFGNN OKV/QPQITCOO,4  -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV JQJN IGHGTVKIV FKG ITÒPG 'OCKNNG FGU .QTDGGTMTCP\GU HCUV   XQNNUV·PFKICDIGRNCV\V2')7XCT<'+ ++p+++



'UJCPFGNVUKEJJKGTDGKOÌINKEJGTYGKUGWOGKPGHTCP\ÌUKUEJG#PHGTVKIWPICWUFGT<GKVPCEJ

255


SPANIEN

(ª0(6'5 -¤0+)4'+%*   

-ÌPKINKEJGT WPF 8GTFKGPUVXQNNGT 5RCPKUEJGT 1TFGP -CTNU +++   D\Y -ÌPKINKEJGT WPF  

DKU   8GTFKGPUVXQNNGT 1TFGP -CTNU +++  WPF UGKV   1TKIKPCNGU CNVGU   MQPHGMVKQPKGTVGU5EJWNVGTDCPF\WO)TQ­MTGW\ ++



-ÌPKINKEJGT 1TFGP FGT 'FNGP &COGP FGT -ÌPKIKP /CTKC .WKUC 1TKIKPCNGU CNVGU \GKVIGPÌUUKUEJGU   5EJWNVGTDCPFFGT1TFGPUFCOGP ++



#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVU



9189



9190

/KNKV·T8GTFKGPUVQTFGP/QFGNN OKV$QWTDQPGPYCRRGPKO<GPVTWO YGK­G#DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP 5VGTP \WO )TQ­MTGW\ 5KNDGTDTKNNCPVKGTVWPFFWTEJDTQEJGPIGCTDGKVGV VGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC/GFKPCKP $CTEGNQPCCP0CFGNOKV\YGK5GKVGPJCMGP2')7<'+ ++



/CTKPG8GTFKGPUVQTFGP  /QFGNN   YGK­G #DVGKNWPI HÒT 8GTFKGPUV KP (TKGFGPU\GKVGP   $TWUVUVGTP-NCUUG5KNDGTDTKNNCPVKGTVWPFXGTIQNFGVVGKNYGKUGGOCKNNKGTVCP0CFGNOKV\YGK5GKVGPJC MGP2')7<'+ +



&GT$TWUVUVGTP\WO)TQ­MTGW\WPFFGT5VGTPFGT-NCUUGWPVGTUEJGKFGPUKEJPWTFWTEJFKG(CTDGFGU/GVCNNRN·VV EJGPUCWHFGOQDGTGP-TGW\CTOFCUDGKOGTUVGTGPUKNDGTHCTDGP  WPFDGKONGV\VGTGPIQNFHCTDGP  KUV



9191



9192

'JTGP\GKEJGPXQO4QVGP-TGW\<YGKVGU/QFGNN  /GFCKNNG-NCUUG CD &WTEJ OGUUGTOO  $TQP\GXGTIQNFGVVGKNYGKUGGOCKNNKGTVQJPG*CNUDCPF2')7XCT<'+ XCT 4++



'JTGP\GKEJGPXQO4QVGP-TGW\<YGKVGU/QFGNN  /GFCKNNG-NCUUG CD $TQP\G XGTIQNFGVVGKNYGKUGGOCKNNKGTV%JKRKPFGTYGK­GP'OCKNNGQJPG*CNUDCPF2')7XCT<'+ XCT ++p



$GUQPFGTUITQ­G#WUHÒJTWPIOKVIQNFHCTDGPGO-TGW\ UVCVVOKVGKPGOTQVGOCKNNKGTVGP 



256


SPANIEN

9193 (1:1)

9195 9197

9199

9198

9196

9200

9201



-ÌPKINKEJG /GKUVGTGK FGT 4KVVGTUEJCHV XQP 4QPFC /KPKCVWT FGU $TWUVUVGTPU 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCP6TCIGMPQRH 4++





.GGTGUIQNFGPDGFTWEMVGU.GFGTGVWKHÒTGKP*CNUMTGW\OKVªDGTJÌJWPI$GUEJ·FKIVXQP%GLCNXQ )CTEKCKP/CFTKF ++p+++





/GFCKNNG HÒT 1RHGTDGTGKVUEJCHV WPF *GNFGPVWO HÒT .GDGPUTGVVWPI  FGT 5RCPKUEJGP )GUGNNUEJCHV   \WT4GVVWPI5EJKHHDTÒEJKIGT5KNDGTOKV5VGORGNUEJPGKFGTUKIPCVWT$/#74#+08 '010';; )4#$1OKVCNVGO$QIGPDCPF 4++



'JTGP\GKEJGPHÒT-QTTGURQPFKGTGPFG/KVINKGFGTFGT-ÌPKINKEJ5RCPKUEJGP#MCFGOKG5KNDGTXGTIQN FGVOGJTVGKNKIIGHGTVKIVCPQTKIKPCNGT6TCIGMQTFGNOKV%QWNCPV5KNDGTXGTIQNFGVKOQTKIKPCNGP8GTNGK JWPIUGVWKFGT(KTOC,QU¾(GTPCPFG\/C[QTKP/CFTKF ++





<9'+6' 4'27$.+-   

<KXKNGT#HTKMC1TFGP/QFGNN OKV/CWGTMTQPG $TWUVUVGTP\WO)TQ­MTGW\5KNDGTFWTEJ DTQEJGPIGCTDGKVGVXGTIQNFGVVGKNYGKUGGOCKNNKGTVOKPQDGTHN·EJNKEJG'OCKNNGEJKRUKPGKPGO$NCVVCWH FGT4ÒEMUGKVG9KFOWPIUITCXWT#572#+0+61/#47%*+CP0CFGNOKV\YGK5GKVGPJCMGP 44++



#NNGKP+PUKIPKGPFGUGTUVGP/QFGNNUUKPFXQPITQ­GT5GNVGPJGKV



'JTGP\GKEJGPXQO4QVGP-TGW\/QFGNN OKV/CWGTMTQPG /GFCKNNG-NCUUG5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP $CPF OKV 6TCIGURCPIG UEJYGFKUEJGT #TV 2')7    <'+ ++



52#0+5%*'456##64')+'470)810(4#0%+5%1(4#0%1   





-ÌPKINKEJ #OGTKMCPKUEJGT 1TFGP +UCDGNNCU FGT -CVJQNKUEJGP   D\Y -ÌPKINKEJGT      1TFGP +UCDGNNCU FGT -CVJQNKUEJGP UGKV    /QFGNN CWH FGT 4ÒEMUGKVG IGMTÌPVGU /QPQ   ITCOO(A; -NGKPQF\WO)TQ­MTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV'OCKNNGOCNGTGKCO QTKIKPCNGP5EJWNVGTDCPF QJPG$TWUVUVGTP KOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC%CLCNXQKP/CFTKF OKV /GVCNNYCRRGP OKV $GINGKV\GVVGN FGU #WUY·TVKIGP #OVGU KP $QPP XQO  $74-'   5HH1#0581.2'5<'+2')7<'+ +



-ÌPKINKEJG-QTRQTCVKQPFGT*KLQUFCNIQ4KVVGTFGU#FGNUXQP/CFTKF&GMQTCVKQPFGT4KVVGT5KNDGT XGTIQNFGV GOCKNNKGTV HGKPG 'OCKNNGOCNGTGK CO CNVGP GVYCU CWUIGDNKEJGPGP $CPF OKV 6TCIGURCPIG   2')7 +p++



'JTGP\GKEJGP HÒT 8GTYWPFGVG  8GTUKNDGTV VNY XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV   6TCIGURCPIG2')7 ++

 257


SPANIEN

9206

9205 (1:2)

9204 (1:2)

9202



9203

-TGW\ HÒT FKG (TGKYKNNKIGP XQP %KWFCF 4GCN KP FGT $NCWGP &KXKUKQP $TQP\G CO $CPF OKV 6TCIG   URCPIG2')7 ++



-#6#.10+'0 

/GFCKNNG%#6#.70;#)7+/'4#/#+)$TQP\GOGFCKNNGPKEJVVTCIDCT&WTEJOGUUGTOO $TQP\GCWHFGT4ÒEMUGKVG5VGORGNUEJPGKFGTUKIPCVWTXQP8CNGPVKCPC$CTPCKO'VWK ++



52#0+'0-+4%*.+%*'-#2+6'.570& $47&'45%*#(65&'-14#6+10'070&#75<'+%*070)'0 

-ÌPKINKEJG $TWFGTUEJCHV FGT 2KNIGT \WO JN ,CMQDWU XQP %QORQUVGNNC $TWFGTUEJCHVUMTGW\ HÒT FGP   /CPVGNZOO5KNDGTIGJ·OOGTVWPFITCXKGTV 4++



#PHGTVKIWPICWUFGO0GWP\GJPVGP,CJTJWPFGTV



-ÌPKINKEJG $TWFGTUEJCHV FGT 2KNIGT \WO JN ,CMQDWU XQP %QORQUVGNNC $TWFGTUEJCHVUMTGW\ HÒT FGP   /CPVGNZOO/GUUKPIXGTUKNDGTVWPFITCXKGTVFKG/WUEJGNGVYCUGKPIGFTÒEMV 4++



#PHGTVKIWPICWUFGO0GWP\GJPVGP,CJTJWPFGTV



258

7PDGMCPPVGU $TWFGTUEJCHVUMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV QJPG *CNUDCPF \WUCOOGP OKV   /KPKCVWTG$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGP ++




TSCHECHOSLOWAKEI

9207 (1:1)

65%*'%*15.19#-'+

'456' 65%*'%*15.19#-+5%*'4'27$.+-   

6UEJGEJQUNQYCMKUEJGT1TFGPXQO9GK­GP.ÌYGP/QFGNN  )TQ­MTGW\UGVHÒT<KXKNXGT FKGPUVDGUVGJGPFCWU-NGKPQFZOO5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVKO6TCIGTKPI OGJTHCEJ RWP\KGTV QJPG 5EJWNVGTDCPF WPF $TWUVUVGTP &WTEJOGUUGT  OO 5KNDGT VGKNYGKUG   GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC -CTPGV -[UGN[ KP2TCICP0CFGNFKGUG RWP\KGTVOKV\YGK5GKVGPJCMGP$#491<'+ 5VÒEM++  <WT )GUEJKEJVG FGU 1TFGPU XIN -NKGVOCPP -WTV) 6UEJGEJQUNQYCMGK  6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK   ­GP.ÌYGP+P1TFGPU.GZKMQP$CPF$GTNKPQ,

259


TSCHECHOSLOWAKEI

9208 9211 9210

9209



6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   $TWUVUVGTP \WO   )TQ­MTGW\&WTEJOGUUGTOO5KNDGTVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI FGT(KTOC-CTPGV-[UGN[KP2TCICP0CFGNFKGUGOGJTHCEJRWP\KGTVWCOKV--HÒTFGP*GTUVGNNGT WPFGT5KNDGTRWP\GOKV\YGK5GKVGPJCMGP$#491<'+ ++





6UEJGEJQUNQYCMKUEJGT1TFGPXQO9GK­GP.ÌYGP/QFGNN  )TQ­MTGW\UGVHÒT/KNKV·T XGTFKGPUV DGUVGJGPF CWU -NGKPQF  Z  OO 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV KO   6TCIGTKPI OGJTHCEJ RWP\KGTV CO QTKIKPCNGO \GKVIGPÌUUKUEJGP 5EJWNVGTDCPF WPF $TWUVUVGTP   &WTEJOGUUGTOO5KNDGTVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC -CTPGV-[UGN[KP2TCICP0CFGNFKGUGRWP\KGTVOKV\YGK5GKVGPJCMGP$#491<'+  5VÒEM++ 



6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   -QOOCPFGWTFGMQTCVKQP   HÒT <KXKNXGTFKGPUV  Z  OO 5KNDGT XGTIQNFGV WPF GOCKNNKGTV FKG 8QTFGTUGKVG WPF 6GKNG FGT   4ÒEMUGKVG PGW GOCKNNKGTV KO 6TCIGTKPI OGJTHCEJ RWP\KGTV W C -- HÒT FGP *GTUVGNNGT -CTPGV WPF   -[UGN[WPFGT5KNDGTRWP\GCOPGWGP*CNUDCPFCDUEJPKVV$#491<'+ ++ +++



6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   -QOOCPFGWTFGMQTCVKQP   HÒT/KNKV·TXGTFKGPUVZOO5KNDGTXGTIQNFGVWPFGOCKNNKGTVQJPG*CNUDCPFTKPICOQTKIKPCNGP \GKVIGPÌUUKUEJGPLGFQEJPKEJV\WFKGUGT-NCUUGIGJÌTGPFGO5EJWNVGTDCPF$#491<'+ ++





260


TSCHECHOSLOWAKEI

9214 9212







6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   1HHK\KGTUFGMQTCVKQP HÒT   <KXKNXGTFKGPUV5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVGKO QTKIKPCNGPUKNDGTPDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC-CTPGV-[UGNÓKP2TCI$#491<'+  +p++



6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   1HHK\KGTUFGMQTCVKQP HÒT   /KNKV·TXGTFKGPUV 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV OKP QDGTHN·EJNKEJGT 'OCKNNGEJKR CWH FGT   4ÒEMUGKVG FGU QDGTGP #TOU CO QTKIKPCNGP $CPF OKV CWHIGNGIVGT 4QUGVVG $#491  <'+    ++



6UEJGEJQUNQYCMKUEJGT 1TFGP XQO 9GK­GP .ÌYGP  /QFGNN   5KNDGTPG /GFCKNNG HÒT   <KXKNXGTFKGPUV5KNDGTKO6TCIGTKPIRWP\KGTVCOQTKIKPCNGP$CPF$#491<'+ +p++



9215



9213

ex 9216

9217

5QMQN (CNMGP 1TFGP/QFGNN  1TFGPUFGMQTCVKQPOKV5EJYGTVGTP#WUICDG   $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP \GKVIGPÌUUKUEJGP $CPF KO 1TKIKPCNGVWK XQP -CTPGV    -[UGNÓKP2TCI$#491<'+ +p++



&GTHTÒJGVUEJGEJQUNQYCMKUEJG1TFGPYWTFGXQO-TKGIUOKPKUVGTKORTQXKUQTKUEJGPVUEJGEJQUNQYCMKUEJGP0CVKQPCN TCV KP 2CTKU &T /KNCP ĥVGRCPKM GKPGO #UVTQPQOGP FGT KP (TCPMTGKEJ \WO (NKGIGTIGPGTCN CWHIGUVKGIGP YCT   GPVYQTHGPKP6QMKQJGTIGUVGNNVWPFUGKV0QXGODGTXQPFKGUGOCPFKGVUEJGUNQYCMKUEJGP.GIKQP·TGKP5KDKTKGP XGTNKGJGP &KG 5VCVWVGP HQNIVGP  FWTEJ FGP 0CVKQPCNTCV 5KG UCJGP HÒPH -NCUUGP XQT VCVU·EJNKEJ MCO CDGT PWT   GKPG-NCUUGOKVWPFQJPG5EJYGTVGT\WT#WUHÒJTWPI/GTKEMCWPVGTUEJGKFGVFTGKXGTUEJKGFGPG#WUICDGPFKGGTUVG KP6QMKQJGTIGUVGNNVG#WUICDGOKVFWPMGNDNCWGO'OCKNFKG\YGKVGXQP-CTPGV-[UGNÓKP2TCIJGTIG UVGNNVG#WUICDGOKVOKVVGNDNCWGO'OCKNWPFFKGFTKVVGXQP-CTPGV-[UGNÓKP2TCIJGTIGUVGNNVG#WUICDGOKV JGNNDNCWGO 'OCKN 8IN /GTKEMC 8±ENCX &GT 6GUEJQUNQYCMKUEJG(CNMGP1TFGP+P1TFGPUMWPFG0T$GTNKP &GTU.GURTGOKGTU1TFTGUGV&¾EQTCVKQPU/KNKVCKTGUFG6EJ¾EQENQXCSWKG+P5QEK¾V¾5WKUUGFG2JCN¾TKUVKSWG $WNNGVKP  5 



+PVGTCNNKKGTVG 5KGIGUOGFCKNNG  1HHK\KGNNG #WUICDG $TQP\G OKV 5VGORGNUEJPGKFGTUKIPCVWT   152#0+'. OKV 1NKXGPÌUG &C\W GKP YGKVGTGU 'ZGORNCT $TQP\G QJPG 5VGORGNUEJPGKFGT OKV   -WIGNÌUG$GKFGCP$·PFGTP 5VÒEM++



65%*'%*15.19#-+5%*'81.-54'27$.+-   

6UEJGEJQUNQYCMKUEJGT /KNKV·TQTFGP (ÒT FKG (TGKJGKV $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV CP   5EJTCWDGOKV5EJTCWDUEJGKDG<'+ 4++

 261


UNGARN

ex 9219

9218

65%*'%*15.19#-+5%*'51<+#.+56+5%*'4'27$.+-   

1TFGP XQO 5KGITGKEJGP (GDTWCT $TQP\G XGTIQNFGV VGKNYGKUG DGTKGDGP  CO QTKIKPCNGP $CPF <'+    ++



-QPXQNWV XQP  #WU\GKEJPWPIGP XQTYKGIGPF FGT %554 8GTUEJKGFGPG /CVGTKCNKGP CWEJ 5KNDGT    GKPKIGVGKNYGKUGGOCKNNKGTVQFGTNCEMKGTVXQTYKGIGPFCP$·PFGTPGKPKIGCP6TCIGURCPIGPKPXQTYKGIGPF IWVGT'TJCNVWPIGKPGLGFQEJDGUEJ·FKIV 5VÒEM+++8 -QPXQNWVXQP#WU\GKEJPWPIGPFGT6UEJGEJQUNQYCMGK+PXGTUEJKGFGPGP/GVCNNGPVGKNUXGTUKNDGTV CP$·PFGTP 5VÒEM++



  

9221

70)#40 -¤0+)4'+%* 

-ÌPKINKEJ7PICTKUEJGT5V5VGRJCPU1TFGP1TFGPUUVGTPKPFGTWTURTÒPINKEJGPUVCVWVGPIGO·­GP#WU HÒJTWPIOKVCEJV(NCOOGP\WPIGP\YKUEJGPFGPDTKNNCPVKGTVGP5VTCJNGPDÒPFGNP&WTEJOGUUGTOO &KG5VTCJNGPDÒPFGN5VCJNFCTCWHFKG$TKNNCPVKGTWPIMÌTRGTGKP\GNPOKVVGNU0KGVGPDGHGUVKIV GKPKIGHGJNGP  FKG (NCOOGP\WPIGP OGJTVGKNKI IGHGTVKIV  KO 4CPF OKV GKP\GNPGP MNGKPGP IGUEJNKHHGPGP /CTMCUKVGP DG   UGV\V 5VTCJNGPDÒPFGN WPF 5VTCJNGP OKVVGNU 5EJCTPKGTGP CP GKPGT \GJPGEMKIGP 5VCJNRNCVVG DGHGUVKIV &CU   /GFCKNNQP DGUVGJV CWU GKPGO TQVGP )NCUMÌTRGT WOIGDGP XQP GKPGO -TCP\ IGUEJNKHHGPGT IGNDGT   /CTMCUKVGWPFGKPGOGOCKNNKGTVGP \CJNTGKEJGCNVG'OCKNNGCDRNCV\WPIGP -TCP\XQP'KEJGPDN·VVGTP#WH FGO )NCUMÌTRGT KUV FGT $GTI CWU )QNF WPF ITÒP GOCKNNKGTV -TQPG WPF $WEJUVCDGP GDGPHCNNU CWU )QNF   WPFOKVIGNDGP/CTMCUKVGPDGUGV\VWPFFCU2CVTKCTEJGPMTGW\CWU5KNDGTOKVYGK­GP/CTMCUKVGPDGUGV\V &CU /GFCKNNQP KUV NQEMGT OKV FGT 7PVGTNCIG XGTDWPFGP WPF FTGJDCT #WH FGT 4ÒEMUGKVG DGHKPFGP UKEJ   -QTTQUKQPUURWTGP 444++p+++  $GFGWVGPFG·W­GTUVFGVCKNNKGTVGWPFSWCNKV·VUXQNNG#PHGTVKIWPICWUFGT\YGKVGP*·NHVGFGU#EJV\GJPVGP,CJTJWPFGTVU CWHITWPFFGT)TÌ­GYQJNWTURTÒPINKEJ\WGKPGO)TQ­MTGW\)GYCPFIGJÌTKIDGKFGOFGT5VGTPXQTPGCWHFGT$TWUV CWHIGUGV\VYCT

262


UNGARN

9224

9223 9222



-ÌPKINKEJ7PICTKUEJGT5V5VGRJCPU1TFGP5COONGTCPHGTVKIWPIFGU-QOVWTMTGW\GU5KNDGTXGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG OKP 'OCKNNGEJKR KO /GFCKNNQPTKPI #WHJ·PIWPI TGUVCWTKGTV QJPG   *CNUDCPF ++p



5GJT SWCNKV·VUXQNNG #PHGTVKIWPI FGT (KTOC 4QVJG KP 9KGP CWU FGP GT ,CJTGP *GTXQTTCIGPFGU 'TUCV\GZGORNCT   HÒTGKPPWT·W­GTUVUEJYGTGTJ·NVNKEJGU\GKVIGPÌUUKUEJGU1TKIKPCNGZGORNCTKPGEJV)QNF



-ÌPKINKEJ7PICTKUEJGT5V5VGRJCPU1TFGP5COONGTCPHGTVKIWPIFGU4KVVGTMTGW\GUKPFGT#WUHÒJTWPI OKVGKPUGKVKICWUIGHÒJTVGT-ÌPKIUMTQPGWPFUEJYCT\GT8QTFGTUGKVGP/GFCKNNQPKPUEJTKHV)QNFGOCKNNKGTV CO$CPF +



5GJT HGKPG WPF JQEJYGTVKIG #PHGTVKIWPI CWU FGT \YGKVGP *·NHVG FGU <YCP\KIUVGP ,CJTJWPFGTVU FGT KO 1TKIKPCN PWT   DKUECXGTNKGJGPGP#WUHÒJTWPI

6+67.#4 -¤0+)4'+%*   

8GTFKGPUVQTFGP 1HHK\KGTUMTGW\ OKV 5EJYGTVGTP WPF -TKGIUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTV CP0CFGN<'+ ++

9225



9226

70)#4+5%*'81.-54'27$.+-   

8GTFKGPUVQTFGPFGT7PICTKUEJGP8QNMUTGRWDNKM&GMQTCVKQP-NCUUG $TWUVUVGTP $TQP\GXGTIQNFGV VGKNYGKUGGOCKNNKGTVCP0CFGN<'+ ++





8GTFKGPUVQTFGPFGT7PICTKUEJGP8QNMUTGRWDNKM&GMQTCVKQP-NCUUG $TWUVUVGTP $TQP\GXGTIQNFGV VGKNYGKUGGOCKNNKGTV'OCKNNGTGRCTCVWTKPFGTQDGTGP5VGTPURKV\GCP0CFGN<'+ ++p+++

 263


VATIKAN

9227

9228

9228

8#6+-#0-+4%*'056##6*'+.+)'4567*. 

2KWU1TFGP'KPUGKVKIG#WUHÒJTWPIFGT&GMQTCVKQPGP5GV\WO-QOOCPFGWTOKV5VGTPDGUVGJGPFCWU -QOOCPFGWTUFGMQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC6CPHCPKWPF$GTVCTGNNKKP4QOWPF5KNDGT\GKEJGP#CO*CNUDCPFCDUEJPKVVWPF$TWUVUVGTP5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI   FGT(KTOC6CPHCPKWPF$GTVCTGNNKWPF5KNDGT\GKEJGP#CP0CFGN<'+ 5VÒEM++



2KWU1TFGP 'KPUGKVKIG #WUHÒJTWPI FGT &GMQTCVKQPGP 4KVVGTFGMQTCVKQP UVCTM IGYÌNDVG #WUHÒJTWPI   )QNF OCUUKX GOCKNNKGTV  I OKP 'OCKNNGCDRNCV\WPIGP KO /GFCKNNQPTKPI WPF ITÌ­VG   'OCKNNGCDRNCV\WPICWHFGOQDGTGP5VTCJNOKVMCPPGNKGTVGO$CPFTKPIQJPG$CPF<'+ 4++p+++



5EJÌPG#PHGTVKIWPICWUFGOGTUVGP&TKVVGNFGU<YCP\KIUVGP,CJTJWPFGTVU&GT1TFGPYWTFGCO,WPKXQP 2CRUV 2KWU +: CNU FTGKMNCUUKIGT YQDGK FKG \YGKVG -NCUUG KP \YGK )TCFG WPVGTVGKNV KUV  1TFGP IGUVKHVGV $KU KP FCU   2QPVKHKMCV2CRUV.GQU:+++ TGIDKU YCTGTFGTJÌEJUVGR·RUVNKEJG1TFGP2CRUV2KWU:TGQTICPKUKGTVG FGP1TFGPCO(GDTWCTWPF2CRUV2KWU:++UVKHVGVGCO&G\GODGTFKG-QNNCPGFGTGP+PUKIPKGPGKPG CPFGTG+PUEJTKHVJCDGPWPFFKG5VCCVUQDGTJ·WRVGTPXQTDGJCNVGPKUV8QPFGT5VKHVWPIDKUYWTFGPNCWV*GTMPGT -QNNCPGP XGTNKGJGP 'TUV UGKV YGPKIGP ,CJTGP MÌPPGP FGP 1TFGP CWEJ (TCWGP GTJCNVGP =8IN CWEJ *GTMPGT   0QTDGTV &GT 2KWU1TFGP UGKPG )QNFGPG -QNNCPG WPF KJTG 6T·IGT +P 1TFGP WPF 'JTGP\GKEJGP *GHV      5HHWPF*GHV  5HH?



'ZGORNCTCWUFGT5VKHVWPIU\GKV

9230 9229



2KWU1TFGP 'KPUGKVKIG #WUHÒJTWPI FGT &GMQTCVKQPGP 4KVVGTFGMQTCVKQP )QNF JQJN IGCTDGKVGV   GOCKNNKGTV  I \CJNTGKEJG 5EJ·FGP KP FGT DNCWGP 'OCKNNG OKV MCPPGNKGTVGO $CPFTKPI CO UR·VGTGP   LGFQEJ·NVGTGP$CPF<'+ +++



#PHGTVKIWPICWUFGO<YGKVGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



264

1TFGPFGUJN)TGIQTUFGU)TQ­GP<YGKVG#WUHÒJTWPI OKVGOCKNNKGTVGP4ÒEMUGKVGPFGT-TGW\CTOG UGKV EC   )TQ­MTGW\UGV HÒT <KXKNXGTFKGPUV DGUVGJGPF CWU -NGKPQF )QNF GOCKNNKGTV OKP MCWO   UKEJVDCTG %JKRU KP FGT ITÒPGP 'OCKNNG FGU .QTDGGTMTCP\GU CO CNVGP LGFQEJ GVYCU UR·VGTGP   5EJWNVGTDCPF WPF $TWUVUVGTP &WTEJOGUUGT  OO   5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP   )QNFGOCKNNKGTVGKPG5VTCJNGPURKV\GGVYCUXGTDQIGPCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC $QWNNCPIGT KP 2CTKU  4 FG NC 2CKZ  CP 0CFGN FKGUG GVYCU XGTDQIGP OKV \YGK 5GKVGPJCMGP <'+    5VÒEM++




VATIKAN 'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T &CXQTGZ#WMVKQP%JTKUVKG UKP4QOXQO&G\GODGT  &GT 5GV UVCOOV CWU FGO $GUKV\ XQP &QP %COKNNQ %CTNQ /CUUKOQ  (ÒTUV XQP #TUQNK   )GPGTCN   5WRGTKPVGPFGPVFGT2·RUVNKEJGP2QUVWPFCOKVKGTGPFGT)GJGKOGT-COOGTJGTTFGU2CRUVGUFK5RCFCG%CRRC5GJT UEJÌPGT 5GV XQP JQJGT #PHGTVKIWPIUSWCNKV·V #WHITWPF FGT *GTUVGNNGTCPICDG CWH FGT 4ÒEMUGKVG FGU $TWUVUVGTPU N·­V   UKEJ UGKPG #PHGTVKIWPIU\GKV \YKUEJGP  WPF  DGITGP\GP  8QP 2CRUV )TGIQT :8+   CO   5GRVGODGT  CNU \WP·EJUV XKGTMNCUUKIGT )TQ­MTGW\  WPF  -NCUUG ņ NGV\VGTG  YKGFGT CDIGUEJCHHV     -QOOCPFGWTWPF4KVVGT CDFTGKMNCUUKIGTCNNIGOGKPGT\KXKNGTWPFOKNKV·TKUEJGT8GTFKGPUVQTFGPIGUVKHVGVYWTFG GT\WP·EJUVCPVTGWG$ÒTIGTWPFCPÌUVGTTGKEJKUEJG6TWRRGPHÒTKJTG7PVGTUVÒV\WPIFGTYGNVNKEJGP/CEJVFGU*GKNKIGP 5VWJNU KO -KTEJGPUVCCV Y·JTGPF FGT 7PTWJGP XQP  XGTNKGJGP 'T XGTHÒIV DKU JGWVG ÒDGT GKPG \KXKNG WPF GKPG   OKNKV·TKUEJG #DVGKNWPI YQDGK NGV\VGTG KP LÒPIGTGT <GKV YQJN UGKV FGT #WHNÌUWPI FGT R·RUVNKEJGP OKNKV·TKUEJGP   'KPJGKVGP ņ DKU CWH FKG 2·RUVNKEJG 5EJYGK\GTICTFG  FWTEJ 2CRUV 2CWN 8+   KO ,CJT   PKEJV OGJT   XGTNKGJGP YQTFGP KUV <YKUEJGP EC  WPF  YWTFG GKPIGHÒJTV FC­ FGT -QOOCPFGWT CWEJ OKV $TWUVUVGTP   XGTNKGJGP YGTFGP MQPPVG YCU FKGUG -NCUUG HCMVKUEJ KP \YGK )TCFG WPVGTVGKNVG WPF FGT 1TFGPU UQOKV YKGFGT   XKGTMNCUUKI YWTFG  TGQTICPKUKGTVG 2CRUV 2KWU :   FGP 1TFGP FGT JGWVG HÒT DGYKGUGPG   WPGTUEJÒVVGTNKEJG 6TGWG WPF 'KHGT KO &KGPUV FGU *GKNKIGP 5VWJNU XGTNKGJGP YKTF /KV *CPFUEJTGKDGP XQO  ,WNK   XGTHÒIVG2CRUV,QJCPPGU2CWN++  FC­FGT1TFGPHQTVCPKPCNNGP-NCUUGPCWEJCP(TCWGPXGTNKGJGP YGTFGPMCPP

9232

9231 9231



1TFGPFGUJN)TGIQTUFGU)TQ­GP#WUHÒJTWPI OKVGOCKNNKGTVGP4ÒEMUGKVGPFGT-TGW\CTOGUGKV EC   )TQ­MTGW\UGV HÒT <KXKNXGTFKGPUV DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   OGJTGTG4KUUGKPFGTTQVGP'OCKNNGCWHFGT4ÒEMUGKVG'OCKNNGEJKRCWHFGOWPVGTGP-TGW\CTOCWHFGT 4ÒEMUGKVGFGU.QTDGGTMTCP\GURWP\KGTV#WPFQJPG5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUG XGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC6CPHCPKWPF$GTVCTGNNKCP 0CFGN KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC 6CPHCPK WPF $GTVCTGNNK KP 4QO OKV IQNFIGFTWEMVGO   9CRRGP2CRUV2KWU:++ TGI <'+ 5VÒEM++p+++++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T #PHGTVKIWPICWUFGPGT,CJTGP



1TFGPFGUJN)TGIQTUFGU)TQ­GP\YGKVG#WUHÒJTWPI OKVGOCKNNKGTVGP4ÒEMUGKVGPFGT-TGW\CTOG UGKVEC 4KVVGTMTGW\HÒT<KXKNXGTFKGPUV)QNFGOCKNNKGTVIMCWOUKEJVDCTG'OCKNNGTGRCTCVWT CWH FGO NKPMGP -TGW\CTO WPF OKP 'OCKNNGURTWPI KO $CPFTKPI RWP\KGTV CO QTKIKPCNGP $CPF <'+    ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPIUSWCNKV·VCWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU  8QP2CRUV)TGIQT:8+  CO5GRVGODGTCNU\WP·EJUVXKGTMNCUUKIGT )TQ­MTGW\WPF-NCUUGņ NGV\VGTG  YKGFGT CDIGUEJCHHV   -QOOCPFGWT WPF 4KVVGT   CD  FTGKMNCUUKIGT CNNIGOGKPGT \KXKNGT WPF   OKNKV·TKUEJGT 8GTFKGPUVQTFGP IGUVKHVGV YWTFG GT \WP·EJUV CP VTGWG $ÒTIGT WPF CP ÌUVGTTGKEJKUEJG 6TWRRGP HÒT KJTG   7PVGTUVÒV\WPIFGTYGNVNKEJGP/CEJVFGU*GKNKIGP5VWJNUKO-KTEJGPUVCCVY·JTGPFFGT7PTWJGPXQPXGTNKGJGP 'TXGTHÒIVDKUJGWVGÒDGTGKPG\KXKNGWPFGKPGOKNKV·TKUEJG#DVGKNWPIYQDGKNGV\VGTGKPLÒPIGTGT<GKV YQJNUGKVFGT #WHNÌUWPI FGT R·RUVNKEJGP OKNKV·TKUEJGP 'KPJGKVGP ņ DKU CWH FKG 2·RUVNKEJG 5EJYGK\GTICTFG  FWTEJ 2CRUV 2CWN 8+  

 KO,CJT PKEJVOGJTXGTNKGJGPYQTFGPKUV<YKUEJGPECWPFYWTFGGKPIGHÒJTVFC­FGT -QOOCPFGWTCWEJOKV$TWUVUVGTPXGTNKGJGPYGTFGPMQPPVGYCUFKGUG-NCUUGHCMVKUEJKP\YGK)TCFGWPVGTVGKNVGWPF FGT1TFGPUUQOKVYKGFGTXKGTMNCUUKIYWTFGTGQTICPKUKGTVG2CRUV2KWU:  FGP1TFGPFGTJGWVGHÒT DGYKGUGPGWPGTUEJÒVVGTNKEJG6TGWGWPF'KHGTKO&KGPUVFGU*GKNKIGP5VWJNUXGTNKGJGPYKTF/KV*CPFUEJTGKDGPXQO ,WNKXGTHÒIVG2CRUV,QJCPPGU2CWN++  FC­FGT1TFGPHQTVCPKPCNNGP-NCUUGPCWEJCP(TCWGP XGTNKGJGPYGTFGPMCPP

265


VATIKAN

9233

9234

9234



'TKPPGTWPIUOGFCKNNG \WO 'KPJWPFGTVL·JTKIGP $GUVGJGP FGU 1TFGPU FGU JN )TGIQT FGU )TQ­GP   $TQP\GXGTIQNFGVCOQTKIKPCNGP$CPF 4++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  )GUVKHVGV XQO  XQO *KUVQTKUEJGP WPF *GTCNFKUEJGP +PUVKVWV XQP (TCPMTGKEJ CWU #PNCUU FGU 'KPJWPFGTVL·JTKIGP    $GUVGJGPU FGU 1TFGPU FGU JN )TGIQTU FGU )TQ­GP XGTIGDGP CP FGP 2CRUV FKG -CTFKP·NG GKPKIG 2T·NCVGP CP FKG    1TFGPUTKVVGTUQYKGCPGKPKIG5QWXGT·PGWPF/KVINKGFGTTGIKGTGPFGT*·WUGT



1TFGPXQOJN2CRUV5[NXGUVGTWPFXQO)QNFGPGP5RQTP-QOOCPFGWTMTGW\5KNDGTXGTIQNFGV/G FCKNNQPU)QNFGOCKNNKGTVCO*CNUDCPFCDUEJPKVV<'+ 4++



'ZGORNCTCWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVUOKVHGKPUVITCXKGTVGT2CRUVDÃ&#x2019;UVGKO<GPVTWO  2CRUV)TGIQT:8+YCPFGNVGCO1MVQDGTFGPCNVGP1TFGPFGT)QNFGPGP/KNK\QFGTXQO)QNFGPGP5RQTPKP GKPGP PGWGP PWPOGJT \YGKMNCUUKIGP 4KVVGT WPF -QOOCPFGWT  1TFGP XQO JN 2CRUV 5[NXGUVGT WPF XQO )QNFGPGP   5RQTP WO FGUUGP +PUKIPKGP PQTOCNGTYGKUG CO *CNU QFGT $TWUVDCPF DGK DGUQPFGTGP HGKGTNKEJGP )GNGIGPJGKVGP   LGFQEJCPGKPGT-GVVGWPFFC\WGKPG1TFGPU7PKHQTOIGVTCIGPYWTFG



1TFGP FGU JN 2CRUVGU 5[NXGUVGT .GGTGU TQVGU 'VWK \WO )TQ­QHHK\KGT XQP %TCXCP\QNC 5WEE '   )CTFKPQ&GEMGNDGUEJ·FKIVOKVIQNFHCTDGPGOR·RUVNKEJGP5[ODQN ++p+++



#O  (GDTWCT  ·PFGTVG 2CRUV 2KWU : FGP 1TFGP XQO JN 2CRUV 5[NXGUVGT WPF XQO )QNFGPGP 5RQTPKPGKPGP FTGKMNCUUKIGP YQDGK FKG \YGKVG -NCUUG KP \YGK )TCFG  OKV WPF QJPG $TWUVUVGTP  WPVGTVGKNV KUV  CNNIGOGKPGP 8GT   FKGPUVQTFGPWO/KV*CPFUEJTGKDGPXQO,WNKXGTHÃ&#x2019;IVG2CRUV,QJCPPGU2CWN++  FCUUFGT1TFGP HQTVCPKPCNNGP-NCUUGPCWEJCP(TCWGPXGTNKGJGPYGTFGPMCPP

9236



9237

9238

1TFGP FGU JN 2CRUVGU 5[NXGUVGT -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP   *CNUDCPF<'+ ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T



1TFGP FGU JN 2CRUVGU 5[NXGUVGT -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP   *CNUDCPF<'+ +p++



¤UVGTTGKEJKUEJG#PHGTVKIWPICWUFGOFTKVVGP8KGTVGNFGU<YCP\KIUVGP,CJTJWPFGTVU



266

1TFGPFGUJN2CRUVGU5[NXGUVGT4KVVGTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVQDGTHN·EJNKEJGT%JKRKP FGTYGK­GP'OCKNNGFKGUGCWEJGVYCUXGTH·TDVCO$CPFKOQTKIKPCNGPOKVIQNFHCTDGPGPR·RUVNKEJGO 5[ODQNDGFTWEMVGP8GTNGKJWPIUGVWKFGT(KTOC6CPHCPK$GTVCTGNNKKP4QO<'+ ++p




VATIKAN

9244 9239 9240

9242 9241



4KVVGTQTFGPXQO*GKNKIGP)TCD/QFGNN  #WUHÃ&#x2019;JTWPIOKV-TQPG4KVVGTMTGW\ZOO )QNFHGKPUVITCXKGTVWPF\KUGNKGTVGOCKNNKGTVICOPGWGP$CPF +p++





4KVVGTQTFGPXQO*GKNKIGP)TCD/QFGNN  $TWUVUVGTP\WO)TQ­MTGW\5KNDGTTGRGTEKGTV #WHNCIGPVGKNYGKUG)QNF IGRTÃ&#x2019;HV GOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-T¾VN[ KP2CTKUCP0CFGNOKV\YGK5GKVGPJCMGP<'+ +p++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T   &KG $TWUVUVGTPG FGT )TQ­MTGW\G  FGU  WPF  /QFGNNU     INGKEJGP KP KJTGT )GUVCNVWPI FGP   $TWUVUVGTPGP FGT )TQ­QHHK\KGTG FGU  /QFGNNU UGKV   5KG NCUUGP UKEJ XQTYKGIGPF PWT FWTEJ FKG 3WCNKV·V KJTGT   #WUHÃ&#x2019;JTWPID\YKJTG&CVKGTWPIWPVGTUEJGKFGP



4KVVGTQTFGP XQO *GKNKIGP )TCD  /QFGNN   -QOOCPFGWTMTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCOCNVGP*CNUDCPFCDUEJPKVV<'+ ++





4KVVGTQTFGP XQO *GKNKIGP )TCD  /QFGNN UGKV   )TQ­MTGW\UGV HÃ&#x2019;T *GTTGP DGUVGJGPF CWU   -NGKPQF 5KNDGT XGTIQNFGV GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<'+XCT 5VÃ&#x2019;EM+p++





8GTFKGPUVQTFGPXQO*GKNKIGP)TCD%CEONCPIGT*CNUDCPFCDUEJPKVV\WO-QOOCPFGWTMTGW\

++



'JTGP\GKEJGPFGT4GEJVUCPY·NVGXQOJGKNKIGP2GVTWU4KVVGTMTGW\$TQP\GGOCKNNKGTVCOQTKIKPCNGP $CPF ++



 267


VATIKAN

9245



9247

9246

/GFCKNNG HÒT -·ORHGT HÒT FKG 9KGFGT'TTKEJVWPI FGT R·RUVNKEJGP 5QWXGT·PKV·V KO -KTEJGPUVCCV    $TQP\G XGTUKNDGTV 8GTUKNDGTWPI CWH FGT 8QTFGTUGKVG UVCTM DGTKGDGP CO QTKIKPCNGP CNVGP   \GKVIGPÌUUKUEJGP$CPF$4#5 ++





/GFCKNNG HÒT -·ORHGT HÒT FKG 9KGFGT'TTKEJVWPI FGT R·RUVNKEJGP 5QWXGT·PKV·V KO -KTEJGPUVCCV   $TQP\GRCVKPKGTVCOQTKIKPCNGPCNVGP\GKVIGPÌUUKUEJGP$CPF$4#5 ++





/GFCKNNG HÒT -·ORHGT HÒT FKG 9KGFGT'TTKEJVWPI FGT R·RUVNKEJGP 5QWXGT·PKV·V KO -KTEJGPUVCCV   $TQP\GUEJYCT\RCVKPKGTVCOUR·VGTGP$CPF$4#5 ++





%CUVGNHKFCTFQ/GFCKNNG#WUICDGKPXGTUKNDGTVGT-WRHGT0KEMGN.GIKGTWPIHÒT/CPPUEJCHVGPCO$CPF $4#5 ++



)GUVKHVGVXQP2CRUV2KWU+:YWTFGFKG/GFCKNNGCPFKGHTCP\ÌUKUEJGPÌUVGTTGKEJKUEJGPURCPKUEJGPWPFPGCRQ NKVCPKUEJG 6TWRRGP CWUIGIGDGP FKG \WT 9KGFGTJGTUVGNNWPI FGT R·RUVNKEJGP 5QWXGT·PKV·V KO -KTEJGPUVCCV DGKIGVTCIGP   WPFFKG5VCFV4QOXQPFGT$GUGV\WPIFWTEJFKGICTTKDCNFKPKUEJGP6TWRRGPDGHTGKVJCDGP

&KG/GFCKNNGYWTFGXQP2CRUV2KWU+:CO0QXGODGTHÒTFKG6TWRRGPIGUVKHVGVFKGKP7ODTKGPWPFKPFGP /CTMGP \WT 8GTVGKFKIWPI FGU -KTEJGPUVCCVGU IGIGP FKG UCTFKPKUEJGP 6TWRRGP IGM·ORHV JCDGP 5KG YWTFG CWEJ CP   XKGNG(TCP\QUGPXGTNKGJGP

9250 9249



/GPVCPC-TGW\ #WUICDG HÒT 7PVGTQHHK\KGTG WPF 5QNFCVGP KP 0KEMGN QJPG 8GTNGKJWPIUPWOOGT CO   CNVGPLGFQEJUR·VGTGP$CPF$4#5 ++



/GFCKNNG1DQGFKGPVKCGV2CZ2CRUV,QJCPPGU::+++XQP5KNDGTKO4CPFRWP\KGTVCO QTKIKPCNGP $CPF OKV 6TCIGURCPIG KO QTKIKPCNGP OKV IQNFHCTDGPGO 2CRUVYCRRGP DGFTWEMVGP   8GTNGKJWPIUGVWK 44+p++



)GUVKHVGV XQP 2CRUV 2KWU +: CO  0QXGODGT  HÒT FKG HTCP\ÌUKUEJGP 'ZRGFKVKQPUVTWRRGP WPVGT )GPGTCN FG   (CKNN[FKGDGK/GPVCPC KO.CVKWO GKPGP5KGIIGIGPFKGICTTKDCNFKPKUEJGP(TGKYKNNKIGPCWHFGTGP8QTOCTUEJIGIGP 4QOGTTWPIGPJCVVGP



'ZVTGOUGNVGPG/GFCKNNGFGUUGJTDGNKGDVGP2CRUVGU

268


ÄGYPTEN

14&'070&'*4'0<'+%*'0#75ª$'45''

9251

9252

);26'0 -¤0+)4'+%*);26'0   

1TFGPFGU0KNU/QFGNN  5GVFGT-NCUUGDGUVGJGPFCWU-NGKPQF5KNDGTVGKNYGKUGXGT IQNFGV #WHNCIGP )QNF IGRTÒHV  VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC6GYHKM$KEJC[KPCTCDKUEJGP5EJTKHV\GKEJGPWPFOGJTHCEJRWP\KGTV WCOKVFGT,CJTGURWP\G( HÒT    Z  OO CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV   #WHNCIGP )QNF IGRTÒHV  VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG OGJTHCEJ RWP\KGTV W C OKV FGT   ,CJTGURWP\G-HÒT &WTEJOOOCP0CFGNOKV5GKVGPJCMGPKOQTKIKPCNGP8GTNGKJWPIUGVWK FGT(KTOC6GYHKM$KEJC[KP-CKTQOKVFGO/QPQITCOO-ÌPKI(QWCFU+1#0 5VÒEM+



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T &CU/QFGNNWPVGTUEJGKFGVUKEJXQOFCTKPFC­FKG#ITCHHGFGU-NGKPQFUIQNFHCTDGPKUVWPFFGT$TWUVUVGTP XGTIQNFGVG 5VTCJNGP CWHYGKUV &KG -QODKPCVKQP XQP ,CJTGURWP\GP WPF 'VWK/QPQITCOO -ÌPKI (QWCF U + IGUV     GTIGDGP HÒT FKGUGU 'PUGODNG PWT GKPGP UGJT MWT\GP 8GTNGKJWPIU\GKVTCWO XQP  DKU  &KG8GTNGKJWPI XQP +PUKIPKGP FGU 0KNQTFGPU OKV GEJV IQNFGPGP #WHNCIGP GPVURTGEJGP GKPGT DGUQPFGTGP RGTUÌPNKEJGP 9GTVUEJ·V\WPI   FGU-ÌPKIUWPFYWTFGPXQPKJOUGNDUVXQTIGPQOOGP#W­GTIGYÌJPNKEJUEJÌPGTJCNVGPGT5GVWPFOKVGEJVIQNFGPGP #WHNCIGPUGJTUGNVGP  5EJQPUVKHVGVG5WNVCP*WUCKP-GOCNFGPHÒPHMNCUUKIGP1TFGPFGUUGP5VCVWVGPGKPKIGPFGTWPIGPFKGUKEJ CWEJ CWH FKG )GUVCNVWPI FGT +PUKIPKGP CWUYKTMVGP GTHCJTGP JCDGP 0CEJ #WUTWHWPI FGT 4GRWDNKM  YWTFG GT    \WP·EJUVCWHIGJQDGPLGFQEJGTPGWVCNUGKPMNCUUKIGT1TFGPIGUVKHVGV

4'27$.+-);26'0 5'+6  

1TFGPFGT4GRWDNKM#WUICDG  5GVFGT-NCUUGDGUVGJGPFCWU*CNUFGMQTCVKQP5KNDGT DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   6GYHKM $KEJC[ KP -CKTQ KP CTCDKUEJGP 5EJTKHV\GKEJGP  -CKTQGT 5KNDGTRWP\G HÒT GT 5KNDGT WPF   ·I[RVKUEJG 4GIKGTWPIURWP\G CO QTKIKPCNGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV VGKNYGKUG   XGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC$KEJC[CP0CFGNFKGUGOKV -CKTQGT5KNDGTRWP\GHÒTGT5KNDGTWPF·I[RVKUEJGT4GIKGTWPIURWP\GOKV\YGK5GKVGPJCMGP  5VÒEM+p++ &GT HÒPHMNCUUKIG 1TFGP KUV  XQP 5VCCVRT·UKFGPV )COCN CDFGN 0CUUGT OKV )GUGV\ 0T  \WT $GNQJPWPI \KXKNGT   8GTFKGPUVGIGUVKHVGVYQTFGPD\YKUVFKG)GUVCNVWPIFGT+PUKIPKGPFWTEJ#PRCUUWPIFGT5VCCVUYCRRGPFGP LGYGKNKIGPRQNKVKUEJGP)GIGDGPJGKVGPCPIGRCUUVYQTFGP



269


ÄTHIOPIEN

9255 (1:1)

9257

9254

9253

9256 (1:1)

6*+12+'0-#+5'44'+%* $+5  

1TFGP FGT *GKNKIUVGP &TGKGKPKIMGKV )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF XGTIQNFGV WPF VGKNYGKUG   GOCKNNKGTVOKV'OCKNNGOCNGTGKCOQTKIKPCNGPCNVGP5EJWNVGTDCPFWPF$TWUVUVGTPXGTIQNFGVWPFVGKNYGKUG GOCKNNKGTVOKV'OCKNNGOCNGTGKCP0CFGNOKV\YGK5GKVGPJCMGP1#0 5VÒEM++



/GPGNKM1TFGP-QOOCPFGWTMTGW\XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF\WUCOOGPOKV-PQRHNQEJ TQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC#TVJWU$GTVTCPFKP2CTKU<WUCOOGPOKVQTKIKPCNGT#P PCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP 1DGTTGIKGTWPIUTCV KO $WPFGURT·UKFKCN   COV *GNOWV /ÒNNGT FCVKGTV $QPP CO  #RTKN  WPF 2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP    \YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT1#0 ++



)GUVKHVGVXQP-CKUGT*CKNG5GNCUUK¾CWU#PNCUUUGKPGT-TÌPWPI\WO-CKUGTWPFKPHÒPH-NCUUGPDKUXGTNKG JGP&KG<CJNFGT)TQ­MTGW\GYCTCWHDGITGP\V



#()*#0+56#0 '/+4#670&-¤0+)4'+%*   

1TFGPFGU&QQTCPGG'ORKTG/KPKCVWTFGU$TWUVUVGTPUFGT-NCUUG5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTVQJPG$·PFEJGP +p++



#PHGTVKIWPIFGU<YCP\KIUVGP,CJTJWPFGTVU



5QPPGP1TFGP/QFGNN  /KPKCVWTFGU$TWUVUVGTPU5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV QJPG$·PFEJGP +p++





1TFGP FGU 5VGTPU =0KUJCPG 7UVWT?  /QFGNN   5GV FGT  -NCUUG DGUVGJGPF CWU   $TWUVUVGTP 5KNDGT /GFCKNNQP )QNF /GFCKNNQP /GFCKNNQPKPUEJTKHV 1TFGP FGU ITQ­GP 5VCCVU XQP   #HIJCPKUVCP WPF 5VQT  CP 0CFGN FKGUG RWP\KGTV  WPF QTKIKPCNGU 5EJWNVGTDCPF KO QTKIKPCNGP   8GTNGKJWPIUGVWK OKV IQNFHCTDGPGO 5VCCVUYCRRGP <WUCOOGP OKV FGT 8GTNGKJWPIUWTMWPFG   WPF   #PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP/KPKUVGTKCNTCVKO$WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  ,WPK  WPF 2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP    WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV LGYGKNKIGO 8GTNGKJWPIULCJT 6#//  81.2'   5 4+



#PHGTVKIWPIFGT(KTOC&GUEJNGT5QJPKP/ÒPEJGP&KGUGJCDGP5·V\GFGT-NCUUGIGNKGHGTV&KG-NCUUG FGU5VGTP1TFGPUWOHCUUVGKPFKGUGT2GTKQFGPWTGKPGP5VGTPWPFGKPG5EJ·TRG QJPG-NGKPQF 

270


ARGENTINIEN

9259

9261

9258

9260



1TFGPFGU5VGTPU=0KUJCPG7UVWT?/QFGNN  &GMQTCVKQP-NCUUG5KNDGT/GFCKNNQP )QNFCWHFGT4ÒEMUGKVGRWP\KGTVCOQTKIKPCNGP*CNUDCPFKOQTKIKPCNGPIQNFGPDGFTWEMVGP8GTNGK JWPIUGVWK<WUCOOGPOKVQTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP 1DGTTGIKGTWPIUTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  1MVQDGT  WPF   2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV   LGYGKNKIGO8GTNGKJWPIULCJT ++



&'/1-4#6+5%*'4'27$.+-   

1TFGP FGT 8ÌNMGTHTGWPFUEJCHV &GMQTCVKQP  -NCUUG 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV CWH FGT   4ÒEMUGKVG6T·IGTPWOOGTCP6TCIGURCPIGXGTUKNDGTVVGKNYGKUGXGTIQNFGVCP0CFGN 44+p++



#4)'06+0+'04'27$.+- 

1TFGPFGU$GHTGKGTU5CP/CTVKP)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFVGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CP   3WGTPCFGN \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP OKV IQNFHCTDGPGO 5VCCVYCRRGP DGFTWEMVGP   8GTNGKJWPIUGVWK$#4911#05H 5VÒEM44+p++



/CK1TFGPHÒT8GTFKGPUV/QFGNN OKVYGKDN-QRHKO/GFCKNNQPEC $TWUVUVGTP\WO )TQ­QHHK\KGT 5KNDGT XGTIQNFGV VGKNYGKUG GOCKNNKGTV GKPKIG OKP *CCTTKUUG KP FGT YGK­GP 'OCKNNG CP   0CFGNOKV\WU·V\NKEJGO$GHGUVKIWPIUJCMGP1#081.2'5 ++



&GT1TFGPKUVKPCNNGP-NCUUGPUGJTUGNVGP)GUVKHVGVCNUUGEJUMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGPCO#WIWUV XGT·PFGTVCO/CKWPF&G\GODGT'TKUVFGTJÌEJUVG1TFGPFGU.CPFGU&CU)TQ­MTGW\KUV CWEJCPFGPGTUVGPFGWVUEJGP$WPFGUMCP\NGT&T-QPTCF#FGPCWGTCO/·T\XGTNKGJGPYQTFGP



&KG+PUKIPKGPFGUWPFFGU/QFGNNUWPVGTUEJGKFGPUKEJPWTFWTEJFKG3WCNKV·VFGT8GTCTDGKVWPI+PFKGUGT-NCUUG YKTFFGT$TWUVUVGTPCNNGKPWPFQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP  &GT1TFGPKUVKO,CJTGXQP1DGTUV,WCP&QOKPIQ2GTÉP2T·UKFGPVXQP#TIGPVKPKGPCNU1TFGPHÒT8GTFKGPUV 1TFGP CN/¾TKVQ IGUVKHVGVYQTFGP0CEJFGOCO5GRVGODGTGTHQNIVGP4ÒEMVTKVV2GTÉPUYWTFGFKG8GTNGKJWPIFGU 1TFGPUGKPIGUVGNNV/KV&GMTGV0TKUVFGT1TFGPCO&G\GODGTWPVGTFGT$G\GKEJPWPI/CK1TFGP KP XKGT #DVGKNWPIGP /CK1TFGP HÒT 8GTFKGPUV /CK1TFGP HÒT /KNKV·T8GTFKGPUV /CK1TFGP HÒT /CTKPG8GTFKGPUV   WPF/CK1TFGPHÒT.WHVHCJTV8GTFKGPUV OKVUGEJUD\YHÒPH-NCUUGPWPFOKVXÌNNKIPGWGT)GUVCNVWPIFGT+PUKIPKGP

CEJVUVTCJNKIG 5QPPG OKV YGKDNKEJGO -QRH  FGO 5KPPDKNF FGT 4GRWDNKM  KO /GFCKNNQP HÒT FKG #DVGKNWPI (ÒT   8GTFKGPUV YKGFGTGTTKEJVGVYQTFGP<WGKPGOUR·VGTGP<GKVRWPMVXGTOWVNKEJKO<WUCOOGPJCPIOKVFGT4ÒEMMGJT 2GTÉPU CP FKG /CEJV KO ,CJTG  KUV FGT YGKDNKEJG -QRH FGT 4GRWDNKM FWTEJ GKPGP O·PPNKEJGP GTUGV\V YQTFGP   9QJNPCEJFGO/KNKV·TRWVUEJKO,CJTGYKGFGTWOKUVFGTO·PPNKEJG-QRHFWTEJFGPHTÒJGTGPYGKDNKEJGP-QRH GTUGV\VYQTFGP 8IN/KPKUVGTKQFG4GNCEKQPGU'ZVGTKQTGU[%WNVQ%QPFGEQTCEKQPGU$WGPQU#KTGU 

271


ARGENTINIEN

9263

9264 (1:1) ex 9262



/CK1TFGPHÒT8GTFKGPUV/QFGNN OKVYGKDN-QRHKO/GFCKNNQPEC -QOOCPFGWTFG MQTCVKQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF \WUCOOGP OKV /KPKCVWT 5KNDGT   XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP OKV CWHIGNGIVGT 4QUGVVG WPF -PQRHNQEJTQUGVVG KO QTKIKPCNGP   IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK FGT (KTOC 4KEEKCTFK KP $WGPQU #KTGU <WUCOOGP OKV QTKIKPCNGT   #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP 1DGTTGIKGTWPIUTCV KO   $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  0QXGODGT  WPF 2JQVQMQRKG FGU   8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV LGYGKNKIGO   8GTNGKJWPIULCJT1#05 5VÒEM4++



/CK1TFGPHÒT8GTFKGPUV/QFGNN OKVO·PPN-QRHKO/GFCKNNQPECEC )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO 5EJWNVGTDCPF WPF $TWUVUVGTP   5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCP0CFGN1#05 5VÒEM++



+PFKGUGT#WUHÒJTWPI OKVGOCKNNKGTVGO.QTDGGTMTCP\CNUªDGTJÌJWPI PKEJVJ·WHKI\WHKPFGP



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV 0T  &GT 1TFGP KUV KO ,CJTG  XQP 1DGTUV ,WCP &QOKPIQ 2GTÉP 2T·UKFGPV XQP #TIGPVKPKGP CNU 1TFGP HÒT   8GTFKGPUV 1TFGP CN /¾TKVQ  IGUVKHVGV YQTFGP 0CEJ FGO CO  5GRVGODGT  GTHQNIVGP 4ÒEMVTKVV 2GTÉPU YWTFG   FKG 8GTNGKJWPI FGU 1TFGPU GKPIGUVGNNV /KV &GMTGV 0T  KUV FGT 1TFGP CO  &G\GODGT  WPVGT FGT   $G\GKEJPWPI /CK1TFGP KP XKGT #DVGKNWPIGP /CK1TFGP HÒT 8GTFKGPUV /CK1TFGP HÒT /KNKV·T8GTFKGPUV /CK   1TFGP HÒT /CTKPG8GTFKGPUV WPF /CK1TFGP HÒT .WHVHCJTV8GTFKGPUV  OKV UGEJU D\Y HÒPH -NCUUGP WPF OKV XÌNNKI   PGWGT)GUVCNVWPIFGT+PUKIPKGP CEJVUVTCJNKIG5QPPGOKVYGKDNKEJGO-QRHFGO5KPPDKNFFGT4GRWDNKMKO/GFCKN NQPHÒTFKG#DVGKNWPI(ÒT8GTFKGPUV YKGFGTGTTKEJVGVYQTFGP<WGKPGOUR·VGTGP<GKVRWPMVXGTOWVNKEJKO<WUCO OGPJCPI OKV FGT 4ÒEMMGJT 2GTÉPU CP FKG /CEJV KO ,CJTG  KUV FGT YGKDNKEJG -QRH FGT 4GRWDNKM FWTEJ GKPGP   O·PPNKEJGP GTUGV\V YQTFGP 9QJN PCEJ FGO /KNKV·TRWVUEJ KO ,CJTG  YKGFGTWO KUV FGT O·PPNKEJG -QRH FWTEJ   FGPHTÒJGTGPYGKDNKEJGP-QRHGTUGV\VYQTFGP 8IN/KPKUVGTKQFG4GNCEKQPGU'ZVGTKQTGU[%WNVQ%QPFGEQTCEKQPGU $WGPQU#KTGU 

 272

'JTGP\GKEJGP HÒT 6CRHGTMGKV WPF &KU\KRNKP $TQP\G CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   (KTOC4)TCPFGKP)TCDÉOKV\YGK/GVCNNTKPIGPWPF5RCPIG\WO$GHGUVKIGPCPFGT7PKHQTO 4++




BOLIVIEN

9266

9265 9267

$1.+8+'04'27$.+- 

0CVKQPCNGT 1TFGP FGU -QPFQTU FGT #PFGP 1TFGPUMQNNCPG DGUVGJGPF CWU  $NÒVGP WPF  5VGTP   )NKGFGTPUQYKGGKPGO-QPFQT6TCIGINKGF5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVWPF-NGKPQF5KNDGT XGTIQNFGV WPF GOCKNNKGTV OKP 'OCKNNGCWUDTWEJ KO /GFCKNNQPTKPI 'OCKNNGOCNGTGK GKPG   -TGW\URKV\GPMWIGNGVYCUXGTDQIGPKO'VWK 444++  'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  &CXQT GZ #WMVKQP (TCPMHWTVGT /ÒP\JCPFNWPI KP (TCPMHWTV CO /CKP XQO  DKU  0QXGODGT   'U   JCPFGNV UKEJ WPUGTGU 9KUUGPU WO FCU GKP\KIG LGOCNU CWH FGO FGWVUEJGP /CTMV GTUEJKGPGPG 'ZGORNCT  &GT UGEJU   MNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP KUV CO  #RTKN  IGUVKHVGV YQTFGP &KG -QNNCPG KUV CWUUEJNKG­NKEJ 5VCCVU   QDGTJ·WRVGTPXQTDGJCNVGP



0CVKQPCNGT 1TFGP FGU -QPFQTU FGT #PFGP 4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNG   OCNGTGKOGJTGTGOKP'OCKNNGUEJ·FGPCWH8QTFGTWPF4ÒEMUGKVGCOQTKIKPCNGP$CPF$#491p 1#081.2'5 ++p+++ &KG DGKFGP WPVGTGP -NCUUGP FKGUGU 1TFGPU UKPF KP 'WTQRC CWH FGO /CTMV YGKVCWU UGNVGPGT \W HKPFGP CNU FKG FTGK   JÌJGTGP-NCUUGP&GTUGEJUMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPKUVCO#RTKNIGUVKHVGVYQTFGP



$4#5+.+'0 -#+5'44'+%*   

)GOGKPUCOGU 'JTGP\GKEJGP FGU %JTKUVWU WPF FGU #XK\QTFGPU (·NUEJWPI GKPGU $TWUVUVGTPU 5KNDGT   XGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVOGJTGTGOKP'OCKNNGEJKRUCWHFGT4ÒEMUGKVGRWP\KGTV%12;CP 0CFGN ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T 'UJCPFGNVUKEJDGKFKGUGO$TWUVUVGTPWOGKPGHTGKG'THKPFWPIFKGGUKPFKGUGT(QTOICTPKEJVIGIGDGPJCDGP MCPP &KG HÒPHCTOKIGP +PUKIPKGP FGU %JTKUVWUQTFGPU D\Y FGU #XK\QTFGPU UKPF GTUV  WPVGT -CKUGT 2GFTQ ++   IGUEJCHHGP YQTFGP YQDGK CWEJ JKGT FKG $TWUVUVGTPG DGK KJTGT CNVGP XKGNUVTCJNKIGP (QTO FGU UQIGP )NCP\MÌTRGTU   DNKGDGP &KG )GUVCNVWPI FKGUGU $TWUVUVGTPU UQNN LGFQEJKP#PNGJPWPICPFGPRQTVWIKGUKUEJGP1TFGPXQO6WTOWPF 5EJYGTV GKPG (QTO CWU FGO GTUVGP 8KGTVGN FGU  ,CJTJWPFGTVU UWIGTKGTGP YQ\W LGFQEJ FKG GKPHCEJG #WUHÒJTWPI   WPF RNWORG )GUVCNVWPI KP MGKPUVGT 9GKUG RCUUGP &KGUG CNU 6TKIWGKTQU(·NUEJWPIGP DGMCPPV IGYQTFGPGP 5VÒEMG   YWTFGPKPFGPGT,CJTGPXQPFGOGJGOCNKIGP&KTGMVQTFGTUVCCVNKEJGP/ÒP\GKP.KUUCDQP#PVÉPKQ/6TKIWGK TQU JGTIGUVGNNV WPF VGKNYGKUG WPVGT TCHHKPKGTVGO /K­DTCWEJ FGU 8GTVTCWGPU OGJTGTGT DGFGWVGPFGT 5COONGT WPF   2JCNGTKUVKMGTYGNVYGKVXGTVTKGDGP0CEJFGOY·JTGPFGKPGT,CJTGUXGTUCOONWPI %QPXGPVKQP FGT1TFGTUCPF/GFCNU 5QEKGV[ QH #OGTKEC 1/5#  FKG (·NUEJWPIGP CNU UQNEJG GTMCPPV YQTFGP UKPF KUV 6TKGIWGKTQU YGIGP WPYÒTFKIGO   8GTJCNVGPUCWUFGO8GTGKPCWUIGUEJNQUGPYQTFGP

273


BRASILIEN

9269



9268

-CKUGTNKEJGT4QUGP1TFGP$TWUVUVGTP\WO-QOOCPFGWTZOO5KNDGTXGTIQNFGV/GFCKNNQP\GP VTWO )QNF VGKNYGKUG GOCKNNKGTV \YGK DGJGNHUO·­KIG 'OCKNNGTGRCTCVWTGP KO /GFCKNNQPTKPI HGKPUVG   'OCKNNGOCNGTGKOKV\YGKOKP$GUEJ·FKIWPIGPCP0CFGN$#4911#0 ++p

'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  &CXQT GTYQTDGP  DGK ( $CTVQNK KP 4QO KO /·T\  <WT )GUEJKEJVG FGU 1TFGPU XGTINGKEJG CWEJ   #NVOCPP(TGF&GT-CKUGTNKEJ$TCUKNKCPKUEJG1TFGPFGT4QUG+P1TFGP/KNKVCTKC/CIC\KP0T  5 





-CKUGTNKEJGT4QUGP1TFGP$TWUVUVGTP\WO1HHK\KGT&WTEJOGUUGTOO)QNF CWEJFGT5VGTPMQT RWU VGKNYGKUGHGKPUVDTKNNCPVKGTVWPFITCXKGTVVGKNYGKUGGOCKNNKGTVIHGKPUVG'OCKNNGOCNGTGKMCWO UKEJVDCTG 'OCKNNGTGRCTCVWT KO /GFCKNNQPTKPI CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   .GOCKVTGKP2CTKUCP0CFGN$#4911#05H 4+p++ 

9270

(¤&'4#6+8'4'27$.+- 5'+6  

0CVKQPCNGT1TFGPXQO-TGW\FGU5ÒFGPU/QFGNN#WUHÒJTWPI OKV/GFCKNNQPVGZV4'27$.+%# &15 '56#&15 70+&15 &1 $4#5+.    )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVOKVQTKIKPCNGPDTCUKNKCPKUEJGO5EJWNVGTDCPFOKV4QUGVVGWPF$TWUVUVGTP5KNDGT XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC .C 4Q[CNG KP 4KQ CP   0CFGN \WUCOOGP OKV -PQRHNQEJTQUGVVG KO 1TKIKPCNGVWK FGT (KTOC .C 4Q[CNG OKV IQNFGP IGFTWEMVGO   5VCCVUYCRRGP$#4911#0 5VÒEM++

'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  7TURTÒPINKEJ XGTNKGJGP CP &T 9CNVGT *CNNUVGKP   'T YCT 2TQHGUUQT HÒT <KXKNGU 4GEJV CP FGT   7PKXGTUKV·V(TCPMHWTVCO/CKPWPFFGTGP4GMVQT'TYWTFGXQP$WPFGUMCP\NGT#FGPCWGT\WO5VCCVUUG MTGV·TKO$WPFGUMCP\NGTCOVDGTWHGPWPFYCTXQPDKU5VCCVUUGMTGV·TKO#W­Y·TVKIGP#OVYWTFG GT \WO GTUVGO 2T·UKFGPVGP FGT -QOOKUUKQP FGT 'WTQR·KUEJGP 9KTVUEJCHVUIGOGKPUEJCHV 8QTN·WHGTKP FGT JGWVKIGP   '7-QOOKUUKQP  DGTWHGP YCU GT DKU  IGDNKGDGP KUV 8QP  DKU  YCT GT #DIGQTFPGVGT KO &GWVUEJGP   $WPFGUVCI 'T IKNV CNU IGKUVKIGT 8CVGT FGT UQIGP *CNNUVGKP&QMVTKP FKG FKG #W­GPRQNKVKM FGT $WPFGUTGRWDNKM   &GWVUEJNCPF KP FGTGTUVGP2JCUGFGUUQIGP-CNVGP-TKGIGUXQPFGPGTDKUKPFKGGT,CJTGJKPGKPRT·IVG*CNN UVGKPYCTPGWPHCEJGT'JTGPFQMVQTUQYKGWCCWEJ6T·IGTFGU#CEJGPGT-CTNURTGKUGUWPFFGU5EJWOCPP2TGKUGU  +P #PNGJPWPI CP FGP MCKUGTNKEJGP 1TFGP UVKHVGVG 2T·UKFGPV )GVWNKQ 8CTICU FGP HÒPHMNCUUKIGP 8GFKGPUVQTFGP CO    &G\GODGT  #O ,WNKYWTFGCNUQDGTUVG-NCUUGFKGUGNVGPXGTNKGJGPG-QNNCPGFGU1TFGPUJKP\WIGHÒIV  GTHQNIVG GKPG PFGTWPI FGT +PUEJTKHV FGU 8QTFGTUGKVGPOGFCPOGFCKNNQP FGU -NGKPQFU XQP 4'27$.+%# &15   '56#&15 70+&15 &1 $4#5+. KP '56#&15 70+&15 &1 $4#5+. 8IN CWEJ /KPKUVGTKQ FCU 4GNC¼QGU   'ZVGTKQTGU1TFGO0CEKQPCNFQ%TW\GKTQFQ5WN4KQFG,CPGKTQ 

274




BRASILIEN

9271



0CVKQPCNGT1TFGPXQO-TGW\FGU5ÒFGPU/QFGNN#WUHÒJTWPI OKV/GFCKNNQPVGZV4'27$.+%# &15 '56#&15 70+&15 &1 $4#5+.    )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK   \KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVQDGTHN·EJNKEJG'OCKNNGEJKRWPFURTÒPIGKO4GXGTUGUOGFCKN NQP WPF QDGTHN·EJNKEJGT 'OCKNNGEJKR CWH FGT 4ÒEMUGKVG FGU QDGTGP #TOGU OKV PGWGO PKEJV MQTTGMVGP   *CNUDCPFCDUEJPKVVWPF$TWUVUVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGNFKGUGHTCP\ÌUKUEJRWP\KGTV $#4911#081.2'5 5VÒEM++p+++++



5EJYGTG#WUHÒJTWPIFGU$TWUVUVGTPUPKEJV\WXGTINGKEJGPOKVFGPNGKEJVGP#WUHÒJTWPIGPFGT(KTOCNCTQ[CNGKP4KQ FG,CPGKTQ

9273 9272





0CVKQPCNGT1TFGPXQO-TGW\FGU5ÒFGPU/QFGNN#WUHÒJTWPI OKV/GFCKNNQPVGZV4'27$.+%# &15'56#&1570+&15&1$4#5+. -QOOCPFGWTMTGW\5KNDGTXGTIQNFGVWPFGOCKN NKGTV OKP #WUDTWEJ KO XQTFGTUGKVKIGP /GFCKNNQPTKPI WPF #WUDTÒEJG KP FGP 5RKV\GP FGT 4ÒEMUGKVG   \YGKGT #TOG CO *CNUDCPF \WUCOOGP OKV -PQRHNQEJTQUGVVG KO 1TKIKPCNGVWK FGT (KTOC .C 4Q[CNG KP   4KQ FG ,CPGKTQ OKV IQNFGP IGFTWEMVGO 5VCCVUYCRRGP <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI   FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP 1DGTTGIKGTWPIUTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT   FCVKGTV$QPPCO,CPWCTWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGPWPFCP /ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT$#4911#0 ++++p+++



/KNKV·T8GTFKGPUVQTFGP  #WUICDG OKV TÒEMUGKVKIGO /GFCKNNQPVGZV 4'27$.+%# &15 '56#&15   70+&15 &1 $4#5+.    #WUHÒJTWPI OKV ITÌ­GTGO (TCWGPMQRH )TQ­MTGW\UGV DGUVGJGPF   CWU)TQ­MTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFDTCUKNKCPKUEJGT0·JCTVWPF $TWUVUVGTP5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC .CWTGPVK-JQWT[.VFCKP4KQFG,CPGKTQCP0CFGNITÒPNGFGTPGP1TKIKPCNGVWKFGT(KTOC.CWTGPVK -JQWT[.VFCOKVIQNFHCTDGPGO5VCCVUYCRRGP$#49121.+#5H81.2'5  5VÒEM++



)GUVKHVGV CO  ,WNK  JCV FGT 1TFGP HÒPH -NCUUGP 'T MCPP KP WPF CWUN·PFKUEJGP /KNKV·TCPIGJÌTKIGP HÒT FGT   DTCUKNKCPKUEJGP4GRWDNKMIGNGKUVGVG&KGPUVGKPDGUQPFGTGP#WUPCJOGH·NNGPCWEJCP<KXKNRGTUQPGPXGTNKGJGPYGTFGP

8INCWEJ/KPKUV¾TKQFQ'Z¾TEKVQ/CFCNJÃUVKEC/KNKVCT$TCUKNGKTCQ17PF.QDCVQ8CNNG*GKVQT%QPFG EQTC¼QGU/KNKVCTGU4KQFG,CPGKTQ5 

275


BRASILIEN

9274



/CTKPG8GTFKGPUVQTFGP  /QFGNN OKV TÒEMUGKVKIGO /GFCKNNQPVGZV 4'27$.+%# &15 '56#&15   70+&15&1$4#5+. $TWUVUVGTP\WO)TQ­MTGW\5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKN NKGTVCP0CFGN$#4911#081.2'5 ++



5GJT UEJYGTG #PHGTVKIWPI XQP JQJGT 3WCNKV·V PKEJV \W XGTINGKEJGP OKV FGP J·WHKI CWH FGO /CTMV \W HKPFGPFGP   UR·VGTGP#WUHÒJTWPIGP  )GUVKHVGVCO,WNKXQP2T·UKFGPV)GVÐNKQ8CTICUOKV&GMTGV0TJCVFGT1TFGPHÒPH-NCUUGP'TMCPP KP WPF CWUN·PFKUEJGP /CTKPGCPIGJÌTKIGP HÒT FGT DTCUKNKCPKUEJGP 4GRWDNKM IGNGKUVGVG &KGPUVG KP DGUQPFGTGP   #WUPCJOGH·NNGPCWEJCP<KXKNRGTUQPGPXGTNKGJGPYGTFGP

9275 9276



1TFGP HÒT 8GTFKGPUVG WO FKG .WHVHCJTV  #WUHÒJTWPI OKV /GFCKNNQPVGZV 4'27$.+%#   ('&'4#6+8# &1 $4#5+.  UGKV   )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUMTGW\ 5KNDGT   XGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKN NKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 4CPFCN CP 0CFGN \WUCOOGP OKV /KPKCVWT   5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGT4QUGVVGKOQTKIKPCNGPIQNFGPDGFTWEMVGP 8GTNGKJWPIUGVWKFGT(KTOC4CPFCN$#4911#05H 5VÒEM44+p++



#WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU  &GTHÒPHMNCUUKIG1TFGPYWTFGCO0QXGODGTOKV&GMTGV0TFGUDTCUKNKCPKUEJGP2T·UKFGPVGPIGUVKHVGV



276

(GNF\WIUOGFCKNNG FGU $TCUKNKCPKUEJGP 'ZRGFKVKQPUMQTRU KO (GDTWCT  $TQP\G CO $CPF OKV   $CPFURCPIG('$ 4++




CHILE

9277

9280

9279

9278

%*+.'4'27$.+- 

8GTFKGPUVOGFCKNNG=/GFCNNCCN/¾TKVQ?D\Y8GTFKGPUVQTFGP CD /QFGNN  D\Y  /QFGNN   8GTFKGPUVOGFCKNNG D\Y 8GTFKGPUVOGFCKNNG  -NCUUG 5KNDGT CWH FGO   4ÒEMUGKVGPOGFCKNNQP 6T·IGTPCOG 4+%#4&1 6#44#5%1 CO PKEJV MQTTGMVGP DNCWGP $CPF OKV   6TCIGURCPIGWPF0CFGN1#05 4++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV 0T9CJTUEJGKPNKEJKUVFCUWTURTÒPINKEJG$CPFXQO6T·IGTPCEJIGIGPFCUPWPOGJTKIGDNCWG$CPFCWUIG VCWUEJVYQTFGP  &GT8GTFKGPUVQTFGP 1TFGP#N/¾TKVQ GPVYKEMGNVGUKEJNCPIUCOCWUFGT8GTFKGPUVOGFCKNNG /GFCNNC#N/¾TKVQ XQP  /QFGNN  FKG OKV 7PVGTUEJTKHV FGU 2T·UKFGPVGP XQO -TKGIUOKPKUVGTKWO JCWRVU·EJNKEJ CP RTGW­KUEJG   /KNKV·TDGTCVGTXGTNKGJGPYWTFG+JTYCTUEJQPFKGIGUVKHVGVG/GFCKNNGHÒTFGWVUEJG/KNKV·TDGTCVGTXQTCPIGICPIGP

/GFCNNC C NQU +PUVTWEVQTGU #NCOCPGU  &KG )GUVCNVWPI FGT PGWGP UKNDGTPGP /GFCKNNG CO DNCWYGKUUTQVGO $CPF    NGJPVGUKEJCPFKG(QTOFGU/QFGNNUFGTCNVGP.GIKÉPFG/¾TKVQCPYWTFGFKG8GTFKGPUVOGFCKNNGCWHFTGK -NCUUGP GTYGKVGTV  /QFGNN  FKG  -NCUUG YKG DKUJGT KP 5KNDGT QJPG 'OCKNNG  WPF FKG  -NCUUG KP 5KNDGT OKV   DNCWGO'OCKNFKGIQNFHCTDGPG-NCUUGOKVYGK­GO'OCKNYCTCO*CNUG\WVTCIGP&KGFCOCNKIG-NCUUGKUVDKU \WOJGWVKIGP6CIFCU1TFGPU\GKEJGPFGTQDGTGP-NCUUGPFGUUR·VGTGP8GTFKGPUVQTFGPUIGDNKGDGP5GKVMQPPVG FKG/GFCKNNGXQO#W­GPOKPKUVGTKWOCWEJCP<KXKNRGTUQPGPXGTNKGJGPYGTFGPCNNGTFKPIUKUVFKG8GTNGKJWPIUVGVUCWH #WUN·PFGTDGUEJT·PMVIGDNKGDGP'KPGQDGTUVG-NCUUG)TQ­QHHK\KGT )TCP1HKEKCN HÒT5VCCVUQDGTJ·WRVGTYWTFG \WIGHÒIV&GTFC\WIGJÌTKIG5VGTPUQNNVGCWUFTÒEMNKEJFGP5VGTPGPFGT.GIKÉPFG/¾TKVQINGKEJGP'KP&GMTGVXQO 1MVQDGT  URTKEJV GTUVOCNU XQP GKPGO ŋ1TFGPŌ #N /¾TKVQ WPF HÒIV FKG -NCUUG )TCP %TW\ JKP\W &KG PWPOGJT   UGEJU-NCUUGPCDLGV\VCNNGCPDNCWGO$CPFJGK­GP)TQ­MTGW\ )TCP%TW\ ņHÒT5VCCVUQDGTJ·WRVGT)TQ­QHHK\KGT

)TCP1HKEKCN -QOOCPFGWTOKV5VGTP %QOGPFCFQTEQP2NCEC -QOOCPFGWT %QOGPFCFQT 1HHK\KGT 1HKEKCNOKV DNCWGO'OCKN WPF4KVVGT %CDCNNGTQOKVTQVGO'OCKN &GT)TQ­QHHK\KGTTÒEMVGUQOKVCPFKG\YGKVG5VGNNG'TVTWI HQTVCP\WFGO5VGTPFKG/GFCKNNG-NCUUGCPDNCWGO$CPFCO*CNU'KPG4GQTICPKUCVKQPVGKNVGFGP1TFGPKP -QNNCPG %QNNCT  )TQ­MTGW\ )TCP %TW\  )TQ­QHHK\KGT )TCP 1HKEKCN  -QOOCPFGWT %QOGPFCFQT  1HHK\KGT  

1HKEKCN  WPF 4KVVGT %CDCNNGTQ  WPF ICD FGP 5VGTPGP KJTG JGWVKIG (QTO &KG PGW GKPIGHÒJTVG -QNNCPG YCT WPF KUV   CWUUEJNKG­NKEJ5VCCVQDGJ·WRVGTPXQTDGJCNVGP&KG1TFGPUKPUKIPKGPYWTFGPDKUXQP#TVJWU$GTVTCPFKP2CTKUWPF UGKVJGTCWUUEJNKG­NKEJXQP'OKNKQ*QWTUKP5CPVKCIQIGHGTVKIV 8INCWEJ'[\CIWKTTG,CKOG.C1TFGPCN/GTKVQFG %JKNG5CPVKCIQEC5 



8GTFKGPUVOGFCKNNG=/GFCNNCCN/¾TKVQ?D\Y8GTFKGPUVQTFGP CD /QFGNN  D\Y /QFGNN  8GTFKGPUVOGFCKNNGD\Y8GTFKGPUVOGFCKNNG-NCUUG5KNDGTCOUR·VGTGP$CPF 1#05 ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T



8GTFKGPUVOGFCKNNG =/GFCNNC CN /¾TKVQ? D\Y 8GTFKGPUVQTFGP CD    /QFGNN UGKV     -NGKPQF\WO)TQ­MTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTV/GFCKNNQPUWPF-QPFQT$TQP\GXGTIQNFGVXKGT 5VGTPURKV\GPOKV'OCKNNGTGRCTCVWTGPQJPG5EJWNVGTDCPF1#0 ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T



8GTFKGPUVOGFCKNNG =/GFCNNC CN /¾TKVQ? D\Y 8GTFKGPUVQTFGP CD    /QFGNN UGKV     )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUFGMQTCVKQP 5KNDGT WPF $TQP\G XGTIQNFGV WPF GOCKNNKGTV   CO DNCWGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV #WHNCIGP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP   0CFGNOKV\YGK5GKVGPJCMGP$#4916#//81.2'5 +p++

 277


CHILE

9283

9282 9281







8GTFKGPUVOGFCKNNG=/GFCNNCCN/¾TKVQ?D\Y8GTFKGPUVQTFGP CD /QFGNN UGKV -QO OCPFGWTFGMQTCVKQP5KNDGTXGTIQNFGVWPFDNCWGOCKNNKGTV/GFCKNNQPUWPF-QPFQT$TQP\GXGTIQNFGVCO *CNUDCPF\WUCOOGPOKV-PQRHNQEJTQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC*QWTUKP5CPVKCIQ <WUCOOGPOKVQTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP/KPKUVGTKCN TCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  &G\GODGT  WPF 2JQVQMQRKG FGU   8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV LGYGKNKIGO 8GTNGK   JWPIULCJT$#4911#05 ++



8GTFKGPUVOGFCKNNG=/GFCNNCCN/¾TKVQ?D\Y8GTFKGPUVQTFGP CD /QFGNN UGKV -QO OCPFGWTUFGMQTCVKQP5KNDGTWPF$TQP\GXGTIQNFGVWPFGOCKNNKGTVOKP#WUDTÒEJGKPFGP5VGTPURKV\GP -NGDUVQHHTGUVGQJPG*CNUDCPF$#4911#081.2'5 ++p+++



8GTFKGPUVOGFCKNNG=/GFCNNCCN/¾TKVQ?D\Y8GTFKGPUVQTFGP CD /QFGNN UGKV 1HHK \KGTUFGMQTCVKQP 5KNDGT XGTIQNFGV WPF DNCW GOCKNNKGTV /GFCKNNQPU WPF -QPFQT $TQP\G XGTIQNFGV CO   $CPFOKVCWHIGNGIVGT4QUGVVGOKV6TCIGURCPIGOKV0CFGN\WUCOOGPOKV-PQRHNQEJTQUGVVGKOQTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC *QWTU KP 5CPVKCIQ <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU   %JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP1DGTTGIKGTWPIUTCVKO$WPFGURT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV $QPPCO&G\GODGTWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGPWPFCP /ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT$#4911#05 ++



&KGWPVGTGP-NCUUGPFKGUGU1TFGPU 1HHK\KGTWPF4KVVGT UKPFUGJTUGNVGPCWHFGOGWTQR·KUEJGP/CTMV\WHKPFGP

9284

9285



8GTFKGPUVOGFCKNNG=/GFCNNCCN/¾TKVQ?D\Y8GTFKGPUVQTFGP CD /QFGNN UGKV 4KVVGT FGMQTCVKQP5KNDGTXGTIQNFGVWPFTQVGOCKNNKGTV/GFCKNNQPUWPF-QPFQT$TQP\GXGTIQNFGVCO$CPFOKV 6TCIGURCPIG OKV 0CFGN KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC *QWTU KP 5CPVKCIQ $#491    1#05 ++



1TFGPXQP$GTPCTFQ1 *KIIKPU)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFVGKNYGKUG GOCKNNKGTVCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCP0C FGNKO1TKIKPCNGVWKFGT(KTOC*QWTUKP5CPVKCIQ81.2'5 5VÒEM+p++



&KGWPVGTGP-NCUUGPFKGUGU1TFGPU 1HHK\KGTWPF4KVVGT UKPFUGJTUGNVGPCWHFGOGWTQR·KUEJGP/CTMV\WHKPFGP



&KG /GFCKNNG $GTPCTFQ 1ʼn*KIIKPU YWTFG  KP \YGK -NCUUGP CNU 'TYGKVGTWPI FGU 1TFGPU #N/¾TKVQHÒT.GKUVWP IGPXQP#WUN·PFGTPCWHFGO)GDKGVFGT-ÒPUVG9KUUGPUEJCHVGP'T\KGJWPI+PFWUVTKGFGU*CPFGNUWPFFGTJWOC PKV·TGPQFGTUQ\KCNGP<WUCOOGPCTDGKVIGUVKHVGVYWTFGUKGWODGPCPPVKPŋ1TFGP$GTPCTFQ1ʼn*KIIKPUŌWPFCWH XKGT-NCUUGP)TCP1HKEKCN%QOGPFCFQT1HKEKCNWPF%CDCNNGTQGTYGKVGV&KGQDGTUVG-NCUUG)TCP%TW\YWTFG JKP\WIGHÒIV

278


CHILE

9286 (1:1)



-TGW\ HÒT 6CTCRCE±  'OCKNNKGTVG #WUHÒJTWPI HÒT JQJG 1HHK\KGTG )QNF GOCKNNKGTV  I OKP   'OCKNNGEJKRUKPFGP$N·VVEJGPFGU.QTDGGTMTCP\GUCOQTKIKPCNGP$·PFEJGPOKV6TCIGURCPIG 44++

8GTNKGJGPCPFKG6GKNPGJOGTCPFGT5EJNCEJVXQP6CTCRCE± DGK2KUCIWCKP2GTWJGWVGKP%JKNG CO0QXGODGT Y·JTGPFFGUUQIGP2C\KHKUEJGP-TKGIGUXQPDKU\YKUEJGP%JKNGGKPGTUGKVUWPF2GTWWPF$QNKXKGP CPFGTGTUGKVU



9288 9287



/GFCKNNGHÒTFGP(GNF\WIIGIGP.KOC CWEJ.KOC(GNF\WIU-TGW\IGPCPPV 5KNDGTPG/GFCKNNG HÒT7PVGTQHHK\KGTGWPF/CPPUEJCHVGP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKP'OCKNNGTGRCTCVWTGP KOTÒEMUGKVKIGP/GFCKNNQPTKPICOCNVGPDNCWGP$CPFCP6TCIGURCPIGOKV0CFGN ++



8GTFKGPUVOGFCKNNG XQP 5CPVKCIQ FG %JKNG )QNFGPG 8GTFKGPUVOGFCKNNG VGKNYGKUG GOCKNNKGTV CWH FGT   4ÒEMUGKVG9KFOWPIUKPUEJTKHV.C+/WPKEKRCNKFCFFG5CPVKCIQCN'ZEOQ5GÇQT*GKPTKEJ.ÒDMG2TGUK FGPVGFGNNC4GRWDNKEC(GFGTCNFG#NGOCPKC+8%JKNGWPF(GKPIGJCNVURWP\GCO$CPFOKV 6TCIGURCPIG 44+



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T   &GT (GNF\WI PCEJ .KOC KP2GTÐDGICPPKO0QXGODGTWPVGT)GPGTCN$CSWGFCPQ#O,CPWCT YWTFGPFKG5V·FVG.KOCWPF%CNNCQGKPIGPQOOGP<WOGTUVGP,CJTGUVCIFGT'KPPCJOGCO,CPWCTKUVFKG /GFCKNNGFWTEJ)GUGV\IGUVKHVGVYQTFGP0WT\YGK5RCPIGPYWTFGPHÒTUKGCWVQTKUKGTV&KGUKNDGTPG/GFCKNNGKUVGVYC OCNXGTNKGJGPYQTFGP&KGQHHK\KGNNGP(CTDGPFGU$CPFGUUKPFTQVYGK­TQVFKGUKNDGTPGP/GFCKNNGPYWTFGP CDGTOGKUVGPUCPGKPGOTQVGP$CPFIGVTCIGP



'ZGORNCT XQP ITQ­GT 5GNVGPJGKV WPF CWHITWPF FGT 9KFOWPIUKPUEJTKHV CP FGP \YGKVGP $WPFGURT·UKFGPVGP FGT $WP   FGUTGRWDNKM &GWVUEJNCPF XQP JKUVQTKUEJGP +PVGTGUUG 'KP KFGPVKUEJGP 'ZGORNCT LGFQEJ OKV CPFGTGT 9KFOWPIUKP   UEJTKHV CPFKG*GT\QIKPXQP-GPV6CPVG-ÌPKIKP'NKUCDGVJU++ WPF&CVKGTWPIXQPYWTFGCO,WPKDGK /QTVQP'FGPKP.QPFQPKPFGTGP#WMVKQPXGTUVGKIGTV

279


CHINA

9289

9291

9291

%*+0# -#+5'44'+%* $+5  

/KNKV·T/GFCKNNG HÒT FKG 8GTVGKFKIWPI XQP 5JCPIJCK IGIGP FKG 6CKRKPI CWEJ CNU &TCEJGP1TFGP   DG\GKEJPGV  EJKPGUKUEJG 1TKIKPCNCWUICDG   5KNDGTPG /GFCKNNG 5KNDGT OKV QTKIKPCNGT FTGJDCTGT   $CPFTCJG FGT -PQRH \WT (KZKGTWPI FGU 5VKGNU FGT /GFCKNNG CDIGDTQEJGP /GFCKNNG J·NV LGFQEJ  CO   QTKIKPCNGP$CPFOKV$CPFURCPIG5KNDGTWPF6TCIGURCPIGFGTGP0CFGNCDIGDTQEJGP5KNDGT6#//  44++p

'UJCPFGNVUKEJJKGTDGKWOFKGGTUVGEJKPGUKUEJG#WU\GKEJPWPIKPYGUVNKEJGO5VKN5KGYWTFGCO0QXGODGT XQP)GPGTCN.K*WPIEJCPIXQPFGT4GIGPVUEJCHVIGPGJOKIVWPFHÒTDGUQPFGTG8GTFKGPUVG  CPGKPKIG/KVINKGFGT FGT GWTQR·KUEJGP -QPVKIGPVG FKG 5JCPIJCK IGIGP FKG 6CKRKPI XGTVGKFKIV WPF DGUQPFGTU DGK FGT 9KGFGTGTQDGTWPI   XQP -CFKPI OKVIGYKTMV JCVVGP 7PIGH·JT  )QNFGPG WPF  5KNDGTPG /GFCKNNGP YWTFGP XQTYKGIGPF CP   HTCP\ÌUKUEJG 'ORH·PIGT CWUIGIGDGP 'U JCV FGP #PUEJGKP FC­ FKG DTKVKUEJ 8QTUEJNCIUNKUVG OKV FGP 'ORH·PIGTPC   OGP PKEJV TGEJV\GKVKI XQTIGNGIV YQTFGP KUV #WEJ GKPG .KUVG OKV \WU·V\NKEJGP HTCP\ÌUKUEJGP 5QNFCVGP YWTFG PKEJV   DGTÒEMUKEJVKIV &KG /GFCKNNG YWTFG QJPG 7TMWPFG XGTNKGJGP YCU \W FGT H·NUEJNKEJGP #PPCJOG HÒJTVG FC­ CNNG   HTCP\ÌUKUEJGP 5QNFCVGP KP %JKPC \WO 'ORHCPI FGT /GFCKNNG DGTGEJVKIV IGYGUGP Y·TGP &GUJCND YWTFGP FWTEJ   .GOCKVTG%JQDKNNQPWPFYGKVGTGKP2CTKUCPU·UUKIG(KTOGPGKPGITQ­G#P\CJNFKGUGT/GFCKNNGPJGTIGUVGNNV&CTÒDGT JKPCWU MCOGP KP FGP GT ,CJTGPIWVG(·NUEJWPIGPFGT/GFCKNNGCWHFGP/CTMV&CU(GJNGPXQP8GTNGKJWPIUWT MWPFGPJCVVG\WT(QNIGFC­FKG/GFCKNNGKP(TCPMTGKEJPKGQHHK\KGNNCPGTMCPPVGYQTFGPKUV.CWV#WUMWPHVXQP&T /KEJGN )QPVKGT KP #PXGTU FGO YKT CWEJ YGKVGTG YKEJVKIG +PHQTOCVKQPGP XGTFCPMGP JCPFGNV GU UKEJ DGK FGO JKGT   CPIGDQVGPGP'ZGORNCTWOGKPGUFGTYGPKIGPGTJCNVGPGPEJKPUKUEJGP1TKIKPCNGZGORNCTGXQP



4'27$.+-   

1TFGPFGT)QNFGPGPJTG=%JKC*Q*UÒP%JCPI?1TKIKPCNGU5EJWNVGTDCPF\WT-NCUUG)TCF IGNDOKVYGK­GP4CPFUVTGKHGPOODTGKVKOQTKIKPCNGP5GKFGDG\QIGPGP'VWKOKV+PUEJTKHV ++



2CUUGPFHÒTGKP-NGKPQFDKU\WGKPGO&WTEJOGUUGTXQPECOOWPFHÒTGKPGP$TWUVUVGTPDKU\WGKPGO&WTEJOGU UGTXQPECOO

0#6+10#.%*+0##7(6#+9#0 5'+6  

1TFGPXQO5VTCJNGPFGP5VGTP6CKYCPGUKUEJG#WUHÒJTWPI5GVFGT-NCUUGDGUVGJGPFCWU-NGKPQF 5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKPMNGKPG*CCTTKUUGCWHFGT4ÒEMUGKVGEJKPGUKUEJG5EJTKHV\GKEJGPWPF OKV8GTNGKJWPIU\CJNCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTV GKP *CCTTKUU CWH FGT 4ÒEMUGKVG EJKPGUKUEJG 5EJTKHV\GKEJGP WPF OKV 8GTNGKJWPIU\CJN  CP 0CFGN   1#05 5VÒEM4++

'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  &CXQT GZ #WMVKQP /CTU  /GTMWT KP /ÒPEJGP CO  0QXGODGT  0T    &GT PGWPMNCUUKIG \KXKNG   8GTFKGPUVQTFGP YWTFG CO  (GDTWCT  IGUVKHVGV WPF XQP FGT 4GIKGTWPI KP 6CKYCP YGKVGT XGTNKGJGP &KG   +PUKIPKGPFGT-NCUUGJCDGP\YGK5VGTPGCWHFGPQDGTGP5VTCJNGPKO7PVGTUEJKGF\WFGPGPFGT-NCUUGFKGFQTV FTGK5VGTPGCWHYGKUGP

280




DOMINIKANISCHE REPUBLIK

9293

9292

81.-54'27$.+- 5'+6  

'JTGP\GKEJGPFGT5QYLGVKUEJ%JKPGUKUEJGP(TGWPFUEJCHV$TQP\GVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEM UGKVG6T·IGTPWOOGTCP6TCIGURCPIGKOQTKIKPCNGP8GTNGKJWPIUGVWK\WUCOOGPOKV8GTNGKJWPIUDÒ EJNGKPKPTWUUKUEJGTWPFEJKPGUKUEJGT5RTCEJGOKVÒDGTGKPUVKOOGPFGT8GTNGKJWPIUPWOOGTFCVKGTV 4++



&1/+0+-#0+5%*'4'27$.+- 

1TFGP XQP ,WCP 2CDNQ &WCTVG )TQ­MTGW\UGV HÒT <KXKNXGTFKGPUV DGUVGJGPF CWU -NGKPQF 5KNDGT VGKN   YGKUGXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVQJPG5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGV VGKNYGKUG GOCKNNKGTV OGJTGTG *CCTKUUG KP FGP -TGW\GEMGP CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJ   PWPIFGT(KTOC8KNCTFGDQ4KGTCKP*CXCPPCCP0CFGN1#081.2'5 ++



2T·UKFGPV)GPGTCNKUUKOWU&T4CHCGN.GQPKFCU6TWLKNNQ/QNKPC  JCVFGP1TFGPCO(GDTWCT\W 'JTGP FGU *GNFGP FGU 7PCDJ·PIKIMGKVUMTKGIGU IGIGP *CKVK IGUVKHVGV 'T KUV KP UKGDGP -NCUUGP XGTNKGJGP YQTFGP   YQDGK GU GKP )QNFGPGU )TQ­MTGW\ WPF GKP )TQ­MTGW\ ICD $GK /KNKV·TXGTFKGPUV VTCIGP FKG +PUKIPKGP IGMTGW\VG   5EJYGTVGT/KV&GMTGVXQO5GRVGODGTYWTFGGTFWTEJFGPPGWIGUVKHVGVGP1TFGPXQP&WCTVG5CPEJG\WPF /GNNCCDIGNÌUV

9294

'%7#&144'27$.+- 

0CVKQPCNGT 8GTFKGPUVQTFGP  /QFGNN CD   )TQ­MTGW\UGV DGUVGJGPF CWU -NGKPQF 5KNDGT   XGTIQNFGV WPF GOCKNNKGTV CO PKEJV ICP\ MQTTGMVGP 5EJWNVGTDCPF TGKP IGND QJPG FKG DGKFGP TQVGP WPF   DNCWGP 4CPFUVTGKHGP  WPF $TWUVUVGTP  #WUHÒJTWPI 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV   'OCKNNGOCNGTGKCP0CFGNFKGUGOKV-QRHRWP\GPCEJTGEJVU1#05 ++



&GT 1TFGP KUV CO  1MVQDGT  YQJN KO *KPDNKEM CWH FGP  ,CJTGUVCI FGT 5EJNCEJV XQP 2KPEJKPEJC CO    /CK   XQP 2T·UKFGPV ,QU¾ .WKU 6COC[Q IGUVKHVGV YQTFGP &KG )GUVCNVWPI FGU GTUVGP /QFGNNU FGU \WP·EJUV   FTGKMNCUUKIGP1TFGPU GTUVG-NCUUGKP)QNF\YGKVG-NCUUGKP5KNDGTWPFFTKVVG-NCUUGKP$TQP\G KUVFGT2KPEJKPEJC /GFCKNNGXQPPCEJGORHWPFGPYWTFGGTOKV&GMTGV0TXQO,WPKCWHUGEJU-NCUUGPGTYGKVGTVWPF FKG+PUKIPKGPPGWIGUVCNVGV<WGKPGOUR·VGTGP<GKVRWPMVKUVFCU#WUUGJGPFGU$TWUVUVGTPUPQEJGKPOCNKPFKGIGIGP Y·TVKIG(QTOXGT·PFGTVYQTFGP

281


ELFENBEINKÜSTE

9296

9295

'.('0$'+0-ª56'4'27$.+- 

0CVKQPCNQTFGP FGT 'NHGPDGKPMÒUVG 1HHK\KGTUMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV 'OCKNNG   CDRNCV\WPIGP KO /GFCKNNQPTKPI CO $CPF OKV CWHIGNGIVGT 4QUGVVG \WUCOOGP OKV -PQRHNQEJTQUGVVG KO    QTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC#%JQDKNNQPKP2CTKUOKVDGKIGHÒIVGO<GVVGNOKV+PHQTOCVKQPGP ÒDGTFGP1TFGP<WUCOOGPOKVQTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒT FGP /KPKUVGTKCNTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  1MVQDGT  WPF   2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV   LGYGKNKIGO8GTNGKJWPIULCJT81.2'5 ++



)#$704'27$.+- 

1TFGPFGUSWCVQT5VGTPU/QFGNN CWHFGT4ÒEMUGKVGOKVHTCP\ÌUKUEJGT6TKMQNQTGKO5VCCVUYCRRGP   -QOOCPFGWTFGMQTCVKQP 5KNDGT RWP\KGTV XGTIQNFGV WPF GOCKNNKGTV #DURNKVVGTWPIGP WPF   4KUUGKPFGTDNCWGP'OCKNNGCWH8QTFGTWPF4ÒEMUGKVGCO*CNUDCPF\WUCOOGPOKV-PQRHNQEJTQUGVVG KO1TKIKPCNGVWKFGT(KTOC#TVJWU$GTVTCPFKP2CTKU41((5 44++p+++



#WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU  &GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG OKV &GMTGV 0T  XQO  #WIWUV  IGUVKHVGV $GTGKVU     PCEJ'TNCPIWPIFGT7PCDJ·PIKIMGKVYWTFGFCU4ÒEMUGKVGP/GFCKNNQPFWTEJ'PVHGTPWPIFGTHTCP\ÌUKUEJGP6TKMQNQTG CDIG·PFGTV

9297



0CVKQPCNGT 8GTFKGPUVQTFGP )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUFGMQTCVKQP 5KNDGT XGTIQNFGV   WPF GOCKNNKGTV CO $CPF OKV CWHIGNGIVGT 4QUGVVG WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCP0CFGNFKGUGRWP\KGTVOKV\YGK5GKVGPJCMGP\WUCOOGPOKV-PQRHNQEJTQUGVVGKO'VWKFGT (KTOC #TVJWU $GTVTCPF KP 2CTKU <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU #WUY·TVKIGP   #OVGU HÒT FGP /KPKUVGTKCNFKTKIGPVGP KO #WUY·TVKIGP #OV *GNOWV /ÒNNGT FCVKGTV $QPP CO  ,CPWCT   WPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGP OKVLGYGKNKIGO8GTNGKJWPIULCJT81.2'5 5VÒEM4+p++ 0CEJHTCP\ÌUKUEJGO8QTDKNFYKTFKPFKGUGT-NCUUGMGKPG*CNUFGMQTCVKQPUQPFGTPFKG1HHK\KGTUFGMQTCVKQP\WUCOOGP OKVFGO$TWUVUVGTPXGTNKGJGPWPFIGVTCIGP

282




GHANA

9299

9298

ex 9300



0CVKQPCNGT 8GTFKGPUVQTFGP )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUFGMQTCVKQP 5KNDGT XGTIQNFGV   WPF GOCKNNKGTV CO $CPF OKV CWHIGNGIVGT 4QUGVVG WPF $TWUVUVGTP 5KNDGT VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCP0CFGNFKGUGRWP\KGTVOKV\YGK5GKVGPJCMGP\WUCOOGPOKV-PQRHNQEJTQUGVVGKO'VWKFGT (KTOC#TVJWU$GTVTCPFKP2CTKU81.2'5 5VÒEM+p++ 0CEJHTCP\ÌUKUEJGO8QTDKNFYKTFKPFKGUGT-NCUUGMGKPG*CNUFGMQTCVKQPUQPFGTPFKG1HHK\KGTUFGMQTCVKQP\WUCOOGP OKVFGO$TWUVUVGTPXGTNKGJGPWPFIGVTCIGP



)*#0#4'27$.+- 



8QNVC1TFGP 1HHK\KGTUUGV DGUVGJGPF CWU -NGKPQF 5KNDGT VGKNYGKUG XGTIQNFGV CO QTKIKPCNGP   5EJWNVGTDCPF UKE WPF*CNUFGMQTCVKQP UKE 5KNDGTVGKNYGKUGXGTIQNFGVCO*CNUDCPFDGKFG+PUKIPKGP CWH FGT 4ÒEMUGKVG OKV -NCUUGPDG\GKEJPWPI KP GPINKUEJGT 5RTCEJG \WUCOOGP OKV /KPKCVWT 5KNDGT   VGKNYGKUG XGTIQNFGV CO $·PFEJGP -PQRHNQEJTQUGVVG WPF $CPFUEJPCNNG KO QTKIKPCNGP OKV IQNFHCTDGPGT   -NCUUGPDG\GKEJPWPI DGFTWEMVGP 8GTNGKJWPIUGVWK FGU -TQPLWYGNKGTU )CTTCTF  %Q KP .QPFQP   <WUCOOGPOKVQTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGPGJGOCNKIGP $QVUEJCHVGTWPF8QTVTCIGPFGP.GICVKQPUTCV+-NCUUGKO#WUY·TVKIGP#OV*GNOWV/ÒNNGTFCVKGTV$QPP CO  ,WNK  WPF \YGK &WTEJUEJTKHVGP QHHK\KGNNGT 5EJTGKDGP FKG 8GTNGKJWPI DGVTGHHGPF UQYKG   2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV   LGYGKNKIGO8GTNGKJWPIULCJT$74-'5 5VÒEM44++



*10&74#54'27$.+-

1TFGP FGT JN 4QUC WPF XQP FGT <KXKNKUCVKQP )TQ­MTGW\UGV FGT \KXKNGP #DVGKNWPI DGUVGJGPF CWU   -NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTV#WHFGT4ÒEMUGKVGOKP'OCKNNG#DURNKVVGTWPIGP/GFCKNNQPTKPI WPF KP GKPGT -TGW\URKV\G CWH FGO -TCP\DCPF HTCP\ÌUKUEJG GT 5KNDGTRWP\G XQP  DKU   

9KNFUEJYGKPMQRH COQTKIKPCNGP\GKVIGPÌUUKUEJGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTDTKNNCPVKGTVWPF TGRGTEKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV MCWO UKEJVDCTG -TCV\GT KP FGT YGK­GP 'OCKNNG CWH FGT   4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC$QWNCPIGTKP2CTKU 4WGFGNC2CKZ CP0CFGNFKGUGWPF FGT 0CFGNJCMGP OKV HTCP\ÌUKUEJGT GT 5KNDGTRWP\G XQP  DKU  9KNFUEJYGKPMQRH  WPF \YGK   5GKVGPJCMGP1#05 5VÒEM+++p++  &GT 1TFGP YWTFG XQO 2T·UKFGPVGP WPF )GPGTCNMCRKV·P ,WCP /CTKC /GFKPC KP HÒPH -NCUUGP WPF FTGK #DVGKNWPIGP  

\KXKNGT8GTFKGPUVOKNKV·TKUEJGT8GTFKGPUVWPFTGNKIKÌUGT8GTFKGPUV CO(GDTWCTIGUVKHVGV5VCVWVGPYWTFGP CO5GRVGODGTRWDNK\KGTV&GT1TFGPYWTFGHÒTXKGNHCEJG8GTFKGPUVGCWEJHKPCP\KGNNGXGTNKGJGP'TYWTFG UEJQP  XQO NKDGTCNGP 2T·UKFGPVGP %CTNQU #TKCU CDIGUEJCHHV /GFKPC YWTFG  GTUEJQUUGP 5R·VGT YKGFGTGT   YGEMV YWTFG FGT 1TFGP  XQO -QPITGUU GPFIÒNVKI CWHIGJQDGP 'T YWTFG XQP GKPGO 1TFGPUTCV XGTNKGJGP FKG   8GTNGKJWPIGP UQNNVGP XQO -QPITGUU DGUV·VKIV WPF XQO 2T·UKFGPVGP WPVGTUEJTKGDGP YGTFGP )TQUUMTGW\G FWTHVGP FKG   7PKHQTO GKPGU &KXKUKQPUIGPGTCNU )TQUUQHHK\KGTG FKG GKPGU $TKICFGIGOGTCNU -QOOCPFGWTG FKG GKPGU 1DGTUVGP WPF   1HHK\KGTG FKG GKPGU 1DGTUVNKGWVGPCPVU VTCIGP 8IN CWEJ %WQOQ 4CHCGNG KP %71/ 5    6TQV\ FGT   IGTKPIGP 5VÒEM\CJN YWTFGP FKG +PUKIPKGP XQP *CNNG[ .GOCKVTG WPF $TKSWGV(C[QNNG JGTIGUVGNNV<WU·V\NKEJXGTVTKGD $QWNNCPIGT FKG +PUKIPKGP XQP .GOCKVTG  7PVGT FGP )TQUUMTGW\GP FGU 1TFGPU YCT PGDGP (ÒTUV #NDGTV + XQP /Q   PCEQ -ÌPKI 8KMVQT 'OCPWGN ++ XQP +VCNKGP -CKUGT 0CRQNGQP +++ -ÌPKI .GQRQNF ++ FGT $GNIKGT WPF -ÌPKI &QO   .WKUXQP2QTVWICNCWEJ(TCP¼QKU/CTVKPFGT'THKPFGTFGU/CTVKP#PMGTU 8INCWEJ)4+6<5HH 

283


INDONESIEN

9302

9303

9301



9304

1TFGPFGTJN4QUCWPFXQPFGT<KXKNKUCVKQP1HHK\KGTUMTGW\FGT\KXKNGP#DVGKNWPI5KNDGTXGTIQNFGV WPF GOCKNNKGTV OKP 'OCKNNGEJKRU KP \YGK -TGW\URKV\GP WPF KP GKPKIGP .QTDGGTDN·VVGTP CWH FGO   -TCP\DCPF HTCP\ÌUKUEJGGT5KNDGTRWP\GXQPDKU 9KNFUEJYGKPMQRH COQTKIKPCNGP$CPF OKVCWHIGNGIVGT4QUGVVG1#0 ++



'Z #WMVKQP  1TFGP CWU CNNGT 9GNV  5COONWPI 6COOCPP FGT 7$5 KP $CUGN CO  7PF  0QXGODGT    .QV0T&KG+PUKIPKGPFGTWPVGTGP-NCUUGPUKPFYGKVCWUUGNVGPGT\WHKPFGPCNUFKGLGPKIGPFGTQDGTGP-NCUUGP

+0&10'5+'04'27$.+- 

1TFGP XQO 5VGTP FGT 4GRWDNKM +PFQPGUKGP &GMQTCVKQP  -NCUUG $TQP\G VGKNYGKUG XGTUKNDGTV   VGKNYGKUGXGTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPFOKVCWHIGNGIVGT4QUGVVG\WUCOOGPOKV+PVGTKOUURCPIG KO CWHYGPFKI IGUEJPKV\VGP QTKIKPCNGP JÌN\GTPGP 8GTNGKJWPIUGVWK DGNGIV OKV OGVCNNGPGO 5VCCVYCRRGP   <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP   1DGTTGIKGTWPIUTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  /·T\  WPF   2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV   LGYGKNKIGO8GTNGKJWPIULCJT81.2'5 ++



+4#- -¤0+)4'+%*+4#-   

1TFGPFGT<YGK(NÒUUG 'N4CHKFCKP1TFGP /QFGNN OKV-TQPGKO/GFCKNNQP &GMQ TCVKQP  -NCUUG HÒT <KXKNXGTFKGPUV 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF KO   QTKIKPCNGP8GTNGKJWPIUGVWKFGUDTKVKUEJGP-TQPLWYGNKGTU)CTTCTFKP.QPFQP1#0 +p++



&CKO'VWK$[CRRQKPVOGPVVQ*/6JG3WGGPUVGJVJCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPI\YKUEJGP  6JTQPDGUVGKIWPI-ÌPKIKP'NKUCDGVJU++ WPF 'PFGFGT/QPCTEJKGKO+TCM   &GT1TFGPKUVXQP-ÌPKI(CKUCN)JC\K+CNUHÒPHMNCUUKIGTCNNIGOGKPGT8GTFKGPUVQTFGPIGUVKHVGVYQTFGP0CEJ FGT #WUTWHWPI FGT 4GRWDNKM YWTFG FGT 1TFGP CO  /CK  DGUV·VKIV WPF GTJKGNV OKV INGKEJGO &CVWO PGWG   5VCVWVGP &KG DKUJGTKIG -TQPG KO /GFCKNNQP FGT 8QTFGTUGKVG YWTFG FWTEJ FCU 5VCCVYCRRGP CWUIGVCWUEJV 9GKVGTG   MNGKPG 8GT·PFGTWPIGP FGT +PUKIPKGP GTHQNIVGP  WPF  8IN CWEJ .KV 4CY4GGU 1YCKP 6JG 1TFGTU   &GEQTCVKQPUCPF/GFCNUQHVJG-KPIFQOQH+TCS+P,QWTPCNQHVJG1TFGTUCPF/GFCNU5QEKGV[QH#OGTKEC0Q

 5 



1TFGPFGT<YGK(NÒUUG 'N4CHKFCKP1TFGP /QFGNN OKV-TQPGKO/GFCKNNQP &GMQ TCVKQP-NCUUGHÒT<KXKNXGTFKGPUVCO$CPFHÒT-TKGIUXGTFKGPUV  5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO $CPFHÒT-TKGIUXGTFKGPUVOKVCWHIGNGIVGT-TQPGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGUDTKVKUEJGP-TQPLWYG NKGTU)CTTCTFKP.QPFQP 4++



&CKO'VWK$[CRRQKPVOGPVVQ*/6JG3WGGPUVGJVJCPFGNVGUUKEJJKGTDGKWOGKPG#PHGTVKIWPI\YKUEJGP  6JTQPDGUVGKIWPI-ÌPKIKP'NKUCDGVJU++ WPF 'PFGFGT/QPCTEJKGKO+TCM 



284

-QPXQNWV XQP  XGTUEJKGFGPGP KTCMKUEJGP #WU\GKEJPWPIGP FGU -ÌPKITGKEJU WPF FGT 4GRWDNKM   &CTWPVGT 5KNDGTPG -TÌPWPIUOGFCKNNG -ÌPKI (CKUCNU ++  5KNDGTPG /GFCKNNG -ÌPKI (CKUCNU + HÒT   CMVKXGP &KGPUV $TQP\GPG /GFCKNNG -ÌPKI (CKUCNU + HÒT CMVKXGP &KGPUV #NNIGOGKPG &KGPUVOGFCKNNG   -ÌPKI(CKUCNU++HÒTFKG2QNK\GK)QNFGPGWPF5KNDGTPG/GFCKNNGHÒTFGP(TKGFGPOKVFGP-WTFGP 8GTUEJKGFGPG/GVCNNGVGKNUXGTIQNFGVVGKNUXGTUKNDGTVVGKNUGOCKNNKGTVKPQTFGPVNKEJGT'TJCNVWPICNNGDKU CWHGKPGCPMQTTGMVGP$·PFGTP 5VÒEM++




ISRAEL

9308 9309

9306

9307

9310

+54#'. 



)QNFGPG /GFCKNNG HÒT 'JTGPOKVINKGFGT FGU 1DGTUVGP 4CVGU FGU 1TFGPU #D %JCQ KP +UTCGN   8GTIQNFGV CP $CPFTCJG OKV $CPF WPF CWHIGNGIVGT $CPFURCPIG CP 6TCIGURCPIG KO QTKIKPCNGP   8GTNGKJWPIUGVWK 4++



7PDGMCPPVGU #D\GKEJGP OKV JGDT·KUEJGP 5EJTKHV\GKEJGP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CWH FGT   4ÒEMUGKVGDG\GKEJPGVl6TGDQT4GIGYWPFPWOOGTKGTVCP5EJTCWDUEJGKDGKO'VWK ++



'UFÒTHVGUKEJJKGTDGKWOGKPTGKPGU2JCPVCUKGRTQFWMVJCPFGNP

,#2#0-#+5'44'+%* 



1TFGP FGT #WHIGJGPFGP 5QPPG =-[QMWLKVUWUJQ? &GMQTCVKQP  -NCUUG D\Y )QNFGPG 5VTCJNGP CO   *CNUDCPF -[QMWLKVUW %JWLWUJQ  5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO IGP·JVGP *CNUDCPF OKV /GVCNN   UEJNKG­GP1#081.2'5 ++



1TFGPFGT#WHIGJGPFGP5QPPG=-[QMWLKVUWUJQ?&GMQTCVKQP-NCUUGD\Y)QNFGPG5VTCJNGPCO*CNU DCPF -[QMWLKVUW%JWLWUJQ 5KNDGTXGTIQNFGVWPFGOCKNNKGTVCOIGP·JVGP*CNUDCPFOKV/GVCNNUEJNKG­GP KOQTKIKPCNGPUEJYCT\GP.CEMGVWKOKVIQNFHCTDGPGT#WHUEJTKHV1#081.2'5 +



1TFGPFGU)GJGKNKIVGP5EJCV\GU=<WKJQUJQ?GTUVGU/QFGNN QJPG2CWNQYPKC$NÒVGCNUªDGTJÌJWPI   $TWUVUVGTP  -NCUUG 5KNDGT XGTIQNFGV WPFGOCKNNKGTVGKPKIGMCWOUKEJVDCTG*CCTTKUUGCP 0CFGNOKV\YGK5GKVGPJCMGP1#0 ++



#WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU



&GT $TWUVUVGTP FGU GTUVGP /QFGNNU   YKTF CNNGKPG QJPG YGKVGTG +PUKIPKGP YKG *CNU QFGT $TWUVMTGW\   XGTNKGJGPWPFIGVTCIGP  &GT1TFGPKUVCO,CPWCTFWTEJ-CKUGT/GKLKVGPPQ /WVUWJKVQņ OKV-CKUGTNKEJGO'FKMV0T IGUVKHVGV YQTFGP 'T YWTFG XQO <GKVRWPMV FGT 5VKHVWPI CP KP  -NCUUGP XGTNKGJGP FKG CWEJ DGIKPPGPF OKV FGT  -NCUUGCNU)TQ­MTGW\UVWHGCNUUQNEJGDG\GKEJPGVYWTFGP$GTGKVUCO/CKKUVFGT1TFGPFWTEJMCKUGTNKEJGU 'FKMV CWEJ HÒT (TCWGP \WI·PINKEJ IGOCEJV YQTFGP &GPPQEJ UKPF UGKVJGT PWT YGPKIG 8GTNGKJWPIGP CP (TCWGP   KPUDGUQPFGTG KP FGP JÌJGTGP -NCUUGP XQTIGPQOOGP YWTFGP &KG  FWTEJIGHÒJTVG 4GXKUKQP XGT·PFGTVG \WP·EJUV   FKG ·W­GTG 'TUEJGKPWPIUHQTO FGU -NGKPQFU FGO CNU ªDGTJÌJWPI ·JPNKEJ FGO 1TFGP FGT #WHIGJGPFGP 5QPPG GKP   YGK­ WPF TQV GOCKNNKGTVGU 2CWNQYPKC$NCVV OKV $NÒVGPUV·PFGP DGKIGHÒIV YWTFG YKG CWEJ FCU 1TFGPUDCPF FGUUGP   )TWPFHCTDGXQPNGKEJVGOJKOOGNDNCWYGK­KPKPVGPUKXGUJGNNDNCWIG·PFGTVYWTFG&CTÒDGTJKPCWUYWTFGFGT1TFGP FWTEJGTUCV\NQUG5VTGKEJWPIFGTDKUJGTKIGPUKGDVGPWPFCEJVGP-NCUUGCWHUGEJU5VWHGPTGFW\KGTV

285


JORDANIEN

9311 9312



1TFGPFGU)GJGKNKIVGP5EJCV\GU=<WKJQUJQ?/QFGNN  &GMQTCVKQPFGT-NCUUG5KNDGT XGTIQNFGVWPFGOCKNNKGTVQJPG*CNUDCPF1#06#//81.2'5 ++





1TFGPFGT)QNFGPGP9GKJG5COONGTCPHGTVKIWPIFGU-NGKPQFUFGT-NCUUGXGTIQNFGVWPFGOCKNNKGTV QJPG$CPF +p++



*GTXQTTCIGPFIGCTDGKVGVGU'TUCV\UVÒEMHÒTGKPGUGJTVGWGTGUWPFPWTUGJTUEJYGT\WDGUEJCHHGPFGU1TKIKPCNGZGORNCT

9313

,14&#0+'0'/+4#664#05,14&#0+'0  70& *#5%*'/+6+5%*'5-¤0+)4'+%* 5'+6  

1TFGPFGT9KGFGTIGDWTV #N0CJFC1TFGP /QFGNN UGKV 5GVFGT-NCUUGDGUVGJGPFCWU -NGKPQF5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGCTCDKUEJG*GTUVGNNGTDG\GKEJPWPIFGT (KTOC$KEJC[KP-CKTQCOQTKIKPCNGP5EJWNVGTDCPFVGKNWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTV OGJTGTG MNGKPG #WUDTÒEJG KP FGT TQVGP 'OCKNNG CWH FGT 4ÒEMUGKVG CTCDKUEJG *GTUVGNNGT   DG\GKEJPWPI CP 0CFGN OKV \YGK 5GKVGPJCMGP KO 1TKIKPCNGVWK OKV IQNFGP IGFTWEMVGO 5VCCVUYCRRGP   1#0 5VÒEM4+++++ 'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T   7TURTÒPINKEJ XGTNKGJGP CP FGP LQTFCPKUEJGP 2TGOKGTOKPKUVGT 'OKT *WUUGKP KDP 0CUT   GKPGP   8GVVGT -ÌPKI #DFWNNCJU + XQP ,QTFCPKGP FGUGP 1TFGPUPCEJNC­ CO  1MVQDGT  DGK 5QVJGD[ U KP .QPFQP   XGTUVGKIGTVYWTFG 0T   1DYQJNQHHK\KGNNUEJQPIGUVKHVGVHCPFGPFKGGTUVGP8GTNGKJWPIGPGTUVCO1MVQDGTUVCVV&GT1TFGPYCT CPH·PINKEJ CNU GT PQEJ CP CP GKPGT -QTFGN UVCVV CP GKPGO $CPF IGVTCIGP YWTFG CWH FKG 6GKNPGJOGT CO #WUHUVCPF   IGIGPFKG6ÒTMGPDGUEJT·PMV'TYWTFGURCTUCOXGTNKGJGPJCWRVU·EJNKEJCPDTKVKUEJG1HHK\KGTG&GT1TFGPYWTFGKP GVYCU XGT·PFGTVGT (QTO  XQO 'OKTCV 6TCPULQTFCPKGP ÒDGTPQOOGP CWU FGO UR·VGT FCU -ÌPKITGKEJ ,QTFCPKGP   JGTXQTIKPI=8IN4CY4GGU1YCKP6JG1TFGTUCPF/GFCNUQHVJG-KPIFQOQH*GLC\+P,QWTPCNQHVJG1TFGTU CPF/GFCNU5QEKGV[QH#OGTKEC  0T5?

286




KAMBODSCHA

9317

ex 9318

ex 9314

9315 9316



9319

1TFGPFGU5VGTPUXQP,QTFCPKGP #N-CYMCD1TFGP &GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGDTKNNCP VKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTRWP\GFGT(KTOC)CTTCTF%QWPF $KTOKPIJCOGT,CJTGURWP\G1HÒTCO*CNUDCPFRNWU\WU·V\NKEJGO\YGKVGP$CPFCDUEJPKVV\WUCO OGP OKV /KPKCVWT 5KNDGT VGKNYGKUG DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   OGJTHCEJ RWP\KGTV CO $·PFEJGP WPF -PQRHNQEJTQUGVVG KO 1TKIKPCNGVWK <WUCOOGP OKV QTKIKPCNGT   #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP 1DGTTGIKGTWPIUTCV KO $WPFGU   RT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPPCO,WPKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP \YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT1#0  5VÒEM+p++



-#/$1&5%*# '456'5 -¤0+)4'+%* $+5  

-ÌPKINKEJGT 5QYCVJCTC1TFGP 1HHK\KGTUFGMQTCVKQP $TQP\G XGTIQNFGV VGKNYGKUG GOCKNNKGTV CO $CPF   OKVCWHIGNGIVGT4QUGVVG1#0 +



&GT WTURTÒPINKEJ FTGKMNCUUKIG 1TFGP HÒT 8GTFKGPUVG WO FKG .CPFYKTVUEJCHV YWTFG OKV -ÌPKINKEJGT 1TFQPCP\ XQO   ,WPKIGUVKHVGVWPFCO#WIWUVCWHHÒPH-NCUUGPGTYGKVGTV0CEJ#DUEJCHHWPIFGT/QPCTEJKG YWTFG GT PKEJV OGJT XGTNKGJGP 0CEJFGOFKG/QPCTEJKGKP-CODQFUEJCYKGFGTGKPIGHÒJTVYQTFGPYCTGTPGWGTVG -ÌPKI0QTQFQO5KJCPQWMFGP1TFGPOKVMÌPKINKEJGO&GMTGV0TXQO1MVQDGT



-ÌPKINKEJGT/QPKUGTCRJQP1TFGP4KVVGTFGMQTCVKQP$TQP\GXGTIQNFGVCOQTKIKPCNGPCNVGP$CPF

++



#NU \WP·EJUV GKPMNCUUKIGT 1TFGP HÒT 8GTFKGPUVG WO .KVGTCVWT WPF 9KUUGPUEJCHV YWTFG GT PCEJ FGO 8QTDKNF FGT   HTCP\ÌUKUEJGP #MCFGOKUEJGP2CNOGP OKVMÌPKINKEJGT1TFQPPCP\XQO(GDTWCTIGUVKHVGVCWHFTGKWPF CWHHÒPH-NCUUGPGTYGKVGTV0CEJ#DUEJCHHWPIFGT/QPCTEJKGYWTFGGTPKEJVOGJTXGTNKGJGP0CEJFGO FKG /QPCTEJKG KP -CODQFUEJC YKGFGT GKPIGHÒJTV YQTFGP YCT GTPGWGTVG -ÌPKI 0QTQFQO 5KJCPQWM FGP 1TFGP OKV   MÌPKINKEJGO&GMTGV0TXQO1MVQDGT



-ÌPKINKEJG 8GTFKGPUVOGFCKNNG )QNFGPG 8GTFKGPUVOGFCKNNG FGU -ÌPKIU 5KUQYCVJ +  #WUICDG OKV   MCODQFUEJCPKUEJGT-ÌPKIUMTQPG5KNDGTXGTIQNFGVCO$CPF ++





-ÌPKINKEJG 8GTFKGPUVOGFCKNNG   )QNFGPG 8GTFKGPUVOGFCKNNG FGU -ÌPKIU 5KUQYCVJOQPKXQPI 5KNDGT   XGTIQNFGV $TQP\GPG8GTFKGPUVOGFCKNNGFGU-ÌPKIU0QTQFQO5WTCOCTKV$TQP\G,GYGKNUCP$·PFGTP 5VÒEM++



-#/'4704'27$.+- 

0CVKQPCNGT 1TFGP FGT 6WIGPF XQP -COGTWP =1TFTG 0CVKQPCN FG NC 8CNGWT FW %COGTQWP?   -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO *CNUDCPF \WUCOOGP OKV   -PQRHNQEJTQUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC #TVJWU $GTVTCPF KP 2CTKU <WUCOOGP OKV   QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP /KPKUVGTKCNTCV KO   $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  ,WPK  WPF2JQVQMQRKGFGU8GT\GKEJPKUUGU XQP\YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT81.2' 5 +p++

 287


KOLUMBIEN

9321

9323 9320





9322

9324

0CVKQPCNGT1TFGPFGT6WIGPFXQP-COGTWP=1TFTG0CVKQPCNFGNC8CNGWTFW%COGTQWP?1HHK\KGTU FGMQTCVKQP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO $CPF OKV CWHIGNGIVGT 4QUGVVG KO QTKIKPCNGP   8GTNGKJWPIUGVWK FGT (KTOC #TVJWU $GTVTCPF KP 2CTKU <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI   FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP 1DGTTGIKGTWPIUTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT   FCVKGTV$QPPCO,WPKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGPWPFCP /ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT81.2'5 ++



'JTGP\GKEJGPFGT$GYCHHPGVGP5VTGKVMT·HVGXQP-COGTWPZOO5KNDGTVGKNYGKUGXGTIQNFGV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC &TCIQ KP 2CTKU WPF 5KNDGTRWP\G #4)'06 KO   QTKIKPCNGP8GTNGKJWPIUGVWK 4++



#WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU

-1.7/$+'04'27$.+- 

$Q[CEC1TFGP4KVVGTMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVGKPKIG'OCKNNGUEJ·FGPKO#XGTUWPF4G XGTUOGFCKNNQPQJPG$CPF$#4911#081.2'5 ++p+++



&KG DGKFGP WPVGTGP -NCUUGP FKGUGU 1TFGPU UKPF KP 'WTQRC CWH FGO /CTMV YGKVCWU UGNVGPGT \W HKPFGP CNU FKG FTGK   JÌJGTGP-NCUUGP  /KV &GMTGV 0T  XQO  #WIWUV  YCPFGNVG 2T·UKFGPV /KIWGN /GPFG\ FCU -TGW\ KP GKPGP UGEJUMNCUUKIGP   <KXKN WPF /KNKV·T8GTFKGPUVQTFGP WO 5GKPG LGV\KIGP 5VCVWVGP FGU KP\YKUEJGP PGWPMNCUUKIGP 1TFGPU -QNNCPG FGU   )TQ­OGKUVGTU CW­GTQTFGPVNKEJGU )TQ­MTGW\ )TQ­MTGW\ 5KNDGTMTGW\ )TQ­QHHK\KGT -QOOCPFGWT 1HHK\KGT WPF   4KVVGT  FCVKGTGP CWU FGO ,CJT  8IN CWEJ -NKGVOCP -WTV 5EJTCFGT 4WFQNHQ WPF 9GJNKUEJ *GKP\ &KG   )GUEJKEJVGFGU-TGW\GUWPF1TFGPUXQP$Q[CEC+P1TFGPUMWPFG0T$GTNKP ! 



/KNKV·T8GTFKGPUVQTFGP #PVQPKQ 0CTKÇQ -TGW\  -NCUUG XGTIQNFGV CO QTKIKPCNGP $CPF OKV \YGK   CWHIGNGIVGP 5VGTPGP OKV 6TCIGURCPIG \WUCOOGP OKV /KPKCVWT XGTIQNFGV CO $·PFEJGP WPF   GOCKNNKGTVGT7PKHQTOUEJPCNNGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC(KDQKP$QIQVC81.2'5 4+p++ #WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU  &GTUGEJUMNCUUKIG1TFGPYWTFGIGUVKHVGV



-1/1457.6#0#6)4155-1/14 

1TFGP FGU 5VGTPU XQP )TQ­-QOQT =1TFTG FG N —VQKNG FG NC )TCPFG %QOQTG?  /QFGNN     1HHK\KGTUFGMQTCVKQP$TQP\GVGKNYGKUGDTKNNCPVKGTVXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO$CPFOKV CWHIGNGIVGT4QUGVVG1#0 + #NUGKPMNCUUKIGT1TFGPXQP5WNVCP5CKF/QJCOOGFXQPIGUVKHVGV5WNVCP5CKF#NKDKP5CKF1OCTGTNKG­CO ,CPWCTFKG5VCVWVGPWPFGTYGKVGTVGKJPCWHHÒPH-NCUUGPWPFICDFGP+PUKIPKGPGKPGPGWG)GUVCNVWPI'T YWTFG DKU \WT 7PCDJ·PIKIMGKV XQP (TCPMTGKEJ D\Y \WT 'VCDNKGTWPI FGT PGWGP(ÌFGTCNGP+UNCOKUEJGP4GRWDNKMFGT %QOQTGPXGTNKGJGP

288




KONGO

9325

ex 9326 9327

9328

9329

-10)1 &'/1-4#6+5%*'4'27$.+--10)1 70&5'+6  

0CVKQPCNQTFGP FGU .GQRCTFGP  /QFGNN   DNCW WPF TQV GOCKNNKGTV  4KVVGTFGMQTCVKQP OKV   5EJYGTVGTPXGTUKNDGTVVGKNYGKUGGOCKNNKGTVCO$CPF ++



&GT HÒPHMNCUUKIG <KXKN WPF /KNKV·TXGTFKGPUVQTFGP YWTFG OKV 1TFQPPCP\)GUGV\ 0T  XQO  /CK  IG   UVKHVGVWPFOKV)GUGV\0TXQO(GDTWCTUQYKGOKV1TFQPPCP\)GUGV\0TXQO/·T\ OQFKHK\KGTV

4'27$.+-<#+4'   

-QPXQNWVXQPCEJVOKNKV·TKUEJGP#WU\GKEJPWPIGP -TGW\HÒT6CRHGTMGKV$TQP\GCO$CPFOKVCWH IGNGIVGO DTQP\GPGO 2CNO\YGKI WPF $CPFURCPIG 4'27$.+37' &7 <#+4' 1255*#$#   GKP   YGKVGTGU'ZGORNCT 'TKPPGTWPIUOGFCKNNGCPFKGOKNKV·TKUEJGP1RGTCVKQPGPKO5JCDC-NCUUG $TQP\GCO$CPFOKVUKNDGTHCTDGPGT.QTDGGT\YGKI#WHNCIGWPF$CPFURCPIG.7276# 9KGXQTOKV $CPFURCPIG -#6#0&#   9KG XQT OKV $CPFURCPIG )#0&#,+-#   9KG XQT OKV $CPFURCPIG   $#4-9#0)# /KNKV·T'JTGP\GKEJGP-NCUUGXGTIQNFGVCO$CPFOKVCWHIGNGIVGOIQNFHCTDGPGO 2CNO\YGKI   /KNKV·T'JTGP\GKEJGP  -NCUUG FGT &GOQMTCVKUEJGP 4GRWDNKM -QPIQ XGTIQNFGV CO   $CPF&C\W /ÒV\GPCD\GKEJGPFGT0CVKQPCNGP2QNK\GKXQP-CVCPICXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTV GKP5RNKPVCDIGDTQEJGP GKPYGKVGTGU'ZGORNCTDTQP\KGTVWPFVGKNYGKUGGOCKNNKGTVOKV\YGK5RNKPVGP 5VÒEM++



-14'#4'27$.+- 5ª& -14'# 5'+6  

1TFGP HÒT JGTXQTTCIGPFG FKRNQOCVKUEJG 8GTFKGPUVG  /QFGNN   &GMQTCVKQP  -NCUUG   5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVGPWOOGTKGTVCOQTKIKPCNGP*CNUDCPF\WUCOOGP OKV $CPFURCPIG KO 1TKIKPCNGVWK <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU   $WPFGURT·UKFKCNCOVU HÒT FGP /KPKUVGTKCNTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO    #WIWUV  WPF 2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT   XGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT$74-'5H ++ &GTUGEJUMNCUUKIG1TFGPHÒT8GTFKGPUVGWOFKGKPVGTPCVKQPCNGP$G\KGJWPIGPYWTFGIGUVKHVGVWPFYGUGPV NKEJKPUGKPGT)GUVCNVWPIXGT·PFGTV



.#15-¤0+)4'+%*   

1TFGP FGT /KNNKQP 'NGHCPVGP WPF FGU 9GK­GP 5QPPGPUEJKTOU =1TFTG FW /KNNKQP —NGRJCPVU GV FW   2CTCUQN$NCPE?/QFGNN  1HHK\KGTUFGMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCO$CPF OKVCWHIGNGIVGT4QUGVVG1#0 ++



1TFGP FGT /KNNKQP 'NGHCPVGP WPF FGU 9GK­GP 5QPPGPUEJKTOU =1TFTG FW /KNNKQP —NGRJCPVU GV FW   2CTCUQN $NCPE?  /QFGNN   4KVVGTFGMQTCVKQP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF   1#0 ++



&GT\WP·EJUVGKPMNCUUKIG1TFGPYWTFGFWTEJ-ÌPKINKEJG1TFQPPCP\XQO/CKXQP-ÌPKI5KUCXCPI8QPIXQP .QWCPI2TCDCPI IGUVKHVGV #O  0QXGODGT  CWH HÒPH -NCUUGP GTYGKVGTV YWTFG GT DKU \WO 'PFG FGT   /QPCTEJKGKP.CQUXGTNKGJGP



289


LIBANON

9330

9331

9332 9333

.+$#010 (4#0<¤5+5%*'5/#0&#65)'$+'6   

'JTGPOGFCKNNGHÒT8GTFKGPUVGWOFGP.KDCPQP=/¾FCKNNGF *QPPGWTFW/¾TKVG.KDCPCKU?/QFGNN

OKV HTCP\ÌUKUEJGT WPF CTCDKUEJGT +PUEJTKHV  /GFCKNNG  -NCUUG 8GTOGKN  5KNDGT VGKNYGKUG XGTIQNFGV   COIGUVKEMVGP$CPF ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T   &KG XKGTMNCUUKIG 'JTGPOGFCKNNG YWTFG CO  ,CPWCT  XQO *QEJMQOOKUUCT FGT HTCP\ÌUKUEJGP 4GIKGTWPI   FGT.GXCPVGWPF)QWXGTPGWTHÒTFGP5VCCVFGU)TQ­.KDCPQP)GPGTCN*GPTK)QWTCWFOKV'TNCUU0TIGUVKHVGV 0CEJFGO DGTGKVU KO &G\GODGT  FWTEJ FGP GTUVGP 2T·UKFGPVGP FGT PWPOGJTKIGP .KDCPGUKUEJGP 4GRWDNKM   %JCTNGU &GDDCU   FGT XKGTMNCUUKIGP 'JTGPOGFCKNNG GKPG )TQ­MQTFQP-NCUUG CPIGINKGFGTV YQTFGP YCT KUV   CO  &G\GODGT  XQP 2T·UKFGPV (QWCF %J¾JCD   FKG 5QPFGTMNCUUG HÒT 5VCCVUQDGTJ·WRVGT IGUVKHVGV   YQTFGP

.+$#0'5+5%*'4'27$.+- 5'+6  

'JTGPOGFCKNNG HÒT 8GTFKGPUVG WO FGP .KDCPQP =/¾FCKNNG F *QPPGWT FW /¾TKVG .KDCPCKU?   /QFGNN PWTOKVCTCDKUEJGT+PUEJTKHVUGKV /GFCKNNG-NCUUG$TQP\GXGTUKNDGTVCOIGUVKEMVGP $CPF&C\WGKPGYGKVGTGNKDCPGUKUEJG$TQP\GOGFCKNNG2QWTNG.KDCPCO$CPF1#05 ++



&KG XKGTMNCUUKIG 'JTGPOGFCKNNG YWTFG CO  ,CPWCT  XQO *QEJMQOOKUUCT FGT HTCP\ÌUKUEJGP 4GIKGTWPI FGT   .GXCPVGWPF)QWXGTPGWTHÒTFGP5VCCVFGU)TQ­.KDCPQP)GPGTCN*GPTK)QWTCWFOKV'TNCUU0TIGUVKHVGV#O &G\GODGTYWTFGXQP2T·UKFGPV(QWCF%J¾JCD  FCU\YGKVG/QFGNNGKPIGHÒJTV



0CVKQPCNGT <GFGTP1TFGP =1TFTG 0CVKQPCN FW %¾FTG? \YGKVGU /QFGNN OKV NKDCPGUKUEJGT (CJPG CWH   FGT 4ÒEMUGKVG FGT &GMQTCVKQPGP  UGKV   $TWUVUVGTP \WO )TQ­QHHK\KGT 5KNDGT VNY XGTIQNFGV CP   0CFGN FKGUG RWP\KGTV \WUCOOGP OKV -PQRHNQEJTQUGVVG WPF $CPFUVÒEMKOQTKIKPCNGPOKVIQNFHCTDGPGT <GFGTDGFTWEMVGPGVYCUDGTKGDGPGP8GTNGKJWPIUGVWKFGT(KTOC#TVJWU$GTVTCPFKP2CTKU81.2'5 +p++



#WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU&GT$TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGP WPFIGVTCIGP  &GT FWTEJ .GIKUNCVKX&GMTGV XQO  &G\GODGT  XQO 2T·UKFGPVGP FGT .KDCPGUKUEJGP 4GRWDNKM —OKNG 'FF¾  

  CNU WTURTÒPINKEJ GKPMNCUUKI IGUVKHVGVG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG CO  ,WPK  KP GKPGP   HÒPHMNCUUKIGP 1TFGP )TQ­MTQFQP )TQ­QHHK\KGT -QOOCPFGWT 1HHK\KGT WPF 4KVVGT  WOUVTWMVWTKGTV WPF GTPGWV CP    ,CPWCT  XGT·PFGTV  /QFGNN  0CEJFGO FKG KO 0QXGODGT  HCMVKUEJ WPCDJ·PIKI IGYQTFGPG .KDCPG   UKUEJG4GRWDNKMCWEJGKPGPGWG5VCCVUHNCIIGCPIGPQOOGPJCVVGYWTFGFKGUGCWEJCWHFGT4ÒEMUGKVGFGT1TFGPU\GK EJGPU CPUVGNNG FGT DKUJGTKIGP HTCP\ÌUKUEJGP 6TKMQNQTG OKV FGT <GFGT KO YGK­GP (GNF CPIGDTCEJV  /QFGNN  /KV   .GIKUNCVKX&GMTGV 0T  XQO  ,WPK GTPGWGTVG5VCCVURT·UKFGPV(QWCF%J¾JCD  FGP1TFGPFGT CPNKDCPGUKUEJGWPFCWUN·PFKUEJG/·PPGTWPF(TCWGPHÒTDGUQPFGTG8GTFKGPUVGWOFGP.KDCPQPHÒTJGNFGPJCHVGWPF OWVKIG6CVGPWPFHÒTNCPIGWPFVTGWG&KGPUVGHÒTFGP5VCCVXGTNKGJGPMCPP9KEJVKIKUVCP\WOGTMGPFC­FKG)TQ­ MQTFQP-NCUUG WPF FKG 5QPFGTMNCUUG HÒT 5VCCVUQDGTJ·WRVGT FGT 'JTGPOGFCKNNG HÒT 8GTFKGPUVG WO FGP .KDCPQP  

/¾FCKNNG FW /¾TKVG .KDCPCKU  D\Y FGU 1TFGPU HÒT 8GTFKGPUVG WO FGP .KDCPQP 1TFTG FW /¾TKVG .KDCPCKU  ņ CD   ņH·NUEJNKEJGTYGKUGQHVCNUō<GFGTPQTFGPŋDG\GKEJPGVYWTFGPWPFYGTFGP



290

0CVKQPCNGT <GFGTP1TFGP =1TFTG 0CVKQPCN FW %¾FTG? \YGKVGU /QFGNN OKV NKDCPGUKUEJGT (CJPG CWH   FGT 4ÒEMUGKVG FGT &GMQTCVKQPGP  UGKV   -QOOCPFGWTFGMQTCVKQP 5KNDGT VNY XGTIQNFGV WPF   GOCKNNKGTVOKV*CNUDCPFCDUEJPKVV81.2'5 +p++




LIBERIA

9335

9336

9334



0CVKQPCNGT <GFGTP1TFGP =1TFTG 0CVKQPCN FW %¾FTG? \YGKVGU /QFGNN OKV NKDCPGUKUEJGT (CJPG CWH   FGT 4ÒEMUGKVG FGT &GMQTCVKQPGP  UGKV   1HHK\KGTUFGMQTCVKQP 5KNDGT VNY XGTIQNFGV WPF GOCKNNKGTV   OKP'OCKNNGCWUDTÒEJGCWH8QTFGTWPF4ÒEMUGKVGCOQTKIKPCNGP$CPFOKVCWHIGNGIVGT4QUGVVG81.2' 5 ++p



&KG DGKFGP WPVGTGP -NCUUGP FKGUGU 1TFGPU UKPF KP 'WTQRC CWH FGO /CTMV YGKVCWU UGNVGPGT \W HKPFGP CNU FKG FTGK   JÌJGTGP-NCUUGP

.+$'4+#4'27$.+- 



1TFGP FGT #HTKMCPKUEJGP 'TNÌUWPI WTURTÒPINKEJ 1TFGP FGT #HTKMCPKUEJGP$GHTGKWPI )TQ­QHHK \KGTUUGVDGUVGJGPFCWU)TQ­QHHK\KGTUFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVGKPGOKP#DRNCV\WPIKP FGT ITÒPGP 'OCKNNG KO $CPFTKPI RWP\KGTV CO QTKIKPCNGO *CNUDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV   VGKNYGKUG GOCKNNKGTV CP 0CFGN FKGUG RWP\KGTV OKV \YGK 5GKVGPJCMGP \WUCOOGP OKV /KPKCVWT 5KNDGT   XGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO$·PFEJGPOKVCWHIGNGIVGT4QUGVVGWPF-PQRHNQEJTQUGVVGKO'VWK FGT(KTOC#TVJWU$GTVTCPFKP2CTKU<WUCOOGPOKVQTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU#WUY·TVKIGP #OVGU HÒT FGP /KPKUVGTKCNFKTKIGPVGP KO #WUY·TVKIGP #OV *GNOWV /ÒNNGT FCVKGTV $QPP CO  ,CPWCT   WPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGP OKVLGYGKNKIGO8GTNGKJWPIULCJT1#0 +p++



1TFGPFGU5VGTPUXQP#HTKMC-QOOCPFGWTFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGO$CP FTKPI HTCP\ÌUKUEJ RWP\KGTV CO *CNUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC # %JQDKNNQP KP   2CTKU1#0XCT81.2'5 +p++

 291


MADAGASKAR

9337

9338

9339

9340

/#&#)#5-#481.-54'27$.+-70&4'27$.+- 5'+6  

0CVKQPCNGT 1TFGT FGT 4GRWDNKM /CFCICUMCT -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV VGKNYGKUG   GOCKNNKGTV FKG YGK­G 'OCKNNG UVGNNGPYGKUG GVYCU XGTH·TDV CO QTKIKPCNGP *CNUDCPF \WUCOOGP OKV   -PQRHNQEJTQUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU   %JGHU FGU $WPFGURT·UKFKCNCOVU HÃ&#x2019;T FGP /KPKUVGTKCNTCV KO $WPFGURT·UKFKCNCOV *GNOWV /Ã&#x2019;NNGT FCVKGTV   $QPPCO#RTKNWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGPWPFCP/Ã&#x2019;NNGT XGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT81.2'5 ++p



/#.#;5+#-¤0+)4'+%* 

&GT5GJT'JTGPYGTVG1TFGPFGT-TQPGXQP/CNC[UKC&GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGDTKNNCP VKGTV VGKNYGKUG GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG *GTUVGNNGTRWP\G FGT (KTOC )CTTCTF  %Q KP .QPFQP WPF   .QPFQPGT,CJTGURWP\GKHÃ&#x2019;TCO*CNUDCPFKOQTKIKPCNGPOKVIQNFHCTDGPGTOCNC[UKUEJGT-TQPGDG FTWEMVGP8GTNGKJWPIUGVWKFGU-TQPLWYGNKGTU)CTTCTF%Q<WUCOOGPOKVQTKIKPCNGT#PPCJOGIGPGJ OKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÃ&#x2019;TFGP/KPKUVGTKCNTCVKO$WPFGURT·UKFKCNCOV*GNOWV/Ã&#x2019;NNGT FCVKGTV$QPPCO,WNKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGPWPFCP /Ã&#x2019;NNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT 44+p++



/#41--1 (4#0<¤5+5%*'52416'-614#6 

*CHKFKGP1TFGP=0KUJCP*CHKFKGP?1HHK\KGTUFGMQTCVKQP5KNDGTVGKNXGTIQNFGVWPFGOCKNNKGTVOGJTGTG 'OCKNNGCWUDTÃ&#x2019;EJGWPFEJKRUCOQTKIKPCNGP$CPFOKVDGUEJ·FKIVGTCWHIGNGIVGT4QUGVVG 4+++



&GTHÃ&#x2019;PHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGOKV&CJKTXQO#WIWUVXQP5WNVCP/QWNC[#DFGN*CHKF

TGIXQPDKU XQP/CTQMMQIGUVKHVGVCDGTDGTGKVUXQPFGUUGP$TWFGTWPF0CEJHQNIGT5WNVCP/QWNC[ ;QWUUGH TGIXQPDKU FWTEJFGP5JGTKHKUEJGP#NQWKVG1TFGP=1WKUUCO#NCQWKVG5JGTKHKGP?GTUGV\V 8IN 4QWUUGCW2KGTTG1TFTGUGV&¾EQTCVKQPUFGN 'ORKTG%J¾TKHKGPCW6GORUFW2TQVGEVQTCV(TCPECKUCWU/CTQE 8GTUCKNNGU5HH 

-¤0+)4'+%* 5'+6  

292

#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #EJEJCTÃ&#x201E;HC =&KG 5JGTKHKUEJG /CLGUV·V?  UGKV   )TQ­MQTFQP5GV DGUVGJGPF CWU -NGKPQF XGTIQNFGV   WPFGOCKNNKGTVZOOCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTV&WTEJOOOCP0CFGN\WUCOOGPOKV-PQRHNQEJTQUGVVGKO1TKIKPCNGVWKFGT(KTOC#TVJWU $GTVTCPF KP 4CDCV OKV FGO IQNFGPGP 5VCCVUYCRRGP DGFTWEMV OKV CWHIGMNGDVGO 'VKMGVV 5QP 'ZEGNNGPEG   /QPUKGWT4QNH.#*4OKVFGT8GTNGKJWPIUWTMWPFGHÃ&#x2019;T&T4QNH.CJTFCVKGTV1#0  5VÃ&#x2019;EM++




MAROKKO 'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  7TURTÒPINKEJ XGTNKGJGP CP &T 4QNH .CJT   'T MCO  KP FCU 4GKEJUYKTVUJCHVUOKOKUVGTKWO WPF   PCEJ -TKGIUFKGPUV KO  9GNVMTKGI  KPU #WUY·TVKIG #OV 'THQNITGKEJGT 7PVGTJ·PFNGT OKV (TCPMTGKEJ WPF FGT   7F554  $QVUEJCHVGT DGK FGT '9)'WTCVQO WPF 5VCCVUUGMTGV·T  $QVUEJCHVGT KP 4QO 5COONGT   KVCNKGPKUEJGT(C[GPEGP5GKPG$TKGHGGTUEJKGPGPWPVGTFGO6KVGN<GWIGXQP(CNNWPF#WHUVKGI *CODWTI   &GTHÒPHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGOKV&CJKTXQOCO,CPWCTXQP5WNVCP/QWNC[;QWUUGH

TGIXQPDKU CPUVGNNGFGU0KUJCP*CHKFKGPIGUVKHVGV /QFGNN YWTFGGKPGPFGTWPIFGT+PUKIPKGP FWTEJ5WNVCP5KFK/QJCOOGF$GP;QWUUGH TGIXQPDKUWPFXQPDKUCDCNUGTUVGT-ÌPKI WPVGT FGO 0COGP /QJCOOGF 8  OKV &CJKT XQO  #RTKN  FWTEJIGHÒJTV  /QFGNN  +P FGT LGV\KIGP (QTO   FWTEJ 5WNVCP 5KFK /QJCOOGF $GP #TCHC TGI XQP  DKU   OKV &CJKT XQO  #RTKN  GTPGWGTV &KG   #P\CJN FGT )TQ­MQTFQPU KUV PWPOGJT UVCVWTCTKUEJ CWH  NKOKVKGTV 8IN 4QWUUGCW 2KGTTG 1TFTGU GV &¾EQTCVKQPU   FGN 'ORKTG%J¾TKHKGPCW6GORUFW2TQVGEVQTCV(TCPECKUCWU/CTQE8GTUCKNNGU5HH 

9342 9341





#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #N[QWUUQWHK[[C=&KG;QWUUQWHKUJG/CLGUV·V? $TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV CP0CFGNFKGUGOKV\YGKHTCP\ÌUKUEJGP2WP\GP1#0 ++



#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #EJEJCTÄHC =&KG 5JGTKHKUEJG /CLGUV·V?  UGKV   )TQ­QHHK\KGTU5GV DGUVGJGPF CWU &GMQTCVKQP    -NCUUG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV CWHIGNGIVGT 4QUGVVG WPF $TWUVUVGTP 5KNDGT   #WHNCIG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC #TVJWU   $GTVTCPF KP 4CDCV OKV IQNFHCTDGPGO 9CRRGP <WUCOOGP OKV FGT QTKIKPCNGP 8GTNGKJWPIUWTMWPFG HÒT   )GPGTCN(QWTSWGVFCVKGTVCO1MVQDGTOKVHTCP\ÌUKUEJURTCEJKIGTªDGTUGV\WPI1#0 5VÒEM+p++



0CEJHTCP\ÌUKUEJGO8QTDKNFYKTFKPFKGUGT-NCUUGMGKPG*CNUFGMQTCVKQPUQPFGTPFKG1HHK\KGTUFGMQTCVKQP\WUCOOGP OKVFGO$TWUVUVGTPXGTNKGJGPWPFIGVTCIGP

9343



#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #EJEJCTÄHC =&KG 5JGTKHKUEJG /CLGUV·V?  UGKV   )TQ­QHHK\KGTU5GV DGUVGJGPF CWU &GMQTCVKQP     -NCUUG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV CWHIGNGIVGT 4QUGVVG WPF $TWUVUVGTP 5KNDGT   #WHNCIG $TQP\G XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP   8GTNGKJWPIUGVWKFGT(KTOC#TVJWU$GTVTCPFKP4CDCVOKVIQNFHCTDGPGO9CRRGP1#0  5VÒEM+p++  0CEJHTCP\ÌUKUEJGO8QTDKNFYKTFKPFKGUGT-NCUUGMGKPG*CNUFGMQTCVKQPUQPFGTPFKG1HHK\KGTUFGMQTCVKQP\WUCOOGP OKVFGO$TWUVUVGTPXGTNKGJGPWPFIGVTCIGP

293


MAROKKO

9349

9345 9346

9344

9348 (1:1)













9347

#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #EJEJCTÄHC=&KG5JGTKHKUEJG/CLGUV·V?UGKV -QOOCPFGWT&GMQTCVKQPXGTIQNFGVWPFGOCKNNKGTV CO*CNUDCPF\WUCOOGPOKV-PQRHNQEJTQUGVVGKO1TKIKPCNGVWKFGT(KTOC#TVJWU$GTVTCPFKP4CDCVOKV FGO IQNFGPGP 5VCCVUYCRRGP DGFTWEMV <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU   $WPFGURT·UKFKCNCOVU HÒT FGP /KPKUVGTKCNTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO    ,CPWCT  WPF 2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT   XGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT1#0 +p++



#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #EJEJCTÄHC =&KG 5JGTKHKUEJG /CLGUV·V?  UGKV   -QOOCPFGWT&GMQTCVKQP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTVCWHFGT4ÒEMUGKVG#WUDTWEJKO/GFCKNNQPTKPIKO6TCIGTKPIOGJTHCEJHTCP\ÌUKUEJRWP\KGTV COQTKIKPCNGP*CNUDCPF1#0 +++++



#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #EJEJCTÄHC =&KG 5JGTKHKUEJG /CLGUV·V?  UGKV   1HHK\KGTU&GMQTCVKQP $TQP\G XGTIQNFGV WPF   GOCKNNKGTV4GRCTCVWTKPFGTTQVGP'OCKNNGFGU8QTFGTUGKVGPOGFCKNNQPUCO$CPFOKVCWHIGNGIVGT4QUGVVG 1#0 ++p+++



#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #EJEJCTÄHC=&KG5JGTKHKUEJG/CLGUV·V?UGKV 4KVVGT&GMQTCVKQP$TQP\GXGTIQNFGVWPFGOCKNNKGTV CO$CPF1#0 ++



#NCQWKVG %J¾TKHKGP1TFGP =1WKUUCO #NCQWKVG %J¾TKHKGP?  /QFGNN OKV <GPVTWOUKPUEJTKHV #NLCN³NC   #EJEJCTÄHC=&KG5JGTKHKUEJG/CLGUV·V?UGKV /KPKCVWTFGT1TFGPUFGMQTCVKQP5KNDGTXGTIQNFGVWPF GOCKNNKGTVKO$CPFTKPIOGJTHCEJRWP\KGTVCOQTKIKPCNGP$·PFEJGP ++



'N #UMCTK1TFGP HÒT /KNKV·TKUEJG 8GTFKGPUVG =1WKUUCO 'N #UMCTK? 5GV FGT 5QPFGTUVWHG DGUVGJGPF   CWU -NGKPQF $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP   $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CP 0CFGN KO QTKIKPCNGP IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK   FGT(KTOC#TVJWU$GTVTCPFKP4CDCV41((5H 5VÒEM44+p++



5GJT UGNVGPGT 1TFGP WPDUGTGU 9KUUGPU KP LÒPIGTGT <GKV GTUV GKPOCN KO *CPFGN CWHIGVCWEJV &KGUGT 5GV CWU FGO   $GUKV\ XQP )GPGTCN /KEJGN /CTVKP .¾QP (QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKVMT·HVGXQP DKU  &GT HÒPHMNCUUKIG 5QPFGTUVWHG  DKU  -NCUUG  1WKUUCO 'N #UMCTK1TFGP HÒT OKNKV·TKUEJG 8GTFKGPUVG YWTFG    XQP -ÌPKI /QJCOOGF 8 IGUVKHVGV KP 8GT·PFGTWPI FGU DKU FCJKP DGUVGJGPFGP GKPMNCUKIGP 5JGTKHKUEJGP /KNKV·T  8GTFKGPUVQTFGPU FGT UGKPGTUGKVU CO  #WIWUV  XQP 5WNVCP /QWNC[*CHKF IGUVKHVGV YQTFGP YCT 'T YKTF HÒT   6CRHGTMGKVWPF/KNKV·TKUEJGP/WVDGKFGT#WHTGEJVGTJCNVWPIFGT5QWXGT·PKV·VWPFVGTTKVQTKCNG+PVGITKV·V/CTQMMQUCP /KVINKGFGT FGT /CTQMMCPKUEJGP 5VTGKVMT·HVG FGT 2QNK\GK FGT *KNHUMT·HVG WPF CP #WUN·PFGT XGTNKGJGP &KGCTCDKUEJG +PUEJTKHV CWH FGP +PUKIPKGP DGFGWVGF )QVV  8CVGTNCPF  -ÌPKI &KG #P\CJN FGT+PJCDGTFGT5QPFGTMNCUUGKUVCWH NKOKVKGTV

294


MEXIKO

9350

/':+-14'27$.+- 5'+6  

/GZKMCPKUEJGT 1TFGP XQO #\VGMKUEJGP #FNGT )TQ­MTGW\5GV  -NCUUG DGUVGJGPF CWU -NGKPQF  

&WTEJOGUUGTOO 5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVGRWP\KGTVCO5EJWNVGT DCPF  OO DTGKV WPF $TWUVUVGTP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG   RWP\KGTV OKV 0CFGN \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP 8GTNGKJWPIUGVWK OKV IQNFHCTDGPGO   #\VGMGPCFNGT1#0 5VÒEM++



5GV FGU )TQ­MTGW\GU 'TUVGT -NCUUG KP ·NVGTGT *GTUVGNNWPIUSWCNKV·V YGNEJGU PWT CP /KPKUVGT WPF $QVUEJCHVGT XGTNKG   JGPYWTFG  'T KUV OKV &GMTGV FGU /GZKMCPKUEJGP 2T·UKFGPVGP CO  &G\GODGT  CNU HÒPHUVWHKIGT 1TFGP %QNNCT $CPFC   2NCEC 'PEQOKGPFC WPF +PUGIPC  IGUVKHVGV FKG 5VCVWVGP CO  ,CPWCT FGU HQNIGPFGP ,CJTGU GTNCUUGP YQTFGP .CWV   5VCVWVGPYCTWPFKUVGTCWUN·PFKUEJGP&KRNQOCVGPXQTDGJCNVGPMCPPCDGTKP#WUPCJOGH·NNGPCWEJCPFGTGP#WUN·PFGTP XGTNKGJGP YGTFGP /KV FGT PFGTWPI FGT 5VCVWVGP YWTFG FKG )TQ­MTGW\UVWHG $CPFC KP \YGK -NCUUGP )TQ­MTGW\    WPF )TQ­MTGW\  -NCUUG WPVGTVGKNV YQDGK FKGUG UKEJ PWT KP FGT $TGKVG FGU 5EJWNVGTDCPFGU WPVGTUEJGKFGP &CU   5EJWNVGTDCPF FGU )TQ­MTGW\GU GTUVGT -NCUUG KUV OO FCU FGU )TQMTGW\GU  -NCUUG PWT OO DTGKV 8IN   5GETGVGTKC FG 4GNCEKQPGU 'ZVGTKQTGU 1TFGP /GZKECPC FGN #IWKNC #\VGEC  4GINCOGPVQ [ .KUVC FG 2GTUQPCU   %QPFGEQTCFCU/GZKMQ 

9352





9351

9352

/GZKMCPKUEJGT 1TFGP XQO #\VGMKUEJGP #FNGT -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV   CO $·PFEJGP WPF -PQRHNQEJTQUGVVG KO QTKIKPCNGP CWHY·PFKI IGRT·IVGP NGFGTPGP 8GTNGKJWPIUGVWK   <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP   /KPKUVGTKCNTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  &G\GODGT  WPF   2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV   LGYGKNKIGO8GTNGKJWPIULCJT ++



/GFCKNNG \WO 'KPJWPFGTVL·JTKIGP ,WDKN·WO FGT JGTQKUEJGP 8GTVGKFKIWPI XQP )WC[OCU    5KNDGTCP$CPFTCJGOKV$CPF ++



#O,WNKITKHHGKPG)TWRRGXQPEC5QNFCVGPOGKUVHTCP\ÌUKUEJGT*GTMWPHVWPVGTFGO$GHGJNFGU%QOVG )CUVQPFG4CQWUUGV$QWNDQPXQP5CP(TCPEKUEQKPFGP8GTGKPKIVGP5VCCVGPXQP#OGTKMCJGTMQOOGPFFKGOGZKMC PKUEJG#TOGGDGK)WC[OCUCP+PFGTPCEJFKGUGO1TVDGPCPPVGP5EJNCEJVIGNCPIGUFGP/GZKMCPGTPWPVGT)GPGTCN ,QU¾ /CTÃC ;CÇG\ WPVGTUVCTMGT6GKNPCJOGFGT<KXKNDGXÌNMGTWPIFKGKPFKGUGT<GKVMCWOOGJTCNU2GTUQPGP WOHCUUVG FGP #PITKHH CD\WYGJTGP WPF FKG (TCP\QUGP \WTÒEM \W FT·PIGP &GT 1TV YWTFG JKGTHÒT KP *GTQKEC   )WC[OCUWODGPCPPV

295


MONGOLEI

9353

9354

9355

/10)1.'+ 81.-54'27$.+- 



1TFGPXQO2QNCTUVGTP/QFGNN  1TFGPUUVGTP5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCWH FGT4Ã&#x2019;EMUGKVG0CFGNU[UVGOWPF6T·IGTPWOOGT$#667*'4(/51001/ ++



'JTGPOGFCKNNG HÃ&#x2019;T 8GTFKGPUVG KO -CORH  /QFGNN  #WUHÃ&#x2019;JTWPI   5KNDGT VGKNYGKUG   GOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG6T·IGTPWOOGT0QCPFTGKGEMKIGT$CPFURCPIGOKV5EJTCWDG5EJTCWD UEJGKDGGTI·P\V$#667*'4(/51001/ 4++



'JTGPOGFCKNNGFGT#TDGKV/QFGNN#WUHÃ&#x2019;JTWPI OKVOQPIQNKUEJGT+PUEJTKHV 5KNDGT VGKNYGKUGGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG6T·IGTPWOOGTCPFTGKGEMKIGT$CPFURCPIGOKV5EJTCWDG WPFQTKIKPCNGT5EJTCWDUEJGKDGOKV*GTUVGNNGTDG\GKEJPWPI$#667*'4(/51001/ ++



5GNVGP HTÃ&#x2019;JG #WUHÃ&#x2019;JTWPI OKV UGJT PKGFTKIGT 8GTNGKJWPIUPWOOGT &KGUG #WUHÃ&#x2019;JTWPI YWTFG KP FGP ,CJTGP  DKU   PWTKPUIGUCOVECOCNXGTNKGJGP



9356









296

ex 9357

'JTGPOGFCKNNG FGT #TDGKV  /QFGNN #WUHÃ&#x2019;JTWPI OKVM[TKNNKUEJGT+PUEJTKHV 5KNDGT VGKNYGKUGGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG6T·IGTPWOOGTCPFTGKGEMKIGT$CPFURCPIGOKV5EJTCWDG WPFQTKIKPCNGT5EJTCWDUEJGKDGOKV*GTUVGNNGTDG\GKEJPWPI$#667*'4(/51001/ ++



1TFGPFGU/WVVGTTWJOGU&GMQTCVKQPGPFGTWPF-NCUUGLGYGKNUXGTIQNFGVWPFGOCKNNKGTVDGKFG 5VÃ&#x2019;EMGOKVUGRCTCVCWHIGNGIVGO/WVVGT-KPF2CCTCWHFGT4Ã&#x2019;EMUGKVGPWOOGTKGTVD\YCP 5EJTCWDUEJGKDGP$#667W*'4(/W51005W 5VÃ&#x2019;EM++



-QPXQNWVXQP#WU\GKEJPWPIGP /GFCKNNGHÃ&#x2019;TFGP5KGIÃ&#x2019;DGT,CRCP 'KPYGKVGTGU'ZGO RNCT /GFCKNNGHÃ&#x2019;TFGP,CJTGUVCIFGU5KGIGUXQP%JCNEJKP)QN /GFCKNNG\WO,CJTGUVCIFGT OQPIQNKUEJGP 8QNMUTGXQNWVKQP   /GFCKNNG \WO  ,CJTGUVCI FGUUGNDGP #PNCUUGU   /GFCKNNG \WO   ,CJTGUVCIFGUUGNDGP#PNCUUGU /GFCKNNG\WO,CJTGUVCIFGUUGNDGP#PNCUUGU /GFCKNNG\WO ,CJTGUVCIFGUUGNDGP#PNCUUGU /GFCKNNG\WO,CJTGUVCIFGUUGNDGP#PNCUUGU /GFCKNNG\WO  ,CJTGUVCI FGT )TÃ&#x2019;PFWPI FGT /QPIQNKUEJGP 5VTGKVMT·HVG   /GFCKNNG \WO  ,CJTGUVCI FGUUGNDGP   #PNCUUGU /GFCKNNG\WO,CJTGUVCIFGU5KGIGUÃ&#x2019;DGT,CRCP /GFCKNNGHÃ&#x2019;T9CHHGPDTÃ&#x2019;FGTUEJCHV LGYGKNU XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV D\Y NCEMKGTV CP GOCKNNKGTVGP D\Y NCEMKGTVGP 6TCIGURCPIGP   5VÃ&#x2019;EM++



-QPXQNWV XQP  #D\GKEJGP FCTWPVGT  XQO 4QVGP -TGW\ 8GTUEJKGFGPG /CVGTKCNKGP VGKNU   XGTIQNFGVVGKNYGKUGGOCKNNKGTVD\YNCEMKGTVVGKNUCPGOCKNNKGTVGPD\YNCEMKGTVGP6TCIGURCPIGPQFGTCP 0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÃ&#x2019;EM++++p+++




NEPAL

9362 9364

9363

9361

9360

0'2#.-¤0+)4'+%* $+5  

1TFGPFGT4GEJVGP*CPFFGU)WTMJC )QTMJC&CMUJKPC$CJW1TFGP &GMQTCVKQP-NCUUG5KNDGT XGTIQNFGVCWHFGT4ÒEMUGKVGPGRCNGUKUEJRWP\KGTVKOQTKIKPCNGP8GTNGKJWPIUGVWK<WUCOOGPOKVQTKIKPC NGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP/KPKUVGTKCNTCVKO$WPFGURT·UKFKCN COV *GNOWV /ÒNNGT FCVKGTV $QPP CO  #RTKN  WPF 2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP    \YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT81.2'5 ++



0+)'44'27$.+- 

0CVKQPCNQTFGP XQP 0KIGT -QOOCPFGWTFGMQTCVKQP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF   \WUCOOGP OKV -PQRHNQEJTQUGVVG KO 1TKIKPCNGVWK FGT (KTOC #TVJWU $GTVTCPF KP 2CTKU <WUCOOGP OKV   QTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP/KPKUVGTKCNTCVKO$WPFGU RT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPPCO,WPKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP \YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT1#0  4+p++



0+)'4+# 4'27$.+--#6#0)# 

8GTFKGPUVQTFGP (·NUEJWPI   FGU -QOOCPFGWTMTGW\GU IGYÌNDVG #WUHÒJTWPI $TQP\G XGTIQNFGV WPF   GOCKNNKGTV4GRCTCVWTKPFGTYGK­GP'OCKNNGCO*CNUDCPF ++



5QPPGPWPF.ÌYGP1TFGP#WUHÒJTWPIHÒT<KXKNKUVGPWPF#WUN·PFGT OKVNKGIGPFGO.ÌYGP &GMQTC VKQP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV 5VTCJNGPCWHNCIGP )QNF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGKQDGTHN·EJNKEJGT'OCKNNGEJKRCWHGKPGO5VTCJNCOQTKIKPCNGP$CPFOKV4QUGVVG ++



-TQPGP 6CL 1TFGP&GMQTCVKQPFGT-NCUUG5KNDGTXGTIQNFGVWPFGOCKNNKGTV$CPFTKPIHTCP\ÌUKUEJ RWP\KGTV CO QTKIKPCNGP $CPF OKV CWHIGNGIVGT 4QUGVVG \WUCOOGP OKV -PQRHNQEJTQUGVVG KO QTKIKPCNGP   DNCWGP8GTNGKJWPIUGVWKFGT(KTOC#TVJWU$GTVTCPFKP2CTKUOKVIQNFHCTDGPGO5VCCVUYCRRGP<WUCOOGP OKVQTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP1DGTTGIKGTWPIUTCVKO $WPFGURT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPPCO,WNKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGU XQP\YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT1#0 +p++





2'45+'0+4#0 5'+6 -#+5'44'+%* $+5



297


PERU

9366

9365

2'474'27$.+- 

1TFGPFGT5QPPGXQP2GTW)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWH FGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT%CUCFG/QPGFC2CTGLCKP.KOCCOQTKIKPCNGP5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   %CUC FG /QPGFC 2CTGLC CP 0CFGN OKV \YGK 5GKVGPJCMGP KO 1TKIKPCNGVWK OKV IQNFHCTDGPGO   5VCCVUYCRRGP1#081.2'5 5VÒEM++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T 7TURTÒPINKEJXGTNKGJGPCP5VCCVUUGMTGV·T&T4QNH.CJT  



1TFGPFGT5QPPGXQP2GTW$TWUVUVGTP\WO)TQ­QHHK\KGT5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVCWHFGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC.GOCKVTGKP2CTKUCP0CFGNOKV\YGK5GKVGPJCMGP1#0 81.2'5 ++



&KG$TWUVUVGTPG\WO)TQ­MTGW\WPF\WO)TQ­QHHK\KGTWPVGTUEJGKFGPUKEJFCFWTEJFCUUDGKOGTUVGTGPFGT.QTDGGT MTCP\ ITÒP GOCKNNKGTV KUV WPF DGKO \YGKVGP PKEJV +P FKGUGT -NCUUG YKTF FGT $TWUVUVGTP CNNGKP WPF QJPG YGKVGTG   +PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP  &GT1TFGPYWTFGWTURTÒPINKEJXQP)GPGTCN5CP/CTVÃP  CO1MVQDGTIGUVKHVGV/KV&GMTGVFGU 2T·UKFGPVGP YWTFG GT KP\YKUEJGP WPVGTIGICPIGPG 1TFGP CO  #RTKN  CNU HÒPHMNCUUKIGT <KXKN WPF /KNKV·T   8GTFKGPUVQTFGPGTPGWGTV

9367



1TFGPHÒTJGTXQTTCIGPFG8GTFKGPUVG)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQF5KNDGTXGTIQNFGVWPFVGKN YGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT %CUC 0CEKQPCN FG /QPGFC KP .KOC CO   QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPI FGT %CUC 0CEKQPCN FG /QPGFC CP 0CFGN OKV \YGK5GKVGPJCMGP\WUCOOGPOKV -PQRHNQEJTQUGVVGKO1TKIKPCNGVWKOKVIQNFDGFTWEMVGO5VCCVUYCRRGP\WUCOOGPOKVFGTQTKIKPCNGP8GT NGKJWPIUWTMWPFGHÒT2TQH&T9CNVGT*CNNUVGKP  FCVKGTV.KOCCO,WPKOKV1TKIK PCNWPVGTUEJTKHVFGU#W­GPOKPKUVGTU&,#IWKNCTOKPGKPIGTKUUGPKPFGTQTKIKPCNGP&QMWOGPVGPTQNNG 1#0581.2'5 5VÒEM+p++ 'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T 7TURTÒPINKEJXGTNKGJGPCP5VCCVUUGMTGV·T&T9CNVGT*CNNUVGKP  &GT\KXKNG8GTFKGPUVQTFGPDGUVGJV CWUHÒPH-NCUUGP

298




PERU

9368





9369

1TFGP HÒT JGTXQTTCIGPFG 8GTFKGPUVG -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKN   NKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT %CUC 0CEKQPCN FG /QPGFC KP .KOC CO QTKIKPCNGP   *CNUDCPF \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP OKV CWHIGNGIVGT   4QUGVVG WPF -PQRHNQEJTQUGVVG KO QTKIKPCNGP IQNFHCTDGP DGFTWEMVGP 8GTNGKJWPIUGVWK <WUCOOGP OKV   QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FCU -QOVWTMTGW\ FGU 1TFGPU   FGT5QPPGXQP2GTW UKE HÒTFGP1DGTTGIKGTWPIUTCVKO$WPFGURT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPP CO0QXGODGTWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP\YKUEJGPWPFCP/ÒNNGT XGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT1#0581.2'5 5VÒEM++



1TFGPHÒTJGTXQTTCIGPFG8GTFKGPUVG-QOOCPFGWTFGMQTCVKQP$TQP\GXGTIQNFGVWPFVGKNYGKUGGOCKN NKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT /ÒP\G KP .KOC CO QTKIKPCNGP NCPIGP *CNUDCPF   1#081.2'5 +p++



&GT\KXKNG8GTFKGPUVQTFGPDGUVGJVCWUHÒPH-NCUUGP

9370



9371

/KNKV·TKUEJGT1TFGPXQP#[CEWEJQ)TQ­QHHK\KGTU$TWUVUVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT 4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT%CUC0CEKQPCNFG/QPGFCKP.KOCCP0CFGNKOQTKIKPCNGPIQNFGP DGFTWEMVGP8GTNGKJWPIUGVWK1#05H81.2'5 ++



#WUFGO$GUKV\XQP)GPGTCN/KEJGN/CTVKP.¾QP(QWTSWGV  )GPGTCNUVCDUEJGHFGTHTCP\ÌUKUEJGP5VTGKV MT·HVGXQPDKU  (ÒPHMNCUUKIGT/KNKV·T8GTFKGPUVQTFGPFGUUGP0COGCPFKG5EJNCEJVXQP#[CEWEJQCO&G\GODGTGTKPPGTV



/KNKV·TKUEJGT1TFGPXQP#[CEWEJQ)TQ­QHHK\KGTU$TWUVUVGTP$TQP\GXGTIQNFGVWPFGOCKNNKGTVCWHFGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT %CUC 0CEKQPCN FG /QPGFC KP .KOC CP 0CFGN 1#0 5 H   81.2'5 ++

 299


RUANDA

9373 (1:1) 9375

9372

9376

9374



/KNKV·TKUEJGT1TFGPXQP#[CEWEJQ-QOOCPFGWTFGMQTCVKQP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV COQTKIKPCNGP*CNUDCPF1#081.2'5 ++





/GFCKNNGHÒTFKG-CPQPKGTGDGK%CNNCQZOO)QNFGOCKNNKGTVI OKV$CPF CO $CPF 44+p++



9·JTGPF FGU URCPKUEJRGTWCPKUEJGP -TKGIGU XQP  XGTGKVGNVGP CO  /CK  KO )GHGEJV KO *CHGP XQP   %CNNCQ  /CPP WPF  -CPQPGPDQQVG FGT XGTGKPVGP RGTWCPKUEJDQNKXKCPKUEJEJKNGPKUEJGP 5VTGKVMT·HVG FGP NGV\VGP   8GTUWEJ FGT URCPKUEJGP (NQVVG CWH FGO RGTWCPKUEJGP (GUVNCPF \W NCPFGP 5GKVJGT KUV CO  /CK FGT RGTWCPKUEJG   0CVKQPCNHGKGTVCI &KG RGTWCPKUEJG 4GIKGTWPI UVKHVGVG FCU 'JTGP\GKEJGP HÒT FKG -CPQPKGTG FGT XGTGKPVGP RGTWCPKUEJ   DQNKXKCPKUEJEJKNGPKUEJGP5VTGKVMT·HVGFKG\WOUVTCVGIKUEJGP5KGIIGIGP5RCPKGPKO*CHGPXQP%CNNCQYGUGPV NKEJDGKIGVTCIGPJCVVGP&KG·W­GTUVUGNVGPG/GFCKNNGKUVPWTDGK4QUCKP415CDIGDKNFGV



(TCP\KUEQ2K\CTTQ'JTGP\GKEJGPFGU4CVGUFGT2TQXKP\.KOC$TQP\GVGKNYGKUGGOCKNNKGTVCP6TCIG MQTFGN 4++



47#0&#4'27$.+- 5'+6  

0CVKQPCNQTFGPFGU(TKGFGPU-QOOCPFGWTFGMQTCVKQPXGTIQNFGVWPFGOCKNNKGTVKO$CPFTKPI*GTUVGNNGT RWP\GFGT(KTOC#TVJWU$GTVTCPFKP2CTKUCO*CNUDCPF 4++



&KG-QOOCPFGWTFGMQTCVKQPGPFKGUGU1TFGPUUKPFYGKVCWUUGNVGPGT\WHKPFGPCNUFKG$TWUVUVGTPG&GTHÒPHMNCUUKIG 8GTFKGPUVQTFGPKUVCPGKPGOWPDGMCPPVGP&CVWO\YKUEJGPWPFIGUVKHVGVYQTFGP

5#7&+#4#$+'0-¤0+)4'+%* 

1TFGP HÒT 5Q\KCNG &KGPUVG &GMQTCVKQP  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV HGKPUVG   'OCKNNGOCNGTGK OKP #WUDTWEJ KP FGT ITÒPGP 'OCKNNG KO $CPFTKPI *GTUVGNNGTRWP\G WPF HTCP\ÌUKUEJG   )CTCPVKGRWP\G XQP  DKU  HÒT GT 5KNDGT 9KNFUEJYGKPMQRH  CO PKEJV MQTTGMVGP *CNUDCPF   -ª ++ &KG +PUEJTKHV -ÌPKITGKEJ 5CWFK #TCDKGP  DG\KGJV UKEJ CWH FKG )TÒPFWPI FGU 5VCCVGU CO  5GRVGODGT     5CWFDKP#DFWN#\K\  -ÌPKIXQP5CWFK#TCDKGPXQPDKUUVKHVGVGFKGGTUVGP#WU\GKEJPWPIGP 5CWFK#TCDKGPUKPFGPUR·VGPGT,CJTGP0CEJUGKPGTFWTEJUGKPGP*CNDDTWFGTWPF0CEJHQNIGT(CKUCNKDP#DFWN #\K\ #N 5CWF GT\YWPIGPGP #DFCPMWPI KO ,CJTG  YWTFG FKG 8GTNGKJWPI FGT XQP KJO IGUVKHVGVGP #WU\GKEJPWP   IGP GKPIGUVGNNV *GTTP 2TQH &T ) # 6COOCPP KP $CUGN WPF *GTTP 1YCKP 4CY4GGU KP 4K[CFJ UGK JKGT HÒT FKG   +PHQTOCVKQPGP TGEJV JGT\NKEJ IGFCPMV   5GJT UGNVGPG #WU\GKEJPWPI #PHGTVKIWPI FGT (KTOC #TVJWU $GTVTCPF KP   2CTKUYQJNCWUGT,CJTGP

300




SENEGAL

9377

9379

ex 9378

5'0')#.4'27$.+- 

0CVKQPCNGT1TFGPFGU.ÌYGPXQP5GPGICN)TQ­QHHK\KGTUUGVDGUVGJGPFCWU1HHK\KGTUFGMQTCVKQPXGTIQN FGVWPFGOCKNNKGTVZOOCO$CPFOKV4QUGVVGWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTV&WTEJOOOCP0CFGNFKGUGRWP\KGTV\WUCOOGPOKV-PQRHNQEJTQUGVVGKO1TKIKPCNGVWK FGT(KTOC#TVJWU$GTVTCPFKP2CTKUOKVGKPNKGIGPFGO$GINGKV\GVVGNFGU#WUY·TVKIGP#OVGUKP$QPPHÒT *GTTP8.4+#T\XQP5VTCW­GPDGTI41((5 5VÒEM+p



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T 7TURTÒPINKEJXGTNKGJGPCP5VCCVUUGMTGV·T&T4QNH.CJT    &GT HÒPHMNCUUKIG JÌEJUVG UGPGICNGUKUEJG 8GTFKGPUVQTFGP YWTFG OKV 1TFQPPCP\ 0T  XQO  1MVQDGT     IGUVKHVGVWPFUQYKGXGT·PFGTV&KG#P\CJNFGT)TQ­QHHK\KGTGKUVUVCVWCTKUEJCWHDGITGP\V

51/#.+#4'27$.+- 

1TFGPFGU5VGTPUXQP5QOCNKC-QOOCPFGWTFGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO $·PFEJGP WPF -PQRHNQEJTQUGVVG KO   QTKIKPCNGP 8GTNGKJWPIUGVWK XQP # 2Q\\K KP 4QO OKV CWHIGNGIVGO GOCKNNKGTVGO 5VCCVUYCRRGP   <WUCOOGP OKV QTKIKPCNGT #PPCJOGIGPGJOKIWPI FGU %JGHU FGU $WPFGURT·UKFKCNCOVU HÒT FGP   1DGTTGIKGTWPIUTCV KO $WPFGURT·UKFKCNCOV *GNOWV /ÒNNGT FCVKGTV $QPP CO  /CK  WPF   2JQVQMQRKG FGU 8GT\GKEJPKUUGU XQP  \YKUEJGP  WPF  CP /ÒNNGT XGTNKGJGPGP 1TFGP OKV   LGYGKNKIGO8GTNGKJWPIULCJT1#05 5VÒEM4+p++



&GT HÒPHMNCUUKIG <KXKN WPF /KNKV·T8GTFKGPUVQTFGP YWTFG CO  (GDTWCT  IGUVKHVGV 1HHK\KGNNG .KGHGTCPVGP   YCTGP HÒT NCPIG <GKV FKG (KTOGP %TCXCP\QNC WPF 2Q\\K KP 4QO 8IN CWEJ 4CY4GGU 1YCKP 5QOG 5QOCNK   #YCTFU+P,QWTPCNQHVJG1TFGTUCPF/GFCNU5QEKGV[QH#OGTKEC  0T5 

5;4+'0 (4#0<¤5+5%*'5/#0&#65)'$+'6   

5[TKUEJGT 8GTFKGPUVQTFGP =1TFTG FW /¾TKVG 5[TKGP? D\Y <KXKN8GTFKGPUVQTFGP =1TFTG FW /¾TKVG   %KXKN?  /QFGNN OKV UGEJU 2HGKNGP    &GMQTCVKQP  -NCUUG $TQP\G XGTUKNDGTV WPF   GOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC#TVJWU$GTVTCPFKP2CTKUCOQTKIKPCNGP $CPF ++



&GT \WP·EJUV XKGTMNCUUKIG CW­GTQTFGPVNKEJG -NCUUG   WPF  -NCUUG  1TFGP YWTFG &GMTGV 0T  XQO    #RTKN  XQO HTCP\ÌUKUEJGP *QEJMQOOKUUCT HÒT 5[TKGP IGUVKHVGV /KV )GUGV\&GMTGV 0T  XQO  ,WPK    YWTFG FGT 1TFGP CNU 5[TKUEJG 8GTFKGPUVOGFCKNNG  CWH HÒPH -NCUUGP GTYGKVGTV WPF FKG +PUKIPKGP GTJKGNVGP PWPOGJT   HÒPH 2HGKNG UVCVV DKUJGT UGEJU  #O  /CK  GTJKGNV GT FKG $G\GKEJPWPI 5[TKUEJGT 8GTFKGPUVQTFGP  +P FKGUGT   (QTOYKTFGTDKUKPFKG)GIGPYCTVXGTNKGJGP

301


THAILAND

ex 9380

9381

9382

5;4+5%*'#4#$+5%*'4'27$.+-$<9#4#$+5%*'4'27$.+-5;4+'0

5'+6  

1TFGPHÒT6CRHGTMGKV-QPXQNWVFGT&GMQTCVKQPGPFGTWPF-NCUUGLGYGKNUVGKNYGKUGXGTIQNFGV WPFGOCKNNKGTVCP$·PFGTPGKPGUFCXQPOKV2CNO\YGKIWPFGKPGUOKV5VGTPEJGPCWHNCIG&C\W2CNGUVKPC (GNF\WIUOGFCKNNGXQPCO$CPFWPFGKPGYGKVGTGUU[TKUEJG/GFCKNNGXGTIQNFGVWPFGOCKNNKGTVCO $CPF81.2'5 5VÒEM++



6*#+.#0&-¤0+)4'+%* 



&GTUGJTJQJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV -QOOCPFGWTFGMQTCVKQP5KNDGT VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKP'OCKNNGCWUDTWEJCWHFGT4ÒEMUGKVGCWHFGT4ÒEMUGKVGFGT-TQPG *GTUVGNNGTWPF5KNDGTRWP\GCO*CNUDCPF ++



&GTUGJTJQJG1TFGPFGU9GK­GP'NGRJCPVGP/QFGNN UGKV 1HHK\KGTUFGMQTCVKQP5KNDGTVGKN YGKUG XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV CWHIGNGIVGT 4QUGVVG \WUCOOGP OKV -PQRHNQEJTQUGVVG KO   QTKIKPCNGP 8GTNGKJWPIUGVWK GKPGU VJCKN·PFKUEJGP *GTUVGNNGTU OKV IQNFGPGO 5VCCVU[ODQN <WUCOOGP OKV   QTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP1DGTTGIKGTWPIUTCVKO$WP FGURT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPPCO/CKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP \YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT 4+p++



9384

9385

9383



&GT 5GJT 8QTPGJOG 1TFGP FGT -TQPG XQP 6JCKNCPF  /QFGNN   $TWUVUVGTP 5KNDGT   XGTIQNFGV WPF GOCKNNKGTV GKPKIG 'OCKNNGEJKRU WPF URTÒPIG CP 0CFGN FKGUG WPF FGT 0CFGNJCMGP OKV   HTCP\ÌUKUEJGT'KPHWJTRWP\GXQPDKU 5EJYCPGPRWP\G  ++p+++





7PDGMCPPVG6JCKN·PFKUEJG/KNKV·T#WU\GKEJPWPI$TQP\GXGTIQNFGVCWHFGT4ÒEMUGKVG,CJTGUCPICDG CO$CPFOKV#WHNCIG ++p





+PQHHK\KGNNG/GFCKNNGCWH-ÌPKI$JWOKRQN-WRHGT0KEMGNCO$CPF



302

++


TOGO

9386 9387 9390

9389 9388

61)14'27$.+- 

/QPQ1TFGP -QOOCPFGWTFGMQTCVKQP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF \W   UCOOGPOKV-PQRHNQEJTQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC#TVJWU$GTVTCPFKP2CTKU<WUCO OGPOKVQTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP/KPKUVGTKCNTCVKO $WPFGURT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPPCO/CKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGU XQP\YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT81.2' 5 4+p++



65%*#&4'27$.+- 

0CVKQPCNGT1TFGPFGU6UEJCF=1TFTG0CVKQPCNFW6EJCF?-QOOCPFGWTMTGW\$TQP\GXGTIQNFGVWPF GOCKNNKGTV CO *CNUDCPF \WUCOOGP OKV -PQRHNQEJTQUGVVG KO DGUEJ·FKIVGT 5EJCEJVGN <WUCOOGP OKV   QTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP/KPKUVGTKCNTCVKO$WPFGU RT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPPCO/CKWPF2JQVQMQRKGFGU8GT\GKEJPKUUGUXQP \YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIULCJT41((5H 4+p++



&GTCNNIGOGKPG8GTFKGPUVQTFGPYWTFGXQPFGT#WVQPQOGP4GRWDNKMMWT\XQT'TNCPIWPIFGTXQNNGP7PCDJ·PIKIMGKV

CO  #WIWUV  OKV&GMTGV0TXQO#RTKNIGUVKHVGVFKG#WUHÒJTWPIUDGUVKOOWPIGPYWTFGPOKV &GMTGV0T2)CO,WNKGTNCUUGP'TGTHWJTPFGTWPIGPOKVFGP&GMTGVGP0T24XQO#WIWUV WPF0T24XQO#WIWUV&GT1TFGPWOHCUUVFTGK)TCFG -QOOCPFGWT1HHK\KGTWPF4KVVGT WPF \YGK 9ÒTFGP )TQ­QHHK\KGT WPF )TQ­MTGW\  #NU ·W­GTGU <GKEJGP UGKPGT 9ÒTFG VT·IV FGT CNU )TQ­OGKUVGT COVKG   TGPFG5VCCVURT·UKFGPVGKPG-QNNCPG



0CVKQPCNGT1TFGPFGU6UEJCF=1TFTG0CVKQPCNFW6EJCF?4KVVGTMTGW\$TQP\GXGTIQNFGVWPFGOCKN NKGTVCO$CPFKO'VWKFGT/ÒP\GKP2CTKU41((5H +p





/KNKV·T8GTFKGPUVMTGW\8GTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO$CPF41((5



4++

6ª4-'+15/#0+5%*'54'+%* $+5  

/GFLKFLKG1TFGP &GMQTCVKQP FGT-NCUUGZOO5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV#WHNCIGP )QNF#ITCHHGOKVGEJVIQNFGPGT#WHNCIGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT/ÒP\G KP-QPUVCPVKPQRGNWPF2WP\GOKVUEJYGFKUEJGP#WHJ·PIGTKPIQJPG5EJWNVGTDCPF'4ª5HH1#0 81.2'5 +p++



&GT XQP $GIKPP CP HÒPHMNCUUKIG 1TFGP YWTFG  XQP 5WNVCP #DFWN/GFLKF IGUVKHVGV FKG GTUVGP 5VCVWVGP FCVKGTGP   XQO#WIWUV <KNMCFG#* 9·JTGPFFGU'TUVGP9GNVMTKGIGUGTHQNIVGFKG#WUICDGXQP+PUKIPKGP OKV5·DGNP/KVFGT#DUEJCHHWPIFGU5WNVCPCVUKO0QXGODGTFWTEJ)C\K/WUVCHC-GOCN2CUEJCIGP#VCVÒTM IKPICWEJFGT/GFLKFLKG1TFGPWPVGT

303


TÜRKEI

9392







/GFLKFLKG1TFGP $TWUVUVGTP &WTEJOGUUGT  OO 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP   VGKNYGKUG )QNF GOCKNNKGTV GKPKIG OKP 'OCKNNGEJKRU CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT   QUOCPKUEJGP /ÒP\G KP -QPUVCPVKPQRGN CP 0CFGN OKV \YGK 5GKVGPJCMGP '4ª 5 HH 1#0    81.2'5 ++



/GFLKFLKG1TFGP &GMQTCVKQP FGT  -NCUUG 5KNDGT DTKNNCPVKGTV #WHNCIGP )QNF #ITCHHG 5KNDGT   XGTIQNFGVGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT/ÒP\GKP-QPUVCPVKPQRGNWPF2WP\G COQTKIKPCNGP*CNUDCPF'4ª5HH1#081.2'5 ++



/GFLKFLKG1TFGP &GMQTCVKQP FGT  -NCUUG 5KNDGT DTKNNCPVKGTV #WHNCIGP )QNF #ITCHHG 5KNDGT   XGTIQNFGVGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT/ÒP\GKP-QPUVCPVKPQRGNWPF2WP\G COQTKIKPCNGP*CNUDCPF'4ª5HH1#081.2'5 ++



9394







9393

9391

9395

/GFLKLKG1TFGP &GMQTCVKQP  -NCUUG OKV 5·DGNP 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV /GFCKNNQP )QNF   GOCKNNKGTV #ITCHHG 5KNDGT XGTIQNFGV OKV )QNFCWHNCIG 5·DGN 5KNDGT XGTIQNFGV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGTQUOCPKUEJGP/ÒP\GKP+UVCPDWNCO*CNUDCPFKOUR·VGTCPIGHGTVKIVGPLGFQEJ RCUUGPFGP'VWKOKVIQNFIGFTWEMVGO*CNDOQPFWPF5VGTP 4+p++



/GFLKFLKG1TFGP &GMQTCVKQP FGT  -NCUUG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV #WHNCIGP )QNF   GOCKNNKGTVOKP'OCKNNGCWUDTÒEJGWPF4GRCTCVWTGPCWHFGT4ÒEMUGKVGQUOCPKUEJG2WP\GCOQTKIKPCNGP $CPF OKV CWHIGNGIVGT 4QUGVVG KO QTKIKPCNGP TQVUCOVGPGP WPF IQNFGP DGFTWEMVGP 8GTNGKJWPIUGVWK   '4ª5HH1#081.2'5 ++



/GFLKFLKG1TFGP&GMQTCVKQPFGT-NCUUG5KNDGTDTKNNCPVKGTV#WHNCIGPWPFªDGTJÌJWPI)QNFGOCKN NKGTVCOQTKIKPCNGP$CPF'4ª5HH81.2'5 ++



5GJTSWCNKV·VUXQNNG#PHGTVKIWPICWUFGONGV\VGP&TKVVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

304

9396


TÜRKEI

9397

9398 9399



/GFLKFLKG1TFGP1TFGPUFGMQTCVKQP5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGXGTIQNFGV)QNFGOCKN NKGTV#DRNCV\WPIGPCWHFGT4ÒEMUGKVGQUOCPKUEJG2WP\GQJPG#ITCHHGWPFQJPG$CPF +++





1UOCPKLG1TFGP$TWUVUVGTP\WT-NCUUG5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTV/GFCKNNQP5KNDGTXGTIQNFGV WPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGTQUOCPKUEJGP/ÒP\GKP+UVCPDWNCP0CFGN OKV\YGK5GKVGPJCMGP ++



1UOCPKLG1TFGP &GMQTCVKQP  -NCUUG 5KNDGT VGKNYGKUG DTKNNCPVKGTV VGKNYGKUG XGTIQNFGV VGKNYGKUG   GOCKNNKGTV'OCKNNGCDRNCV\WPIGP<GPVTWOFGU8QTFGTUGKVGPOGFCKNNQPUGKPIGFTÒEMVCO$CPFOKVCNVGO 5COONWPIUGVKMGVVFGT5COONWPI(#NDGTVKP'RKPCN +++





9404

9400

9405 9401



1UOCPKLG1TFGP/KPKCVWTFGT&GMQTCVKQP-NCUUG5KNDGTVGKNYGKUGDTKNNCPVKGTVVGKNYGKUGXGTIQNFGV VGKNYGKUGGOCKNNKGTVCO$·PFEJGP ++





1TFGP 0KUJCP 5JGHMCV -NGKPQF \WT  -NCUUG )QNF GOCKNNKGTV \YGK OKP #WUDTÒEJG KP FGT ITÒPGP   'OCKNNG ¤UG OKV #ITCHHG CDIGDTQEJGP QJPG 5EJWNVGTDCPF '4ª 5 HH 1#0 5  81.2'   5 4+++



1TFGP0KUJCP5JGHMCV5EJWNVGTDCPF\WT-NCUUG QJPG-NGKPQF QTKIKPCNIGVTGWGUR·VGTG#PHGTVKIWPI CWU FGO <YGKVGP &TKVVGN FGU <YCP\KIUVGP ,CJTJWPFGTVU KO UR·VGTGP LGFQEJ QTKIKPCNIGVTGW IGHGTVKIVGP   'VWKFGT-NCUUGOKVIQNFDGFTWEMVGO*CNDOQPFWPF5VGTPWPF$G\GKEJPWPI +p++





1TFGP 0KUJCP 5JGHMCV 5R·VGT CPIGHGTVKIVGU 'VWK \WT  -NCUUG OKV IQNFDGFTWEMVGO *CNDOQPF WPF   5VGTPWPF$G\GKEJPWPI ++





6CJNKUK[G/GFCKNNG HÒT.GDGPUTGVVWPI 5KNDGTFWTEJDQJTVCOQTKIKPCNGP$CPF'4ª5H



++p



&KG/GFCKNNGKUVKPKJTGT)GUVCNVWPIKFGPVKUEJOKVFGT6CFKTK*ÒPGT/GFCKNNG HÒT8GTFKGPUVGKP-WPUVWPF9KUUGP UEJCHV YGKUVLGFQEJGKPGCPFGTG4ÒEMUGKVGPKPUEJTKHVCWH



+HVKJCT/GFCKNNG5KNDGTPG/GFCKNNG5KNDGTCP6TCIGTCJGOKV$CPFWPF6TCIGURCPIG'4ª5HH ++

 305


TÜRKEI

9408 9406 9407



.K[CMCV/GFCKNNG)QNFGPG/GFCKNNG5KNDGTXGTIQNFGVCPQTPCOGPVCNGT6TCIGURCPIG5KNDGTXGTIQNFGV OKV\YGK0CFGNP'4ª5HHXCT +p++



'UJCPFGNVUKEJJKGTDGKOÌINKEJGTYGKUGWOGKPGPKEJV\GKVIGPÌUUKUEJG#PHGTVKIWPI



.K[CMCV/GFCKNNG5KNDGTPG/GFCKNNG5KNDGTCP6TCIGURCPIGCO$CPFOKV5·DGNURCPIG5KNDGT CWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI#9'5/70<'$'4.+0CP0CFGN'4ª5HH ++





-TKO-TKGIU/GFCKNNG  #WUHÒJTWPI HÒT FKG RKGOQPVGUKUEJGP 6TWRRGP OKV .# %4+/'# 5KNDGT   QJPG 6T·IGTPCOGP CO QTKIKPCNGP $CPF OKV QTKIKPCNGT CNVGT 6TCIGURCPIG CWU 5KNDGT '4ª 5    ++p+++



9409

9410

9411

9412



-TKO-TKGIU/GFCKNNG  /KPKCVWT FGT #WUHÒJTWPI HÒT FKG RKGOQPVGUKUEJGP 6TWRRGP OKV .#   %4+/'#5KNDGTCP$CPFTCJGDTKVKUEJGP5VKNUCOPGWGP$·PFEJGP ++





1UOCPKUEJG-TKGIUOGFCKNNG5QIGPCPPVGT'KUGTPGT*CNDOQPFFGWVUEJG#WUHÒJTWPI$TQP\GXGTUKNDGTV WPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI$$%QCP0CFGNKOUR·VGTCPIGHGTVKIVGP LGFQEJRCUUGPFGP'VWKOKVGKPIGRT·IVGTIQNFHCTDGPGT6WIJTC'4ª5HH ++



4QVGT *CNDOQPF 7PDGMCPPVGU 'JTGP\GKEJGP FGU 4QVGP *CNDOQPFU VÒTMKUEJG 4QV-TGW\   1TICPKUCVKQP $TQP\GXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVQJPG$CPF ++





/ÌINKEJGTYGKUG JCPFGNV GU UKEJ JKGTDGK WO GKPG $CUVGNCTDGKV WPVGT 8GTYGPFWPI GKPGU QTKIKPCNGP #D\GKEJGPU XQO   4QVGP*CNDOQPFCWUFGO'TUVGP9GNVMTKGI FCGKPG#WU\GKEJPWPIFGUKUNCOKUEJGP4QVGP*CNDOQPFUKP(QTOGKPGU EJTKUVNKEJGP-TGW\GUYKFGTUKPPKIGTUEJGKPV





306

(GNFUEJPCNNG HÒT UGEJU #WU\GKEJPWPIGP GKPGU FGWVUEJGP D\Y ÌUVGTTGKEJKUEJGP +PJCDGTU   'KUGTPGU   -TGW\ ++ -NCUUG    ÌUVGTTGKEJKUEJGU -TKGIUDCPF OKV 5EJYGTVGTP   'JTGPMTGW\ FGU 9GNVMTKGIG   OKV 5EJYGTVGTP   /GFLKFLKG1TFGP OKV /KPKCVWTCWHNCIG   1UOCPKUEJG -TKGIUOGFCKNNG UQIGP   'KUGTPGT*CNDOQPF /GFCKNNGXQO4QVGP*CNDOQPF ++p+++



.GGTGU'VWK0GWCPHGTVKIWPIKPTQVGO5COVOKVCWHIGNGIVGO.QTDGGTMTCP\WPF5VGTP



++


TUNESIEN

9414

9415



9416

9418

1HHK\KGTUMQRRGNOKV-QRRGNUEJNQUU$TQP\GIWUUOKV4GUVXGTUKNDGTWPI

9417

++p+++



670'5+'0 (ª456'067/670+5 $+5  

1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP/QJCOGFGU 5CFQM &GMQTCVKQP-NCUUG5KNDGTDTKNNCPVKGTVWPFTGRGTEKGTVVGKNYGKUGGOCKNNKGTV#WU DTWEJKPFGTTQVGP'OCKNNGCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC-T½VN[KP2CTKUCOQTKIK PCNGPLGFQEJUR·VGTGP*CNUDCPF81.2'5H ++p



0CEJ FGO 8QTDKNF FGU QUOCPKUEJGP 0KUJCP +HVKMJCT1TFGPU YWTFG FGT 1TFGP XQP/WUVCRJC$G[XQP6WPKU IGUVKHVGV 5GKP 0CEJHQIGT #JOGF $G[ GTYGKVGTVG KJP CWH HÒPH 5VWHGP WPF HÒIVG UGKP GKIGPGU /QPQITCOO GKP GKPG   2TCZKUFKGCNNGUGKPG0CEJHQNIGTDKU\WO'PFGFGT/QPCTEJKGDGKDGJKGNVGP/QJCOGFGU5CFQM$G[XQP6WPKUICD FGP+PUKIPKGPOKV&GMTGVXQO(GDTWCT/·T\GKPGPGWG)GUVCNVWPIWPFGTYGKVGTVGKJPCWHPWPOGJTUGEJU-NCUUGP

)TQ­MQTFQP  DKU  -NCUUG  /KV FGT #DUGV\WPI FGU NGV\VGP $G[U /QJCOGF 'N #OKP  FWTEJ 2T·UKFGPV   $QWTIWKDCJÌTVGFGT1TFGPCWH\WDGUVGJGP#WITWPFFGT\YGK/QFGNNGOKVUKGDGPXGTUEJKGFGPGP#WUHÒJTWPIGPFGU  /QFGNNU KP \WFGO LGYGKNU \CJNTGKEJGP 8CTKCPVGP IGJÌTV FKGT 1TFGP \W FGP XKGNUGKVKIUVGP WPF KPVGTGUUCPVGUVGP   ÒDGTJCWRV



1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP/QJCOGFGU 5CFQM    &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV VGKNYGKUG GOCKNNKGTV 'OCKNNGCWUDTWEJ KP   GKPGO5VTCJNCOQTKIKPCNGPCNVGP$CPFOKVCWHIGNGIVGT4QUGVVG81.2'5H ++p



1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP/QJCOGFGU 5CFQM    &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV VGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP CNVGP   $CPF81.2'5H 4+p++



1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP/QJCOGFGU 5CFQM    &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV VGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP CNVGP   $CPF81.2'5H +p++



(TCP\ÌUKUEJG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU



5GJTHGKPIGCTDGKVGVG#WUHÒJTWPICWUFGT#PHCPIU\GKVFGU\YGKVGP/QFGNNU



(TCP\ÌUKUEJG#PHGTVKIWPICWUFGONGV\VGP8KGTVGNFGU0GWP\GJPVGP,CJTJWPFGTVU

307


TUNESIEN

9420

9419

9421

9423 9422







1TFGP FGU 4WJOGU =0KUJCP +HVKMJCT?  /QFGNN  #WUICDG OKV FGO /QPQITCOO XQP #NK $G[      &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG GOCKNNKGTV CWH FGT   4ÒEMUGKVGVWPGUKUEJG*GTUVGNNGTDG\GKEJPWPICOQTKIKPCNGPCNVGP$CPFOKVCWHIGNGIVGT4QUGVVG81.2' 5H ++



1TFGP FGU 4WJOGU =0KUJCP +HVKMJCT?  /QFGNN  #WUICDG OKV FGO /QPQITCOO XQP #NK $G[      &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG GOCKNNKGTV CWH FGT   4ÒEMUGKVGVWPGUKUEJG*GTUVGNNGTDG\GKEJPWPICOQTKIKPCNGPCNVGP$CPF81.2'5H ++



1TFGP FGU 4WJOGU =0KUJCP +HVKMJCT?  /QFGNN  #WUICDG OKV FGO /QPQITCOO XQP #NK $G[     &GMQTCVKQP-NCUUG5KNDGTDTKNNCPVKGTVVGKNYGKUGGOCKNNKGTVCOQTKIKPCNGPCNVGP$CPFFGT -NCUUGOKVCWHIGNGIVGT4QUGVVG81.2'5H ++



6WPGUKUEJG#PHGTVKIWPI



1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP/QJCOOGF GN *CFK    $TWUVUVGTPUVGTP \WT )TQ­MNCUUG QFGT )TQ­MQTFQP 5KNDGT DTKNNCPVKGTV VGKNYGKUG   GOCKNNKGTV&WTEJOGUUGTOOCP0CFGNOKV\YGK5GKVGPJCMGP81.2'5H +p++



(TCP\ÌUKUEJG #PHGTVKIWPI FKGUGT PWT XKGT ,CJTG NCPI XGTNKGJGPGP #WUHÒJTWPI &GT $TWUVUVGTP \WT 5QPFGTMNCUUG   WPVGTUEJGKFGV UKEJ XQO $TWUVUVGTP FGT  -NCUUG FCTKP FCUU GTUVGTGT UKGDGP 5VTCJNGPURKV\GP \YKUEJGP FGP ITQ­GP   5VTCJNGPJCVY·JTGPFNGV\VGTGTPWTHÒPHCWHYGKUV



308

1TFGP FGU 4WJOGU =0KUJCP +HVKMJCT?  /QFGNN  #WUICDG OKV /QPQITCOO XQP /QJCOOGF GN   *CFK    &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG GOCKNNKGTV MN   'OCKNNGEJKRKO/GFCKNNQPCWHFGT4ÒEMUGKVG2WP\GOKVCTCDKUEJGP5EJTKHV\GKEJGPCOQTKIKPCNGP$CPF OKVCWHIGNGIVGT4QUGVVG81.2'5H ++p




TUNESIEN

9425

9424





9426

1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP/QJCOGFGN *CFK    &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV VGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP CNVGP   $CPFOKVCWHIGNGIVGT4QUGVVG81.2'5H +p++



1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP5KFK*COGFK    $TWUVUVGTP FGT  -NCUUG 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV VGKNYGKUG GOCKNNKGTV   QDGTHN·EJNKEJGT 'OCKNNGEJKR CWH FGT 4ÒEMUGKVG VWPGUKUEJG *GTUVGNNGTDG\GKEJPWPI CP 0CFGN OKV \YGK   5GKVGPJCMGP81.2'5H ++



6WPGUKUEJG #PHGTVKIWPI &GT $TWUVUVGTP FGT  -NCUUG WPVGTUEJGKFGV UKEJ XQO $TWUVUVGTP \WT 5QPFGTMNCUUG FCTKP   FCUU GTUVGTGT PWT HÒPH 5VTCJNGPURKV\GP \YKUEJGP FGP ITQ­GP 5VTCJNGP JCV Y·JTGPF NGV\VGTGT UKGDGP CWHYGKUV &GT   $TWUVUVGTPYKTFCNNGKPGQJPGYGKVGTG+PUKIPKGPYKG*CNUQFGT$TWUVMTGW\XGTNKGJGPWPFIGVTCIGP



1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP5KFK*COGF   &GMQTCVKQP  -NCUUG 5KNDGT DTKNNCPVKGTV WPF VGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP *CNUDCPF   81.2'5H +p++



(TCP\ÌUKUEJG#PHGTVKIWPI

9427



1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?/QFGNN#WUICDG OKVFGO/QPQITCOOXQP/QJCOGFCN #OKPTGIDKU )TQ­MQTFQPUGVHTCP\ÌUKUEJG#PHGTVKIWPIDGUVGJGPFCWU-NGKPQF5KNDGT VGKNYGKUG GOCKNNKGTV CO QTKIKPCNGP 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT VGKNYGKUG GOCKNNKGTV CP 0CFGN   OKV\YGK5GKVGPJCMGP1#05H 5VÒEM+p++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T  7TURTÒPINKEJ CWU FGO $GUKV\ GKPGU HTCP\ÌUKUEJGP &KRNQOCPVGP FGUUGP 1TFGPUPCEJNC­ OKV  )TQ­MTGW\GP   CO#RTKNDGK5RKPM UKP.QPFQPXGTUVGKIGTVYWTFG

309


URUGUAY

9430



9429

9430

1TFGPFGU4WJOGU=0KUJCP+HVKMJCT?&CJKT 8GTNGKJWPIUWTMWPFG FCVKGTV#* #& QDGP WPFWPVGPDGUEJPKVVGPIGHCNVGV 4+++



670'5+5%*'4'27$.+- 5'+6  

1TFGP FGT 4GRWDNKM -QOOCPFGWTFGMQTCVKQP $TQP\G XGTUKNDGTV VGKNYGKUG GOCKNNKGTV CO *CNUDCPF   \WUCOOGPOKV-PQRHNQEJTQUGVVGKOQTKIKPCNGP8GTNGKJWPIUGVWKFGT(KTOC#TVJWU$GTVTCPFKP2CTKU<W UCOOGPOKVQTKIKPCNGT#PPCJOGIGPGJOKIWPIFGU%JGHUFGU$WPFGURT·UKFKCNCOVUHÒTFGP/KPKUVGTKCNTCV KO$WPFGURT·UKFKCNCOV*GNOWV/ÒNNGTFCVKGTV$QPPCO5GRVGODGTWPF2JQVQMQRKGFGU8GT \GKEJPKUUGUXQP\YKUEJGPWPFCP/ÒNNGTXGTNKGJGPGP1TFGPOKVLGYGKNKIGO8GTNGKJWPIU LCJT81.2'5 ++



747)7#;4'27$.+- 

2CTCIWC[(GNF\WIU/GFCKNNG'KUGPOKP-QTTQUKQPUUVGNNGPCODGUEJ·FKIVGP1TKIKPCNDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC ,WCP $ )KWFKEK KP $WGPQU #KTGU OKV IQNFHCTDGPGO   5VCCVYCRRGP7TWIWC[U 44++ &KGYGPKIGP#WU\GKEJPWPIGP7TWIWC[UIGJÌTGP\WFGPUGNVGPUVGPXQPICP\5ÒFCOGTKMC



9431

8'0'<7'.#$1.+8#4+5%*'4'27$.+- 

1TFGPFGU$GHTGKGTU CWEJ1TFGPFGT$ÒUVG$QNKXCTUIGPCPPV )TQ­QHHK\KGTUUGVDGUVGJGPFCWU)TQ­ QHHK\KGTUFGMQTCVKQP5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVFKG/GFCKNNQPCWHNCIGUGRCTCVCWHIGNGIVCO QTKIKPCNGP *CNUDCPF WPF $TWUVUVGTP 5KNDGT DTKNNCPVKGTV WPF TGRGTEKGTV FKG /GFCKNNQPCWHNCIG UGRCTCV   CWHIGNGIVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC$QWNNCPIGTKP2CTKU 4FGNC2CKZ CP 0CFGN FKGUG OKV HTCP\ÌUKUEJGT )CTCPVKGRWP\G XQP  DKU  HÒT GT 5KNDGT 9KNFUEJYGKPMQRH    FGUINGKEJGP CWH FGO 0CFGNJCMGP OKV \YGK 5GKVGPJCMGP KO QTKIKPCNGP GVYCU DGUEJ·FKIVGP 8GTNGK   JWPIUGVWKFGT(KTOC$QWNNCPIGT#&'05 5VÒEM+p++ *GTXQTTCIGPFGHTCP\ÌUKUEJG#PHGTVKIWPIUSWCNKV·V  &GT CO  #RTKN  KP HÒPH -NCUUGP IGITÒPFGVG 1TFGP IGJV CWH FKG #WU\GKEJPWPIU/GFCKNNG /GFCNNC FG   &GUVKPEKÉP  XQP  \WTÒEM &KGUG WTURTÒPINKEJ QXCNG IQNFGPG QFGT UKNDGTPG /GFCKNNG OWUU UEJQP XQT  FKG   (QTO FGU 1TFGPU\GKEJGPU FGU UR·VGTGP 1TFGPU FGU $GHTGKGTU CPIGPQOOGP JCDGP YWTFG CDGT CP GKPGO JGNNDNCWGP   $CPFCO*CNUIGVTCIGPWPFJCVVGPCEJ*5EJWN\GUEJQPOGJTCNUGKPG-NCUUG&GT1TFGPJKG­QHHK\KGNNXQP %QPFGEQTCEKÉPFGN$WUVQFGN.KDGTVCFQT 8INCWEJ2NCPCU5WCTG\5*KUVQTKCFGNC1TFGPFGN.KDGTVCFQT %CTCECU   6GPTGKTQ 6QOCU 2 %QPFGEQTCEKQPGU 0CEKQPCNGU %CTCECU   7TFCPGVC $TCUEJK '\GSWKGN   $QNKXCTGPNCPWOKUOCVKECEQPOGOQTCVKXC[GPNCUEQPFGEQTCEKQPGU%CTCECU5)4+6<5HH 

310




USA

9432 9433



1TFGP XQP (TCPEKUEQ FG /KTCPFC -QOOCPFGWTFGMQTCVKQP XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CO   MWT\GP*CNUDCPFCDUEJPKVV81.2'5 +p++



8'4'+0+)6'56##6'0810#/'4+-# 75#  

8GTFKGPUV.GIKQP -QOOCPFGWT&GMQTCVKQP $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPFCDUEJPKVV   ++



ex 9434

ex 9434



ex 9435

#WU\GKEJPWPIUPCEJNCUUFGU/CVTQUGP5VGRJGP2CFNCTXQPFGT7556TGPVQPDGUVGJGPFCWU 0CX[ )QQF %QPFWEV /GFCN  /QFGNN $TQP\G CWH FGT 4ÒEMUGKVG ITCXKGTV %5% 56'2*'0   2#&.#4 755 64'0610  /#4%* CO $CPF OKV \YGK $CPFURCPIGP  WPF    DGKFG CWH FGT 4ÒEMUGKVG ITCXKGTV 56'2*'0 2#&.#4 CP CNVGT 6TCIGURCPIG   5GEQPF 0KECTCIWCP   %CORCKIP/GFCN$TQP\GKO4CPFPWOOGTKGTV/0QCO$CPFCPCNVGT6TCIGURCPIG 9QTNF 9CT++8KEVQT[/GFCN 750CX['ZRGTV4KHNGOCP/GFCNCO$CPFCPCNVGT6TCIGURCPIG564$' 5HHH 5VÒEM4++



5EJÌPG )TWRRG GKPGU 8GVGTCPGP FGU <YGKVGP 0KECTCIWC-TKGIU WPF FGU <YGKVGP 9GNVMTKGIGU  &KG 8GTGKPKIVGP   5VCCVGPXQP#OGTKMCJKGNVGPFKGXQPFGT-QPUGTXCVKXGP2CTVGKTGIKGTVGP4GRWDNKM0KECTCIWCXQPDKUXQP 5QNFCVGP FGU /CTKPGMQTRU UGKV  FG HCEVQ CNU 2QVGMVQTCV  DGUGV\V WO \W XGTJKPFGTP FC­ KTIGPF GKPG CPFGTG   0CVKQPGKPGP-CPCNXQO#VNCPVKM\WO2C\KHKMDCWGPMÌPPVG8QPCPHÒJTVG)GPGTCN#WIWUVQ%5CPFKPQ    GKPGP )WGTKNNC-TKGI IGIGP FKG COGTKMCPKUEJG $GUCV\WPI WPF FKG MQPUGTXCVKXG 4GIKGTWPI FGU .CPFGU FGT   UEJNKG­NKEJ  FKG 8GTGKPKIVGP 5VCCVGP \YCPI FKG $GUCV\WPI CWH\WIGDGP WPF FCU .CPF \W XGTNCUUGP <W $GIKPP   FGU -TKGIGU VTCPURQTVKGTVG FGT NGKEJVG -TGW\GT FGT 1OCJC-NCUUG  755 6TGPVQP FGP COGTKMCPKUEJGP 2QNKVKMGT   1DGTUV *GPT[ . 5VKOUQP -TKGIUOKPKUVGT XQP  DKU  WPF #W­GPOKPKUVGT XQP  DKU   CNU 5QPFGT   IGUCPFVGT2T·UKFGPV%CNXKP%QQNKFIGU  PCEJ0KECTCIWCYQDGKFCU5EJKHHXQO#RTKNDKU/CK KP PKECTCIWCPKUEJGP )GY·UUGTP QRGTKGTVG 0WT KP FKGUGO MWT\GO <GKVTCWO Y·JTGPF FGO CWEJ 5VGRJGP 2CFNCT CP   $QTFFGT7556TGPVQPFKGPVGPCJOFCU5EJKHHCO<YGKVGP0KECTCIWCPKUEJGP-TKGIVGKN



-QPXQNWV XQP FTGK #WU\GKEJPWPIGP FGT 0CVKQPCN #GTQPCWVKEU CPF 5RCEG #FOKPKUVTCVKQP 0#5#      0#5# &UKUVKPIWKUJGF 2WDNKE 5GTXKEG /GFCN   0#5# 'SWCN 'ORNQ[OGPV 1RRQTVWPKV[ /GFCN    0#5#5RCEG5JWVVNG5RCEG(NKIJV/GFCNLGYGKNUCOMQTTGMVGP$CPFOKV6TCIGURCPIG 5VÒEM+p++

 311


USA

9437 9436



9438

%KPEKPPCVK1TFGP1TFGPU\GKEJGPFGT/KVINKGFGT5KNDGTXGTIQNFGVWPFGOCKNNKGTVOKP#DURNKVVGTWPIGP KPFGTITÒPGP'OCKNNGCO1TKIKPCNDCPF6#// 4++



6[RKUEJG #PHGTVKIWPI FGT (KTOC #TVJWU $GTVTCPF KP 2CTKU &KG (KTOC FCTH FCU 1TFGPU\GKEJGP PWT CP $GTGEJVKIVG   XGTMCWHGP  &KG %KPEKPPCVK)GUGNNUEJCHV YWTFG DGTGKVU KO ,CJTG  XQP )GQTIG 9CUJKPIVQPU 1HHK\KGTUMQTRU IGITÒPFGV 'KPG   $GFKPIWPI HÒT FKG #WHPCJOG YCT WPF KUV GU CWEJ JGWVG OGKUV PQEJ  FGT 0CEJYGKU FGT #DUVCOOWPI XQP GKPGO   1HHK\KGT FGT KO 7PCDJ·PIKIMGKVUMTKGI OKPFGUVGPU FTGK ,CJTG NCPI &KGPUV IGVCP JCV &KG )GUGNNUEJCHV DGUVGJV JGWVG   PQEJWPFJCVPCEJ$KUJQR $+5* EC/KVINKGFGTKPFGP8GTGKPKIVGP5VCCVGPWPFKP(TCPMTGKEJ 0CEJMQOOGP FGT 1HHK\KGTG FGT 6TWRRGP FGU /CTSWKU FG NC (C[GVVG  8IN CWEJ /[GTU / 6JG +PUKIPKC QH VJG 5QEKGV[ QH   %KPEKPPCVK9CUJKPIVQP&%7PF&KGHTCP\ÌUKUEJGP/KVINKGFGTWPFKJTG#DUVCOOWPI+P.COQPV*WPF FG5CKPV5KOQP(#TOQTKCNFGU%KPEKPPCVKFG(TCPEG2CTKU 



%KPEKPPCVK1TFGP 1TFGPU\GKEJGP FGT /KVINKGFGT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO 1TKIKPCNDCPF   6#// ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T



1TFGP FGT 8GVGTCPGP #WUY·TVKIGT -TKGIG FGT 8GTGKPKIVGP 5VCCVGP =1TFGT QH VJG 8GVGTCPU QH   (QTGKIP 9CTU QH VJG 7PKVGF 5VCVGU? -QOOCPFGWTMTGW\ XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   OKV ITCXKGTVGO 6T·IGTOQPQITCOO /( WPF *GTUVGNNGTDG\GKEJPWPI FGT (KTOC %NGTE KP 2CTKU CO   *CNUDCPF KO QTKIKPCNGP 8GTNGKJWPIUGVWK FGT (KTOC %NGTM OKV FGP IQNFHCTDGPGP +PKVKCNGP FGU 6T·IGTU   <WUCOOGPOKVFGT8GTNGKJWPIUWTMWPFGHÒT)GPGTCN/KEJGN(QWTSWGVFCVKGTV,CPWCT +p++

ex 9439





312



ex 9440

-QPXQNWV XQP  XGTUEJKGFGPGP #WU\GKEJPWPIGP &CTWPVGT CWEJ JÌJGTTCPIKIG YKG \ $ 0CUC   &KUVKPIWKUGI 5GTXKEG /GFCN  /QFGNN  5KNXGT 5VCT WPF &KUVKPIWKUJGF (N[KPI %TQUU CWU   WPVGTUEJKGFNKEJGP /CVGTKCNKGP VGKNU XGTIQNFGV QFGT XGTUKNDGTV LGYGKNU CP $·PFGTP KP QTFGPVNKEJGP   'TJCNVWPIU\WUV·PFGP 5VÒEM++



-QPXQNWVXQPXGTUEJKGFGPGPOKNKV·TKUEJGP#WU\GKEJPWPIGP&CTWPVGT#TO[&KUVKPIWKUJGF5GTXKEG %TQUU #TO[ &KUVKPIWKUJGF 5GTXKEG /GFCN WPF 2WTRNG *GCTV $TQP\G \YGK FCXQP XGTIQNFGV WPF   GOCKNNKGTVCP$·PFGTP 5VÒEM++




VIETNAM

9443

9441

-#+5'44'+%*#00#/ 

9442

8+'60#/

-KO-JCPJ5QIGPCPPVGUR·VG5VCPFCTFCWUHÒJTWPI&GMQTCVKQPFGT)TQ­GP-NCUUGKP)QNF &CK*CPI -KO -JCPJ   Z  OO $TQP\G XGTIQNFGV OKV #PJ·PIGT WPF 6TCIGUEJPWT KP FGT QTKIKPCNGP   GKPHCEJGP LGFQEJ UGNVGPGP NGKEJV DGUEJ·FKIVGP 8GTNGKJWPIUUEJCEJVGN FGT (KTOC .CEVKPJXKGP KP *W¾ OKV   FGT$GK\GKEJPWPI-+/-*#0**145%.#55'CWHFGO$QFGP1#05 ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T &CXQTGZ#WMVKQP/CKUQP2NCVVKP2CTKUXQO,WPK  &GT5VKHVWPIU\GKVRWPMVFKGUGTDGFGWVGPFUVGP#WU\GKEJPWPIFGU-CKUGTTGKEJGU#PPCONKGIVKO&WPMGNFGT)GUEJKEJVG 5QYQJN UGKPG $G\GKEJPWPI YKG CWEJ UGKP #WUUGJGP YWTFGP XQP GKPGO )QPI CWU /GVCNN QFGT 5VGKP JGTIGNGKVGV FGT   GKPG JQJG \GTGOQPKGNNG $GFGWVWPI JCVVG &KG /KVINKGFGT FGT MCKUGTNKEJGP (COKNKG VTWIGP -JCPJU CWU ,CFG CPFGTG   YÒTFGP 6T·IGT UQNEJG KP )QNF -KO -JCPJ DG\GKEJPGV  /KV FGO 'PFG FGT /QPCTEJKG GTNQUEJ \WP·EJUV CWEJ FGT   -JCPJ CNNGTFKPIU HÒJTVG KJP 2T·UKFGPV &KGO  YKGFGT GKP 'T YWTFG FCPP DKU \WO 'PFG FGT 4GRWDNKM 5ÒF    8KGVPCOXGTNKGJGP8INCWEJ5;.*ª55H



-KO$QK/QFGNNWPVGT-CKUGT6J¯PJ6J±K TGIDKU -KO$QKKP)QNF\WVKGPZOO )QNF  #PJ·PIGTWPF6TCIGUEJPWTXGTMGJTVJGTWODGHGUVKIV ++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T &CXQTGTYQTDGPKO,WNKXQP2CVTKEG4GDQWNKP2CTKU  -CKUGT 6J¯PJ 6J±K TGIKGTVG FCU .CPF XQP  DKU  WPF YWTFG WPVGT FGO 8QTYCPF CDIGUGV\V GT JCDG    )TCWUOCMGKVGP IGIGP FKG (TCWGP FGU *QHGU DGICPIGP 5;.*ª5 5    &GT $QK YWTFG  XQP -CKUGT 6J¯PJ   6J±KCNUSWKXCNGPV \WO-JCPJ HÒT(TCWGPIGUVKHVGVWPFDKU\WO'PFGFGT/QPCTEJKGXGTNKGJGP

4'27$.+- 5ª& 8+'60#/ 

0CVKQPCNQTFGPXQP8KGVPCO4KVVGTFGMQTCVKQP5KNDGT  XGTIQNFGVWPFGOCKNNKGTVCOQTKIKPCNGP$CPF 1#0 ++



5GJT UEJÌPG GOCKNNKGTVG HTCP\ÌUKUEJG #PHGTVKIWPI PKEJV \W XGTINGKEJGP OKV FGP UR·VGTGP NCEMKGTVGP COGTKMCPKUEJGP   'ZGORNCTGP  &GT HÒPHMNCUUKIG CNNIGOGKPG 8GTFKGPUVQTFGP YWTFG CO  #WIWUV  IGUVKHVGV 0CEJ FGT 8GTGKPKIWPI 5ÒF   8KGVPCOUOKVFGT5Q\KCNKUVKUEJGP4GRWDNKM8KGVPCOCO,WNKJÌTVGCWEJFGT1TFGPHCMVKUEJCWH\WDGUVGJGP

313


ZENTRALAFRIKANISCHE REPUBLIK

9445

ex 9448

9444 9446

6*#(¤&'4#6+10 

<KXKN8GTFKGPUVQTFGP 1HHK\KGTUMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV CWHIGNGIVGT   4QUGVVG +



&GTXKGTMNCUUKIG1TFGPKUVFWTEJFGP4CVFGT6JCÅ(ÌFGTCVKQPIGUVKHVGVWPFXQTYKGIGPFCP(TCP\QUGPXGTNKGJGPYQTFGP

<'064#.#(4+-#0+5%*'4'27$.+- 

<GPVTCNCHTKMCPKUEJGT8GTFKGPUVQTFGP)TQ­MTGW\UGVDGUVGJGPFCWU-NGKPQFXGTIQNFGVWPFGOCKNNKGTV ZOOCOQTKIKPCNGP5EJWNVGTDCPFWPF$TWUVUVGTPXGTIQNFGVWPFGOCKNNKGTV&WTEJOOOCP 0CFGN \WUCOOGP OKV -PQRHNQEJTQUGVVG WPF 7PKHQTO$CPFUEJPCNNG KP QTKIKPCNGO 8GTNGKJWPIUGVWK FGT   (KTOC#TVJWU$GTVTCPFKP2CTKU1#0541((5 5VÒEM+p++



'Z#WMVKQP1TFGPCWUCNNGT9GNV5COONWPI6COOCPPFGT7$5KP$CUGNCOWPF0QXGODGT.QV0T 7TURTÒPINKEJXGTNKGJGPCP5VCCVUUGMTGV·T2TQH&T9CNVGT*CNNUVGKP   &GTHÒPHMNCUUKIGCNNIGOGKPG8GTFKGPUVQTFGPYWTFGCO,WPKIGUVKHVGV



<GPVTCNCHTKMCPKUEJGT 8GTFKGPUVQTFGP 1HHK\KGTUMTGW\ $TQP\G XGTIQNFGV WPF GOCKNNKGTV CO $CPF OKV   CWHIGNGIVGT4QUGVVG41((5 ++



8'4'+06'0#6+10'0 



-QPXQNWV XQP UKGDGP 701/GFCKNNGP KP XGTUEJKGFGPGP #WUHÒJTWPIGP &CTWPVGT XKGT XGTUEJKGFGPG   #WUICDGP FGT -QTGC/GFCKNNG HTCP\ÌUKUEJ ITKGEJKUEJVÒTMKUEJWPFVJCKN·PFKUEJ LGYGKNUCP$·PFGTP 5VÒEM++



#WU\GKEJPWPIU WPF #D\GKEJGP0CEJNCUU GKPGU UEJYGFKUEJGP 70'(5QNFCVGP $GUVGJGPF CWU \YGK   70'(/GFCKNNGP CP $·PFGTP GKPGO GOCKNNKGTVGP 70'(#D\GKEJGP GKPGT /GFCKNNG OKV ITCXKGTVGT +P   UEJTKHV70'(1.;/2+#)#<#1%61$'46*+4&2.#%'$TQP\GQJPG$CPFUQYKG701 /GFCKNNGOKV5RCPIG%10)1WPF-TGW\(0$#6#.,10:++-10)1 5VÒEM++



&GTGTUVG70'('KPUCV\ 7PKVGF0CVKQPU'OGTIGPE[(QTEG70'( FCWGTVGXQP0QXGODGTDKU,WPK'T WOHC­VG EC  /CPP CWU  0CVKQPGP FCTWPVGT CWEJ 5EJYGFGP  WPF XGTUWEJVG CWH FGT 5KPCK*CNDKPUGN WPF KO   )C\C FGP (TKGFGP \YKUEJGP I[RVGP WPF +UTCGN \W UKEJGTP 70'( IKNV CNU FKG GTUVG (TKGFGPUOKUUKQP FGT 8GTGKPVGP   0CVKQPGPCPFGTDGYCHHPGVG'KPJGKVGPVGKNIGPQOOGPJCDGP

314


ORDENSSCHNALLEN INTERNATIONAL

9449

14&'055%*0#..'0+06'40#6+10#. 

)TQ­G1TFGPUUEJPCNNGOKVXKGT#WU\GKEJPWPIGP 1UOCPKUEJGU4GKEJ/KFLKFLKG1TFGP&GMQTCVKQP -NCUUG5KNDGTDTKNNCPVKGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCOKPMQTTGMVGP$CPF -CODQFUEJC -ÌPKINKEJGT /QPKUGTCRJQP1TFGP 4KVVGTFGMQTCVKQP $TQP\G XGTIQNFGV   2GTUKGP 8GTFKGPUVQTFGP HÒT   -WPUVWPF9KUUGPUEJCHV&GMQTCVKQP-NCUUG5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTVHGKPG'OCKNNGOCNG TGK 6JCKNCPF1TFGPFGT-TQPGXQP6JCKNCPF/QFGNN  &GMQTCVKQP-NCUUG5KNDGT XGTIQNFGVVGKNYGKUGGOCKNNKGTVOKP'OCKNNGCWUDTWEJKPGKPGT5RKV\G#P0CFGN 5VÒEM4++



9450



)TWRRG XQP FTGK \WUCOOGPIGP·JVGP #WU\GKEJPWPIGP   2TGW­GP 4QVGT #FNGT1TFGP  /QFGNN  

OKV NKNCTQVGO #FNGT    -TGW\  -NCUUG #WUHÒJTWPI OKV IGMÌTPVGP -TGW\CTOGP HGKPG   'OCKNNGOCNGTGKCWHFGO4CPFFGUWPVGTGP-TGW\CTOU4KV\OCTMG9 ¤UVGTTGKEJ5KNDGTPG/GFCKNNG XQO 4QVGP -TGW\ QJPG -TKGIUFGMQTCVKQP  KP FGT ¤UG FTGKHCEJ RWP\KGTV   $GNIKGP -ÌPKI #NDGTV   /GFCKNNG CO $CPF HÒT *WOCPKV·V &C\W (TCPMTGKEJ #MCFGOKUEJG 2CNOGP  /QFGNN     'JTGP\GKEJGP GKPGU 1HHK\KGTU FGT 8QNMUGT\KGJWPI UQIGP )QNFGPG #MCFGOKUEJG 2CNOGP  5KNDGT   DTKNNCPVKGTV WPF XGTIQNFGV VGKNYGKUG GOCKNNKGTV CO 1TKIKPCNDCPF OKV DGKNKGIGPFGT 4QUGVVG 5QYKG   -PQRHNQEJOKPKCVWT\WOUEJYGFKUEJGP0QTFUVGTPQTFGP ++



-1081.76'+06'40#6+10#. 

-QPXQNWV XQP UGEJU XGTUEJKGFGPGP +PVGTCNNKKGTVGP 5KGIGUOGFCKNNGP #WU $GNIKGP (TCPMTGKEJ \YGK   XGTUEJKGFGPG +VCNKGP2QTVWICNWPF6UEJGEJQUNQYCMGK,GYGKNUCP$·PFGTP 5VÒEM++





-QPXQNWVXQPFTGK#WU\GKEJPWPIGP $GNIKGP-TQPGPQTFGP4KVVGTFGMQTCVKQP 2QNGP1TFGP2QNQ PKC 4GUVKVWVC 4KVVGTFGMQTCVKQP   2QNGP )QNFGPGU 8GTFKGPUVMTGW\ XGTIQNFGV LGYGKNU GOCKNNKGTV CO   $CPFWPFKO1TKIKPCNGVWK 5VÒEM++



-QPXQNWVXQPXGTUEJKGFGPGPGWTQR·KUEJGP#WU\GKEJPWPIGP7CCWU$WNICTKGP+VCNKGPFGP0KG FGTNCPFGP2QNGP4WO·PKGP5EJYGFGPWPF5GTDKGP1TKIKPCNGWPF-QRKGPKPXGTUEJKGFGPGP/GVCNNGP

CWEJ KP 5KNDGT  VGKNU XGTIQNFGV VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV VGKNU CP 0CFGN VGKNU CP $·PFGTP KP   WPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p++++++





315


KONVOLUTE 

-QPXQNWVXQPGWTQR·KUEJGP#WU\GKEJPWPIGP7CCWU$WNICTKGP(KPPNCPF(TCPMTGKEJ)TKGEJGP NCPF)TQ­DTKVCPPKGP0QTYGIGP5EJYGFGPWPF7PICTPKPXGTUEJKGFGP/GVCNNGPCWEJ5KNDGTVGKNYGKUG XGTIQNFGV VNY XGTUKNDGTV GKPKIG GOCKNNKGTV KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP XQTYKGIGPF CP $·PFGTP   \YGKKP'VWKU 5VÒEM++++p+++++++8



-QPXQNWVXQP#WU\GKEJPWPIGPCWUCNNGT9GNV7CCWU$GNIKGP+PFKGP,QTFCPKGP,WIQUNCYKGP -COGTWP 5ÒF-QTGC 2CMKUVCP 2QNGP 5GTDKGP FGT 6UEJGEJQUNQYCMGK FGP 8GTGKPVGP 0CVKQPGP FGO   8CVKMCP 8KGVPCO WPF CWU <CKTG 8GTUEJKGFGPG /GVCNNG CWEJ 5KNDGT  VGKNU XGTIQNFGV KP   WPVGTUEJKGFNKEJGP'TJCNVWPIGPCP$·PFGTP 5VÒEM++



-QPXQNWVXQP#WU\GKEJPWPIGPWPF#D\GKEJGP7CCWU%JKPC2QNGP4WUUNCPF <CTGPVWO FGT 5QYLGVWPKQP WPF FGT 6UEJGEJQUNQYCMGK 8GTUEJKGFGPG /GVCNNG VGKNU XGTIQNFGV VGKNU XGTUKNDGTV VGKNU   GOCKNNKGTVVGKNUCP2GPVCIQPCNDCPFURCPIGPVGKNUQJPG$·PFGTVGKNUCP0CFGNKPWPVGTUEJKGFNKEJGP'TJCN VWPIGP&C\W7OJCPIUEJNKG­G 5VÒEM++





-QPXQNWV XQPEC1TFGPWPF'JTGP\GKEJGP7CCWU$GNIKGP$WNICTKGP(KPPNCPF(TCPMTGKEJ )TQ­DTKVCPPKGP +VCNKGP -WYCKV 2QNGP 4WUUNCPF 5CWFK #TCDKGP 5RCPKGP FGT 5QYLGVWPKQP WPF FGP   75#7PVGTUEJKGFNKEJG/GVCNNG CWEJ5KNDGT VGKNUXGTIQNFGVVGKNUXGTUKNDGTVVGKNUGOCKNNKGTVVGKNUCP $·PFGTPVGKNUCP0CFGNPKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP&C\WEC/KPKCVWTGP(GNFURCPIGPWPF UQPUVKIG-NGKPVGKNGFKX$·PFGTWPFXKGT'VWKU 5VÒEM++++p++++++





-QPXQNWVXQP#WU\GKEJPWPIGPWPF#D\GKEJGP7CCWU&GWVUEJNCPF(TCPMTGKEJ)TQ­DTKVCPPKGP 0KGFGTUCEJUGP 2QNGP 4WUUNCPF 5RCPKGP WPF FGT 6UEJGEJQUNQYCMGK 7PVGTUEJKGFNKEJG /GVCNNG VGKNU   XGTIQNFGVVGKNUXGTUKNDGTVVGKNUGOCKNNKGTVVGKNUCP$·PFGTPVGKNUCP6TCIGMQTFGNVGKNUCP0CFGNPGKPGU KO'VWKKPWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p++++++



-QPXQNWVXQP#WU\GKEJPWPIGPCWU$GNIKGP$WNICTKGP(TCPMTGKEJ,CRCPFGP0KGFGTNCPFGP2QNGP WPF 6JCKNCPF 8GTUEJKGFGPG /CVGTKCNKGP GKPKIG XGTIQNFGV VGKNYGKUG GOCKNNKGTV CP $·PFGTP VGKNU OKV   $CPFURCPIGP QFGT 2GPVCIQPCN$CPFURCPIGP KP IWVGT 'TJCNVWPI GKPG KO QTKIKPCNGP 8GTNGKJWPIUGVWK   &C\WVGKNKIG\KXKNG$CPFURCPIGCP0CFGN 5VÒEM++





-QPXQNWVXQP#WU\GKEJPWPIGPCWUFGTICP\GP9GNV7CCWU$GNIKGP$QNKXKGP$WNICTKGP&·PG OCTM&GWVUEJNCPF(KPPNCPF)TQ­DTKVCPPKGP+VCNKGP/GZKMQ¤UVGTTGKEJFGT5QYLGVWPKQPFGT6UEJG EJQUNQYCMGK WPF FGO 8CVKMCP -QRKGP WPF 1TKIKPCNG XGTUEJKGFGPG /GVCNNG CWEJ 5KNDGT  VGKNU   XGTIQNFGV VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV VGKNU CP $·PFGTP VGKNU CP 6TCIGURCPIGPVGKNUCP0CFGNPKP WPVGTUEJKGFNKEJGP'TJCNVWPIGP ++++p+++





-QPXQNWVXQP#WU\GKEJPWPIGPWPF#D\GKEJGPCWU&GWVUEJNCPF$GNIKGPWPF2QNGPXGTUEJKGFGPG /GVCNNG CWEJ5KNDGT VGKNUGOCKNNKGTVKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNYGKUGCP$·PFGTP  5VÒEM++++p+++



-QPXQNWVXQP#WU\GKEJPWPIGPCWUªDGTUGG7CCWU,CRCP2CMKUVCP6WPGUKGP70175# 8KGVPCO WPF <CKTG KP XGTUEJKGFGP /GVCNNGP VGKNYGKUG XGTIQNFGV VNY XGTUKNDGTV GKPKIG GOCKNNKGTV KP   WPVGTUEJKGFNKEJGP'TJCNVWPIGPXQTYKGIGPFCP$·PFGTP 5VÒEM++



-QPXQNWVXQP#WU\GKEJPWPIGPCWUªDGTUGG7CCWUVJKQRKGP#HIJCPKUVCPFGT8QNMUTGRWDNKM %JKPC )JCPC +PFKGP 0KIGTKC 5TK .CPMC 6CKYCP FGP 75# WPF 8GPG\WGNC KP XGTUEJKGFGPGP   /GVCNNGP CWEJ KP 5KNDGT  VGKNU XGTIQNFGV VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV VGKNU CP $·PFGTP KP   WPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p+++



-QPXQNWV XQP  1TFGPU WPF 'JTGP\GKEJGP/KPKCVWTGP 7PVGT CPFGTGO CWU &·PGOCTM  

&CPGDTQIQTFGP (KPPNCPF)TQ­DTKVCPPKGPWPF5EJYGFGP 0QTFUVGTPQTFGP 7PVGTUEJKGFNKEJG/GVCNNG CWEJ5KNDGTWPF)QNFVGKNUGOCKNNKGTVKPWPVGTUEJKGFNKEJGP'TJCNVWPIGPVGKNUCP$·PFEJGP  5VÒEM+p++++++p+++

















-QPXQNWVXQPUKGDGPCNVGP5EJWNVGTDCPF#DUEJPKVVGP7CCWU$GKFG5K\KNKGP$GNIKGP&·PGOCTMWPF FGT6QUMCPCLGYGKNU\YKUEJGPECWPFEONCPIKPXGTUEJKGFGPGP'TJCNVWPIGP 5VÒEM++++p+++





-QPXQNWVXQPEC/KPKCVWTGP$CPFCDUEJPKVVGP#D\GKEJGP+PVGTKOUUEJPCNNGP#PUVGEMPCFGNP GVEGVE+PWPVGTUEJKGFNKEJGP'TJCNVWPIGP 5VÒEM++++p++++++





-QPXQNWV CWU EC  #D\GKEJGP #WU\GKEJPWPIUOKPKCVWTGP +PVGTKOUEJPCNNGP -PQRHNQEJTQUGVVG   $CPFURCPIGP WPF +PVGTKOUEJPCNNGPCWHNCIGP 7 C CWU &GWVUEJNCPF +VCNKGP ,CRCP )TQ­DTKVCPPKGP   FGO .KDCPQP 5RCPKGP 5TK .CPMC 7PICTP WPF FGP 75# KP XGTUEJKGFGPGP /CVGTKCNKGP VGKNU   XGTIQNFGV VGKNU XGTUKNDGTV VGKNU GOCKNNKGTV VGKNU CP 0CFGN KP WPVGTUEJKGFNKEJGP 'TJCNVWPIGP &C\W   $·PFGT 5VÒEM++





-QPXQNWVXQP1TFGPUWPF#WU\GKEJPWPIUGVWKUWPFMCTVQPU/GKUVCWU5EJYGFGPKPWPVGTUEJKGF NKEJGP'TJCNVWPIGP 5VÒEM++++p+++





-QPXQNWVXQPFTGKNGGTGP'VWKU&CTWPVGT1HHK\KGTUQFGT4KVVGTFGMQTCVKQPFGUHTCP\ÌUKUEJGP1TFGPUFGT 'JTGPNGIKQP XQP #TVJWU $GTVTCPF  WPF ÌUVGTTGKEJKUEJGU /KNKV·T8GTFKGPUVMTGW\ OKV -TKGIUFGMQTCVKQP   WPF5EJYGTVGTP XQP(TCP\$TCWPKP9KGP &C\WTQVG5EJWNVGTDCPFUEJNGKHGWPFGKPG-TKGIUFGPMOÒP\G FGT&GWVUEJGP'JTGPNGIKQP 5VÒEM++++p+++



-QPXQNWVXQPFTGK1TFGPUGVWKU 0KGFGTNCPFG1HHK\KGTUMTGW\FGU*CWUQTFGPUXQP1TCPKGP ,WIQ UNCYKGP-NCUUGFGU1TFGPUFGTLWIQUNCYKUEJGP(CJPG 5C/CTKPQ-QOOCPFGWTMTGW\FGU1TFGPU FGTJN#ICVJC 5VÒEM++++p





316


 #&'0   $#491  $#667 $+0+ $4# $4# $74-'  %1..+)  &'%  '(9#  '4ª  )'$  )-.   *'4(  *';+6    *ª52  ,#%1$ -#8  -&1'   -.+47 -ª0  .¤9 /#.6  /#4-  /;$ 0'&  0+'/   0+//  014&'08



LITERATUR  6COOCPP )WUVCX #PFTGCU WPF *QOOGN 'PIGNDGTV *I  &KG 1TFGP WPF 'JTGP\GKEJGP -QPTCF

 





    









  











 



       







 

 

 







 





  



 

#FGPCWGTU  6JG 1TFGTU CPF &GEQTCVKQPU CYCTFGF VQ -QPTCF #FGPCWGT $CF *QPPGH  4JÌPFQTH  $CTCE$QTPC4GHGTGPEG%CVCNQIWG1TFGTU/GFCNUCPF&GEQTCVKQPUQHVJG9QTNFKPUVKVWVGUWPVKN 2CTV++TQP$QQM#&<CITGD $CVVWUJKI#/QPIQNKCP1TFGTU/GFCNU$CFIGU7NCCPDCCVCT $KPK&KOKVTK.G/GFCINKG7HHKEKCNK/KNKVCTKFGN4GIPQF +VCNKC1JPG1TVUCPICDG $TCODKNNC#NGUUCPFTQ.G/GFCINKG+VCNKCPG/CKNCPF $TCODKNNC#NGUUCPFTQ.G/GFCINKG+VCNKCPG/CKNCPF 5VCKT 5CKPV[ )W[ WPF *G[FGN/CPMQQ 4CHCN *I  $WTMG U 9QTNF 1TFGTU QH -PKIJVJQQF  /GTKV9KNOKPIVQP &GNCYCTG75#  %QNNKIPQP,GCP2KGTTG1TFTGFG%JGXCNGTKG&¾EQTCVKQPUGVO¾FCKNNGUFG(TCPEG FGUQTKIKPGU¯NC HKPFW5GEQPF'ORKTG .C/QVJG#TEJCTF 4KDCWNV .QKE NG %COKPCFG $GTPCTF WPF .CEQODG 'TKE +FGPVKHKECVKQP GV %QVG  &¾EQTCVKQPU $KCTTKV\#WHNCIG 'HNGT )GTV &KG 1TFGP WPF 'JTGP\GKEJGP FGU (ÒTUVGPVWOU 9CNFGEM WPF 2[TOQPV 5EJYCNOUVCFV  'TÒTGVGP/GVKP1UOCPNK/CFCN[CNCTKXG0KUCPNCTK$GNIGTNG6CTKJK1VVQOCP/GFCNUCPF1TFGTU &QEWOGPVGF*KUVQT[+UVCPDWN )GDCWGT9QNHTCO&KG1TFGPWPF'JTGP\GKEJGPXQP5CEJUGPGKPUEJNKG­NKEJFGTU·EJUKUEJGP8GT FKGPUV2T·OKGP2TGKUWPF#WU\GKEJPWPIUOGFCKNNGP&TGUFGP#WHNCIG -NGPCW#TPJCTF)TCH1TFGPKP&GWVUEJNCPFWPF¤UVGTTGKEJ 0QTOCNCWUICDG $CPF&GWVUEJG 5VCCVGPDKU6GKN #PJCNVKUEJG5VCCVGP$CFGP$C[GTP$TCWPUEJYGKI*CPPQXGT )TQ­JGT\QIVWO(TCPMHWTV 1HHGPDCEJ *GTHWTVJ &KGVTKEJ 5QYLGVKUEJG #WU\GKEJPWPIGP   #WU\GKEJPWPIGP FGT /QPIQNKUEJGP 8QNMUTGRWDNKM'KP-CVCNQI8KGTVG#WUICDG$GTNKP#WHNCIG *G[FGP *GTOCPP XQP 'JTGP\GKEJGP -TKGIU&GPM\GKEJGP 8GTFKGPUV &KGPUVCNVGT<GKEJGP 4GV VWPIU/GFCKNNGP WPF#D\GKEJGPKO-ÌPKITGKEJ+VCNKGPWPFKPUGKPGPGTNQUEJGPGP5VCCVGP5CTFKPKGP .QODCTFGK 8GPGFKI 2CTOC /QFGPC .WEEC 6QUECPC $GKFG 5K\KNKGP -KTEJGPUVCCV UQYKG 5CP /CTKPQ9KGUDCFGP *ÒUMGP #PFT¾ -WTHÒTUVGPVWO $TCPFGPDWTI /CTMITCHUEJCHV $TCPFGPDWTI#PUDCEJ /CTMITCH UEJCHV$TCPFGPDWTI$C[TGWVJ1TFGPFGU-ÌPKITGKEJU2TGW­GP$TGOGP ,CEQD,GHHTG[4%QWTV,GYGNGTUQHVJG9QTNF%JGTT[*KNN -CXCNKCWUMCU8KNKWU1TFGTU&GEQTCVKQPUCPF/GFCNUQH'UVQPKC.CVXKCCPF.KVJWCPKC -QRGPJCIGP 0KOOGTIWV,ÌTI(GFGT-NCWUWPFXQPFGT*G[FG4WFQNH&GWVUEJG1TFGPWPF'JTGP\GKEJGP -CVCNQI  &TKVVGU 4GKEJ &&4 WPF $WPFGUTGRWDNKM   DKU JGWVG   #WHNCIG 4GIGPUVCWH #MVWCNKUKGTVG#WHNCIG -NKGVOCPP&T-WTV)GTJCTF2JCNGTKUVKM4WO·PKGP$GTNKP #WVGPITWDGT /KEJCGN  #WMVKQP  ,WPK  1TFGP WPF 'JTGP\GKEJGP  'KPG PQTF COGTKMCPKUEJG2TKXCVUCOONWPIWC1UPCDTÒEM .ÌYGPJKGNO(TGFTKM5XGPUMC1TFPCTQEJ/GFCNLGT5VQEMJQNO#WHNCIG -KTEJPGT*GKP\WPF6TWU\E\[PUMK)GQTIXQP1TFGPUKPUKIPKGPWPF#WU\GKEJPWPIGPFGU5QWXGT· PGP/CNVGUGT4KVVGTQTFGPU-ÌNP#WHNCIG /CTMQ #NGZCPFGT # #WU\GKEJPWPIGP FGT ¤UVGTTGKEJKUEJ7PICTKUEJGP /QPCTEJKG WPF FGT <YKUEJGPMTKGIU\GKV2TGKUMCVCNQI.KP\ /WUUGNN,QJP9 *I /GFCN;GCTDQQM*QPKVQP#WHNCIG /GKLGT*)/WNFGT%2WPF9CIGPCCT$91TFGTUCPF&GEQTCVKQPUQH6JG0GVJGTNCPFU 1JPG1TV#WHNCIG 0KGOCPP&GVNGX$GYGTVWPIU-CVCNQI&GWVUEJNCPF2TKEG)WKFG)GTOCP[-CòCëQµ 1TFGP 'JTGP\GKEJGP 8GTNGKJWPIU7TMWPFGP /KPKCVWTGP WPF 'VWKU  1TFGTU &GEQTCVKQPU #YCTF &QEWOGPVU /KPKCVWTGU CPF %CUGU QH +UUWG  1ðäåíà, çíaêè Qòëè÷èÿ, íàãðàäíü³å äîêóìåíòü³, ìèíèàòþðü³ è ôóòëÿðü³*CODWTI#WHNCIG 0KOOGTIWV ,ÌTI &GWVUEJG 1TFGP WPF 'JTGP\GKEJGP DKU   )GUCOVCWUICDG KP HÒPH $·PFGP /ÒPEJGPDKU 0QTFGPXCNN2GT-WPINKIC5GTCHKOGTQTFGP5VQEMJQNO


1#0      1'-    2#$1    2')7  24-    241)#    41((    41/1  4147    415'    47)    5#..    5%*/4  5%*/+47    5100    56'.#      564$'    5;.*ª5    6#//      6#/472  6'6  6*14    61<    81.2'81.2'   9'$    9'4.    9'5    94'&  <'+   

9GTNKEJ4QDGTV1TFGTUCPF&GEQTCVKQPUQHCNN0CVKQPUņ#PEKGPVCPF/QFGTPņ%KXKNCPF/KNK VCT[ 9CUJKPIVQP#WHNCIG\YGKVGT&TWEM 0KOOGTIWV,ÌTIDGCTDGKVGVXQP&T)GTF5EJCTHGPDGTI&GWVUEJG1TFGPWPF'JTGP\GKEJGP  #WUICDG 4GIGPUVCWHMQORNGVVÒDGTCTDGKVGVGWPFCMVWCNKUKGTVG#WHNCIG 2CVTKMGGX5$WPF$QLPQXKEJ#&0CITWFPKG5PCMK4QUUKK$CFIGUQH4WUUKC/QUMCWWPF 5V2GVGTUDWTI $CPF WPF $CPF  2¾TG\)WGTTC,QU¾/CPWGN1TFGPGU[%QPFGEQTCEKQPGUFG'URCPC5CTCIQUUC -NGPCW #TPJCTF )TCH WPF 5CWGTYCNF 2GVGT &KG 1TFGP WPF 'JTGP\GKEJGP FGU -ÌPKITGKEJU 2TGW­GP(CTDMCVCNQIOKV2TGKUGP1HHGPDCEJCO/CKP 2TQEJ±\MC4QOCP(TGKJGTTXQP¤UVGTTGKEJKUEJGU1TFGPUJCPFDWEJņ)TQ­G#WUICDG$CPFDKU /ÒPEJGP 4QHHKIPCE0KEQNCUFG1TFTGUGV/¾FCKNNGUFGU2C[UF #HTKSWG¯N 'RQSWG2QUV%QNQPKCNGFG¯ PQU,QWTU2CTKU 4QOCPQHH2TKPEG&KOKVTK6JG1TFGTU/GFCNUCPF*KUVQT[QH/QPVGPGITQ4WPIUVGF-[UV 4QOCPQHH 2TKPEG &KOKVTK 6JG 1TFGTU /GFCNU CPF *KUVQT[ QH +ORGTKCN 4WUUKC 4WPIUVGF -[UV  4QOCPQHH 2TKPEG &KOKVTK 6JG 1TFGTU /GFCNU CPF *KUVQT[ QH VJG -KPIFQOU QH 5GTDKC CPF ;WIQUNCXKC4WPIUVGF-[UV 5QXTCPQ /KNKVCTG 1TFKPG )GTQUNQNKOKVCPQ FK /CNVC 4WQNQ )GPGTCNG 7HHKEKCNG FGN )TCP /CIKUVGTQ /CKNCPF 5CNNCEJ#NGZCPFGTXQP&KG1TFGPWPF'JTGP\GKEJGPWPUGTGT4GRWDNKM&TKVVG#WHNCIG-QPUVCP\ FTKVVGGTJGDNKEJGTYGKVGTVGWPFXQNNMQOOGPÒDGTCTDGKVGVG#WHNCIG 5EJOKFV)WGPVGT'TKM1TFGPWPF'JTGP\GKEJGP¤UVGTTGKEJU9KGP 5EJOKVV 4CKPGT &KG #WU\GKEJPWPIGP FGT 8QNMUTGRWDNKM WPF FGT 5Q\KCNKUVKUEJGP 4GRWDNKM 4WO· PKGPDKU1HHGPDCEJCO/CKP 5QPPGPDGTI*GKP/QPIQNKUEJG#WU\GKEJPWPIGP/QPIQNKCP#YCTFU/ÒPEJGP  5VGNC 9QLEKGEJ 2QNPKUEJG 'JTGP\GKEJGP WPF 'TKPPGTWPIUCD\GKEJGP     NKUJ *QPQT CPF %QOOGOQTCVKXG $CFIGU     2QNUMKG 1F\PCMK *QPQTQYG K 2COKCVMQYG9CTUEJCW 5VTCPFDGTI,QJPWPF$GPFGT4QIGT,COGU6JG%CNNQH&WV[/KNKVCT[#YCTFUCPF&GEQTCVKQPU QHVJG7PKVGF5VCVGUQH#OGTKEC5CP,QU¾ 5[NXGUVGT LT ,QJP WPF *ÒUMGP #PFT¾ &KG VTCFKVKQPGNNGP #WU\GKEJPWPIGP XQP #PPCO  6JG 6TCFKVKQPCN#YCTFUQH#PPCO.GU&¾EQTCVKQPU6TCFKVKQPGNNGUF #PPCO$TGOGP #WVGPITWDGT/KEJCGNWPF6COOCPP)#PFTGCU-CVCNQI\WT#WMVKQPWPF0QXGODGT 1TFGPCWUCNNGT9GNVņ5COONWPI6COOCPP9QTNF1TFGTUņ%QNNGEVKQP6COOCPP$CUGN  6COOCPP)WUVCX#+ORGTKCN4WUUKCP/CMGTU /CTMUQP1TFGTUCPF&GEQTCVKQPU.QPFQP 6GVTK,WJC'-WPPKCOGTMMKMKTLC*GNUKPMK#WHNCIG 6JQTPKV 2GT 6JG 4Q[CN %QOOGOQTCVKXG CPF %QTQPCVKQP /GFCNU QH 5ECPFKPCXKC -QRGPJCIGP  6Q\GT%JCTNGU96JG+PUKIPKCCPF/GFCNUQHVJG)TCPF2TKQT[QHVJG/QUV8GPGTCDNG1TFGTQH VJG*QURKVCNQH5V,QJPQH,GTWUCNGO.QPFQP 8QNRG/CTKQ5GIPKF 1PQTG%QORGPFKQFGINK1TFKPK%CXCNNGTGUEJKGFGNNG1PQTKHKEGP\GF +VCNKC F 'WTQRCGFGN4GUVQFGN/QPFQ4QO 9GDGT&KGVGT#TPQNF2CWNWPF-GKN2GVGT&KG1TFGPFGU-ÌPKITGKEJU5CEJUGP1HHGPDCEJCO /CKP 9GTNKEJ4QDGTV4WUUKCP1TFGTU&GEQTCVKQPUCPF/GFCNUKPENWFKPIVJQUGQH+ORGTKCN4WUUKCVJG RTQXKUKQPCN)QXGTPOCPGVVJG%KXKN9CTCPFVJG5QXKGV7PKQP9CUJKPIVQP 9GUQNQYUMK&T<F\KUNCY22QNKUJ1TFGTU/GFCNU$CFIGUCPF+PUKIPKC/KNKVCT[CPF%KXKNKCP &GEQTCVKQPU/KCOK 9TGFG'((KPNCPFU7VO·TMGNUGVGEMGP*GNUKPMK <GKIG %CTUVGP 'WTQR·KUEJG 1TFGP QJPG &GWVUEJNCPF  XQP     2TGKUMCVCNQI  *CODWTI#WUICDG


16 Figuren aus der Affenkapelle. Meißen, die Modelle von J.J. Kaendler und P. Reinicke, um 1753, Ausformungen ab 1753 - ca. 1780 Verkauft für: e 150.000,-

Einladung zu Einlieferungen Herbstauktionen 2009 25./26. Sept. 1. Okt. 20. Nov. 21. Nov.

Bücher, Graphik Gemälde 15.–19. Jh. Kunstgewerbe Alte Kunst

4. Dez. 4. Dez. 5. Dez. 11./12. Dez.

Zeitgenössische Kunst Photographie Moderne Kunst Asiatische Kunst

LEMPERTZ gegründet 1845

Neumarkt 3 50667 Köln Poststraße 22 10178 Berlin St.-Anna-Platz 3 80538 München www.Lempertz.com

Tel. 02 21 ⁄ 92 57 29 - 0 Fax - 6 Tel. 030 ⁄ 27 87 60 8 - 0 Fax - 6 Tel. 089 ⁄ 98 10 77 67 Fax 089 ⁄ 21 01 96 95 info@Lempertz.com


010 2 , 1 29. – 31. Janua 3 – r 2010 | January 29

Ehrengast | Guest of Honour South African Mint Auktionshaus Fritz Rudolf Künker 5. Berlin Auktion | 28. Januar 2010


HINWEISE FÜR UNSERE BIETENDEN AUKTIONSKUNDEN 1. Die Auktionsbedingungen finden Sie am Ende dieses Katalogs. 2. Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. 3. Das beiliegende Formular macht es Ihnen leicht, ein schriftliches Gebot abzugeben. Falls Sie Ihre Gebote faxen möchten: unser Telefax 05 41-96 20 222 steht Ihnen Tag und Nacht zur Verfügung. 4. Die von Ihnen ersteigerten Objekte werden Ihnen innerhalb von acht Tagen nach Beendigung der Auktion zugeschickt. Die Aufträge werden in der Reihenfolge des Eingangs bearbeitet, d. h. die zuerst eingegangenen Aufträge werden auch zuerst bearbeitet. Auch alle Bieter, die keinen Zuschlag erhalten haben, werden von uns nach der Auktion benachrichtigt. 5. Wenn Sie telefonisch bieten möchten, teilen Sie uns diesen Wunsch bitte mindestens 48 Stunden vor der Auktion mit. Unseren Kundenservice erreichen Sie unter 05 41-96 20 20 oder gebührenfrei unter 08 00-58 36 537. 6. Wenn Sie als neuer Kunde noch nicht bei uns gekauft haben, ist es empfehlenswert, wenn Sie uns Referenzen angeben. Nennen Sie uns eine Münzhandlung, mit der Sie bereits in Geschäftsverbindung stehen. Oder rufen Sie unseren Kundenservice an. 7. Die Echtheit aller verkauften Objekte wird auch über die gesetzliche Frist hinaus gewährleistet. 8. Alle Kunden, die als Bieter an einer unserer Auktionen teilnehmen, erhalten innerhalb von zwei Wochen nach der Auktion unsere Ergebnisliste gratis. 9. Sie haben Fragen zu einer bestimmten Münze? Sie möchten persönlich an unserer Auktion teilnehmen? Sie haben andere Fragen? Unser Kundenservice freut sich auf Ihren Anruf, entweder direkt unter 05 41-96 20 20 oder gebührenfrei unter 08 00-58 36 537.

IMPORTANT INFORMATION FOR PLACING BIDS 1. The terms and conditions of the auction can be found at the end of this catalogue. 2. Please send us your instructions as early as possible. The likelihood of errors occurring increases if we do not receive your instructions until shortly before the auction. 3. The enclosed form makes it simple for you to submit a written bid. Our fax machine +49 (0)541 – 96 20 222 is on standby day and night in case you wish to fax your bids. 4. The objects which you purchase will be delivered to you within eight days of the close of auction. Instructions are processed in the same order as they were received – in other words, the first instructions to be received are the first to be processed. All unsuccessful bidders will be also informed after the auction. 5. If you would like to bid by telephone, please ring our customer service beforehand on +49 (0)541 - 96 20 20. 6. If you are a new customer who has not yet bought anything through us, we recommend that you give us references. Name a coin dealer with whom you have already done business. Or call our customer service. 7. The genuineness of all sold objects is also warranted beyond the statutory length of time. 8. All customers who participate as bidders in our auction receive our list of results free of charge within two weeks of the close of auction. 9. Do you have questions about a particular coin? Would you like to participate personally in our auction? Do you have any other questions? Our customer service team will be pleased to help you – call on +49 (0)541 - 96 20 20.

RENSEIGNEMENTS À L'ATTENTION DE NOS CLIENTS DES VENTES AUX ENCHÈRES 1. Vous trouverez les conditions générales de vente aux enchères à la fin de ce catalogue. 2. Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. 3. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Si vous souhaitez faxer votre offre, vous pourrez le faire 24 heures sur 24 au +49 (0)541 – 96 20 222. 4. Les objets dont vous serez adjudicataire vous seront envoyés dans les huit jours suivant la fin de la vente aux enchères. Les commandes seront prises en compte dans l’ordre de leur arrivée, c’est-à-dire que les commandes nous parvenant les premières seront d’abord traitées. Après la vente aux enchères, nous préviendrons tous les enchérisseurs n’ayant pas obtenu l’adjudication. 5. Si vous souhaitez faire des enchères par téléphone, veuillez appeler aupravant notre service clientèle au +49 (0)541 – 96 20 20. 6. Si vous êtes un nouveau client et n’avez encore fait aucune acquisition chez nous, il serait conseillé de nous fournir quelques références. Indiquez nous si vous traitez déjà avec un professionnel du commerce des monnaies. Ou contactez notre service clientèle au +49 (0)541 – 96 20 20. 7. L’authenticité des pièces vendues sera garantie même au-delà des délais légaux. 8. Tous les clients participant à l’une de nos ventes aux enchères en tant qu’enchérisseurs recevront gratuitement une liste de résultats dans les deux semaines suivant la vente aux enchères. 9. Vous avez des questions concernant une pièce particulière? Vous désirez prendre part personnellement à notre vente aux enchères? Vous avez d’autres questions? Notre service clientèle se fera un plaisir de vous répondre au +49 (0)541 – 96 20 20.

INFORMAZIONI PER GLI OFFERENTI DELLE NOSTRE ASTE 1. Le condizioni d’asta si trovano alla fine di questo catalogo. 2. Siete pregati di inviarci i vostri ordini il più presto possibile. Se il vostro ordine ci perviene poco tempo prima dell’apertura dell’asta, si possono verificare errori nell’elaborazione dello stesso. 3. Per le vostre offerte scritte potete utilizzare il modulo allegato al catalogo. Nel caso voleste trasmettere le vostre offerte per fax, siete pregati di inviarle al seguente numero: +49 (0)541-96 20 222. 4. Gli oggetti che avete acquistato all’asta vi saranno spediti entro otto giorni dal termine della stessa. Gli ordini vengono evasi in base alla data di ricevimento, quindi hanno precedenza quelli pervenuti prima. Anche gli offerenti che non hanno avuta alcuna aggiudicazione riceveranno una nostra comunicazione al termine dell’asta. 5. Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare prima la consulenza ai clienti al numero diretto +49 (0)541-96 20 20. 6. Se siete clienti nuovi e non avete mai acquistato da noi, vi proponiamo di inviarci delle referenze. Dateci il nome di un negozio di monete presso il quale avete già fatto degli acquisti, oppure chiamate la nostra consulenza ai clienti al numero +49 (0)541 96 20 20. 7. Il certificato d’autenticità di tutti gli oggetti venduti viene rilasciato anche oltre i termini privisti per legge. 8. Tutti i clienti che hanno partecipato ad una nostra asta riceveranno gratuitamente l´elenco delle aggiudicazioni entro quindici giorni dal termine della stessa. 9. Avete delle domande su una moneta in particolare ? Desiderate partecipare personalmente ad una nostra asta? Avete altre domande? Rivolgetevi al nostro Servizio Clienti al numero +49 (0)541 – 96 20 20.


MEINE TEILNAHME ALS SCHRIFTLICHER BIETER 1. 2. 3. 4. 5. 6. 7.

Studieren Sie den Katalog sorgfältig und notieren Sie alle Lose, die interessant für Sie sind. Legen Sie für jedes Los Ihr persönliches Limit fest, das Sie maximal zu zahlen bereit sind. Füllen Sie das beiliegende Formular aus (siehe rechte Seite) und tragen Sie für jedes Los Ihr Höchstgebot ein. Schicken Sie uns Ihren Auftrag frühzeitig. Bei gleich hohen Geboten erhält das zuerst eingegangene Gebot den Zuschlag. Sie haben interessante Lose für insgesamt € 10.000,-- gefunden, möchten jedoch nur € 2.000,-- ausgeben. Kein Problem: Sie geben als Gesamtlimit (ohne Aufgeld) € 2.000,-- an. Wenn Sie Fragen haben: Die MitarbeiterInnen unserer Kundenbetreuung sind für Sie da. Tel. 08 00-58 36 537 (gebührenfrei). Wenn Sie telefonisch an unseren Auktionen teilnehmen möchten, ist das ab einer Schätzung von € 500,- pro Los möglich. Bitte teilen Sie uns diesen Wunsch mindestens einen Werktag vor Beginn der Versteigerung schriftlich mit.

MEINE PERSÖNLICHE TEILNAHME IN OSNABRÜCK 1.

2. 3.

Wir freuen uns sehr, wenn Sie persönlich nach Osnabrück kommen möchten. Das Flair einer Auktion und die Stimmung im Auktionssaal sind ein besonderes Erlebnis für Sie als Sammler. Osnabrück ist außerdem immer eine Reise wert und die persönliche Betreuung durch unsere Mitarbeiter wissen immer mehr Kunden zu schätzen. Bitte rufen Sie uns rechtzeitig an, damit wir Ihnen Tipps für die Anreise geben und Ihnen ein Hotelzimmer reservieren können. Sie erreichen uns gebührenfrei unter: 08 00-58 36 537. Als erfolgreicher Bieter können Sie Ihre neu erworbenen Stücke gleich persönlich mit nach Hause nehmen. Als guter Kunde unseres Hauses haben Sie 20 Tage Zahlungsziel nach der Auktion.

WIE ENTSTEHT DER PREIS EINER AUKTION? 1. 2.

Der im Auktionskatalog angegebene Preis ist ein Schätzpreis, der durch unsere Experten festgelegt wurde. Das Mindestgebot liegt bei 80% dieses Wertes. Die Zuschlagpreise sind oft deutlich höher als die Schätzpreise. Als Auktionshaus müssen wir bereits vor der Auktion alle schriftlichen Gebote koordinieren. Folgende Beispiele sind im Bietverfahren möglich:

Beispiel 1 (Schätzpreis: € 1.000,--) Es liegt kein schriftlicher Auftrag vor: der Auktionator ruft das Los in der Auktion mit € 800,-- aus. Wenn im Saal nur ein Bieter darauf ein Gebot abgibt, erhält der Saalbieter den Zuschlag für € 800,--.

Beispiel 3 (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 850,-- vor: das Los wird in der Auktion mit € 800,-ausgerufen. Falls kein Bieter im Saal ein Gegenangebot abgibt, erhält der schriftliche Bieter den Zuschlag bei € 800,--.

Beispiel 2 (Schätzpreis: € 1.000,--) Es liegen dem Auktionator drei schriftliche Gebote vor:

Beispiel 4: (Schätzpreis: € 1.000,--) Es liegt dem Auktionator nur ein schriftliches Gebot von € 1.200,-- vor: der Auktionator ruft das Los mit € 800,-- aus. Gibt es im Saal keinen Gegenbieter, erhält der schriftliche Bieter den Zuschlag bei € 800,--. Falls es im Saal Gegenbieter gibt, bietet der Auktionator für seinen schriftlichen Bieter bis maximal € 1.200,-- und erteilt einem Gegenbieter im Saal erst bei mehr als € 1.200,-- den Zuschlag.

Bieter 1: Limit € 2.900,-Bieter 2: Limit € 1.800,-Bieter 3: Limit: € 800,-Nach der Versteigerungsordnung muss der Auktionator im Interesse von Bieter 1 und 2 angemessen überbieten (um ca. 5 bis 10%). Der Ausrufpreis in der Auktion beträgt daher im Interesse von Bieter 1, € 1.900,-- (obwohl die Schätzung € 1.000,-- beträgt). Falls keine höheren Gebote aus dem Saal erfolgen, erhält Bieter 1 den Zuschlag für € 1.900,--. Das Höchstangebot von € 2.900,-- musste nicht ausgeschöpft werden.

Beispiel 5 (Schätzpreis: € 1.000,--) Es liegen drei Gebote von je € 975,-- vor: um Missverständnisse zu vermeiden, überzieht der Auktionator das zuerst eingegangene Gebot geringfügig und erteilt den Zuschlag bei € 1.000,--.


MUSTERAUKTIONSAUFTRAG FÜR SCHRIFTLICHE BIETER 1. Name, Adresse, Telefon: Ihre vollständige Anschrift ist wichtig, damit wir Ihren Auktionsauftrag annehmen und bearbeiten können. Ihre Telefonnummer brauchen wir, um Sie bei Rückfragen zu Ihren Geboten schnell erreichen zu können.

5. Ihre Kundennummer Die Angabe Ihrer Kundennummer unterstützt uns bei der Bearbeitung Ihres Auktionsauftrages. Viele Vorarbeiten für die Auktion werden dadurch einfacher und es werden Fehler vermieden.

2. Losnummern und Gebote Listen Sie alle Lose, für die Sie sich interessieren, mit ihrer Katalognummer auf und legen Sie für sich selbst fest, wie viel Sie bereit sind für jedes einzelne Los zu bieten.

6. Ihr Limit pro Einzellos An dieser Stelle geben Sie an, was Sie für jedes einzelne Stück maximal bereit sind auszugeben.

3. „Oder“-Gebote Wenn Sie sich für mehrere Münzen interessieren, aber nur ein Stück davon erwerben wollen, können Sie Ihre Gebote einfach mit einem „oder“ verbinden. Wichtig: bei den „oder“-Geboten können Sie nicht auf frühere Katalognummern zurückgreifen (z.B. 2890 oder 1558), da die Nr. 1558 dann bereits versteigert ist. 4. Unterschreiben Sie Ihren Auktionsauftrag . . .nachdem Sie Ihre Angaben noch einmal überprüft haben. Ihre Unterschrift ist wichtig, denn damit bestätigen Sie uns, dass sie tatsächlich teilnehmen wollen.

7. Überschreitung Ihrer Limits pro Einzellos In der Praxis zeigt sich, daß oft mehrere Bieter mit ihren Geboten dicht beieinander liegen. Deshalb empfiehlt es sich, an dieser Stelle einer geringfügigen Überschreitung Ihrer Gebote zuzustimmen. Dadurch erhöhen sich Ihre Chancen, im Wettbewerb mit anderen den Zuschlag zu erhalten. 8. Begrenzung Ihres Gesamtlimits Hier können sie die Gesamtsumme Ihrer Gebote begrenzen und festlegen, was Sie insgesamt maximal bereit sind auszugeben. Aufgeld und Mehrwertsteuer kommen später noch hinzu.

ANTWORTEN AUF FRAGEN, DIE UNS OFT GESTELLT WERDEN 1.

Zuschlagpreis/Aufgeld: Wir berechnen als Auktionshaus ein Aufgeld von 15% auf den Zuschlagpreis, dazu kommt die gesetzliche Mehrwertsteuer. Beispiel 2: Zuschlagpreis: € 1.000,-€ 100,-Aufgeld 15% € 150,-€ 15,00 Versandkosten, z. B.* € 5,90 € 5,90 MwSt. 7% € 80,91 € 8,46 ______ ________ Rg.-Betrag € 1.236,81 Rg.-Betrag € 129,36 Mehrwertsteuer: üblicherweise in Deutschland 7%, seit dem 01.01.2000 sind viele Goldmünzen, die nach 1800 geprägt wurden, steuerfrei. Bei Fragen zu der MWSt-Berechnung rufen Sie uns an, gebührenfrei unter: 08 00-58 36 537. Rücklosverkauf: Alle Lose, die in der Auktion nicht verkauft wurden, können Sie innerhalb von vier Wochen nach der Versteigerung zu 80% des Schätzpreises (zzgl. Aufgeld und Mehrwertsteuer) erwerben. Achtung: Viele Rücklose sind schnell vergriffen. Unser Spezialservice: Alle Bieter erhalten gratis die Ergebnisliste innerhalb von zwei Wochen nach der Auktion. Im Internet können Sie die Ergebnisliste der Auktion sofort nach der Auktion unter www.kuenker.de einsehen. Beispiel 1:

2. 3.

4.

Zuschlagpreis Aufgeld 15%: Versandkosten, z. B.* MwSt. 7%

* Die Kosten für Versand und Versicherung werden nach Aufwand berechnet.


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in € - Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Umsatzsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die jeweils gültige Umsatzsteuer erhoben, soweit dies gesetzlich vorgeschrieben ist. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in € - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a UStG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b UStG in Verbindung mit § 6 a UStG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf den Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen.

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Werktag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker GmbH & Co. KG ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden.

Die Mindeststeigerungsstufen für das Bietungsverfahren betragen:

Mindestangebote

Mindeststeigerungsstufe

Wenn Sie in unserer Auktion erworbene Münzen an einen Grading Service in den USA verschicken möchten, übernehmen wir keine Garantie, daß die Münzen dort angenommen oder entsprechend unserer Bewertung eingestuft werden.

bis zu

€ 100,--

€ 5,--

bis zu

€ 200,--

€ 10,--

bis zu

€ 500,--

€ 20,--

bis zu

€ 1.000,--

€ 50,--

bis zu

€ 2.000,--

€ 100,--

bis zu

€ 5.000,--

€ 200,--

bis zu

€ 10.000,--

€ 500,--

Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 20.000,--

€ 1.000,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 50.000,--

€ 2.000,--

DIE VERSTEIGERER:

ab

€ 50.000,--

€ 5.000,--

Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden. Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the VAT (value added tax=Mehrwertsteuer), which is payabel additionally. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awarded item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

same price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sense of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively.

The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

up to

€ 100,--

€ 5,--

up to

€ 200,--

€ 10,--

up to

€ 500,--

€ 20,--

up to

€ 1.000,--

€ 50,--

up to

€ 2.000,--

€ 100,--

up to

€ 5.000,--

€ 200,--

up to

€ 10.000,--

€ 500,--

up to

€ 20.000,--

€ 1.000,--

up to

€ 50.000,--

€ 2.000,--

above

€ 50.000,--

€ 5.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours before auction. If necessary, the auctioneer is allowed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the

If a coin that is sold by us is sent to a grading service ("slabbing"), we do not guarantee that the coin will be slabbed (nor that it will be slapped at any particular grade or with any particular comments); however, we always warranty that each coin or numismatic item we sell will be genuine. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted. Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only discharge such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s). Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde. The prices realized will be published in the form of a list immediately after the auction.

THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


NUMISMATISCHE AUSDRÜCKE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA НУМИЗМАТИЧЕСКИЕ ТЕРМИНЫ DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

RUSSISCH

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlpr?gung

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike

frappe en tranche frotté plomb décentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione

Feld(er) Fundexemplar Gedenkmünze Gegl?ttet Gelocht Geprägt Gewellt Goldpatina Henkelspur Hübsch Jahrh. = Jahrhundert. Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar

field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina mount mark attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece

champ exemplaire de trouvaille monnaie commémorative retouch? trou? frappé ondulé patine dorée Trace de monture joli siècle petit traces de corrosion rayure cuivre alliage légèrement gauche minime imitation pièce magnifique

campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro Tracce di appicagnolo carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico

Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren

weakly struck edge nick edge faults lettered edge to right reverse traces of inscription

de frappe faible défaut sur la tranche erreur sur la tranche tranche inscrite droite revers traces de légende

conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda

Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung

flan flan defect weakly struck rare in this condition

flan flan défectueux de frappe faible rare en cet état

tondello errore di tondello conio stanco conservazione rara

Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert

rare year die(s) mistake in the die extraordinary condition

année rare coin erreur de frappe conservation extraordinaire

annata rara conio errore di conio conservazione estraordinaria

ОТТИСК НА ГУРТЕ ПОТЕРТАЯ СВИНЕЦ АССИМЕТРИЧНЫЙ ДВОЙНОЙ ЧЕКАН КАЙМА ОДНОСТОРОННЯЯ ЭМАЛИРОВАННАЯ СОХРАННОСТЬ СЛЕГКА ЭКЗЕМПЛЯР СЛЕДЫ ОБРАБОТКИ ОШИБКА В ПРОЦЕССЕ ЧЕКАНКИ ПОЛЕ ЭКЗЕМПЛЯР ПАМЯТНАЯ МОНЕТА ОТГЛАЖЕННАЯ ПРОКОЛАТАЯ ОТЧЕКАНЕННАЯ ВОЛНИСТАЯ ЗОЛОТАЯ ПАТИНА СЛЕДЫ ОТ УШКА КРАСИВАЯ СТОЛЕТИЕ МАЛЕНЬКИЙ СЛЕДЫ КОРРОЗИИ ЦАРАПИНА МЕДЬ СПЛАВ ЛЕГКИЙ СЛЕВА МИНИМАЛЬНЫЙ ИМИТАЦИЯ ПРЕВОСХОДНЫЙ ЭКЗЕМПЛЯР ИЗДЕРЖКН ПРИ ЧЕКАНКE ВМЯТИНА НА ГУРТЕ ОШИБКА НА ГУРТЕ ГУРТОВАЯ НАДПИСЬ СПРАВА РЕВЕРС СЛЕДЫ ПРЕДЫДУЩЕЙ НАДПИСИ ЗАГОТОВКА БРАК ЗАГОТОВКИ СЛАБО ОТЧЕКАНEНА РЕДКАЯ В ТАКОЙ СОХРАННОСТИ РЕДКИЙ ГОД ШТАМП ОШИБКА ШТАМПА СОХРАННОСТЬ ВЫШЕ СРЕДНЕГО

overstruck unpublished

surfrappé in?dit

ribattuto inedito

Unikum Vergoldet Von allergrößter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn ziseliert

unique specimen gilt extremely rare head tiny flan ornamental border tin chased

unique doré de toute rareté en face petit flan tranche ornée ?tain ciselé

pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

ПЕРЕЧЕКАН НЕОПУБЛИКОВАННАЯ МОНЕТА УНИКАЛЬНАЯ ПОЗОЛОЧЕННАЯ НАИРЕДЧАЙШАЯ АВЕРС НЕЗНАЧИТЕЛЬНЫЙ ЗАГОТОВКА ДЕКОРАТИВНЫЙ ГУРТ ЦИНК ГРАВИРОВАННЫЙ


Künker eAuctions

Künker eAuctions

Unsere eAuctions umfassen circa 250 Losnummern. In einem festgelegten Zeitraum von 14 Tagen haben Sie die Möglichkeit, online auf die für Sie interessanten Münzen und Medaillen zu bieten. Die einzelnen Losnummern laufen zeitlich versetzt aus. Selbstverständlich werden Sie über Ihren aktuellen Gebotsstatus laufend per Email informiert und können Ihre Gebote bei Bedarf bis zur letzten Sekunde erhöhen.

Our eAuctions contain 250 lots. During a fixed period of 14 days you have the opportunity to submit your bids online on your favourite coins and medals.

Weitere Informationen und die nächsten Termine zu den Künker eAuctions finden Sie unter:

You may find further information and the next dates of the Künker eAuctions here:

www.kuenker.de

www.kuenker.com

Each lot will expire at different times. Certainly you will be informed constantly by email about the current status of your bids so that you permanent have the possibility – if necessary – to raise your bids till the end of the eAuction.

Fritz Rudolf Künker GmbH & Co. KG Gutenbergstraße 23 · 49076 Osnabrück · Germany Tel. +49 (0)541 96 20 20 · Fax +49 (0)541 96 20 222 www.kuenker.de · service@kuenker.de Osnabrück · Berlin · München · Zürich


IMPRESSUM NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Michael Autengruber, Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Eva Weber, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen meister print und media, Kassel Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

ZAHLUNGEN AUS DEM INLAND Deutsche Bank Osnabrück Dresdner Bank Osnabrück Sparkasse Osnabrück Volksbank eG Bad Laer-Borgloh-Hilter-Melle Bankhaus Lampe KG, Bielefeld Postbank Hannover HypoVereinsbank München WestLB Dortmund Paypal

(BLZ 265 700 90) Konto-Nummer 0 177 006 (BLZ 265 800 70) Konto-Nummer 780 520 200 (BLZ 265 501 05) Konto-Nummer 247 320 (BLZ 265 624 90) Konto-Nummer 1 200 222 400 (BLZ 480 201 51) Konto-Nummer 174 076 (BLZ 250 100 30) Konto-Nummer 2900 60-308 (BLZ 700 202 70) Konto-Nummer 24 17 952 (BLZ 440 500 00) Konto-Nummer 1128 842 paypal@kuenker.de, Service charge: 3,5 %

ZAHLUNGEN AUS DEM AUSLAND - FOREIGN PAYMENTS Deutsche Bank Osnabrück Sparkasse Osnabrück Postbank Hannover Credit Suisse-5288 Credit Cards Paypal

IBAN: DE11 2657 0090 0017 7006 00 Swift-Code: DEUTDE3B265 IBAN: DE50 2655 0105 0000 2473 20 Swift-Code: NOLADE22XXX IBAN: DE73 2501 0030 0290 0603 08 Swift-Code: PBNKDEFF IBAN: CH88 0483 5013 5494 4200 1 Swift-Code: CRESCHZZ81Z We do accept VISA and MASTERCARD, Service charge: 4,5 % paypal@kuenker.de, Service charge: 3,5 %

ERHALTUNGS- UND SELTENHEITSGRADE Orden, Ehrenzeichen und historische Sammlungsgegenstände sind Objekte, die zum Tragen bzw. zum Gebrauch bestimmt waren und somit einer naturgemäßen Abnutzung unterliegen. Besonders bei frühen Exemplaren berücksichtigt die Erhaltungseinstufung das Alter. Mängel oder Beschädigungen, die über das übliche Maß hinausgehen, werden in der Beschreibung ausdrücklich erwähnt. Wir weisen in diesem Zusammenhang auch ausdrücklich darauf hin, daß der Kunde die Möglichkeit zur Vorbesichtigung vor der Versteigerung hat. Erhaltungsangaben als Ergebnis subjektiver Betrachtung sind kein Bestandteil der Beschreibung. Der jeweilige Erhaltungszustand ist nach der Beschreibung wie folgt angegeben: I II III IV

= = = =

Prachtexemplar, neuwertig oder neu; vorzüglich erhalten, mit kleinen Gebrauchsspuren; gut erhalten, mit Gebrauchsspuren; mit sehr deutlichen Gebrauchsspuren

Auktion 162 Künker  

Orden und Ehrenzeichen

Read more
Read more
Similar to
Popular now
Just for you